2GZ8A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz8A02
2QCYA 2SGAA 1Z8IB 3GYLB 2PTCE 4ABAA 3KNXA 1ZMJA 4D76A 1QA0A 1GMDG 1MTNB 1PQ7A 3MU8A 3SUDA 3H5CB 2YNAA 1WYKA 3P17H 1C5TA 8ESTE 1LMWB 4O3TA 3M37A 1N8OC 3R3GB 1IQGA 4ISLA 4R0IA 5A0CA 4KGAA 1EZUC 1B0FA 2GP9B 2ZHWH 4Y7AA 3DA9B 1WQSA 1F2SE 2A2QH 2J34A 4K2YA 2NU1E 1NFXA 1NM6A 1S5SA 3QTVH 4WMDA 1GJ9B 1C5NH 2C8WB 1EP5A 2OCVB 1GHZA 1EJNA 2JETC 5DP5A 1MCVA 3RXTA 2A7HA 3ZZ6A 4O9VA 1DM4B 4K5ZA 1H8IH 1O2OA 4DCDA 2PKAA 2B7DH 3FZZA 1J9CH 1GG6B 1NROH 2TRMA 3VB7A 1SFQB 3SGAE 3G01A 5ESBA 1OXGA 2ZZUH 3GCTF 2A5KA 1GJBB 1UVSH 4LOYH 1GCTC 4H6SB 4JK5A 3TJNA 5C1XA 1GMDF 1NRSH 4I31A 1BTWA 2ODQA 4NA8A 3TGJE 1EJAA 2OC7A 1EX3A 4H4FA 1TBZH 1YPEH 1ANDA 1MD8A 5L2YH 1ZJKA 1PQ5A 2A2XH 2FX4A 4AG1A 3S7KB 4U30A 1TPOA 1YP9A 1O3KA 4X1PU 1HNEE 1DSTA 2OC0A 2Z9IA 3BTKE 5E8EH 1SFIA 5E0GA 1OWEA 2G4TA 3LGYA 3LU9B 4FU7A 3F6UH 1GGDC 3I29A 4TY6A 3E16B 1AIXH 1TX6A 1QBVH 1WV7H 4ABJA 5EXNA 1F7ZA 2ZC9H 2PUXB 2BXUH 1MKXK 5A8XA 1QIXB 1V2WT 1CGJE 1SGPE 1JMOH 5EQSA 1ARCA 3RXJA 3SU0A 2JH5D 3MH4A 3OSYA 3RMOH 1HAVB 1LVOA 3ZZ8A 4DGJA 1RTFB 2ZDLA 1G3BA 1QB1A 1W7XH 2PLXA 3ZZ7A 2C8YB 5EGMA 4YLQH 4GCHG 4NA7A 1EPTA 1YCPM 4ABHA 3M5MA 1T8OA 5A8YA 3KGPA 5JB9S 1V2TT 3UUZA 1ABJH 3UOUA 1EUFA 2WYGA 3SU3A 1ZHRA 2BD3A 2GT8A 2WPIS 2FOEA 3TPIZ 1VCQA 1O36A 4MNWA 3GYMA 7ESTE 3TNSA 3KCGH 3S9AA 1AKSB 3EAJA 1TNLA 4IBLH 1DOJA 7LPRA 1BBRH 4I32A 2Q6FA 1TALA 1XMNB 2XC0A 2KAIA 5C5OA 4XDEA 1SC8U 2OTVA 1JXPA 4KTSA 3QUMP 3VXFH 1F0SA 4H6TA 5T3HA 1TQ0B 1YC0A 1GBHA 3MTYA 1TX7A 2RDLA 2FS9A 2SGPE 1IQJA 1HIAB 1GJ7B 2W5EA 1MH0A 2W7UA 2ZG0H 5DP6A 2ZF0H 1SGNE 3ATWA 3MNXA 3S9BA 3ESTA 2A5AA 4AB8A 2CHAB 4JZ1A 1V6DA 1ELVA 1P06A 1P2KA 2DE9A 3T2NA 5F8XA 1EASA 4OS5A 3LC5A 1C5SA 3PO1B 4O03A 1GBCA 1ZMNA 1D3PB 4ISNA 4MPVA 3T25A 2A4QA 2F3CE 2FOHA 3V12A 1A1RA 3ZZ4A 3ZZ3A 4SGBE 4AYYB 2GDEH 1NRNH 1E34B 1WAYB 3BEUA 3PWBA 1N1LA 2VIDA 4KTCA 4UDWH 1OYQA 1LKBA 1IQKA 1O39A 3Q77A 4Z6AH 2RCEA 1PQ8A 2OBQA 3I78A 1C2LA 1BTPA 1D4PB 2B8OH 6GCHG 4CRAA 5ABWA 3SJIA 2ALVA 3A88A 4J1YA 1MCTA 1LHFH 1WU1A 1AE8H 1OYTH 1TPAE 3SGBE 3IITA 3KN2A 4Y8ZA 5EPYA 3K6ZA 3K2UA 1LKAA 3PLBA 2F9BH 3D49H 1FY5A 2A4OA 1C5ZB 3Q00A 4BOHA 1GBBA 1ZYOA 4YT7H 3RXVA 1SGFG 1MU6B 3ZZBA 3A8CA 4CBOA 3V3MA 2BHGA 4IN2A 3QWCH 1GI4A 4XOJA 4K1EA 3A8DA 3K65B 1IHSH 1RTKA 4CRGA 3SI4H 1FN6A 1THRH 3URCA 1A0JA 2HGTH 1GDQA 2XWBI 1C1TA 4FUIA 2ZU3A 3FVFB 2H9TH 5EPNA 5FAHA 1PPZA 3SI3H 1CHOF 4X1SU 3P8GA 3TVJB 4ASHA 6GCHF 1CBWB 3RUOA 2CF9H 4X2YA 3BTME 1XXFA 1ZSKA 1RIWB 4WJG2 1IQEA 1A7SA 1FY1A 3P70B 3HK3B 3ZVFA 1DITH 1UCYH 5AFZH 2ZU5A 5JBCS 2BD5A 3E8LA 3RU4E 1NY22 2QXJA 3KL6A 1GJCB 3GCHB 2IOTA 2FLBH 4VGCB 1ELTA 2ZI2H 1GI0A 4Y10E 3RU4T 2G52A 1UTQA 2J9NA 2ZEBA 4Y8XA 2QN5T 1BT7A 2EC9H 2ZECA 1IQMA 2BD4A 2NU0E 1C4U2 1RTLA 1DWDH 3EA7A 3UY9A 2UWOA 2CGAA 1CVWH 1H4WA 2PSYA 7GCHG 1UVOA 2ZDAH 1UK2A 2P8OB 1BTXA 1QBOA 3RXAA 1CGHA 3P8NA 4NZQA 2YNBA 1GBAA 1NTPA 1KIGH 4HI3A 2VWMA 5A0AE 1O3DA 3A7YA 4ZHMU 2NU3E 1SGTA 3M7TA 1GHBG 1MBMA 4WMEA 1G36A 1GL1A 3OY6U 3ATIA 1GBTA 4MDSA 1SGDE 1P2JA 5JYIA 2P3FH 1A2CH 4ZXYH 5HYOA 2HALA 4JZIA 3RMLH 4AFZA 1DUEA 1UTJA 3IG6B 1ESTA 1FONA 1VZQH 1H9LB 2C3SA 1K1MA 3MH6A 2P3TB 2PKAB 2F9OA 1NRRH 3PMBB 4O97A 3RU4D 1K1OA 3QGJA 4I8KA 2ANKH 3B8JA 3QZRA 1AO5A 3UR9A 3LKWA 2VJ1A 1EP6A 1EZXC 4FUHA 4ZMAH 3LH1A 7GCHF 1ELAA 2Y6TA 9ESTA 1EOJA 3O8DA 2CJIA 1K1NA 2BY6X 1EXFA 4OS7A 4K8YA 1KTTB 1Z7KA 2G5VA 3STIA 1W3CA 1O5BB 2O8UA 2QF3A 3SUEA 1ETSH 2EI8A 2VINA 1RXPA 2QIQA 4NCYA 2TIOA 1BUIA 3AW1A 2JH0D 3ZVAA 1MQ6A 1HAPH 1A3EH 1ANBA 2O9QA 1GHBF 4YZUA 4XSKU 2G00A 1O3IA 2Q1JA 1TIOA 2BY5X 2Z3DA 3LC3A 3W95A 2AFQB 3ZZ5A 1H8DH 2VWNA 1HGTH 1SGEE 1ELGA 3L33A 3AASA 3LGTA 4GSOA 5GCHG 2SGQE 5EQQA 3SU4A 1ZLRA 2BLWA 5DKMA 4FUDA 2AGIX 1UMAH 2A7JA 3PO1C 3QGNB 5CHAB 4IMZA 1A61H 1O31A 1IQLA 4WWYA 4NFFA 1ANCA 3LGIA 1YLDA 1Z6JH 1MKXH 2BXTH 1ZOMA 2A32A 1GVLA 1J8AA 1FIWA 4YM9A 2ZCHP 2SNWA 2G8TA 4JZDH 2H5DA 4OS4A 3W94A 2ZTZA 4CRDA 2ZCKP 1C2KA 1FJSA 2BDBA 4A1VA 2ZIQH 1Q3XA 5AF9H 1GI9B 1BBRE 1P11E 2XBYA 4DT7B 3UWIA 2PFEA 1L0ZA 1HLTH 1G3DA 2PHBA 2VVUA 2FOAA 4A7IB 4FU8A 3GY3A 2KAIB 5GCHF 2J95A 1N6XA 2XC4A 3S0NA 4AFSA 4XE4A 1UO6A 1SBWA 3SZNA 1FY3A 2ZQ1A 5C1YA 2AMDA 4X8VH 3AAVA 3CS0A 1KSNA 1BRBE 2QY0B 4AYVB 1UVPA 4WY3A 3F9GA 4JZFH 3GY6A 4CH8B 2FP7B 4Q2KA 4JYVH 4ABFA 3HKJB 4CRCA 2SFAA 1T8MA 5C5NA 1BMMH 2EI7A 1C1QA 2W7SA 2AIPA 2BTCE 1CBWC 4X2VA 3U69H 3MH7A 1O2RA 3MFJA 4A92A 1RIWC 4MVNA 4X6PA 1QQUA 2WPKS 1B5GH 1P9SA 4MLFB 1KXFA 3VB3A 4DIHH 2FO9A 3BEIB 1DXWA 1LO6A 1AQ7A 5T6FA 4TWYA 4YLUA 1ARBA 3ZYDA 2RG3A 3VB5A 5AFYH 1P12E 4A5TS 1LPZB 1CQQA 1IAUA 1GBEA 4VGCC 3M61U 4X1NU 4X1QU 2GMTB 3RXGA 3ZVDA 1WQVH 2XBWA 3BTQE 3LT3A 5TCAA 4DY7B 2PUQH 4AB9A 2NU4E 5E2OA 3T5FH 1HPGA 9LPRA 1CE5A 3A80A 5A0BA 1G3EA 2P8OC 3TK5A 2HLCA 3JZ1B 5SGAE 2WPHS 1V2NT 3S7HB 5T6DA 2VIWA 1HBTH 1C1RA 3SJ8A 5L30H 2PTNA 5E0HA 4ISHH 5FX6A 5DO4H 1O3JA 1SGIB 2ZGBH 3DFJA 2XBXA 2D26C 3Q3YA 2GZ7A 2BY9X 2ZKSA 2F9PA 2D1JA 2FOCA 3LGUA 3O8CA 2ANYA 4YOIA 1O3EA 1O2QA 5EXMA 1UK4A 