2GZ8A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz8A02
3ZZ6A 1AZ8A 4UONA 2OUAA 1KXDA 4D7FA 1DSTA 3VB4A 2H9TH 2C8YB 5DJ7A 4PROA 3RXCA 1MTNB 2SGAA 2PKAA 1IQKA 1ELEE 4WJG2 6LPRA 5EXLA 4X2YA 2P16A 1WCZA 5K7RA 1EAWA 3R3GB 4AORA 2A4OA 1C2GA 1G36A 3FP7E 1V2TT 2O8TA 1FUJA 2FMJA 3PO1C 2GP9B 1E38B 3DUXH 1O2VA 3BV9B 3L33A 1TLDA 2SNWA 1A5HA 3TK5A 1SGCA 2PHBA 3P70B 4X1RU 4UFEH 4X1SU 3RP2A 2TGPZ 1MKXK 2XBXA 2ANKH 1O2SA 3DT0H 1LHCH 2VVVA 1LHEH 3OTJE 1UVTH 1DX5M 2OC1A 1AE8H 1GJ6A 1T8LA 2EI8A 3QGNB 2ODYB 2Y6TA 2BDYA 1TX6A 5L30H 1LTOA 3QZQA 4XBBA 4ZH8A 4RKOB 1OX1A 4AB8A 3DA9B 3SJOA 1GI0A 3V3MA 1WQVH 2C8WB 5LGOA 1YPGH 3RM0H 2Y82A 2BY6X 1UTMA 1B0FA 3M36A 2FOBA 1EPTA 2PTNA 3ODFA 2GCTB 3TPIZ 1ANEA 1C5WB 3ZYEA 1WQSA 2A5IA 4F49A 1AVGH 1S81A 1K1LA 1E0FD 2F9BH 2G4TA 2HPPH 3PTNA 3SGAE 2Z6BD 3MH7A 5DP5A 1VGCB 5EPNA 2XBVA 1C2MA 2OCVB 3PWBA 2BD9A 2VIVA 3O8RA 3U98H 3TH4H 1A0HB 1OWHA 1UK3A 1FONA 2Z3EA 1XUKA 2BZAA 1QBOA 3SUDA 1BMAA 1ACBE 5DPAA 2G5NA 1TRNA 4INKA 1CGIE 2GDEH 1QL7A 1G3EA 2FZZA 4IN1A 4E7RG 7GCHF 2F83A 2Y80A 1AD8H 2R0LA 2A32A 1CHOG 7LPRA 3HGNA 1TNJA 2SGPE 1ZJDA 2BD3A 4BTIB 1A46H 2FOEA 4NIWA 1MTUA 1GI9B 1U6QA 1XUHA 1NFUA 1A4WH 1ZYOA 1P9SA 1W10U 2NU4E 1UTOA 2PV9B 3GY3A 3RXTA 1WBGB 3SU1A 1ELGA 2FM2A 2AGEX 5A8ZA 3SUGA 3PYHA 3EA8A 2HGTH 1INCA 5E0GA 3P95A 1DOJA 3E3TA 1KTTB 2XNIA 2F9NA 4ABFA 4ZHAA 1P9UA 3UNSA 4I33A 5DG6A 1HCGA 3KIDU 5TJXA 3ZVGA 4ISOA 1HUTH 5T6DA 5ESBA 2VWMA 4JZIA 1FY4A 2BD5A 1T32A 3HKJB 3ELAH 1O2ZA 2Y7XA 2BD4A 1VITF 3LONA 1LCYA 4U32A 1SR5C 2P93A 2AGIX 1O37A 1FIWA 1O33A 1KXCA 3PLPA 2UUFB 3ZVEA 1FAKH 2FXRA 3GY8A 2QF0A 1TMUH 4Y0YE 3UR9A 2VGCB 1NRQH 3U8OH 2GT8A 4BAKB 1P11E 1DUAA 4UFGH 3M3VA 1B7XB 3A81A 2RCEA 4NCYA 1EXFA 3P8FA 2GCTC 1BMMH 1JIMA 2AFQB 1GDQA 2FTMA 4IMQA 4MQAA 4LZ4B 4ISNA 1H9LB 1C1VH 1OYQA 1ZPBA 3URCA 5JB8S 2VWOA 2BOKA 1S0RA 2ZU2A 4WF8A 4AYYB 2R3UA 4O3UA 2J9NA 1DICA 1DY9A 1J9CH 3BEFB 2O9QA 1DS2E 1Z8RA 2A5AA 3SUFA 1BTPA 1EOJA 2THFB 1TNHA 3UPEA 4GHTA 1P2NA 5C1XA 1SLUB 3S69A 4NGAH 1V2NT 1UK4A 4X0WU 4ABGA 2B0FA 4Y71A 3CP7A 2QXJA 4K69A 5LPFA 3GCHC 1W8BH 4X1PU 5C1UA 1OS8A 4GCHG 1GJ9B 1YF4A 2OINA 1ZHRA 2QN5T 2P3FH 3A7YA 3B23B 2ZDVH 3GCNA 1HPGA 1O5GH 4I31A 2LPRA 4FUHA 1C2FA 2FOFA 1P2KA 1TGSZ 1LMWB 2QYIA 3BTME 2VB0A 4JMYA 4ZAEA 2PGQB 4TYDA 3MTYA 2CMYA 5FHTA 1N6XA 2VU8E 1BMLA 1PQ7A 1ZZZA 1RIWC 1ZSLA 1KTSB 2HNTE 1UVUH 1NZQH 1P04A 3D49H 1VCWA 2GX4A 1RRKA 1GI5A 3M35A 1V3XA 3U69H 1T8MA 1GDUA 4B73A 1QL8A 3NCLA 1ANCA 1MZDA 1C2HA 1CHGA 4ABEA 2W7SA 4AFSA 4MTBA 2ZFRH 1OOKB 5PTPA 3RXUA 1IQLA 2G52A 4A1VA 1C4Y2 5C2ZA 1KDQB 2VINA 2OLGA 4U01A 2AYWA 1BTUA 1P03A 4H4FA 5GCHG 1QY6A 2XRCA 1LDTT 3KN2A 1ZMLA 1SGQE 1WTGH 3ZZ9A 1LPGB 5AHGH 1C5SA 3VXEH 1SGDE 1OWEA 4VGCB 3JZ1B 1PQAA 3KQCA 1NFYA 3AASA 1O2LA 1O2YA 3FP8E 1GJ7B 2VIQA 3SJ9A 3GCOA 1TOCB 2UWPA 1C1UH 4Y7BA 2BLQA 1W11U 1W7GH 4DIHH 1PYTC 4NWKA 3QTVH 5FBEA 3ZZBA 2TPIZ 3BTFE 3SV6A 1FY8E 1GJBB 4Y10E 3A8DA 4Z0KA 3F68H 5EGMA 1GMDG 1L4DA 3SU0A 1QL9A 2ZZUH 3ZV8A 2H6MA 3PMAB 5JB9S 2FP7B 3SNDA 1ARCA 1K1MA 4A7IB 4AOQA 2ZU1A 1IHTH 1C2KA 3D65E 4MDSA 4IS5A 3EBNA 1OPHB 4YTAA 3FP6E 1OP2A 3NPSA 2Z9IA 4DG4A 2BDHA 2FOMB 1PPCE 4DJZB 3V12A 4TY6A 3AW0A 2ZHDA 3TGJE 2A7JA 3E16B 2OC8A 1GI6A 3UREA 4YOJA 1A5IA 3RXGA 2H5DA 2VH6A 1Z6EA 1JRSA 4IBLH 4OS7A 4XDEA 3TNSA 2ZU4A 1O39A 1PPZA 2WUBA 1AWHB 1RTLA 3EE0B 2F9PA 3TK6A 1W0YH 4ZKNU 1S5SA 1G2MA 4GSOA 1HIAB 4RKJB 2IJOB 1GL1A 3QDZB 3O8CA 1FY3A 1UMAH 4D76A 3SV9A 2WUCA 1ETRH 1VITH 5FX5A 1UK2A 1UTKA 3AVZA 1GI4A 3GDSA 4OGYA 1E36B 4LXBH 4MPVA 5F6MA 1AI8H 5IDKA 3ATMA 2ZDMA 1N8OB 3TH3H 3MH6A 4I8GA 1AFQC 5FPTA 2XC4A 3PB1E 3A8CA 4U30A 2AEIH 4HI3A 2JETB 2ZCLP 4Y76A 2FOAA 1Y3UA 5B6OA 1TWXB 4UD9H 1ZTLA 1BBRH 2K7XA 3UIRA 1EJNA 4B2BA 2XC5A 4I32A 5A09A 4MNVA 3KL6A 1T8OA 1CHOF 1GMCG 1SBWA 3VB3A 4GPGA 1A2CH 2JKHA 2YNAA 1YPKH 1BJVA 1FXYA 1TE0A 1J8AA 2BLOA 1GBFA 3BTKE 5FBIA 3A85A 4Y8XA 3S7KB 4X6PA 3UUZA 1RTFB 2FPZA 2Y5FA 1XVMA 2JH5D 2ZQ2A 4DCDA 1MKWH 1Z7KA 4MLFB 3FANA 1GWAA 5HMAA 6CHAB 3PLKA 1O2MA 1T4VH 1SQAA 4MNXA 1ZRKA 1XUIA 1QRXA 1K22H 1WV7H 1SLWB 2BLVA 4Q80A 2WV4A 4NWLA 4BNRA 1GGDB 1O5FH 1TNLA 2ESTE 2G4UA 4UFDH 3EQ0H 1SI5H 4A1TA 4KKDA 5DP8A 1NPMA 5IYTA 3GICB 1BRCE 4O9VA 1S6FA 2QIQA 1HAHH 1O3CA 1GDNA 1PQ8A 2BXUH 3GYMA 5GWZA 3RXHA 4KP0A 2ZPSA 1AUTC 2UWLA 1W0ZU 3ZVBA 8ESTE 2ZDLA 1F0SA 1IQIA 1WOFA 4CR9A 4NIVA 1UCYE 1JRTA 2BX3A 1KLIH 2IN2A 2A45B 8KME2 2EC9H 2P8OC 1GHBG 3Q76A 2PKSB 1GI2A 4TY7A 5DP7A 2ALPA 4ISLA 3ZVDA 1AKSB 1GI3A 3EYDA 3A89A 3UR6A 1W14U 4NIXA 2ZGXH 1HXEH 1OWDA 3UQVA 2C4FH 4KTUA 6ESTA 3MO6A 1C2LA 2F91A 3AAUA 1V2OT 3MNBA 3BSQA 3S7HB 1EB2A 2PGBB 3KHVA 1O3HA 1F7ZA 1TABE 2BDCA 2BXTH 5J4SA 1V2JT 2ZTZA 4ABJA 2G55A 1MTWA 2H9EH 1BDAA 3RXJA 2PR3A 2XWAA 1HJAB 1X7AC 1K1NA 4NFFA 1C5YB 1ABJH 2W5EA 1N8OC 3RXAA 1TYNA 4NIYA 1O2NA 1S82A 1C5MD 2BZ6H 2ZHFH 5SGAE 4DIIH 3LIWA 2JETC 2C90B 1O2QA 1TAWA 3F9EA 2XCNA 2BD2A 2KAIA 1G3BA 5C5OA 1QB6A 5A8XA 1O2PA 1GCTC 4GCHF 5C1YA 3UQOA 4MG3A 5FCRA 3K65B 3UOUA 4NZLA 1O3PB 2D26C 2FYRA 1ZHMA 2XBWA 3HGPA 1LVOA 1YPLH 