2GZ8A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords Replicase polyprotein 1ab
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz8A02
2R3UA 5FHTA 1MTSA 4B73A 2R0LA 2SNWA 3MHWU 2GV6A 1K1IA 2SGQE 3LJOA 5DPAA 4YOGA 1O2LA 1VJ9U 3RXOA 2ZDKA 5GCHF 3ATLA 4ZROA 2XXLA 4Y0ZE 2H6MA 3RMNH 5CHAB 4UFGH 2BD4A 4Y71A 3M7QA 1BT7A 3SV7A 3BTEE 4K69A 2ZC9H 4OS4A 1YLCA 4NZQA 5AFZH 3SI3H 2Y7XA 1EUFA 1HAIH 1Z7KA 3ODDA 3Q3KA 1EZQA 1GJ4H 1O3EA 3MTYA 1KTSB 2RCEA 3BN9A 1UTQA 3SZNA 3PTNA 1TA2A 4JMYA 2GCTC 3OU0A 4X1RU 1E37B 3ZZ3A 4WXIA 1O3BA 2BDCA 4NFEA 2C8YB 1SI5H 1C2IA 1SGIB 3M7UA 4Y7BA 1UCYH 4HZHA 4FUBA 2ZDLA 5EOKA 1P57B 4YM9A 1YKTA 5DP9A 3GY8A 3RXQA 1O0DH 2W3IA 5EQRA 4DIHH 2V3HH 4AG1A 4A6LA 4CR9A 2ZDVH 3AAVA 2Z3CA 3M3TA 1DUAA 2BDGA 1EX3A 1SG8B 3V0XA 3MU0A 2BOHB 4X2WA 1EOLA 2ZEBA 1GBLA 1NS3A 3MH6A 3RMMH 4DOQA 1N6XA 4JCNA 1AZ8A 1BRCE 1DM4B 2HOBA 1HFDA 4TWYA 1TMTH 1VGCB 3ZVBA 1GL1A 2FS9A 1RTKA 4DURA 2LPRA 2EC9H 3A80A 2SGFE 2ZIQH 1GBMA 2VIQA 3A82A 5HMAA 1DPOA 2VIPA 1TMBH 1K28D 1QNJA 3RXRA 7KMEH 3GY5A 1SGQE 2ZQ2A 5JBCS 2ZHDA 4ZAEA 1PPHE 1IQKA 1EQ9A 2F9NA 1QIXB 4WH8A 5EQSA 4UFFH 4YOIA 1EPTA 5GIBA 2QN5T 4J1YA 1J16A 1ETRH 3P6ZB 1V2WT 1S85A 2OBQA 3PLPA 5HM2A 4OS7A 1BB0B 3UWIA 5DO4H 2R2MB 1WTGH 3F9FA 1BTHH 4XFQA 4WWYA 1GI7B 2NU2E 1ELBA 1K1NA 1YP9A 1O3NA 2PSXA 4I31A 1QJ6B 3GDSA 4GAWA 3F68H 2JH6D 1P06A 2DE8A 1P02A 1Z8RA 4E06H 1GVLA 1LHDH 3A81A 1A61H 1ETSH 4O97A 1YGCH 3RXPA 1NROH 1WCZA 3EBNA 1E34B 3RP2A 3UR9A 5A2MH 2VWMA 3VPKA 5GXPA 4A5TS 4YO9A 1FY5A 1GBKA 1JIMA 2PTCE 3RLYH 3KIDU 3RMLH 1O33A 1O37A 2WYJA 1ZR0A 2O8TA 1BHXF 1UMAH 4H4FA 2VWOA 5C5OA 3LH1A 1O39A 1SGYE 3L33A 2C93B 2ZU1A 3KGPA 3QLPH 1SSXA 4UEHH 1OX1A 1GHWH 2O8UA 1IHTH 2G5VA 4R8TB 4CRCA 3EQ0H 1TNIA 2SGAA 2UUFB 4FXGH 1BRAA 1OKXA 1EJNA 2ASUB 2G00A 1EZUC 4CRDA 2IJOB 4X6NA 1RIWC 1L1NA 1TX7A 5BPEA 2D2DA 1QA0A 1TBZH 1AD8H 3PMAB 4ISOA 4FUEA 1GBCA 2HPPH 1O2SA 2FWWA 3KL6A 3GCTG 1GVKB 4I8LA 2F9VA 1HXFH 2GP9B 3I77A 1CT2E 1OXGA 1TNGA 4LXBH 1G2LA 1C2JA 1MKXH 2A2XH 3RLWH 3U8TH 1MTNB 3EA9A 3DA9B 2BY9X 1NRRH 1ZMJA 4NIWA 3QTOH 1Y59T 2BDBA 3BEFB 1P2NA 1QTFA 4SGAE 2ZCKP 2OQ5A 4GPGA 2H9TH 2PSYA 2H1UA 2C8WB 1TGTA 5TCCA 1TNHA 1FV9A 1TFXA 1W0ZU 3VGCC 2XC4A 3GOVB 1TYNA 1QQ4A 4B2BA 3ENSB 1P9SA 2A5IA 1SB1H 1YCPM 4Y76A 2AGEX 3PV4A 2WPHS 2ZTYA 2FTLE 2VVVA 2QYIA 2ILNA 4K2YA 2VVCA 4OS1A 1XUGA 1YPGH 5JPMH 1FPCH 3RXBA 3TU7H 5TJXA 1O5FH 4UDWH 1HAVA 1BJVA 4K3JA 1IHSH 1YPJH 3SHAH 1BBRH 1V3XA 1KXFA 2WINI 2BD2A 1QY6A 2O8MA 2XWAA 3RC5A 2BLVA 2GZ8A 2WPMS 1HLTH 5AF9H 3DUXH 2Y81A 1ZPZA 3LJJA 2HNTF 3A8CA 5HYOA 2PWXA 2XNIA 4A92A 2XBWA 2BVSH 1GI2A 1O2OA 4ABBA 3TK9A 1A0LA 3FANA 2HNTC 4CH8B 1AHTH 1SVPA 4IN1A 3A8AA 1XKBC 2BQ7B 4SGBE 1LQEA 2ZP0H 1O3HA 1VCQA 1SGEE 2BMGB 4IC6A 1GJCB 1GGDB 1LQDB 2ZHEH 2P95A 5DGJA 5DK1A 3PMHB 1GBIA 3EA8A 1KY9A 1ANEA 1BITA 1BTUA 1LPZB 4X2YA 2DE9A 1E35B 2P3TB 3OY6U 4Y8YA 1QRZA 1BMLA 3MWIU 4FUIA 1TPOA 5DP4A 1J14A 5LH8A 4KTCA 1GPZA 4RSPA 5F8ZA 3UWJH 1O2WA 3GY3A 3TH2H 4X6OA 1QBNA 1V2PT 6CHAB 1O35A 4I7YH 1QQUA 1ABJH 2Q6DA 1XUIA 1TNLA 2ULLA 3BG8A 1TBQH 4INKA 5SGAE 2AFQB 1INCA 1GCDA 1CGJE 4ABFA 4ASHA 4K5ZA 3E90B 1TBRH 2FOAA 1BTZA 4B74A 2ODQA 1D3TB 5ETXA 1RIWB 5EW1H 1HGTH 2BB4A 3URCA 1BZXE 3A7VA 4X0WU 5DP3A 1ZHRA 2SNVA 1Y3WA 1K2I1 3TPIZ 1A5IA 4YT7H 1TGCA 4B2AA 1SQAA 1O38A 1AB9B 1T8OA 1VITH 1MAXA 3ZZDA 2QIQA 3MO9A 1HIAB 4BAKB 2FDAA 1MCVA 5GJ4B 1GDUA 2ZQ1A 1ZOMA 1C5TA 4Y10E 2O9QA 2TIOA 5L6NH 2JH0D 5F6MA 1JBUH 3BV9B 3MH7A 3LKWA 1NZQH 3H7TA 4KELA 3SBKA 1BMMH 1MBQA 3PTBA 3H7OA 4GSOA 3P8GA 1LVOA 5FPTA 1YC0A 2ZPSA 1SFIA 2WUCA 2HLCA 3BEUA 3QGJA 3A85A 4CHAB 3IG6B 4FU9A 3HK6B 4UFEH 3ITIA 3GICB 4X6MA 2BLQA 3GYMA 3RXCA 1H9HE 2OC7A 2D26C 3DT0H 5DP8A 1H4WA 5EW2H 1GHVH 3TIUA 4ESTE 1RRKA 2Z94A 1SMFE 1O2YA 3ZZCA 1DS2E 3I78A 1JRTA 2FM2A 1A3EH 1ESAA 3QDZB 2OUAA 1VR1H 2ZFPH 1UVPA 2FOMB 3A84A 5K7RA 4JYTA 4MLFB 4X8TH 3AW0A 1Z71A 3RXFA 1WYKA 4DY7B 1TB6H 1THSH 3LC3A 3TH3H 5GWZA 4GCHF 1C1SA 1WV7H 4X1SU 2ANWA 3K6YA 4NA9H 2FLBH 2ODYB 1NT1A 5EXMA 3S9BA 9LPRA 1QBOA 1PPZA 4Y79A 2F9UA 1AFQC 3LGWA 1DXWA 4IC5A 3TGIE 1JOUB 3ODFA 4BANB 4TWWA 2XBYA 1SLUB 1YLDA 2BQ6B 1F5RA 4WJG2 4Z0KA 3DHKH 1W12U 4RN6A 1O2PA 1CGHA 1SFQB 2OLGA 2A7CA 1DITH 3M5OA 1W11U 1ZSJA 1HAZB 3P17H 1GHBG 3KQCA 1TQ7B 2FIRH 3R0FA 3SUDA 3SU2A 1PQ8A 2EEKA 1ELFA 2A4OA 1MZAA 1V2VT 1G3EA 2F3CE 4LZ1H 1XVOA 1DLKB 1IQIA 1S82A 3OX7U 3P70B 2YNAA 1P01A 1GBEA 1D3QB 3O8RA 1ZTKA 4IBLH 4NIYA 1GI0A 2FODA 1TX8A 3UQVA 4U01A 1FDPA 2OBOA 1FAXA 3A89A 4VGCC 4A1VA 2Z7FE 3AASA 1Z6JH 4BXWA 1AUTC 4ISLA 2Y82A 1NY22 2TGTA 2GZ7A 3PLKA 1O5AB 1HCGA 2UWLA 1OWIA 2Z9JA 1AY6H 2ALVA 1Z1JA 1QL7A 1DFPA 4JZDH 7ESTE 1ZJKA 2Y5HA 1ZHPA 1YPKH 1QL8A 2P3UB 5F03A 2F9PA 2FXRA 8GCHG 2A45B 5I25A 3HKIB 2LIZA 2PGQB 3U8OH 2CN0H 3ZVCA 2ZHWH 4H42U 2XTTB 3QUMP 2OD3B 3RU4D 3ZZ7A 2BD3A 3SGBE 1FJSA 3E1XB 4H6SB 2AERH 4CRAA 1K9OE 5J4SA 1MKWH 3EE0B 1ESBA 5DP7A 1T31A 1T8NA 3LGTA 2TBSA 3BTWE 1V2KT 3URDA 1EAUA 1C2HA 1SGNE 2BTCE 1UTNA 1NFXA 3TNSA 3S0NA 4CRFA 2Q6GA 1NU9A 3RXAA 3VXEH 3KN2A 1A5HA 1GHBF 1V2LT 4I32A 