3M3SA 3ZVCA 3KEEA 1FNIA 1YF4A 3GY2A 2BD8A 1GMHG 2F83A 5DG6A 1Q2WA 3A7VA 1GBLA 1N6YA 3T26A 1GWAA 2QXHA 1KXCA 3K6YA 2FTLE 4IC5A 1MKWK 3BTFE 4IGDA 2QGRA 3QZQA 1QL7A 1HRTH 3M5OA 3GDSA 1ZRKA 1C2HA 1LHGH 4NWKA 3V13A 1VGCB 4MG3A 1DWCH 1OX1A 1CU1A 2THFB 3TNTA 3U8RH 3SQHE 1C5RA 4I8JA 5AHGH 4AG2A 3M3TA 1F5KU 1A5IA 3MU5A 3RXSA 2P93A 1Y59T 2TGAA 1FPHH 3BSQA 1DDJA 1SHHB 3M7UA 2GT7A 2HRVA 1EATA 5AVDA 2CXVA 1BIOA 3E91A 2ZHFH 1EKBB 3NWUA 4GHTA 1V2PT 1QA7A 3MWIU 4TPIZ 1HJAB 4FUEA 1JRSA 2ASUB 4AGJA 3HK6B 5IDKA 1BRAA 1RRKA 4CRBA 1ETTH 1OWIA 2Y80A 1ZTKA 3LONA 2R0LA 3E1XB 3KQBA 1AVWA 1Y3YA 3BG4B 3QTOH 4BAHB 2FI4E 1J16A 2BD9A 2J4IA 1G3CA 1H1BA 4X8UH 2VIPA 2CN0H 4HGCA 3DHKH 2NWNA 4FUJA 1TGSZ 1T8LA 1GBFA 1ZTLA 2H9EH 1GBMA 2UUJB 3SW2B 1K1IA 3BTWE 1GPZA 3RXPA 1GJ8B 1JRTA 1QB6A 1DS2E 5F8ZA 3MHWU 4ABGA 1Z8GA 2G4UA 1RS0A 4CH2B 1B7XB 3EDXB 3ZZ9A 1EPTC 3SJOA 1Z8JB 1VCWA 1DT2A 1EAIA 1XUIA 3GDVA 4X0WU 1OP0A 1IQHA 1HCGA 3M36A 3OTJE 5FPYA 3UREA 2H2ZA 1SGQE 4CBNA 3RXOA 5J4SA 1AMHA 2XWAA 1LCYA 2JH6D 4B73A 2M5TA 2OQUA 2CV3A 4BXSA 1BZXE 1SOTA 1ZSJA 4ZAEA 1PPGE 2DE8A 5FCRA 4NIVA 1O38A 5PTPA 2ZPRA 4INLA 1S85A 4F4OC 2PV9B 1M9UA 3RXCA 1NFYA 1HAZB 2OXSA 1C1VH 1FY8E 2FZZA 3U98H 4I33A 1EB1H 2BX3A 1TA6A 2ANMH 1W0ZU 4I8GA 1CT4E 5DPAA 2Z94A 5GWZA 2EEKA 4RKOB 2BMGB 1IQNA 2GDDA 3ATMA 3C1KA 1GJ4H 2GCHG 3RLYH 4Y79A 4MTBA 3F9HA 3A81A 3HATH 1O2NA 1XM1A 5BPEA 4TY7A 4NFEA 5DJ7A 1IOEA 5EG4A 1QTFA 2IN2A 5I46H 3A86A 1P05A 1W0YH 1GHAG 1LDTT 1ESAA 4BANB 1C5UA 2C93B 2BOHB 2FM2A 4ZHLU 4BAMB 2A5IA 3BIVH 3A83A 4XFQA 2R2MB 1TBQH 4ISIH 3LIWA 1L4ZA 2BLOA 3CENA 1QURH 3TIUA 2ZGCA 1AN1E 1VJ9U 4X2XA 2FI3E 4M7GA 5H4IB 2BDIA 1DLKB 1D3QB 2GMTC 3KIDU 1O2SA 8KME2 1P57B 4ZKRU 3RDZA 1W13U 5A8ZA 4NGAH 3VGCB 1K22H 2FOBA 1GBJA 1G32B 1XVOA 1NRPH 1O2MA 2G5NA 4GCHF 1ELDE 1HXEH 2TGTA 4IS5A 1ETRH 1C1SA 1XUGA 1YCPK 3SNBA 3SOSA 1GI7B 4NIWA 2ZU4A 1CSOE 2GCHF 1BJUA 1CGIE 1VITG 2YOLA 1QQ4A 3SV7A 1XXDA 2Y82A 4TWWA 1QNJA 2Z9LA 4YOGA 2HNTF 2C8ZB 4FVBA 1WUNH 3VPKA 1AUJA 1QB9A 1GHAF 4H42U 3U1IB 2OBOA 4OGXA 2Y5GA 1TNGA 2PWXA 1ZMLA 2WUBA 2GCTB 3CP7A 1C1PA 1LPGB 1TYNA 2PR3A 1EOLA 2V6NA 2JKHA 1IQFA 1HJ9A 1Y5BT 3A8BA 1S81A 4GAWA 1MTNC 2P95A 1GI1A 3SU2A 3E90B 1O3HA 4A1TA 3RXMA 1P09A 4ZROA 1J14A 1GBDA 2O8MA 3V0XA 2K1QA 3RXUA 3PLPA 1VGCC 3M5NA 3RXKA 4E7NA 1GVKB 1BTZA 2ODYB 2RA3A 1FIZA 3F68H 1CT2E 1O0DH 4MNYA 2PKSB 1K1JA 4Y11E 1MZDA 1FZZA 2UWPA 1DFPA 5A09A 3RXDA 2ZPSA 2WV4A 2BDGA 5JBTA 3A82A 2UUKB 1TBRH 1VITF 1NZQH 1OKXA 3PB1E 3BTEE 4AN7A 3PMHB 2PSXA 3PTNA 1O2HA 1F0UA 1HJAC 1O3NA 1WTGH 4ISOA 2ZGJA 1D3TB 2D8WA 1CA8B 3KQCA 1MD7A 1TGNA 5F03A 1BHXB 1HV7A 1GG6C 1TPSA 2VVVA 2A4RA 1LQEA 4UFGH 2Y7XA 1MTUA 2Y5FA 4BAKB 1PPFE 3ZZDA 1LTOA 1O35A 1C5XB 5HMAA 1O3PB 1DY8A 2Y7ZA 4SGAE 4NWLA 5EOKA 4DOQA 4JYUH 4RSPA 3ENSB 4BTIB 1Y8TA 1O5CB 4E05H 1SGFA 4Y6DA 1E37B 4B2AA 5FCKA 1FQ3A 1QR3E 4K69A 4XBCA 2WYJA 4YO9A 1XKAC 2BVXH 2TGDA 1KLJH 2XBVA 1SLVB 3S9CA 1AZ8A 4BAOB 1QFKH 1O2KA 1UK3A 1C2DA 1TMTH 1YPJH 2BQWB 2QYIA 3HKIB 3RXIA 2BDHA 2G55A 1K2I1 1MKWH 1O2XA 2I6QA 2XCNA 1C1UH 1Y3VA 1S83A 1QBNA 3E6PH 3GDUA 1GL0E 2VIVA 1LVMA 1INCA 2XTTB 2ULLA 4NSVA 3D62A 1KY9A 3BF6H 2H1UA 2AS9A 1BQYA 1GBKA 1SI5H 1V2QT 8LPRA 1P03A 1W14U 3EQ0H 1NO9H 5LPEA 2FLRH 1FV9A 5E0JA 3EGKH 1SOZA 2BLVA 2HOBA 2Y5HA 2FPZA 1HAHH 2HPPH 2BZ6H 1BRUP 1UHBA 5ETXA 3TJVA 2C90B 4FU9A 4F49A 2ZDVH 2LIZA 1FN8A 4AORA 1XUKA 3NPSA 1OS8A 3A7ZA 5LGOA 2ALPA 1TMUH 4MPWA 4FUCA 1MTSA 1DX5M 5TCCA 3BTDE 1N8OB 4Y76A 1E35B 1CA0B 1Y3UA 3M35A 4LK4A 4INKA 1W2KH 4B2BA 1JWTA 3SU1A 3SNDA 1G2MA 3UPEA 3A84A 1L4DA 2I6SA 1V2ST 2OC1A 1P10A 1S82A 4ZKOU 4AOQA 1D9IA 3SNCA 1G30B 2CHAC 3NXPA 2Q6DA 1Y5AT 3GICB 1GI5A 1S6FA 2V35A 3GY4A 2JETB 3MO9A 5GPIB 1AUTC 3T28A 1C1OA 2OINA 2VB0A 1SGCA 1QJ7B 4K1TA 1O2PA 1SQTA 4CR5A 1NESE 3MU1A 2WPMS 2XNIA 1V2JT 1G9IE 1ZRBA 3UWJH 1WOFA 2XC5A 1BBRK 1GCTB 2STAE 5EXLA 3UNSA 3FANA 1T7CA 1UTNA 4THNH 1C1WH 3VXEH 5C1UA 2BOKA 2BX4A 3O8RA 2GX4A 3UNRA 1B0EA 1TNIA 4JMYA 3SNAA 3SNEA 4ABIA 1YPHE 3LOXA 4ZHAA 2GCTC 3TH3H 3ZVBA 3PMJA 2HWLB 4U32A 1IQIA 4Q80A 2BDYA 4BTTB 1SR5C 1D6WA 3F9FA 4U01A 4UFFH 4UONA 1VCPA 3MOCA 1GCDA 3Q3KA 1UTLM 6ESTA 3DD2H 2BQ6B 1OWHA 2WINI 2RA0A 5LPFA 1QCPA 1NFUA 1UTPA 3GISB 1O2UA 1BMLA 1TOMH 4HFPB 2BD7A 4AFQA 1HAOH 1FAXA 1P8VC 3AAUA 1QL9A 1V3XA 2CF8H 3QK1A 3VB6A 1C5QA 4NSYA 1NT1A 1SSXA 4OS6A 5LH8A 3GY8A 1P9UA 1YM0A 2XRCA 4E7RG 2ZP0H 1AGJA 1P3EA 3SU6A 3BV9B 1BTYA 3RMNH 4ABBA 5DP9A 1O2IA 1V2LT 4JYTA 1C5WB 2Q6GA 1NRQH 4A1XA 1ELBA 1MAYA 3NUMA 3UIRA 2W3KA 4X6MA 3QDZB 3D65E 1H9IE 1A46H 5C20A 2XYAA 4FUBA 2ZTXA 2A4GA 1HJ8A 1RGQA 3GCHC 1O32A 2LNCA 1BB0B 5F6MA 1YLCA 2ZDNA 2VIOA 4B1TA 1HAXB 1E36B 3GOVB 4JZEH 2FMJA 2FDAA 2Z9JA 3S69A 1F5RA 2BYAX 1UTMA 3F1SB 1Z71A 1V2MT 3LDXH 1EZQA 1BOQA 3HGNA 4WMFA 1DUAA 1TMBH 2R9PA 1BJVA 3RM2H 2AERH 1GBIA 4YESB 3H7TA 4IMQA 1FXYA 1OOKB 3DFLA 3K9XB 2ZCLP 1O3CA 4FVDA 1TRNA 3BTGE 1GMCG 4X8SH 4KP0A 3BTHE 5LPRA 1PYTC 5DP7A 1C1NA 3A89A 1KTSB 2ZNKH 5JB8S 4UD9H 4DIIH 2D2DA 3O8BA 2ZU2A 2QF0A 4JCNA 1ZSLA 5GIBA 1GI3A 1ZJDA 4Y0YE 