2AYWA

Crystal structure of the complex formed between trypsin and a designed synthetic highly potent inhibitor in the presence of benzamidine at 0.97 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of trypsin with a highly potent synthetic inhibitor at 0.97 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA02
3OX7U 1TX6A 4FUHA 2W26A 3SJIA 1P03A 1FDPA 4FVBA 1FLEE 5DJ7A 3TPIZ 2BDCA 2PKAA 2Z3EA 1XX9A 4UONA 1MTWA 1SG8B 2ZTZA 2TBSA 4FXGH 2WPJS 4DOQA 3MFJA 4AORA 3E90B 5C2ZA 1B5GH 5ESTE 3MOCA 2NU3E 4NIWA 3BTTE 3O8CA 3RXGA 1DANH 3MHWU 2HNTE 3IWMA 1QCPA 2GZ8A 1QIXB 2BY8X 4JK6A 1C1TA 2ZPQA 4AN7A 5AF9H 1ZZZA 1SLXB 1THPB 2AS9A 2NU4E 1RTKA 1P2IA 4AFUA 2W7SA 3E16B 2J94A 4Y8ZA 4WMDA 3SUFA 3LGTA 3T25A 4ZAEA 1XKBC 1O3JA 1SGTA 3A80A 1HIAB 4FUGA 5I25A 2IN2A 2AMPA 2BDIA 1DT2A 3T29A 3GY3A 3TGKE 2B9LA 2ZGCA 4THNH 2GDDA 1UTKA 5A8YA 1M9UA 2AIPA 2GTBA 3PLBA 2B5TB 3SU0A 1CHGA 5EPNA 2PTNA 2BD4A 1O3HA 1UTOA 3UPEA 1DM4B 1NRSH 1NN6A 1FI8A 3MO6A 1D6RA 5HXFA 6LPRA 2HVXA 4ZROA 1O3GA 2G8TA 1YPJH 2FTLE 5DK1A 4RKOB 1GBBA 5IDKA 1ZLRA 1AWHB 1V2ST 3LH1A 2BTCE 3GY4A 1GJ5H 1KXAA 1UHBB 3MU5A 1RTLA 1AKSA 1EKBB 1D3PB 5FHTA 3DD2H 3U69H 2BLOA 1G3CA 1AB9B 2CF9H 1GI0A 3ITIA 3UQVA 1O2OA 3FP6E 3KEEA 4A1VA 1BRCE 1C2HA 5DP4A 1YYY1 3FP8E 3ZZBA 4WMEA 3M3SA 3MH7A 7GCHG 4HFPB 1GG6B 1BIOA 3QTVH 4U32A 4ABJA 2GP9B 4IC5A 1QL9A 1XUKA 4DG4A 2PR3A 1Q31A 3BEUA 3GY2A 2J92A 3HK3B 1GBTA 2QN5T 4K60A 1TGSZ 3EGKH 3P17H 3QUMP 1L1GA 2DUCA 3TIUA 1HFDA 4Y8XA 1WU1A 4I7YH 4J1YA 1ANCA 2H6MA 2UUYA 3ZYEA 3OY5U 1GCTC 1GI4A 2AGGX 4CRAA 1BRAA 1BJUA 1LPKB 1WTHD 2FX6A 3UR6A 4ASHA 1PPFE 5C5OA 3S0NA 3Q76A 2A4RA 2A31A 4Y79A 1O3DA 1O2WA 2ZWLH 1HAYB 1NESE 2FX4A 1AZ8A 4KTSA 1TGCA 1ZSJA 1P0SH 3C1KA 1HJ8A 3M5OA 1V2NT 3S7HB 4OS1A 3SU5A 3QX5H 1Z7KA 4GSOA 1JIRA 3S9CA 3EA9A 1KY9A 1ARCA 4YOGA 1GJ7B 1E34B 1GBJA 2WPHS 1UTQA 1FY3A 4GHQA 3OU0A 1OP2A 3F68H 3M3VA 2GCHG 2A45B 1GJ8B 6CHAB 2SNWA 1RTFB 1GJ6A 3RXBA 1AE8H 3LGWA 1C5OH 4GCHG 3LGUA 3SI3H 1TRYA 1MKWH 1QJ1B 1FAXA 1GBDA 1MTNB 2PTCE 3IITA 1V2MT 1TPAE 2Q6DA 1DWBH 2UUFB 4K69A 1S5SA 1O2LA 2FPZA 1P57B 1K1LA 2A7JA 1XUIA 1LO6A 2A32A 1G2LA 2P8OB 5F8ZA 2VIDA 3MNSA 2BM2A 4CR5A 1HRTH 4XSKU 3RC4A 4JYVH 1ZPCA 1TABE 2PKSB 4NWKA 2Z7FE 2Y82A 3A7YA 1ESBA 4Y0YE 2BXUH 1P2QA 3SJOA 4D7FA 2TGDA 4AOQA 2Q6FA 3SV2H 2J95A 3SU3A 5EU8A 1GI5A 3PLKA 2CMYA 1TLDA 1TE0A 2V3OH 2R2WU 3A84A 4B74A 1YCPM 3UTUH 1FMGA 3LIWA 4I8GA 2ZPSA 1IQEA 2Z9JA 2ANKH 2GZ9A 1Y3YA 1CBWC 4VGCC 3ZV8A 2VIOA 3K6ZA 4Y76A 1C4U2 2W5EA 5JBTA 3PMJA 3MH6A 2YNAA 3HGNA 2ZI2H 2BLQA 1A3EH 1DPOA 1NTPA 1HAZB 2WINI 4X1NU 4UFEH 1ZJDA 1SQAA 1Z71A 4FUEA 2FLBH 1ZMNA 1O31A 2ZP0H 3ODDA 3UFAA 2A2XH 1RJXB 1MKXH 2PWXA 3LGIA 1AUTC 1BTXA 1W12U 2P3FH 1AGJA 4FU8A 5A2MH 3PWCA 1QRWA 4ZHAA 3M7TA 1LHDH 1LQEA 1SGFG 2J4IA 1E0FD 1LTOA 4X2VA 4ISNA 1LKAA 2BQWB 1P8VC 4KTUA 2VIWA 2ANYA 1YPHE 3BTWE 3RU4E 1C5ZB 2ZU4A 1BBRK 2D26C 1H8IH 2ZHEH 4R8TB 2CJIA 1LPGB 2HNTF 2VWNA 3AW1A 1TRNA 1RIWB 3SNAA 4WWYA 3TJVA 3ZVEA 2OXSA 5CE1A 1LVOA 1L2EA 1O3BA 4JYTA 4CRCA 2FI3E 3A85A 1GWAA 1OX1A 3SJ8A 4GVUA 2ZTXA 4OS2A 3B8JA 2ZCHP 3Q3KA 1UVOA 1A61H 3QZRA 1IQJA 3KHVA 3SBKA 4MQAA 1GHBF 3H7TA 1ZMLA 7LPRA 2F9VA 3SNBA 3NWUA 2J2UA 5K7RA 5DO4H 1DVAH 1AY6H 2HGTH 1DS2E 2PUXB 4NA9H 1ZSKA 1FUJA 3A7XA 1BMMH 2WYGA 1C2IA 5EODA 2CF8H 2VGCC 4WH6A 1SFQB 5FBEA 5JBBS 2FEQH 4BXWA 3P70B 1O2NA 1NM6A 4I32A 5E0GA 1UVPA 5JB9S 1KLIH 2FYQA 3F9HA 2VVCA 1SGIB 2JH0D 1WYKA 1GBLA 1GHBG 3H7OA 3P8FA 4MNWA 2WPIS 8ESTE 2K1QA 1YBWA 2ZFSA 3LC3A 3MO9A 5FX5A 2CHAC 1O3NA 3Q77A 3RXMA 1BRUP 2UWPA 4BAHB 1PPBH 1ZHMA 4FUFA 3RXDA 4F49A 2A7HA 4Q80A 2ZCKP 1P3EA 1S82A 1SOTA 3SI4H 4I31A 2C90B 3MWIU 4JK5A 1FIZA 2GZ7A 1GHAF 5DP9A 3B9FH 5I46H 2VINA 1AFQB 5LH8A 3W95A 3LH3A 2VB0A 2W7UA 2OP9A 3PO1B 3RXIA 1YCPH 3ZZ5A 1NRNH 2JETB 3QZQA 3RXKA 3ZZ9A 1GMCF 1WV7H 1DLKB 1O34A 2JKHA 2XBXA 5DPAA 1C5SA 2BVRH 2A0QB 3SNEA 2WYJA 5FCKA 1W10U 2ZZUH 3R0FA 2WPLS 1IQLA 1EUFA 4GUXA 2ZFQH 2F9NA 3E3TA 2GV6A 2FOBA 1NFUA 1IQNA 2P93A 2ZNKH 3PB1E 1MKXK 1C5VA 1WAYB 4DY7B 2A5IA 3CP7A 3M37A 4WY3A 3E6PH 1O32A 1THRH 3MYWA 3BF6H 1O2RA 2EC9H 2ZGJA 2ODQA 1CSOE 1JMOH 1QRZA 3RM0H 2UWLA 3QWCH 1EQ9A 1XVMA 5EG4A 1TYNA 1GJ4H 1T8NA 1ZHPA 4ZXXH 1B0EA 3M7QA 4D7GA 1ANEA 1C4V2 3RUOA 1C2KA 2GCTC 1J9CH 4CRFA 3V7TA 4YOIA 2ULLA 1H4WA 1P02A 2FODA 2XW9A 4K5ZA 1GHAG 1MCTA 2FOGA 2VIVA 1WCZA 4AB9A 4H4FA 4QT8C 3U9AH 1KSNA 3TVJB 4CRGA 3RXTA 1C5QA 4YO9A 4AZ2B 1Y3VA 2EI7A 2AGIX 1QGFA 1MH0A 1OS8A 3VB7A 2RA3A 2Q6GA 4B2AA 2ZQ2A 3RXHA 3BTKE 4XBCA 4INLA 1S6HA 2WPKS 3TITA 1LQDB 1LMWB 1PPGE 1TFXA 1GHYH 1EAWA 1ELAA 2SGAA 1A5HA 1O2QA 5T6GA 3STIA 3FZDA 3SUEA 1HAIH 3GCOA 4ABAA 2R0KA 1TAWA 4K2YA 3FFGA 1ZSLA 1HAVB 3FP7E 2FOCA 2JH5D 2FZZA 1MTVA 3IG6B 4A1XA 1O2XA 2QXIA 3BIVH 1MUEB 5T6DA 2RCEA 1BMLA 1QJ7B 4AFSA 4FU9A 4IBLH 1DUEA 2RG3A 3NUMA 2DE9A 3TJUA 9ESTA 4ISOA 4CR9A 1JXPA 1OXGA 1A7SA 3SORA 1XUGA 1QRXA 3UNSA 1NS3A 5GDSH 1XUJA 2WUBA 1SSXA 2GGVB 1A46H 1CBWB 1RIWC 5SGAE 1XVOA 3S9AA 1GMHF 2TPIZ 3UNRA 1A5IA 1O35A 2ZTYA 1O3CA 3PTNA 1P05A 2PUQH 1TNJA 2VVVA 1HLTH 3VGCC 1GJAB 1T4VH 1QFKH 3GOVB 