2ANMH 4O3UA 1ELVA 1XM1A 1AIXH 2PW8H 2CGAA 4LK4A 2XBXA 1Q31A 3FVFB 2FYRA 4K1SA 1DWDH 4A1XA 3FP6E 3RXUA 4UONA 1TABE 4ZKNU 3SV8A 4B2CA 3OTJE 2ZF0H 1HXEH 1NFWA 3SJIA 1CQQA 1JXPA 4FUHA 3QTVH 4MVNA 2ZCHP 1KYNA 1GL0E 3P95A 1K1PA 5HGGA 1GI5A 1K21H 2OC8A 3P8NA 1A2CH 4MPVA 1S0QA 3ZZ4A 3P8FA 1C1NA 3B23B 1H1BA 1EB1H 4YLUA 4A1TA 3LONA 3OYPA 3PO1C 4U32A 2KAIA 2FX6A 1UHBB 3A88A 1TRYA 2JETB 1ZMLA 4U2WA 2XCFA 3PWBA 2RG3A 2NWNA 2A0QB 4Z6AH 4GCHG 1OWKA 1F5LA 1OWDA 3HPTB 1ELDE 1ELTA 1XXDA 2ZGBH 4NGAH 1CA0B 3UOPA 2GX4A 1BRUP 1TIOA 2J4IA 3UNSA 1GMDF 3MYWA 4DJZB 3D65E 1DOJA 1O34A 5LGOA 1P05A 4I8HA 2Y7ZA 1G3CA 1W0YH 1XMNB 3MNBA 3NKKA 5A8ZA 2VVUA 2LNCA 2JH5D 1KIGH 1L2EA 3CS7A 3HATH 3UY9A 1CE5A 1C1WH 5LPRA 3E0NB 3KF2A 1BJUA 1CHGA 3E0PB 4Y7AA 4JYUH 3ATKA 1N1LA 3MU5A 2ESTE 3NPSA 1XUFA 5DP6A 5E2OA 2V3OH 1MKXK 2ZA5A 1TQ0B 1J17T 1C2EA 4RKJB 3RU4E 4ZKRU 8LPRA 2GT8A 4NSYA 3SOSA 3BG4B 3E8LA 5A8YA 1H9LB 3VB7A 2BYAX 2BZ6H 2F9BH 2B8OH 1O2IA 5E2PA 1GI8B 1G3DA 1EOJA 1FY8E 3SU1A 4MPXA 1N8OC 4HFPB 3LC5A 3Q3XA 1IQGA 2PKAA 2PUXB 1OWJA 2A32A 2NU3E 4FUFA 5IYTA 2AIPA 1DT2A 1MTVA 3VB5A 1D3DB 2GMTC 1YYY1 2VWNA 1DUEA 1O2JA 4PROA 1O2HA 3KQBA 5T3HA 1WSSH 1XUHA 1CT4E 1EJMA 4A7IB 2FZZA 1ZPCA 1CT0E 3MOCA 1Z8IB 1V2JT 2ZG0H 3WY8A 1HDTH 1J9CH 3TITA 4OGYA 2ANKH 3R3GB 3ZVAA 5E0HA 1O31A 3LT3A 3A7ZA 5EGMA 2I6QA 1AVGH 3U1JB 1A0JA 3NZIA 5FCKA 1ZMNA 1FY1A 1GGDC 1O2VA 1LVBA 3ZZ8A 3FZDA 1HYLA 3ZVDA 2OC0A 3GCOA 1W7GH 1CHOG 2ZZUH 1LHFH 2UWPA 1ELAA 2P8OB 1KLIH 1L1GA 1F0RA 1AB9C 2W7SA 2J92A 5C67A 5TCAA 2ZO3H 4YESB 1P04A 4H6TA 4GVUA 1MD7A 1O36A 3RXHA 4GHTA 1C2LA 2BLWA 4YOJA 3TNTA 3S9CA 1WQVH 1SQTA 2D8WA 1AKSB 1DICA 5C20A 1ANDA 4CRBA 1GMCF 2TPIZ 3MU1A 2GT7A 1PPGE 1Q2WA 4TY6A 3SJ9A 3SU3A 5CHAC 1NU7B 2B7DH 2FX4A 4AG2A 1MU8B 1NM6A 1L1JA 2QXJA 4NG9H 1ARBA 1ZRKA 1FIZA 2FOCA 1LKBA 8GCHF 2H9EH 1C2DA 4AFSA 3NWUA 4ABGA 1P2KA 3TGKE 2ZECA 1ELCA 4I8GA 1JMOH 2J38A 2XW9A 4TY7A 1C5UA 5IDKA 2Z3DA 2QXGA 1ZRBA 1IQEA 1QJ7B 2B5TB 4WY3A 1S6HA 4U30A 1NRNH 2BQWB 3BTTE 1DY8A 3RXSA 1SC8U 3LOXA 3AW1A 2VIVA 1KXAA 4D9QA 1BHXB 2H5DA 1C5QA 2WV5A 1O3GA 1IOEA 1GJAB 1GHXH 1LVYA 3P92A 1W2KH 3SGQE 2BY6X 2ZFRH 2Z9GA 2J2UA 2A5AA 1SGFG 1GCTB 2SGPE 2XWBI 4M7GA 3HGPA 2FPZA 3S7HB 1YPHE 1SQOA 1VCPA 2WUBA 3GCTF 1SLVB 3U1IB 2O8WA 4FUGA 2B0FA 2BX3A 1TNKA 3SUFA 2FOEA 4E7NA 1ELGA 1W7XH 4ABDA 1BRBE 1O5DH 2A7HA 2FTMA 2TGAA 1BTYA 2FLRH 2C4FH 3M5NA 2HNTE 5FX5A 3SU5A 1IQFA 2NU4E 1CBWC 2BD7A 5C1YA 1TALA 1O2GH 2ZFQH 3VXFH 6GCHF 2VGCC 3SU0A 2WV4A 1HAOH 4BAMB 4HTCH 4NIVA 1C1VH 3Q3YA 4HI3A 1PYTD 1K1MA 1P2JA 2QV1A 2XYAA 3UIRA 2C3SA 3A83A 4TYDA 1OYTH 3LH3A 2ZHFH 1XUJA 1Z6EA 1V6DA 1C1TA 2ALPA 2G4TA 1OSSA 3IITA 3Q76A 1C2MA 4ISNA 2BX4A 5C5NA 2QF0A 4AGKA 2CHAC 4WMDA 5A0BA 1AZZA 1C5NH 1D3PB 4OS6A 3SW2B 1F92A 3M7TA 3KHVA 1GVZA 1GI3A 4AB9A 1GJ5H 3SNDA 1GBDA 1ZTJA 1C5LH 2Z9KA 4K8YA 4BXSA 1TPAE 1TE0A 1KDQA 2QY0B 3L6PA 1IQLA 3EGKH 3RXTA 1C4V2 5C1XA 1O3JA 1TOMH 3RXIA 3RDZA 3QWCH 4WF8A 5I46H 4MNWA 2ZDNA 1JIRA 3U98H 3SV6A 1UK2A 2Z3EA 1A4WH 1DSTA 1LHGH 1QRWA 1CBWB 2R9PA 3LGVA 3ZZAA 1C9TA 1KTTB 3QZRA 1O3MA 3W95A 5EXLA 1AFQB 1PPCE 2ZNKH 3L3TA 1FQ3A 2HPQH 4ISIH 1KDQB 3UNRA 1VGCC 2SFAA 4BOHA 3EA7A 2G51A 1HAGE 1NPMA 2K7XA 3NUMA 1WOFA 1SLXB 3U69H 1ZTLA 1ZJDA 1A3BH 5FCRA 3RXMA 1B5GH 3OY5U 4ZKSU 2ZGJA 1A7SA 1AU8A 5BRRE 3V12A 5FAHA 1T32A 2UUYA 4VGCB 3A8DA 6LPRA 1BIOA 3K9XB 1MQ5A 1TPPA 2A4QA 4ABEA 1B0EA 2G8TA 2ZGHA 1CU1A 5A09A 1C2FA 3GYLB 2FOGA 3PMBB 3RM2H 1CGIE 1VZQH 3UOUA 3ZV9A 1G9IE 4Y0YE 2XBVA 1MKWK 8ESTE 1PFXC 1TMUH 1UK4A 1GI6A 2VWLA 3TJVA 3A87A 3ZVFA 3C1KA 2BDHA 2TGPZ 3LGIA 1F0SA 1QCPA 1HJAB 2BY8X 3MMGA 5PTPA 5C3NA 1ZGIA 5JBTA 1QURH 1SL3A 1ZYOA 3BTDE 5FX6A 3MNXA 2F91A 4K1EA 1G32B 1PQAA 1T7CA 3STJA 2PUQH 4WH6A 1KLJH 1C5ZB 2EI8A 3MH4A 4AYVB 3ATMA 3HGNA 4CR5A 4THNH 2B9LA 3SV2H 5F8TA 3D62A 1GI4A 1GJ9B 2VIOA 4NWLA 2ZU4A 3ZZ6A 3UFAA 1CA0C 1LPGB 1C1OA 3V7TA 1MZDA 1YCPK 1FUJA 2QA9E 3SNCA 2EI7A 3T2NA 4K8BA 4E05H 1SGCA 2ZU5A 3ZVGA 2OXSA 2AEIH 2VJ1A 4IMQA 3BF6H 3S7KB 1EAIA 1EPTB 1TGBA 1O30A 1FAKH 1XXFA 5JB8S 2GCHG 3MH5A 2VNTA 5FBEA 3QN7A 2XC5A 3GISB 4NSVA 1Y3XA 1C1RA 3E16B 1P12E 1H9IE 1SR5C 1O3AA 1SGDE 1Y3VA 2VU8E 1XKAC 5DKMA 1T8LA 2ZGCA 1LPKB 1ZHMA 4XBDA 3BTGE 3E91A 3N7OA 3RXLA 1IQHA 3SJ8A 1FMGA 4ZXYH 1A0HB 1KXEA 2QAAA 1HNEE 1C9PA 4YTAA 2FYQA 4BTIB 2GCHF 3MU8A 1BDAA 3DD2H 2DUCA 4IN2A 4D9RA 4NZLA 4X1NU 4INHA 1V2MT 2HVXA 1UTJA 1GI1A 3CS0A 4XE4A 5AHGH 1QGFA 1EPTC 1AFEH 1UTPA 3GCNA 5GDSH 1TLDA 1UTKA 1VCWA 1ZGVA 3U8RH 3SQEE 2Y80A 3KNXA 4INLA 4Y8XA 3RXVA 1P8VC 4AORA 1XVMA 3T26A 4Q80A 7GCHG 1GG6C 4FUJA 2I6SA 1Y5AT 1GBBA 3MO3A 4KP0A 4UD9H 1ORFA 1GBFA 1O2XA 1QB1A 1GJ6A 1FN6A 1Y3YA 4FU8A 3TH4H 4ABJA 4CH2B 1GMHF 1YPMH 7LPRA 1RGQA 1TNJA 2PLXA 3CENA 1W13U 1XX9A 4FU7A 1TPSA 3TJOA 1GDNA 3P8OA 1BMNH 3H5CB 4XSKU 5ESTE 1O3CA 3ZZ5A 3SV9A 1MAYA 1OYQA 1S81A 1FNIA 2QXHA 1UVTH 1MTUA 1BA8B 1HJAC 3QZQA 4B75A 4UE7H 5G4BA 1KXBA 2UUKB 3B8JA 3SNAA 1CSOE 5EPYA 1FN8A 1HJ8A 1VJAU 2SGDE 5EPNA 3STIA 1GI9B 4WMFA 2R3YA 3O8CA 5EQQA 4ABAA 1AWFH 2PTNA 2GD4B 1THPB 1FPHH 2GMTB 