3D62A 1D3TB 4JZFH 3I78A 3TGKE 1D9IA 1TONA 2Z94A 3S9BA 1AHTH 3UFAA 3U1IB 1RS0A 3PMBB 1AMHA 1GGDC 4R0IA 4XSKU 3SV8A 5FXLA 2AERH 1GBTA 2WPHS 2ZCKP 2VJ1A 3SNAA 1D3DB 2B5TB 2ZWLH 1GCDA 1A0LA 1YCPH 3CENA 2FIRH 4Q7ZA 3ITIA 4Q7XA 3ZZ8A 5JBTA 3LGYA 2Z9KA 1O3MA 5GCHF 1QRZA 2GKVE 1Z8JB 1UTLM 4FVDA 1AFEH 1DFPA 1K21H 2ZI2H 3MU4A 4GHQA 1C5PA 3ZZAA 4KELA 3NWUA 1MH0A 3CS7A 1TGBA 1BT7A 3A7VA 4AFUA 2B8OH 1CT2E 2A7CA 3RMOH 5JDUB 4WY3A 2ANWA 2Q6FA 3Q00A 1AVWA 1HB0B 4J1YA 2PKSC 3H5CB 1KYNA 5HM2A 1O2RA 4UE7H 1O3FA 1G3CA 3VB5A 4K8BA 4DW2U 3BEIB 4Y8ZA 1O3LA 1TMBH 4X8SH 3E90B 5JBCS 1QJ6B 1D4PB 2WINI 1GMDF 3STIA 4AX9H 2Z3CA 1XKAC 4XBDA 2FYQA 2CF9H 1YPJH 1BQYA 2CF8H 2O8MA 2H9HA 2SGDE 2NU0E 2LNCA 3MWIU 3DHKH 5ESTE 1C1QA 2JH6D 3RXPA 1DWBH 3FZZA 1MAXA 4CH8B 4AFZA 2C3SA 1DSUA 3P6ZB 3GYLB 1TPPA 1HJAC 1EUFA 4HZHA 2HALA 3M5MA 3Q3XA 3B9FH 3GY6A 1W7XH 1F5KU 1SG8B 3BG4B 1F0TA 1P57B 4A5TS 1GVKB 1QFKH 4WXIA 1JWTA 1QB9A 1J14A 3ZZ4A 4CBNA 1TNKA 3G01A 3A7TA 1IOEA 1AB9B 3P92A 2BYAX 3VGCB 1SGFA 3WY8A 2C8XB 1C1RA 1SLXB 1EZQA 1NRNH 2ZG0H 1BZXE 3DFLA 4AGKA 1EP6A 2GMTB 2BY7X 3TITA 2EEKA 4BAQB 2PKAB 1CGJE 1A61H 3LGWA 3LH3A 3F1SB 3W94A 3RC5A 1O3KA 5JBAS 1F0UA 3RMNH 1PFXC 1O5BB 1TMTH 1YLDA 3GY2A 4FUDA 4A1XA 5AFZH 5FPYA 1TQ0B 1O3JA 2J94A 1GBEA 1GL0E 1C5UA 1K1OA 1MTNC 4Z6AH 3SQEE 1SL3A 2FEQH 1Z6JH 1EP5A 3HATH 4O3TA 1HAIH 3BIVH 1LVBA 3LC5A 4JZDH 3KNXA 5E0JA 1KXFA 2Z9JA 4NA9H 3P8NA 5F8ZA 2F9OA 2J95A 5ETXA 1KSNA 1GMCF 1RGQA 2DE8A 5EOKA 5DKMA 2OC7A 2VH0A 1W2KH 2ZPQA 1D3PB 2HOBA 3ATKA 3QN7A 1E34B 3K6YA 1H9IE 1NRRH 1TA6A 4LOYH 3BTTE 1ANBA 1H9HE 1NTPA 1QJ7B 2ZGHA 5L2YH 2OBQA 1Z8IB 1P2QA 5AF9H 4R8TB 2J92A 2ANYA 1F5RA 1CSOE 2ZNKH 4CBOA 2Q6GA 1EKBB 5BRRE 3Q3KA 3Q77A 1C1NA 3RMLH 1FPHH 3PV4A 1HFDA 4O97A 7ESTE 5EG4A 1MTSA 5BPEA 1K1IA 1HAOH 1Y3YA 1EPTB 3E6PH 4X2WA 1RTKA 2P3TB 4BAOB 5CMXH 1ELVA 3KQBA 1GBMA 3TH2H 3A8AA 3RMMH 1BBRK 3SO3A 1OWIA 1LHFH 3RXMA 4X6OA 3UOPA 3E1XB 1KY9A 2PUQH 1DXPA 1PPHE 1MBQA 2BQ6B 5GJ4B 1ZOMA 4I8LA 5HYOA 1ESBA 4AG1A 8GCHG 1O3EA 3KGPA 5AFYH 4MPUA 1SOTA 4NA7A 4ABHA 3LDXH 1O32A 1D6WA 1QB1A 1A3EH 1MKWK 1O2KA 3UWJH 4BTTB 1F5LA 2AIPA 2ZU3A 1HLTH 2FOHA 3BF6H 2ZECA 3ZZ7A 1FQ3A 5LPEA 3K6ZA 3VEQB 4LZ1H 3PMJA 3BG4C 1C2JA 1LVYA 2Z3DA 3EGKH 1O3DA 1TQ7B 2GV6A 1A0JA 1VGCC 4YLQH 1NM6A 1EX3A 4ISHH 2ODQA 3RU4T 3VXFH 3T62A 2FX6A 3SU6A 1TFXA 2VVUA 1SGTA 1E35B 2A2XH 2PW8H 4ABIA 2R9PA 1XUJA 4ISIH 1N1LA 1FDPA 4X1NU 1LPKB 4X8VH 1BIOA 2WPKS 5F8XA 4K3JA 1SGEE 3MU0A 1DLKB 1AN1E 1JOUB 4Y8YA 1Y5AT 4BAHB 3UY9A 1V2LT 5DP4A 3SGQE 1GBDA 5EW1H 4DVAU 3BG8A 3OYPA 1BTYA 4BXSA 2BTCE 2HNTC 1V2MT 5T6GA 1Y8TA 3S9AA 1Q2WA 1GBJA 5F8TA 3E91A 3RXEA 1HNEE 1QQ4A 4FUEA 3FAOA 1NT1A 5L2ZH 1SHYA 3M7UA 1F92A 4UFFH 3GCTG 1GI7B 1SGRE 1XMNB 3M7TA 4K8YA 3FFGA 1GBIA 2WPJS 2STAE 4FU7A 1SGPE 1Y3VA 1B5GH 1L1NA 1OXGA 2A0QB 2FI3E 1FLEE 4Q2KA 4UEHH 2CXVA 5JYIA 4LK4A 3A84A 3F6UH 2D2DA 1EASA 1MCVA 3ZZDA 2CJIA 2WV5A 4HFPB 5EPYA 2FX4A 2ZHWH 3IG6B 2J2UA 2ZQ1A 2Z7FE 2TGAA 4WH8A 1QIXB 1QRWA 1XVOA 2F9VA 1THPB 3SNEA 2BDIA 1O2IA 4AGJA 2P94A 2Y5GA 3LJOA 5FAHA 1YPHE 1O5CB 3SZNA 4FVBA 1O34A 4CRCA 1DY8A 3TK9A 3LH1A 2RA3A 2O8LA 3QX5H 1YYY1 1DWDH 3PMHB 3BTQE 3A7ZA 1EJAA 2VGCC 1GG6B 3ATLA 1ZJKA 1O3NA 4FUJA 1C2IA 3OY6U 2AMDA 1SVPA 1YPEH 4CRGA 2C8ZB 2ZFFH 4K2YA 3MO3A 1RXPA 1TGNA 5TCAA 4B2AA 1MTVA 3R0FA 1ABIH 1O5AB 1C5VA 3BTEE 4RSPA 2BY5X 1EAUA 5A0CA 4OS4A 1PQ5A 7KMEH 4B71A 3LOXA 1GHZA 2NU2E 1MUEB 1DITH 1VJ9U 4DGJA 3MFJA 1C5LH 3URDA 3QUMP 2CV3A 1QGFA 1M9UA 1C1MA 5DP3A 2FI4E 2BLWA 3UTUH 5CE1A 1YKTA 2J34A 3MYWA 1AY6H 5CHAB 3GDVA 3FZDA 3GDUA 1RFNA 1ZPCA 1VZQH 1O36A 3ATIA 4YT7H 2P3UB 3MHWU 4NSVA 2G8TA 1XX9A 1NESE 3ZZ3A 3SORA 1P2OA 1J17T 1MD7A 4KTCA 1YCPK 1C5XB 1TALA 1TPSA 1UHBA 1YGCH 1QJ1B 1LKAA 1FIZA 1EJMA 2BDGA 1IQJA 2SNVA 1AIXH 2ALVA 3M61U 1PPFE 2FS8A 4Y6DA 3T28A 3RXVA 1WUNH 1C1WH 4CHAB 2A1DB 4D9RA 1FZZA 3U9AH 2M5TA 4JZ1A 5JBBS 2OD3B 5A0BA 2ODPA 1WU1A 3RXKA 4INHA 2HRVA 2HPQH 1TGTA 2GT7A 2J4IA 2HLCA 3L3TA 2ZDNA 2GCHG 1A7SA 4CR5A 2R3YA 1RJXB 2WPMS 1L0ZA 1FAXA 2ZFQH 2FO9A 1UCYH 3I29A 3RU4E 1MBMA 2TBSA 1EZSC 1XXDA 1AQ7A 1KXBA 3RU4D 1QR3E 3QTOH 2FTLE 3EDXB 5E2OA 1GBBA 1CT4E 1UTNA 4VGCC 4XE4A 4H42U 2W26A 1FJSA 3RUOA 1V6DA 3KEEA 1GG6C 2ZDAH 3T29A 3T25A 1JMOH 2GZ9A 3SU3A 4WMEA 4MNYA 2BDAA 3UNQA 2OBOA 1QA0A 4WVPE 1Z71A 3RLWH 1YLCA 4Y0ZE 2JH0D 4O03A 5DK1A 1HAVA 1FY5A 3E0PB 1LO6A 3SV7A 2BHGA 1THSH 1VCPA 2TGTA 1BJUA 2P59A 3RXBA 5CHAC 3TNTA 4IGDA 1H8DH 4FUFA 2FLBH 3ZYDA 1GVLA 3A82A 1VJAU 3T2NA 1XM1A 4B75A 1T8NA 1C1SA 2BOHB 4AG2A 1Y5UT 3PO1B 3T5FH 4JZEH 1CO7E 2Q6DA 2AIQA 4X8UH 5EODA 3RM2H 1ZGVA 1HBTH 4TPIZ 4ZMAH 1L1JA 4FXGH 1UO6A 3LGUA 2FOGA 2OP9A 1KXEA 5DGJA 4DOQA 1SGYE 1BHXB 1BBRE 2ZDKA 1HDTH 3SV2H 1ZMNA 2IOTA 3A8BA 1O30A 5I25A 2I6SA 3O8DA 4E05H 4E06H 5H4IB 2ANMH 1GBKA 1OP0A 4KTSA 1CQQA 3SHAH 3LGTA 3PTBA 4AB9A 4Y7AA 3SJIA 2A7HA 1CE5A 1THRH 3QWCH 1HJ9A 1QCPA 2F9UA 3L6PA 4UDWH 4TWWA 1W13U 2ZIQH 2ZP0H 1OSSA 1GJCB 3M5NA 2QV1A 4JYUH 1IQEA 1V2RT 2B9LA 4K5ZA 3M5LA 2XC0A 2WYJA 2TGDA 4B74A 3KQEA 1Y3XA 1C5RA 1EAIA 3SW2B 