3TNTA 5TJXA 4OS4A 1P2KA 1YPHC 3RDZA 2BMGB 1ARBA 1OWKA 2H5DA 3SW2B 4X6OA 1GMHG 1EJNA 3TGJE 1QJ6B 1IQKA 3GICB 2ODPA 1W0YH 4YTAA 4NIVA 5HGGA 4LOYH 2TRMA 1C1OA 2BDAA 4B76A 1INCA 1Z6EA 3V3MA 4Y71A 3A7ZA 1QR3E 4ABHA 3ATMA 1H9LB 3RXRA 3UIRA 4AGKA 4E06H 3RXOA 1TMBH 1H9IE 1GBKA 3PMAB 1VGCB 5DKMA 1NU9A 3A7VA 3SU6A 1GCDA 3KN2A 1LPZB 1JRTA 2RDLA 1ZPZA 1LCYA 5EQRA 3Q3YA 1J17T 2VU8E 2SGPE 4WXIA 3MI4A 1KTSB 3F6UH 1QTFA 3LC5A 3G01A 1AVGH 3SU2A 1F0SA 1NFXA 2HPQH 3MTYA 2FDAA 3GY8A 1JOUB 1DLEA 1G37A 2XTTB 3EA8A 1ZGVA 1SGEE 2R3YA 3P92A 1RRKA 4OGYA 2ZFRH 4CRBA 2TGTA 1NU7B 3BV9B 4SGAE 3M61U 3DUXH 1Q3XA 1GBAA 3QLPH 2VWOA 3PO1C 2BZAA 2Z3DA 5AVDA 5EXNA 3GDVA 3VXFH 1L4DA 1MQ5A 4Y11E 1ETRH 1BT7A 1ANBA 4AFZA 1WTGH 2ZEBA 1C2DA 1QB6A 3BIUH 1MU8B 4GPGA 3E0NB 4H6TA 3F9GA 4U01A 2G5VA 1SGCA 1AIXH 1FONA 2SGDE 2BX4A 1HIAA 1AKSB 2O8LA 1O5BB 4AFQA 1TPOA 1SBWA 1WUNH 4Y6DA 1ZRBA 1OWDA 1C5TA 5A8XA 1F7ZA 1XUHA 1Y5BT 1O39A 1F0RA 3LONA 3BG4C 3BSQA 1UO6A 1YF4A 1AVXA 3BTFE 1C4Y2 2BLWA 2Y5GA 4NFFA 4Y10E 5CHAB 1A1RA 1NFWA 1TNHA 1TOMH 2AEIH 1LDTT 1DICA 1FN8A 4ABBA 2BD8A 5HM9A 4TPYA 4O3TA 1TMUH 2O8MA 3TK9A 4XOJA 4Q7YA 2Y5HA 2QXGA 2ZDNA 1LVYA 2J38A 3GYMA 3TH3H 1UVUH 2BDBA 4XE4A 1O36A 4X2XA 5FBIA 1ZJKA 2OC7A 4A1TA 3LPRA 1TBRH 2WV5A 1J8AA 3BTME 4GHTA 5HM2A 3SHCH 1EB2A 1VCQA 5F8TA 3ZVBA 3R3GB 4CRDA 3I78A 5DP7A 2ZDVH 2P95A 3UUZA 2ZDLA 2AH4X 1BHXF 1GJDB 7ESTE 1EASA 1IQGA 1TALA 1PPZA 1ZRKA 4F4OC 1GHZA 2GMTB 1EJMA 2AFQB 6ESTA 3L33A 3SHAH 1QURH 2XXLA 1C1MA 4I8LA 1TBQH 3TK5A 3U98H 4ABEA 4NFEA 3AVZA 3EAJA 1GI1A 1ORFA 2BD9A 3MNCA 1ZTKA 1HNEE 4CHAC 4JCNA 3SUGA 4IN2A 4AB8A 5B6OA 1KXBA 5E2PA 4X1RU 1V2OT 3OYPA 1OWHA 4OS7A 3RXSA 2VWLA 1MKWK 3EQ0H 1C1UH 1C2JA 2QXJA 4NCYA 1GI7B 2ZU3A 3AAVA 2AMQA 2Z94A 1J16A 1GVLA 1UCYK 1OKXA 1GI2A 2R0LA 2Z9GA 1KTTB 4CBNA 1FAKH 1P12E 1UTJA 2Z9LA 1P09A 3FZZA 4LZ4B 4ZHLU 5DP6A 1VJ9U 1A4WH 1PQAA 1DFPA 2EEKA 2OC0A 4JYUH 1SPJA 1C2MA 1TQ7B 2EI6A 2G51A 3F1SB 3GISB 4RSPA 1GBMA 2ZHDA 2FI4E 2STAE 4FUIA 3STJA 2VJ1A 2FOMB 1ELCA 2OC8A 3KQDA 4TY7A 4AG1A 4INKA 2Y81A 1DWCH 1O2KA 1Y3XA 3PROA 2FWWA 3SGAE 3ZVGA 1FY4A 4J2YB 5L6NH 3D23A 1WQVH 3SGBE 2GT7A 3U8TH 1B0FA 3ENSB 2ZIQH 1LHGH 2B7DH 3RXAA 3KGPA 5L30H 1MAYA 5GPIB 4DT7B 1Y59T 2XBWA 1CU1A 1HAGE 2A7CA 5E2OA 1TX8A 1AE5A 1IHSH 2GCHF 3KCGH 1HBTH 2ZECA 1K22H 2BZ6H 3FAOA 3KQBA 2OUAA 1GG6C 4B71A 1RS0A 4A5TS 3PYHA 1Y3WA 1O30A 4NSYA 1K1JA 1L1JA 2QXHA 4KKDA 4B2CA 1MTSA 3A88A 1O2ZA 1LHEH 3SN8A 1ELDE 2QYIA 4CREA 3F9EA 1W0ZU 1K21H 1VZQH 1C1QA 3K9XB 1O3FA 5TCCA 4XBDA 2XBVA 1QA0A 3ODFA 2AMDA 2CHAB 3TK6A 3F9FA 1PPHE 4K1TA 2YOLA 1G2MA 9LPRA 1H1BA 3MU8A 3SO3A 1CA0B 2R2MB 2F3CE 1TOCB 4DGJA 3B23B 1V2UT 2IJOB 1O2SA 1QL7A 2BQ7B 2SGFE 1BITA 2O8WA 3UOUA 1MMJN 1SHYA 3ZZ4A 2Z9KA 5A0AE 2ZFFH 2Z3CA 1NY22 3SU4A 1ELGA 1DWDH 1GGDC 4FUCA 3VB5A 2CGAA 2F9OA 1PYTC 3ZZDA 4YZUA 1O3PB 2GMTC 5T6FA 4NA7A 1EXFA 2J34A 1ZTLA 2D8WA 4NA8A 1TGNA 2GDEH 2UUKB 3T2NA 2OINA 1DUAA 1TNLA 2ALPA 4XBBA 3QO6A 1PYTD 1VGCC 1G3BA 5C5NA 4LK4A 2BD7A 2OTVA 3M5LA 4B75A 3SQHE 5ABWA 1HAOH 1W3CA 3GCHC 1EP5A 4JZIA 4TPIZ 4LZ1H 1Z8RA 3RXQA 1AVWA 3N7OA 2OQ5A 3E0PB 1HXFH 1UVSH 1DXPA 2H9EH 1H8DH 3VXEH 4DURA 4FU7A 3ZZAA 3M5NA 5GCHF 5CHAC 3RXEA 3A8AA 5PTPA 1GL0E 2HPPH 4ZKOU 1ELEE 1TRMA 1DE7H 5JPMH 1Z6JH 4I8KA 1TQ0B 3W94A 2A2QH 4NGAH 2F91A 4RKJB 1F0TA 1HV7A 1UK2A 2DE8A 1EX3A 1C5NH 2W3IA 4D8NA 2ZPRA 3TLOA 3ZV9A 3NK8A 3HATH 3SNCA 1SFIA 2ZQ1A 2AGEX 3A7TA 3PMHB 5FPSA 1CHOF 2ESTE 2BX3A 4ZKSU 1YLDA 2H9TH 3T28A 1K2I1 1O3AA 4YLUA 5C1YA 3UREA 2SGEE 3K65B 2JH6D 2O9QA 1BHXB 2OCVB 3KNXA 5AFYH 3RC6A 1O2HA 1O38A 2G52A 2FM2A 3KQCA 3LJJA 4IN1A 4MNVA 8GCHG 1O2JA 3SGQE 1OYQA 1A0HB 3BTEE 1G3EA 1Z8GA 1SLUB 5FPYA 4ABIA 1ELVA 1FPHH 1X7AC 3ESTA 2GKVE 3UWIA 2ZHQH 3TJNA 1V2PT 2ZGXH 3RM2H 1O37A 2XWAA 4D9QA 1N8OB 1P9SA 1N1LA 1KXFA 3S9BA 1HB0B 3NKKA 1JWTA 2QF0A 1GDQA 1P06A 2P3TB 1S0RA 2H1UA 4BNRA 1DX5M 3UNQA 4TY6A 5FPTA 4MTBA 2BQ6B 1FJSA 1OWEA 4UFDH 2XCFA 1GMDF 2BDYA 5DG6A 1C5WB 2FOHA 4YOJA 2HLCA 4O9VA 3RLWH 1K9OE 5BRRE 3DFJA 3RXFA 4E7RG 2J9NA 3ZYDA 3A83A 1NROH 1EJAA 1W7GH 1GJ9B 1W14U 1VR1H 2BB4A 5C67A 3E8LA 4YT7H 1TNKA 1MBMA 5FAHA 4HTCH 5EW2H 1J14A 1CA0C 1IAUA 1O5CB 1TX7A 1O5GH 1YPMH 1PQ5A 1FY8E 5C3NA 4JZDH 1FXYA 2B0FA 2BXTH 4Q7XA 4SGBE 2GD4B 4CHAB 1SHHB 1VCPA 4JMYA 4MPUA 3RXPA 4MPVA 3PMBB 1CGHA 3OSYA 5K0HA 4CH8B 4OS5A 2H5CA 4ZXYH 4DW2U 1CO7E 5FX6A 1SL3A 4X1QU 2OD3B 1W11U 3VGCB 1GI3A 1TB6H 4NIYA 2ZU5A 1GJCB 2R9PA 3JZ1B 4FUDA 3O8BA 1TNIA 4ISHH 2OLGA 5FXLA 2M5TA 1QQ4A 3T62A 2H2ZA 3RMOH 5C20A 5EQSA 4ZH8A 1O3MA 1HAVA 3D65E 2FLRH 2SGQE 5EGMA 2ZCLP 3MH5A 3A81A 1YPGH 1C2GA 1IQMA 2BD2A 4YESB 3O8DA 3ELAH 4MNXA 5A09A 2QGRA 1EP6A 4FUBA 4UDWH 2ASUB 4U2WA 1P2MA 4LXBH 1Q2WA 2NU1E 1AZZA 1CT4E 3A8BA 1O5DH 5HYOA 3OY6U 1A5GH 2Z9IA 5AFZH 1YM0A 5L2YH 1O33A 2OBQA 3MH4A 1QQUA 2OQUA 1GMCG 2JETC 3T27A 1ID5H 1ABIH 1KIGH 1SQOA 2BOHB 1AWFH 4HZHA 1O3LA 4IMQA 1GBCA 3EE0B 3RXLA 2F9UA 3ATLA 4DVAU 2FS9A 1V2JT 1O2MA 3MNXA 3A7WA 1E35B 1UK4A 2WUCA 2QA9E 2QAAA 4DJZB 2PGBB 3TGIE 1S85A 1O5FH 4PROA 3DT0H 1TONA 1F5RA 1SLWB 1KDQB 2ZHFH 3RC5A 1IHTH 