3SUGA 3KF2A 2ZWLH 1AI8H 3SQEE 4X1RU 3UNQA 2FEQH 3ZYEA 4DJZB 1YPLH 3QX5H 4IC6A 4OGYA 1BMNH 1BITA 3A87A 1RD3B 4KTUA 4CHAB 4LZ1H 1UCYE 3P6ZB 1QJ1B 3TK9A 5J4QA 4D9RA 1SGYE 1L1GA 4WXVA 4MNVA 4UFEH 5EW2H 4B74A 2O8WA 1GHVH 5T6GA 1W11U 4D7GA 1P01A 4QT8C 1CO7E 3SU5A 3FP8E 3C27B 1QL8A 1P04A 1GMCF 2P3UB 1Z1JA 3ZZAA 5C67A 2EA3A 1CA0C 5DP4A 1EZSC 1V2VT 1ELCA 3M3VA 1HXFH 1KLTA 1S6HA 1TE0A 1V2RT 4IN1A 5FPTA 5B6OA 1C4Y2 1NN6A 1F5LA 1CT0E 1C2EA 1OSSA 2P94A 3Q3XA 5L2ZH 2BB4A 1AVXA 2ZFRH 4MPXA 1O3MA 3TH2H 2XXLA 3R0FA 1ZZZA 1BA8B 2W26A 2QAAA 1ELEE 1C2IA 1GMHF 1HAGE 1S0RA 3RC4A 4XBDA 3V7TA 2OUAA 1TAWA 2WPJS 1QY6A 1HAIH 3ODDA 3NK8A 3OX7U 5CHAC 3PTBA 1TB6H 1TOCB 2EI6A 1TGTA 2GZ9A 1SQOA 3P95A 3EBNA 4FUGA 3TGIE 1ZHMA 3SBKA 1GHWH 1C9TA 1EAXA 2SGEE 1K1LA 4Y8YA 3SGQE 2VWLA 3OU0A 2STBE 1LPKB 3URDA 1TPPA 1VITH 6LPRA 1JIMA 1O3BA 1UHBB 1UTOA 1T4VH 1YPMH 4WF8A 4A6LA 3M5LA 4Y0ZE 3ODFA 3PM3A 3QO6A 1H9HE 1L1NA 2A0QB 3DT0H 1NFWA 1MTVA 2ODPA 2QV1A 5TJXA 2Z3CA 3SV2H 2BZAA 1AWFH 1C2JA 3BTTE 3RMMH 2GTBA 1F0RA 3UTUH 2PW8H 1PPCE 5JDUB 1EB2A 3LJOA 1GHXH 2LPRA 2VIQA 4JK6A 3PROA 4NA9H 1P2OA 1GI8B 3TLOA 2F9UA 3RXQA 1QRXA 3L6PA 4UE7H 1AWHB 1O3GA 1F0TA 1O2TA 5K7RA 1GI2A 1QGFA 2V3OH 3MMGA 3T27A 1MTWA 4CRFA 1WBGB 2FWWA 3SN8A 2VH6A 4BNRA 3E0PB 5DP8A 1RJXB 1TGBA 2O8LA 1ZR0A 1FI8A 3MU4A 5JPMH 1AE5A 4D9QA 5CE1A 4NIYA 2VH0A 3BIUH 3SORA 3SHCH 3BN9A 3LGWA 1L1JA 1XVMA 4Z0KA 4DG4A 1NPMA 1K9OE 2BVRH 2ZHQH 2BVSH 3ATLA 4UFDH 4FUFA 1S84A 5C3NA 5GXPA 1K28D 1PPEE 1SG8B 1TLDA 2GV7A 3TJUA 3HGPA 5FXLA 1PFXC 2HNTC 2SNVA 3RXEA 3RP2A 4YT6H 1P3CA 3EA9A 3EA8A 1OP8A 2TGPZ 2UUYA 1Y3WA 4BAQB 1FMGA 1DPOA 2BLQA 1KXBA 1TA2A 3SJKA 5FPSA 1U6QA 2HVXA 2OLGA 1C5LH 1HFDA 2GD4B 2QXGA 2FI5E 2SGDE 5FHTA 1OWJA 1V2KT 2J92A 1MQ5A 3GY5A 1FDPA 2Z3EA 1YGCH 1GDUA 1FAKH 2BM2A 1C5YB 4E06H 1E38B 4WVPE 1C5PA 2CMYA 1EAUA 3GCOA 4X8TH 2FIRH 1C2FA 3UR6A 3EE0B 2ZGXH 3P8FA 2BY7X 3ZZCA 3PYHA 1AB9B 3L3TA 1GJ6A 1AVGH 1P2IA 1O5EH 5C2ZA 2VGCB 2AEIH 4GVUA 4Y71A 1DWBH 1G37A 1OPHB 3E3TA 5EW1H 2A7CA 1NU7B 3AVZA 1WTHD 5BRRE 2AMPA 1SLWB 1PYTD 5HXFA 3OY5U 1ESBA 1ZPCA 2WUCA 2FOGA 1HUTH 1ELFA 4MQAA 1VR1H 1Z8RA 1MU8B 1C5VA 1TONA 1XUFA 1P2NA 1CHOG 1LHDH 2Z9KA 1AFEH 1TFXA 4CHAC 4K3JA 3QLPH 5JBAS 5DK1A 1TWXB 5GJ4B 1FPCH 3ZVGA 3MNSA 4AGKA 2W3IA 1KDQB 1OWDA 2WV5A 2ZFQH 2AYWA 1ACBE 1C4V2 4Q7YA 4I8LA 2G51A 1BTUA 3DUXH 1YPKH 4B71A 2GV6A 1V2OT 2R3UA 3NKKA 3T29A 1ZGVA 2H9HA 2VWOA 2ZFFH 1ABIH 1AFQB 1UVTH 1RFNA 3E0NB 2AGGX 4X6NA 5DP3A 1JBUH 1FLEE 3PLKA 1Y3XA 4RN6A 4AFUA 2Z6BD 2GZ8A 1YPHC 3UOPA 1SB1H 3VEQB 3IWMA 8GCHG 4X2WA 2FESH 1W12U 2OP9A 1J17T 1SHYA 1NU9A 1SLUB 2J94A 1TX8A 4GUXA 3RXFA 1ZHPA 1F92A 2QC2A 2B9LA 1G2LA 1T4UH 3BG4C 2QA9E 1C5OH 1FUJA 3FZDA 1W10U 1O37A 1O5GH 1UVUH 2B0FA 3M7QA 6CHAB 4J2YB 2FYRA 1LQDB 1NC6A 4TPYA 1BRCE 2ZFPH 1QRZA 3PMAB 2FX6A 1K21H 3EYDA 1GJAB 1FY4A 4NZLA 3A85A 3LJJA 1THPB 4X6OA 1GJ5H 1HAYB 2TBSA 3P8OA 4NG9H 5FBEA 3RXHA 3U8OH 1A5GH 4ZKSU 1ID5H 1XKBC 3MU0A 2XW9A 4PROA 1SGRE 1OWKA 5HGGA 3SV6A 2P16A 4ABDA 1DICA 2R0KA 2ILNA 4K1SA 1O2LA 3LPRA 3D23A 2UWLA 5EU8A 1O5AB 1O2VA 1L2EA 2O8TA 1OP2A 1VJAU 4K8BA 2Y81A 1ANEA 3PWCA 4HZHA 8GCHF 2BQ7B 4FXGH 1O3OA 1KLIH 1DY9A 3SV8A 4ABEA 1DXPA 1P0SH 4D8NA 4RKJB 3TH4H 2H5CA 2HNTE 1W8BH 2FTMA 3KQEA 1TABE 5GDSH 1BTHH 2OQ5A 1SPJA 4WH6A 4R8TB 1DWEH 1AHTH 1WCZA 2ESTE 3P92A 3SO3A 1HYLA 2GKVE 1JIRA 1KXDA 4ESTE 2ZQ2A 3SJ9A 2BDCA 1O2ZA 4Y7BA 2A1DB 2Z9GA 2QXIA 2BDAA 3MO6A 2IJOB 5ESTE 1QRWA 1O2JA 1TNJA 2ZTYA 4YTAA 1O2GH 2FS8A 2F9VA 2NU2E 2ZA5A 4IW4E 3WY8A 1D6RA 5HM9A 1A4WH 1PQAA 2VVCA 5IYTA 2ANWA 5L6NH 1SQAA 1O5FH 3TK6A 1O33A 1K1PA 2IPHA 3B23B 3T62A 3ZV9A 2C8XB 3NZIA 3QN7A 1EQ9A 3RXBA 1GHYH 1MMJN 4MNXA 3JZ2B 3H7OA 3LGVA 2FOFA 1ZPZA 3RC6A 4DURA 1P02A 4KKDA 3MH5A 3GY7A 3MNBA 1NS3A 4DW2U 1T31A 3MI4A 4ZH8A 3BG8A 1O34A 5I25A 1DSUA 1C9PA 2FOMB 3VB4A 3AW0A 4LXBH 1P2MA 1HB0B 4KELA 2HPQH 3RXLA 3VGCC 1SMFE 2ZHDA 1PJPA 1HAVA 2BD2A 2AMQA 2XCFA 1LVYA 4AZ2B 2R3YA 2VU8E 2R2WU 2FYQA 1UTKA 5E2PA 3BEFB 1MUEB 2DUCA 4OS2A 3MYWA 3RM0H 3ELAH 1TNHA 1W7GH 3KHVA 1GJDB 5G4BA 2H6MA 2FODA 3ZVEA 1C5MD 2ZU1A 1UJ1A 1AB9C 2J38A 3TJOA 3UFAA 1AKSA 2WPLS 4B75A 2F9NA 2VGCC 1KXAA 2PGQB 4B2CA 2PGBB 2Z7FE 1BMAA 3SUFA 1IHTH 2G81E 1YPGH 1TGCA 1YKTA 3SHAH 1SLXB 1MBQA 3MNCA 3LH3A 4U2WA 2B5TB 1EPTB 4HTCH 1Q31A 1SVPA 1HIAA 3U9AH 4BTUB 1GGDB 1AU8A 2V0BA 1PPHE 3RC5A 1Z1IA 2AIQA 5JBBS 1WSSH 1GDNA 1LHCH 1E0FD 3ATKA 1TRMA 2UUFB 3A7WA 4O3UA 2PKSC 1O3LA 7KMEH 4B76A 1LVBA 1HDTH 1TQ7B 2VNTA 3GCNA 3KQDA 1CHGA 1EAWA 4UEHH 3FAOA 4AX9H 1AFQC 1PPBH 2V3HH 2ZPQA 1BDAA 2A45B 1DE7H 2SGFE 2J2UA 3STJA 4CR9A 1LHEH 1O3FA 3SV9A 3A8AA 3TITA 4YOJA 3U8TH 5FBIA 2TPIZ 4MPUA 1O2YA 1ZTJA 2K7XA 5F8TA 3UQVA 3TGKE 1ORFA 3NCLA 4I8HA 2ZDKA 3F9EA 1S0QA 2FXRA 3Q76A 1A0HB 1QJ6B 5EODA 1O2WA 1C2GA 1A5HA 2P59A 2ZFTA 3A7TA 5K0HA 4ZUHA 1BCUH 1YBWA 1O3AA 1YCPH 2OC8A 3ZV8A 2GGVB 1KDQA 3UQOA 4BXWA 3A7XA 2AH4X 3PV4A 1YYY1 6CHAC 1SL3A 1ZPBA 3ITIA 4GPGA 4I7YH 4NIXA 1T32A 2A31A 2ZDMA 1MZAA 2ZGHA 4K60A 4Q7ZA 4Q7XA 1D3DB 5CMXH 3MO3A 2F91A 2GVFA 1THSH 1EJMA 2AGEX 3OYPA 4LZ4B 1V2UT 1XUHA 3TU7H 3B9FH 1DLEA 5EQRA 1JOUB 1XUJA 4OS1A 1P2QA 4ZKNU 3U1JB 3VFEA 3CS7A 1Y5UT 1AY6H 5DGJA 1GVZA 5A2MH 2ZHEH 4TYDA 1C1MA 1A3BH 1J15A 1C2MA 1DVAH 2BY8X 3RXRA 5HM2A 1XX9A 4INHA 1X7AC 1UCYK 1T8NA 4DVAU 1ZGIA 4WH8A 1KXEA 3HPTB 1BHXF 3FP6E 4CREA 4D7FA 1GI6A 3FFGA 1KYNA 2ZO3H 1Z6EA 4GLYA 1O5DH 3FP7E 3I77A 1TNKA 1MAXA 3RLWH 4XBBA 2OD3B 1TRYA 1DANH 4ZXXH 2C4FH 4GHQA 1AZZA 2ZFSA 1A0LA 1QHRB 3N7OA 1O30A 5FX5A 1AD8H 3GCTG 4WXIA