3BEUA 3U8RH 3A87A 2ZTXA 1JBUH 2SFAA 2XXLA 1LVMA 3M37A 1GVZA 4FUCA 2RA0A 1ELFA 1VR1H 3RDZA 3SJKA 1UJ1A 1TPOA 4IC6A 2CHAB 8LPRA 3A88A 1UVPA 2VWNA 1C5TA 1P2JA 2VIDA 5FCKA 1BA8B 1BRBE 2FS9A 3BTWE 6CHAC 1O0DH 2HNTF 3LJJA 3PLBA 2ZC9H 4RN6A 4MVNA 1FPCH 3FVFB 5J4QA 3ESTA 3RXOA 4GAWA 1SPJA 4DT7B 3RXFA 1HAYB 1V2PT 4MPWA 1HGTH 1MD8A 3KCGH 3T26A 1GBCA 1PPEE 5A8YA 2ILNA 1BTXA 4BAMB 4AFQA 3BTHE 2PSYA 1OWJA 3A86A 5FX6A 6GCHG 3ZZ5A 1FN8A 5EQRA 1G3DA 1DPOA 1V2KT 1LHGH 2XCFA 3N7OA 1L1GA 2VNTA 4OS5A 1MQ5A 5GDSH 4K60A 3BIUH 1FY1A 1C4V2 1XUGA 2UUJB 4I8HA 1P02A 4ZXYH 4AN7A 4Y11E 3TJOA 3C1KA 2PTCE 1ELBA 1IQHA 4KGAA 1SQTA 3BTDE 1SLVB 3OSYA 1QBNA 4D8NA 4F4OC 1HAPH 3PROA 3B8JA 4I8KA 1P8VC 5F03A 1OP8A 2VIWA 3SI3H 1O3OA 1MMJN 4YZUA 2WPLS 1ARBA 3ZZCA 4X8TH 1KLTA 4ZKRU 2OTVA 3KQDA 2SGFE 1P12E 1Y3WA 1P3CA 2KAIB 2OQ5A 1S83A 3MNXA 3M3TA 1QTFA 2ZCHP 1EAXA 1GHAG 5GXPA 1C4U2 2XTTB 4BOHA 2SGQE 1EQ9A 4X1QU 2V3HH 1DWEH 1LHDH 1PJPA 3EA9A 1MU6B 1OKXA 1P06A 1SFQB 2QXIA 2BM2A 4NFEA 2ZFPH 3TJUA 4XFQA 1QURH 2WPIS 3RXQA 1BCUH 1P05A 2R2WU 1O38A 1TRYA 1SFIA 4M7GA 2BD7A 2CHAC 2CGAA 3GOVB 4HTCH 1HRTH 1AU8A 1ANDA 2V6NA 5E2PA 3JZ2B 4JCNA 3OY5U 2A5KA 4MPXA 1ZTJA 1GHXH 1O3GA 2I6QA 4ZXXH 1V2WT 4X2VA 1MQ6A 3M7QA 1CA8B 2PUXB 4Y79A 2AS9A 5A0AE 4BXWA 1TOMH 3HPTB 1K9OE 1TNIA 1AZZA 2VVCA 2GCHF 4K1SA 1SC8U 1ELDE 3GCHB 2O8WA 3RLYH 2UWOA 1DXWA 4ESTE 1O5DH 1XUFA 1DVAH 2H1UA 3DFJA 2G51A 2XBYA 1UVOA 3HK3B 3E0NB 5LPRA 2AH4X 1HXFH 4GLYA 1NFXA 2GZ7A 2DUCA 3VPKA 1O31A 1CA0B 3MU8A 1SGNE 1BTZA 3UNRA 2QY0B 3PWCA 3GY7A 4Q7YA 2V0BA 1D6RA 2YOLA 3SU4A 1AUJA 2G5VA 1YP9A 2ZFTA 1DUEA 4WH6A 1FNIA 3A83A 2LIZA 3SHCH 1ZHPA 2BD8A 4H6TA 3V7TA 1BRAA 1RIWB 4GUXA 3CS0A 1B0EA 2Y5HA 1Y59T 2Y81A 4YM9A 3RXDA 2A31A 1S84A 1JXPA 3LGVA 4BANB 3Q3YA 1P09A 1GJ5H 2BX4A 4X6NA 2PLXA 1UCYK 2A4QA 1MZAA 4TWYA 1H1BA 1O2XA 2HVXA 1GJAB 1BMNH 1SHHB 2R0KA 4ZHMU 1GHWH 4FU9A 1TIOA 3RXLA 1EOLA 2EA3A 3LKWA 3SJ8A 1ELAA 3T27A 1O3AA 4DURA 4E7NA 5K0HA 5EQSA 1TBZH 1A3BH 1DT2A 2B7DH 4A6LA 2A4GA 2NU1E 1GI1A 3S0NA 1SB1H 2QA9E 1DLEA 1HAGE 1IQMA 3M5OA 1KDQA 1GI8B 4ABBA 1O35A 3EA7A 1GHBF 2G81E 2ZU5A 1CVWH 5E0HA 5C20A 3P17H 2GTBA 1ELCA 1AB9C 3SNCA 1FI8A 1WAYB 3OU0A 5ABWA 2ZKSA 3VGCC 3ZVAA 1P3EA 4SGAE 5AVDA 1V2UT 5C67A 1K2I1 3D23A 4ZROA 2GMTC 3SN8A 2QC2A 3H7TA 1GJ8B 3GY4A 3SUEA 2GGVB 1BTWA 2QXHA 4D7GA 1O2UA 2ZHEH 1YM0A 1FMGA 1WSSH 1G9IE 5A2MH 5T3HA 3U1JB 1ZLRA 3H7OA 2R2MB 1HJ8A 2FOCA 4GVUA 3OX7U 3E8LA 4THNH 1P2MA 1Z1IA 1NY22 4YESB 9ESTA 2Z9GA 2UUKB 1QHRB 4YLUA 2V3OH 2ZO3H 1O3BA 3NKKA 3ZV9A 1K1JA 3MI4A 4CRDA 1GMHG 3SU5A 3AW1A 3EAJA 1OYTH 1SMFE 1CGHA 1ORFA 1WTHD 1C5ZB 3TVJB 2ZGBH 1QNJA 1GJDB 1O2WA 2OC0A 3VB6A 2A2QH 3F9HA 3SBKA 1CA0C 2Y7ZA 1YPMH 3QZRA 1K28D 1P0SH 1YPHC 4YT6H 2W7UA 3HK6B 3UWIA 4TPYA 1QA7A 1J15A 3A7XA 1MKXH 2YNBA 1NN6A 2WYGA 4K1TA 1T4UH 2AMQA 4JK5A 1KXAA 2ZA5A 1ESAA 1HAZB 1ZMJA 1FN6A 1NRPH 4ZKOU 3LPRA 1NU9A 3MO9A 3QLPH 1HIAA 2VIOA 4I7YH 5EXMA 1AO5A 1AFQB 1MCTA 3V13A 2Q1JA 3QK1A 1EPTC 1MU8B 4IC5A 3LU9B 1P01A 4BTUB 3ODDA 3NZIA 4IN2A 1A5GH 4YO9A 2BVRH 1TRMA 2IPHA 2ZEBA 2ZFSA 4I8JA 6GCHF 1TPAE 2J38A 1SSXA 5EXNA 2HWLB 1V2VT 2W3IA 3V0XA 1ETTH 3P8GA 4HGCA 1MAYA 1HV7A 1GBHA 2D8WA 1DE7H 1TNGA 4AZ2B 1CT0E 1J16A 1H8IH 1DDJA 1P2IA 1S0QA 2QXGA 3HKIB 2PSXA 3LC3A 3QGJA 1XXFA 1KLJH 1Z1JA 1SGFG 1C2EA 1NROH 5T6FA 1T7CA 3MU5A 2QF3A 5JPMH 1UTQA 5FPSA 4NG9H 1F0RA 2SGEE 4NZQA 1E37B 2QCYA 2FI5E 3MU1A 1S6HA 1DANH 1C1OA 1ZRBA 4CH2B 1RD3B 1WYKA 5EQQA 3TU7H 1QQUA 3NXPA 4NSYA 3ZVCA 1L4ZA 1O2TA 1BHXF 2BVXH 1PYTD 1PPGE 2XYAA 1Z8GA 2TRMA 4X2XA 1ELTA 2ZPRA 1TGCA 1ZSKA 4OS6A 2EI7A 1Y5BT 3PM3A 1O5EH 2GDDA 3A80A 1C5OH 1UTJA 5LH8A 1Q31A 2Z9LA 4YOIA 5HGGA 1GHAF 1S85A 2ZGCA 3SGBE 1NO9H 2P8OB 1TBRH 2BVSH 1FV9A 2P95A 5HM9A 5EW2H 1PPBH 3P8OA 1O3IA 4ASHA 4ZUHA 4ABAA 1GJ4H 3S9CA 2G00A 1DM4B 4CRBA 1BUIA 1O2GH 3RXRA 1CBWB 4ZHLU 1GHVH 4OS2A 1C2DA 2VWLA 1EZUC 3IWMA 1Q3XA 2K1QA 7GCHG 1EB1H 1W12U 3LT3A 2BB4A 2AGGX 3STJA 1AKSA 2V35A 1TX7A 1N6YA 1NFWA 4FUGA 9LPRA 3TGIE 3K2UA 4SGBE 2RDLA 3SU2A 2OXSA 5GIBA 4FUIA 3TJVA 1SOZA 3KF2A 3MH4A 1AGJA 4D9QA 1ZPZA 4U2WA 1ESTA 1LPZB 4A92A 1TA2A 4XOJA 2H2ZA 1EATA 3RC6A 4AYVB 1BRUP 1NC6A 1GCTB 4K1EA 1NRSH 1TX8A 3O8BA 2BY9X 5DP9A 1P10A 1UTPA 1YC0A 2QGRA 2VIPA 2TIOA 2ZF0H 1V2ST 3GY5A 3F9GA 3F9FA 3BTGE 4JYVH 3GISB 5L6NH 3MNSA 1KIGH 4CREA 4YOGA 5DO4H 2PFEA 1L2EA 3MNCA 5TCCA 4ABDA 1G2LA 2XW9A 1IHSH 1VITG 4MNWA 2ZTYA 3IITA 2D1JA 5E8EH 1BITA 4B1TA 1UHBB 1G32B 2O8UA 3MOCA 2BY8X 1YBWA 3NUMA 1ZR0A 1C1PA 2GD4B 1EZXC 2ULLA 3QO6A 5C5NA 1K1PA 4FU8A 2NWNA 4XBCA 2GV7A 3VFEA 1GBLA 4B2CA 4CRAA 4CRFA 3AAVA 3SOSA 1XKBC 1IAUA 8GCHF 3C27B 3MH5A 1ZGIA 4NA8A 2OQUA 4H6SB 3TJNA 1C9TA 4OS1A 5EU8A 2GVFA 1GHYH 1AE5A 3SNBA 2AMPA 2PWXA 2GZ8A 1JIRA 1A1RA 1DWCH 2CN0H 5HXFA 1QBVH 1GPZA 4QT8C 2A4RA 1BB0B 1CU1A 1IQGA 4IMZA 1V2QT 3RXIA 3DD2H 3M3SA 4CHAC 4IW4E 2RG3A 4WMFA 2FESH 4J2YB 1T31A 1C5NH 1G30B 1O2JA 3NK8A 1W3CA 5GPIB 1CBWC 1F2SE 1BOQA 4JK6A 4OGXA 2EI6A 4ZKSU 2FODA 5C3NA 4B76A 1NS3A 2BQWB 2H5CA 3LGIA 4INLA 1LQEA 3VB7A 1C1TA 3RXSA 4X6MA 1VCQA 3BN9A 3RC4A 2W3KA 1G37A 1SGIB 1HYLA 3I77A 5DP6A 1LKBA 2BMGB 3TIUA 1AVXA 1NU7B 3MMGA 1TB6H 3A7WA 1TBQH 1SQOA 1ZTKA 1ID5H 4DY7B 2STBE 2BDBA 1HAXB 2BQ7B 1ZSJA 3K9XB 3ZVFA 1GBAA 1C9PA 1GMHF 3GCTF 1ETSH 3SI4H 3ENSB 4WMDA 1LQDB 2ASUB 1HAVB 3SQHE 3TLOA 4WXVA 1BTHH 1OWKA 1H4WA 2FDAA 4WWYA 3W95A 2FLRH 2NU3E 1O2HA 2ZGJA 2QAAA 1IQFA 4JYTA 2ZHQH 2XWBI 3U8TH 2DE9A 3ATWA 1D3QB 1UVSH 2UUYA 5I46H 1C5QA 1YCPM 4FUBA 2C93B 1IQNA 2F3CE 5G4BA 2FWWA 1O2OA 1AWFH