3BN9A 1EATA 4AG2A 3ATIA 3HPTB 4KTCA 2NWNA 1AU8A 4INHA 2C4FH 6GCHF 3EA7A 1XMNB 2PGQB 1LHFH 1B7XB 1C5PA 1V6DA 3LGVA 4AX9H 4H6SB 3SV8A 1SMFE 2KAIB 1HJAC 1T4UH 1T8MA 2ODYB 2G00A 1T7CA 3BEIB 2Y80A 1DOJA 3U8RH 1ZHRA 5EOKA 2ZGHA 1KLJH 1VCWA 5BPEA 1VJAU 2BY5X 4MPXA 1JIMA 5HMAA 5E8EH 1CQQA 1C1RA 1MBQA 3D62A 2AIQA 1YPKH 1C1WH 4IW4E 3Q00A 1GI8B 2TGPZ 4WH8A 3P6ZB 1KYNA 1YLCA 1V2RT 3MNBA 2VNTA 4WMFA 1DY8A 1Y3UA 1AI8H 4X6PA 4ESTE 1E37B 2V0BA 2ZA5A 3SQEE 3SOSA 1BRBE 2D2DA 1V2QT 2R3UA 2P16A 4B73A 1ZMJA 3MU1A 5GIBA 3UOPA 1HAHH 3SJ9A 5EPYA 3URDA 1CT0E 3GY5A 4I8HA 3KF2A 1CGJE 3MU0A 1NFYA 4FUJA 3AAUA 5F8XA 4TWWA 3GCHB 3VB4A 3DA9B 2D1JA 3ZVFA 2TIOA 2IPHA 2BY9X 1T8OA 3RU4D 4K3JA 1FY5A 2Y7XA 5GWZA 2VIQA 3RP2A 1GBFA 5TCAA 3A87A 3RXVA 8LPRA 2F83A 3A86A 2ZU1A 1K1OA 1OP0A 2VWMA 1VITF 1C5XB 4X6MA 1F5KU 1GBEA 1G30B 1V2VT 1BQYA 3GCTG 1MU6B 3M35A 3NCLA 1EB1H 3U8OH 2F9PA 4JZFH 1XXFA 4TYDA 4UE7H 3VFEA 3A8CA 2ZDMA 2G4UA 4BAOB 2FO9A 1YP9A 3LKWA 1HPGA 4IC6A 4KGAA 1KDQA 1GHXH 4I8JA 1DY9A 4MPWA 2P8OC 5F03A 1O5AB 3E91A 1JRSA 2Q1JA 2VIPA 2QCYA 2ZGBH 3LOXA 1EZUC 1BMNH 4E7NA 3EYDA 4NZLA 4M7GA 1Z8JB 1F5LA 2BYAX 1MZAA 1P2NA 1W8BH 1ESAA 3VB3A 4JZEH 3D49H 1D9IA 2G81E 1HYLA 5DP3A 2P3UB 3NZIA 2SFAA 1AB9C 4NIXA 2ALVA 3AASA 5F6MA 3ZZCA 1UCYH 1V2LT 3VPKA 1NRRH 3K2UA 2XBYA 1TA6A 2FS8A 5E0JA 6GCHG 1DSTA 3OTJE 4X8TH 3M7UA 5GCHG 2IOTA 1SGYE 5ESBA 1UJ1A 1S81A 2NU2E 1GBHA 3QN7A 4A6LA 1SGFA 2OC1A 1O0DH 5FCRA 1EOLA 1SB1H 2FTMA 3GCTF 1W2KH 3KL6A 2Z6BD 4Y7AA 1QHRB 1Z1JA 1O3IA 1RFNA 3TH4H 2HALA 2YNBA 1CT2E 3BTDE 1MTNC 1K1IA 2XC4A 1K1PA 4AYYB 1V2TT 1SOZA 3P8NA 1C2EA 3DFLA 3LT3A 1TGBA 4GLYA 1V2KT 1IQHA 5GXPA 3PWBA 1ETTH 1KXEA 1WOFA 3L6PA 3BEFB 2ILNA 3GY7A 3ATWA 5EXMA 3PM3A 4YLQH 1HCGA 1HUTH 3P8OA 5E0HA 3URCA 1QBOA 1QBNA 2C8XB 1OWIA 4XDEA 3GY6A 5G4BA 2QIQA 3ZVCA 3KQEA 1P2JA 2KAIA 1TMTH 1C1PA 3T26A 4Y0ZE 4YT6H 1P01A 1GDNA 1O3EA 1TPPA 1UTLM 2BY7X 1HAXB 2CV3A 4DIIH 1GMDG 1FQ3A 1GI6A 4MLFB 4BANB 4Q7ZA 3I77A 1L1NA 1LHCH 1EZSC 1C2LA 5JYIA 4B2BA 1CA8B 1F0UA 1W13U 2A4QA 4K1SA 1EAIA 1P3CA 1BMAA 2C3SA 4WXVA 2XNIA 4Z0KA 1GHWH 3QTOH 1NPMA 1MQ6A 2BLVA 3L3TA 2V6NA 2XCNA 3K6YA 3PLPA 3RLYH 1ELFA 4K8YA 2Y6TA 3BTHE 2ZC9H 3VEQB 3HKIB 1FZZA 3ATKA 4OGXA 2BVXH 3NPSA 1EAUA 2CN0H 3QGNB 3HK6B 5EW1H 1O2TA 1TA2A 1MZDA 1TPSA 1Y5AT 4MDSA 1S0QA 4Y7BA 3TH2H 1RD3B 1O3KA 3FVFB 1FY1A 5DP8A 4Y8YA 4Z6AH 1TIOA 4X8SH 1TBZH 2Y7ZA 3P95A 4TWYA 1EPTC 1S6FA 4XFQA 4BOHA 1BDAA 1QBVH 8KME2 2G4TA 2O8TA 1K1NA 4HI3A 4A7IB 1FN6A 1FV9A 2V35A 2FESH 1L0ZA 3SJKA 1AO5A 1O2VA 2ZFPH 1AN1E 5A0CA 1BOQA 1SGQE 2Y5FA 3BTGE 2ANWA 2GT8A 2ZDKA 4AYVB 4KP0A 1UTPA 2A1DB 3MU4A 1C5MD 1G32B 1LKBA 1LVMA 6CHAC 1D3DB 2LNCA 3RU4T 1ZR0A 1L4ZA 1TGTA 3SV7A 4UFGH 1NRPH 3C27B 5DGJA 3BTQE 2ZDAH 1C1NA 1QA7A 8GCHF 1UTMA 1N6YA 4WF8A 5T3HA 3VB6A 1SLVB 2A5AA 1DWEH 3QK1A 4X8VH 1ELTA 4UD9H 1EZQA 5LPRA 1ABJH 1UMAH 2ZHWH 2VGCB 3QDZB 5GJ4B 1C5YB 2EI8A 1MD7A 1O2YA 2THFB 1YPEH 2A4GA 1PQ7A 2C8WB 1GDUA 2XRCA 2VVUA 3ZVDA 1O5EH 1BB0B 2FXRA 2EA3A 2UUJB 1HJ9A 1BJVA 1UCYE 1XKAC 3CS7A 4BAQB 3PV4A 1CGIE 4CBOA 2FOEA 2FP7B 1HGTH 2I6SA 2ZFTA 3DHKH 1D3QB 1GJBB 1UHBA 2XC5A 1OP8A 5DP5A 4BAKB 1SI5H 1VITH 1E36B 2A5KA 1T31A 3M3TA 3HGPA 4K1EA 1EAXA 3SV9A 2GCTB 2BDHA 3JZ2B 1BBRE 1YKTA 1O3OA 1A0JA 2WV4A 2WPMS 1IQFA 3ZZ8A 1ZGIA 3WY8A 2GV7A 1T32A 5LPFA 1A3BH 1BUIA 2SNVA 3BG8A 1WQSA 2HNTC 1BTPA 5ETXA 1DSUA 2C8ZB 5A0BA 2RA0A 1NRQH 1SGPE 2STBE 3A89A 4IS5A 3NXPA 1VITG 3GDUA 4O97A 4BTIB 2FI5E 1ETSH 3SZNA 1O2UA 4K8BA 1ELBA 1OOKB 1RGQA 1THSH 1YPLH 4IGDA 2HWLB 5EQQA 1D4PB 1NO9H 4GCHF 1JBUH 1K1MA 1WBGB 1Z1IA 1HAPH 1LVBA 3TU7H 1MCVA 2G55A 3KIDU 4B1TA 1OPHB 2AYWA 5C1XA 2XC0A 4BTTB 4ZHMU 2BD3A 1PQ8A 4D9RA 4GAWA 2QC2A 3ZZ6A 4NG9H 2C93B 1O2IA 2PLXA 4X1SU 1F92A 1MD8A 4BXSA 2HOBA 4U30A 3TNSA 4Q2KA 4X2YA 1W7XH 3HKJB 5IYTA 3O8RA 2QY0B 3UR9A 1AFQC 2BHGA 1GVZA 4X6NA 4IMZA 1ACBE 2PSXA 1EZXC 2ZO3H 1S84A 2PSYA 5JBCS 1BTHH 1DITH 2NU0E 1CVWH 4D76A 2GVFA 5A8ZA 3EDXB 4ISLA 1SVPA 1GBIA 2PHBA 3RMLH 1FNIA 1A2CH 1BTYA 4NZQA 4HGCA 1SQTA 1BTWA 3GCNA 2FOAA 4O3UA 4MNYA 3M36A 1S83A 3MO3A 1DDJA 3ZZ7A 3CENA 3U1IB 3Q3XA 1IQIA 3UQOA 1D3TB 3T5FH 2BVSH 1XUFA 3P8GA 1BBRH 1GCTB 1GGDB 2G5NA 3A82A 3I29A 1E38B 1J15A 1K28D 7KMEH 1KXDA 1P9UA 1XM1A 3LU9B 1QB9A 7GCHF 1GI9B 2PFEA 1G9IE 3S69A 4DIHH 3GYLB 4R0IA 1AFEH 1AUJA 1HDTH 4UEHH 1OYTH 1YCPK 3AW0A 1NZQH 4UFFH 1ESTA 1C2FA 2B8OH 1MAXA 4X2WA 1DXWA 3MMGA 1QB1A 1A0LA 4NSVA 4ZKRU 5LPEA 1AMHA 2TGAA 2QF3A 2XYAA 2P59A 5AHGH 2O8UA 2PKAB 2BY6X 2F9BH 4BAMB 4O03A 3ZZ3A 1SGRE 4X0WU 2GX4A 3CS0A 1KXCA 1Z8IB 1T8LA 1UK3A 1TWXB 3RXUA 2VH6A 1CHOG 2BD5A 1D6WA 1WSSH 1ZTJA 1MTUA 1C5LH 4YM9A 1AQ7A 4RN6A 1O2GH 2ZF0H 4DCDA 1PPCE 3SNDA 2FOFA 5LGOA 1BA8B 3PTBA 2VH0A 3LJOA 4ZUHA 1C1VH 4ZMAH 3A8DA 1AD8H 1XXDA 2QV1A 1SGNE 4CH2B 1PFXC 2PV9B 1KLTA 2LPRA 2HRVA 2BDGA 1IOEA 1GPZA 1O2PA 1EOJA 2ANMH 3V0XA 1P04A 1EPTA 1P11E 1NT1A 3UY9A 1C9TA 1EPTB 1OSSA 4ZKNU 3RMNH 1G3DA 4MVNA 2XWBI 4BTUB 1BCUH 1ZYOA 1Y8TA 2BOKA 4WJG2 2FIRH 2A4OA 2FMJA 1PPEE 3V13A 5JDUB 1FIWA 1AHTH 3M5MA 1C1SA 1U6QA 4FVDA 3RMMH 1RXPA 3E1XB 3SV6A 1C5RA 5H4IB 3RXJA 3UWJH 1SC8U 3V12A 1FPCH 1H9HE 5CMXH 1P2OA 4KELA 1V2WT 1BTZA 2W3KA 3TJOA 4H42U 2AERH 4MG3A 1UVTH 4VGCB 1YGCH 5EXLA 2ZG0H 5L2ZH 4I33A 1N8OC 1GVKB 1TNGA 2ZKSA 1UTNA 1ANDA 1N6XA 1BZXE 5J4SA 1PJPA 3H5CB 4WVPE 5J4QA 1P10A 1F2SE 1CE5A 5JBAS 4NWLA 4X1PU 2I6QA 4A92A 3QGJA 3LGYA 5C1UA 1BTUA 4X8UH 2PW8H 3BG4B 2H9HA 2CXVA 3FANA 3LDXH 4ABDA 3SUDA 1YC0A 2V3HH 1OWJA 1SGDE 4ISIH 1QY6A 1GL1A 1Y5UT 1GHVH 2PKSC 1C5UA 3U1JB 4OS6A 1SR5C 1NC6A 1HXEH 1ZPBA 4AGJA 1HJAB 1QL8A 1QNJA 2C8YB 3RXCA 3ZVAA 3S7KB 3SU1A 1V3XA 2P94A 2ZU2A 4JZ1A 1ZOMA 1C9PA 2FYRA 1G36A 4E05H 4ABGA 2OBOA 5JB8S 2UWOA 3GDSA 4ABFA
