2C3SA

Structure of sars cov main proteinase at 1.9 a (ph6.5)
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Sars Coronavirus Main Proteinase as an Active C2 Crystallographic Dimer.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords SARS COV 3C-LIKE PROTEINASE
total genus 84
structure length 301
sequence length 301
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2c3sA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2c3sA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2c3sA02
2K7XA 1S83A 2BDHA 1LDTT 4F4OC 4ISLA 1K1NA 4TY6A 2ZCKP 2FWWA 4BTUB 3GY5A 1LVMA 4Z0KA 3SNEA 2P3TB 1GHXH 1O2OA 1CU1A 1UCYK 3MH7A 1FV9A 1EZXC 1NT1A 4TPYA 1FDPA 2BDBA 5DP8A 3TVJB 1AU8A 1MUEB 4FUHA 2R3YA 3KIDU 5L2ZH 1CGJE 2QIQA 2FX6A 3PLPA 1V2WT 1GI4A 1AZ8A 1HAVA 2D8WA 3LGYA 1SQOA 3OU0A 3PB1E 4ISNA 2ZHQH 2GVFA 4GVUA 1FN8A 3SUDA 1V2UT 3BF6H 1C5QA 3SI3H 1GHYH 1ZGVA 4Q2KA 2F3CE 1SQTA 2P94A 1HB0B 2VIOA 1O2KA 1GI0A 1GJ5H 4DGJA 4CRGA 1GBCA 3GDVA 1BOQA 1VGCC 7GCHG 4ZMAH 1N8OC 2XRCA 1B0EA 4RKOB 1HNEE 2O9QA 2QAAA 1YPMH 4BOHA 2JETB 1S5SA 1ETTH 1EB2A 1AKSA 2Y81A 3ATLA 1C2JA 2DE9A 1GVZA 4YTAA 3I78A 1DXPA 5C5OA 1FXYA 3RMLH 1PQ5A 3FAOA 4ABEA 3MYWA 3A81A 3GY4A 3PLBA 2CF8H 4OS4A 6GCHF 1S6FA 5GCHF 1ELEE 4MNWA 3OTJE 3RDZA 4VGCC 2FO9A 2UUJB 4U30A 3RP2A 1OPHB 2ZTYA 3BIVH 1O3EA 2BD4A 1AFQB 5A8YA 5DPAA 5L30H 8ESTE 1UVTH 1MBQA 1SLVB 2EC9H 1YCPK 2VWMA 2XCNA 3K9XB 3ZVAA 1UCYH 3RU4T 2W7SA 1GI3A 4Y7AA 3KQEA 1Y3WA 4K60A 1SGTA 1H9IE 2R9PA 3OSYA 1UCYE 1RS0A 1UMAH 2GZ8A 3LJOA 4RKJB 2ZWLH 4JZFH 4LXBH 4X8VH 1PFXC 2AMQA 2ZHDA 1TMTH 4FUFA 4QT8C 5JBAS 1CGHA 3RXDA 3UWJH 4I8KA 2CGAA 5EPYA 3PLKA 2P16A 1KXBA 5F8ZA 1CBWB 1O39A 5FAHA 1V2ST 4YM9A 4ISOA 2FIRH 3GISB 5A0BA 2BX4A 4AGKA 1BTHH 2P93A 2VIVA 1O2VA 1YCPM 3UUZA 2PGBB 1HXFH 2Y7XA 3V0XA 1IAUA 4JK6A 1QBOA 1FY8E 3P17H 3ENSB 3ZYDA 1P04A 4D7GA 1FJSA 1L0ZA 2HVXA 1QFKH 3A80A 5GCHG 5DO4H 2HPPH 5C1UA 3QZQA 4XE4A 1IHSH 4GCHG 4UD9H 3SQHE 1TNKA 1Q3XA 2FXRA 4CRDA 1A2CH 3M5LA 4ZAEA 1FAKH 4GCHF 2BD3A 1BTYA 1A3EH 1XKAC 1BZXE 4DOQA 2ZDVH 4K69A 3FZDA 1S0RA 2LPRA 3BTDE 1UVOA 2GZ7A 2TGDA 4AZ2B 1ZTKA 4B73A 2QXJA 1EOJA 2J95A 2A7HA 3SORA 1MD8A 3LH3A 6LPRA 8GCHG 1SR5C 1BRCE 1O34A 5HM9A 1ZHRA 1O30A 1C1UH 2ULLA 1LKBA 2A4RA 1ZPZA 3PMJA 1AE5A 4YT6H 3MOCA 3BEIB 2WPJS 1YPJH 1C2KA 3EE0B 3GDUA 3MWIU 1FAXA 1ZYOA 1VZQH 1XKBC 2Q1JA 1CHOF 1GBIA 1KLTA 1BMNH 1MTNC 5ETXA 4NIXA 2Z3EA 1V2NT 3LGUA 3UNRA 3QTVH 3STIA 2NU3E 2ZG0H 3HK3B 3EA7A 1GDNA 3O8BA 2A2QH 4X6MA 4B2CA 1T7CA 4D9RA 5LPEA 5FBIA 3LH1A 1TBQH 2AMPA 1P06A 1F0SA 1C1MA 4NIWA 3ZZ3A 1G3CA 4CHAB 3BIUH 1V2LT 2A5KA 1K28D 1MTVA 1KLJH 4Y7BA 1LKAA 5AVDA 2D1JA 3GCOA 1TBRH 2XCFA 2GCHF 1O2QA 3ZZAA 1MTNB 4Z6AH 1EZQA 1UHBA 1O32A 1L4ZA 2FOMB 3E0PB 1CT2E 3U8RH 2WINI 2BVXH 1Z1JA 1FY3A 2BY9X 3LC5A 1UJ1A 1AD8H 1OWDA 4I8JA 1BBRH 1Y3YA 5DJ7A 4DCDA 1FNIA 1P2KA 1L2EA 3JZ2B 3RLWH 4AFZA 2Y7ZA 2J94A 2Z94A 1CA0C 2XBYA 1CE5A 1DDJA 1LCYA 3RXBA 4AYVB 1NRPH 3FZZA 2HNTF 3SN8A 3RLYH 2EI7A 4X8TH 1QQ4A 1FPCH 1MAYA 2AMDA 4A1TA 1XXDA 3AW1A 3QX5H 4WH6A 5H4IB 4A5TS 1HAGE 1NU9A 3LGWA 2P8OB 1G2LA 2VIDA 3TK6A 1BITA 9ESTA 2FYRA 4ZKOU 2GDEH 2PFEA 5EQRA 3TGIE 2ZKSA 3MU4A 1F0UA 2FM2A 1F5LA 1O5FH 3SU6A 2GP9B 1V6DA 2VIQA 4WWYA 1H8IH 5E0HA 2B0FA 1EATA 1O5CB 1P2NA 1P57B 1AWHB 4AYYB 2NU4E 3E16B 4MVNA 1W0ZU 2XC4A 4NGAH 3E3TA 4FUDA 1GJ9B 3L3TA 3M5OA 3RMMH 1RRKA 1NO9H 4GUXA 5BPEA 2O8MA 2QCYA 3GYMA 2A45B 1TPOA 2G51A 2D26C 2G4UA 4WXIA 2B8OH 3UQOA 3FP6E 2HLCA 2BTCE 1AN1E 1WTHD 4FUIA 3DD2H 3GY8A 4I32A 1RTFB 3U69H 4M7GA 3UREA 4IW4E 3SU3A 1YM0A 4GPGA 1C2MA 1OS8A 1VCQA 3RXQA 4ZH8A 2BQ7B 4DIHH 5DP5A 1X7AC 2F9UA 4AOQA 4ZHAA 1G32B 4MPUA 1MKWK 4NFEA 2AIPA 1P9SA 4DY7B 2RG3A 4MLFB 1HCGA 3BTME 2FS8A 1QJ6B 3RXLA 4BAHB 1GBBA 4PROA 2FYQA 1V3XA 1OP0A 1NFYA 2F9NA 1GL0E 1NY22 4HZHA 4IMQA 1BMMH 2C4FH 1IQNA 5DKMA 3VGCC 2CV3A 3BEFB 2ZGCA 3UFAA 3ZVDA 4OS1A 1FIZA 4ZKSU 4X2YA 1GL1A 3PWBA 2GT7A 1H9LB 2H9EH 4IN2A 1GG6C 2HWLB 3QLPH 1DSTA 1C5ZB 3HPTB 4ABBA 4CBNA 3O8DA 2GV6A 3LGIA 1MKXH 2HOBA 3SOSA 1ZOMA 3QN7A 1OWKA 1BDAA 2ANMH 3PROA 1MTSA 1YPEH 1P3EA 2IPHA 1IQHA 1Y5AT 3H7TA 2DE8A 4ABGA 3P95A 2FESH 2PTNA 2V3HH 4U32A 1AO5A 4KKDA 1XM1A 1ZZZA 2WPMS 3MNSA 3M5NA 1P2IA 1ZSKA 2UUYA 2TGTA 5BRRE 1ETRH 1C2DA 1TPAE 3AASA 1TRYA 3VEQB 3A8BA 1RIWB 3GCHC 1P02A 1GGDB 1TRMA 3UPEA 1D3PB 2QGRA 1AY6H 1EPTB 4Y8XA 2WYGA 2OTVA 1EAIA 3RM0H 3M7QA 3NK8A 5LH8A 4J2YB 3ZZ5A 3P70B 2FLRH 2VGCB 3A8CA 1O3IA 1O2TA 3I77A 3QGJA 2A1DB 3TPIZ 3EBNA 3SGAE 3TU7H 4X6PA 4JZIA 1RJXB 4ZHMU 1O2ZA 2BYAX 1Z6JH 2EI6A 1T8LA 1C2GA 1DY9A 1PPEE 2RDLA 3P8GA 5T6FA 3KHVA 5F03A 3D49H 2ZEBA 4IN1A 3GY6A 3K6YA 2W3IA 1S82A 1SGNE 5EPNA 1AB9B 1RGQA 2R0LA 4OS7A 2YNAA 1IQJA 3LONA 3TNTA 2UUKB 1GHAG 2KAIB 2ZGJA 1EPTA 2AGEX 2AGIX 2Z7FE 2F9BH 3M36A 4CREA 3PMAB 3ZVBA 3TJNA 1W11U 7GCHF 2J38A 3DHKH 2BLVA 3S0NA 2A7CA 1CT0E 1W14U 3SHCH 1BCUH 2XXLA 1OXGA 3LKWA 1GMDF 2AH4X 2BLQA 1K9OE 1S6HA 3W95A 5A2MH 4IS5A 3DFLA 2WV5A 5SGAE 1O3LA 5HGGA 1NPMA 1D3QB 1QHRB 5HMAA 2JKHA 1G3DA 4E05H 2BHGA 3ZV8A 1J17T 1LTOA 5CHAB 7ESTE 1EZSC 7KMEH 3T26A 2PSXA 4FVDA 2SGEE 2ZU3A 2OBOA 3ZZBA 