chains in the Genus database with same CATH superfamily
3ZZ6A 2JJ1D 1AZ8A 4UONA 2OUAA 1KXDA 4D7FA 1DSTA 3VB4A 2H9TH 2C8YB 5DJ7A 4PROA 3RXCA 1MTNB 2SGAA 2PKAA 1IQKA 1ELEE 4WJG2 6LPRA 5EXLA 4X2YA 1EFRD 2M2AA 1WCZA 2P16A 5K7RA 1EAWA 3R3GB 4AORA 2A4OA 5KGOA 1C2GA 1G36A 3FP7E 1V2TT 2O8TA 1FUJA 2FMJA 3PO1C 2GP9B 1E38B 3DUXH 1O2VA 3BV9B 3L33A 1TLDA 2SNWA 1A5HA 3TK5A 1SGCA 2PHBA 3P70B 4X1RU 4UFEH 4X1SU 3RP2A 2TGPZ 1MKXK 2XBXA 2ANKH 1O2SA 3DT0H 2K0QA 2J98B 1LHCH 2VVVA 4FETA 1LHEH 3OTJE 1UVTH 1DX5M 2OC1A 1AE8H 1GJ6A 1T8LA 2EI8A 3QGNB 2ODYB 2Y6TA 2BDYA 1TX6A 5L30H 1LTOA 3QZQA 4XBBA 4ZH8A 4RKOB 1OX1A 2W6JD 4AB8A 3DA9B 3SJOA 1GI0A 3V3MA 1WQVH 2C8WB 5LGOA 1YPGH 3RM0H 2Y82A 2BY6X 1UTMA 1B0FA 3M36A 2FOBA 1EPTA 2PTNA 3ODFA 2GCTB 3TPIZ 1ANEA 1C5WB 3ZYEA 1WQSA 2A5IA 4F49A 1AVGH 1S81A 1K1LA 1E0FD 2F9BH 2G4TA 2HPPH 3PTNA 3SGAE 2Z6BD 3MH7A 5CHBA 5DP5A 1VGCB 5EPNA 2XBVA 1C2MA 2OCVB 3PWBA 2BD9A 2VIVA 3O8RA 3U98H 3CNRA 3TH4H 1A0HB 1OWHA 1UK3A 1FONA 2Z3EA 1XUKA 2BZAA 1QBOA 3SUDA 1BMAA 1ACBE 5DPAA 2G5NA 1TRNA 4INKA 1CGIE 2GDEH 1QL7A 1G3EA 2FZZA 4IN1A 4E7RG 7GCHF 2F83A 2RFKC 2Y80A 1AD8H 2R0LA 2A32A 1CHOG 7LPRA 3HGNA 1TNJA 2SGPE 1ZJDA 2BD3A 4BTIB 1A46H 2FOEA 4NIWA 1MTUA 1GI9B 1U6QA 1XUHA 1NFUA 1A4WH 1ZYOA 1P9SA 1W10U 4Q63A 2NU4E 1UTOA 2PV9B 3GY3A 3RXTA 1WBGB 3SU1A 1ELGA 2FM2A 2AGEX 5A8ZA 3SUGA 3PYHA 3EA8A 2HGTH 1INCA 5E0GA 3P95A 1DOJA 3E3TA 1KTTB 2XNIA 2F9NA 4ABFA 4ZHAA 1P9UA 3UNSA 4I33A 5DG6A 1HCGA 3KIDU 5TJXA 3ZVGA 4ISOA 3VG8A 1HUTH 5T6DA 5ESBA 2VWMA 4JZIA 1FY4A 2BD5A 1T32A 3HKJB 3ELAH 1O2ZA 2Y7XA 2BD4A 4HG6A 1VITF 3LONA 1LCYA 1YLNA 4U32A 1SR5C 2P93A 3SZEA 2AGIX 1O37A 1FIWA 1O33A 1KXCA 3PLPA 2UUFB 3ZVEA 1FAKH 2FXRA 3GY8A 2QF0A 1TMUH 4Y0YE 3UR9A 2VGCB 1NRQH 3U8OH 2GT8A 4BAKB 1P11E 1DUAA 4UFGH 3M3VA 1B7XB 3A81A 2RCEA 4NCYA 1EXFA 3P8FA 2GCTC 3UAIC 3FO8D 1BMMH 1JIMA 2AFQB 1GDQA 2FTMA 4IMQA 4MQAA 4LZ4B 4ISNA 1H9LB 2YMSB 1C1VH 1OYQA 1ZPBA 3URCA 5JB8S 2VWOA 2BOKA 1S0RA 4XRNA 2ZU2A 4WF8A 4AYYB 2R3UA 4O3UA 2J9NA 1DICA 1DY9A 1J9CH 3BEFB 4RI0A 2O9QA 1DS2E 1Z8RA 2A5AA 3SUFA 1BTPA 1EOJA 2THFB 1TNHA 4TT3D 3UPEA 4GHTA 1P2NA 5C1XA 1SLUB 3S69A 4NGAH 1V2NT 1UK4A 4X0WU 4ABGA 2B0FA 4Y71A 3CP7A 2QXJA 4K69A 5LPFA 3GCHC 2QF5A 1W8BH 4X1PU 5C1UA 1OS8A 4GCHG 1GJ9B 1YF4A 2OINA 1ZHRA 2QN5T 2P3FH 3A7YA 3B23B 2ZDVH 3GCNA 1HPGA 1O5GH 4F48B 4I31A 2LPRA 4FUHA 1C2FA 2FOFA 1P2KA 1TGSZ 1LMWB 2QYIA 3BTME 2VB0A 4JMYA 4ZAEA 2PGQB 4TYDA 3MTYA 2CMYA 5FHTA 1N6XA 2VU8E 1BMLA 1PQ7A 1ZZZA 1RIWC 1ZSLA 1KTSB 2HNTE 1UVUH 1NZQH 1P04A 3D49H 1VCWA 2GX4A 1RRKA 1E1RD 1GI5A 3M35A 1V3XA 3U69H 1T8MA 1GDUA 4B73A 1QL8A 3NCLA 1ANCA 1MZDA 1C2HA 1CHGA 2KCYA 4ABEA 2W7SA 4AFSA 4MTBA 2ZFRH 1OOKB 5PTPA 3RXUA 1IQLA 2G52A 4A1VA 1C4Y2 5C2ZA 1KDQB 2QE7D 2VINA 2OLGA 4U01A 2AYWA 1BTUA 1P03A 4H4FA 5GCHG 1QY6A 2XRCA 1LDTT 3KN2A 1ZMLA 1SGQE 1WTGH 3ZZ9A 1LPGB 5AHGH 1C5SA 3VXEH 1SGDE 1OWEA 4VGCB 3JZ1B 1PQAA 3KQCA 1NFYA 3AASA 1O2LA 1O2YA 3FP8E 1GJ7B 2VIQA 3SJ9A 2JIZD 3GCOA 1TOCB 2UWPA 1C1UH 4Y7BA 2BLQA 1W11U 1W7GH 4DIHH 1PYTC 4NWKA 3QTVH 5FBEA 3ZZBA 2TPIZ 3BTFE 3SV6A 1FY8E 1GJBB 4Y10E 3A8DA 4Z0KA 3F68H 5EGMA 1GMDG 1L4DA 3SU0A 1QL9A 2ZZUH 3ZV8A 2H6MA 3PMAB 5JB9S 2FP7B 2YMSC 3SNDA 1ARCA 1K1MA 4A7IB 4AOQA 2ZU1A 1IHTH 1C2KA 3D65E 4MDSA 4IS5A 3EBNA 1OPHB 4YTAA 3FP6E 2JJ2D 1OP2A 3NPSA 2Z9IA 4DG4A 2BDHA 2FOMB 4B6EA 1PPCE 4DJZB 3V12A 4TY6A 3AW0A 2ZHDA 3TGJE 2A7JA 3E16B 2OC8A 1GI6A 3UREA 4YOJA 1A5IA 3RXGA 2H5DA 2VH6A 1Z6EA 1JRSA 4IBLH 4OS7A 4XDEA 5F53A 3TNSA 2ZU4A 1O39A 1PPZA 2WUBA 3F3BA 1AWHB 1RTLA 3EE0B 2F9PA 3TK6A 1W0YH 4ZKNU 1S5SA 1G2MA 4GSOA 1HIAB 4RKJB 2IJOB 1GL1A 3QDZB 3O8CA 1FY3A 1UMAH 4D76A 3SV9A 2WUCA 1ETRH 1VITH 5FX5A 1UK2A 1UTKA 2KX4A 3AVZA 1GI4A 3GDSA 4OGYA 1E36B 4LXBH 2WV9A 4MPVA 5F6MA 1AI8H 5IDKA 3ATMA 2ZDMA 1N8OB 3TH3H 3MH6A 4I8GA 1AFQC 1WDIA 5FPTA 2XC4A 3PB1E 3A8CA 4U30A 4M9FA 2AEIH 4HI3A 2JETB 2ZCLP 4Y76A 2FOAA 1Y3UA 5B6OA 2V3MA 1TWXB 4UD9H 1ZTLA 1BBRH 2K7XA 3UIRA 1EJNA 4B2BA 2XC5A 4I32A 5A09A 4MNVA 3KL6A 1T8OA 1CHOF 4AC9A 1GMCG 1SBWA 3VB3A 4GPGA 1A2CH 2JKHA 2YNAA 1YPKH 1BJVA 1FXYA 1TE0A 1J8AA 2BLOA 1GBFA 3BTKE 5FBIA 3A85A 4Y8XA 3S7KB 4X6PA 3UUZA 1RTFB 2FPZA 2Y5FA 1XVMA 2JH5D 2ZQ2A 4DCDA 1MKWH 1Z7KA 4MLFB 3FANA 1GWAA 5HMAA 6CHAB 3F2FA 3PLKA 1O2MA 1T4VH 1SQAA 4MNXA 1ZRKA 1XUIA 1QRXA 1K22H 1WV7H 1SLWB 3U28C 2BLVA 3NRLA 4Q80A 2WV4A 4NWLA 4BNRA 1GGDB 1O5FH 1TNLA 2ESTE 2G4UA 4UFDH 3EQ0H 1SI5H 4A1TA 4KKDA 3WW7A 5DP8A 1NPMA 5IYTA 3DSOA 3GICB 1BRCE 4O9VA 1S6FA 2QIQA 1HAHH 1O3CA 1GDNA 3KYFA 1PQ8A 2BXUH 3GYMA 5GWZA 3RXHA 4KP0A 2ZPSA 