chains in the Genus database with same CATH superfamily
3OX7U 1TX6A 4FUHA 2W26A 3SJIA 1P03A 1FDPA 4FVBA 1FLEE 1E1RD 5DJ7A 2BDCA 2PKAA 2Z3EA 1XX9A 3TPIZ 4UONA 1MTWA 1SG8B 2ZTZA 2TBSA 4FXGH 2WPJS 4DOQA 3MFJA 4AORA 3E90B 5C2ZA 1B5GH 5ESTE 3MOCA 2NU3E 4NIWA 3BTTE 4Q4LA 3O8CA 3RXGA 1DANH 3MHWU 2HNTE 3IWMA 1QCPA 2GZ8A 1QIXB 1KMHB 2BY8X 4JK6A 1C1TA 2ZPQA 4AN7A 5AF9H 1ZZZA 1SLXB 1THPB 2KM0A 2AS9A 2NU4E 3ZIAD 1RTKA 1P2IA 4AFUA 5DSFA 2W7SA 5KGOA 3E16B 2J94A 4Y8ZA 4WMDA 3SUFA 3LGTA 3T25A 4ZAEA 1XKBC 1O3JA 1SGTA 3A80A 1HIAB 4FUGA 5I25A 2IN2A 2AMPA 2BDIA 1DT2A 3T29A 3GY3A 3TGKE 2B9LA 2ZGCA 4THNH 2GDDA 1UTKA 5A8YA 1M9UA 2AIPA 2GTBA 3PLBA 2B5TB 3SU0A 1CHGA 5EPNA 2PTNA 2BD4A 1O3HA 1UTOA 3UPEA 1DM4B 1NRSH 1NN6A 1FI8A 3MO6A 1D6RA 5HXFA 4XD7D 3FOAA 6LPRA 2HVXA 4ZROA 1O3GA 2G8TA 1YPJH 2FTLE 5DK1A 5CHBA 4RKOB 1GBBA 5IDKA 1ZLRA 3N99A 1AWHB 1V2ST 3LH1A 2BTCE 3GY4A 1GJ5H 1KXAA 1UHBB 3MU5A 1RTLA 1AKSA 1EKBB 1D3PB 5FHTA 3DD2H 3U69H 2BLOA 1G3CA 1AB9B 2CF9H 1GI0A 3ITIA 3UQVA 1O2OA 3FP6E 3KEEA 4A1VA 1BRCE 1C2HA 5DP4A 1YYY1 3FP8E 3ZZBA 4WMEA 3M3SA 3MH7A 7GCHG 4HFPB 1GG6B 1BIOA 3F2GA 3QTVH 4U32A 4ABJA 2GP9B 4IC5A 1QL9A 1XUKA 4DG4A 2PR3A 1Q31A 3BEUA 3GY2A 2J92A 3HK3B 1GBTA 2QN5T 4K60A 1TGSZ 3EGKH 3P17H 3QUMP 1L1GA 2DUCA 3TIUA 1HFDA 4Y8XA 1WU1A 4I7YH 4J1YA 5EJ1A 1ANCA 2H6MA 2UUYA 3ZYEA 3OY5U 1GCTC 1GI4A 2AGGX 4CRAA 1BRAA 1BJUA 1LPKB 1WTHD 2FX6A 3UR6A 4ASHA 1PPFE 5C5OA 3S0NA 3Q76A 2A4RA 2A31A 4RT0A 4Y79A 1O3DA 1O2WA 2ZWLH 1HAYB 1NESE 2FX4A 1AZ8A 4KTSA 1TGCA 1ZSJA 1P0SH 3C1KA 1HJ8A 3M5OA 1V2NT 3S7HB 4OS1A 3SU5A 3QX5H 1Z7KA 4GSOA 1JIRA 3S9CA 3EA9A 5KECA 1KY9A 1ARCA 4YOGA 1GJ7B 1E34B 1WXRA 1GBJA 2WPHS 1UTQA 1FY3A 4GHQA 3OU0A 1OP2A 1QZ8A 3F68H 3M3VA 2GCHG 2A45B 1GJ8B 6CHAB 2SNWA 1RTFB 1GJ6A 3RXBA 1AE8H 3LGWA 1C5OH 4GCHG 3LGUA 3SI3H 1TRYA 1MKWH 3OEHD 1QJ1B 1FAXA 1GBDA 1MTNB 2PTCE 3IITA 1V2MT 2V7QD 1TPAE 2Q6DA 1DWBH 2UUFB 3PRDA 1S5SA 1O2LA 2FPZA 4K69A 1P57B 1K1LA 2A7JA 1XUIA 1LO6A 2A32A 1G2LA 2P8OB 5F8ZA 2VIDA 3MNSA 2BM2A 4CR5A 1HRTH 4XSKU 3RC4A 4JYVH 1ZPCA 1TABE 2PKSB 4NWKA 2Z7FE 2Y82A 3A7YA 1ESBA 3GS9A 2BXUH 4Y0YE 1P2QA 3SJOA 4D7FA 2TGDA 4AOQA 2Q6FA 3SV2H 2J95A 3SU3A 5EU8A 2IJD1 1GI5A 3PLKA 2CMYA 1TLDA 1TE0A 2V3OH 2R2WU 3A84A 4B74A 1YCPM 3UTUH 1FMGA 3LIWA 3PRBA 4I8GA 2ZPSA 1IQEA 2Z9JA 2ANKH 2GZ9A 1Y3YA 1CBWC 4VGCC 3ZV8A 2VIOA 3K6ZA 4Y76A 1C4U2 2W5EA 4TT3D 5JBTA 3PMJA 3MH6A 2YNAA 3HGNA 2ZI2H 2BLQA 1A3EH 1DPOA 1YY3A 1NTPA 1HAZB 2WINI 4X1NU 4UFEH 1ZJDA 3CNRA 1SQAA 1Z71A 4FUEA 4TSFD 2FLBH 1ZMNA 1O31A 2J98A 2ZP0H 3ODDA 3UFAA 2A2XH 1RJXB 1MKXH 2K0QA 2PWXA 1AUTC 1BTXA 1W12U 2P3FH 3LGIA 3DSOA 3WWFA 1AGJA 4FU8A 5A2MH 3PWCA 1QRWA 4ZHAA 3M7TA 1LHDH 1LQEA 1SGFG 2J4IA 1E0FD 1LTOA 2KZ4A 2EQNA 2YMSB 4X2VA 4ISNA 1LKAA 2BQWB 1P8VC 4KTUA 2VIWA 2ANYA 1YPHE 3BTWE 3RU4E 1C5ZB 2ZU4A 1BBRK 2D26C 1H8IH 2ZHEH 4R8TB 5C94A 2CJIA 1LPGB 2HNTF 2VWNA 3AW1A 1TRNA 1RIWB 3SNAA 4WWYA 3TJVA 3ZVEA 2OXSA 5CE1A 1LVOA 1L2EA 1O3BA 4JYTA 4CRCA 2FI3E 3A85A 1GWAA 4FOUC 1OX1A 3SJ8A 5C17A 4GVUA 2ZTXA 2J5UA 4OS2A 3B8JA 2ZCHP 3Q3KA 1UVOA 1A61H 3QZRA 1IQJA 3KHVA 3SBKA 4MQAA 1GHBF 3H7TA 1ZMLA 7LPRA 2F9VA 3SNBA 3NWUA 2J2UA 5K7RA 5DO4H 1DVAH 1AY6H 2HGTH 1DS2E 2PUXB 4NA9H 1ZSKA 1FUJA 3A7XA 1UW7A 1BMMH 2WYGA 1C2IA 5EODA 2CF8H 2VGCC 2J97A 1SFQB 4WH6A 5FBEA 5JBBS 2FEQH 4BXWA 4XRNA 3P70B 1O2NA 1NM6A 4I32A 5E0GA 1UVPA 5JB9S 1KLIH 2FYQA 3F9HA 2VVCA 1SGIB 2JH0D 1WYKA 1GBLA 1GHBG 3H7OA 3P8FA 4MNWA 2WPIS 8ESTE 2K1QA 1YBWA 2ZFSA 3LC3A 3MO9A 5FX5A 2CHAC 1O3NA 3Q77A 3RXMA 1BRUP 2UWPA 4BAHB 1PPBH 1ZHMA 4FUFA 3RXDA 4F49A 2A7HA 4Q80A 2ZCKP 1P3EA 1S82A 1SOTA 3SI4H 4I31A 2C90B 3MWIU 4JK5A 1FIZA 2GZ7A 1GHAF 2OK5A 5DP9A 3B9FH 5I46H 2VINA 1AFQB 5LH8A 3W95A 3LH3A 2VB0A 2W7UA 2OP9A 3PO1B 3RXIA 1YCPH 3ZZ5A 1NRNH 2JETB 3QZQA 3RXKA 3DSGA 3ZZ9A 1GMCF 1WV7H 1DLKB 1O34A 2JKHA 2XBXA 5DPAA 1C5SA 2BVRH 2A0QB 3SNEA 2WYJA 5FCKA 1W10U 2ZZUH 2QF5A 3R0FA 2WPLS 1IQLA 1EUFA 4GUXA 2ZFQH 2F9NA 3E3TA 2GV6A 2FOBA 1NFUA 1IQNA 2P93A 2ZNKH 3PB1E 1MKXK 3FO8D 3AK5A 1C5VA 1WAYB 4DY7B 2A5IA 3CP7A 3M37A 4HG6A 4WY3A 3E6PH 1O32A 1THRH 3MYWA 3BF6H 1O2RA 2EC9H 2ZGJA 3KYFA 2ODQA 1CSOE 1JMOH 1QRZA 3RM0H 2UWLA 3QWCH 1EQ9A 1XVMA 5EG4A 1TYNA 1GJ4H 1T8NA 1ZHPA 4ZXXH 1B0EA 3M7QA 4D7GA 1ANEA 1C4V2 3RUOA 1C2KA 2GCTC 1J9CH 4CRFA 3V7TA 4YOIA 2ULLA 1H4WA 1P02A 2FODA 2XW9A 4K5ZA 1GHAG 1MCTA 2FOGA 2VIVA 1WCZA 3N7EA 4AB9A 4H4FA 4QT8C 3U9AH 4B6FA 1KSNA 3TVJB 3F2HA 4CRGA 3RXTA 1C5QA 