5C2ZA 1KXDA 2ZTZA 2G52A 3PO1B 4AN7A 1C5PA 1GBJA 1DY9A 1UTOA 2ZU3A 5J4QA 2P3FH 3JZ1B 2AYWA 3PB1E 4KKDA 1EP6A 3SJKA 1RXPA 1Q3XA 3VB4A 2G4UA 2W3KA 1CVWH 1YF4A 3SNBA 2AMPA 1RTFB 1V2ST 3SHCH 3FP7E 4KGAA 5E0JA 3LU9B 1DWBH 1YM0A 3EAJA 1OP0A 2ZFFH 2G5NA 5EU8A 1PPEE 1V2RT 4MTBA 3FAOA 4GUXA 4IS5A 1UK3A 4QT8C 1NRSH 4LZ4B 1UHBA 1DSUA 1AGJA 2NU0E 1WTHD 2AH4X 2BLOA 1NC6A 1OP8A 3LGYA 3RXDA 5CE1A 3GY2A 4FVBA 1C1PA 4AOQA 4IW4E 3DFLA 2M5TA 1K1LA 5HM9A 2TRMA 2F83A 3GY4A 2YOLA 5HXFA 1GHAG 2ZI2H 4Q2KA 1NN6A 1O3LA 2ZPRA 3LPRA 3T5FH 2BD8A 1D6RA 1PYTC 1AI8H 2BY7X 3A7TA 4MNXA 4AYYB 2OC1A 1TOCB 3VFEA 2GVFA 2J34A 4ABHA 3LIWA 1O5BB 4JZEH 4ZUHA 1YBWA 2ZCLP 2STAE 3HKJB 1AN1E 1EZSC 2BZAA 1O5CB 1QR3E 4ZHAA 3V13A 5LPEA 1K22H 2TGDA 3M5MA 1FY4A 2A7JA 4MQAA 2PGBB 1SOTA 2IN2A 4DGJA 5FBIA 4CBOA 2VIWA 4TPIZ 2FI4E 5AFYH 4CRGA 1EP5A 1ABIH 4MPWA 1YPHC 5JBAS 2XRCA 1HV7A 1GJ7B 3BTME 1MU6B 4AX9H 1O3DA 1L0ZA 3QX5H 2PKAB 4K1TA 2G81E 2ZDMA 3GY7A 1S6FA 1MTWA 4FVDA 4ZHMU 1OS8A 4BAHB 5T6GA 1DANH 2J9NA 1P9UA 3O8BA 3VEQB 3V3MA 5B6OA 1GBTA 2BVXH 1WUNH 2V0BA 1PPFE 4IMZA 1V2TT 2P59A 1Z8GA 5JYIA 3TLOA 1NFYA 5L2ZH 3SGAE 2FOBA 1GG6B 3QK1A 1UVOA 1MUEB 2HALA 5T6DA 2O8LA 4JK5A 3M3SA 1GBHA 1Z1IA 3BTQE 5A8XA 2ZU2A 1H8IH 1RS0A 1Y3UA 4X1PU 2BXTH 4D76A 4GHQA 1GBAA 4E7RG 3RXEA 1Y5BT 5GCHG 4AFUA 1J15A 2WPKS 1E36B 3KCGH 2BOKA 2FO9A 2OINA 2P93A 4DVAU 2C90B 4I8JA 1PJPA 4D7FA 1TX6A 2ZPQA 3A7YA 2GZ9A 1NTPA 1L4DA 3GY6A 1P2OA 3ESTA 3M3VA 1C1QA 4X6PA 1GWAA 5EODA 4AZ2B 4KTSA 3PYHA 1P3EA 2VIDA 4O3TA 9ESTA 3AVZA 1TAWA 2XC0A 1SHYA 1RJXB 4F49A 2BD9A 1HAYB 4NIXA 2H5CA 4ZH8A 1AO5A 2FESH 1F0UA 3BEIB 1MCTA 3PM3A 1ANBA 3OSYA 1UVUH 2PKSB 3UUZA 4ZMAH 1CHOF 4AFQA 2FEQH 3EDXB 1D9IA 4DG4A 3BIVH 4YLQH 1UTLM 1GMCG 1RTLA 1E38B 3ZZBA 1AVWA 1ZSLA 4RKOB 3T27A 2VGCB 5C1UA 1O3FA 2BDAA 1V2QT 3SI4H 1DE7H 4NFFA 4O9VA 1K1OA 3MNSA 1W3CA 4ZHLU 5FXLA 1YCPH 5A0AE 4XOJA 5K0HA 4DIIH 2BY5X 1MTNC 1QHRB 3T25A 2Z6BD 3UNQA 4X2VA 3VB3A 1EATA 1UCYE 2PFEA 4Y8ZA 3U9AH 4HGCA 3ZYDA 1P3CA 3D49H 1D6WA 1W10U 3JZ2B 2GV7A 1C5YB 1AE8H 1XUKA 4B1TA 2QGRA 1UO6A 4MPUA 2OQUA 1EAXA 3QGNB 3RXGA 4D8NA 1EKBB 1HB0B 1U6QA 3VB6A 1NFUA 3K6ZA 1O2KA 1EZXC 2OTVA 1AVXA 4Q7ZA 3AAUA 3O8DA 2J95A 4X8SH 3C27B 3F6UH 2YNBA 4YZUA 4X2XA 1LMWB 1BOQA 4JZ1A 1LKAA 2GGVB 1QFKH 2VH6A 4JZIA 2PR3A 1F7ZA 3BSQA 1JRSA 3Q00A 1O2NA 1X7AC 1EJAA 3ZV8A 2Y6TA 1JWTA 2VH0A 2C8XB 2WPJS 3SQHE 1P11E 1ZLRA 2FOHA 4R0IA 2AMDA 1ZZZA 2HRVA 3RXKA 2BHGA 1F5KU 3SNEA 2ZFSA 5F8XA 3NCLA 3M5LA 1G2MA 1HAVB 2W26A 1NO9H 3E3TA 4CREA 1EXFA 1TA6A 1QB9A 1K1JA 3ATIA 1BQYA 1HBTH 3F9GA 4WMEA 1HAHH 1T4VH 2FI5E 1ARCA 1UCYK 3BG4C 3PROA 3ELAH 3PWCA 2FMJA 4Q7YA 1SPJA 2Q1JA 1C2KA 3GCHB 4MNVA 4O03A 1RD3B 3BIUH 2V6NA 2GTBA 2JKHA 1DVAH 1GDQA 4BNRA 2A31A 3SORA 2C8ZB 4UFDH 4CHAC 1TWXB 5JBBS 4AFZA 2BDIA 5ABWA 1A46H 2GDEH 2FS8A 1ACBE 7GCHF 5L2YH 1QJ1B 2PHBA 2UWOA 4JZFH 1BMAA 3RC4A 3MFJA 4J2YB 3RXJA 3SN8A 1GHYH 2FI3E 2SGEE 3T62A 5JDUB 1WAYB 3TK5A 1M9UA 4DT7B 3TJUA 3RMOH 3KEEA 1O5GH 2QF3A 1O2UA 1ETTH 4DW2U 1BCUH 1OOKB 2VB0A 5EXNA 1LCYA 5T6FA 3TJNA 1GMHG 2J94A 2AGGX 1FI8A 1SGTA 3F9EA 1YPEH 2JETC 4KTUA 5H4IB 6ESTA 1FXYA 2PV9B 6GCHG 2VINA 1O2RA 2G55A 2AS9A 3GCHC 1DXPA 4LOYH 4I33A 5E0GA 3RC6A 4D7GA 5AVDA 3T29A 2A4GA 3TVJB 4OS2A 3SU6A 1TONA 4XBBA 4Y11E 4XDEA 5A0CA 4X1QU 3SU4A 2QC2A 1QRXA 1ANCA 1TGSZ 1V2NT 1N8OB 2CF8H 3GDVA 2QXIA 1NESE 2KAIB 1QL9A 2OCVB 5E8EH 1O32A 2R0KA 1AUJA 3QO6A 1V2UT 3HK3B 3B9FH 1VITF 1S5SA 1O2QA 2K1QA 3MU4A 1IQMA 1SGRE 2THFB 2WPIS 1SLWB 1O2ZA 3MNCA 1QA7A 2AGIX 3PLBA 1WU1A 4BAOB 1S84A 2FOFA 5FPSA 1PPBH 1SGFA 2AIQA 4TPYA 2Z9IA 3SUGA 1HRTH 1C5MD 3K2UA 1F2SE 2P16A 2CMYA 3GDUA 1HIAA 4JK6A 3A86A 4X8UH 3BTKE 1G3BA 3NK8A 1G37A 2A4RA 2Z9LA 1EAWA 2BDYA 4OGXA 3F1SB 3UREA 2RA0A 1W8BH 1PQ5A 3FFGA 3DFJA 1TGNA 1BUIA 1Y5UT 1AWHB 1UJ1A 1C5WB 1ESTA 3G01A 1EASA 5EG4A 2UUJB 2F9OA 1PQ7A 4WVPE 2IPHA 2IOTA 1SOZA 3M35A 2ZHQH 1KXCA 3ZYEA 2WPLS 2CV3A 4Y6DA 1FONA 3KQEA 3NXPA 4GLYA 1KSNA 3UPEA 4AGJA 3CP7A 2P94A 2RDLA 2RA3A 2H2ZA 2WYGA 4ZKOU 1OWEA 1HUTH 2BM2A 5L30H 1P0SH 4FUDA 1C1UH 2FP7B 2AMQA 1C5OH 1W14U 2P8OC 1B0FA 1C5XB 2W7UA 4ABIA 1G30B 4AB8A 1O3OA 1NRQH 1O2MA 1C4Y2 3MI4A 1J8AA 2BXUH 3BTHE 1BTPA 1GHZA 2OP9A 1GJDB 1T4UH 1TRMA 4ISHH 1CO7E 2PKSC 2BVRH 4BTUB 3BTFE 1HJ9A 1C1MA 1P2IA 1LHCH 4NA7A 4MNYA 1OWHA 2GDDA 3VGCB 1C5VA 3ZVEA 2Y5GA 2ZGXH 1DLEA 2A2QH 3F9HA 3KQDA 4BAQB 5DG6A 1GJBB 3UR6A 1LHEH 2NU1E 1L4ZA 4BTTB 4CBNA 1A5GH 1HPGA 3W94A 1B7XB 1P2QA 1O5EH 4F4OC 1DX5M 1P09A 1HAXB 1FIWA 4OS5A 2CXVA 1AQ7A 1QBVH 5GPIB 3S9AA 3UTUH 1SBWA 4DCDA 3SO3A 1TRNA 3S69A 3RU4T 5JB9S 3TGJE 1O2TA 2Y5FA 4FUCA 2ZDAH 1ZSKA 1BTXA 1MBMA 1AKSA 1IQNA 4MG3A 1UVSH 4Q7XA 1C5SA 1T8MA 1FZZA 3MO6A 5ESBA 5CMXH 1H8DH 1YPLH 2ANYA 2CHAB 1N6YA 2EA3A 2V35A 1LTOA 4ZXXH 2R2WU 2BD5A 3T28A 3TK6A 1G36A 1FLEE 4MDSA 1GHAF 3E6PH 1ZPBA 1P10A 1S83A 1SHHB 1D4PB 2XCNA 1QB6A 3M36A 3SJOA 1MQ6A 1FY3A 5LPFA 1AE5A 2QCYA 1AMHA 1ID5H 4IGDA 1V2OT 3LDXH 1P2MA 1BTWA 1DWEH 1C4U2 3M61U 5DP5A 1WQSA 2A5KA 2Q6FA 2STBE 2ZWLH 1F0TA 4X8VH 3ATWA 3RM0H 2EI6A 1Y8TA 6CHAC 3A7XA 2A1DB 1SGPE 1LO6A 3M37A 1GMDG 4NWKA 1NRPH 3ZZ9A 1IAUA 1S0RA 1P03A 1WBGB 1Z8JB 3A7WA 4K60A 4WXVA 4NCYA 2CF9H 2ZTXA 3K65B 3PMJA 1HAPH 1IQJA 2W5EA 1O3KA 1O3IA 1OP2A 1EB2A 4B71A 1E0FD 3LGUA 2GKVE 4YT6H 1KLTA 3SUEA 1C2GA 1CA8B 3IWMA 1GCTC 1MMJN 1A1RA 4XBCA 1OPHB 4JYVH 1RFNA 2HGTH 1MD8A 1GJ8B 1LVMA 1DDJA 5FPYA 2D1JA 2ODPA 1ELEE 4I8KA 1THRH 3FZZA 2ZFTA 5DJ7A 3D23A 1O3PB 1LDTT 2GCTB 3EYDA 1DWCH 1BBRE 4B76A 3FP8E 4NA8A 3RUOA 1MH0A 1UTMA 1BBRK 3UQOA 1VITG 3A8BA 2ZKSA 8KME2 2H9HA 2CJIA 3I29A 1C5RA 3Q77A 2HWLB
