2AYWA

Crystal structure of the complex formed between trypsin and a designed synthetic highly potent inhibitor in the presence of benzamidine at 0.97 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structure of the complex of trypsin with a highly potent synthetic inhibitor at 0.97 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA02
3TVJB 1F92A 1QQ4A 1CGJE 5A0BA 2DUCA 2HALA 1GMHG 1QL7A 1VITH 1SGIB 1SC8U 1OWHA 1O2QA 1V2ST 1YPMH 1ZPZA 2ZU1A 2YNAA 1VITG 4H6SB 2XWBI 2C93B 1TGTA 2CF9H 2VWLA 2R3UA 4FVDA 1EJAA 3VXEH 1TB6H 1EB2A 3RXBA 1Y5AT 1F2SE 1ARCA 3MU4A 2Q6GA 2HRVA 1RGQA 4K3JA 3EYDA 2A7JA 1K1NA 1IQFA 2BXTH 5T6GA 1W3CA 5HM2A 2FOGA 2HNTE 1O2HA 1PQAA 4FUHA 4Q7ZA 1MKXK 1SQOA 4H6TA 6LPRA 1XMNB 2WINI 4AN7A 1UMAH 1BJUA 1PPCE 3OTJE 1Y3UA 1ANBA 3BEUA 1LTOA 2ANMH 4X6NA 4U32A 4WY3A 3UNSA 2Y7ZA 4DOQA 1AN1E 1KLTA 1MTNB 1P2OA 1F0TA 1S6FA 4YESB 2ZFRH 3F1SB 2BQWB 1CHGA 2QF0A 4X0WU 4BAMB 4FXGH 4F49A 3F9GA 2SGFE 2Z3DA 3BTGE 2SGDE 2PLXA 3RXFA 5E0JA 1C5XB 5DG6A 1KYNA 4J1YA 3KQEA 3SUDA 1GJ4H 2ZEBA 3UNRA 1O34A 1GBFA 1QL9A 1AGJA 2XYAA 2HNTC 1JMOH 1O2UA 1XKBC 2PGBB 1CGIE 1EB1H 3SJIA 1V2RT 2VB0A 1A61H 1P03A 2ZGHA 3SU6A 3A86A 2A4RA 3SJKA 3AW0A 1EATA 3H7TA 1Y3YA 3GY7A 3QO6A 2Y6TA 3RLYH 4PROA 1HB0B 1O2PA 4D9QA 3RDZA 4A5TS 4UFGH 3E1XB 1O2GH 3LGVA 1HIAB 5FCRA 1AUJA 4ISHH 3BEIB 2JETB 1UTOA 1TA2A 2FS8A 4NA9H 3PWBA 1UCYH 1KXCA 3PYHA 4X8VH 1A3BH 3SW2B 2ZHFH 1WTGH 2H9EH 1UCYE 3GCHC 4JCNA 2A5IA 3SN8A 4D7FA 4IBLH 2D26C 4NWKA 3V12A 4RN6A 1GI9B 4KELA 1L0ZA 5EQRA 1GHAG 4BXWA 1XM1A 2BY9X 4CBNA 3GY5A 2ALPA 1MAYA 4UFFH 2AMQA 4BAOB 3EDXB 4NGAH 4I8KA 4ASHA 1H8IH 2ZWLH 1RIWB 1O3PB 3VGCB 3A7TA 3V3MA 3GYLB 3U9AH 1GG6C 2GT7A 4GLYA 1TNHA 1YPLH 1BTZA 4I31A 3NUMA 2VWMA 1QL8A 1C2HA 3KQBA 4OS7A 1RTLA 1T8LA 1QB6A 2UUYA 2RG3A 4I32A 3RMLH 1EPTA 3P95A 4X6PA 4BANB 1NPMA 3RXTA 3SNDA 