4YO9A 4AZ2B 1Y3VA 2EI7A 2AGIX 1QGFA 1MH0A 1OS8A 3VB7A 2RA3A 2Q6GA 4B2AA 2ZQ2A 3RXHA 3BTKE 4XBCA 4INLA 1S6HA 2WPKS 3TITA 1LQDB 1LMWB 1PPGE 1TFXA 1GHYH 1EAWA 1ELAA 2SGAA 1SQRA 1A5HA 1O2QA 5T6GA 3STIA 3DSPA 3FZDA 3SUEA 1HAIH 3GCOA 4ABAA 2R0KA 1TAWA 4K2YA 2XNDD 3FFGA 1ZSLA 1HAVB 3FP7E 2FOCA 2JH5D 2FZZA 1MTVA 3IG6B 4A1XA 2RFKC 1O2XA 2QXIA 3BIVH 1MUEB 5T6DA 2RCEA 1BMLA 1QJ7B 4AFSA 4FU9A 4IBLH 1DUEA 2RG3A 3NUMA 2DE9A 3TJUA 1S6LA 9ESTA 4ISOA 3F0PA 4CR9A 1JXPA 1OXGA 1A7SA 3SORA 1XUGA 2HVYB 1QRXA 3UNSA 1NS3A 5GDSH 1XUJA 2WUBA 1SSXA 2GGVB 1A46H 1CBWB 1RIWC 5SGAE 1XVOA 3S9AA 1GMHF 2TPIZ 3UNRA 1A5IA 1O35A 2ZTYA 1O3CA 3PTNA 1P05A 2KCAA 2PUQH 1TNJA 2VVVA 1HLTH 3VGCC 1GJAB 1T4VH 1QFKH 3GOVB 3TNTA 5TJXA 4OS4A 1P2KA 1YPHC 3RDZA 2BMGB 1ARBA 2V3MA 1OWKA 2H5DA 3SW2B 3FN8A 4X6OA 1GMHG 1EJNA 3TGJE 1QJ6B 1IQKA 3GICB 2ODPA 1W0YH 4YTAA 4NIVA 5HGGA 4LOYH 2TRMA 1C1OA 2BDAA 4B76A 1INCA 1Z6EA 3V3MA 4Y71A 3A7ZA 1QR3E 4ABHA 3ATMA 1H9LB 3RXRA 3UIRA 4AGKA 4E06H 3RXOA 1TMBH 1H9IE 1GBKA 3PMAB 1VGCB 5DKMA 1NU9A 3A7VA 3SU6A 1GCDA 3KN2A 1LPZB 1JRTA 2RDLA 1ZPZA 1LCYA 5EQRA 3Q3YA 1NBMD 1J17T 2VU8E 2SGPE 4WXIA 3MI4A 1KTSB 3F6UH 5KEDA 1QTFA 3LC5A 3G01A 1AVGH 3SU2A 1F0SA 1NFXA 2HPQH 3MTYA 2FDAA 3GY8A 1JOUB 1DLEA 4FETA 1G37A 2XTTB 3EA8A 1ZGVA 1SGEE 2R3YA 3P92A 1RRKA 4OGYA 2ZFRH 4CRBA 2TGTA 1NU7B 3BV9B 4SGAE 3M61U 3DUXH 1Q3XA 1GBAA 3QLPH 2VWOA 3PO1C 2BZAA 2KCYA 2Z3DA 5AVDA 5EXNA 3GDVA 3VXFH 5C0TA 1L4DA 1MQ5A 4Y11E 1ETRH 1BT7A 1ANBA 4AFZA 1WTGH 2ZEBA 1C2DA 1QB6A 3BIUH 1MU8B 4GPGA 3E0NB 4H6TA 3F9GA 4U01A 2G5VA 1SGCA 1AIXH 1FONA 2SGDE 2BX4A 5EJZA 1HIAA 1AKSB 2O8LA 1O5BB 4AFQA 1TPOA 1SBWA 1WUNH 4Y6DA 3NRLA 1ZRBA 1OWDA 1C5TA 5A8XA 1F7ZA 1XUHA 1Y5BT 1O39A 1F0RA 5FL7D 3LONA 3BG4C 3BSQA 1UO6A 1YF4A 1AVXA 3BTFE 1C4Y2 2BLWA 2Y5GA 4NFFA 4Y10E 5CHAB 1A1RA 1NFWA 1TNHA 1TOMH 2AEIH 1LDTT 1DICA 1FN8A 4ABBA 2BD8A 5HM9A 4TPYA 4O3TA 1TMUH 2O8MA 3TK9A 3OEED 4XOJA 2JDID 4Q7YA 2Y5HA 2QXGA 2ZDNA 1LVYA 2J38A 3GYMA 3TH3H 1UVUH 2BDBA 4XE4A 1O36A 4X2XA 5FBIA 1ZJKA 2OC7A 4A1TA 3LPRA 1TBRH 2WV5A 1J8AA 3BTME 4GHTA 5HM2A 3SHCH 1EB2A 1VCQA 5F8TA 3ZVBA 3R3GB 1H8HD 4CRDA 3I78A 5DP7A 2ZDVH 2P95A 3UUZA 2ZDLA 2AH4X 1E79D 1BHXF 1GJDB 7ESTE 1EASA 1IQGA 1TALA 1PPZA 1ZRKA 4F4OC 1GHZA 2GMTB 1EJMA 2AFQB 6ESTA 3L33A 3SHAH 1QURH 2XXLA 1C1MA 2M2AA 4I8LA 1TBQH 3TK5A 3U98H 4ABEA 4NFEA 3AVZA 3EAJA 1GI1A 1ORFA 2BD9A 3MNCA 1ZTKA 1HNEE 4CHAC 4JCNA 3SUGA 4IN2A 4AB8A 5B6OA 1KXBA 5E2PA 1E1QD 4X1RU 1V2OT 3OYPA 1OWHA 4OS7A 3RXSA 2VWLA 1MKWK 3EQ0H 1C1UH 1C2JA 2QXJA 4NCYA 1GI7B 2ZU3A 3AAVA 2AMQA 2Z94A 4F48B 1J16A 1GVLA 1UCYK 1OKXA 1GI2A 2R0LA 2Z9GA 1KTTB 4CBNA 1FAKH 1P12E 1UTJA 3SYJA 2Z9LA 1P09A 3FZZA 2L74A 4LZ4B 4ZHLU 5DP6A 1VJ9U 1A4WH 1PQAA 1DFPA 2EEKA 2OC0A 2W6ID 4JYUH 1SPJA 1C2MA 1TQ7B 2EI6A 2G51A 3F1SB 3GISB 4RSPA 1GBMA 2ZHDA 2FI4E 2STAE 4FUIA 3STJA 2VJ1A 2FOMB 1ELCA 2OC8A 3KQDA 4TY7A 4AG1A 4INKA 2Y81A 1DWCH 1O2KA 1Y3XA 3PROA 2FWWA 3SGAE 3ZVGA 1FY4A 4J2YB 5HKKD 5L6NH 3D23A 1WQVH 3SGBE 2GT7A 3U8TH 1B0FA 3ENSB 2ZIQH 1LHGH 2B7DH 3RXAA 3KGPA 5L30H 1MAYA 5GPIB 4DT7B 1Y59T 2XBWA 1CU1A 1HAGE 1YLNA 2A7CA 5E2OA 1TX8A 1AE5A 1IHSH 2GCHF 3KCGH 1HBTH 2ZECA 1K22H 2BZ6H 3FAOA 2KCOA 3KQBA 3OFND 2OUAA 1GG6C 4B71A 1RS0A 4A5TS 3PYHA 1Y3WA 1O30A 4NSYA 1K1JA 1L1JA 2QXHA 3KQ5A 4KKDA 3UB0A 4B2CA 1MTSA 3A88A 1O2ZA 1LHEH 3SN8A 1ELDE 2QYIA 4CREA 3F9EA 1W0ZU 1K21H 1VZQH 1C1QA 3K9XB 1O3FA 5TCCA 4XBDA 2XBVA 1QA0A 3ODFA 2WHXA 2AMDA 2CHAB 3TK6A 3F9FA 1PPHE 4K1TA 2YOLA 3FKSD 1G2MA 9LPRA 1H1BA 3MU8A 3SO3A 1CA0B 2R2MB 2F3CE 1TOCB 4DGJA 3B23B 1V2UT 2IJOB 1O2SA 1QL7A 2BQ7B 2SGFE 1BITA 2O8WA 3UOUA 1MMJN 1SHYA 3ZZ4A 2Z9KA 5A0AE 2ZFFH 2Z3CA 2CK3D 1NY22 2F4LA 3SU4A 1ELGA 1DWDH 1GGDC 3PV2A 4FUCA 3VB5A 2CGAA 2HLDD 2F9OA 1PYTC 3ZZDA 4YZUA 1O3PB 2GMTC 5T6FA 4NA7A 1EXFA 2J34A 1ZTLA 2D8WA 4NA8A 1TGNA 2GDEH 2UUKB 3T2NA 2OINA 1DUAA 3N7DA 1TNLA 2ALPA 4XBBA 3QO6A 2W6JD 1PYTD 1VGCC 1G3BA 5C5NA 4LK4A 2BD7A 2OTVA 3M5LA 4B75A 3SQHE 5ABWA 1HAOH 1W3CA 3GCHC 1EP5A 4JZIA 4TPIZ 4LZ1H 1Z8RA 3RXQA 1AVWA 3N7OA 2OQ5A 3E0PB 1HXFH 1UVSH 3OAAD 1DXPA 2H9EH 1H8DH 3VXEH 4DURA 4FU7A 3ZZAA 3M5NA 5GCHF 5CHAC 3RXEA 3A8AA 5PTPA 2KX4A 1GL0E 2HPPH 4ZKOU 1ELEE 1TRMA 1DE7H 5JPMH 1Z6JH 4I8KA 1TQ0B 3W94A 2A2QH 4NGAH 2F91A 2LELA 4RKJB 1F0TA 1HV7A 1UK2A 2DE8A 1EX3A 1C5NH 2W3IA 4D8NA 2ZPRA 3TLOA 3ZV9A 3NK8A 3HATH 3SNCA 1SFIA 2ZQ1A 2AGEX 3A7TA 3PMHB 5FPSA 1CHOF 2ESTE 2BX3A 4ZKSU 1YLDA 2H9TH 3T28A 1K2I1 1O3AA 4YLUA 5C1YA 3UREA 2SGEE 3K65B 2JH6D 2O9QA 1BHXB 1H8ED 2OCVB 3KNXA 5AFYH 3RC6A 1O2HA 1O38A 2G52A 2FM2A 3KQCA 3LJJA 3SZEA 4IN1A 4MNVA 8GCHG 1O2JA 3SGQE 1OYQA 1A0HB 3BTEE 1G3EA 1Z8GA 1SLUB 5FPYA 4ABIA 1ELVA 1FPHH 1X7AC 3ESTA 2GKVE 3UWIA 2ZHQH 3TJNA 1V2PT 2ZGXH 3RM2H 5DN6D 1O37A 2XWAA 4D9QA 1N8OB 1P9SA 1N1LA 1KXFA 3S9BA 1HB0B 3NKKA 1JWTA 2QF0A 1GDQA 1P06A 2P3TB 1S0RA 2H1UA 4BNRA 1DX5M 3UNQA 4TY6A 5FPTA 4MTBA 2BQ6B 1FJSA 5CDFE 1OWEA 4UFDH 2XCFA 1GMDF 2BDYA 5DG6A 1C5WB 2FOHA 4YOJA 2HLCA 4I86A 4O9VA 3RLWH 1K9OE 5BRRE 3DFJA 3RXFA 4E7RG 2J9NA 3ZYDA 3A83A 3H09A 1NROH 1EJAA 1W7GH 1GJ9B 1W14U 1VR1H 