1AUTC 2UWLA 1W0ZU 3ZVBA 8ESTE 2ZDLA 1F0SA 1IQIA 1WOFA 4CR9A 4NIVA 1YWUA 1UCYE 2LELA 1JRTA 4B6FA 2BX3A 1KLIH 2IN2A 2A45B 8KME2 3N7EA 2EC9H 2P8OC 1GHBG 3Q76A 2PKSB 1GI2A 4TY7A 5DP7A 2ALPA 4ISLA 3ZVDA 1AKSB 1GI3A 3EYDA 3A89A 3UR6A 1W14U 4NIXA 2ZGXH 1HXEH 1OWDA 3UQVA 2C4FH 4KTUA 6ESTA 3MO6A 1C2LA 2F91A 3AAUA 1V2OT 3MNBA 3BSQA 3S7HB 1EB2A 3PRBA 2PGBB 4OM9A 3KHVA 1O3HA 1F7ZA 5DN6D 1TABE 2BDCA 2KCOA 2BXTH 5J4SA 1V2JT 2ZTZA 4ABJA 2G55A 1BMFD 1MTWA 2H9EH 1BDAA 3RXJA 2PR3A 2XWAA 1HJAB 1X7AC 1K1NA 4NFFA 1C5YB 1ABJH 2W5EA 1N8OC 3RXAA 1TYNA 4NIYA 1O2NA 1S82A 1C5MD 2BZ6H 2ZHFH 5SGAE 4DIIH 3LIWA 2JETC 2C90B 1O2QA 1TAWA 3F9EA 2XCNA 1WXRA 2BD2A 2KAIA 1G3BA 5C5OA 1QB6A 5A8XA 1O2PA 1GCTC 4GCHF 5C1YA 3UQOA 4MG3A 5FCRA 3K65B 3UOUA 4NZLA 1O3PB 5B6LA 1S6LA 2D26C 2FYRA 1ZHMA 2XBWA 3HGPA 1LVOA 1YPLH 3D62A 1D3TB 2F43B 4JZFH 3I78A 3TGKE 1D9IA 1TONA 2Z94A 3S9BA 4P02A 1AHTH 3UFAA 3U1IB 1RS0A 3PMBB 1AMHA 1GGDC 4R0IA 4XSKU 2GJGA 5FXLA 3SV8A 4FOUC 2QF4A 2AERH 1GBTA 2WPHS 2ZCKP 2VJ1A 3SNAA 5HIZA 1D3DB 2B5TB 2ZWLH 1GCDA 1A0LA 1YCPH 3CENA 2FIRH 4Q7ZA 3ITIA 4Q7XA 3ZZ8A 5JBTA 3LGYA 2Z9KA 1O3MA 5GCHF 1QRZA 2GKVE 1Z8JB 1UTLM 4FVDA 1AFEH 1DFPA 1K21H 2ZI2H 3MU4A 4GHQA 1C5PA 3ZZAA 4KELA 3NWUA 1MH0A 3CS7A 1TGBA 1BT7A 3A7VA 5EJZA 4AFUA 2B8OH 1CT2E 2A7CA 5EIYA 3RMOH 5JDUB 4WY3A 2ANWA 2Q6FA 3Q00A 1AVWA 1HB0B 4J1YA 2PKSC 3H5CB 1KYNA 5HM2A 1O2RA 2KCAA 4UE7H 1O3FA 1G3CA 3VB5A 4K8BA 4DW2U 3BEIB 4Y8ZA 1O3LA 1TMBH 4X8SH 3E90B 5JBCS 1QJ6B 1D4PB 2WINI 1GMDF 3STIA 4AX9H 2Z3CA 1XKAC 4XD7D 4XBDA 2FYQA 2CF9H 1YPJH 1BQYA 2CF8H 1YY3A 2O8MA 2H9HA 2WPDD 2SGDE 2NU0E 2LNCA 3MWIU 3DHKH 5ESTE 1C1QA 2JH6D 3RXPA 1DWBH 3FZZA 1MAXA 4CH8B 4AFZA 2C3SA 1DSUA 2W6ID 3P6ZB 3GYLB 1TPPA 1HJAC 1EUFA 4HZHA 2HALA 3M5MA 3Q3XA 3B9FH 3GY6A 1W7XH 1F5KU 1SG8B 3BG4B 1F0TA 1P57B 4A5TS 1GVKB 1QFKH 4YXWD 4WXIA 1JWTA 1QB9A 1J14A 3ZZ4A 4CBNA 1TNKA 5EJ1A 3G01A 3A7TA 1IOEA 1AB9B 3P92A 2BYAX 3VGCB 4I86A 1SGFA 3WY8A 2C8XB 4TSFD 1C1RA 1SLXB 1EZQA 1NRNH 2ZG0H 1BZXE 3DFLA 4AGKA 3OAAD 1EP6A 2GMTB 2BY7X 2KR7A 3WWBA 3TITA 2EEKA 3N99A 2PKAB 4BAQB 1CGJE 1A61H 3LGWA 3LH3A 3F1SB 3W94A 3RC5A 1O3KA 5JBAS 2RDEA 1F0UA 3RMNH 1PFXC 1O5BB 1TMTH 1YLDA 3GY2A 4FUDA 4A1XA 5AFZH 5FPYA 1TQ0B 1O3JA 2J94A 1GBEA 1GL0E 1C5UA 1K1OA 1MTNC 4Z6AH 3SQEE 1SL3A 1FX0B 2FEQH 1Z6JH 1EP5A 3HATH 4O3TA 1HAIH 3BIVH 1LVBA 3LC5A 4JZDH 3KNXA 5E0JA 3PRDA 1KXFA 2Z9JA 4NA9H 3P8NA 5F8ZA 2F9OA 2J95A 5ETXA 1KSNA 1GMCF 1RGQA 2DE8A 5EOKA 5DKMA 2OC7A 2VH0A 1W2KH 2ZPQA 1D3PB 2HOBA 3ATKA 3QN7A 1E34B 3K6YA 1H9IE 1NRRH 1TA6A 4Q4LA 4LOYH 3BTTE 1ANBA 1H9HE 1NTPA 1QJ7B 2ZGHA 5L2YH 2OBQA 4P00A 1Z8IB 1P2QA 5AF9H 4R8TB 2J92A 2ANYA 1F5RA 1CSOE 2ZNKH 4CBOA 2Q6GA 1EKBB 5BRRE 3Q3KA 3Q77A 1C1NA 3RMLH 1FPHH 3PV4A 1HFDA 4O97A 7ESTE 5EG4A 1MTSA 5BPEA 1K1IA 1HAOH 1Y3YA 1EPTB 3E6PH 4X2WA 1RTKA 2P3TB 4BAOB 5CMXH 1ELVA 3KQBA 1GBMA 3TH2H 3A8AA 3RMMH 5IK2D 1BBRK 3SO3A 1OWIA 1LHFH 3WWFA 3RXMA 4X6OA 1VKYA 3UOPA 3E1XB 1KY9A 2PUQH 1DXPA 1PPHE 1MBQA 2BQ6B 5GJ4B 1ZOMA 4I8LA 5HYOA 1ESBA 4AG1A 8GCHG 1O3EA 3KGPA 5AFYH 4MPUA 1SOTA 4NA7A 4ABHA 3LDXH 1O32A 4F55A 1D6WA 1QB1A 1A3EH 1MKWK 1O2KA 3UWJH 4BTTB 1F5LA 2AIPA 2ZU3A 1HLTH 2FOHA 3BF6H 2ZECA 3ZZ7A 2IPQX 1FQ3A 5LPEA 3K6ZA 3VEQB 4LZ1H 3PMJA 3BG4C 1C2JA 1LVYA 3F0PA 2Z3DA 3OTPA 3EGKH 1O3DA 1TQ7B 2GV6A 1A0JA 1VGCC 4YLQH 1NM6A 1EX3A 3DSGA 4ISHH 2ODQA 3RU4T 3VXFH 3T62A 2FX6A 3SU6A 1TFXA 2VVUA 1SGTA 1E35B 2A2XH 2PW8H 4ABIA 2R9PA 1XUJA 4ISIH 1N1LA 1FDPA 4X1NU 1LPKB 4X8VH 1BIOA 2WPKS 5F8XA 4K3JA 3SYJA 3OE7D 1SGEE 3MU0A 1DLKB 1AN1E 1JOUB 4Y8YA 1Y5AT 1E79D 4BAHB 3UY9A 1V2LT 5DP4A 3SGQE 1GBDA 5EW1H 4DVAU 2OK5A 3BG8A 3OYPA 1BTYA 4BXSA 2BTCE 2HNTC 1V2MT 5T6GA 1Y8TA 3S9AA 1Q2WA 1GBJA 5F8TA 3E91A 3RXEA 1SQRA 1HNEE 1QQ4A 4FUEA 3FAOA 1NT1A 5L2ZH 1SHYA 3M7UA 1F92A 4DT4A 4UFFH 3GCTG 1GI7B 1SGRE 1XMNB 3M7TA 4K8YA 3FFGA 1GBIA 2WPJS 2STAE 4FU7A 1SGPE 1Y3VA 1B5GH 1L1NA 1OXGA 2A0QB 2FI3E 1FLEE 4Q2KA 4UEHH 2CXVA 5JYIA 4LK4A 3A84A 3F6UH 2D2DA 1EASA 1MCVA 3ZZDA 2CJIA 2WV5A 4HFPB 5EPYA 2FX4A 2ZHWH 1SKYE 2J2UA 3IG6B 2ZQ1A 2Z7FE 2TGAA 4WH8A 1QIXB 1QRWA 1XVOA 2F9VA 1THPB 3SNEA 2BDIA 1O2IA 4AGJA 2P94A 2Y5GA 3LJOA 5FAHA 1YPHE 1H8HD 1O5CB 3SZNA 4FVBA 1O34A 4CRCA 1DY8A 3TK9A 3LH1A 2RA3A 2O8LA 3QX5H 1YYY1 1DWDH 3PMHB 3BTQE 3A7ZA 1EJAA 2VGCC 1GG6B 3ATLA 1ZJKA 1O3NA 4FUJA 1C2IA 3OY6U 2AMDA 1SVPA 1YPEH 4CRGA 2C8ZB 2ZFFH 4K2YA 3MO3A 1RXPA 1TGNA 5TCAA 4B2AA 1MTVA 3R0FA 1ABIH 1O5AB 1C5VA 3BTEE 4RSPA 2BY5X 1EAUA 5A0CA 4OS4A 1PQ5A 7KMEH 4B71A 3LOXA 1GHZA 2NU2E 1MUEB 1DITH 1VJ9U 4DGJA 3MFJA 1C5LH 3URDA 3QUMP 2CV3A 1QGFA 1M9UA 1C1MA 5DP3A 2FI4E 2BLWA 3UTUH 5CE1A 1YKTA 2J34A 3MYWA 1AY6H 5CHAB 3GDVA 3FZDA 2WSSD 3GDUA 1RFNA 1ZPCA 1VZQH 1O36A 3ATIA 4YT7H 2P3UB 3MHWU 4NSVA 2G8TA 1XX9A 1NESE 1H8ED 3F0OA 4RT1A 3ZZ3A 3SORA 1P2OA 1J17T 1MD7A 4KTCA 1YCPK 1C5XB 1TALA 1TPSA 4ACBA 1UHBA 1YGCH 1QJ1B 1LKAA 1FIZA 1EJMA 2BDGA 1IQJA 2SNVA 1AIXH 2ALVA 3M61U 1PPFE 2FS8A 4Y6DA 3T28A 3RXVA 1WUNH 1C1WH 4CHAB 2A1DB 4D9RA 1FZZA 3U9AH 2M5TA 4JZ1A 5JBBS 2OD3B 5A0BA 2ODPA 