chains in the Genus database with same CATH superfamily
2QCYA 2SGAA 1Z8IB 3GYLB 2PTCE 4ABAA 3KNXA 1ZMJA 4D76A 1QA0A 1GMDG 1MTNB 1PQ7A 3MU8A 3SUDA 3H5CB 2YNAA 1WYKA 3P17H 1C5TA 8ESTE 1LMWB 4O3TA 3M37A 1N8OC 3R3GB 1IQGA 4ISLA 4R0IA 5A0CA 4KGAA 1EZUC 1B0FA 2GP9B 2ZHWH 4Y7AA 3DA9B 1WQSA 1F2SE 2A2QH 2J34A 4K2YA 2QF4A 2NU1E 1NFXA 1NM6A 1S5SA 3QTVH 4WMDA 1GJ9B 1C5NH 2C8WB 1EP5A 2OCVB 1GHZA 1EJNA 2JETC 2XOKD 5DP5A 1MCVA 3RXTA 5IK2D 2A7HA 3ZZ6A 4O9VA 1DM4B 3WW7A 4K5ZA 1H8IH 1O2OA 2YMSD 4DCDA 2PKAA 2B7DH 3FZZA 1J9CH 1GG6B 1NROH 2TRMA 3VB7A 1SFQB 3SGAE 3G01A 5ESBA 1OXGA 2ZZUH 3GCTF 2A5KA 1GJBB 1UVSH 4LOYH 1GCTC 4H6SB 4JK5A 3TJNA 5C1XA 1GMDF 1NRSH 4I31A 1BTWA 2ODQA 4NA8A 3TGJE 1EJAA 2OC7A 1EX3A 4H4FA 1TBZH 1YPEH 1ANDA 1MD8A 5L2YH 1ZJKA 1PQ5A 2A2XH 2FX4A 4AG1A 3S7KB 4U30A 1TPOA 1YP9A 1O3KA 1W0KD 4X1PU 1HNEE 1DSTA 2OC0A 2Z9IA 3BTKE 5E8EH 1SFIA 5E0GA 1OWEA 2G4TA 3LGYA 3LU9B 4FU7A 3F6UH 1GGDC 3I29A 4TY6A 3E16B 1AIXH 1TX6A 1QBVH 1WV7H 4ABJA 5EXNA 1F7ZA 2ZC9H 2PUXB 2BXUH 1MKXK 5A8XA 1QIXB 1V2WT 1CGJE 1SGPE 1JMOH 2AHME 5EQSA 1ARCA 3RXJA 3SU0A 2JH5D 3MH4A 3OSYA 3RMOH 3KYGA 4TT3D 1HAVB 1LVOA 3ZZ8A 4DGJA 1RTFB 2ZDLA 1G3BA 1QB1A 1W7XH 2PLXA 3ZZ7A 2C8YB 5EGMA 4YLQH 4GCHG 4NA7A 1EPTA 1YCPM 3N99A 3AK5A 2EY4C 4ABHA 3M5MA 1T8OA 5A8YA 3KGPA 5JB9S 1V2TT 3UUZA 1ABJH 3UOUA 1EUFA 2WYGA 3SU3A 1ZHRA 2BD3A 2GT8A 2WPIS 2FOEA 3TPIZ 1VCQA 1O36A 3OE7D 4MNWA 3GYMA 7ESTE 3TNSA 2KR7A 3KCGH 3S9AA 1AKSB 3EAJA 1TNLA 4IBLH 1DOJA 7LPRA 1BBRH 4I32A 2Q6FA 5HIZA 1TALA 1XMNB 2XC0A 2KAIA 5C5OA 4XDEA 4P02A 1SC8U 2OTVA 1JXPA 4KTSA 3QUMP 3VXFH 1F0SA 4H6TA 5T3HA 1YY3A 1TQ0B 1GBHA 1YC0A 3MTYA 1TX7A 2RDLA 2FS9A 2SGPE 1IQJA 1HIAB 1GJ7B 2W5EA 1MH0A 2W7UA 2ZG0H 5DP6A 2ZF0H 1SGNE 3ATWA 3MNXA 3S9BA 3ESTA 2A5AA 4AB8A 2CHAB 4JZ1A 1V6DA 1ELVA 1P06A 1P2KA 2DE9A 3T2NA 5F8XA 1EASA 4OS5A 3LC5A 1C5SA 3PO1B 4O03A 2V3MA 1GBCA 1ZMNA 1D3PB 4ISNA 4MPVA 5GNDA 3T25A 2A4QA 2F3CE 2FOHA 3V12A 1A1RA 3ZZ4A 2J97A 3ZZ3A 4SGBE 4AYYB 2GDEH 1NRNH 1E34B 1WAYB 3BEUA 3PWBA 1N1LA 2VIDA 4KTCA 4UDWH 1OYQA 4Q4LA 2JIZD 1LKBA 1IQKA 1O39A 3Q77A 1OHHD 4DT4A 2RCEA 1PQ8A 4Z6AH 2OBQA 3I78A 1W0JD 1C2LA 1BTPA 1D4PB 2B8OH 6GCHG 4CRAA 5ABWA 4AC9A 3SJIA 2ALVA 3A88A 1MABB 4J1YA 2J98B 1MCTA 1LHFH 1WU1A 1AE8H 4FETA 1OYTH 1TPAE 2XNDD 3SGBE 3IITA 3KN2A 4Y8ZA 5EPYA 3K6ZA 3K2UA 1LKAA 3PLBA 2F9BH 3D49H 1FY5A 2A4OA 1C5ZB 3Q00A 4BOHA 1GBBA 1ZYOA 4YT7H 3RXVA 4B6EA 1SGFG 1MU6B 3ZZBA 3A8CA 4CBOA 3V3MA 2BHGA 4IN2A 3QWCH 1GI4A 2PP6A 4K1EA 4XOJA 3A8DA 3K65B 1IHSH 1RTKA 4CRGA 3SI4H 1FN6A 1THRH 3URCA 1A0JA 2HGTH 1GDQA 2XWBI 1C1TA 4FUIA 2ZU3A 3FVFB 2H9TH 5EPNA 5FAHA 1PPZA 3SI3H 3N7DA 1CHOF 4X1SU 2F4LA 3P8GA 3TVJB 4ASHA 6GCHF 1CBWB 3RUOA 2CF9H 4X2YA 3BTME 1XXFA 1ZSKA 3OTPA 1RIWB 4WJG2 1IQEA 1A7SA 1FY1A 3P70B 3HK3B 3ZVFA 1DITH 1UCYH 5AFZH 2ZU5A 5JBCS 2BD5A 3E8LA 3RU4E 1NY22 2QXJA 3KL6A 1GJCB 3GCHB 2IOTA 2FLBH 4VGCB 1ELTA 2ZI2H 3DSOA 1GI0A 4Y10E 3RU4T 2G52A 1UTQA 2J9NA 2ZEBA 4Y8XA 2QN5T 1BT7A 2EC9H 2ZECA 1IQMA 2BD4A 2NU0E 1C4U2 1RTLA 1DWDH 3EA7A 3UY9A 2UWOA 2CGAA 1CVWH 1H4WA 2PSYA 7GCHG 1UVOA 2ZDAH 1UK2A 2P8OB 1BTXA 1QBOA 3RXAA 1CGHA 3P8NA 4FOUC 1WDIA 4NZQA 2YNBA 1GBAA 1NTPA 1KIGH 4HI3A 2K8IA 2VWMA 5A0AE 1O3DA 3A7YA 4ZHMU 2NU3E 4RT0A 1SGTA 3M7TA 1GHBG 3KQ5A 1MBMA 4WMEA 1G36A 1GL1A 3OY6U 3ATIA 1GBTA 4MDSA 1SGDE 1P2JA 5JYIA 2P3FH 1A2CH 4ZXYH 5HYOA 2HALA 4HG6A 4JZIA 3RMLH 4AFZA 1DUEA 3FOAA 1UTJA 3IG6B 1ESTA 1FONA 1VZQH 1H9LB 2C3SA 1K1MA 2HLDD 2P3TB 3MH6A 2PKAB 2GJGA 2F9OA 1NRRH 3PMBB 4O97A 3RU4D 1K1OA 3QGJA 4I8KA 2ANKH 3B8JA 3QZRA 1AO5A 3UR9A 3LKWA 2JJ1D 2VJ1A 5EJ1A 5KGOA 1EP6A 1EZXC 4FUHA 4ZMAH 3LH1A 7GCHF 1ELAA 2Y6TA 9ESTA 1EOJA 3O8DA 5CHBA 2CJIA 3F0OA 1K1NA 2BY6X 1EXFA 4OS7A 4K8YA 1KTTB 1Z7KA 2G5VA 3STIA 1W3CA 1O5BB 2O8UA 2QF3A 3SUEA 1ETSH 2EI8A 1QZ8A 2VINA 1RXPA 2QIQA 4NCYA 2TIOA 1BUIA 3AW1A 2JH0D 3ZVAA 1MQ6A 1HAPH 1A3EH 1ANBA 2O9QA 1GHBF 4YZUA 4XSKU 2G00A 1O3IA 2Q1JA 1TIOA 2BY5X 2Z3DA 3LC3A 3W95A 2AFQB 3ZZ5A 1H8DH 2OK5A 2VWNA 1HGTH 1SGEE 1ELGA 3L33A 3AASA 3LGTA 4GSOA 5GCHG 2SGQE 5EQQA 3SU4A 1ZLRA 2BLWA 5DKMA 4FUDA 2AGIX 3F2HA 2WPDD 1UMAH 2A7JA 3PO1C 3QGNB 5CHAB 4IMZA 1A61H 1O31A 1IQLA 4WWYA 4NFFA 1ANCA 3LGIA 1YLDA 1Z6JH 1MKXH 2BXTH 1ZOMA 2A32A 1GVLA 1J8AA 1FIWA 2KCAA 4YM9A 2ZCHP 2SNWA 2G8TA 4JZDH 2H5DA 4OS4A 3W94A 2ZTZA 4CRDA 2ZCKP 1C2KA 1FJSA 2BDBA 1FX0B 4A1VA 2ZIQH 1Q3XA 5AF9H 1GI9B 1BBRE 1P11E 2XBYA 4DT7B 3UWIA 2PFEA 1L0ZA 1HLTH 1G3DA 2PHBA 2VVUA 2FOAA 4A7IB 4FU8A 3GY3A 2KAIB 5GCHF 2J95A 1N6XA 1VKYA 2XC4A 3S0NA 4AFSA 4XE4A 1UO6A 1SBWA 3SZNA 3OAAD 1FY3A 