chains in the Genus database with same CATH superfamily
2R3UA 5FHTA 1MTSA 4B73A 2R0LA 2SNWA 3MHWU 2GV6A 1K1IA 2SGQE 3LJOA 5DPAA 4YOGA 1O2LA 1VJ9U 5HIYA 3RXOA 2ZDKA 5GCHF 3ATLA 4ZROA 2XXLA 4Y0ZE 2H6MA 3RMNH 5CHAB 4Q4LA 4UFGH 2BD4A 4Y71A 3M7QA 1BT7A 1QZ8A 3SV7A 3BTEE 4K69A 2ZC9H 4OS4A 1YLCA 4NZQA 5AFZH 3SI3H 1YLNA 1EUFA 2Y7XA 1HAIH 1Z7KA 3ODDA 3Q3KA 1EZQA 1GJ4H 1O3EA 3MTYA 1KTSB 2RCEA 3BN9A 1UTQA 3SZNA 3PTNA 1TA2A 4JMYA 2GCTC 3OU0A 4X1RU 1E37B 3ZZ3A 4WXIA 1O3BA 2BDCA 4NFEA 2C8YB 1SI5H 1C2IA 1SGIB 3M7UA 4Y7BA 1UCYH 4HZHA 4FUBA 2ZDLA 5EOKA 1P57B 4YM9A 3W1EA 1YKTA 2V7QD 5DP9A 3GY8A 3RXQA 1O0DH 3DSOA 2W3IA 5EQRA 4DIHH 2V3HH 4AG1A 4A6LA 4CR9A 2ZDVH 3AAVA 2Z3CA 3M3TA 1DUAA 2BDGA 1EX3A 1SG8B 3V0XA 3MU0A 2BOHB 4X2WA 1EOLA 2ZEBA 1GBLA 1NS3A 3MH6A 3RMMH 4DOQA 1N6XA 1BMFD 4JCNA 1AZ8A 1BRCE 1DM4B 1SQRA 2HOBA 1HFDA 4TWYA 1TMTH 1VGCB 3ZVBA 1GL1A 2FS9A 4XD7D 1RTKA 4DURA 2LPRA 2EC9H 3A80A 2SGFE 2ZIQH 1GBMA 2VIQA 3A82A 5HMAA 1DPOA 2VIPA 1TMBH 1K28D 5HKKD 1QNJA 3RXRA 7KMEH 3GY5A 1SGQE 2ZQ2A 5JBCS 2YMSC 2ZHDA 4ZAEA 4AC9A 1PPHE 1IQKA 1EQ9A 2F9NA 1QIXB 4WH8A 5EQSA 4UFFH 4YOIA 1EPTA 5GIBA 3UB0A 2QN5T 4J1YA 1J16A 1ETRH 3P6ZB 1V2WT 1S85A 2OBQA 3PLPA 5KEDA 5HM2A 4OS7A 1BB0B 3UWIA 5DO4H 2R2MB 1WTGH 3F9FA 1BTHH 4XFQA 4WWYA 1GI7B 2NU2E 1ELBA 1K1NA 1YP9A 1O3NA 2PSXA 4I31A 1QJ6B 3GDSA 4GAWA 3F68H 2JH6D 1P06A 2DE8A 1P02A 1Z8RA 4E06H 1GVLA 1LHDH 3A81A 1A61H 1ETSH 4O97A 4B6FA 1YGCH 3RXPA 1NROH 1WCZA 2QF4A 3EBNA 1E34B 3RP2A 3UR9A 5A2MH 2VWMA 3VPKA 5GXPA 4A5TS 4YO9A 1FY5A 1GBKA 1JIMA 2PTCE 3RLYH 3KIDU 3RMLH 1O33A 1O37A 2WYJA 1ZR0A 2O8TA 1BHXF 1UMAH 4H4FA 2VWOA 5C5OA 3LH1A 1O39A 1SGYE 3L33A 2C93B 2ZU1A 3KGPA 3QLPH 1SSXA 4UEHH 1OX1A 3OFND 1GHWH 2O8UA 1IHTH 2G5VA 4R8TB 4CRCA 3EQ0H 1TNIA 2SGAA 2UUFB 4FXGH 1BRAA 1OKXA 1EJNA 2HLDD 2ASUB 2G00A 1EZUC 4CRDA 2IJOB 4X6NA 1RIWC 1L1NA 1TX7A 5BPEA 2D2DA 1QA0A 1TBZH 1AD8H 3PMAB 4ISOA 4FUEA 1GBCA 2HPPH 1O2SA 2FWWA 3KL6A 3GCTG 1GVKB 4I8LA 2F9VA 1HXFH 2GP9B 3I77A 1CT2E 1OXGA 1TNGA 4LXBH 2KCYA 1G2LA 1C2JA 1MKXH 2A2XH 3RLWH 3U8TH 1MTNB 1S6LA 3EA9A 3DA9B 2BY9X 1NRRH 1ZMJA 4NIWA 3QTOH 1Y59T 2BDBA 3BEFB 1P2NA 1QTFA 4SGAE 2ZCKP 5KECA 2OQ5A 4GPGA 2H9TH 2PSYA 2H1UA 2C8WB 1TGTA 5TCCA 1TNHA 1FV9A 1TFXA 1W0ZU 3VGCC 2XC4A 3GOVB 3OAAD 1TYNA 1QQ4A 4B2BA 3ENSB 4ASUD 1P9SA 2A5IA 2KR7A 1SB1H 1YCPM 3F0PA 4Y76A 2AGEX 3PV4A 2WPHS 2ZTYA 2FTLE 2VVVA 2QYIA 2ILNA 4K2YA 2VVCA 4OS1A 1XUGA 1YPGH 5JPMH 1FPCH 3RXBA 3TU7H 5TJXA 1O5FH 4UDWH 1HAVA 1BJVA 4K3JA 1IHSH 1YPJH 3SHAH 1BBRH 1V3XA 1KXFA 2WINI 2BD2A 1QY6A 2O8MA 2XWAA 3RC5A 2BLVA 2GZ8A 2WPMS 1HLTH 5AF9H 3DUXH 2Y81A 1ZPZA 3LJJA 2HNTF 3A8CA 5HYOA 2PWXA 2XNIA 4A92A 2XBWA 2BVSH 1GI2A 1O2OA 4ABBA 3TK9A 1A0LA 2IJD1 3FANA 2HNTC 4CH8B 1AHTH 1SVPA 4IN1A 3A8AA 1XKBC 2BQ7B 4SGBE 1LQEA 2ZP0H 1O3HA 1VCQA 1SGEE 2BMGB 4IC6A 1GJCB 1GGDB 1LQDB 2ZHEH 2P95A 5DGJA 2KFWA 2YMSD 5DK1A 3PMHB 1GBIA 3EA8A 1KY9A 1ANEA 1BITA 1BTUA 1LPZB 4X2YA 2DE9A 1E35B 2P3TB 3OY6U 4Y8YA 1QRZA 1BMLA 3MWIU 4FUIA 1TPOA 5DP4A 1J14A 5LH8A 4KTCA 1GPZA 4RSPA 5F8ZA 3UWJH 3PV5A 1O2WA 3GY3A 3TH2H 4X6OA 1QBNA 1V2PT 6CHAB 1O35A 4I7YH 1QQUA 1ABJH 2Q6DA 1XUIA 1TNLA 2ULLA 3BG8A 1TBQH 4INKA 5SGAE 2AFQB 1INCA 1GCDA 1CGJE 4ABFA 4ASHA 4K5ZA 3E90B 1TBRH 2FOAA 1BTZA 4B74A 2ODQA 1D3TB 5ETXA 1RIWB 5EW1H 1HGTH 2BB4A 3URCA 1BZXE 3A7VA 4X0WU 5DP3A 1ZHRA 3DCLA 2SNVA 1Y3WA 1K2I1 3CNRA 3TPIZ 1A5IA 4YT7H 1TGCA 4B2AA 1SQAA 1O38A 1AB9B 1T8OA 1VITH 1MAXA 3ZZDA 2QIQA 3MO9A 1HIAB 4BAKB 2FDAA 1MCVA 5GJ4B 1GDUA 2ZQ1A 1ZOMA 1C5TA 4Y10E 2O9QA 2TIOA 5L6NH 2JH0D 2W6ID 5F6MA 1JBUH 3BV9B 3MH7A 3LKWA 1NZQH 3H7TA 4KELA 3SBKA 1BMMH 1MBQA 3PTBA 4RT1A 3H7OA 4GSOA 3F2HA 3P8GA 1LVOA 5HIZA 5FPTA 1YC0A 2ZPSA 1SFIA 2WUCA 2HLCA 3BEUA 3QGJA 3A85A 4CHAB 3IG6B 4FU9A 3HK6B 4UFEH 2VBCA 3ITIA 3GICB 4X6MA 2BLQA 2KCAA 3GYMA 3RXCA 1H9HE 2OC7A 2D26C 5F53A 3DT0H 5DP8A 1H4WA 5EW2H 1GHVH 3TIUA 4ESTE 1RRKA 2Z94A 1SMFE 1O2YA 3N7EA 3ZZCA 1DS2E 3I78A 1JRTA 2FM2A 2YMSB 1A3EH 1ESAA 3QDZB 2OUAA 1VR1H 2ZFPH 1UVPA 2FOMB 3A84A 5K7RA 4JYTA 4MLFB 4X8TH 3AW0A 1Z71A 3RXFA 1WYKA 4DY7B 1TB6H 2F4LA 1THSH 3LC3A 3TH3H 5GWZA 4GCHF 1C1SA 1WV7H 4X1SU 2ANWA 3K6YA 4NA9H 2FLBH 2ODYB 1NT1A 5EXMA 3S9BA 9LPRA 1QBOA 1PPZA 4Y79A 2F9UA 1AFQC 3LGWA 1DXWA 4IC5A 3TGIE 1JOUB 3ODFA 1EFRD 4TWWA 4BANB 2XBYA 1SLUB 1YLDA 2BQ6B 1F5RA 4WJG2 4Z0KA 3DHKH 1W12U 4RN6A 1O2PA 1CGHA 1SFQB 2OLGA 2A7CA 1DITH 3M5OA 1W11U 1ZSJA 1HAZB 3P17H 1GHBG 3KQCA 1TQ7B 2FIRH 3R0FA 3SUDA 3SU2A 1PQ8A 2EEKA 1ELFA 2A4OA 1MZAA 1V2VT 1G3EA 2F3CE 