2GT8A 1NS3A 1YYY1 1MH0A 2FX4A 2F83A 1AKSB 2QXIA 1BJVA 1EJMA 3O8CA 4DG4A 3A83A 1HFDA 2Z3CA 1P3CA 3TJUA 2R2WU 3RXSA 3T62A 1DY8A 1P01A 2XWAA 4FXGH 3T27A 3A87A 1GJ8B 3P92A 3IWMA 1FUJA 4X0WU 2TGPZ 3R0FA 4CBOA 2TGAA 4YOGA 1GPZA 3ATMA 4LZ1H 2ZTZA 1P09A 3EA9A 4KTCA 1GBEA 3TGKE 1ESTA 1FY1A 2ZCLP 2C90B 1ANCA 5E2OA 3EGKH 1QIXB 3PYHA 1G9IE 4Q7XA 3F6UH 3RXVA 1PPGE 3A84A 3PM3A 1JMOH 2P3UB 3SQEE 1FI8A 4TPIZ 1Z7KA 4ZKRU 1PQAA 1O2JA 1ARCA 5T6GA 3H7OA 4CRBA 3BTKE 1OWHA 1WQSA 1BTUA 5I25A 1GJBB 2VU8E 5DP7A 4K1EA 4BXSA 2OQUA 4NZLA 1C5UA 5EQQA 1C2IA 2GCTB 4A6LA 2VVUA 1ZTLA 2NU1E 1UK4A 2TBSA 1C2LA 2J92A 1SC8U 4KELA 3C27B 4I8LA 5C20A 1O2XA 1N8OB 4WMDA 1SOTA 1BTXA 4GSOA 1NU7B 3BTFE 1MKXK 1SGYE 1Y3XA 3SU2A 3GY2A 1RXPA 4B1TA 2JETC 3SNAA 3TH4H 2FOAA 1DXWA 3RXEA 1NM6A 2CF9H 1TONA 1LVBA 1SB1H 1QL9A 3TJOA 1DFPA 5E0GA 2ALVA 3B23B 5J4SA 4YO9A 2Z9KA 4THNH 4ZHLU 3NUMA 1J8AA 3OYPA 1O3KA 1GHVH 4O97A 2OC1A 4AFUA 1D3TB 3UOUA 4X1NU 1GBHA 5GIBA 3ESTA 3UR9A 3S9AA 3PMBB 1O3PB 1Q31A 1K2I1 2LNCA 4X1RU 4OGYA 1FN6A 3LGVA 2V35A 4INKA 4K1TA 2O8TA 1A5GH 2QV1A 4X2VA 3L33A 2VJ1A 4AX9H 3TNSA 1PPFE 4WJG2 1YLCA 4YLQH 1A5IA 4MDSA 3GOVB 3E8LA 2G52A 4BNRA 1BA8B 5ESBA 3VB3A 1C5VA 1MCVA 4Y79A 1O3HA 4A7IB 3DT0H 1BHXB 3F9FA 2LIZA 4JZ1A 1O0DH 1OWEA 1ELVA 1BMAA 2NU2E 1ID5H 1CA0B 3D65E 1THSH 1TX8A 2VWNA 1W7GH 1MCTA 2AEIH 3GCTG 4XDEA 1D6RA 2OXSA 1FLEE 1EXFA 5LPRA 4B76A 2C8ZB 3TK9A 2ZTXA 4YOIA 3ATIA 2NU0E 3BN9A 4BAKB 2ZFSA 3MI4A 4JMYA 2BDAA 1C1WH 1O3MA 1P0SH 1TIOA 3D62A 2FP7B 1PYTC 2VIPA 1F7ZA 2ASUB 4Q7YA 1BTPA 1TGCA 1UVUH 2XYAA 1RTKA 1BUIA 2UWOA 1TPSA 1GJAB 1O36A 1LHFH 1GHBF 5EW1H 1TLDA 3RXGA 2ZFFH 1ZMNA 1GBDA 2ZNKH 1KDQA 3T2NA 2D2DA 5EXMA 1K21H 1O5BB 3A89A 5FCRA 2UWPA 3BTEE 1JRTA 1XX9A 2XBVA 5ABWA 4UONA 1HUTH 4WH8A 2BD8A 1UK3A 1HBTH 1Z8JB 3UTUH 2ZPRA 1DUEA 1YCPH 2FDAA 3M3SA 1INCA 3TGJE 1MU6B 1YPGH 3ZZ8A 1N1LA 3RU4D 4AFSA 1O2UA 3F9HA 1C2HA 1BHXF 5F6MA 1EAXA 2PHBA 1C2FA 4UFGH 1E37B 5FX6A 2EEKA 3UNSA 1QB9A 1WBGB 5FBEA 3ZZCA 4F49A 3RXJA 2FODA 3SU0A 1XUIA 5FCKA 2BDIA 1L1NA 1C1QA 1HAYB 2GMTB 3UY9A 4B2AA 1K1IA 1MBMA 3O8RA 1TQ7B 1QJ1B 8KME2 1ZHMA 1CHOG 1O2IA 4WMFA 5EW2H 1QBNA 3E0NB 3SBKA 2ANKH 2ZDLA 2FOBA 3V3MA 1SLXB 5LGOA 4J1YA 4NCYA 3U8TH 5CMXH 1YBWA 4E7NA 4UFDH 1GMHF 2ZI2H 3GY7A 2ZIQH 3RXRA 1MZDA 1ELFA 4NSYA 3SU4A 1UVPA 3VB4A 2ZGBH 2Y82A 3S7HB 3QWCH 5EXLA 5C1YA 3CP7A 3NZIA 1NESE 4MTBA 1ZLRA 3ATWA 1LO6A 2XBXA 4KTUA 2QF3A 3U98H 1H4WA 5PTPA 4A1VA 2Z3DA 1D3DB 4MPXA 3JZ1B 5F8TA 2BY8X 2WYJA 1V2MT 2W5EA 1TNIA 3HKJB 3H5CB 3HK6B 1JRSA 1GJCB 2WV4A 2ZGXH 3SW2B 5GXPA 3EA8A 1XUJA 2B5TB 2FZZA 4YOJA 2I6SA 1D6WA 1KSNA 1SLUB 3QGNB 3A8DA 3OY6U 3T5FH 2XTTB 1SFIA 2FMJA 3RXHA 3Q3KA 5FPYA 1SI5H 3RC6A 1EKBB 1G3BA 4X6OA 1SG8B 2THFB 4IBLH 4GLYA 3TJVA 4H6TA 1A5HA 3KF2A 5EOKA 3PO1C 4I7YH 4RSPA 4ZXYH 3MH4A 1C5LH 1O31A 4GHTA 1T8MA 2TRMA 4O3UA 2PLXA 1ABIH 1LQEA 1QL7A 2ZDMA 2ZU4A 2RCEA 2ALPA 3QUMP 1HLTH 5J4QA 2PTCE 2GV7A 4ABIA 2AS9A 2H5CA 2BD7A 2ZU5A 1DT2A 3EDXB 4O03A 3PV4A 2ZDNA 3Q3XA 1Z6EA 2QYIA 2Y80A 4CH2B 4BTIB 4DVAU 5L2YH 1AVXA 1V2KT 2Q6DA 1A4WH 1TQ0B 1AHTH 4WXVA 5HXFA 1O2NA 3GCNA 1NFWA 1O3BA 1ACBE 1ZR0A 4UDWH 1UTJA 3LU9B 2C8YB 2XBWA 2H5DA 4R8TB 1IQIA 3BTWE 2Q6GA 4JZDH 2VNTA 1YP9A 3K2UA 1EAUA 2VWOA 5FX5A 1P11E 1NC6A 5DG6A 4BAQB 2OQ5A 2BY6X 1UTOA 3MNXA 1ARBA 2ZO3H 1P03A 2ZA5A 4CRCA 1TOCB 2ANWA 3ZV9A 3LJJA 1O2YA 1ELCA 1A0LA 3RC5A 3ZZ7A 4ZROA 3GICB 4JCNA 1V2TT 4A92A 1Z1IA 1HAPH 2HNTE 3U9AH 1CQQA 1L1JA 1P12E 1FMGA 2GX4A 1P2OA 2C8WB 1H9HE 4GAWA 3SJ9A 1MTWA 1TNGA 1HV7A 1TGTA 1QA0A 1O3AA 2SNVA 1OP2A 1G3EA 3A8AA 4XFQA 1C9TA 3ITIA 2BOKA 4ZKNU 3ZZ9A 2ZU1A 1HXEH 1VCPA 3A7YA 3EYDA 4U01A 1NFXA 3M7TA 1QB6A 2ZP0H 1N6XA 4B71A 1ZHPA 4BXWA 4CR5A 1J16A 1GBJA 3FP8E 2STBE 2ODQA 4X1PU 1MD7A 4B2BA 1UTPA 2PKSC 2M5TA 1YPLH 2VH0A 3E1XB 2TPIZ 1HPGA 5C5NA 1A3BH 3SUGA 3A88A 4DW2U 3SJIA 1QY6A 4HGCA 1KXFA 2SGFE 2A5IA 2ZFRH 2FI5E 2VINA 2HALA 4CH8B 3IG6B 5C3NA 1ANDA 1B5GH 5JPMH 2XC0A 3SV9A 3MNBA 2BQ6B 2SFAA 4ABDA 1AE8H 2JH5D 4X2WA 6ESTA 2QA9E 3E90B 3SV2H 1QB1A 4KP0A 2GZ9A 2BD5A 1PQ8A 3BTGE 1QRZA 1O3DA 4CRFA 1GHZA 1SQAA 3Q00A 1Z8IB 4D8NA 2A5AA 2J9NA 1WCZA 2CXVA 1V2PT 2QXGA 1GBAA 5LPFA 1BBRK 2W26A 2JH6D 2BXTH 3E91A 4BAMB 5HM2A 3ZZDA 1V2RT 2TIOA 1TMUH 1T8NA 3V12A 2FTMA 1IQEA 3HATH 5TCCA 3SJKA 3SUFA 1W13U 1H8DH 1GWAA 2QN5T 3RXTA 1OWJA 3A86A 4OGXA 1ELDE 1MKWH 1O2LA 2FOHA 3ATKA 4A1XA 5B6OA 5AFYH 2RA3A 1S85A 5JDUB 3KQDA 1IQFA 8LPRA 3WY8A 4FU8A 1EP5A 1KXCA 9LPRA 3QZRA 4Y76A 1F2SE 2H9TH 3KQCA 5JBBS 3B9FH 1QRXA 1ELGA 3MNCA 1EJNA 4HTCH 2BZ6H 2P59A 2CJIA 1YC0A 1L1GA 1PYTD 3GYLB 1TGBA 1W0YH 1SHHB 1GI2A 1UVSH 2PUXB 1TE0A 5GWZA 1SBWA 3K65B 1HJAB 1S0QA 4WY3A 4H4FA 4SGAE 5E0JA 1JBUH 2UWLA 1W7XH 4ISHH 1LVOA 1AZZA 1YF4A 2ESTE 3MH5A 1A0JA 2SGAA 2ZECA 1O3OA 3BTTE 4FUCA 3V7TA 1ESAA 3I29A 4D7FA 1XUKA 1AVWA 1Y3UA 4AGJA 1JWTA 1QJ7B 1C5XB 2J2UA 3ZVEA 1DSUA 4AG1A 3A82A 5DGJA 3ZZ4A 5L6NH 3AW0A 2WPLS 1BT7A 1C1TA 1GHWH 1YLDA 4BAOB 1WSSH 5EXNA 3VXEH 4TY7A 4GHQA 2BDGA 2ZDAH 1TA6A 1DITH 3E6PH 1VITH 3UQVA 1DX5M 4I31A 2XWBI 3URCA 4ASHA 1F5RA 1H1BA 3MU8A 3S69A 5C67A 1O3JA 1UTMA 2Z9IA 