2ZQ1A 5C1YA 2AMDA 4X8VH 3AAVA 3CS0A 1KSNA 1BRBE 2QY0B 4AYVB 1UVPA 4WY3A 3F9GA 4JZFH 3GY6A 4CH8B 2FP7B 4Q2KA 4JYVH 4WXIA 4ABFA 3HKJB 4CRCA 2SFAA 1T8MA 5C5NA 1YLNA 1BMMH 2EI7A 1C1QA 2W7SA 2AIPA 2BTCE 1CBWC 4X2VA 3U69H 3MH7A 1O2RA 3MFJA 4A92A 1RIWC 4MVNA 4X6PA 1QQUA 2WPKS 1B5GH 1P9SA 4MLFB 1KXFA 3VB3A 1E1QD 2FO9A 4DIHH 3BEIB 1DXWA 1LO6A 1AQ7A 5T6FA 4TWYA 4YLUA 1ARBA 3ZYDA 2RG3A 3VB5A 5AFYH 1P12E 4A5TS 1LPZB 1CQQA 1IAUA 1GBEA 4VGCC 3M61U 4F55A 4X1NU 4X1QU 2GMTB 3RXGA 3ZVDA 1WQVH 2XBWA 3BTQE 3LT3A 5TCAA 4DY7B 2PUQH 4AB9A 2NU4E 5E2OA 3T5FH 1HPGA 9LPRA 1CE5A 3PRDA 3A80A 5A0BA 5HIYA 1G3EA 2P8OC 3TK5A 2HLCA 3JZ1B 5SGAE 2WPHS 1V2NT 3S7HB 5T6DA 2VIWA 1HBTH 1C1RA 3SJ8A 5L30H 2PTNA 5E0HA 4ISHH 5FX6A 5DO4H 1O3JA 1SGIB 2ZGBH 3FO8D 3DFJA 2XBXA 2D26C 3Q3YA 2GZ7A 2BY9X 2ZKSA 2F9PA 2D1JA 2FOCA 3LGUA 3O8CA 2ANYA 4YOIA 1O3EA 1O2QA 5EXMA 1UK4A 3M3SA 3ZVCA 3KEEA 1FNIA 1YF4A 3GY2A 2BD8A 1GMHG 2F83A 5DG6A 1Q2WA 3A7VA 1GBLA 1N6YA 3T26A 1GWAA 2QXHA 1KXCA 3K6YA 2FTLE 4IC5A 1MKWK 3BTFE 4IGDA 2QGRA 3QZQA 1QL7A 1HRTH 3M5OA 3GDSA 1ZRKA 1C2HA 1LHGH 4NWKA 3V13A 1VGCB 4MG3A 1DWCH 3F2GA 1OX1A 1CU1A 2THFB 3TNTA 3U8RH 3SQHE 1C5RA 4I8JA 5AHGH 4AG2A 3M3TA 1F5KU 1A5IA 3MU5A 3RXSA 2P93A 1Y59T 2TGAA 1FPHH 3BSQA 1DDJA 1SHHB 3M7UA 2GT7A 2HRVA 1EATA 5AVDA 2CXVA 1BIOA 3E91A 2ZHFH 1EKBB 3NWUA 4GHTA 1V2PT 1QA7A 3MWIU 4TPIZ 1HJAB 1KMHB 4FUEA 1JRSA 2ASUB 4AGJA 3HK6B 5IDKA 1BRAA 1RRKA 5KEDA 2WSSD 4CRBA 2KCPA 1ETTH 1OWIA 2Y80A 4XD7D 1ZTKA 3LONA 2R0LA 3E1XB 2JDID 3KQBA 1AVWA 1Y3YA 3BG4B 3QTOH 4BAHB 2FI4E 1J16A 2BD9A 2J4IA 5KECA 1G3CA 1H1BA 4X8UH 2VIPA 2CN0H 4HGCA 3DHKH 2NWNA 4FUJA 1TGSZ 1T8LA 1GBFA 1ZTLA 2H9EH 1GBMA 2UUJB 3SW2B 1K1IA 3BTWE 1GPZA 3RXPA 1GJ8B 1JRTA 1QB6A 1DS2E 5F8ZA 3MHWU 4ACBA 4ABGA 1Z8GA 2G4UA 1RS0A 4CH2B 4OM9A 1B7XB 3EDXB 3ZZ9A 1EPTC 3SJOA 1Z8JB 1VCWA 1DT2A 5C0TA 1EAIA 1XUIA 3GDVA 4X0WU 1OP0A 1IQHA 1HCGA 3M36A 3OTJE 3DSGA 5FPYA 3UREA 2H2ZA 1SGQE 4CBNA 3RXOA 2WZQA 1AMHA 5J4SA 2XWAA 1LCYA 2JH6D 4B73A 3SZEA 2M5TA 2OQUA 2CV3A 3ZIAD 4BXSA 1BZXE 1SOTA 1ZSJA 4ZAEA 1PPGE 2DE8A 4RI0A 5FCRA 4NIVA 1O38A 5PTPA 2ZPRA 4INLA 1S85A 4F4OC 2PV9B 1M9UA 3RXCA 1NFYA 1HAZB 2OXSA 1C1VH 1FY8E 2FZZA 3U98H 4I33A 1EB1H 2BX3A 1TA6A 4M9FA 2ANMH 1W0ZU 4I8GA 1CT4E 5DPAA 2Z94A 5GWZA 2EEKA 4RKOB 2BMGB 1IQNA 2GDDA 3ATMA 3C1KA 1GJ4H 5EIYA 2GCHG 3RLYH 4Y79A 4MTBA 3F9HA 3A81A 3HATH 1O2NA 1XM1A 5BPEA 4TY7A 4NFEA 5DJ7A 1IOEA 5EG4A 1QTFA 2IN2A 5I46H 3A86A 1P05A 1W0YH 1GHAG 1LDTT 1ESAA 4BANB 1C5UA 2C93B 2BOHB 2FM2A 4ZHLU 4BAMB 2A5IA 3BIVH 3A83A 4XFQA 2R2MB 1TBQH 4ISIH 3LIWA 1L4ZA 2BLOA 3CENA 1QURH 3TIUA 2ZGCA 1AN1E 1VJ9U 3F2FA 2FI3E 4M7GA 4X2XA 5H4IB 2BDIA 1DLKB 1D3QB 2GMTC 3KIDU 1O2SA 8KME2 1P57B 4ZKRU 1SQRA 3RDZA 1W13U 5A8ZA 4NGAH 3VGCB 2FOBA 1K22H 1GBJA 1G32B 1XVOA 1NRPH 1O2MA 2G5NA 4GCHF 1ELDE 1HXEH 2TGTA 4IS5A 1ETRH 1C1SA 1XUGA 1YCPK 3SNBA 4I86A 3SOSA 1GI7B 4NIWA 2ZU4A 1CSOE 2GCHF 1BJUA 1CGIE 1VITG 2YOLA 1QQ4A 3SV7A 1XXDA 2Y82A 4TWWA 1QNJA 2Z9LA 4YOGA 2L6OA 2HNTF 2C8ZB 4FVBA 1WUNH 3VPKA 1AUJA 1QB9A 1GHAF 4H42U 3U1IB 2OBOA 4OGXA 2Y5GA 1TNGA 2PWXA 1ZMLA 2WUBA 2GCTB 3CP7A 1C1PA 1LPGB 1TYNA 2PR3A 1EOLA 2V6NA 2JKHA 1IQFA 1HJ9A 1Y5BT 3A8BA 1S81A 4GAWA 1MTNC 2P95A 1GI1A 3SU2A 3E90B 1O3HA 5T1VA 4A1TA 3RXMA 1P09A 4ZROA 1J14A 1GBDA 2O8MA 3V0XA 2K1QA 4YXWD 3RXUA 3PLPA 1VGCC 3M5NA 3RXKA 4E7NA 1GVKB 1BTZA 2ODYB 2RA3A 1FIZA 3F68H 1CT2E 1O0DH 4MNYA 2PKSB 1K1JA 3OEED 4Y11E 1MZDA 1FZZA 2UWPA 1DFPA 5A09A 3RXDA 2ZPSA 2WV4A 2BDGA 5JBTA 3A82A 2UUKB 1TBRH 1VITF 1NZQH 2WHXA 1OKXA 3PB1E 3BTEE 4AN7A 3PMHB 2PSXA 3PTNA 5EJLA 1O2HA 1F0UA 1HJAC 1O3NA 1WTGH 4ISOA 2ZGJA 1D3TB 2D8WA 1CA8B 3KQCA 1MD7A 1TGNA 5F03A 1BHXB 1HV7A 1GG6C 1TPSA 2VVVA 2A4RA 1LQEA 4UFGH 2Y7XA 1MTUA 2Y5FA 4BAKB 1PPFE 3ZZDA 1LTOA 1O35A 1C5XB 5HMAA 1O3PB 1DY8A 2Y7ZA 4SGAE 4NWLA 5EOKA 4DOQA 4JYUH 2QF5A 4RSPA 3ENSB 4BTIB 1Y8TA 1O5CB 4E05H 1SGFA 4Y6DA 1E37B 4B2AA 5FCKA 1FQ3A 1QR3E 4K69A 4XBCA 2WYJA 4YO9A 1XKAC 2BVXH 2TGDA 1KLJH 2XBVA 2HVYB 1YWUA 5C17A 3OEHD 1SLVB 3S9CA 1AZ8A 4BAOB 1UW7A 1QFKH 1O2KA 1UK3A 1C2DA 1TMTH 1YPJH 2BQWB 2QYIA 3HKIB 3RXIA 2BDHA 2G55A 1BMFD 1K2I1 1MKWH 1O2XA 2I6QA 2XCNA 1C1UH 1Y3VA 1S83A 1QBNA 3E6PH 3GDUA 1GL0E 2VIVA 1LVMA 1INCA 2XTTB 2ULLA 4NSVA 2KCOA 3D62A 1KY9A 3BF6H 2H1UA 2AS9A 1BQYA 1GBKA 1SI5H 1V2QT 1K0HA 8LPRA 1P03A 1W14U 3EQ0H 1NO9H 5LPEA 2FLRH 1FV9A 5E0JA 3EGKH 1SOZA 3UB0A 2BLVA 2HOBA 2Y5HA 2FPZA 1HAHH 2HPPH 2BZ6H 1BRUP 1UHBA 5ETXA 3TJVA 2C90B 4FU9A 4F49A 2JJ2D 5DN6D 2ZDVH 2LIZA 1FN8A 4AORA 1XUKA 3NPSA 1OS8A 3A7ZA 5LGOA 2ALPA 1TMUH 4MPWA 4FUCA 1MTSA 1DX5M 5TCCA 3BTDE 1N8OB 4Y76A 1E35B 1CA0B 1Y3UA 3M35A 4LK4A 4INKA 1W2KH 4ACAA 4B2BA 1JWTA 3SU1A 3SNDA 1G2MA 3UPEA 3A84A 1L4DA 2I6SA 1V2ST 2OC1A 1P10A 1S82A 4ZKOU 4AOQA 1D9IA 3SNCA 1G30B 2CHAC 3NXPA 2Q6DA 1Y5AT 3GICB 1GI5A 1S6FA 2V35A 3GY4A 2JETB 3MO9A 5GPIB 2LP6A 1AUTC 2V7QD 3T28A 1C1OA 2OINA 5EJZA 2VB0A 1SGCA 1QJ7B 3CNRA 1E1RD 4K1TA 1O2PA 1SQTA 4CR5A 1NESE 3MU1A 2WPMS 2XNIA 1V2JT 1G9IE 1ZRBA 3UWJH 1WOFA 2XC5A 1BBRK 1GCTB 2STAE 