4LZ1H 1XVOA 1DLKB 1IQIA 1S82A 3OX7U 3H09A 3P70B 2YNAA 1P01A 1GBEA 1D3QB 3O8RA 1ZTKA 4IBLH 4NIYA 1GI0A 2FODA 1TX8A 3UQVA 4U01A 1FDPA 2OBOA 1FAXA 3A89A 4VGCC 4A1VA 2Z7FE 3AASA 1Z6JH 4BXWA 1AUTC 4ISLA 2Y82A 1NY22 2TGTA 2GZ7A 3PLKA 1O5AB 1HCGA 2UWLA 1OWIA 2Z9JA 1AY6H 2ALVA 1Z1JA 1QL7A 1DFPA 4JZDH 7ESTE 1ZJKA 2Y5HA 1ZHPA 1YPKH 1QL8A 2P3UB 5F03A 2F9PA 2FXRA 8GCHG 2A45B 5I25A 3HKIB 2LIZA 2PGQB 3U8OH 2CN0H 3ZVCA 2ZHWH 4H42U 2XTTB 3QUMP 2OD3B 3RU4D 3ZZ7A 2BD3A 3GS9A 3SGBE 1FJSA 3E1XB 4H6SB 2AERH 4CRAA 1MABB 1K9OE 5J4SA 1MKWH 3EE0B 1ESBA 5DP7A 1T31A 1T8NA 3LGTA 2TBSA 3BTWE 1V2KT 3URDA 1EAUA 1C2HA 1SGNE 2BTCE 1UTNA 1NFXA 3TNSA 3S0NA 4CRFA 2Q6GA 1NU9A 3RXAA 3VXEH 3KN2A 1A5HA 1GHBF 1V2LT 4I32A 2ANMH 4O3UA 1ELVA 1XM1A 3OEHD 1AIXH 2PW8H 2CGAA 4LK4A 2XBXA 1Q31A 3FVFB 2FYRA 4K1SA 1DWDH 4A1XA 3FP6E 4OM9A 3RXUA 4UONA 1TABE 4ZKNU 3SV8A 4B2CA 3OTJE 2ZF0H 1HXEH 1OHHD 1NFWA 3SJIA 1CQQA 1JXPA 4FUHA 3QTVH 4MVNA 2ZCHP 1KYNA 1GL0E 3P95A 1K1PA 5HGGA 1GI5A 1K21H 2OC8A 3P8NA 1A2CH 4MPVA 1S0QA 3ZZ4A 3P8FA 1C1NA 3B23B 1H1BA 1EB1H 4YLUA 4A1TA 3LONA 3OYPA 3PO1C 4U32A 2KAIA 2FX6A 1UHBB 3A88A 1TRYA 2JETB 1ZMLA 4U2WA 2XCFA 3PWBA 2RG3A 2NWNA 2A0QB 4Z6AH 4GCHG 1OWKA 1F5LA 1OWDA 3HPTB 1ELDE 1ELTA 1XXDA 2ZGBH 4NGAH 1CA0B 3UOPA 2GX4A 1BRUP 1TIOA 2J4IA 3UNSA 1GMDF 3MYWA 4DJZB 3D65E 1DOJA 1O34A 2J97A 1P05A 4I8HA 2Y7ZA 5LGOA 1G3CA 1W0YH 1XMNB 3MNBA 3NKKA 5A8ZA 2VVUA 2LNCA 2JH5D 1KIGH 1L2EA 3CS7A 3HATH 3UY9A 1CE5A 1C1WH 2KZ4A 3E0NB 5LPRA 3KF2A 1BJUA 1CHGA 3E0PB 4B6EA 4Y7AA 4JYUH 3ATKA 1N1LA 3MU5A 2ESTE 3NPSA 1XUFA 5DP6A 5E2OA 2V3OH 1MKXK 2ZA5A 1TQ0B 1J17T 1C2EA 4RKJB 3RU4E 5DN6D 4ZKRU 8LPRA 2GT8A 4NSYA 3SOSA 3BG4B 3E8LA 5A8YA 4Z1MD 1H9LB 3VB7A 2BYAX 2BZ6H 2F9BH 2B8OH 1O2IA 4HG6A 5E2PA 1GI8B 1G3DA 1EOJA 1FY8E 5CDFE 3SU1A 4MPXA 1N8OC 4HFPB 3LC5A 3Q3XA 1IQGA 2PKAA 2PUXB 1OWJA 2A32A 3F2FA 2NU3E 4FUFA 5IYTA 2AIPA 1DT2A 1MTVA 3VB5A 1D3DB 2GMTC 1YYY1 2VWNA 1DUEA 1O2JA 4PROA 1O2HA 3KQBA 5T3HA 1WSSH 1XUHA 1CT4E 1EJMA 4A7IB 2FZZA 1ZPCA 1CT0E 3MOCA 1Z8IB 1V2JT 2JJ2D 2ZG0H 3WY8A 1HDTH 1J9CH 3TITA 4OGYA 2ANKH 3R3GB 3ZVAA 5E0HA 1O31A 3LT3A 3A7ZA 5EGMA 2I6QA 1AVGH 3U1JB 1A0JA 3NZIA 2LELA 5FCKA 1ZMNA 1FY1A 1GGDC 1O2VA 1LVBA 1VKYA 3ZZ8A 3FZDA 1HYLA 3ZVDA 2OC0A 3GCOA 1W7GH 1CHOG 2ZZUH 4RI0A 1LHFH 5DSFA 2UWPA 1ELAA 2P8OB 2F43B 1KLIH 1L1GA 1F0RA 1AB9C 2W7SA 2J92A 5C67A 5TCAA 4ACBA 2ZO3H 4YESB 1P04A 4H6TA 4GVUA 1MD7A 1O36A 3RXHA 4GHTA 1C2LA 2BLWA 4YOJA 3TNTA 3S9CA 1WQVH 1SQTA 2D8WA 1AKSB 1DICA 5C20A 1ANDA 4CRBA 1GMCF 2TPIZ 3MU1A 2GT7A 1PPGE 3ZIAD 1Q2WA 4TY6A 3SJ9A 3SU3A 5CHAC 1NU7B 2B7DH 2FX4A 4AG2A 1MU8B 1NM6A 1L1JA 2QXJA 4NG9H 1ARBA 1ZRKA 1FIZA 2FOCA 1LKBA 8GCHF 2H9EH 1C2DA 4AFSA 2WPDD 3NWUA 4ABGA 1P2KA 3TGKE 2ZECA 1ELCA 3VG8A 4I8GA 1JMOH 2J38A 2XW9A 4TY7A 1C5UA 5IDKA 2Z3DA 2QXGA 1ZRBA 4TT3D 1IQEA 1QJ7B 2B5TB 4WY3A 1S6HA 4U30A 1NRNH 2BQWB 3BTTE 1DY8A 3RXSA 1SC8U 3LOXA 3AW1A 2VIVA 1KXAA 4D9QA 1BHXB 2H5DA 1C5QA 2WV5A 1O3GA 1IOEA 1GJAB 1GHXH 1LVYA 3P92A 1W2KH 3SGQE 2BY6X 2ZFRH 2Z9GA 2J2UA 2A5AA 1SGFG 1GCTB 2SGPE 2XWBI 4M7GA 3HGPA 2FPZA 3S7HB 1YPHE 1SQOA 1VCPA 2WUBA 3GCTF 1SLVB 3U1IB 2O8WA 4FUGA 2B0FA 2BX3A 1TNKA 3SUFA 2FOEA 4E7NA 1ELGA 1W7XH 4ABDA 1BRBE 1O5DH 2A7HA 2FTMA 2TGAA 1BTYA 2FLRH 2C4FH 3M5NA 2HNTE 5FX5A 3SU5A 1IQFA 2NU4E 1CBWC 2BD7A 5C1YA 1TALA 1O2GH 2ZFQH 3VXFH 6GCHF 2JDID 2VGCC 3SU0A 2WV4A 1HAOH 4BAMB 4HTCH 4NIVA 1C1VH 3Q3YA 4HI3A 1PYTD 3SYJA 1K1MA 1P2JA 1COWD 2QV1A 2XYAA 3UIRA 2C3SA 3A83A 4TYDA 1OYTH 3LH3A 2ZHFH 1XUJA 1Z6EA 1V6DA 1C1TA 2ALPA 2G4TA 1OSSA 3IITA 3Q76A 1C2MA 4ISNA 2BX4A 5C5NA 2QF0A 4AGKA 2CHAC 4WMDA 5A0BA 1AZZA 1C5NH 1D3PB 4OS6A 3SW2B 1F92A 3FO8D 3M7TA 3KHVA 1GVZA 1GI3A 4AB9A 1GJ5H 3SNDA 1GBDA 1ZTJA 1C5LH 2Z9KA 4K8YA 4BXSA 1TPAE 1TE0A 1KDQA 2QY0B 3L6PA 1IQLA 3EGKH 3RXTA 1C4V2 5C1XA 3PV2A 1O3JA 1TOMH 3RXIA 3RDZA 3QWCH 4WF8A 3WWBA 5I46H 4MNWA 2ZDNA 1JIRA 3U98H 2KCOA 1UK2A 3SV6A 2Z3EA 1A4WH 1DSTA 1LHGH 2HVYB 1QRWA 1CBWB 2R9PA 3LGVA 3ZZAA 1C9TA 1KTTB 3QZRA 1O3MA 3W95A 5EXLA 1AFQB 1PPCE 2ZNKH 3L3TA 2EY4C 1FQ3A 2HPQH 4ISIH 1KDQB 3UNRA 4ZCNA 1VGCC 2SFAA 4BOHA 3EA7A 2G51A 1HAGE 1NPMA 2K7XA 3NUMA 1WOFA 1SLXB 3U69H 1ZTLA 1ZJDA 1A3BH 5FCRA 3RXMA 1B5GH 3N99A 3OY5U 4ZKSU 2ZGJA 1A7SA 1AU8A 5BRRE 3V12A 5FAHA 1T32A 2UUYA 4VGCB 3A8DA 6LPRA 1BIOA 3K9XB 1MQ5A 2K0QA 1TPPA 2A4QA 2J98A 4ABEA 1B0EA 2G8TA 2V3MA 2ZGHA 1CU1A 5A09A 1C2FA 3GYLB 2FOGA 3PMBB 3RM2H 1CGIE 1VZQH 3UOUA 3ZV9A 1G9IE 4Y0YE 2XBVA 3N7DA 1MKWK 8ESTE 1PFXC 1TMUH 1E1QD 1UK4A 1GI6A 2VWLA 3TJVA 3A87A 3WW7A 3C1KA 3ZVFA 2BDHA 2TGPZ 3LGIA 1F0SA 1QCPA 1HJAB 2BY8X 3MMGA 5PTPA 5C3NA 1ZGIA 5JBTA 3NRLA 1QURH 1SL3A 1ZYOA 2J98B 3BTDE 5FX6A 3MNXA 2F91A 4K1EA 1G32B 1PQAA 1T7CA 3STJA 2PUQH 4FETA 4WH6A 1KLJH 1C5ZB 2EI8A 3MH4A 4AYVB 3ATMA 3HGNA 4CR5A 4THNH 2B9LA 3SV2H 5F8TA 3D62A 1GI4A 1GJ9B 2VIOA 4NWLA 2ZU4A 3ZZ6A 3UFAA 1CA0C 1LPGB 1C1OA 3V7TA 1MZDA 1YCPK 1FUJA 2QA9E 3SNCA 2EI7A 3T2NA 4K8BA 4E05H 1SGCA 2ZU5A 3ZVGA 2OXSA 2AEIH 3OE7D 4P02A 2VJ1A 4IMQA 3BF6H 3S7KB 1EAIA 1EPTB 1TGBA 1O30A 1FAKH 1XXFA 