2OC8A 1W2KH 2V0BA 1WOFA 3SNDA 3VFEA 5A09A 4OS6A 2PKAA 1W3CA 2I6QA 2ODYB 1GCTB 1BRAA 1ELAA 3RC4A 3T28A 5A0AE 1AQ7A 3VB6A 4TWWA 1SMFE 5JBTA 1PQ7A 2BB4A 1OYQA 2Y5GA 2HGTH 4FU9A 7LPRA 1C9PA 1JOUB 5AFZH 2ODPA 2ZU2A 5EQSA 2VIWA 1MMJN 1WQVH 3F1SB 1WYKA 1C5WB 1SHYA 2FTLE 1FY4A 1EQ9A 4MPWA 2A32A 3RXMA 2FLBH 1HAVB 1HGTH 4WMEA 1SPJA 3L6PA 4I8GA 1EB1H 2WPKS 1O2MA 1SGFG 4E7RG 4ABHA 2PKAB 3CS7A 3FP7E 4MPVA 5T3HA 1DWDH 1V2OT 1NN6A 4K8YA 1O2WA 4ISIH 1BMLA 1C5TA 3VPKA 1ETSH 3RXAA 2WUCA 4AN7A 3ZVFA 2IJOB 2GTBA 4NG9H 1AMHA 2ZFPH 2Z9LA 4IGDA 1VITG 3RXFA 2GD4B 2A4GA 1WUNH 4AB9A 1C1SA 2OC0A 1XUFA 2H6MA 2XW9A 2OINA 2A0QB 5ESTE 1NROH 1C5OH 1LHEH 4DT7B 3S9BA 3OX7U 3EAJA 5I46H 5JYIA 2YNBA 1NTPA 1BJUA 1JIRA 1C2EA 1GBFA 1MAXA 1TB6H 1ZJDA 2SGDE 3A7ZA 1GBLA 3TIUA 4Q7ZA 1G2MA 2W7UA 1QQUA 3NXPA 5E2PA 1GVLA 3A7XA 1PPZA 1BIOA 1O38A 3NPSA 1MU8B 2R0KA 1KTTB 4NIVA 2SNWA 2BXUH 4JK5A 1J14A 1JXPA 1GI8B 4XBBA 1F0RA 4ESTE 5JBCS 1NRQH 5F8XA 3VGCB 3ZVGA 1CT4E 2PW8H 1V2VT 1THRH 5A0CA 5C2ZA 2FI3E 1DM4B 1DLKB 2ZQ1A 4K5ZA 4O3TA 1C5PA 1C5MD 1SGDE 2RA0A 1JIMA 1VR1H 3LDXH 3A85A 8GCHF 3NCLA 5DP3A 2ZDKA 2K1QA 1WAYB 2BDYA 1CVWH 1FY5A 1O2HA 2ZHWH 4MNXA 5FPSA 3F68H 2SGQE 1C1RA 1SVPA 4DJZB 3V13A 3M37A 2A4QA 3ODFA 1ZPCA 3KQBA 2BOHB 2V3OH 3KL6A 1RIWC 3ELAH 3GCHB 4UFFH 3BV9B 1HDTH 4ABJA 3SHAH 1T32A 2A4OA 1EPTC 2IN2A 3DUXH 1SOZA 1TRNA 1G30B 4NA8A 3BTQE 3UNQA 2F91A 2PR3A 2QC2A 4IMZA 1NZQH 1O5DH 3KGPA 1T4UH 3R3GB 2SGPE 2FI4E 1GBKA 3P8NA 3STJA 2BMGB 1ZGIA 2WPIS 3QK1A 1Z8GA 2CHAC 1CHGA 3TK5A 1DVAH 1C5SA 1UTLM 2P3FH 1QCPA 4INHA 3A7WA 1DUAA 3MHWU 5FHTA 4NWKA 1OKXA 1DWCH 2B9LA 1NRNH 1YPHE 2C3SA 2R3UA 3AAUA 4AORA 1GJ6A 2F9VA 1VGCB 2FOEA 2Z9JA 1HIAA 1E36B 1AI8H 1M9UA 2FPZA 2BZAA 2CHAB 2A7JA 1SGFA 3LIWA 1KXDA 1QBVH 3RM2H 1AUJA 1MZAA 1GGDC 1KXEA 1EUFA 1TA2A 2C93B 2ZC9H 1A0HB 1TOMH 1ORFA 4XSKU 1ZSLA 3PTBA 3SV7A 4NFFA 1EOLA 4YZUA 1DWBH 3F9EA 1TX7A 3OY5U 4X8SH 3TLOA 4K1SA 4FUGA 1C5RA 2EI8A 1AFEH 2AGGX 4VGCB 5DP6A 1Z8RA 1UK2A 1GMCG 4DIIH 1AIXH 3Q3YA 1Y3VA 1RFNA 2QY0B 1EASA 1YKTA 1T4VH 1QNJA 2CMYA 1UHBB 4JYVH 5EU8A 4SGBE 3RXPA 1FQ3A 2BY7X 2FOCA 3SZNA 1E35B 4OS2A 1GJDB 1XUGA 1HIAB 2ZHEH 1K1OA 3SI4H 2BY5X 2H9HA 4MQAA 1O2PA 2R2MB 5GJ4B 2A2XH 1FONA 3Q77A 2AYWA 2Q6FA 3VB7A 3SO3A 5FPTA 1RD3B 5DP4A 2ZZUH 3RMNH 3MTYA 1XVMA 1DWEH 1TGSZ 1P2MA 1ELBA 1CBWC 1GCDA 1F0TA 4YLUA 1IQMA 1LHGH 3MFJA 1ANBA 4R0IA 1UTQA 2JH0D 3GCTF 3P8FA 1MQ6A 5AHGH 3M5MA 1S84A 2ZPQA 1RTLA 1LHCH 1GI7B 2G5NA 2VWLA 4NA7A 1SGPE 3U1IB 1F92A 1FZZA 3SJ8A 1VJ9U 2FOFA 1MTUA 5TJXA 4BTTB 1DICA 1BRUP 1YPKH 2BD9A 1IOEA 4AFQA 5CHAC 2PUQH 1LPKB 1EJAA 1SGIB 1KTSB 4KGAA 1U6QA 1GBMA 1TAWA 1XMNB 3UR6A 1K1MA 1NRSH 5DP9A 1GMCF 1HJ9A 3UOPA 3GY3A 4O9VA 3P6ZB 2Z6BD 1K1JA 5TCAA 4B74A 1KXAA 4Y71A 3BG8A 3CS0A 3M35A 1UO6A 1ABJH 4XBDA 3TH3H 2HNTC 2BX3A 1EZUC 1C4V2 4K3JA 4NA9H 1TALA 3BSQA 1T8OA 4NIYA 4IC5A 1IQGA 4X8UH 1E38B 4TWYA 2ZFQH 5EG4A 1CGIE 3KEEA 5CE1A 1O3GA 2IOTA 2G81E 2PKSB 2VH6A 1QL8A 3RUOA 3RXKA 1XVOA 1HAHH 4X2XA 1D9IA 2OCVB 1QR3E 4FUJA 3HGNA 1TGNA 3D23A 2FOGA 1Y5BT 5A8XA 1J15A 2PWXA 3HGPA 3LC3A 3M61U 3RXIA 1GI1A 5DK1A 1A7SA 3RXOA 2XC5A 3GDSA 5C1XA 1W12U 1GHAF 2DUCA 1OYTH 1HYLA 1O2GH 2XNIA 4FUEA 3SV8A 3LOXA 2GCTC 3UWIA 1DS2E 1C1PA 1PPBH 4I8HA 3MO6A 1GDQA 6CHAB 1TYNA 4KTSA 4JZEH 1Y5UT 4CHAC 4Y6DA 5GPIB 1IQLA 1GCTC 3SGBE 1YPHC 2GGVB 2H2ZA 1AFQC 1TABE 1SFQB 3F9GA 1EX3A 2PV9B 3ODDA 5IYTA 1YGCH 4YESB 1O2SA 2PGQB 4INLA 1HAOH 4Y0YE 1NFUA 1CO7E 4MNVA 1D4PB 2WUBA 1DOJA 3UIRA 2Y6TA 4H42U 1BBRE 4Y0ZE 4NSVA 5EGMA 6CHAC 1S81A 1HAZB 1QURH 1GI6A 1GBTA 1SGQE 1VCWA 4CR9A 5HYOA 3TH2H 3FFGA 2YOLA 1ZMJA 3MU1A 4UFEH 2OBQA 3ZZ6A 1OP8A 2FS9A 1G36A 3NWUA 4E06H 1P10A 4FUBA 3SUEA 1AUTC 1MQ5A 3BEUA 1KLIH 2AIQA 4ABAA 1O37A 3LT3A 6GCHG 1N6YA 1LMWB 1J9CH 4IC6A 1OOKB 3SJOA 3SNBA 4UE7H 2QXHA 4JYUH 5T6DA 2B7DH 2VB0A 1QTFA 1Z71A 4FVBA 1ZRKA 4LOYH 2G5VA 4YT7H 4Y11E 1WV7H 5AF9H 1P2JA 2ANYA 4LZ4B 1HJAC 1LHDH 1Y59T 1V2QT 3U8OH 2GKVE 2ILNA 4LK4A 3PWCA 5A8ZA 2C8XB 2KAIA 3G01A 4AG2A 3N7OA 5IDKA 3MU0A 3U1JB 3S7KB 3SV6A 2GCHG 4XOJA 4RN6A 1LPZB 4H6SB 2FEQH 3MO9A 4WF8A 4AB8A 2O8UA 3SNCA 1HAXB 1CSOE 1C1VH 2BVSH 2VVVA 1GI9B 4X6NA 1GHBG 2Y5HA 1TWXB 4NWLA 2ZF0H 4I33A 4TYDA 4B75A 4BANB 3HKIB 4CRAA 2OC7A 1V2JT 4JYTA 2O8WA 1ANEA 1W8BH 1GVKB 1K1PA 1L4DA 2ZCHP 1PJPA 2OUAA 3EQ0H 4D9QA 2A31A 1SGCA 1LVYA 4MG3A 3RU4E 2ZPSA 2BD2A 3ZYEA 2P95A 3KNXA 1EP6A 3KCGH 1O3FA 1AWFH 3FVFB 1XXFA 3IITA 1C4Y2 1TX6A 2G00A 1DE7H 1LPGB 2UUFB 1K1LA 3MMGA 2BVRH 4ZXXH 1W10U 1G37A 2ZGHA 1PPHE 4X1QU 1TNHA 1UTNA 1C5YB 2ZHFH 1BTWA 2Z9GA 2EA3A 1SSXA 3T25A 1QGFA 2GMTC 1E0FD 2STAE 3QO6A 2BLOA 1O2RA 5EODA 5K7RA 1C1OA 3A7VA 1O5EH 3SU1A 2G4TA 1ELTA 1WTGH 1GJ7B 4HFPB 4UEHH 2CN0H 1TNJA 2OLGA 1GDUA 1ZTJA 3P8OA 1THPB 3RXCA 3QTOH 2F9PA 4HI3A 1B7XB 2W3KA 3Q76A 1FIWA 1C5NH 1DLEA 1O35A 3AAVA 3S9CA 1O5AB 1DANH 1BTZA 1LQDB 1AVGH 3C1KA 1GI5A 2HRVA 1P9UA 1TBZH 3PO1B 4MNYA 2F9OA 4U2WA 4OS5A 1SGEE 1SGRE 3A7TA 1QA7A 1Y8TA 2VGCC 5GDSH 1TPPA 3LPRA 1E34B 1SLWB 1BQYA 3M7UA 3B8JA 1C4U2 2P8OC 4X1SU 2O8LA 3QDZB 1GMHG 2G55A 5JB9S 2AERH 1HJ8A 1TFXA 2QF0A 1OSSA 2J4IA 1A61H 