2BB4A 5C67A 3E8LA 4YT7H 1TNKA 1MBMA 5FAHA 4HTCH 2RDEA 3OE7D 5EW2H 1J14A 1CA0C 1IAUA 1O5CB 1TX7A 1O5GH 1YPMH 1PQ5A 1BMFD 1FY8E 5C3NA 4JZDH 1FXYA 2B0FA 2BXTH 4Q7XA 4SGBE 2GD4B 4CHAB 1SHHB 1VCPA 4JMYA 4MPUA 3RXPA 4MPVA 3PMBB 1CGHA 3OSYA 5K0HA 4CH8B 5T1VA 4OS5A 2H5CA 4ZXYH 4DW2U 1CO7E 5FX6A 1SL3A 4X1QU 2OD3B 1W11U 3VGCB 1GI3A 1TB6H 4NIYA 2ZU5A 1GJCB 2R9PA 3JZ1B 4FUDA 3O8BA 1TNIA 4ISHH 2OLGA 5F53A 5FXLA 3WW7A 2M5TA 1QQ4A 3T62A 2H2ZA 3RMOH 5C20A 5EQSA 4ZH8A 5HIZA 1O3MA 1HAVA 3D65E 2FLRH 2SGQE 5EGMA 2ZCLP 3MH5A 4F55A 3A81A 1YPGH 1C2GA 1IQMA 2BD2A 4YESB 3O8DA 3ELAH 4MNXA 5A09A 1EFRD 2QGRA 1EP6A 4FUBA 5B6LA 4UDWH 2ASUB 4U2WA 1P2MA 4LXBH 1NBME 1Q2WA 2NU1E 1AZZA 2KFWA 1CT4E 3A8BA 1O5DH 5HYOA 3OY6U 1A5GH 2Z9IA 5AFZH 1YM0A 5L2YH 1O33A 2OBQA 3MH4A 1QQUA 2OQUA 1GMCG 2JETC 3T27A 1ID5H 1ABIH 1KIGH 1SQOA 2BOHB 1AWFH 4HZHA 1O3LA 4IMQA 1GBCA 3EE0B 3RXLA 2F9UA 3ATLA 4DVAU 2FS9A 1V2JT 1O2MA 3MNXA 4YXWD 3A7WA 1E35B 1UK4A 1VKYA 2WUCA 2QA9E 2QAAA 4DJZB 2PGBB 3TGIE 1S85A 1O5FH 4PROA 3DT0H 3WWBA 1TONA 1F5RA 1SLWB 1KDQB 2ZHFH 3RC5A 1IHTH 3BN9A 1EATA 4AG2A 3ATIA 3HPTB 4KTCA 2NWNA 1AU8A 4INHA 2C4FH 6GCHF 3EA7A 1XMNB 2PGQB 1LHFH 4Q63A 1B7XB 1C5PA 1V6DA 3LGVA 4AX9H 4H6SB 3SV8A 1SMFE 2KAIB 1HJAC 1T4UH 1T8MA 2ODYB 2G00A 1T7CA 3BEIB 2Y80A 1DOJA 3U8RH 1ZHRA 2WV9A 5EOKA 2ZGHA 1KLJH 3F3BA 1VCWA 5BPEA 1VJAU 2BY5X 4MPXA 1JIMA 5HMAA 5E8EH 5GNDA 1CQQA 1C1RA 1MBQA 5C0UA 3D62A 2AIQA 1YPKH 1C1WH 4IW4E 3Q00A 2F43B 1GI8B 2TGPZ 4WH8A 3P6ZB 1KYNA 1YLCA 1V2RT 3MNBA 2VNTA 4WMFA 1DY8A 1Y3UA 1AI8H 4X6PA 4ESTE 1E37B 2V0BA 2ZA5A 3SQEE 3SOSA 1BRBE 1W0JD 2D2DA 1V2QT 2R3UA 2P16A 4B73A 1ZMJA 3MU1A 5GIBA 3UOPA 1HAHH 3SJ9A 5EPYA 3URDA 3F0OA 1CT0E 3GY5A 4I8HA 3KF2A 1CGJE 3MU0A 4OM9A 2EY4C 1NFYA 4FUJA 3AAUA 2KCPA 5F8XA 4TWWA 3GCHB 3VB4A 4ASUD 3DA9B 2D1JA 3ZVFA 2TIOA 2K8IA 2IPHA 2BY9X 1T8OA 3RU4D 4K3JA 1FY5A 2Y7XA 5GWZA 2VIQA 3RP2A 5EIYA 1GBFA 5TCAA 3A87A 3RXVA 8LPRA 2F83A 3A86A 2ZU1A 1K1OA 1OP0A 1FX0B 2VWMA 1VITF 1C5XB 4X6MA 1F5KU 1GBEA 1G30B 1V2VT 1BQYA 3GCTG 1MU6B 3M35A 3NCLA 1EB1H 3U8OH 2F9PA 4JZFH 1XXFA 4TYDA 4UE7H 3VFEA 3A8CA 2ZDMA 2G4UA 4BAOB 2FO9A 1YP9A 3LKWA 1HPGA 4IC6A 4KGAA 1KDQA 1GHXH 4I8JA 1DY9A 4MPWA 2P8OC 5F03A 1O5AB 3E91A 1JRSA 2Q1JA 2VIPA 2QCYA 2ZGBH 3LOXA 1EZUC 1BMNH 4E7NA 3EYDA 4NZLA 4M7GA 1Z8JB 1F5LA 2BYAX 1MZAA 1P2NA 1W8BH 1ESAA 3VB3A 4JZEH 3D49H 1D9IA 2G81E 1HYLA 4RI0A 3PV5A 5DP3A 2P3UB 3NZIA 2SFAA 1AB9C 4NIXA 2PP6A 2ALVA 3AASA 5F6MA 3ZZCA 1UCYH 1V2LT 3VPKA 1NRRH 3K2UA 4ACBA 4AC9A 2XBYA 1TA6A 2FS8A 5E0JA 6GCHG 1DSTA 3OTJE 4X8TH 3M7UA 5GCHG 2IOTA 1SGYE 5ESBA 1UJ1A 1S81A 2NU2E 1GBHA 3QN7A 4A6LA 1SGFA 2OC1A 1O0DH 5FCRA 1EOLA 1SB1H 2FTMA 3GCTF 1W2KH 3KL6A 2Z6BD 4Y7AA 1QHRB 1Z1JA 1O3IA 1RFNA 2J98B 3TH4H 2HALA 2YNBA 1CT2E 3BTDE 1MTNC 1K1IA 2XC4A 1K1PA 4AYYB 1V2TT 1SOZA 3P8NA 1C2EA 3DFLA 3LT3A 1TGBA 4GLYA 1V2KT 1IQHA 5GXPA 3PWBA 1ETTH 1KXEA 1WOFA 3L6PA 3BEFB 2ILNA 3GY7A 3ATWA 5EXMA 3MQKC 3PM3A 4RT1A 4YLQH 1HCGA 1HUTH 5EJLA 3P8OA 5E0HA 3URCA 1QBOA 1QBNA 2C8XB 1OWIA 2WPDD 4XDEA 3GY6A 5G4BA 4Z1MD 2QIQA 3ZVCA 4B6EA 3KQEA 1P2JA 2KAIA 1TMTH 1C1PA 3T26A 4Y0ZE 4YT6H 1P01A 1GDNA 1O3EA 1TPPA 1UTLM 2BY7X 1HAXB 2CV3A 4DIIH 1GMDG 1FQ3A 1GI6A 4MLFB 4BANB 4Q7ZA 3I77A 1L1NA 1LHCH 1EZSC 1C2LA 5JYIA 4B2BA 1CA8B 1F0UA 1W13U 1W0KD 2A4QA 4K1SA 1EAIA 1P3CA 1BMAA 2C3SA 4WXVA 2XNIA 4Z0KA 2KR7A 2WZQA 1GHWH 3QTOH 1NPMA 1MQ6A 2BLVA 3L3TA 2V6NA 2XCNA 3K6YA 3PLPA 3RLYH 1ELFA 4K8YA 1MABB 2Y6TA 3BTHE 2ZC9H 3VEQB 3HKIB 1FZZA 3ATKA 4OGXA 2BVXH 3NPSA 1EAUA 2CN0H 3QGNB 3HK6B 1WDIA 5EW1H 1O2TA 1TA2A 1MZDA 1TPSA 1Y5AT 4MDSA 1S0QA 4Y7BA 3TH2H 1RD3B 1O3KA 3FVFB 1FY1A 5DP8A 4Y8YA 3OTPA 4Z6AH 1TIOA 4X8SH 3EE7A 1TBZH 2Y7ZA 3P95A 4TWYA 1EPTC 1S6FA 4XFQA 4BOHA 1BDAA 1QBVH 8KME2 2G4TA 2O8TA 1K1NA 3U28C 4HI3A 4A7IB 1FN6A 1FV9A 2V35A 2FESH 1L0ZA 3SJKA 1AO5A 1O2VA 2ZFPH 1AN1E 5A0CA 1BOQA 1SGQE 2Y5FA 2AHME 3BTGE 2ANWA 2GT8A 3W1EA 4ZCNA 2ZDKA 4ACAA 4AYVB 4KP0A 1UTPA 2A1DB 3MU4A 1C5MD 1G32B 1LKBA 1LVMA 6CHAC 1D3DB 2LNCA 3RU4T 1ZR0A 1L4ZA 1TGTA 3SV7A 4UFGH 1NRPH 3C27B 5DGJA 3BTQE 2ZDAH 1C1NA 1QA7A 8GCHF 1UTMA 1N6YA 4WF8A 5T3HA 3VB6A 1SLVB 2A5AA 1DWEH 3QK1A 4X8VH 1ELTA 4UD9H 1EZQA 5LPRA 1ABJH 1UMAH 2ZHWH 2VGCB 3QDZB 5GJ4B 1C5YB 2EI8A 1MD7A 1O2YA 2THFB 1YPEH 2A4GA 1PQ7A 2C8WB 1GDUA 2XRCA 2VVUA 3ZVDA 1O5EH 1BB0B 2FXRA 2EA3A 2UUJB 1HJ9A 1BJVA 1UCYE 1XKAC 3CS7A 4BAQB 1K0HA 3PV4A 1CGIE 4CBOA 2FOEA 2FP7B 1HGTH 2I6SA 2ZFTA 3DHKH 1D3QB 1GJBB 1UHBA 2XC5A 1OP8A 5HIYA 5DP5A 4BAKB 1SI5H 2L6OA 1VITH 3UAIC 1E36B 2A5KA 1T31A 3M3TA 3HGPA 4K1EA 1EAXA 3SV9A 2GCTB 2BDHA 3JZ2B 1BBRE 1YKTA 1O3OA 1A0JA 2WV4A 2WPMS 1IQFA 3ZZ8A 1ZGIA 3WY8A 2GV7A 1T32A 5LPFA 1A3BH 4P02A 1BUIA 2SNVA 3BG8A 1WQSA 2HNTC 4DT4A 1BTPA 5ETXA 1DSUA 2C8ZB 5A0BA 2RA0A 1NRQH 1SGPE 2STBE 3A89A 4IS5A 3NXPA 1VITG 3GDUA 2JJ2D 4O97A 4BTIB 2FI5E 1ETSH 3SZNA 1O2UA 4K8BA 1ELBA 1OOKB 1RGQA 1THSH 1YPLH 4IGDA 2HWLB 3KYGA 5EQQA 1D4PB 1NO9H 4GCHF 1JBUH 1K1MA 1WBGB 1Z1IA 3DCLA 3VG8A 1HAPH 1LVBA 3TU7H 1MCVA 2G55A 2JJ1D 3KIDU 4B1TA 1OPHB 2AYWA 2YMSC 2XC0A 5C1XA 1COWD 4BTTB 