5JB8S 2GCHG 2AHME 3MH5A 2VNTA 5FBEA 3QN7A 1H8ED 2XC5A 3GISB 4NSVA 1Y3XA 1C1RA 3E16B 1P12E 1H9IE 1SR5C 5C94A 1O3AA 1SGDE 1Y3VA 2VU8E 1XKAC 5DKMA 1T8LA 2ZGCA 1LPKB 1ZHMA 4XBDA 3BTGE 3E91A 3N7OA 3RXLA 3EE7A 1IQHA 3SJ8A 1FMGA 4ZXYH 1A0HB 1KXEA 2QAAA 1HNEE 1YY3A 5FL7D 1C9PA 3DSGA 3SZEA 4YTAA 2FYQA 4BTIB 2GCHF 3MU8A 1BDAA 3DD2H 2DUCA 4IN2A 4D9RA 4NZLA 4X1NU 4INHA 1V2MT 2HVXA 1UTJA 1GI1A 3CS0A 4XE4A 2KX4A 2L74A 5AHGH 1QGFA 1EPTC 1AFEH 1UTPA 3GCNA 5GDSH 1TLDA 1UTKA 1VCWA 1ZGVA 3U8RH 3SQEE 2Y80A 3KNXA 4INLA 4Y8XA 3RXVA 1P8VC 2L6OA 4AORA 1XVMA 3T26A 4Q80A 7GCHG 1GG6C 4FUJA 2I6SA 5EJ1A 1Y5AT 1GBBA 2M2AA 3MO3A 4KP0A 4UD9H 1ORFA 1GBFA 1O2XA 1QB1A 1GJ6A 1FN6A 1Y3YA 4FU8A 3TH4H 4ABJA 4CH2B 3F0OA 1GMHF 1YPMH 7LPRA 1RGQA 1TNJA 1UW7A 2PLXA 3CENA 5EJZA 1W13U 1XX9A 4FU7A 1TPSA 3TJOA 1GDNA 3P8OA 1BMNH 3H5CB 4XSKU 5ESTE 1O3CA 3ZZ5A 3SV9A 1MAYA 1OYQA 1S81A 1FNIA 2QXHA 1UVTH 1MTUA 1BA8B 1HJAC 3QZQA 4B75A 4UE7H 5G4BA 1KXBA 2UUKB 3B8JA 3SNAA 1CSOE 5EPYA 1FN8A 1HJ8A 1VJAU 2SGDE 5EPNA 3STIA 3WWFA 1GI9B 4WMFA 2R3YA 3O8CA 5EQQA 4ABAA 1AWFH 2PTNA 2GD4B 1THPB 1FPHH 2GMTB 5C2ZA 1KXDA 2ZTZA 2G52A 3PO1B 4AN7A 1C5PA 1GBJA 1DY9A 1UTOA 2ZU3A 5J4QA 2P3FH 3JZ1B 2AYWA 3PB1E 4KKDA 1EP6A 3SJKA 1RXPA 2KCPA 1Q3XA 3VB4A 2G4UA 2W3KA 1CVWH 1YF4A 3SNBA 2AMPA 1RTFB 3FKSD 3PRBA 1V2ST 3SHCH 3FP7E 4KGAA 5E0JA 3LU9B 1DWBH 1YM0A 3EAJA 1OP0A 2ZFFH 2G5NA 5EU8A 1PPEE 1V2RT 4MTBA 3FAOA 1WXRA 4GUXA 4IS5A 1UK3A 4QT8C 1NRSH 4LZ4B 1UHBA 1DSUA 1AGJA 2NU0E 1WTHD 2AH4X 2BLOA 1NC6A 1OP8A 3LGYA 3RXDA 5CE1A 3GY2A 4FVBA 1C1PA 5EIYA 4AOQA 4IW4E 3DFLA 2M5TA 1K1LA 5HM9A 2TRMA 2F83A 3GY4A 2YOLA 5HXFA 1GHAG 2ZI2H 2WHXA 2CK3D 4Q2KA 1NN6A 1O3LA 2ZPRA 3LPRA 3T5FH 2BD8A 1D6RA 1PYTC 1AI8H 2BY7X 3A7TA 4MNXA 4AYYB 2OC1A 1TOCB 3VFEA 4I86A 2GVFA 2J34A 4ABHA 3F3BA 3LIWA 1O5BB 4JZEH 4ZUHA 1YBWA 2ZCLP 2STAE 2WZQA 3HKJB 2J5UA 1AN1E 1EZSC 2BZAA 1O5CB 1QR3E 4ZHAA 3V13A 5KGOA 5LPEA 1K22H 2TGDA 3M5MA 4FOUC 1FY4A 2A7JA 4MQAA 2PGBB 1SOTA 2IN2A 4DGJA 5FBIA 4CBOA 2VIWA 4TPIZ 2FI4E 5AFYH 4CRGA 1EP5A 1ABIH 4MPWA 1YPHC 5JBAS 2XRCA 1HV7A 1GJ7B 3BTME 1MU6B 4AX9H 1O3DA 1L0ZA 3QX5H 1W0JD 2PKAB 5C17A 1FX0B 4K1TA 5C0UA 2G81E 2ZDMA 3GY7A 1S6FA 1MTWA 4FVDA 5IK2D 4ZHMU 1OS8A 4BAHB 5T6GA 1DANH 2J9NA 3KYFA 1P9UA 3O8BA 3VEQB 3V3MA 5B6OA 1GBTA 2BVXH 1WUNH 2V0BA 5EJLA 1PPFE 2WSSD 4IMZA 1V2TT 2P59A 1Z8GA 5JYIA 3TLOA 1NFYA 5L2ZH 3SGAE 2FOBA 1GG6B 3QK1A 1UVOA 1MUEB 2HALA 5T6DA 2O8LA 4JK5A 3M3SA 1GBHA 1Z1IA 3BTQE 1YWUA 5A8XA 2ZU2A 1H8IH 1RS0A 1Y3UA 4X1PU 2BXTH 4D76A 4GHQA 1GBAA 4E7RG 3RXEA 4RT0A 1Y5BT 2RFKC 5GCHG 4AFUA 1J15A 2WPKS 4Q63A 1E36B 3KCGH 2BOKA 2FO9A 2OINA 2P93A 4DVAU 2C90B 4I8JA 1PJPA 4D7FA 1TX6A 2ZPQA 3A7YA 2GZ9A 1NTPA 1L4DA 3GY6A 1P2OA 3ESTA 3M3VA 1C1QA 4X6PA 1GWAA 5EODA 4AZ2B 4KTSA 2GJGA 3PYHA 1P3EA 2VIDA 4O3TA 9ESTA 3AVZA 1TAWA 2XC0A 1SHYA 1RJXB 2XOKD 3OTPA 4F49A 2BD9A 1HAYB 4NIXA 4YXWD 2H5CA 4ZH8A 1AO5A 2FESH 1F0UA 3BEIB 1MCTA 3PM3A 5C0TA 1ANBA 3OSYA 1UVUH 2PKSB 3UUZA 4ZMAH 3DSPA 1CHOF 4AFQA 2FEQH 3EDXB 1D9IA 4DG4A 3BIVH 4YLQH 1UTLM 1GMCG 1RTLA 1E38B 3ZZBA 1AVWA 1ZSLA 4RKOB 3T27A 2VGCB 5C1UA 1O3FA 2BDAA 1V2QT 3SI4H 5GNDA 1DE7H 4NFFA 4O9VA 5T1VA 1E79D 1K1OA 3MNSA 1W3CA 4ZHLU 3OEED 5FXLA 1YCPH 5A0AE 4XOJA 5K0HA 1W0KD 4DIIH 2BY5X 1MTNC 1QHRB 3T25A 2Z6BD 3UNQA 4ACAA 4X2VA 3VB3A 1EATA 1UCYE 2PFEA 4Y8ZA 3U9AH 4HGCA 3ZYDA 1P3CA 3D49H 1D6WA 4F55A 1W10U 3F2GA 3JZ2B 2GV7A 1C5YB 1AE8H 1XUKA 4B1TA 2QGRA 1UO6A 2QE7D 4MPUA 5B6LA 2OQUA 1EAXA 3QGNB 3RXGA 4D8NA 1EKBB 1HB0B 1U6QA 3VB6A 1NFUA 3K6ZA 1O2KA 1EZXC 2OTVA 1AVXA 4Q7ZA 3AAUA 3O8DA 2J95A 4X8SH 3C27B 3F6UH 2YNBA 4YZUA 4X2XA 1LMWB 1BOQA 4JZ1A 1LKAA 2GGVB 1QFKH 2K8IA 2VH6A 1H8HD 4JZIA 2PR3A 1F7ZA 3BSQA 1JRSA 3Q00A 1O2NA 1X7AC 1EJAA 3FN8A 3ZV8A 2Y6TA 1JWTA 2VH0A 2C8XB 2WPJS 3SQHE 1P11E 1ZLRA 2FOHA 4R0IA 2AMDA 1ZZZA 2HRVA 3RXKA 2BHGA 1F5KU 3SNEA 2ZFSA 5F8XA 3NCLA 3M5LA 1E1RD 1G2MA 1HAVB 2W26A 1NO9H 3E3TA 4CREA 1EXFA 1TA6A 1QB9A 1K1JA 3ATIA 1BQYA 4M9FA 1HBTH 3F9GA 4WMEA 1HAHH 1T4VH 2FI5E 1ARCA 1UCYK 3BG4C 3PROA 3ELAH 3PWCA 2FMJA 4Q7YA 1SPJA 2Q1JA 1C2KA 3GCHB 4MNVA 4O03A 1RD3B 3BIUH 2V6NA 2GTBA 2JKHA 1DVAH 1GDQA 4BNRA 2A31A 2WV9A 3SORA 2C8ZB 4UFDH 4CHAC 1TWXB 2W6JD 5JBBS 2BDIA 4AFZA 1A46H 2GDEH 5ABWA 2FS8A 1ACBE 7GCHF 5L2YH 1QJ1B 2PHBA 2UWOA 4JZFH 1BMAA 3RC4A 3MFJA 4J2YB 4XRNA 3RXJA 3SN8A 1GHYH 2FI3E 2SGEE 3T62A 5JDUB 1WAYB 3TK5A 1M9UA 4DT7B 3TJUA 3RMOH 3KEEA 1O5GH 2PP6A 2QF3A 1O2UA 1ETTH 4DW2U 1BCUH 1OOKB 2VB0A 5EXNA 1LCYA 5T6FA 3TJNA 1GMHG 2J94A 2AGGX 1FI8A 1SGTA 3F9EA 1YPEH 4TSFD 2JETC 4KTUA 5H4IB 6ESTA 1FXYA 2PV9B 6GCHG 2VINA 1O2RA 2G55A 2AS9A 3GCHC 1DXPA 4LOYH 4I33A 5E0GA 2KM0A 3RC6A 4D7GA 5AVDA 3T29A 2A4GA 3TVJB 4OS2A 3SU6A 1TONA 4XBBA 4Y11E 4XDEA 5A0CA 4X1QU 3SU4A 2QC2A 2EQNA 1QRXA 1ANCA 1TGSZ 1V2NT 1N8OB 2CF8H 3GDVA 2QXIA 1NESE 2KAIB 1QL9A 2OCVB 5E8EH 1O32A 2R0KA 1AUJA 3QO6A 1V2UT 3HK3B 3B9FH 1VITF 1S5SA 1O2QA 2K1QA 3MU4A 1IQMA 1SGRE 2THFB 2WPIS 3AK5A 1SLWB 1O2ZA 1K0HA 3MNCA 1QA7A 2AGIX 3PLBA 1WU1A 3UAIC 4BAOB 1S84A 2FOFA 5FPSA 1PPBH 1SGFA 2AIQA 