3VB5A 1WU1A 1DPOA 1TMBH 1VITF 3URDA 1IHTH 1SL3A 3BG4B 2AFQB 1K22H 1O33A 1P2QA 4WVPE 1GMDG 2BDCA 2BQWB 4DURA 5FXLA 1ZSJA 3M3TA 1O5GH 3CENA 3MO3A 4XBCA 3RXUA 5JB8S 1AB9C 3FANA 1TNLA 1NRRH 1O3CA 1OWIA 3SU5A 3VXFH 1P05A 3DA9B 1PPCE 1BRBE 4Y8ZA 1HRTH 4Q80A 1ESBA 2J34A 1ZJKA 1KYNA 2ZFTA 1KY9A 2WPHS 1CA8B 3BG4C 2OD3B 1IQKA 4NZQA 3MH6A 4Y8YA 5K0HA 1EAWA 1VJAU 3K6ZA 4D76A 1Q2WA 2HPQH 1KDQB 1AGJA 1HAIH 1ZMLA 2Y5FA 1A1RA 5G4BA 3RMOH 3AVZA 4Y10E 1C1NA 2BM2A 1P8VC 2OP9A 1A46H 2G8TA 3TITA 2ZQ2A 4FU7A 5E8EH 1ZPBA 1UTKA 2VVCA 1BB0B 1B0FA 3SGQE 2GDDA 1ZRBA 3NKKA 4K2YA 3LGTA 2V6NA 1F5KU 3PTNA 4ZUHA 1XUHA 1T31A 1GJ4H 3T29A 3ZVCA 2H1UA 1FPHH 1O3NA 3DFJA 3BTHE 2NWNA 1KIGH 4ABFA 3MU5A 3KN2A 2PSYA 3W94A 1GG6B 1QRWA 3PMHB 1OX1A 3M3VA 4K8BA 2BLWA
chains in the Genus database with same CATH superfamily
2K7XA 1S83A 2BDHA 1LDTT 4F4OC 4ISLA 1K1NA 4TY6A 2ZCKP 2FWWA 4BTUB 2JJ2D 3GY5A 1LVMA 4Z0KA 3SNEA 2P3TB 1GHXH 1O2OA 1CU1A 1UCYK 3MH7A 2J98B 1FV9A 1EZXC 1NT1A 4TPYA 1FDPA 2BDBA 5DP8A 3TVJB 1AU8A 3DSPA 1MUEB 4FUHA 2R3YA 3KIDU 5L2ZH 1CGJE 2QIQA 2FX6A 3PLPA 1V2WT 1GI4A 1AZ8A 1HAVA 2D8WA 3LGYA 1SQOA 3OU0A 3PB1E 4ISNA 2ZHQH 2GVFA 4GVUA 1FN8A 3SUDA 1V2UT 3BF6H 1C5QA 3SI3H 1GHYH 1ZGVA 4Q2KA 2F3CE 1SQTA 2P94A 1HB0B 2VIOA 1O2KA 1GI0A 1GJ5H 4DGJA 4CRGA 1GBCA 3GDVA 1BOQA 1VGCC 7GCHG 4ZMAH 1N8OC 2XRCA 1B0EA 4RKOB 1HNEE 2O9QA 2QAAA 1YPMH 4BOHA 2JETB 1S5SA 1ETTH 1EB2A 1AKSA 2Y81A 3ATLA 1C2JA 2DE9A 1GVZA 4YTAA 3I78A 1DXPA 5C5OA 1FXYA 3RMLH 1PQ5A 1NBMD 3FAOA 4ABEA 3MYWA 3A81A 3GY4A 3PLBA 2CF8H 4OS4A 3CNRA 1S6FA 6GCHF 5GCHF 1ELEE 4MNWA 3OTJE 3RDZA 4VGCC 2FO9A 2UUJB 4U30A 3RP2A 1OPHB 2ZTYA 2JDID 3BIVH 1O3EA 2BD4A 1AFQB 5A8YA 5DPAA 5L30H 8ESTE 1UVTH 1MBQA 1SLVB 2EC9H 1YCPK 2VWMA 2XCNA 3K9XB 3ZVAA 1UCYH 3RU4T 2W7SA 1GI3A 4Y7AA 3KQEA 1Y3WA 4K60A 1SGTA 1H9IE 2R9PA 3OSYA 1UCYE 1RS0A 1UMAH 2GZ8A 3LJOA 4RKJB 2ZWLH 4JZFH 4LXBH 4X8VH 1PFXC 2AMQA 2ZHDA 1TMTH 4FUFA 4QT8C 5JBAS 1CGHA 3RXDA 4RT1A 3UWJH 4I8KA 2CGAA 5EPYA 3PLKA 2P16A 1KXBA 5F8ZA 1CBWB 1MABB 1O39A 5FAHA 1V2ST 4TSFD 2QF5A 4YM9A 4ISOA 2FIRH 3GISB 5A0BA 2BX4A 4AGKA 1BTHH 2QE7D 2P93A 2VIVA 1O2VA 1YCPM 3OEHD 3UUZA 2PGBB 1HXFH 2Y7XA 3V0XA 1IAUA 3WWBA 4JK6A 1QBOA 1FY8E 3P17H 3ENSB 3ZYDA 1P04A 4D7GA 1FJSA 1L0ZA 2HVXA 1QFKH 3A80A 5GCHG 5DO4H 2HPPH 5C1UA 3QZQA 4XE4A 1IHSH 4GCHG 4UD9H 3SQHE 1TNKA 1Q3XA 2FXRA 4CRDA 1A2CH 3M5LA 3PV5A 5EJLA 1FAKH 4ZAEA 4GCHF 2BD3A 1BTYA 1A3EH 1XKAC 1BZXE 4DOQA 2ZDVH 4K69A 3FZDA 1S0RA 2LPRA 3BTDE 1UVOA 2GZ7A 2TGDA 4AZ2B 1ZTKA 4B73A 2QXJA 1EOJA 2J95A 2A7HA 3SORA 1MD8A 3LH3A 6LPRA 8GCHG 1SR5C 1BRCE 1O34A 5HM9A 1ZHRA 1O30A 1C1UH 2ULLA 1LKBA 2A4RA 1ZPZA 3PMJA 1AE5A 4YT6H 3MOCA 3BEIB 1SQRA 2WPJS 5C0TA 1YPJH 1C2KA 3H09A 3EE0B 3GDUA 2IJD1 3MWIU 1FAXA 1ZYOA 1VZQH 1XKBC 2YMSC 2Q1JA 2RDEA 1CHOF 1GBIA 1KLTA 1BMNH 1MTNC 5ETXA 4NIXA 2Z3EA 1V2NT 3LGUA 3UNRA 3QTVH 3STIA 2NU3E 2ZG0H 3HK3B 3N99A 3EA7A 1GDNA 3O8BA 2A2QH 4X6MA 4B2CA 1T7CA 4D9RA 5LPEA 5FBIA 3LH1A 1TBQH 2AMPA 1P06A 1F0SA 1C1MA 4NIWA 3ZZ3A 1G3CA 4CHAB 3BIUH 2OK5A 1V2LT 2A5KA 1K28D 1MTVA 1KLJH 4Y7BA 1LKAA 5AVDA 2D1JA 3GCOA 1TBRH 2XCFA 2GCHF 1O2QA 3ZZAA 2KX4A 1MTNB 4Z6AH 1EZQA 1UHBA 1O32A 1L4ZA 2L6OA 2FOMB 3E0PB 1CT2E 3U8RH 2WINI 2BVXH 1Z1JA 1FY3A 2BY9X 3LC5A 1UJ1A 1AD8H 1OWDA 4I8JA 1BBRH 1Y3YA 5DJ7A 4DCDA 1FNIA 1P2KA 1L2EA 3JZ2B 3RLWH 4AFZA 2Y7ZA 2J94A 4I86A 2Z94A 1CA0C 2XBYA 1CE5A 1DDJA 1LCYA 3RXBA 4AYVB 1NRPH 3FZZA 2HNTF 3SN8A 2JJ1D 3RLYH 2EI7A 4X8TH 4XRNA 1QQ4A 1FPCH 1MAYA 2AMDA 4A1TA 1XXDA 3UB0A 3AW1A 3QX5H 4WH6A 5H4IB 4A5TS 1HAGE 1NU9A 3LGWA 2P8OB 1G2LA 2VIDA 3TK6A 1BITA 9ESTA 2FYRA 4ZKOU 2GDEH 2PFEA 5EQRA 3TGIE 2ZKSA 3MU4A 5CDFE 1F0UA 2FM2A 1F5LA 1O5FH 3SU6A 2GP9B 1V6DA 2VIQA 4WWYA 2WSSD 1H8IH 5E0HA 2B0FA 1EATA 1O5CB 1P2NA 1P57B 1AWHB 4AYYB 2NU4E 3E16B 4MVNA 1W0ZU 2XC4A 4NGAH 3E3TA 4FUDA 1GJ9B 3L3TA 3M5OA 3RMMH 1RRKA 1NO9H 4GUXA 5BPEA 2O8MA 2QCYA 3GYMA 2A45B 1TPOA 2G51A 2D26C 2G4UA 4WXIA 2B8OH 3UQOA 3FP6E 2HLCA 2BTCE 1AN1E 1WTHD 4FUIA 3DD2H 3GY8A 4I32A 1RTFB 3U69H 4M7GA 3UREA 4IW4E 3SU3A 1YM0A 4GPGA 1C2MA 1OS8A 1VCQA 3RXQA 4ZH8A 2BQ7B 4DIHH 5DP5A 1X7AC 2F9UA 4AOQA 4ZHAA 1G32B 4MPUA 1MKWK 4NFEA 2AIPA 1P9SA 1OHHD 4DY7B 2RG3A 4MLFB 1HCGA 3BTME 2FS8A 1QJ6B 3RXLA 4BAHB 1GBBA 4PROA 2FYQA 1V3XA 1OP0A 1NFYA 2F9NA 1GL0E 1NY22 4HZHA 4IMQA 3MQKC 5C17A 1BMMH 2C4FH 1IQNA 5DKMA 1K0HA 3VGCC 2CV3A 3BEFB 2ZGCA 3UFAA 3ZVDA 3N7EA 1FIZA 4OS1A 4X2YA 1GL1A 3PWBA 4ZKSU 2GT7A 1H9LB 2H9EH 4IN2A 1E1RD 1GG6C 2HWLB 1DSTA 1C5ZB 3KYGA 3QLPH 3HPTB 4ABBA 4CBNA 4RI0A 3O8DA 2GV6A 3LGIA 1MKXH 2HOBA 3SOSA 1ZOMA 3QN7A 1OWKA 1BDAA 2ANMH 3PROA 1MTSA 1YPEH 1P3EA 2IPHA 1IQHA 1Y5AT 3H7TA 2DE8A 4ABGA 3P95A 2FESH 2PTNA 2V3HH 4U32A 1AO5A 4KKDA 1XM1A 1ZZZA 2WPMS 3MNSA 3M5NA 1P2IA 1ZSKA 2UUYA 2TGTA 5BRRE 1ETRH 1C2DA 1TPAE 3AASA 1TRYA 3VEQB 3A8BA 1RIWB 3GCHC 2IPQX 1P02A 1GGDB 1TRMA 3UPEA 1D3PB 2QGRA 1AY6H 1EPTB 4Y8XA 5KEDA 2WYGA 2OTVA 1EAIA 3RM0H 3M7QA 3NK8A 5LH8A 4J2YB 3ZZ5A 3P70B 2FLRH 2VGCB 2W6JD 3A8CA 1O3IA 1O2TA 3I77A 3QGJA 2A1DB 3TPIZ 3EBNA 3SGAE 3TU7H 4X6PA 4JZIA 1RJXB 4ZHMU 1O2ZA 2BYAX 1Z6JH 2EI6A 