3EQ0H 1BTUA 1GMDF 2W5EA 5TJXA 4DIIH 1SLWB 4YOJA 4MVNA 1DICA 5EXMA 1N1LA 1IQLA 1ARBA 2EI6A 1QY6A 2PKSB 1RRKA 3PM3A 5CMXH 2GT8A 4R8TB 3STIA 4X1PU 1SB1H 2HWLB 1GJDB 1FIWA 1T4VH 1PYTD 3MFJA 4ZKOU 4MNXA 1ZMLA 2ZHEH 3M5LA 3P92A 3PROA 4DG4A 1ESTA 3I78A 3LKWA 4AORA 3C1KA 1GBKA 4AG1A 1DY8A 3I29A 3SJ8A 4TPIZ 3H7OA 5B6OA 1ANDA 4AB9A 2EI8A 2FPZA 1GHWH 4GHQA 1F7ZA 1OWJA 2M5TA 3URDA 2C4FH 1DUEA 3NCLA 1K1LA 1NO9H 1TLDA 3UNQA 3QTVH 1B0EA 1AVWA 2OXSA 1OWKA 4Z0KA 3EA9A 1UHBB 1A1RA 2OP9A 4Y0YE 2CHAB 5FBIA 2PKAA 3GY6A 1C4V2 1ANEA 3OY5U 3SO3A 1HAHH 3OSYA 1ZZZA 3KNXA 2BDGA 3KQDA 2FI3E 3RMOH 4K1SA 3ZZ6A 2TPIZ 1W11U 1QJ1B 4B76A 1PFXC 4HTCH 1KXFA 1ZSLA 1BTPA 2GCTB 1OWIA 1KLIH 4NIVA 2IN2A 1GL1A 1GMCG 1L1JA 2QCYA 1TOCB 1BTHH 1CT0E 4D7GA 2KAIB 1A46H 4VGCC 4JMYA 4B2BA 2VIPA 2O8TA 1C5MD 1GI4A 1KSNA 4FUJA 4A1VA 1P2QA 2FWWA 5C5OA 2GZ7A 1KXBA 1ZSKA 5JYIA 1NRQH 1BJVA 1F0UA 2V0BA 2K1QA 1ZTLA 1A0HB 3TIUA 1BTXA 1G3CA 1MKXH 2WYGA 1VGCC 4NZQA 3URCA 2LNCA 3P6ZB 1PPHE 4KTSA 1YPGH 3T26A 1V2QT 2AIPA 2ASUB 1SQTA 2BXUH 5C67A 1GVKB 2G00A 4BAKB 1HJAC 4X1RU 4D9RA 1HXFH 1WOFA 1UK3A 5F8TA 1O5EH 1ID5H 1K1IA 1O2XA 1T31A 1BCUH 3RU4D 4IC5A 1GBHA 4B2CA 3P8FA 1MCTA 2BY8X 4HZHA 1ZLRA 1GJBB 3LU9B 3UWIA 1PPEE 3BG4C 3MH5A 3ZVFA 2P3FH 1O5BB 1O2LA 2PFEA 3A7VA 3E91A 1O37A 3E16B 1VCWA 1VCQA 1HAZB 2NWNA 4AFSA 1CBWB 1DOJA 1HAXB 1QHRB 2D1JA 3LIWA 1TALA 3D23A 4NFFA 4HI3A 2QXIA 5C1XA 5ESTE 1YF4A 2WV5A 1J9CH 5DPAA 3K9XB 4AZ2B 4IMZA 2H9TH 1RTKA 4ISOA 3ENSB 5F8ZA 5JBCS 1C2JA 6CHAC 3O8DA 1KY9A 1ZYOA 3FP8E 4ABGA 2OC0A 1SGFA 2FLRH 3GISB 3BEFB 1CO7E 2BMGB 3BTFE 1C2GA 3BN9A 2ZDAH 3GICB 3SGAE 1HV7A 3SUFA 4DY7B 1KXEA 2TGTA 1EJNA 2P3UB 4A1XA 2OLGA 4CRDA 1ELBA 1W8BH 2P8OC 1J14A 1WCZA 1ETRH 1H8DH 3MH7A 3T28A 4D8NA 3F6UH 1O5GH 1SPJA 1YPJH 3BSQA 2GTBA 1DDJA 1O3OA 1T8MA 3E3TA 2FZZA 2ZHWH 3MU1A 4AFZA 4BAQB 2GVFA 4MPVA 