4TPYA 2Z9IA 3SUGA 1HRTH 1C5MD 3K2UA 1F2SE 2P16A 2CMYA 3GDUA 1HIAA 4JK6A 3A86A 5CHBA 4X8UH 2JJ1D 3BTKE 1G3BA 2RDEA 3NK8A 1G37A 2A4RA 1KMHB 3MQKC 2Z9LA 1EAWA 2BDYA 2LP6A 4OGXA 3F1SB 3UREA 2RA0A 1W8BH 1PQ5A 3FFGA 3DFJA 1TGNA 1BUIA 4F48B 1Y5UT 1AWHB 1UJ1A 1C5WB 1ESTA 3G01A 1EASA 5EG4A 2UUJB 2F9OA 1PQ7A 4WVPE 2IPHA 2IOTA 1SOZA 3M35A 2ZHQH 1KXCA 3ZYEA 2WPLS 2CV3A 4Y6DA 1FONA 3KQEA 3NXPA 4GLYA 1KSNA 3KQ5A 3UPEA 4AGJA 3CP7A 2P94A 2RDLA 2RA3A 2H2ZA 2WYGA 4ZKOU 1OWEA 1HUTH 2BM2A 5L30H 1P0SH 4FUDA 1C1UH 2FP7B 2AMQA 1C5OH 1W14U 1WDIA 2P8OC 1B0FA 1NBMD 1C5XB 2W7UA 4DT4A 4ABIA 1G30B 4AB8A 1O3OA 1NRQH 1O2MA 1C4Y2 3KYGA 3MI4A 1J8AA 2BXUH 3BTHE 1BTPA 1GHZA 2OP9A 1GJDB 1T4UH 1TRMA 4ISHH 1CO7E 2PKSC 2BVRH 4BTUB 3BTFE 1HJ9A 1C1MA 1P2IA 1LHCH 4NA7A 4MNYA 1NBME 1OWHA 2GDDA 3VGCB 1C5VA 3ZVEA 2Y5GA 2ZGXH 1DLEA 2A2QH 3F9HA 3FOAA 3KQDA 4BAQB 5DG6A 1GJBB 3UR6A 1LHEH 2NU1E 1L4ZA 4BTTB 4CBNA 1A5GH 1HPGA 4P00A 3W94A 1B7XB 1P2QA 1O5EH 4F4OC 1DX5M 1P09A 1HAXB 1FIWA 4OS5A 2CXVA 1AQ7A 1QBVH 5GPIB 3S9AA 3UTUH 1SBWA 4DCDA 2JIZD 3SO3A 1TRNA 3S69A 2XNDD 3RU4T 5JB9S 3TGJE 1O2TA 2Y5FA 4FUCA 2ZDAH 1ZSKA 1BTXA 1MBMA 1AKSA 1IQNA 4MG3A 1UVSH 4Q7XA 1C5SA 1T8MA 1FZZA 3MO6A 5ESBA 5CMXH 1H8DH 1YPLH 2ANYA 2CHAB 1N6YA 2EA3A 2V35A 1LTOA 4ZXXH 2BD5A 2R2WU 3T28A 3TK6A 1G36A 1FLEE 4MDSA 1GHAF 3E6PH 1ZPBA 1P10A 1S83A 1SHHB 1D4PB 2XCNA 1QB6A 3M36A 3SJOA 1MQ6A 1FY3A 5LPFA 1AE5A 3PRDA 2QCYA 1AMHA 1ID5H 4IGDA 1V2OT 3LDXH 1P2MA 1BTWA 1DWEH 1C4U2 3M61U 5DP5A 1WQSA 2A5KA 2Q6FA 2STBE 2ZWLH 1F0TA 4X8VH 3ATWA 3RM0H 2EI6A 1Y8TA 6CHAC 3A7XA 2A1DB 2IPQX 1SGPE 1LO6A 3M37A 1GMDG 4NWKA 1NRPH 3ZZ9A 1IAUA 1S0RA 1P03A 1WBGB 1Z8JB 3A7WA 4K60A 4WXVA 4NCYA 2CF9H 2ZTXA 1SKYE 3K65B 3PMJA 1HAPH 2OK5A 1IQJA 2W5EA 1O3KA 1O3IA 1OP2A 1EB2A 4B71A 1E0FD 3LGUA 2GKVE 4YT6H 1KLTA 3SUEA 1C2GA 1CA8B 3IWMA 1GCTC 2QF5A 1MMJN 1A1RA 4XBCA 1OPHB 4JYVH 1RFNA 2HGTH 1MD8A 1GJ8B 1LVMA 1DDJA 5FPYA 2D1JA 2ODPA 1ELEE 4I8KA 3U28C 1THRH 3FZZA 2ZFTA 5DJ7A 3D23A 1O3PB 1LDTT 2GCTB 3EYDA 1DWCH 1BBRE 4B76A 3FP8E 4NA8A 3RUOA 1MH0A 1UTMA 1BBRK 3UQOA 1VITG 3A8BA 2ZKSA 8KME2 2H9HA 2CJIA 3I29A 1C5RA 3Q77A 2HWLB
chains in the Genus database with same CATH topology
2R3UA 5FHTA 1MTSA 4B73A 2R0LA 2SNWA 3MHWU 2GV6A 1K1IA 2SGQE 3LJOA 5DPAA 4YOGA 1O2LA 1VJ9U 3RXOA 2ZDKA 5GCHF 3ATLA 4ZROA 2XXLA 4Y0ZE 2H6MA 3RMNH 5CHAB 4UFGH 2BD4A 4Y71A 3M7QA 1BT7A 3SV7A 3BTEE 4K69A 2ZC9H 4OS4A 1YLCA 4NZQA 5AFZH 3SI3H 2Y7XA 1EUFA 1HAIH 1Z7KA 3ODDA 3Q3KA 1EZQA 1GJ4H 1O3EA 3MTYA 1KTSB 2RCEA 3BN9A 1UTQA 3SZNA 3PTNA 1TA2A 4JMYA 2GCTC 3OU0A 4X1RU 1E37B 3ZZ3A 4WXIA 1O3BA 2BDCA 4NFEA 2C8YB 1SI5H 1C2IA 1SGIB 3M7UA 4Y7BA 1UCYH 4HZHA 4FUBA 2ZDLA 5EOKA 1P57B 4YM9A 1YKTA 5DP9A 3GY8A 3RXQA 1O0DH 2W3IA 5EQRA 4DIHH 2V3HH 4AG1A 4A6LA 4CR9A 2ZDVH 3AAVA 2Z3CA 3M3TA 1DUAA 2BDGA 1EX3A 1SG8B 3V0XA 3MU0A 2BOHB 4X2WA 1EOLA 2ZEBA 1GBLA 1NS3A 3MH6A 3RMMH 4DOQA 1N6XA 4JCNA 1AZ8A 1BRCE 1DM4B 2HOBA 1HFDA 4TWYA 1TMTH 1VGCB 3ZVBA 1GL1A 2FS9A 1RTKA 4DURA 2LPRA 2EC9H 3A80A 2SGFE 2ZIQH 1GBMA 2VIQA 3A82A 5HMAA 1DPOA 2VIPA 1TMBH 1K28D 1QNJA 3RXRA 7KMEH 3GY5A 1SGQE 2ZQ2A 5JBCS 2ZHDA 4ZAEA 1PPHE 1IQKA 1EQ9A 2F9NA 1QIXB 4WH8A 5EQSA 4UFFH 4YOIA 1EPTA 5GIBA 2QN5T 4J1YA 1J16A 1ETRH 3P6ZB 1V2WT 1S85A 2OBQA 3PLPA 5HM2A 4OS7A 1BB0B 3UWIA 5DO4H 2R2MB 1WTGH 3F9FA 1BTHH 4XFQA 4WWYA 1GI7B 2NU2E 1ELBA 1K1NA 1YP9A 1O3NA 2PSXA 4I31A 1QJ6B 3GDSA 4GAWA 3F68H 2JH6D 1P06A 2DE8A 1P02A 1Z8RA 4E06H 1GVLA 1LHDH 3A81A 1A61H 1ETSH 4O97A 1YGCH 3RXPA 1NROH 1WCZA 3EBNA 1E34B 3RP2A 3UR9A 5A2MH 2VWMA 3VPKA 5GXPA 4A5TS 4YO9A 1FY5A 1GBKA 1JIMA 2PTCE 3RLYH 3KIDU 3RMLH 1O33A 1O37A 2WYJA 1ZR0A 2O8TA 1BHXF 1UMAH 4H4FA 2VWOA 5C5OA 3LH1A 1O39A 1SGYE 3L33A 2C93B 2ZU1A 3KGPA 3QLPH 1SSXA 4UEHH 1OX1A 1GHWH 2O8UA 1IHTH 2G5VA 4R8TB 4CRCA 3EQ0H 1TNIA 2SGAA 2UUFB 4FXGH 1BRAA 1OKXA 1EJNA 2ASUB 2G00A 1EZUC 4CRDA 2IJOB 4X6NA 1RIWC 1L1NA 1TX7A 5BPEA 2D2DA 1QA0A 1TBZH 1AD8H 3PMAB 4ISOA 4FUEA 1GBCA 2HPPH 1O2SA 2FWWA 3KL6A 3GCTG 1GVKB 4I8LA 2F9VA 1HXFH 2GP9B 3I77A 1CT2E 1OXGA 1TNGA 4LXBH 1G2LA 1C2JA 1MKXH 2A2XH 3RLWH 3U8TH 1MTNB 3EA9A 3DA9B 2BY9X 1NRRH 1ZMJA 4NIWA 3QTOH 1Y59T 2BDBA 3BEFB 1P2NA 1QTFA 4SGAE 2ZCKP 2OQ5A 4GPGA 2H9TH 2PSYA 2H1UA 2C8WB 1TGTA 5TCCA 1TNHA 1FV9A 1TFXA 1W0ZU 3VGCC 2XC4A 3GOVB 1TYNA 1QQ4A 4B2BA 3ENSB 1P9SA 2A5IA 1SB1H 1YCPM 4Y76A 2AGEX 3PV4A 2WPHS 2ZTYA 2FTLE 2VVVA 2QYIA 2ILNA 4K2YA 2VVCA 4OS1A 1XUGA 1YPGH 5JPMH 1FPCH 3RXBA 3TU7H 5TJXA 1O5FH 4UDWH 1HAVA 1BJVA 4K3JA 1IHSH 1YPJH 3SHAH 1BBRH 1V3XA 1KXFA 2WINI 2BD2A 1QY6A 2O8MA 2XWAA 3RC5A 2BLVA 2GZ8A 2WPMS 1HLTH 5AF9H 3DUXH 2Y81A 1ZPZA 3LJJA 2HNTF 3A8CA 5HYOA 2PWXA 2XNIA 4A92A 2XBWA 2BVSH 1GI2A 1O2OA 4ABBA 3TK9A 1A0LA 3FANA 2HNTC 4CH8B 1AHTH 1SVPA 4IN1A 3A8AA 1XKBC 2BQ7B 4SGBE 1LQEA 2ZP0H 1O3HA 1VCQA 1SGEE 2BMGB 4IC6A 1GJCB 1GGDB 1LQDB 2ZHEH 2P95A 5DGJA 5DK1A 3PMHB 1GBIA 3EA8A 1KY9A 1ANEA 1BITA 1BTUA 1LPZB 4X2YA 2DE9A 1E35B 2P3TB 3OY6U 4Y8YA 1QRZA 1BMLA 3MWIU 4FUIA 1TPOA 5DP4A 1J14A 5LH8A 4KTCA 1GPZA 4RSPA 5F8ZA 3UWJH 1O2WA 3GY3A 3TH2H 