1T8LA 1C2GA 1DY9A 1PPEE 2RDLA 3P8GA 5T6FA 1YLNA 3KHVA 5F03A 3D49H 2ZEBA 4FETA 4IN1A 3GY6A 3K6YA 2W3IA 1S82A 1SGNE 5EPNA 1AB9B 1RGQA 2R0LA 4OS7A 2YNAA 1IQJA 3LONA 3TNTA 2UUKB 1GHAG 2KAIB 2ZGJA 1EPTA 2AGEX 2AGIX 2Z7FE 2F9BH 3M36A 4CREA 3PMAB 3ZVBA 3TJNA 1W11U 7GCHF 2J38A 3DHKH 2BLVA 3S0NA 2A7CA 1CT0E 1W14U 3SHCH 1BCUH 2XXLA 1OXGA 3LKWA 1GMDF 2AH4X 2BLQA 2J5UA 1K9OE 1S6HA 3W95A 5A2MH 4IS5A 3DFLA 2WV5A 5SGAE 1O3LA 5HGGA 1NPMA 1D3QB 1QHRB 5HMAA 2JKHA 1G3DA 4E05H 2BHGA 3ZV8A 1J17T 1LTOA 5CHAB 7ESTE 1EZSC 7KMEH 3T26A 2PSXA 4FVDA 2SGEE 2ZU3A 2OBOA 3ZZBA 2GT8A 1NS3A 1YYY1 1MH0A 2FX4A 2F83A 1AKSB 2QXIA 1BJVA 1EJMA 3O8CA 4DG4A 3A83A 1HFDA 2Z3CA 1P3CA 3TJUA 2R2WU 3RXSA 3T62A 1DY8A 1P01A 2XWAA 2YMSD 4FXGH 3T27A 3A87A 1GJ8B 3P92A 5F53A 3IWMA 1FUJA 4X0WU 2TGPZ 3R0FA 4CBOA 2TGAA 4YOGA 1GPZA 3ATMA 4LZ1H 2ZTZA 1P09A 3EA9A 4TT3D 4KTCA 1GBEA 2KCAA 3TGKE 1ESTA 1FY1A 2ZCLP 2C90B 1ANCA 5E2OA 3EGKH 1QIXB 3PYHA 1G9IE 4Q7XA 3F6UH 3RXVA 1PPGE 3A84A 5CHBA 3PM3A 1JMOH 2P3UB 3SQEE 1FI8A 4TPIZ 1Z7KA 4ZKRU 1PQAA 1O2JA 1ARCA 5T6GA 3H7OA 4CRBA 1EFRD 3BTKE 1OWHA 1WQSA 1BTUA 5I25A 1GJBB 2VU8E 5DP7A 4K1EA 4BXSA 2OQUA 4NZLA 1C5UA 5EQQA 1C2IA 2GCTB 4A6LA 2VVUA 1ZTLA 1QZ8A 1UK4A 2NU1E 2TBSA 1C2LA 2J92A 1SC8U 4KELA 3C27B 4I8LA 5C20A 1O2XA 1N8OB 4WMDA 1SOTA 1BTXA 4GSOA 1NU7B 3BTFE 1MKXK 1SGYE 1Y3XA 3SU2A 3GY2A 5GNDA 1RXPA 4B1TA 2JETC 3SNAA 3WW7A 3TH4H 2FOAA 1DXWA 2KZ4A 3RXEA 1NM6A 2CF9H 1TONA 1LVBA 1SB1H 1QL9A 3TJOA 1DFPA 5E0GA 2ALVA 3B23B 5J4SA 4YO9A 2Z9KA 4THNH 4ZHLU 3NUMA 1J8AA 3OYPA 1O3KA 1GHVH 4O97A 2OC1A 4AFUA 1D3TB 3UOUA 4X1NU 1GBHA 5GIBA 3ESTA 3UR9A 3S9AA 3PMBB 1O3PB 1Q31A 1K2I1 2LNCA 4X1RU 4OGYA 1FN6A 3LGVA 2V35A 4INKA 4K1TA 2O8TA 1A5GH 2QV1A 4X2VA 3L33A 2VJ1A 4AX9H 3TNSA 1PPFE 4WJG2 1YLCA 4YLQH 1A5IA 4MDSA 3GOVB 3E8LA 2G52A 4BNRA 1BA8B 5ESBA 3VB3A 1C5VA 1MCVA 4Y79A 1O3HA 4A7IB 3DT0H 1BHXB 3OEED 1H8HD 3F9FA 2LIZA 4JZ1A 2KCOA 1O0DH 3FO8D 1OWEA 3SZEA 1ELVA 1BMAA 2NU2E 1ID5H 4B6FA 1CA0B 3D65E 1THSH 1TX8A 2VWNA 1W7GH 1MCTA 2AEIH 3GCTG 4XDEA 1D6RA 2OXSA 1FLEE 1EXFA 5LPRA 4B76A 2C8ZB 3TK9A 3OTPA 2ZTXA 4YOIA 3ATIA 2NU0E 3BN9A 4BAKB 2ZFSA 3MI4A 4JMYA 5HKKD 2BDAA 1C1WH 1O3MA 1P0SH 1TIOA 3D62A 2FP7B 1PYTC 2VIPA 5EJ1A 1F7ZA 2ASUB 4Q7YA 3FKSD 1BTPA 1TGCA 1UVUH 2XYAA 1RTKA 1BUIA 2UWOA 1TPSA 1GJAB 1O36A 1LHFH 1GHBF 5EW1H 1TLDA 3RXGA 2ZFFH 1ZMNA 1GBDA 2ZNKH 1KDQA 3F3BA 3T2NA 2D2DA 1S6LA 5EXMA 1K21H 1O5BB 3A89A 5FCRA 2UWPA 3BTEE 1JRTA 1XX9A 2XBVA 5ABWA 4YXWD 4UONA 1HUTH 4WH8A 2BD8A 1UK3A 1HBTH 1Z8JB 3UTUH 2ZPRA 1DUEA 1YCPH 2FDAA 3M3SA 1INCA 3TGJE 1MU6B 1YPGH 3ZZ8A 1N1LA 3RU4D 4AFSA 1O2UA 3F9HA 1C2HA 1BHXF 5F6MA 1EAXA 2PHBA 1C2FA 4UFGH 1E37B 5FX6A 2EEKA 3UNSA 1QB9A 1WBGB 3F0PA 5FBEA 3ZZCA 4F49A 3RXJA 2FODA 3SU0A 1XUIA 5FCKA 2BDIA 1L1NA 1C1QA 1HAYB 2GMTB 3UY9A 4B2AA 1K1IA 1MBMA 3O8RA 1TQ7B 1QJ1B 8KME2 1ZHMA 1CHOG 1O2IA 3WWFA 1YY3A 4WMFA 5EW2H 1QBNA 3E0NB 3PRDA 2ANKH 2ZDLA 2FOBA 3SBKA 3V3MA 1SLXB 5LGOA 4J1YA 4NCYA 3U8TH 5CMXH 1YBWA 4E7NA 4UFDH 1GMHF 2ZI2H 3GY7A 2F4LA 2ZIQH 3RXRA 1MZDA 1ELFA 4NSYA 3SU4A 5KGOA 1UVPA 3VB4A 2ZGBH 2Y82A 3S7HB 3QWCH 5EXLA 5C1YA 3CP7A 3NZIA 1NESE 4MTBA 1ZLRA 1W0JD 3ATWA 1LO6A 2XBXA 4KTUA 2QF3A 3U98H 1H4WA 5PTPA 4A1VA 2Z3DA 1D3DB 4MPXA 3JZ1B 5F8TA 2BY8X 2WYJA 1V2MT 2W5EA 1TNIA 3HKJB 3H5CB 3HK6B 1JRSA 1GJCB 2WV4A 2ZGXH 3SW2B 5GXPA 3EA8A 1XUJA 2B5TB 2FZZA 4YOJA 4Q63A 2I6SA 1D6WA 1KSNA 1SLUB 3QGNB 3A8DA 3OY6U 3T5FH 3W1EA 2XTTB 5IK2D 1SFIA 1VKYA 2FMJA 3DSOA 3RXHA 3Q3KA 5FPYA 1SI5H 3RC6A 1EKBB 1G3BA 4X6OA 1SG8B 2THFB 4IBLH 4GLYA 3TJVA 4H6TA 1A5HA 3KF2A 5EOKA 3PO1C 4I7YH 4RSPA 4ZXYH 3MH4A 1C5LH 1O31A 2HLDD 4GHTA 1T8MA 2TRMA 4O3UA 2PLXA 5EIYA 1ABIH 1LQEA 1QL7A 2ZDMA 2ZU4A 2ALPA 2RCEA 3QUMP 1HLTH 5J4QA 2PTCE 2GV7A 4ABIA 2AS9A 2H5CA 2BD7A 2ZU5A 1DT2A 3EDXB 4O03A 3PV4A 2ZDNA 3PV2A 3Q3XA 1KMHB 1Z6EA 2QYIA 2Y80A 4CH2B 4BTIB 4DVAU 5L2YH 1AVXA 4FOUC 1V2KT 2Q6DA 1A4WH 1TQ0B 1AHTH 4WXVA 5HXFA 1O2NA 3UAIC 3GCNA 3VG8A 1NFWA 1O3BA 1ACBE 1ZR0A 4UDWH 1UTJA 1SKYE 3LU9B 2C8YB 2XBWA 2V3MA 2H5DA 4R8TB 1IQIA 3BTWE 2Q6GA 3GS9A 4JZDH 2VNTA 1YP9A 3K2UA 3EE7A 1EAUA 2VWOA 5FX5A 1P11E 1NC6A 5DG6A 4BAQB 2OQ5A 2BY6X 1UTOA 4AC9A 3MNXA 1ARBA 2ZO3H 1P03A 2ZA5A 4CRCA 1TOCB 2ANWA 3ZV9A 3LJJA 1O2YA 1ELCA 2GJGA 1A0LA 3RC5A 3ZZ7A 4ZROA 3GICB 4JCNA 1V2TT 4A92A 1Z1IA 1HAPH 5FL7D 2HNTE 3U9AH 1CQQA 1L1JA 5KECA 1P12E 1FMGA 2GX4A 1P2OA 2C8WB 1H9HE 1WXRA 4GAWA 3SJ9A 1H8ED 1MTWA 1TNGA 1HV7A 1TGTA 1QA0A 1O3AA 2SNVA 1OP2A 1G3EA 4ASUD 3A8AA 4XFQA 1C9TA 3ITIA 2BOKA 4ZKNU 3ZZ9A 2ZU1A 1HXEH 1VCPA 3A7YA 3EYDA 4U01A 1NFXA 3M7TA 1QB6A 2ZP0H 2M2AA 1N6XA 4B71A 1ZHPA 4BXWA 4CR5A 1J16A 1GBJA 3FP8E 2STBE 3OAAD 2J97A 2ODQA 4X1PU 1MD7A 4B2BA 1UTPA 2PKSC 2M5TA 1YPLH 2VH0A 3E1XB 2TPIZ 4P02A 3AK5A 1HPGA 5C5NA 1A3BH 3SUGA 3A88A 4DW2U 3SJIA 1QY6A 4HGCA 1KXFA 2SGFE 2A5IA 2ZFRH 2FI5E 2VINA 2HALA 4CH8B 3IG6B 5C3NA 1ANDA 1B5GH 5JPMH 2XC0A 3SV9A 3MNBA 2BQ6B 2SFAA 4ABDA 1AE8H 2JH5D 4X2WA 6ESTA 2QA9E 3E90B 3SV2H 1QB1A 4KP0A 2GZ9A 2BD5A 1PQ8A 3BTGE 1QRZA 1O3DA 4CRFA 1GHZA 1SQAA 3Q00A 1Z8IB 4D8NA 2A5AA 2J9NA 1WCZA 2CXVA 1V2PT 2QXGA 