5CHAB 2XW9A 1O5DH 1ZHPA 3SV2H 2GMTB 1GVLA 1O2RA 5A09A 5T6DA 1BUIA 5E2OA 1P11E 4WH8A 2FP7B 2FLBH 3ZZ8A 3NKKA 5LPFA 5H4IB 1GHVH 1OYTH 4ISIH 2GCHF 5AHGH 2OUAA 3GY2A 1A0JA 1W7GH 5EODA 1UVOA 4X2WA 1C1WH 1ZMNA 3A7ZA 3TJVA 2ZHDA 2GX4A 1N6YA 5FX6A 3GY8A 4DIHH 2VWNA 1EXFA 1AE5A 2FI4E 4AOQA 1SLUB 3PLPA 2PWXA 1C5QA 2VVVA 1TMUH 4I8LA 5HM9A 5K0HA 2GDDA 1K1PA 2FEQH 3ATKA 1ELEE 1QBVH 4AYYB 4KP0A 1TNGA 6GCHF 2BD5A 2FTMA 1DWEH 1OP0A 2BVXH 3GOVB 3T27A 5FCKA 3SZNA 1TQ0B 4CRGA 5A2MH 1QJ6B 2VH6A 5IYTA 1GJAB 1DLKB 3A87A 2BB4A 1MBMA 1BTWA 3VB6A 4UFDH 4Y79A 1DITH 1HCGA 3OYPA 1NN6A 3V13A 5L2ZH 2B0FA 3RXUA 1OOKB 1AKSB 1SFIA 1ELGA 2PSYA 1IHTH 1RJXB 1SGRE 4MPXA 5LPEA 1C5WB 4AYVB 1LO6A 2VNTA 4BXSA 3MTYA 4LZ1H 1S82A 1O3NA 4CH8B 9LPRA 3D62A 5JBTA 4FUFA 1IQMA 1Q2WA 1O31A 2ZZUH 1CA0C 2XBWA 4H4FA 4NA8A 3HK3B 4GCHG 1OP2A 4WH6A 1PQ8A 3VEQB 2CGAA 3A8BA 3F9FA 3U8OH 3TITA 3STJA 1L4DA 1GMDG 3S7KB 1DSUA 3BG8A 1YBWA 3QX5H 1YM0A 1RFNA 2BVSH 4MTBA 3L33A 1XUJA 3AAVA 1AY6H 2BLWA 3ZZCA 3MWIU 1GJ7B 4JYVH 3M36A 2BD3A 7ESTE 1L1GA 1D3TB 1BMAA 1NC6A 2R0LA 1NU7B 3M35A 1P09A 1A7SA 5FPYA 3RP2A 1GCTB 1TRYA 2XCFA 2F9UA 1C5UA 4FVBA 3M7TA 1O2MA 2VIVA 8LPRA 4O3UA 2P94A 1AZZA 3LT3A 1Y5BT 2PGQB 4SGAE 5EXNA 1C2FA 1DFPA 1Z6EA 5JB8S 1XVMA 1ZR0A 2WYJA 1BT7A 1C9TA 1YLDA 2Z9JA 4NWLA 4INHA 2F9BH 2UUKB 1KDQA 3EA8A 3NPSA 1YCPK 1JRTA 1MKWK 1SR5C 1SLVB 4IS5A 1Y3VA 1A2CH 2ZU2A 1O3IA 2ZDVH 3L3TA 2AH4X 3M37A 2J9NA 1GBDA 3KIDU 2ZECA 3QGJA 1AVXA 3FFGA 1TFXA 3RU4E 4FUCA 1DT2A 3A84A 1BMNH 4IW4E 2BZAA 2QY0B 3RUOA 5FPTA 3RXOA 2NU4E 3C27B 1J16A 3K6ZA 2VIDA 3SU1A 3M3TA 1OWDA 1ELDE 3MH6A 3MU8A 5GCHG 3TU7H 1PPGE 1HAPH 5AVDA 1GBCA 1UVUH 1AFQC 2FDAA 1ELVA 2H5DA 1SI5H 1Y8TA 1YPHE 1PPFE 4JZEH 3MO6A 1O32A 4X1QU 3NXPA 2ODPA 3BTEE 1Z1JA 3GCHB 2BDHA 2F9VA 1HRTH 3LJJA 3O8CA 1ETTH 1SGDE 1GDUA 1BA8B 5E8EH 3MI4A 3OU0A 2IPHA 1YPEH 