4X6OA 1QBNA 1V2PT 6CHAB 1O35A 4I7YH 1QQUA 1ABJH 2Q6DA 1XUIA 1TNLA 2ULLA 3BG8A 1TBQH 4INKA 5SGAE 2AFQB 1INCA 1GCDA 1CGJE 4ABFA 4ASHA 4K5ZA 3E90B 1TBRH 2FOAA 1BTZA 4B74A 2ODQA 1D3TB 5ETXA 1RIWB 5EW1H 1HGTH 2BB4A 3URCA 1BZXE 3A7VA 4X0WU 5DP3A 1ZHRA 2SNVA 1Y3WA 1K2I1 3TPIZ 1A5IA 4YT7H 1TGCA 4B2AA 1SQAA 1O38A 1AB9B 1T8OA 1VITH 1MAXA 3ZZDA 2QIQA 3MO9A 1HIAB 4BAKB 2FDAA 1MCVA 5GJ4B 1GDUA 2ZQ1A 1ZOMA 1C5TA 4Y10E 2O9QA 2TIOA 5L6NH 2JH0D 5F6MA 1JBUH 3BV9B 3MH7A 3LKWA 1NZQH 3H7TA 4KELA 3SBKA 1BMMH 1MBQA 3PTBA 3H7OA 4GSOA 3P8GA 1LVOA 5FPTA 1YC0A 2ZPSA 1SFIA 2WUCA 2HLCA 3BEUA 3QGJA 3A85A 4CHAB 3IG6B 4FU9A 3HK6B 4UFEH 3ITIA 3GICB 4X6MA 2BLQA 3GYMA 3RXCA 1H9HE 2OC7A 2D26C 3DT0H 5DP8A 1H4WA 5EW2H 1GHVH 3TIUA 4ESTE 1RRKA 2Z94A 1SMFE 1O2YA 3ZZCA 1DS2E 3I78A 1JRTA 2FM2A 1A3EH 1ESAA 3QDZB 2OUAA 1VR1H 2ZFPH 1UVPA 2FOMB 3A84A 5K7RA 4JYTA 4MLFB 4X8TH 3AW0A 1Z71A 3RXFA 1WYKA 4DY7B 1TB6H 1THSH 3LC3A 3TH3H 5GWZA 4GCHF 1C1SA 1WV7H 4X1SU 2ANWA 3K6YA 4NA9H 2FLBH 2ODYB 1NT1A 5EXMA 3S9BA 9LPRA 1QBOA 1PPZA 4Y79A 2F9UA 1AFQC 3LGWA 1DXWA 4IC5A 3TGIE 1JOUB 3ODFA 4BANB 4TWWA 2XBYA 1SLUB 1YLDA 2BQ6B 1F5RA 4WJG2 4Z0KA 3DHKH 1W12U 4RN6A 1O2PA 1CGHA 1SFQB 2OLGA 2A7CA 1DITH 3M5OA 1W11U 1ZSJA 1HAZB 3P17H 1GHBG 3KQCA 1TQ7B 2FIRH 3R0FA 3SUDA 3SU2A 1PQ8A 2EEKA 1ELFA 2A4OA 1MZAA 1V2VT 1G3EA 2F3CE 4LZ1H 1XVOA 1DLKB 1IQIA 1S82A 3OX7U 3P70B 2YNAA 1P01A 1GBEA 1D3QB 3O8RA 1ZTKA 4IBLH 4NIYA 1GI0A 2FODA 1TX8A 3UQVA 4U01A 1FDPA 2OBOA 1FAXA 3A89A 4VGCC 4A1VA 2Z7FE 3AASA 1Z6JH 4BXWA 1AUTC 4ISLA 2Y82A 1NY22 2TGTA 2GZ7A 3PLKA 1O5AB 1HCGA 2UWLA 1OWIA 2Z9JA 1AY6H 2ALVA 1Z1JA 1QL7A 1DFPA 4JZDH 7ESTE 1ZJKA 2Y5HA 1ZHPA 1YPKH 1QL8A 2P3UB 5F03A 2F9PA 2FXRA 8GCHG 2A45B 5I25A 3HKIB 2LIZA 2PGQB 3U8OH 2CN0H 3ZVCA 2ZHWH 4H42U 2XTTB 3QUMP 2OD3B 3RU4D 3ZZ7A 2BD3A 3SGBE 1FJSA 3E1XB 4H6SB 2AERH 4CRAA 1K9OE 5J4SA 1MKWH 3EE0B 1ESBA 5DP7A 1T31A 1T8NA 3LGTA 2TBSA 3BTWE 1V2KT 3URDA 1EAUA 1C2HA 1SGNE 2BTCE 1UTNA 1NFXA 3TNSA 3S0NA 4CRFA 2Q6GA 1NU9A 3RXAA 3VXEH 3KN2A 1A5HA 1GHBF 1V2LT 4I32A 2ANMH 4O3UA 1ELVA 1XM1A 1AIXH 2PW8H 2CGAA 4LK4A 2XBXA 1Q31A 3FVFB 2FYRA 4K1SA 1DWDH 4A1XA 3FP6E 3RXUA 4UONA 1TABE 4ZKNU 3SV8A 4B2CA 3OTJE 2ZF0H 1HXEH 1NFWA 3SJIA 1CQQA 1JXPA 4FUHA 3QTVH 4MVNA 2ZCHP 1KYNA 1GL0E 3P95A 1K1PA 5HGGA 1GI5A 1K21H 2OC8A 3P8NA 1A2CH 4MPVA 1S0QA 3ZZ4A 3P8FA 1C1NA 3B23B 1H1BA 1EB1H 4YLUA 4A1TA 3LONA 3OYPA 3PO1C 4U32A 2KAIA 2FX6A 1UHBB 3A88A 1TRYA 2JETB 1ZMLA 4U2WA 2XCFA 3PWBA 2RG3A 2NWNA 2A0QB 4Z6AH 4GCHG 1OWKA 1F5LA 1OWDA 3HPTB 1ELDE 1ELTA 1XXDA 2ZGBH 4NGAH 1CA0B 3UOPA 2GX4A 1BRUP 1TIOA 2J4IA 3UNSA 1GMDF 3MYWA 4DJZB 3D65E 1DOJA 1O34A 5LGOA 1P05A 4I8HA 2Y7ZA 1G3CA 1W0YH 1XMNB 3MNBA 3NKKA 5A8ZA 2VVUA 2LNCA 2JH5D 1KIGH 1L2EA 3CS7A 3HATH 3UY9A 1CE5A 1C1WH 5LPRA 3E0NB 3KF2A 1BJUA 1CHGA 3E0PB 4Y7AA 4JYUH 3ATKA 1N1LA 3MU5A 2ESTE 3NPSA 1XUFA 5DP6A 5E2OA 2V3OH 1MKXK 2ZA5A 1TQ0B 1J17T 1C2EA 4RKJB 3RU4E 4ZKRU 8LPRA 2GT8A 4NSYA 3SOSA 3BG4B 3E8LA 5A8YA 1H9LB 3VB7A 2BYAX 2BZ6H 2F9BH 2B8OH 1O2IA 5E2PA 1GI8B 1G3DA 1EOJA 1FY8E 3SU1A 4MPXA 1N8OC 4HFPB 3LC5A 3Q3XA 1IQGA 2PKAA 2PUXB 1OWJA 2A32A 2NU3E 4FUFA 5IYTA 2AIPA 1DT2A 1MTVA 3VB5A 1D3DB 2GMTC 1YYY1 2VWNA 1DUEA 1O2JA 4PROA 1O2HA 3KQBA 5T3HA 1WSSH 1XUHA 1CT4E 1EJMA 4A7IB 2FZZA 1ZPCA 1CT0E 3MOCA 1Z8IB 1V2JT 2ZG0H 3WY8A 1HDTH 1J9CH 3TITA 4OGYA 2ANKH 3R3GB 3ZVAA 5E0HA 1O31A 3LT3A 3A7ZA 5EGMA 2I6QA 1AVGH 3U1JB 1A0JA 3NZIA 5FCKA 1ZMNA 1FY1A 1GGDC 1O2VA 1LVBA 3ZZ8A 3FZDA 1HYLA 3ZVDA 2OC0A 3GCOA 1W7GH 1CHOG 2ZZUH 1LHFH 2UWPA 1ELAA 2P8OB 1KLIH 1L1GA 1F0RA 1AB9C 2W7SA 2J92A 5C67A 5TCAA 2ZO3H 4YESB 1P04A 4H6TA 4GVUA 1MD7A 1O36A 3RXHA 4GHTA 1C2LA 2BLWA 4YOJA 3TNTA 3S9CA 1WQVH 1SQTA 2D8WA 1AKSB 1DICA 5C20A 1ANDA 4CRBA 1GMCF 2TPIZ 3MU1A 2GT7A 1PPGE 1Q2WA 4TY6A 3SJ9A 3SU3A 5CHAC 1NU7B 2B7DH 2FX4A 4AG2A 1MU8B 1NM6A 1L1JA 2QXJA 4NG9H 1ARBA 1ZRKA 1FIZA 2FOCA 1LKBA 8GCHF 2H9EH 1C2DA 4AFSA 3NWUA 4ABGA 1P2KA 3TGKE 2ZECA 1ELCA 4I8GA 1JMOH 2J38A 2XW9A 4TY7A 1C5UA 5IDKA 2Z3DA 2QXGA 1ZRBA 1IQEA 1QJ7B 2B5TB 4WY3A 1S6HA 4U30A 1NRNH 2BQWB 3BTTE 1DY8A 3RXSA 1SC8U 3LOXA 3AW1A 2VIVA 1KXAA 4D9QA 1BHXB 2H5DA 1C5QA 2WV5A 1O3GA 1IOEA 1GJAB 1GHXH 1LVYA 3P92A 1W2KH 3SGQE 2BY6X 2ZFRH 2Z9GA 2J2UA 2A5AA 1SGFG 1GCTB 2SGPE 2XWBI 4M7GA 3HGPA 2FPZA 3S7HB 1YPHE 1SQOA 1VCPA 2WUBA 3GCTF 1SLVB 3U1IB 2O8WA 4FUGA 2B0FA 2BX3A 1TNKA 3SUFA 2FOEA 4E7NA 1ELGA 1W7XH 4ABDA 1BRBE 1O5DH 2A7HA 2FTMA 2TGAA 1BTYA 2FLRH 2C4FH 3M5NA 2HNTE 5FX5A 3SU5A 1IQFA 2NU4E 1CBWC 2BD7A 5C1YA 1TALA 1O2GH 2ZFQH 3VXFH 6GCHF 2VGCC 3SU0A 2WV4A 1HAOH 4BAMB 4HTCH 4NIVA 1C1VH 3Q3YA 4HI3A 1PYTD 1K1MA 1P2JA 2QV1A 2XYAA 3UIRA 2C3SA 3A83A 4TYDA 1OYTH 3LH3A 2ZHFH 1XUJA 1Z6EA 1V6DA 1C1TA 2ALPA 2G4TA 1OSSA 3IITA 3Q76A 1C2MA 4ISNA 2BX4A 5C5NA 2QF0A 4AGKA 2CHAC 4WMDA 5A0BA 1AZZA 1C5NH 1D3PB 4OS6A 3SW2B 1F92A 3M7TA 3KHVA 1GVZA 1GI3A 4AB9A 1GJ5H 3SNDA 1GBDA 1ZTJA 1C5LH 2Z9KA 4K8YA 4BXSA 1TPAE 1TE0A 1KDQA 2QY0B 3L6PA 1IQLA 3EGKH 3RXTA 1C4V2 5C1XA 1O3JA 1TOMH 3RXIA 3RDZA 3QWCH 4WF8A 5I46H 4MNWA 2ZDNA 1JIRA 3U98H 3SV6A