5IK2D 4ZHMU 2BD3A 1PQ8A 4D9RA 4GAWA 1SKYE 2QC2A 3ZZ6A 4NG9H 2C93B 1O2IA 2PLXA 4X1SU 1F92A 1MD8A 4BXSA 2HOBA 4U30A 3TNSA 4Q2KA 4X2YA 1W7XH 3HKJB 5IYTA 3O8RA 2QY0B 3UR9A 1AFQC 2BHGA 1GVZA 4X6NA 4IMZA 1ACBE 2PSXA 1EZXC 2ZO3H 1S84A 2PSYA 5JBCS 1YWUA 1BTHH 1DITH 2NU0E 1CVWH 4D76A 2GVFA 5A8ZA 3EDXB 4ISLA 1SVPA 1GBIA 2JIZD 2PHBA 3RMLH 1FNIA 1A2CH 1BTYA 4NZQA 4HGCA 1SQTA 1BTWA 3GCNA 2FOAA 4O3UA 4MNYA 3M36A 1S83A 3MO3A 1DDJA 3ZZ7A 3CENA 3U1IB 3Q3XA 1IQIA 3UQOA 1D3TB 3T5FH 2BVSH 1XUFA 3P8GA 1BBRH 1GCTB 1GGDB 2G5NA 3A82A 3I29A 1E38B 1J15A 1K28D 7KMEH 1KXDA 1P9UA 1XM1A 3LU9B 1QB9A 7GCHF 1GI9B 2PFEA 1G9IE 3S69A 4DIHH 3GYLB 4R0IA 1AFEH 1AUJA 1HDTH 4UEHH 1OYTH 1YCPK 3AW0A 1NZQH 4UFFH 1ESTA 1C2FA 2B8OH 1MAXA 4X2WA 1DXWA 3MMGA 1QB1A 1A0LA 2WSSD 4NSVA 4ZKRU 5LPEA 1AMHA 2TGAA 2QF3A 2XYAA 2P59A 1OHHD 5AHGH 2O8UA 2PKAB 2BY6X 2F9BH 4BAMB 4O03A 3ZZ3A 1SGRE 4X0WU 2GX4A 3CS0A 1KXCA 1Z8IB 1T8LA 1UK3A 1TWXB 3RXUA 2VH6A 1CHOG 2BD5A 1D6WA 1WSSH 1ZTJA 1MTUA 2YMSD 1C5LH 4YM9A 1AQ7A 4RN6A 1O2GH 2ZF0H 4DCDA 1PPCE 3SNDA 2FOFA 5LGOA 1BA8B 3PTBA 2VH0A 3LJOA 4ZUHA 1C1VH 4ZMAH 3A8DA 1AD8H 1XXDA 2QV1A 1SGNE 4CH2B 1PFXC 2PV9B 1KLTA 2LPRA 2HRVA 2BDGA 1IOEA 1GPZA 1O2PA 1EOJA 2ANMH 3V0XA 1P04A 1EPTA 1P11E 1NT1A 3UY9A 1C9TA 1EPTB 1OSSA 4ZKNU 3RMNH 2XOKD 1G3DA 3F2FA 2XWBI 4MVNA 4BTUB 1BCUH 1ZYOA 1Y8TA 2BOKA 4WJG2 2QF4A 2FIRH 2A4OA 2FMJA 1PPEE 2VBCA 3V13A 1FIWA 5JDUB 1AHTH 3M5MA 1C1SA 1U6QA 4FVDA 3RMMH 1RXPA 3E1XB 3SV6A 1C5RA 5H4IB 3RXJA 2LP6A 2QE7D 3UWJH 1SC8U 3V12A 1FPCH 1H9HE 5CMXH 1P2OA 2IPQX 4KELA 1V2WT 1BTZA 2W3KA 3TJOA 4H42U 2AERH 4MG3A 1UVTH 4VGCB 1YGCH 5EXLA 2ZG0H 5L2ZH 4I33A 1N8OC 1GVKB 1TNGA 2GJGA 2ZKSA 1UTNA 1ANDA 1N6XA 1BZXE 5J4SA 1PJPA 3H5CB 4WVPE 5J4QA 1P10A 1F2SE 1CE5A 5JBAS 4NWLA 4X1PU 2I6QA 4A92A 3QGJA 3LGYA 5C1UA 1BTUA 4X8UH 2PW8H 3BG4B 2H9HA 2CXVA 3FANA 3LDXH 4ABDA 3SUDA 1YC0A 2V3HH 1OWJA 1SGDE 4ISIH 1QY6A 1GL1A 1Y5UT 1GHVH 2PKSC 4P00A 1C5UA 3U1JB 4OS6A 1SR5C 1NC6A 1HXEH 1ZPBA 4AGJA 1HJAB 1QL8A 1QNJA 2C8YB 3RXCA 3ZVAA 3S7KB 3SU1A 1V3XA 2P94A 2ZU2A 4JZ1A 1ZOMA 1C9PA 2FYRA 1G36A 4E05H 4ABGA 2OBOA 5JB8S 2UWOA 3GDSA 4M9FA 4ABFA
chains in the Genus database with same CATH topology
3OX7U 1TX6A 4FUHA 2W26A 3SJIA 1P03A 1FDPA 4FVBA 1FLEE 5DJ7A 3TPIZ 2BDCA 2PKAA 2Z3EA 1XX9A 4UONA 1MTWA 1SG8B 2ZTZA 2TBSA 4FXGH 2WPJS 4DOQA 3MFJA 4AORA 3E90B 5C2ZA 1B5GH 5ESTE 3MOCA 2NU3E 4NIWA 3BTTE 3O8CA 3RXGA 1DANH 3MHWU 2HNTE 3IWMA 1QCPA 2GZ8A 1QIXB 2BY8X 4JK6A 1C1TA 2ZPQA 4AN7A 5AF9H 1ZZZA 1SLXB 1THPB 2AS9A 2NU4E 1RTKA 1P2IA 4AFUA 2W7SA 3E16B 2J94A 4Y8ZA 4WMDA 3SUFA 3LGTA 3T25A 4ZAEA 1XKBC 1O3JA 1SGTA 3A80A 1HIAB 4FUGA 5I25A 2IN2A 2AMPA 2BDIA 1DT2A 3T29A 3GY3A 3TGKE 2B9LA 2ZGCA 4THNH 2GDDA 1UTKA 5A8YA 1M9UA 2AIPA 2GTBA 3PLBA 2B5TB 3SU0A 1CHGA 5EPNA 2PTNA 2BD4A 1O3HA 1UTOA 3UPEA 1DM4B 1NRSH 1NN6A 1FI8A 3MO6A 1D6RA 5HXFA 6LPRA 2HVXA 4ZROA 1O3GA 2G8TA 1YPJH 2FTLE 5DK1A 4RKOB 1GBBA 5IDKA 1ZLRA 1AWHB 1V2ST 3LH1A 2BTCE 3GY4A 1GJ5H 1KXAA 1UHBB 3MU5A 1RTLA 1AKSA 1EKBB 1D3PB 5FHTA 3DD2H 3U69H 2BLOA 1G3CA 1AB9B 2CF9H 1GI0A 3ITIA 3UQVA 1O2OA 3FP6E 3KEEA 4A1VA 1BRCE 1C2HA 5DP4A 1YYY1 3FP8E 3ZZBA 4WMEA 3M3SA 3MH7A 7GCHG 4HFPB 1GG6B 1BIOA 3QTVH 4U32A 4ABJA 2GP9B 4IC5A 1QL9A 1XUKA 4DG4A 2PR3A 1Q31A 3BEUA 3GY2A 2J92A 3HK3B 1GBTA 2QN5T 4K60A 1TGSZ 3EGKH 3P17H 3QUMP 1L1GA 2DUCA 3TIUA 1HFDA 4Y8XA 1WU1A 4I7YH 4J1YA 1ANCA 2H6MA 2UUYA 3ZYEA 3OY5U 1GCTC 1GI4A 2AGGX 4CRAA 1BRAA 1BJUA 1LPKB 1WTHD 2FX6A 3UR6A 4ASHA 1PPFE 5C5OA 3S0NA 3Q76A 2A4RA 2A31A 4Y79A 1O3DA 1O2WA 2ZWLH 1HAYB 1NESE 2FX4A 1AZ8A 4KTSA 1TGCA 1ZSJA 1P0SH 3C1KA 1HJ8A 3M5OA 1V2NT 3S7HB 4OS1A 3SU5A 3QX5H 1Z7KA 4GSOA 1JIRA 3S9CA 3EA9A 1KY9A 1ARCA 4YOGA 1GJ7B 1E34B 1GBJA 2WPHS 1UTQA 1FY3A 4GHQA 3OU0A 1OP2A 3F68H 3M3VA 2GCHG 2A45B 1GJ8B 6CHAB 2SNWA 1RTFB 1GJ6A 3RXBA 1AE8H 3LGWA 1C5OH 4GCHG 3LGUA 3SI3H 1TRYA 1MKWH 1QJ1B 1FAXA 1GBDA 1MTNB 2PTCE 3IITA 1V2MT 1TPAE 2Q6DA 1DWBH 2UUFB 4K69A 1S5SA 1O2LA 2FPZA 1P57B 1K1LA 2A7JA 1XUIA 1LO6A 2A32A 1G2LA 2P8OB 5F8ZA 2VIDA 3MNSA 2BM2A 4CR5A 1HRTH 4XSKU 3RC4A 4JYVH 1ZPCA 1TABE 2PKSB 4NWKA 2Z7FE 2Y82A 3A7YA 1ESBA 4Y0YE 2BXUH 1P2QA 3SJOA 4D7FA 2TGDA 4AOQA 2Q6FA 3SV2H 2J95A 3SU3A 5EU8A 1GI5A 3PLKA 2CMYA 1TLDA 1TE0A 2V3OH 2R2WU 3A84A 4B74A 1YCPM 3UTUH 1FMGA 3LIWA 4I8GA 2ZPSA 1IQEA 2Z9JA 2ANKH 2GZ9A 1Y3YA 1CBWC 4VGCC 3ZV8A 2VIOA 3K6ZA 4Y76A 1C4U2 2W5EA 5JBTA 3PMJA 3MH6A 2YNAA 3HGNA 2ZI2H 2BLQA 1A3EH 1DPOA 1NTPA 1HAZB 2WINI 4X1NU 4UFEH 1ZJDA 1SQAA 1Z71A 4FUEA 2FLBH 1ZMNA 1O31A 2ZP0H 3ODDA 3UFAA 2A2XH 1RJXB 1MKXH 2PWXA 3LGIA 1AUTC 1BTXA 1W12U 2P3FH 1AGJA 4FU8A 5A2MH 3PWCA 1QRWA 4ZHAA 3M7TA 1LHDH 1LQEA 1SGFG 2J4IA 1E0FD 1LTOA 4X2VA 4ISNA 1LKAA 2BQWB 1P8VC 4KTUA 2VIWA 2ANYA 1YPHE 3BTWE 3RU4E 1C5ZB 2ZU4A 1BBRK 2D26C 1H8IH 2ZHEH 4R8TB 2CJIA 1LPGB 2HNTF 2VWNA 3AW1A 1TRNA 1RIWB 3SNAA 4WWYA 3TJVA 3ZVEA 2OXSA 5CE1A 1LVOA 1L2EA 1O3BA 4JYTA 4CRCA 2FI3E 3A85A 1GWAA 1OX1A 3SJ8A 4GVUA 2ZTXA 4OS2A 3B8JA 2ZCHP 3Q3KA 1UVOA 1A61H 3QZRA 1IQJA 3KHVA 3SBKA 4MQAA 1GHBF 3H7TA 1ZMLA 7LPRA 2F9VA 3SNBA 3NWUA 2J2UA 5K7RA 