1WU1A 3RXKA 4INHA 2HRVA 2HPQH 1TGTA 2GT7A 2J4IA 2HLCA 3L3TA 2ZDNA 2GCHG 1A7SA 4CR5A 2R3YA 1RJXB 2WPMS 1L0ZA 1FAXA 2ZFQH 2FO9A 1UCYH 3I29A 3RU4E 1MBMA 2TBSA 1EZSC 1XXDA 1AQ7A 1KXBA 3RU4D 1QR3E 3QTOH 2FTLE 3EDXB 5E2OA 1GBBA 1CT4E 1UTNA 4VGCC 4XE4A 4H42U 1QZ8A 2W26A 1FJSA 3RUOA 1V6DA 3KEEA 1GG6C 2ZDAH 3T29A 3T25A 2EY4C 1JMOH 2GZ9A 3SU3A 4WMEA 4MNYA 2BDAA 3UNQA 2OBOA 1QA0A 4WVPE 1Z71A 3RLWH 1YLCA 4Y0ZE 2JH0D 4O03A 5DK1A 1HAVA 1FY5A 3E0PB 1LO6A 3SV7A 2BHGA 2K8IA 1THSH 1VCPA 2TGTA 1BJUA 2IJD1 2P59A 3RXBA 5CHAC 3TNTA 4IGDA 1H8DH 4FUFA 2FLBH 3ZYDA 1GVLA 3A82A 1VJAU 3T2NA 1XM1A 4B75A 1T8NA 1C1SA 2BOHB 4AG2A 1Y5UT 3PO1B 3T5FH 4JZEH 1CO7E 2Q6DA 2AIQA 4X8UH 5EODA 3RM2H 1ZGVA 1HBTH 4TPIZ 4ZMAH 2F4LA 1L1JA 4FXGH 1UO6A 3LGUA 2FOGA 2OP9A 1KXEA 5DGJA 4DOQA 1SGYE 1BHXB 1BBRE 2ZDKA 1HDTH 3SV2H 1ZMNA 2IOTA 3A8BA 5GNDA 1O30A 3H09A 5I25A 2I6SA 3O8DA 4E05H 4E06H 5H4IB 2ANMH 1GBKA 1OP0A 4KTSA 1CQQA 3SHAH 3LGTA 3PTBA 4AB9A 4Y7AA 3SJIA 2A7HA 1CE5A 1THRH 3QWCH 1HJ9A 1QCPA 2F9UA 3L6PA 2J98A 4UDWH 4TWWA 1W13U 2ZIQH 2ZP0H 1OSSA 3OFND 1GJCB 3M5NA 2QV1A 4JYUH 1IQEA 1W0JD 1V2RT 2B9LA 4K5ZA 3OEED 3M5LA 2XC0A 2WYJA 2TGDA 4B74A 3KQEA 1Y3XA 1C5RA 1EAIA 3SW2B 3BEUA 3U8RH 3A87A 5C0TA 2ZTXA 1JBUH 2SFAA 2XXLA 1LVMA 3M37A 1GVZA 4FUCA 2RA0A 1ELFA 1VR1H 3RDZA 3SJKA 1UJ1A 1TPOA 4IC6A 2CHAB 8LPRA 3A88A 1UVPA 2VWNA 1C5TA 1P2JA 2VIDA 5FCKA 1BA8B 1BRBE 2FS9A 3BTWE 6CHAC 1O0DH 2HNTF 2KFWA 3LJJA 3PLBA 2ZC9H 4RN6A 4MVNA 1FPCH 3FVFB 5J4QA 3ESTA 3RXOA 4GAWA 1SPJA 4DT7B 3RXFA 1HAYB 1V2PT 4MPWA 1HGTH 1MD8A 3KCGH 3T26A 1GBCA 1PPEE 5A8YA 2ILNA 1UW7A 1BTXA 3KQ5A 4BAMB 1E1QD 4AFQA 3BTHE 2PSYA 1OWJA 3A86A 5FX6A 3DCLA 6GCHG 4ASUD 3ZZ5A 1FN8A 5EQRA 1G3DA 1DPOA 1V2KT 1LHGH 2XCFA 3N7OA 1L1GA 2V7QD 2VNTA 4OS5A 1MQ5A 5GDSH 4K60A 3BIUH 1FY1A 1C4V2 1XUGA 2UUJB 4I8HA 1P02A 4ZXYH 4AN7A 5KECA 4Y11E 3TJOA 3C1KA 2PTCE 2KM0A 2L74A 1ELBA 1IQHA 4KGAA 1SQTA 3BTDE 1SLVB 3OSYA 1QBNA 4D8NA 4F4OC 1HAPH 3PROA 3B8JA 4I8KA 1P8VC 5F03A 1OP8A 2VIWA 3SI3H 1O3OA 1MMJN 4YZUA 2WPLS 2J5UA 1ARBA 3ZZCA 4X8TH 1KLTA 4ZKRU 2OTVA 3KQDA 2SGFE 1P12E 1Y3WA 1P3CA 2KAIB 2KZ4A 2OQ5A 1S83A 3MNXA 3M3TA 1QTFA 2ZCHP 1EAXA 1GHAG 5GXPA 1C4U2 2XTTB 4BOHA 2SGQE 2XNDD 1EQ9A 4X1QU 2V3HH 1DWEH 1LHDH 1PJPA 3EA9A 1MU6B 1OKXA 1P06A 1SFQB 2QXIA 2BM2A 4NFEA 2ZFPH 3TJUA 4XFQA 2CK3D 1QURH 2WHXA 2WPIS 3RXQA 1BCUH 1P05A 2R2WU 1O38A 1TRYA 1SFIA 3FN8A 4M7GA 2PP6A 2BD7A 2CHAC 2CGAA 3GOVB 4HTCH 1HRTH 1AU8A 1ANDA 2V6NA 5E2PA 3JZ2B 4JCNA 3OY5U 2A5KA 3DSPA 4MPXA 1ZTJA 1GHXH 1NBME 1O3GA 2I6QA 2AHME 4ZXXH 1V2WT 4X2VA 1MQ6A 1NBMD 3M7QA 1CA8B 2PUXB 4Y79A 2AS9A 5A0AE 5HKKD 4BXWA 1TOMH 3HPTB 1K9OE 1TNIA 1AZZA 2VVCA 2GCHF 4K1SA 1SC8U 1ELDE 3GCHB 2O8WA 3RLYH 2UWOA 1DXWA 4ESTE 1O5DH 1XUFA 1DVAH 2H1UA 3DFJA 2G51A 2XBYA 1UVOA 3HK3B 3E0NB 5LPRA 2AH4X 1HXFH 4GLYA 1NFXA 2GZ7A 2DUCA 3VPKA 1O31A 1CA0B 3MU8A 1SGNE 1BTZA 5FL7D 3UNRA 2QY0B 3PWCA 3GY7A 4Q7YA 2V0BA 1D6RA 2YOLA 2WZQA 3SU4A 3GS9A 1AUJA 2G5VA 1YP9A 2ZFTA 1DUEA 4WH6A 1FNIA 3A83A 2LIZA 3SHCH 1ZHPA 2BD8A 4H6TA 3V7TA 1BRAA 1RIWB 4GUXA 3CS0A 1B0EA 2Y5HA 1Y59T 2Y81A 4YM9A 3RXDA 2A31A 1S84A 1JXPA 3LGVA 4BANB 3Q3YA 1P09A 1GJ5H 2BX4A 4X6NA 2PLXA 1UCYK 5C94A 2A4QA 1MZAA 4TWYA 1H1BA 1O2XA 2JDID 2HVXA 1GJAB 1BMNH 1SHHB 2L6OA 2R0KA 4ZHMU 1GHWH 4FU9A 1TIOA 3RXLA 1EOLA 2EA3A 3LKWA 3SJ8A 1ELAA 3T27A 1O3AA 4DURA 4E7NA 5K0HA 5EQSA 1TBZH 5KEDA 3PV5A 1A3BH 1DT2A 2B7DH 4A6LA 2A4GA 2NU1E 1K0HA 1GI1A 1KMHB 3S0NA 1SB1H 2QA9E 1DLEA 1COWD 1HAGE 1IQMA 3M5OA 1KDQA 1GI8B 4ABBA 3F2GA 1O35A 3EA7A 1GHBF 2G81E 2HVYB 2ZU5A 1CVWH 2KCPA 5E0HA 5C20A 3P17H 2GTBA 1ELCA 1AB9C 3SNCA 1FI8A 1WAYB 3OU0A 5ABWA 2ZKSA 3VGCC 3ZVAA 4Z1MD 1P3EA 4SGAE 5AVDA 1V2UT 5C67A 3N7DA 4RT0A 1K2I1 3D23A 4ZROA 2GMTC 3SN8A 3KYGA 2QC2A 3H7TA 1GJ8B 3GY4A 3SUEA 2GGVB 1BTWA 2QXHA 4D7GA 1O2UA 2ZHEH 1YM0A 1FMGA 1WSSH 1G9IE 5A2MH 5T3HA 3U1JB 1ZLRA 3H7OA 2R2MB 1HJ8A 2FOCA 4GVUA 3OX7U 3E8LA 4THNH 1P2MA 1Z1IA 1NY22 4YESB 9ESTA 2Z9GA 2UUKB 1QHRB 4YLUA 2V3OH 2ZO3H 1O3BA 3NKKA 3ZV9A 1K1JA 3MI4A 4CRDA 1GMHG 3SU5A 3AW1A 3EAJA 1OYTH 1SMFE 1CGHA 1ORFA 1WTHD 1C5ZB 3TVJB 2ZGBH 1QNJA 1GJDB 1O2WA 2OC0A 3VB6A 2A2QH 3F9HA 3SBKA 1CA0C 2Y7ZA 1YPMH 3QZRA 1K28D 1OHHD 1P0SH 1YPHC 4YT6H 2W7UA 3HK6B 3UWIA 4TPYA 1QA7A 1J15A 3A7XA 1MKXH 2YNBA 1NN6A 2WYGA 4K1TA 1T4UH 2AMQA 4JK5A 1KXAA 2ZA5A 1ESAA 1HAZB 1ZMJA 1FN6A 1NRPH 4ZKOU 3LPRA 1NU9A 3MO9A 3QLPH 1HIAA 2VIOA 4I7YH 5EXMA 1AO5A 1AFQB 1MCTA 3V13A 2Q1JA 3QK1A 1EPTC 1MU8B 4IC5A 3LU9B 1P01A 4BTUB 3ODDA 3NZIA 4IN2A 3FKSD 1A5GH 4YO9A 2BVRH 1TRMA 2IPHA 2ZEBA 2ZFSA 3MQKC 4I8JA 6GCHF 1TPAE 2J38A 1SSXA 5EXNA 2HWLB 1V2VT 2W3IA 3V0XA 1ETTH 3P8GA 4HGCA 1MAYA 1HV7A 1GBHA 2D8WA 1DE7H 1TNGA 4AZ2B 1CT0E 1J16A 1H8IH 1DDJA 1P2IA 1S0QA 5HIYA 2QXGA 3HKIB 2PSXA 3LC3A 3QGJA 1XXFA 1KLJH 1Z1JA 1SGFG 1C2EA 1NROH 5T6FA 1T7CA 3MU5A 2QF3A 5JPMH 1UTQA 5FPSA 4NG9H 1F0RA 2SGEE 4NZQA 1E37B 2QCYA 2FI5E 3MU1A 1S6HA 1DANH 1C1OA 1ZRBA 4CH2B 1RD3B 1WYKA 5EQQA 3TU7H 1QQUA 3NXPA 4NSYA 3ZVCA 1L4ZA 1O2TA 1BHXF 2BVXH 3ZIAD 1PYTD 1PPGE 2XYAA 1Z8GA 