5EXLA 3UNSA 3FANA 1T7CA 1UTNA 4THNH 1C1WH 3VXEH 5C1UA 2BOKA 2BX4A 3O8RA 2W6JD 2GX4A 3UNRA 1B0EA 1TNIA 4JMYA 3SNAA 4Q63A 3SNEA 4ABIA 1YPHE 3LOXA 4ZHAA 2GCTC 3TH3H 3ZVBA 3PMJA 2HWLB 4U32A 1IQIA 4Q80A 2BDYA 4BTTB 1SR5C 1D6WA 3F9FA 4U01A 4UFFH 4UONA 1VCPA 3MOCA 1GCDA 3Q3KA 1UTLM 6ESTA 3DD2H 2BQ6B 1OWHA 2IJD1 2WINI 2RA0A 5LPFA 1QCPA 1NFUA 1UTPA 3GISB 4B6FA 1O2UA 1BMLA 1TOMH 4HFPB 2BD7A 1WXRA 4AFQA 1HAOH 1FAXA 1P8VC 3AAUA 1QL9A 1V3XA 2CF8H 3QK1A 3VB6A 1C5QA 4NSYA 1NT1A 1SSXA 4OS6A 5LH8A 3GY8A 1P9UA 1YM0A 2XRCA 4E7RG 2ZP0H 1AGJA 1P3EA 3SU6A 3BV9B 1BTYA 3RMNH 4ABBA 5DP9A 1O2IA 1V2LT 4JYTA 1C5WB 2Q6GA 1NRQH 4A1XA 1ELBA 1MAYA 3NUMA 3UIRA 2W3KA 4X6MA 3QDZB 3D65E 1H9IE 1A46H 2M2AA 2XYAA 5C20A 4FUBA 2ZTXA 2A4GA 1HJ8A 1H8ED 1RGQA 3GCHC 1O32A 2LNCA 1BB0B 5F6MA 1YLCA 2ZDNA 2VIOA 4B1TA 1HAXB 1E36B 3GOVB 4JZEH 2FMJA 2FDAA 2Z9JA 3S69A 1F5RA 2BYAX 1UTMA 3F1SB 1Z71A 1V2MT 3LDXH 4RT1A 1EZQA 1BOQA 3HGNA 4WMFA 1DUAA 1TMBH 2R9PA 1BJVA 3RM2H 2AERH 1GBIA 4YESB 3H7TA 4IMQA 1S6LA 1FXYA 1OOKB 3DFLA 3K9XB 2ZCLP 3NRLA 1O3CA 4FVDA 1TRNA 3BTGE 3UAIC 1GMCG 4X8SH 4KP0A 3BTHE 3U28C 5F53A 5LPRA 1PYTC 5DP7A 1C1NA 3A89A 2WV9A 1KTSB 2ZNKH 5JB8S 4UD9H 4DIIH 2D2DA 3O8BA 2ZU2A 3KYFA 2QF0A 4JCNA 1ZSLA 5GIBA 1GI3A 1ZJDA 4Y0YE 3SUGA 3KF2A 2ZWLH 1AI8H 3SQEE 4X1RU 3H09A 3UNQA 2FEQH 3ZYEA 4DJZB 1YPLH 3QX5H 4IC6A 4OGYA 1BMNH 1BITA 3F3BA 3A87A 1RD3B 4KTUA 4CHAB 4LZ1H 1UCYE 2KZ4A 3P6ZB 1QJ1B 3TK9A 5J4QA 4D9RA 1SGYE 1L1GA 4WXVA 2LELA 4MNVA 4UFEH 5EW2H 4B74A 2O8WA 1GHVH 5T6GA 1W11U 4D7GA 1P01A 4QT8C 1CO7E 2KM0A 3SU5A 3FP8E 3C27B 1QL8A 5C0UA 1P04A 1GMCF 2P3UB 3F0PA 3FKSD 1Z1JA 3ZZAA 5C67A 3PV5A 2EA3A 1CA0C 5DP4A 1EZSC 1V2VT 1ELCA 3M3VA 1HXFH 1KLTA 1S6HA 1TE0A 1V2RT 4IN1A 5FPTA 5B6OA 1C4Y2 1NN6A 1F5LA 1CT0E 1C2EA 1OSSA 2P94A 3Q3XA 5L2ZH 2BB4A 1AVXA 2ZFRH 4MPXA 1O3MA 3DSPA 3TH2H 2XXLA 3R0FA 1ZZZA 1BA8B 2W26A 2QAAA 1ELEE 1C2IA 1GMHF 1HAGE 1S0RA 3RC4A 4XBDA 3V7TA 2OUAA 1TAWA 2WPJS 1EFRD 1QY6A 1HAIH 3ODDA 3NK8A 3OX7U 5CHAC 3PTBA 1TB6H 1TOCB 2EI6A 3PRBA 1TGTA 2GZ9A 1SQOA 3P95A 3EBNA 4FUGA 3TGIE 1ZHMA 3SBKA 1GHWH 1C9TA 1EAXA 2SGEE 1K1LA 4Y8YA 3SGQE 2VWLA 3OU0A 2STBE 1LPKB 3URDA 1TPPA 1VITH 6LPRA 1JIMA 1O3BA 1UHBB 1UTOA 1T4VH 1YPMH 4WF8A 4A6LA 3M5LA 4Y0ZE 3ODFA 3PM3A 3QO6A 1H9HE 1L1NA 2A0QB 3DT0H 1NFWA 1MTVA 2ODPA 2QV1A 5TJXA 5B6LA 2Z3CA 3SV2H 2BZAA 1AWFH 1C2JA 3BTTE 3RMMH 2GTBA 1F0RA 3UTUH 2PW8H 1PPCE 5JDUB 2VBCA 1EB2A 3LJOA 1GHXH 2LPRA 2VIQA 4JK6A 3PROA 4NA9H 1P2OA 1GI8B 3TLOA 2F9UA 3RXQA 1QRXA 3L6PA 4UE7H 1AWHB 1O3GA 1F0TA 5CDFE 1O2TA 3SYJA 5K7RA 1GI2A 1QGFA 2V3OH 3MMGA 3T27A 1MTWA 4CRFA 1WBGB 2FWWA 3SN8A 2VH6A 4BNRA 3E0PB 5DP8A 1RJXB 1TGBA 2O8LA 1ZR0A 1FI8A 3MU4A 5C94A 5JPMH 1AE5A 4D9QA 5CE1A 4NIYA 2VH0A 3BIUH 3SORA 3SHCH 3BN9A 3LGWA 1L1JA 1XVMA 4Z0KA 4DG4A 1NPMA 1K9OE 2RDEA 2BVRH 2ZHQH 2BVSH 5FL7D 3ATLA 5HKKD 4UFDH 4FUFA 1S84A 5C3NA 2RFKC 5GXPA 1K28D 1PPEE 1SG8B 1TLDA 2GV7A 3TJUA 3HGPA 5FXLA 1PFXC 2HNTC 2SNVA 3RXEA 3RP2A 4YT6H 1P3CA 3EA9A 3EA8A 1OP8A 2TGPZ 2UUYA 1Y3WA 4BAQB 1FMGA 1DPOA 2YMSB 2BLQA 1KXBA 1TA2A 3SJKA 5FPSA 3FN8A 1U6QA 2HVXA 3DCLA 2OLGA 1C5LH 1HFDA 2GD4B 2QXGA 2FI5E 4ASUD 2SGDE 5FHTA 1OWJA 1V2KT 2J92A 1MQ5A 3GY5A 1FDPA 2Z3EA 1YGCH 1GDUA 1FAKH 2BM2A 1C5YB 4E06H 1E38B 4WVPE 1C5PA 2CMYA 1EAUA 2QE7D 3GCOA 3MQKC 4X8TH 2FIRH 1C2FA 3UR6A 2IPQX 3EE0B 2ZGXH 3P8FA 2BY7X 1COWD 3ZZCA 3PYHA 1AB9B 3L3TA 1GJ6A 1AVGH 1P2IA 1O5EH 5C2ZA 2VGCB 2AEIH 4GVUA 4Y71A 1DWBH 1G37A 1OPHB 3E3TA 5EW1H 2A7CA 1NU7B 3AVZA 1WTHD 5BRRE 2AMPA 1SLWB 1PYTD 5HXFA 3OY5U 1ESBA 1ZPCA 2WUCA 2FOGA 3W1EA 1HUTH 1ELFA 4MQAA 1VR1H 1Z8RA 1MU8B 1C5VA 1TONA 1XUFA 1P2NA 1CHOG 1LHDH 2Z9KA 1AFEH 1TFXA 4CHAC 2CK3D 4K3JA 3QLPH 5JBAS 5DK1A 1TWXB 5GJ4B 1FPCH 3ZVGA 3MNSA 4AGKA 2W3IA 1KDQB 1OWDA 2WV5A 2ZFQH 2AYWA 1ACBE 1C4V2 4Q7YA 4I8LA 2G51A 1BTUA 3DUXH 1YPKH 4B71A 2GV6A 1V2OT 2R3UA 3NKKA 3T29A 1ZGVA 2H9HA 2VWOA 2ZFFH 1ABIH 1AFQB 1UVTH 1RFNA 3E0NB 2AGGX 4X6NA 5DP3A 1JBUH 1FLEE 3PLKA 1Y3XA 4RN6A 4AFUA 2Z6BD 2GZ8A 1YPHC 3UOPA 1SB1H 3VEQB 3IWMA 8GCHG 4X2WA 2FESH 1W12U 2OP9A 1J17T 1SHYA 1NU9A 1SLUB 2J94A 1TX8A 4GUXA 3RXFA 3OFND 2KFWA 1ZHPA 1F92A 2QC2A 2B9LA 1G2LA 1NBME 1T4UH 3BG4C 2QA9E 1C5OH 2KCYA 1FUJA 3FZDA 1W10U 1O37A 1O5GH 1UVUH 2B0FA 3M7QA 6CHAB 4J2YB 2FYRA 1LQDB 1NC6A 4TPYA 1BRCE 2ZFPH 1QRZA 3PMAB 2FX6A 1K21H 3EYDA 1GJAB 1FY4A 3EE7A 4NZLA 3A85A 3LJJA 1THPB 4X6OA 1GJ5H 1HAYB 2TBSA 3P8OA 4NG9H 5FBEA 3RXHA 3U8OH 1A5GH 4ZKSU 1ID5H 1XKBC 3MU0A 2XW9A 4PROA 1SGRE 1OWKA 5HGGA 3SV6A 2P16A 4ABDA 1DICA 3GS9A 2R0KA 2ILNA 4K1SA 1O2LA 3LPRA 3D23A 2UWLA 5EU8A 1O5AB 1O2VA 1L2EA 2O8TA 1OP2A 1VJAU 4K8BA 2Y81A 1ANEA 3PWCA 4HZHA 8GCHF 2BQ7B 4FXGH 1O3OA 3WWBA 1KLIH 1DY9A 3SV8A 4ABEA 1DXPA 1P0SH 4D8NA 4RKJB 3TH4H 2H5CA 2HNTE 1W8BH 2FTMA 3KQEA 4F48B 1TABE 5GDSH 1BTHH 2OQ5A 1SPJA 4WH6A 4R8TB 1DWEH 1AHTH 1WCZA 2ESTE 3P92A 3SO3A 1HYLA 1NBMD 2GKVE 1JIRA 1KXDA 4ESTE 2ZQ2A 3SJ9A 2BDCA 1O2ZA 4Y7BA 2A1DB 2Z9GA 2QXIA 2BDAA 3MO6A 2IJOB 5ESTE 1QRWA 1O2JA 1TNJA 2W6ID 2ZTYA 4YTAA 1O2GH 2FS8A 2F9VA 2NU2E 2ZA5A 