1GBAA 5LPFA 1BBRK 2W26A 4F55A 2JH6D 2BXTH 3E91A 4BAMB 5HM2A 3ZZDA 1V2RT 2TIOA 5HIZA 1TMUH 1T8NA 3V12A 2FTMA 1IQEA 3HATH 5TCCA 3SJKA 3SUFA 1W13U 1H8DH 1GWAA 2QN5T 3RXTA 1OWJA 3A86A 4OGXA 1ELDE 1MKWH 1O2LA 2FOHA 3ATKA 4A1XA 5B6OA 5AFYH 2RA3A 1S85A 5JDUB 3KQDA 1IQFA 8LPRA 3WY8A 4FU8A 1EP5A 1KXCA 9LPRA 3QZRA 4P00A 4Y76A 1F2SE 2H9TH 3KQCA 5JBBS 3OE7D 3B9FH 1QRXA 1ELGA 3MNCA 2WZQA 1EJNA 4HTCH 2BZ6H 2P59A 2CJIA 1YC0A 1L1GA 1PYTD 3GYLB 1TGBA 1W0YH 1SHHB 1GI2A 1UVSH 2PUXB 1TE0A 5GWZA 1SBWA 1UW7A 1HJAB 3K65B 1S0QA 4WY3A 4H4FA 4SGAE 4XD7D 5E0JA 3FOAA 1JBUH 2UWLA 1W7XH 4ISHH 1LVOA 1AZZA 1YF4A 2ESTE 3MH5A 1A0JA 2SGAA 3OFND 2ZECA 1O3OA 3BTTE 4FUCA 3V7TA 1ESAA 3I29A 4D7FA 1XUKA 2YMSB 1AVWA 1BMFD 1Y3UA 4AGJA 1JWTA 4Z1MD 1QJ7B 1C5XB 2J2UA 3ZVEA 2RFKC 1DSUA 4AG1A 3A82A 5DGJA 3ZZ4A 5L6NH 3AW0A 2WPLS 1BT7A 1C1TA 1GHWH 4F48B 1YLDA 4BAOB 1WSSH 5EXNA 3VXEH 4TY7A 4GHQA 2BDGA 3F2GA 2ZDAH 1TA6A 1DITH 3E6PH 1VITH 3UQVA 1DX5M 4I31A 2XWBI 3URCA 4ASHA 1F5RA 1H1BA 3MU8A 3S69A 5C67A 1O3JA 1UTMA 2Z9IA 2OC8A 1W2KH 2V0BA 1WOFA 3SNDA 3VFEA 4ZCNA 2L74A 5A09A 4OS6A 2PKAA 1W3CA 2I6QA 2ODYB 1GCTB 1BRAA 1ELAA 3RC4A 3T28A 5A0AE 1AQ7A 3VB6A 4TWWA 5T1VA 1SMFE 5JBTA 1PQ7A 2BB4A 1OYQA 2Y5GA 2HGTH 4FU9A 7LPRA 1C9PA 1JOUB 5AFZH 2ODPA 2ZU2A 5EQSA 2VIWA 1MMJN 1WQVH 3F1SB 1WYKA 1C5WB 1SHYA 2FTLE 1FY4A 1EQ9A 4MPWA 2A32A 3RXMA 4DT4A 2FLBH 1HAVB 1HGTH 4WMEA 1SPJA 3L6PA 4I8GA 1EB1H 2WPKS 1O2MA 1SGFG 4E7RG 4ABHA 2PKAB 3PRBA 3CS7A 3FP7E 4MPVA 2HVYB 2WV9A 5T3HA 1DWDH 2JIZD 1V2OT 1NN6A 4K8YA 1O2WA 4ISIH 1BMLA 1C5TA 3VPKA 1ETSH 3RXAA 2WUCA 4AN7A 3ZVFA 2IJOB 2GTBA 4NG9H 1AMHA 2ZFPH 2Z9LA 3U28C 4IGDA 1VITG 3RXFA 2GD4B 2A4GA 1WUNH 4AB9A 1C1SA 2OC0A 1XUFA 2H6MA 2XW9A 2OINA 2A0QB 5ESTE 1NROH 1C5OH 1LHEH 4DT7B 3S9BA 3OX7U 3EAJA 5I46H 5HIYA 5JYIA 2YNBA 1NTPA 1BJUA 1JIRA 1C2EA 1GBFA 1MAXA 1TB6H 1ZJDA 2SGDE 3A7ZA 1GBLA 3TIUA 1WDIA 2AHME 4Q7ZA 1G2MA 2W7UA 1QQUA 3NXPA 5E2PA 1GVLA 3A7XA 1PPZA 1BIOA 1O38A 3NPSA 1MU8B 2R0KA 1COWD 1KTTB 4NIVA 2SNWA 4B6EA 2BXUH 4JK5A 1J14A 1JXPA 1GI8B 4XBBA 1F0RA 4ESTE 5JBCS 1NRQH 5F8XA 3VGCB 3ZVGA 1CT4E 2PW8H 1V2VT 1THRH 5A0CA 5C2ZA 2FI3E 1DM4B 1DLKB 2ZQ1A 4K5ZA 4O3TA 1C5PA 1C5MD 1FX0B 1SGDE 2RA0A 1JIMA 1VR1H 3LDXH 3A85A 8GCHF 1YWUA 3NCLA 5DP3A 2ZDKA 2K1QA 1WAYB 2BDYA 1CVWH 1FY5A 1O2HA 2ZHWH 4MNXA 5FPSA 3F68H 2SGQE 1C1RA 1SVPA 4DJZB 3V13A 3M37A 2A4QA 3ODFA 1ZPCA 3KQBA 4ACBA 2BOHB 2V3OH 3KL6A 1RIWC 3ELAH 3GCHB 4UFFH 3BV9B 1HDTH 4ABJA 3SHAH 1T32A 2A4OA 1EPTC 2IN2A 3DUXH 1SOZA 1TRNA 1G30B 3F0OA 4NA8A 3BTQE 3UNQA 2F91A 2PR3A 2QC2A 4IMZA 1NZQH 1O5DH 3KGPA 1T4UH 3R3GB 2SGPE 2FI4E 1GBKA 3P8NA 3STJA 2BMGB 1ZGIA 2WPIS 3QK1A 1Z8GA 2CHAC 1CHGA 3TK5A 2XOKD 2K8IA 1DVAH 1C5SA 1UTLM 2P3FH 1QCPA 4INHA 3A7WA 1DUAA 3MHWU 5FHTA 4NWKA 1OKXA 1DWCH 2B9LA 1NRNH 1YPHE 2C3SA 2R3UA 3AAUA 4AORA 1GJ6A 2F9VA 1VGCB 3SYJA 2FOEA 2Z9JA 1HIAA 1E36B 1AI8H 1M9UA 2FPZA 2BZAA 2CHAB 1E79D 1SGFA 2A7JA 1KXDA 1QBVH 3LIWA 3RM2H 1AUJA 1MZAA 5DN6D 1GGDC 1KXEA 1EUFA 1TA2A 2C93B 2ZC9H 1A0HB 1TOMH 1ORFA 4XSKU 1ZSLA 3PTBA 3SV7A 4NFFA 2CK3D 1EOLA 4YZUA 1DWBH 3F9EA 1TX7A 3OY5U 4X8SH 3TLOA 4K1SA 4FUGA 1C5RA 2EI8A 1AFEH 2AGGX 4VGCB 5DP6A 1Z8RA 1UK2A 1GMCG 4DIIH 1AIXH 3Q3YA 1Y3VA 2J98A 1RFNA 5C94A 2QY0B 1EASA 1YKTA 1T4VH 1QNJA 2CMYA 1UHBB 4JYVH 5EU8A 4SGBE 3RXPA 1FQ3A 2BY7X 2FOCA 3SZNA 1E35B 4OS2A 1GJDB 2KM0A 1XUGA 1HIAB 2ZHEH 1K1OA 3SI4H 2BY5X 2H9HA 4HG6A 4MQAA 1O2PA 2R2MB 5GJ4B 2A2XH 1FONA 3KQ5A 2XNDD 3Q77A 2AYWA 2Q6FA 3VB7A 3SO3A 5FPTA 1RD3B 5DP4A 2ZZUH 3RMNH 3MTYA 1XVMA 1DWEH 1TGSZ 1P2MA 1ELBA 1CBWC 1GCDA 1F0TA 4YLUA 1IQMA 1LHGH 3MFJA 1ANBA 4R0IA 1UTQA 2JH0D 3GCTF 3P8FA 1MQ6A 5AHGH 3M5MA 1S84A 2ZPQA 1RTLA 1LHCH 1GI7B 2G5NA 2VWLA 4NA7A 1SGPE 3U1IB 1F92A 1FZZA 3SJ8A 1VJ9U 2FOFA 1MTUA 5TJXA 4BTTB 1DICA 1BRUP 1YPKH 2F43B 2BD9A 1IOEA 3KYFA 5CHAC 4AFQA 2PUQH 1LPKB 1EJAA 1SGIB 2EQNA 1KTSB 4KGAA 1U6QA 1GBMA 1TAWA 1XMNB 3UR6A 1K1MA 1NRSH 5DP9A 1GMCF 1HJ9A 3UOPA 3GY3A 4O9VA 3P6ZB 2Z6BD 1K1JA 3F2FA 5TCAA 4B74A 1KXAA 4Y71A 3BG8A 2EY4C 3CS0A 3M35A 1UO6A 1ABJH 4XBDA 3TH3H 2HNTC 2BX3A 1EZUC 2QF4A 1C4V2 4K3JA 4NA9H 1TALA 3BSQA 1T8OA 4NIYA 4IC5A 1IQGA 4Q4LA 4X8UH 1E38B 4TWYA 2ZFQH 5EG4A 1CGIE 3KEEA 5CE1A 1O3GA 2IOTA 2G81E 2PKSB 2VH6A 1QL8A 3RUOA 3RXKA 1XVOA 1HAHH 4X2XA 1D9IA 2OCVB 1QR3E 4FUJA 3HGNA 1TGNA 3D23A 2FOGA 1Y5BT 5A8XA 1J15A 2PWXA 3HGPA 3LC3A 3M61U 3RXIA 1GI1A 5DK1A 1A7SA 3RXOA 2XC5A 3GDSA 4M9FA 5C1XA 1W12U 1GHAF 2DUCA 2VBCA 1OYTH 1HYLA 1O2GH 2XNIA 4FUEA 3SV8A 3LOXA 2GCTC 3UWIA 1DS2E 1C1PA 1PPBH 4I8HA 3MO6A 5B6LA 1GDQA 6CHAB 1TYNA 4KTSA 4JZEH 1Y5UT 4CHAC 4Y6DA 5GPIB 1IQLA 1GCTC 3SGBE 1YPHC 2GGVB 2H2ZA 1AFQC 1TABE 1SFQB 3F9GA 1EX3A 2PV9B 3ODDA 5IYTA 1YGCH 4YESB 1O2SA 2PGQB 4INLA 1HAOH 4Y0YE 4RT0A 1NFUA 1CO7E 4MNVA 1D4PB 2V7QD 2WUBA 1DOJA 3UIRA 2Y6TA 4H42U 1BBRE 4Y0ZE 4NSVA 5EGMA 6CHAC 1S81A 1HAZB 1QURH 1GI6A 1GBTA 1SGQE 1VCWA 4CR9A 5HYOA 5EJZA 3TH2H 3FFGA 2YOLA 1ZMJA 3MU1A 4UFEH 2OBQA 3ZZ6A 1OP8A 2FS9A 1G36A 3NWUA 4E06H 1P10A 4FUBA 3SUEA 1AUTC 1MQ5A 3BEUA 1KLIH 2AIQA 4ABAA 1O37A 3LT3A 6GCHG 1N6YA 1LMWB 1J9CH 4IC6A 1OOKB 3SJOA 