2TRMA 4X2XA 1ELTA 2ZPRA 1TGCA 1ZSKA 4OS6A 2EI7A 1Y5BT 3PM3A 1O5EH 1MABB 2GDDA 2J97A 3UB0A 3A80A 1C5OH 1UTJA 2YMSD 1Q31A 5LH8A 2Z9LA 4YOIA 5HGGA 1GHAF 1S85A 2ZGCA 3SGBE 1NO9H 2P8OB 1TBRH 2BVSH 1FV9A 2P95A 5HM9A 5EW2H 1PPBH 3P8OA 1O3IA 4ASHA 4ZUHA 4ABAA 1GJ4H 3S9CA 2G00A 1DM4B 4CRBA 1BUIA 1O2GH 1W0KD 3RXRA 1CBWB 4ZHLU 5EJLA 1GHVH 4OS2A 1C2DA 2VWLA 2VBCA 1EZUC 3IWMA 1Q3XA 2K1QA 7GCHG 1EB1H 4ACAA 1W12U 3LT3A 2BB4A 2AGGX 3STJA 1AKSA 2V35A 1TX7A 1N6YA 1NFWA 4FUGA 9LPRA 3TGIE 3K2UA 4SGBE 2RDLA 3SU2A 2OXSA 5GIBA 4FUIA 3TJVA 1SOZA 3KF2A 3MH4A 1AGJA 4D9QA 1ZPZA 4U2WA 1ESTA 1LPZB 4A92A 1TA2A 4XOJA 2H2ZA 1EATA 3AK5A 3RC6A 4AYVB 2EQNA 1BRUP 1NC6A 1GCTB 4K1EA 5C17A 1NRSH 1TX8A 3O8BA 5CDFE 2BY9X 5DP9A 1P10A 1UTPA 1YC0A 2QGRA 2VIPA 2TIOA 2ZF0H 1V2ST 3GY5A 3F9GA 3F9FA 3BTGE 4JYVH 3GISB 5L6NH 3MNSA 1KIGH 4CREA 4YOGA 5DO4H 2PFEA 1L2EA 3MNCA 5TCCA 4ABDA 1G2LA 2XW9A 1IHSH 1VITG 4MNWA 2ZTYA 3IITA 2D1JA 5E8EH 1BITA 4B1TA 2LP6A 1UHBB 1G32B 2O8UA 3MOCA 2BY8X 1YBWA 3NUMA 1ZR0A 1C1PA 2GD4B 1EZXC 2ULLA 3QO6A 5C5NA 1K1PA 4FU8A 2NWNA 4XBCA 2GV7A 3VFEA 1GBLA 4B2CA 4CRAA 4CRFA 3AAVA 3SOSA 3W1EA 1XKBC 1IAUA 8GCHF 3C27B 3MH5A 1ZGIA 4NA8A 2OQUA 4H6SB 3TJNA 1C9TA 4OS1A 5EU8A 2GVFA 1GHYH 1AE5A 3SNBA 2AMPA 2PWXA 2GZ8A 1JIRA 1A1RA 1DWCH 2CN0H 3F2HA 5HXFA 1QBVH 1GPZA 4QT8C 2A4RA 1BB0B 1CU1A 1IQGA 4IMZA 1V2QT 3RXIA 3DD2H 3M3SA 4CHAC 5C0UA 4IW4E 2RG3A 4WMFA 2FESH 3PV2A 4J2YB 1T31A 1C5NH 1G30B 1O2JA 3NK8A 1W3CA 5GPIB 1CBWC 1F2SE 1BOQA 4JK6A 4OGXA 2EI6A 4ZKSU 2FODA 5C3NA 4B76A 1NS3A 2BQWB 2H5CA 5T1VA 3LGIA 4INLA 1LQEA 3VB7A 1C1TA 3RXSA 4X6MA 1VCQA 3BN9A 3RC4A 2W3KA 1G37A 1SGIB 1HYLA 3I77A 5DP6A 1LKBA 2BMGB 3TIUA 1AVXA 1NU7B 2XOKD 3MMGA 1TB6H 3A7WA 1TBQH 1SQOA 1ZTKA 4ZCNA 1ID5H 4DY7B 2STBE 2HLDD 2BDBA 1HAXB 2BQ7B 1ZSJA 3K9XB 3ZVFA 1GBAA 1C9PA 1GMHF 3GCTF 1ETSH 3SI4H 3EE7A 3ENSB 4WMDA 1LQDB 2ASUB 1HAVB 3SQHE 3TLOA 4WXVA 3OEHD 1BTHH 5DSFA 1OWKA 1H4WA 2FDAA 4WWYA 3W95A 2FLRH 2NU3E 1O2HA 2ZGJA 2QAAA 1IQFA 4JYTA 2ZHQH 2XWBI 3U8TH 2DE9A 3ATWA 1D3QB 1UVSH 2UUYA 3FOAA 5I46H 1C5QA 1YCPM 4FUBA 2C93B 1IQNA 2F3CE 5G4BA 2FWWA 1O2OA 1AWFH
chains in the Genus database with same CATH topology
3ZZ6A 1AZ8A 4UONA 2OUAA 1KXDA 4D7FA 1DSTA 3VB4A 2H9TH 2C8YB 5DJ7A 4PROA 3RXCA 1MTNB 2SGAA 2PKAA 1IQKA 1ELEE 4WJG2 6LPRA 5EXLA 4X2YA 2P16A 1WCZA 5K7RA 1EAWA 3R3GB 4AORA 2A4OA 1C2GA 1G36A 3FP7E 1V2TT 2O8TA 1FUJA 2FMJA 3PO1C 2GP9B 1E38B 3DUXH 1O2VA 3BV9B 3L33A 1TLDA 2SNWA 1A5HA 3TK5A 1SGCA 2PHBA 3P70B 4X1RU 4UFEH 4X1SU 3RP2A 2TGPZ 1MKXK 2XBXA 2ANKH 1O2SA 3DT0H 1LHCH 2VVVA 1LHEH 3OTJE 1UVTH 1DX5M 2OC1A 1AE8H 1GJ6A 1T8LA 2EI8A 3QGNB 2ODYB 2Y6TA 2BDYA 1TX6A 5L30H 1LTOA 3QZQA 4XBBA 4ZH8A 4RKOB 1OX1A 4AB8A 3DA9B 3SJOA 1GI0A 3V3MA 1WQVH 2C8WB 5LGOA 1YPGH 3RM0H 2Y82A 2BY6X 1UTMA 1B0FA 3M36A 2FOBA 1EPTA 2PTNA 3ODFA 2GCTB 3TPIZ 1ANEA 1C5WB 3ZYEA 1WQSA 2A5IA 4F49A 1AVGH 1S81A 1K1LA 1E0FD 2F9BH 2G4TA 2HPPH 3PTNA 3SGAE 2Z6BD 3MH7A 5DP5A 1VGCB 5EPNA 2XBVA 1C2MA 2OCVB 3PWBA 2BD9A 2VIVA 3O8RA 3U98H 3TH4H 1A0HB 1OWHA 1UK3A 1FONA 2Z3EA 1XUKA 2BZAA 1QBOA 3SUDA 1BMAA 1ACBE 5DPAA 2G5NA 1TRNA 4INKA 1CGIE 2GDEH 1QL7A 1G3EA 2FZZA 4IN1A 4E7RG 7GCHF 2F83A 2Y80A 1AD8H 2R0LA 2A32A 1CHOG 7LPRA 3HGNA 1TNJA 2SGPE 1ZJDA 2BD3A 4BTIB 1A46H 2FOEA 4NIWA 1MTUA 1GI9B 1U6QA 1XUHA 1NFUA 1A4WH 1ZYOA 1P9SA 1W10U 2NU4E 1UTOA 2PV9B 3GY3A 3RXTA 1WBGB 3SU1A 1ELGA 2FM2A 2AGEX 5A8ZA 3SUGA 3PYHA 3EA8A 2HGTH 1INCA 5E0GA 3P95A 1DOJA 3E3TA 1KTTB 2XNIA 2F9NA 4ABFA 4ZHAA 1P9UA 3UNSA 4I33A 5DG6A 1HCGA 3KIDU 5TJXA 3ZVGA 4ISOA 1HUTH 5T6DA 5ESBA 2VWMA 4JZIA 1FY4A 2BD5A 1T32A 3HKJB 3ELAH 1O2ZA 2Y7XA 2BD4A 1VITF 3LONA 1LCYA 4U32A 1SR5C 2P93A 2AGIX 1O37A 1FIWA 1O33A 1KXCA 3PLPA 2UUFB 3ZVEA 1FAKH 2FXRA 3GY8A 2QF0A 1TMUH 4Y0YE 3UR9A 2VGCB 1NRQH 3U8OH 2GT8A 4BAKB 1P11E 1DUAA 4UFGH 3M3VA 1B7XB 3A81A 2RCEA 4NCYA 1EXFA 3P8FA 2GCTC 1BMMH 1JIMA 2AFQB 1GDQA 2FTMA 4IMQA 4MQAA 4LZ4B 4ISNA 1H9LB 1C1VH 1OYQA 1ZPBA 3URCA 5JB8S 2VWOA 2BOKA 1S0RA 2ZU2A 4WF8A 4AYYB 2R3UA 4O3UA 2J9NA 1DICA 1DY9A 1J9CH 3BEFB 2O9QA 1DS2E 1Z8RA 2A5AA 3SUFA 1BTPA 1EOJA 2THFB 1TNHA 3UPEA 4GHTA 1P2NA 5C1XA 1SLUB 3S69A 4NGAH 1V2NT 1UK4A 4X0WU 4ABGA 2B0FA 4Y71A 3CP7A 2QXJA 4K69A 5LPFA 3GCHC 1W8BH 4X1PU 5C1UA 1OS8A 4GCHG 1GJ9B 1YF4A 2OINA 1ZHRA 2QN5T 2P3FH 3A7YA 3B23B 2ZDVH 3GCNA 1HPGA 1O5GH 4I31A 2LPRA 4FUHA 1C2FA 2FOFA 1P2KA 1TGSZ 1LMWB 2QYIA 3BTME 2VB0A 4JMYA 4ZAEA 2PGQB 4TYDA 3MTYA 2CMYA 5FHTA 1N6XA 2VU8E 1BMLA 1PQ7A 1ZZZA 1RIWC 1ZSLA 1KTSB 2HNTE 1UVUH 1NZQH 1P04A 3D49H 1VCWA 2GX4A 1RRKA 1GI5A 3M35A 1V3XA 3U69H 1T8MA 1GDUA 4B73A 1QL8A 3NCLA 1ANCA 1MZDA 1C2HA 1CHGA 4ABEA 2W7SA 4AFSA 4MTBA 2ZFRH 1OOKB 5PTPA 3RXUA 1IQLA 2G52A 4A1VA 1C4Y2 5C2ZA 1KDQB 2VINA 2OLGA 4U01A 2AYWA 1BTUA 1P03A 4H4FA 5GCHG 1QY6A 2XRCA 1LDTT 3KN2A 1ZMLA 1SGQE 1WTGH 3ZZ9A 1LPGB 5AHGH 1C5SA 3VXEH 1SGDE 1OWEA 4VGCB 3JZ1B 1PQAA 3KQCA 1NFYA 3AASA 1O2LA 1O2YA 3FP8E 1GJ7B 2VIQA 3SJ9A 3GCOA 1TOCB 2UWPA 1C1UH 4Y7BA 2BLQA 1W11U 1W7GH 4DIHH 1PYTC 4NWKA 3QTVH 5FBEA 3ZZBA 2TPIZ 3BTFE 3SV6A 