4IW4E 3WY8A 2KX4A 1D6RA 5HM9A 2EQNA 1A4WH 1PQAA 2VVCA 5IYTA 2ANWA 5L6NH 1SQAA 1O5FH 3TK6A 1O33A 1K1PA 2IPHA 3B23B 3T62A 3ZV9A 2C8XB 3NZIA 3QN7A 1EQ9A 3RXBA 1GHYH 1MMJN 4MNXA 3JZ2B 3H7OA 3LGVA 2FOFA 1ZPZA 3RC6A 4DURA 1P02A 4KKDA 3MH5A 3GY7A 3MNBA 1NS3A 4DW2U 4Z1MD 1T31A 3MI4A 2YMSC 4ZH8A 3BG8A 1O34A 5I25A 1DSUA 1C9PA 2FOMB 3VB4A 3AW0A 4LXBH 1P2MA 1HB0B 4KELA 2HPQH 3RXLA 3VGCC 1SMFE 2ZHDA 1PJPA 1HAVA 2BD2A 2AMQA 2XCFA 1LVYA 4AZ2B 2R3YA 2VU8E 2R2WU 1H8HD 2FYQA 1UTKA 5E2PA 3BEFB 1MUEB 2DUCA 4OS2A 3MYWA 3RM0H 3ELAH 1TNHA 1W7GH 3KHVA 1GJDB 5G4BA 2H6MA 2J5UA 2FODA 3ZVEA 1C5MD 2ZU1A 1UJ1A 1AB9C 2J38A 3TJOA 3UFAA 1AKSA 2WPLS 4B75A 2F9NA 2VGCC 1KXAA 2PGQB 4B2CA 2PGBB 2Z7FE 1BMAA 3SUFA 1IHTH 2G81E 1YPGH 1TGCA 1YKTA 3SHAH 1SLXB 1MBQA 3MNCA 3LH3A 4U2WA 2B5TB 1EPTB 4HTCH 1Q31A 1SVPA 1HIAA 3U9AH 4BTUB 1GGDB 1AU8A 2V0BA 1PPHE 3RC5A 1Z1IA 2AIQA 5JBBS 1WSSH 1GDNA 1LHCH 1E0FD 3ATKA 1TRMA 2UUFB 3A7WA 4O3UA 2PKSC 1O3LA 7KMEH 4XRNA 4B76A 1LVBA 1HDTH 1TQ7B 2VNTA 3GCNA 3KQDA 1CHGA 1EAWA 4UEHH 3FAOA 4AX9H 1AFQC 1PPBH 2V3HH 2ZPQA 1BDAA 2A45B 1DE7H 2SGFE 2J2UA 3STJA 4CR9A 1LHEH 1O3FA 3SV9A 3A8AA 3TITA 4YOJA 3U8TH 5FBIA 2TPIZ 4MPUA 1O2YA 1ZTJA 2K7XA 5F8TA 3UQVA 3PV2A 3TGKE 1ORFA 3NCLA 4I8HA 2ZDKA 3F9EA 1S0QA 2FXRA 3Q76A 1A0HB 1QJ6B 5EODA 1O2WA 1C2GA 1A5HA 2P59A 2ZFTA 3A7TA 5K0HA 4ZUHA 4ZCNA 1BCUH 1YBWA 2J98A 1O3AA 1YCPH 2OC8A 3ZV8A 2GGVB 1KDQA 3UQOA 4BXWA 3A7XA 2AH4X 3PV4A 1YYY1 6CHAC 1SL3A 1ZPBA 1E79D 3ITIA 4GPGA 4I7YH 4NIXA 1T32A 2A31A 2ZDMA 1MZAA 2ZGHA 4K60A 4Q7ZA 4Q7XA 1D3DB 5CMXH 3N7EA 3MO3A 2F91A 2GVFA 1THSH 1EJMA 2AGEX 3OYPA 4LZ4B 1V2UT 1XUHA 3TU7H 3B9FH 1DLEA 5EQRA 5DSFA 1JOUB 1XUJA 4OS1A 1P2QA 4ZKNU 3U1JB 3VFEA 3CS7A 1Y5UT 1AY6H 5DGJA 1GVZA 5A2MH 2ZHEH 1SKYE 4TYDA 1C1MA 1A3BH 1J15A 1C2MA 1DVAH 2BY8X 3RXRA 4P00A 5HM2A 1XX9A 4INHA 4TSFD 1X7AC 1UCYK 1T8NA 2F43B 4DVAU 1ZGIA 4WH8A 1KXEA 3HPTB 1BHXF 3FP6E 4CREA 4D7FA 1GI6A 3FFGA 1KYNA 2K0QA 2ZO3H 1Z6EA 4GLYA 1O5DH 3FP7E 3I77A 1TNKA 1MAXA 3RLWH 4XBBA 2OD3B 3VG8A 1TRYA 1DANH 3WWFA 4ZXXH 2C4FH 4GHQA 1AZZA 2ZFSA 1A0LA 1QHRB 3N7OA 1O30A 5FX5A 1AD8H 3GCTG 2L74A
chains in the Genus database with same CATH topology
2QCYA 2SGAA 1Z8IB 3GYLB 2PTCE 4ABAA 3KNXA 1ZMJA 4D76A 1QA0A 1GMDG 1MTNB 1PQ7A 3MU8A 3SUDA 3H5CB 2YNAA 1WYKA 3P17H 1C5TA 8ESTE 1LMWB 4O3TA 3M37A 1N8OC 3R3GB 1IQGA 4ISLA 4R0IA 5A0CA 4KGAA 1EZUC 1B0FA 2GP9B 2ZHWH 4Y7AA 3DA9B 1WQSA 1F2SE 2A2QH 2J34A 4K2YA 2NU1E 1NFXA 1NM6A 1S5SA 3QTVH 4WMDA 1GJ9B 1C5NH 2C8WB 1EP5A 2OCVB 1GHZA 1EJNA 2JETC 5DP5A 1MCVA 3RXTA 2A7HA 3ZZ6A 4O9VA 1DM4B 4K5ZA 1H8IH 1O2OA 4DCDA 2PKAA 2B7DH 3FZZA 1J9CH 1GG6B 1NROH 2TRMA 3VB7A 1SFQB 3SGAE 3G01A 5ESBA 1OXGA 2ZZUH 3GCTF 2A5KA 1GJBB 1UVSH 4LOYH 1GCTC 4H6SB 4JK5A 3TJNA 5C1XA 1GMDF 1NRSH 4I31A 1BTWA 2ODQA 4NA8A 3TGJE 1EJAA 2OC7A 1EX3A 4H4FA 1TBZH 1YPEH 1ANDA 1MD8A 5L2YH 1ZJKA 1PQ5A 2A2XH 2FX4A 4AG1A 3S7KB 4U30A 1TPOA 1YP9A 1O3KA 4X1PU 1HNEE 1DSTA 2OC0A 2Z9IA 3BTKE 5E8EH 1SFIA 5E0GA 1OWEA 2G4TA 3LGYA 3LU9B 4FU7A 3F6UH 1GGDC 3I29A 4TY6A 3E16B 1AIXH 1TX6A 1QBVH 1WV7H 4ABJA 5EXNA 1F7ZA 2ZC9H 2PUXB 2BXUH 1MKXK 5A8XA 1QIXB 1V2WT 1CGJE 1SGPE 1JMOH 5EQSA 1ARCA 3RXJA 3SU0A 2JH5D 3MH4A 3OSYA 3RMOH 1HAVB 1LVOA 3ZZ8A 4DGJA 1RTFB 2ZDLA 1G3BA 1QB1A 1W7XH 2PLXA 3ZZ7A 2C8YB 5EGMA 4YLQH 4GCHG 4NA7A 1EPTA 1YCPM 4ABHA 3M5MA 1T8OA 5A8YA 3KGPA 5JB9S 1V2TT 3UUZA 1ABJH 3UOUA 1EUFA 2WYGA 3SU3A 1ZHRA 2BD3A 2GT8A 2WPIS 2FOEA 3TPIZ 1VCQA 1O36A 4MNWA 3GYMA 7ESTE 3TNSA 3KCGH 3S9AA 1AKSB 3EAJA 1TNLA 4IBLH 1DOJA 7LPRA 1BBRH 4I32A 2Q6FA 1TALA 1XMNB 2XC0A 2KAIA 5C5OA 4XDEA 1SC8U 2OTVA 1JXPA 4KTSA 3QUMP 3VXFH 1F0SA 4H6TA 5T3HA 1TQ0B 1YC0A 1GBHA 3MTYA 1TX7A 2RDLA 2FS9A 2SGPE 1IQJA 1HIAB 1GJ7B 2W5EA 1MH0A 2W7UA 2ZG0H 5DP6A 2ZF0H 1SGNE 3ATWA 3MNXA 3S9BA 3ESTA 2A5AA 4AB8A 2CHAB 4JZ1A 1V6DA 1ELVA 1P06A 1P2KA 2DE9A 3T2NA 5F8XA 1EASA 4OS5A 3LC5A 1C5SA 3PO1B 4O03A 1GBCA 1ZMNA 1D3PB 4ISNA 4MPVA 3T25A 2A4QA 2F3CE 2FOHA 3V12A 1A1RA 3ZZ4A 3ZZ3A 4SGBE 4AYYB 2GDEH 1NRNH 1E34B 1WAYB 3BEUA 3PWBA 1N1LA 2VIDA 4KTCA 4UDWH 1OYQA 1LKBA 1IQKA 1O39A 3Q77A 4Z6AH 2RCEA 1PQ8A 2OBQA 3I78A 1C2LA 1BTPA 1D4PB 2B8OH 6GCHG 4CRAA 5ABWA 3SJIA 2ALVA 3A88A 4J1YA 1MCTA 1LHFH 1WU1A 1AE8H 1OYTH 1TPAE 3SGBE 3IITA 3KN2A 4Y8ZA 5EPYA 3K6ZA 3K2UA 1LKAA 3PLBA 2F9BH 3D49H 1FY5A 2A4OA 1C5ZB 3Q00A 4BOHA 1GBBA 1ZYOA 4YT7H 3RXVA 1SGFG 1MU6B 3ZZBA 3A8CA 4CBOA 3V3MA 2BHGA 4IN2A 3QWCH 1GI4A 4XOJA 4K1EA 3A8DA 3K65B 1IHSH 1RTKA 4CRGA 3SI4H 1FN6A 1THRH 3URCA 1A0JA 2HGTH 1GDQA 2XWBI 1C1TA 4FUIA 2ZU3A 3FVFB 2H9TH 5EPNA 5FAHA 1PPZA 3SI3H 1CHOF 4X1SU 3P8GA 3TVJB 4ASHA 6GCHF 1CBWB 3RUOA 2CF9H 4X2YA 3BTME 1XXFA 1ZSKA 1RIWB 4WJG2 1IQEA 1A7SA 1FY1A 3P70B 3HK3B 3ZVFA 1DITH 1UCYH 5AFZH 2ZU5A 5JBCS 2BD5A 3E8LA 3RU4E 1NY22 2QXJA 3KL6A 1GJCB 3GCHB 2IOTA 2FLBH 4VGCB 1ELTA 2ZI2H 1GI0A 4Y10E 3RU4T 2G52A 1UTQA 2J9NA 2ZEBA 4Y8XA 2QN5T 1BT7A 2EC9H 2ZECA 1IQMA 2BD4A 2NU0E 1C4U2 1RTLA 1DWDH 3EA7A 3UY9A 2UWOA 2CGAA 1CVWH 1H4WA 2PSYA 7GCHG 1UVOA 2ZDAH 1UK2A 2P8OB 1BTXA 1QBOA 3RXAA 1CGHA 3P8NA 