3SNBA 4UE7H 2QXHA 4JYUH 5T6DA 2B7DH 2VB0A 1QTFA 1Z71A 4FVBA 1ZRKA 4LOYH 2G5VA 4YT7H 4Y11E 1WV7H 5AF9H 1P2JA 2ANYA 4LZ4B 1HJAC 1Y59T 1LHDH 1V2QT 3U8OH 2GKVE 2ILNA 4LK4A 3FN8A 3PWCA 5A8ZA 2C8XB 2KAIA 3G01A 4AG2A 3N7OA 1NBME 3DCLA 3MU0A 5IDKA 3U1JB 3S7KB 3SV6A 2GCHG 4XOJA 4RN6A 1LPZB 2K0QA 4H6SB 2FEQH 3MO9A 4WF8A 4AB8A 2O8UA 3SNCA 1HAXB 1CSOE 1C1VH 2BVSH 2VVVA 1GI9B 4X6NA 1GHBG 2Y5HA 1TWXB 4NWLA 2ZF0H 4I33A 4TYDA 4B75A 4BANB 3HKIB 4CRAA 2OC7A 4OM9A 1V2JT 4JYTA 2O8WA 1ANEA 1W8BH 1GVKB 1K1PA 1L4DA 2KCPA 2ZCHP 1PJPA 2OUAA 3EQ0H 4D9QA 2A31A 1SGCA 1LVYA 2LELA 2KR7A 4MG3A 3RU4E 2ZPSA 2BD2A 3DSGA 3ZYEA 2P95A 3KNXA 1EP6A 3KCGH 1O3FA 1AWFH 3FVFB 1XXFA 3IITA 1C4Y2 1TX6A 2G00A 1DE7H 1LPGB 2UUFB 1K1LA 3MMGA 2BVRH 4ZXXH 1W10U 1G37A 2ZGHA 1PPHE 4X1QU 1TNHA 1UTNA 1C5YB 2ZHFH 1BTWA 2Z9GA 2EA3A 1SSXA 3T25A 1QGFA 2GMTC 1E0FD 2STAE 3QO6A 2BLOA 2LP6A 1O2RA 5EODA 5K7RA 1C1OA 3A7VA 1O5EH 3SU1A 2G4TA 1ELTA 1WTGH 1GJ7B 3N7DA 4HFPB 4UEHH 3NRLA 2CN0H 1TNJA 2WHXA 2OLGA 1GDUA 1ZTJA 3P8OA 5DSFA 1THPB 3RXCA 3QTOH 2F9PA 4HI3A 1B7XB 2W3KA 3Q76A 1FIWA 1C5NH 1DLEA 1O35A 1W0KD 3AAVA 3S9CA 1O5AB 2KCYA 1DANH 1BTZA 1LQDB 1AVGH 3C1KA 1GI5A 2PP6A 2HRVA 1P9UA 1TBZH 3PO1B 2W6ID 4MNYA 2F9OA 4U2WA 4OS5A 1SGEE 5C0UA 1SGRE 3A7TA 1QA7A 1Y8TA 2VGCC 5GDSH 1TPPA 3LPRA 1E34B 1SLWB 1BQYA 3M7UA 3B8JA 1C4U2 2P8OC 4X1SU 2O8LA 3QDZB 1GMHG 2G55A 5JB9S 2AERH 1HJ8A 1TFXA 2QF0A 1OSSA 2J4IA 1A61H 3VB5A 1WU1A 1DPOA 1TMBH 1VITF 3URDA 1IHTH 1SL3A 3BG4B 2AFQB 1K22H 1O33A 1P2QA 4WVPE 1GMDG 2WPDD 2BDCA 2BQWB 4DURA 5FXLA 1ZSJA 3M3TA 1O5GH 3CENA 3MO3A 4XBCA 3RXUA 5JB8S 1AB9C 3FANA 1TNLA 1NRRH 1O3CA 1OWIA 3SU5A 3VXFH 1P05A 3DA9B 1PPCE 1BRBE 4Y8ZA 1HRTH 4Q80A 1ESBA 2J34A 1ZJKA 1KYNA 2ZFTA 1KY9A 2WPHS 3ZIAD 1CA8B 3BG4C 2OD3B 1IQKA 4NZQA 3MH6A 4Y8YA 5K0HA 1EAWA 1VJAU 3K6ZA 4D76A 1Q2WA 2HPQH 1E1QD 1KDQB 1AGJA 1HAIH 1ZMLA 2Y5FA 1A1RA 5G4BA 3RMOH 3AVZA 4Y10E 1C1NA 2BM2A 1P8VC 2OP9A 1A46H 2G8TA 3TITA 2ZQ2A 4FU7A 5E8EH 1ZPBA 1UTKA 2VVCA 1BB0B 1B0FA 3SGQE 4ACAA 2GDDA 1ZRBA 3NKKA 4K2YA 3LGTA 2V6NA 1F5KU 3PTNA 4ZUHA 1XUHA 1T31A 1GJ4H 3T29A 3F2HA 3ZVCA 2H1UA 1FPHH 1O3NA 3DFJA 3BTHE 2NWNA 1KIGH 4ABFA 3MU5A 3KN2A 2PSYA 3W94A 1GG6B 2KFWA 1QRWA 3PMHB 1OX1A 3M3VA 4K8BA 2BLWA
chains in the Genus database with same CATH topology
2K7XA 1S83A 2BDHA 1LDTT 4F4OC 4ISLA 1K1NA 4TY6A 2ZCKP 2FWWA 4BTUB 3GY5A 1LVMA 4Z0KA 3SNEA 2P3TB 1GHXH 1O2OA 1CU1A 1UCYK 3MH7A 1FV9A 1EZXC 1NT1A 4TPYA 1FDPA 2BDBA 5DP8A 3TVJB 1AU8A 1MUEB 4FUHA 2R3YA 3KIDU 5L2ZH 1CGJE 2QIQA 2FX6A 3PLPA 1V2WT 1GI4A 1AZ8A 1HAVA 2D8WA 3LGYA 1SQOA 3OU0A 3PB1E 4ISNA 2ZHQH 2GVFA 4GVUA 1FN8A 3SUDA 1V2UT 3BF6H 1C5QA 3SI3H 1GHYH 1ZGVA 4Q2KA 2F3CE 1SQTA 2P94A 1HB0B 2VIOA 1O2KA 1GI0A 1GJ5H 4DGJA 4CRGA 1GBCA 3GDVA 1BOQA 1VGCC 7GCHG 4ZMAH 1N8OC 2XRCA 1B0EA 4RKOB 1HNEE 2O9QA 2QAAA 1YPMH 4BOHA 2JETB 1S5SA 1ETTH 1EB2A 1AKSA 2Y81A 3ATLA 1C2JA 2DE9A 1GVZA 4YTAA 3I78A 1DXPA 5C5OA 1FXYA 3RMLH 1PQ5A 3FAOA 4ABEA 3MYWA 3A81A 3GY4A 3PLBA 2CF8H 4OS4A 6GCHF 1S6FA 5GCHF 1ELEE 4MNWA 3OTJE 3RDZA 4VGCC 2FO9A 2UUJB 4U30A 3RP2A 1OPHB 2ZTYA 3BIVH 1O3EA 2BD4A 1AFQB 5A8YA 5DPAA 5L30H 8ESTE 1UVTH 1MBQA 1SLVB 2EC9H 1YCPK 2VWMA 2XCNA 3K9XB 3ZVAA 1UCYH 3RU4T 2W7SA 1GI3A 4Y7AA 3KQEA 1Y3WA 4K60A 1SGTA 1H9IE 2R9PA 3OSYA 1UCYE 1RS0A 1UMAH 2GZ8A 3LJOA 4RKJB 2ZWLH 4JZFH 4LXBH 4X8VH 1PFXC 2AMQA 2ZHDA 1TMTH 4FUFA 4QT8C 5JBAS 1CGHA 3RXDA 3UWJH 4I8KA 2CGAA 5EPYA 3PLKA 2P16A 1KXBA 5F8ZA 1CBWB 1O39A 5FAHA 1V2ST 4YM9A 4ISOA 2FIRH 3GISB 5A0BA 2BX4A 4AGKA 1BTHH 2P93A 2VIVA 1O2VA 1YCPM 3UUZA 2PGBB 1HXFH 2Y7XA 3V0XA 1IAUA 4JK6A 1QBOA 1FY8E 3P17H 3ENSB 3ZYDA 1P04A 4D7GA 1FJSA 1L0ZA 2HVXA 1QFKH 3A80A 5GCHG 5DO4H 2HPPH 5C1UA 3QZQA 4XE4A 1IHSH 4GCHG 4UD9H 3SQHE 1TNKA 1Q3XA 2FXRA 4CRDA 1A2CH 3M5LA 4ZAEA 1FAKH 4GCHF 2BD3A 1BTYA 1A3EH 1XKAC 1BZXE 4DOQA 2ZDVH 4K69A 3FZDA 1S0RA 2LPRA 3BTDE 1UVOA 2GZ7A 2TGDA 4AZ2B 1ZTKA 4B73A 2QXJA 1EOJA 2J95A 2A7HA 3SORA 1MD8A 3LH3A 6LPRA 8GCHG 1SR5C 1BRCE 1O34A 5HM9A 1ZHRA 1O30A 1C1UH 2ULLA 1LKBA 2A4RA 1ZPZA 3PMJA 1AE5A 4YT6H 3MOCA 3BEIB 2WPJS 1YPJH 1C2KA 3EE0B 3GDUA 3MWIU 1FAXA 1ZYOA 1VZQH 1XKBC 2Q1JA 1CHOF 1GBIA 1KLTA 1BMNH 1MTNC 5ETXA 4NIXA 2Z3EA 1V2NT 3LGUA 3UNRA 3QTVH 3STIA 2NU3E 2ZG0H 3HK3B 3EA7A 1GDNA 3O8BA 2A2QH 4X6MA 4B2CA 1T7CA 4D9RA 5LPEA 5FBIA 3LH1A 1TBQH 2AMPA 1P06A 1F0SA 1C1MA 4NIWA 3ZZ3A 1G3CA 4CHAB 3BIUH 1V2LT 2A5KA 1K28D 1MTVA 1KLJH 4Y7BA 1LKAA 5AVDA 2D1JA 3GCOA 1TBRH 2XCFA 2GCHF 1O2QA 3ZZAA 1MTNB 4Z6AH 1EZQA 1UHBA 1O32A 1L4ZA 2FOMB 3E0PB 1CT2E 3U8RH 2WINI 2BVXH 1Z1JA 1FY3A 2BY9X 3LC5A 1UJ1A 1AD8H 1OWDA 4I8JA 1BBRH 1Y3YA 5DJ7A 4DCDA 1FNIA 1P2KA 1L2EA 3JZ2B 3RLWH 4AFZA 2Y7ZA 2J94A 2Z94A 1CA0C 2XBYA 1CE5A 1DDJA 1LCYA 3RXBA 4AYVB 1NRPH 3FZZA 2HNTF 3SN8A 3RLYH 2EI7A 4X8TH 1QQ4A 1FPCH 1MAYA 2AMDA 4A1TA 1XXDA 3AW1A 3QX5H 4WH6A 5H4IB 4A5TS 1HAGE 1NU9A 3LGWA 2P8OB 1G2LA 2VIDA 3TK6A 1BITA 9ESTA 2FYRA 4ZKOU 2GDEH 2PFEA 5EQRA 3TGIE 2ZKSA 3MU4A 1F0UA 2FM2A 1F5LA 1O5FH 3SU6A 2GP9B 1V6DA 2VIQA 4WWYA 1H8IH 5E0HA 2B0FA 1EATA 1O5CB 1P2NA 1P57B 1AWHB 4AYYB 2NU4E 3E16B 4MVNA 1W0ZU 2XC4A 4NGAH 