5DO4H 1DVAH 1AY6H 2HGTH 1DS2E 2PUXB 4NA9H 1ZSKA 1FUJA 3A7XA 1BMMH 2WYGA 1C2IA 5EODA 2CF8H 2VGCC 4WH6A 1SFQB 5FBEA 5JBBS 2FEQH 4BXWA 3P70B 1O2NA 1NM6A 4I32A 5E0GA 1UVPA 5JB9S 1KLIH 2FYQA 3F9HA 2VVCA 1SGIB 2JH0D 1WYKA 1GBLA 1GHBG 3H7OA 3P8FA 4MNWA 2WPIS 8ESTE 2K1QA 1YBWA 2ZFSA 3LC3A 3MO9A 5FX5A 2CHAC 1O3NA 3Q77A 3RXMA 1BRUP 2UWPA 4BAHB 1PPBH 1ZHMA 4FUFA 3RXDA 4F49A 2A7HA 4Q80A 2ZCKP 1P3EA 1S82A 1SOTA 3SI4H 4I31A 2C90B 3MWIU 4JK5A 1FIZA 2GZ7A 1GHAF 5DP9A 3B9FH 5I46H 2VINA 1AFQB 5LH8A 3W95A 3LH3A 2VB0A 2W7UA 2OP9A 3PO1B 3RXIA 1YCPH 3ZZ5A 1NRNH 2JETB 3QZQA 3RXKA 3ZZ9A 1GMCF 1WV7H 1DLKB 1O34A 2JKHA 2XBXA 5DPAA 1C5SA 2BVRH 2A0QB 3SNEA 2WYJA 5FCKA 1W10U 2ZZUH 3R0FA 2WPLS 1IQLA 1EUFA 4GUXA 2ZFQH 2F9NA 3E3TA 2GV6A 2FOBA 1NFUA 1IQNA 2P93A 2ZNKH 3PB1E 1MKXK 1C5VA 1WAYB 4DY7B 2A5IA 3CP7A 3M37A 4WY3A 3E6PH 1O32A 1THRH 3MYWA 3BF6H 1O2RA 2EC9H 2ZGJA 2ODQA 1CSOE 1JMOH 1QRZA 3RM0H 2UWLA 3QWCH 1EQ9A 1XVMA 5EG4A 1TYNA 1GJ4H 1T8NA 1ZHPA 4ZXXH 1B0EA 3M7QA 4D7GA 1ANEA 1C4V2 3RUOA 1C2KA 2GCTC 1J9CH 4CRFA 3V7TA 4YOIA 2ULLA 1H4WA 1P02A 2FODA 2XW9A 4K5ZA 1GHAG 1MCTA 2FOGA 2VIVA 1WCZA 4AB9A 4H4FA 4QT8C 3U9AH 1KSNA 3TVJB 4CRGA 3RXTA 1C5QA 4YO9A 4AZ2B 1Y3VA 2EI7A 2AGIX 1QGFA 1MH0A 1OS8A 3VB7A 2RA3A 2Q6GA 4B2AA 2ZQ2A 3RXHA 3BTKE 4XBCA 4INLA 1S6HA 2WPKS 3TITA 1LQDB 1LMWB 1PPGE 1TFXA 1GHYH 1EAWA 1ELAA 2SGAA 1A5HA 1O2QA 5T6GA 3STIA 3FZDA 3SUEA 1HAIH 3GCOA 4ABAA 2R0KA 1TAWA 4K2YA 3FFGA 1ZSLA 1HAVB 3FP7E 2FOCA 2JH5D 2FZZA 1MTVA 3IG6B 4A1XA 1O2XA 2QXIA 3BIVH 1MUEB 5T6DA 2RCEA 1BMLA 1QJ7B 4AFSA 4FU9A 4IBLH 1DUEA 2RG3A 3NUMA 2DE9A 3TJUA 9ESTA 4ISOA 4CR9A 1JXPA 1OXGA 1A7SA 3SORA 1XUGA 1QRXA 3UNSA 1NS3A 5GDSH 1XUJA 2WUBA 1SSXA 2GGVB 1A46H 1CBWB 1RIWC 5SGAE 1XVOA 3S9AA 1GMHF 2TPIZ 3UNRA 1A5IA 1O35A 2ZTYA 1O3CA 3PTNA 1P05A 2PUQH 1TNJA 2VVVA 1HLTH 3VGCC 1GJAB 1T4VH 1QFKH 3GOVB 3TNTA 5TJXA 4OS4A 1P2KA 1YPHC 3RDZA 2BMGB 1ARBA 1OWKA 2H5DA 3SW2B 4X6OA 1GMHG 1EJNA 3TGJE 1QJ6B 1IQKA 3GICB 2ODPA 1W0YH 4YTAA 4NIVA 5HGGA 4LOYH 2TRMA 1C1OA 2BDAA 4B76A 1INCA 1Z6EA 3V3MA 4Y71A 3A7ZA 1QR3E 4ABHA 3ATMA 1H9LB 3RXRA 3UIRA 4AGKA 4E06H 3RXOA 1TMBH 1H9IE 1GBKA 3PMAB 1VGCB 5DKMA 1NU9A 3A7VA 3SU6A 1GCDA 3KN2A 1LPZB 1JRTA 2RDLA 1ZPZA 1LCYA 5EQRA 3Q3YA 1J17T 2VU8E 2SGPE 4WXIA 3MI4A 1KTSB 3F6UH 1QTFA 3LC5A 3G01A 1AVGH 3SU2A 1F0SA 1NFXA 2HPQH 3MTYA 2FDAA 3GY8A 1JOUB 1DLEA 1G37A 2XTTB 3EA8A 1ZGVA 1SGEE 2R3YA 3P92A 1RRKA 4OGYA 2ZFRH 4CRBA 2TGTA 1NU7B 3BV9B 4SGAE 3M61U 3DUXH 1Q3XA 1GBAA 3QLPH 2VWOA 3PO1C 2BZAA 2Z3DA 5AVDA 5EXNA 3GDVA 3VXFH 1L4DA 1MQ5A 4Y11E 1ETRH 1BT7A 1ANBA 4AFZA 1WTGH 2ZEBA 1C2DA 1QB6A 3BIUH 1MU8B 4GPGA 3E0NB 4H6TA 3F9GA 4U01A 2G5VA 1SGCA 1AIXH 1FONA 2SGDE 2BX4A 1HIAA 1AKSB 2O8LA 1O5BB 4AFQA 1TPOA 1SBWA 1WUNH 4Y6DA 1ZRBA 1OWDA 1C5TA 5A8XA 1F7ZA 1XUHA 1Y5BT 1O39A 1F0RA 3LONA 3BG4C 3BSQA 1UO6A 1YF4A 1AVXA 3BTFE 1C4Y2 2BLWA 2Y5GA 4NFFA 4Y10E 5CHAB 1A1RA 1NFWA 1TNHA 1TOMH 2AEIH 1LDTT 1DICA 1FN8A 4ABBA 2BD8A 5HM9A 4TPYA 4O3TA 1TMUH 2O8MA 3TK9A 4XOJA 4Q7YA 2Y5HA 2QXGA 2ZDNA 1LVYA 2J38A 3GYMA 3TH3H 1UVUH 2BDBA 4XE4A 1O36A 4X2XA 5FBIA 1ZJKA 2OC7A 4A1TA 3LPRA 1TBRH 2WV5A 1J8AA 3BTME 4GHTA 5HM2A 3SHCH 1EB2A 1VCQA 5F8TA 3ZVBA 3R3GB 4CRDA 3I78A 5DP7A 2ZDVH 2P95A 3UUZA 2ZDLA 2AH4X 1BHXF 1GJDB 7ESTE 1EASA 1IQGA 1TALA 1PPZA 1ZRKA 4F4OC 1GHZA 2GMTB 1EJMA 2AFQB 6ESTA 3L33A 3SHAH 1QURH 2XXLA 1C1MA 4I8LA 1TBQH 3TK5A 3U98H 4ABEA 4NFEA 3AVZA 3EAJA 1GI1A 1ORFA 2BD9A 3MNCA 1ZTKA 1HNEE 4CHAC 4JCNA 3SUGA 4IN2A 4AB8A 5B6OA 1KXBA 5E2PA 4X1RU 1V2OT 3OYPA 1OWHA 4OS7A 3RXSA 2VWLA 1MKWK 3EQ0H 1C1UH 1C2JA 2QXJA 4NCYA 1GI7B 2ZU3A 3AAVA 2AMQA 2Z94A 1J16A 1GVLA 1UCYK 1OKXA 1GI2A 2R0LA 2Z9GA 1KTTB 4CBNA 1FAKH 1P12E 1UTJA 2Z9LA 1P09A 3FZZA 4LZ4B 4ZHLU 5DP6A 1VJ9U 1A4WH 1PQAA 1DFPA 2EEKA 2OC0A 4JYUH 1SPJA 1C2MA 1TQ7B 2EI6A 2G51A 3F1SB 3GISB 4RSPA 1GBMA 2ZHDA 2FI4E 2STAE 4FUIA 3STJA 2VJ1A 2FOMB 1ELCA 2OC8A 3KQDA 4TY7A 4AG1A 4INKA 2Y81A 1DWCH 1O2KA 1Y3XA 3PROA 2FWWA 3SGAE 3ZVGA 1FY4A 4J2YB 5L6NH 3D23A 1WQVH 3SGBE 2GT7A 3U8TH 1B0FA 3ENSB 2ZIQH 1LHGH 2B7DH 3RXAA 3KGPA 5L30H 1MAYA 5GPIB 4DT7B 1Y59T 2XBWA 1CU1A 1HAGE 2A7CA 5E2OA 1TX8A 1AE5A 1IHSH 2GCHF 3KCGH 1HBTH 2ZECA 1K22H 2BZ6H 3FAOA 3KQBA 2OUAA 1GG6C 4B71A 1RS0A 4A5TS 3PYHA 1Y3WA 1O30A 4NSYA 1K1JA 1L1JA 2QXHA 4KKDA 4B2CA 1MTSA 3A88A 1O2ZA 1LHEH 3SN8A 1ELDE 2QYIA 4CREA 3F9EA 1W0ZU 1K21H 1VZQH 1C1QA 3K9XB 1O3FA 5TCCA 4XBDA 2XBVA 1QA0A 3ODFA 2AMDA 2CHAB 3TK6A 3F9FA 1PPHE 4K1TA 2YOLA 1G2MA 9LPRA 1H1BA 3MU8A 3SO3A 1CA0B 2R2MB 2F3CE 1TOCB 4DGJA 3B23B 1V2UT 2IJOB 1O2SA 1QL7A 2BQ7B 2SGFE 1BITA 2O8WA 3UOUA 1MMJN 1SHYA 3ZZ4A 2Z9KA 5A0AE 2ZFFH 2Z3CA 1NY22 3SU4A 1ELGA 1DWDH 1GGDC 4FUCA 3VB5A 2CGAA 2F9OA 1PYTC 3ZZDA 4YZUA 1O3PB 2GMTC 5T6FA 4NA7A 1EXFA 2J34A 1ZTLA 2D8WA 4NA8A 1TGNA 2GDEH 2UUKB 3T2NA 2OINA 1DUAA 1TNLA 2ALPA 4XBBA 3QO6A 1PYTD 1VGCC 1G3BA 5C5NA 4LK4A 2BD7A 2OTVA 3M5LA 4B75A 3SQHE 5ABWA 1HAOH 1W3CA 3GCHC 1EP5A 4JZIA 4TPIZ 4LZ1H 1Z8RA 3RXQA 1AVWA 3N7OA 2OQ5A 3E0PB 1HXFH 1UVSH 1DXPA 2H9EH 1H8DH 3VXEH 4DURA 4FU7A 3ZZAA 3M5NA 5GCHF 5CHAC 3RXEA 3A8AA