1FY8E 1GJBB 4Y10E 3A8DA 4Z0KA 3F68H 5EGMA 1GMDG 1L4DA 3SU0A 1QL9A 2ZZUH 3ZV8A 2H6MA 3PMAB 5JB9S 2FP7B 3SNDA 1ARCA 1K1MA 4A7IB 4AOQA 2ZU1A 1IHTH 1C2KA 3D65E 4MDSA 4IS5A 3EBNA 1OPHB 4YTAA 3FP6E 1OP2A 3NPSA 2Z9IA 4DG4A 2BDHA 2FOMB 1PPCE 4DJZB 3V12A 4TY6A 3AW0A 2ZHDA 3TGJE 2A7JA 3E16B 2OC8A 1GI6A 3UREA 4YOJA 1A5IA 3RXGA 2H5DA 2VH6A 1Z6EA 1JRSA 4IBLH 4OS7A 4XDEA 3TNSA 2ZU4A 1O39A 1PPZA 2WUBA 1AWHB 1RTLA 3EE0B 2F9PA 3TK6A 1W0YH 4ZKNU 1S5SA 1G2MA 4GSOA 1HIAB 4RKJB 2IJOB 1GL1A 3QDZB 3O8CA 1FY3A 1UMAH 4D76A 3SV9A 2WUCA 1ETRH 1VITH 5FX5A 1UK2A 1UTKA 3AVZA 1GI4A 3GDSA 4OGYA 1E36B 4LXBH 4MPVA 5F6MA 1AI8H 5IDKA 3ATMA 2ZDMA 1N8OB 3TH3H 3MH6A 4I8GA 1AFQC 5FPTA 2XC4A 3PB1E 3A8CA 4U30A 2AEIH 4HI3A 2JETB 2ZCLP 4Y76A 2FOAA 1Y3UA 5B6OA 1TWXB 4UD9H 1ZTLA 1BBRH 2K7XA 3UIRA 1EJNA 4B2BA 2XC5A 4I32A 5A09A 4MNVA 3KL6A 1T8OA 1CHOF 1GMCG 1SBWA 3VB3A 4GPGA 1A2CH 2JKHA 2YNAA 1YPKH 1BJVA 1FXYA 1TE0A 1J8AA 2BLOA 1GBFA 3BTKE 5FBIA 3A85A 4Y8XA 3S7KB 4X6PA 3UUZA 1RTFB 2FPZA 2Y5FA 1XVMA 2JH5D 2ZQ2A 4DCDA 1MKWH 1Z7KA 4MLFB 3FANA 1GWAA 5HMAA 6CHAB 3PLKA 1O2MA 1T4VH 1SQAA 4MNXA 1ZRKA 1XUIA 1QRXA 1K22H 1WV7H 1SLWB 2BLVA 4Q80A 2WV4A 4NWLA 4BNRA 1GGDB 1O5FH 1TNLA 2ESTE 2G4UA 4UFDH 3EQ0H 1SI5H 4A1TA 4KKDA 5DP8A 1NPMA 5IYTA 3GICB 1BRCE 4O9VA 1S6FA 2QIQA 1HAHH 1O3CA 1GDNA 1PQ8A 2BXUH 3GYMA 5GWZA 3RXHA 4KP0A 2ZPSA 1AUTC 2UWLA 1W0ZU 3ZVBA 8ESTE 2ZDLA 1F0SA 1IQIA 1WOFA 4CR9A 4NIVA 1UCYE 1JRTA 2BX3A 1KLIH 2IN2A 2A45B 8KME2 2EC9H 2P8OC 1GHBG 3Q76A 2PKSB 1GI2A 4TY7A 5DP7A 2ALPA 4ISLA 3ZVDA 1AKSB 1GI3A 3EYDA 3A89A 3UR6A 1W14U 4NIXA 2ZGXH 1HXEH 1OWDA 3UQVA 2C4FH 4KTUA 6ESTA 3MO6A 1C2LA 2F91A 3AAUA 1V2OT 3MNBA 3BSQA 3S7HB 1EB2A 2PGBB 3KHVA 1O3HA 1F7ZA 1TABE 2BDCA 2BXTH 5J4SA 1V2JT 2ZTZA 4ABJA 2G55A 1MTWA 2H9EH 1BDAA 3RXJA 2PR3A 2XWAA 1HJAB 1X7AC 1K1NA 4NFFA 1C5YB 1ABJH 2W5EA 1N8OC 3RXAA 1TYNA 4NIYA 1O2NA 1S82A 1C5MD 2BZ6H 2ZHFH 5SGAE 4DIIH 3LIWA 2JETC 2C90B 1O2QA 1TAWA 3F9EA 2XCNA 2BD2A 2KAIA 1G3BA 5C5OA 1QB6A 5A8XA 1O2PA 1GCTC 4GCHF 5C1YA 3UQOA 4MG3A 5FCRA 3K65B 3UOUA 4NZLA 1O3PB 2D26C 2FYRA 1ZHMA 2XBWA 3HGPA 1LVOA 1YPLH 3D62A 1D3TB 4JZFH 3I78A 3TGKE 1D9IA 1TONA 2Z94A 3S9BA 1AHTH 3UFAA 3U1IB 1RS0A 3PMBB 1AMHA 1GGDC 4R0IA 4XSKU 3SV8A 5FXLA 2AERH 1GBTA 2WPHS 2ZCKP 2VJ1A 3SNAA 1D3DB 2B5TB 2ZWLH 1GCDA 1A0LA 1YCPH 3CENA 2FIRH 4Q7ZA 3ITIA 4Q7XA 3ZZ8A 5JBTA 3LGYA 2Z9KA 1O3MA 5GCHF 1QRZA 2GKVE 1Z8JB 1UTLM 4FVDA 1AFEH 1DFPA 1K21H 2ZI2H 3MU4A 4GHQA 1C5PA 3ZZAA 4KELA 3NWUA 1MH0A 3CS7A 1TGBA 1BT7A 3A7VA 4AFUA 2B8OH 1CT2E 2A7CA 3RMOH 5JDUB 4WY3A 2ANWA 2Q6FA 3Q00A 1AVWA 1HB0B 4J1YA 2PKSC 3H5CB 1KYNA 5HM2A 1O2RA 4UE7H 1O3FA 1G3CA 3VB5A 4K8BA 4DW2U 3BEIB 4Y8ZA 1O3LA 1TMBH 4X8SH 3E90B 5JBCS 1QJ6B 1D4PB 2WINI 1GMDF 3STIA 4AX9H 2Z3CA 1XKAC 4XBDA 2FYQA 2CF9H 1YPJH 1BQYA 2CF8H 2O8MA 2H9HA 2SGDE 2NU0E 2LNCA 3MWIU 3DHKH 5ESTE 1C1QA 2JH6D 3RXPA 1DWBH 3FZZA 1MAXA 4CH8B 4AFZA 2C3SA 1DSUA 3P6ZB 3GYLB 1TPPA 1HJAC 1EUFA 4HZHA 2HALA 3M5MA 3Q3XA 3B9FH 3GY6A 1W7XH 1F5KU 1SG8B 3BG4B 1F0TA 1P57B 4A5TS 1GVKB 1QFKH 4WXIA 1JWTA 1QB9A 1J14A 3ZZ4A 4CBNA 1TNKA 3G01A 3A7TA 1IOEA 1AB9B 3P92A 2BYAX 3VGCB 1SGFA 3WY8A 2C8XB 1C1RA 1SLXB 1EZQA 1NRNH 2ZG0H 1BZXE 3DFLA 4AGKA 1EP6A 2GMTB 2BY7X 3TITA 2EEKA 4BAQB 2PKAB 1CGJE 1A61H 3LGWA 3LH3A 3F1SB 3W94A 3RC5A 1O3KA 5JBAS 1F0UA 3RMNH 1PFXC 1O5BB 1TMTH 1YLDA 3GY2A 4FUDA 4A1XA 5AFZH 5FPYA 1TQ0B 1O3JA 2J94A 1GBEA 1GL0E 1C5UA 1K1OA 1MTNC 4Z6AH 3SQEE 1SL3A 2FEQH 1Z6JH 1EP5A 3HATH 4O3TA 1HAIH 3BIVH 1LVBA 3LC5A 4JZDH 3KNXA 5E0JA 1KXFA 2Z9JA 4NA9H 3P8NA 5F8ZA 2F9OA 2J95A 5ETXA 1KSNA 1GMCF 1RGQA 2DE8A 5EOKA 5DKMA 2OC7A 2VH0A 1W2KH 2ZPQA 1D3PB 2HOBA 3ATKA 3QN7A 1E34B 3K6YA 1H9IE 1NRRH 1TA6A 4LOYH 3BTTE 1ANBA 1H9HE 1NTPA 1QJ7B 2ZGHA 5L2YH 2OBQA 1Z8IB 1P2QA 5AF9H 4R8TB 2J92A 2ANYA 1F5RA 1CSOE 2ZNKH 4CBOA 2Q6GA 1EKBB 5BRRE 3Q3KA 3Q77A 1C1NA 3RMLH 1FPHH 3PV4A 1HFDA 4O97A 7ESTE 5EG4A 1MTSA 5BPEA 1K1IA 1HAOH 1Y3YA 1EPTB 3E6PH 4X2WA 1RTKA 2P3TB 4BAOB 5CMXH 1ELVA 3KQBA 1GBMA 3TH2H 3A8AA 3RMMH 1BBRK 3SO3A 1OWIA 1LHFH 3RXMA 4X6OA 3UOPA 3E1XB 1KY9A 2PUQH 1DXPA 1PPHE 1MBQA 2BQ6B 5GJ4B 1ZOMA 4I8LA 5HYOA 1ESBA 4AG1A 8GCHG 1O3EA 3KGPA 5AFYH 4MPUA 1SOTA 4NA7A 4ABHA 3LDXH 1O32A 1D6WA 1QB1A 1A3EH 1MKWK 1O2KA 3UWJH 4BTTB 1F5LA 2AIPA 2ZU3A 1HLTH 2FOHA 3BF6H 2ZECA 3ZZ7A 1FQ3A 5LPEA 3K6ZA 3VEQB 4LZ1H 3PMJA 3BG4C 1C2JA 1LVYA 2Z3DA 3EGKH 1O3DA 1TQ7B 2GV6A 1A0JA 1VGCC 4YLQH 1NM6A 1EX3A 4ISHH 2ODQA 3RU4T 3VXFH 3T62A 2FX6A 3SU6A 1TFXA 2VVUA 1SGTA 1E35B 2A2XH 2PW8H 4ABIA 2R9PA 1XUJA 4ISIH 1N1LA 1FDPA 4X1NU 1LPKB 4X8VH 1BIOA 2WPKS 5F8XA 4K3JA 1SGEE 3MU0A 1DLKB 1AN1E 1JOUB 4Y8YA 1Y5AT 4BAHB 3UY9A 1V2LT 5DP4A 3SGQE 1GBDA 5EW1H 4DVAU 3BG8A 3OYPA 1BTYA 4BXSA 2BTCE 2HNTC 1V2MT 5T6GA 1Y8TA 3S9AA 1Q2WA 1GBJA 5F8TA 3E91A 3RXEA 1HNEE 1QQ4A 4FUEA 3FAOA 1NT1A 5L2ZH 1SHYA 3M7UA 1F92A 4UFFH 3GCTG 1GI7B 1SGRE 1XMNB 3M7TA 4K8YA 3FFGA 1GBIA 2WPJS 2STAE 4FU7A 1SGPE 1Y3VA 1B5GH 1L1NA 1OXGA 2A0QB 2FI3E 1FLEE 4Q2KA 4UEHH 2CXVA 5JYIA 4LK4A 3A84A 3F6UH 2D2DA 1EASA 1MCVA 3ZZDA 2CJIA 2WV5