3E3TA 4FUDA 1GJ9B 3L3TA 3M5OA 3RMMH 1RRKA 1NO9H 4GUXA 5BPEA 2O8MA 2QCYA 3GYMA 2A45B 1TPOA 2G51A 2D26C 2G4UA 4WXIA 2B8OH 3UQOA 3FP6E 2HLCA 2BTCE 1AN1E 1WTHD 4FUIA 3DD2H 3GY8A 4I32A 1RTFB 3U69H 4M7GA 3UREA 4IW4E 3SU3A 1YM0A 4GPGA 1C2MA 1OS8A 1VCQA 3RXQA 4ZH8A 2BQ7B 4DIHH 5DP5A 1X7AC 2F9UA 4AOQA 4ZHAA 1G32B 4MPUA 1MKWK 4NFEA 2AIPA 1P9SA 4DY7B 2RG3A 4MLFB 1HCGA 3BTME 2FS8A 1QJ6B 3RXLA 4BAHB 1GBBA 4PROA 2FYQA 1V3XA 1OP0A 1NFYA 2F9NA 1GL0E 1NY22 4HZHA 4IMQA 1BMMH 2C4FH 1IQNA 5DKMA 3VGCC 2CV3A 3BEFB 2ZGCA 3UFAA 3ZVDA 4OS1A 1FIZA 4ZKSU 4X2YA 1GL1A 3PWBA 2GT7A 1H9LB 2H9EH 4IN2A 1GG6C 2HWLB 3QLPH 1DSTA 1C5ZB 3HPTB 4ABBA 4CBNA 3O8DA 2GV6A 3LGIA 1MKXH 2HOBA 3SOSA 1ZOMA 3QN7A 1OWKA 1BDAA 2ANMH 3PROA 1MTSA 1YPEH 1P3EA 2IPHA 1IQHA 1Y5AT 3H7TA 2DE8A 4ABGA 3P95A 2FESH 2PTNA 2V3HH 4U32A 1AO5A 4KKDA 1XM1A 1ZZZA 2WPMS 3MNSA 3M5NA 1P2IA 1ZSKA 2UUYA 2TGTA 5BRRE 1ETRH 1C2DA 1TPAE 3AASA 1TRYA 3VEQB 3A8BA 1RIWB 3GCHC 1P02A 1GGDB 1TRMA 3UPEA 1D3PB 2QGRA 1AY6H 1EPTB 4Y8XA 2WYGA 2OTVA 1EAIA 3RM0H 3M7QA 3NK8A 5LH8A 4J2YB 3ZZ5A 3P70B 2FLRH 2VGCB 3A8CA 1O3IA 1O2TA 3I77A 3QGJA 2A1DB 3TPIZ 3EBNA 3SGAE 3TU7H 4X6PA 4JZIA 1RJXB 4ZHMU 1O2ZA 2BYAX 1Z6JH 2EI6A 1T8LA 1C2GA 1DY9A 1PPEE 2RDLA 3P8GA 5T6FA 3KHVA 5F03A 3D49H 2ZEBA 4IN1A 3GY6A 3K6YA 2W3IA 1S82A 1SGNE 5EPNA 1AB9B 1RGQA 2R0LA 4OS7A 2YNAA 1IQJA 3LONA 3TNTA 2UUKB 1GHAG 2KAIB 2ZGJA 1EPTA 2AGEX 2AGIX 2Z7FE 2F9BH 3M36A 4CREA 3PMAB 3ZVBA 3TJNA 1W11U 7GCHF 2J38A 3DHKH 2BLVA 3S0NA 2A7CA 1CT0E 1W14U 3SHCH 1BCUH 2XXLA 1OXGA 3LKWA 1GMDF 2AH4X 2BLQA 1K9OE 1S6HA 3W95A 5A2MH 4IS5A 3DFLA 2WV5A 5SGAE 1O3LA 5HGGA 1NPMA 1D3QB 1QHRB 5HMAA 2JKHA 1G3DA 4E05H 2BHGA 3ZV8A 1J17T 1LTOA 5CHAB 7ESTE 1EZSC 7KMEH 3T26A 2PSXA 4FVDA 2SGEE 2ZU3A 2OBOA 3ZZBA 2GT8A 1NS3A 1YYY1 1MH0A 2FX4A 2F83A 1AKSB 2QXIA 1BJVA 1EJMA 3O8CA 4DG4A 3A83A 1HFDA 2Z3CA 1P3CA 3TJUA 2R2WU 3RXSA 3T62A 1DY8A 1P01A 2XWAA 4FXGH 3T27A 3A87A 1GJ8B 3P92A 3IWMA 1FUJA 4X0WU 2TGPZ 3R0FA 4CBOA 2TGAA 4YOGA 1GPZA 3ATMA 4LZ1H 2ZTZA 1P09A 3EA9A 4KTCA 1GBEA 3TGKE 1ESTA 1FY1A 2ZCLP 2C90B 1ANCA 5E2OA 3EGKH 1QIXB 3PYHA 1G9IE 4Q7XA 3F6UH 3RXVA 1PPGE 3A84A 3PM3A 1JMOH 2P3UB 3SQEE 1FI8A 4TPIZ 1Z7KA 4ZKRU 1PQAA 1O2JA 1ARCA 5T6GA 3H7OA 4CRBA 3BTKE 1OWHA 1WQSA 1BTUA 5I25A 1GJBB 2VU8E 5DP7A 4K1EA 4BXSA 2OQUA 4NZLA 1C5UA 5EQQA 1C2IA 2GCTB 4A6LA 2VVUA 1ZTLA 2NU1E 1UK4A 2TBSA 1C2LA 2J92A 1SC8U 4KELA 3C27B 4I8LA 5C20A 1O2XA 1N8OB 4WMDA 1SOTA 1BTXA 4GSOA 1NU7B 3BTFE 1MKXK 1SGYE 1Y3XA 3SU2A 3GY2A 1RXPA 4B1TA 2JETC 3SNAA 3TH4H 2FOAA 1DXWA 3RXEA 1NM6A 2CF9H 1TONA 1LVBA 1SB1H 1QL9A 3TJOA 1DFPA 5E0GA 2ALVA 3B23B 5J4SA 4YO9A 2Z9KA 4THNH 4ZHLU 3NUMA 1J8AA 3OYPA 1O3KA 1GHVH 4O97A 2OC1A 4AFUA 1D3TB 3UOUA 4X1NU 1GBHA 5GIBA 3ESTA 3UR9A 3S9AA 3PMBB 1O3PB 1Q31A 1K2I1 2LNCA 4X1RU 4OGYA 1FN6A 3LGVA 2V35A 4INKA 4K1TA 2O8TA 1A5GH 2QV1A 4X2VA 3L33A 2VJ1A 4AX9H 3TNSA 1PPFE 4WJG2 1YLCA 4YLQH 1A5IA 4MDSA 3GOVB 3E8LA 2G52A 4BNRA 1BA8B 5ESBA 3VB3A 1C5VA 1MCVA 4Y79A 1O3HA 4A7IB 3DT0H 1BHXB 3F9FA 2LIZA 4JZ1A 1O0DH 1OWEA 1ELVA 1BMAA 2NU2E 1ID5H 1CA0B 3D65E 1THSH 1TX8A 2VWNA 1W7GH 1MCTA 2AEIH 3GCTG 4XDEA 1D6RA 2OXSA 1FLEE 1EXFA 5LPRA 4B76A 2C8ZB 3TK9A 2ZTXA 4YOIA 3ATIA 2NU0E 3BN9A 4BAKB 2ZFSA 3MI4A 4JMYA 2BDAA 1C1WH 1O3MA 1P0SH 1TIOA 3D62A 2FP7B 1PYTC 2VIPA 1F7ZA 2ASUB 4Q7YA 1BTPA 1TGCA 1UVUH 2XYAA 1RTKA 1BUIA 2UWOA 1TPSA 1GJAB 1O36A 1LHFH 1GHBF 5EW1H 1TLDA 3RXGA 2ZFFH 1ZMNA 1GBDA 2ZNKH 1KDQA 3T2NA 2D2DA 5EXMA 1K21H 1O5BB 3A89A 5FCRA 2UWPA 3BTEE 1JRTA 1XX9A 2XBVA 5ABWA 4UONA 1HUTH 4WH8A 2BD8A 1UK3A 1HBTH 1Z8JB 3UTUH 2ZPRA 1DUEA 1YCPH 2FDAA 3M3SA 1INCA 3TGJE 1MU6B 1YPGH 3ZZ8A 1N1LA 3RU4D 4AFSA 1O2UA 3F9HA 1C2HA 1BHXF 5F6MA 1EAXA 2PHBA 1C2FA 4UFGH 1E37B 5FX6A 2EEKA 3UNSA 1QB9A 1WBGB 5FBEA 3ZZCA 4F49A 3RXJA 2FODA 3SU0A 1XUIA 5FCKA 2BDIA 1L1NA 1C1QA 1HAYB 2GMTB 3UY9A 4B2AA 1K1IA 1MBMA 3O8RA 1TQ7B 1QJ1B 8KME2 1ZHMA 1CHOG 1O2IA 4WMFA 5EW2H 1QBNA 3E0NB 3SBKA 2ANKH 2ZDLA 2FOBA 3V3MA 1SLXB 5LGOA 4J1YA 4NCYA 3U8TH 5CMXH 1YBWA 4E7NA 4UFDH 1GMHF 2ZI2H 3GY7A 2ZIQH 3RXRA 1MZDA 1ELFA 4NSYA 3SU4A 1UVPA 3VB4A 2ZGBH 2Y82A 3S7HB 3QWCH 5EXLA 5C1YA 3CP7A 3NZIA 1NESE 4MTBA 1ZLRA 3ATWA 1LO6A 2XBXA 4KTUA 2QF3A 3U98H 1H4WA 5PTPA 4A1VA 2Z3DA 1D3DB 4MPXA 3JZ1B 5F8TA 2BY8X 2WYJA 1V2MT 2W5EA 1TNIA 3HKJB 3H5CB 3HK6B 1JRSA 1GJCB 2WV4A 2ZGXH 3SW2B 5GXPA 3EA8A 1XUJA 2B5TB 2FZZA 4YOJA 2I6SA 1D6WA 1KSNA 1SLUB 3QGNB 3A8DA 3OY6U 3T5FH 2XTTB 1SFIA 2FMJA 3RXHA 3Q3KA 5FPYA 1SI5H 3RC6A 1EKBB 1G3BA 4X6OA 1SG8B 2THFB 4IBLH 4GLYA 3TJVA 4H6TA 1A5HA 3KF2A 5EOKA 3PO1C 4I7YH 4RSPA 4ZXYH 3MH4A 1C5LH 1O31A 4GHTA 1T8MA 2TRMA 4O3UA 2PLXA 1ABIH 1LQEA 1QL7A 2ZDMA 2ZU4A 2RCEA 2ALPA 3QUMP 1HLTH 5J4QA 2PTCE 2GV7A 4ABIA 2AS9A 2H5CA 2BD7A 2ZU5A 1DT2A 3EDXB 4O03A 3PV4A 2ZDNA 3Q3XA 1Z6EA 2QYIA 2Y80A 4CH2B 4BTIB 4DVAU 5L2YH 1AVXA 1V2KT 2Q6DA 1A4WH 1TQ0B 1AHTH 4WXVA 5HXFA 1O2NA 3GCNA 1NFWA 1O3BA 1ACBE 1ZR0A 4UDWH 1UTJA 3LU9B 2C8YB 2XBWA 2H5DA 4R8TB 1IQIA 3BTWE 2Q6GA 4JZDH 2VNTA 1YP9A 3K2UA 1EAUA 2VWOA 5FX5A 1P11E 1NC6A 5DG6A 4BAQB 2OQ5A 2BY6X 1UTOA 3MNXA 1ARBA 2ZO3H 1P03A 2ZA5A 4CRCA