4NZQA 2YNBA 1GBAA 1NTPA 1KIGH 4HI3A 2VWMA 5A0AE 1O3DA 3A7YA 4ZHMU 2NU3E 1SGTA 3M7TA 1GHBG 1MBMA 4WMEA 1G36A 1GL1A 3OY6U 3ATIA 1GBTA 4MDSA 1SGDE 1P2JA 5JYIA 2P3FH 1A2CH 4ZXYH 5HYOA 2HALA 4JZIA 3RMLH 4AFZA 1DUEA 1UTJA 3IG6B 1ESTA 1FONA 1VZQH 1H9LB 2C3SA 1K1MA 3MH6A 2P3TB 2PKAB 2F9OA 1NRRH 3PMBB 4O97A 3RU4D 1K1OA 3QGJA 4I8KA 2ANKH 3B8JA 3QZRA 1AO5A 3UR9A 3LKWA 2VJ1A 1EP6A 1EZXC 4FUHA 4ZMAH 3LH1A 7GCHF 1ELAA 2Y6TA 9ESTA 1EOJA 3O8DA 2CJIA 1K1NA 2BY6X 1EXFA 4OS7A 4K8YA 1KTTB 1Z7KA 2G5VA 3STIA 1W3CA 1O5BB 2O8UA 2QF3A 3SUEA 1ETSH 2EI8A 2VINA 1RXPA 2QIQA 4NCYA 2TIOA 1BUIA 3AW1A 2JH0D 3ZVAA 1MQ6A 1HAPH 1A3EH 1ANBA 2O9QA 1GHBF 4YZUA 4XSKU 2G00A 1O3IA 2Q1JA 1TIOA 2BY5X 2Z3DA 3LC3A 3W95A 2AFQB 3ZZ5A 1H8DH 2VWNA 1HGTH 1SGEE 1ELGA 3L33A 3AASA 3LGTA 4GSOA 5GCHG 2SGQE 5EQQA 3SU4A 1ZLRA 2BLWA 5DKMA 4FUDA 2AGIX 1UMAH 2A7JA 3PO1C 3QGNB 5CHAB 4IMZA 1A61H 1O31A 1IQLA 4WWYA 4NFFA 1ANCA 3LGIA 1YLDA 1Z6JH 1MKXH 2BXTH 1ZOMA 2A32A 1GVLA 1J8AA 1FIWA 4YM9A 2ZCHP 2SNWA 2G8TA 4JZDH 2H5DA 4OS4A 3W94A 2ZTZA 4CRDA 2ZCKP 1C2KA 1FJSA 2BDBA 4A1VA 2ZIQH 1Q3XA 5AF9H 1GI9B 1BBRE 1P11E 2XBYA 4DT7B 3UWIA 2PFEA 1L0ZA 1HLTH 1G3DA 2PHBA 2VVUA 2FOAA 4A7IB 4FU8A 3GY3A 2KAIB 5GCHF 2J95A 1N6XA 2XC4A 3S0NA 4AFSA 4XE4A 1UO6A 1SBWA 3SZNA 1FY3A 2ZQ1A 5C1YA 2AMDA 4X8VH 3AAVA 3CS0A 1KSNA 1BRBE 2QY0B 4AYVB 1UVPA 4WY3A 3F9GA 4JZFH 3GY6A 4CH8B 2FP7B 4Q2KA 4JYVH 4ABFA 3HKJB 4CRCA 2SFAA 1T8MA 5C5NA 1BMMH 2EI7A 1C1QA 2W7SA 2AIPA 2BTCE 1CBWC 4X2VA 3U69H 3MH7A 1O2RA 3MFJA 4A92A 1RIWC 4MVNA 4X6PA 1QQUA 2WPKS 1B5GH 1P9SA 4MLFB 1KXFA 3VB3A 4DIHH 2FO9A 3BEIB 1DXWA 1LO6A 1AQ7A 5T6FA 4TWYA 4YLUA 1ARBA 3ZYDA 2RG3A 3VB5A 5AFYH 1P12E 4A5TS 1LPZB 1CQQA 1IAUA 1GBEA 4VGCC 3M61U 4X1NU 4X1QU 2GMTB 3RXGA 3ZVDA 1WQVH 2XBWA 3BTQE 3LT3A 5TCAA 4DY7B 2PUQH 4AB9A 2NU4E 5E2OA 3T5FH 1HPGA 9LPRA 1CE5A 3A80A 5A0BA 1G3EA 2P8OC 3TK5A 2HLCA 3JZ1B 5SGAE 2WPHS 1V2NT 3S7HB 5T6DA 2VIWA 1HBTH 1C1RA 3SJ8A 5L30H 2PTNA 5E0HA 4ISHH 5FX6A 5DO4H 1O3JA 1SGIB 2ZGBH 3DFJA 2XBXA 2D26C 3Q3YA 2GZ7A 2BY9X 2ZKSA 2F9PA 2D1JA 2FOCA 3LGUA 3O8CA 2ANYA 4YOIA 1O3EA 1O2QA 5EXMA 1UK4A 3M3SA 3ZVCA 3KEEA 1FNIA 1YF4A 3GY2A 2BD8A 1GMHG 2F83A 5DG6A 1Q2WA 3A7VA 1GBLA 1N6YA 3T26A 1GWAA 2QXHA 1KXCA 3K6YA 2FTLE 4IC5A 1MKWK 3BTFE 4IGDA 2QGRA 3QZQA 1QL7A 1HRTH 3M5OA 3GDSA 1ZRKA 1C2HA 1LHGH 4NWKA 3V13A 1VGCB 4MG3A 1DWCH 1OX1A 1CU1A 2THFB 3TNTA 3U8RH 3SQHE 1C5RA 4I8JA 5AHGH 4AG2A 3M3TA 1F5KU 1A5IA 3MU5A 3RXSA 2P93A 1Y59T 2TGAA 1FPHH 3BSQA 1DDJA 1SHHB 3M7UA 2GT7A 2HRVA 1EATA 5AVDA 2CXVA 1BIOA 3E91A 2ZHFH 1EKBB 3NWUA 4GHTA 1V2PT 1QA7A 3MWIU 4TPIZ 1HJAB 4FUEA 1JRSA 2ASUB 4AGJA 3HK6B 5IDKA 1BRAA 1RRKA 4CRBA 1ETTH 1OWIA 2Y80A 1ZTKA 3LONA 2R0LA 3E1XB 3KQBA 1AVWA 1Y3YA 3BG4B 3QTOH 4BAHB 2FI4E 1J16A 2BD9A 2J4IA 1G3CA 1H1BA 4X8UH 2VIPA 2CN0H 4HGCA 3DHKH 2NWNA 4FUJA 1TGSZ 1T8LA 1GBFA 1ZTLA 2H9EH 1GBMA 2UUJB 3SW2B 1K1IA 3BTWE 1GPZA 3RXPA 1GJ8B 1JRTA 1QB6A 1DS2E 5F8ZA 3MHWU 4ABGA 1Z8GA 2G4UA 1RS0A 4CH2B 1B7XB 3EDXB 3ZZ9A 1EPTC 3SJOA 1Z8JB 1VCWA 1DT2A 1EAIA 1XUIA 3GDVA 4X0WU 1OP0A 1IQHA 1HCGA 3M36A 3OTJE 5FPYA 3UREA 2H2ZA 1SGQE 4CBNA 3RXOA 5J4SA 1AMHA 2XWAA 1LCYA 2JH6D 4B73A 2M5TA 2OQUA 2CV3A 4BXSA 1BZXE 1SOTA 1ZSJA 4ZAEA 1PPGE 2DE8A 5FCRA 4NIVA 1O38A 5PTPA 2ZPRA 4INLA 1S85A 4F4OC 2PV9B 1M9UA 3RXCA 1NFYA 1HAZB 2OXSA 1C1VH 1FY8E 2FZZA 3U98H 4I33A 1EB1H 2BX3A 1TA6A 2ANMH 1W0ZU 4I8GA 1CT4E 5DPAA 2Z94A 5GWZA 2EEKA 4RKOB 2BMGB 1IQNA 2GDDA 3ATMA 3C1KA 1GJ4H 2GCHG 3RLYH 4Y79A 4MTBA 3F9HA 3A81A 3HATH 1O2NA 1XM1A 5BPEA 4TY7A 4NFEA 5DJ7A 1IOEA 5EG4A 1QTFA 2IN2A 5I46H 3A86A 1P05A 1W0YH 1GHAG 1LDTT 1ESAA 4BANB 1C5UA 2C93B 2BOHB 2FM2A 4ZHLU 4BAMB 2A5IA 3BIVH 3A83A 4XFQA 2R2MB 1TBQH 4ISIH 3LIWA 1L4ZA 2BLOA 3CENA 1QURH 3TIUA 2ZGCA 1AN1E 1VJ9U 4X2XA 2FI3E 4M7GA 5H4IB 2BDIA 1DLKB 1D3QB 2GMTC 3KIDU 1O2SA 8KME2 1P57B 4ZKRU 3RDZA 1W13U 5A8ZA 4NGAH 3VGCB 1K22H 2FOBA 1GBJA 1G32B 1XVOA 1NRPH 1O2MA 2G5NA 4GCHF 1ELDE 1HXEH 2TGTA 4IS5A 1ETRH 1C1SA 1XUGA 1YCPK 3SNBA 3SOSA 1GI7B 4NIWA 2ZU4A 1CSOE 2GCHF 1BJUA 1CGIE 1VITG 2YOLA 1QQ4A 3SV7A 1XXDA 2Y82A 4TWWA 1QNJA 2Z9LA 4YOGA 2HNTF 2C8ZB 4FVBA 1WUNH 3VPKA 1AUJA 1QB9A 1GHAF 4H42U 3U1IB 2OBOA 4OGXA 2Y5GA 1TNGA 2PWXA 1ZMLA 2WUBA 2GCTB 3CP7A 1C1PA 1LPGB 1TYNA 2PR3A 1EOLA 2V6NA 2JKHA 1IQFA 1HJ9A 1Y5BT 3A8BA 1S81A 4GAWA 1MTNC 2P95A 1GI1A 3SU2A 3E90B 1O3HA 4A1TA 3RXMA 1P09A 4ZROA 1J14A 1GBDA 2O8MA 3V0XA 2K1QA 3RXUA 3PLPA 1VGCC 3M5NA 3RXKA 4E7NA 1GVKB 1BTZA 2ODYB 2RA3A 1FIZA 3F68H 1CT2E 1O0DH 4MNYA 2PKSB 1K1JA 4Y11E 1MZDA 1FZZA 2UWPA 1DFPA 5A09A 3RXDA 2ZPSA 2WV4A 2BDGA 5JBTA 3A82A 2UUKB 1TBRH 1VITF 1NZQH 1OKXA 3PB1E 3BTEE 4AN7A 3PMHB 2PSXA 3PTNA 1O2HA 1F0UA 1HJAC 1O3NA 1WTGH 4ISOA 2ZGJA 1D3TB 2D8WA 1CA8B 3KQCA 1MD7A 1TGNA 5F03A 1BHXB 1HV7A 1GG6C 1TPSA 2VVVA 2A4RA 1LQEA 4UFGH 2Y7XA 1MTUA 2Y5FA 4BAKB 1PPFE 3ZZDA 1LTOA 1O35A 1C5XB 5HMAA 1O3PB 1DY8A 2Y7ZA 4SGAE 4NWLA 5EOKA 4DOQA 4JYUH 4RSPA 3ENSB 4BTIB 1Y8TA 1O5CB 4E05H 1SGFA 4Y6DA 1E37B 4B2AA 5FCKA 1FQ3A 1QR3E 4K69A 4XBCA 2WYJA 4YO9A 1XKAC 2BVXH 2TGDA 1KLJ