5EOKA 1A3EH 5AFZH 2G4UA 1IQEA 1T8OA 5C3NA 1UHBA 3ZVDA 1TX7A 2OTVA 2CF8H 3DUXH 1H9IE 2AGGX 1NRPH 1O3LA 2AMDA 3QWCH 4ABJA 2CJIA 3QK1A 2Y7XA 1NFUA 1DVAH 1QRWA 1HGTH 1YLCA 1FMGA 1KIGH 5I25A 2A1DB 1JOUB 1FJSA 3TGJE 1GI8B 1W7XH 4AX9H 1C2LA 1WV7H 4JYUH 1GG6B 1HAVA 3Q00A 3UREA 1NM6A 3QZRA 3RXRA 4ISNA 2G8TA 3LC3A 1GCDA 3SI4H 1ABJH 1YPHC 1QURH 4O3TA 1P9SA 5L2YH 5C5NA 5EW2H 1AVGH 2BDYA 1OWEA 4TPYA 1GWAA 7KMEH 2ESTE 3GY4A 1IQJA 2NU1E 1K1OA 1AWFH 1XXDA 1XUFA 2FOAA 1TNLA 5GIBA 1U6QA 2Y5GA 1ZGVA 1ZTKA 4Q7XA 1FY3A 2Q1JA 3ITIA 1F0SA 2C8YB 1C2IA 3ATLA 2Z7FE 1P9UA 2P3TB 4ABBA 1G9IE 1D3DB 1IQNA 2A5KA 3GYMA 1TIOA 4JZFH 1C2EA 3HK6B 3SHAH 4OGXA 4D76A 1SGEE 1C1MA 1V2WT 1ESAA 2FOHA 4JZDH 1GBAA 2AMPA 1FY1A 4X6MA 4GPGA 1C1QA 2ZFFH 5J4SA 4CH2B 3SGBE 2GCHG 1CHOF 2FXRA 2G52A 2Z94A 2LPRA 2ZGCA 1H1BA 1C1NA 1UTNA 1TRMA 2SGPE 4Q2KA 2G55A 4FUGA 1C5NH 4ABIA 1EUFA 1CU1A 1P3EA 4J2YB 8ESTE 1O2JA 1GI0A 1EOLA 1LHEH 3A83A 1KXDA 1AE8H 1THSH 3A7YA 1SVPA 1ZPCA 3PTBA 1K21H 1SL3A 3W94A 1EZSC 1W0ZU 5DP5A 1C5OH 3SJOA 3RM2H 8GCHF 1CSOE 2VGCC 4DW2U 4ABAA 4VGCB 2B8OH 3A8AA 3MOCA 3T29A 3LONA 1T8NA 4LOYH 3UY9A 2J4IA 1QRXA 1SGQE 1WU1A 6GCHG 4MPWA 1O5AB 1OKXA 2XCNA 4YOGA 2R2MB 3MNCA 3TJNA 3DFLA 1C5TA 9ESTA 4ABEA 1TNKA 1BBRK 3ATWA 2ZDLA 1IHSH 4OS5A 3AASA 1G3EA 1NFWA 4WF8A 1NFXA 3PTNA 3SV9A 4Y11E 1VGCB 1C5ZB 2ULLA 1CQQA 2ZDKA 2ZF0H 1LQDB 4WVPE 5AF9H 1EAIA 4O97A 4YTAA 1UTJA 1O2IA 4X8TH 2BLVA 1HJAB 2VU8E 2ZI2H 4FU8A 1UVPA 1ELAA 1QB1A 3PMHB 4FUEA 1TQ7B 5F03A 3KGPA 5FHTA 1AFEH 1GDQA 1FLEE 2Z9IA 1S83A 2ZGXH 2OBQA 2H1UA 3T62A 3KQCA 1GBIA 3ZVCA 2FX6A 5A0CA 1MTNC 1OYQA 4Q80A 1V2LT 1P04A 1F5RA 4INLA 4ABDA 5C1UA 3BG4B 1O3DA 2ZGJA 1BITA 4XE4A 4LK4A 1ZOMA 4LXBH 1A5IA 2ZPRA 3OY6U 1GJ8B 4GUXA 2FIRH 3E0NB 3E8LA 2F9OA 4M7GA 1FAKH 1IQHA 1GJ9B 3SU5A 5JBAS 3DFJA 3SQEE 1HAOH 1W10U 4ZXXH 3DA9B 3QZQA 3ZZ3A 1SGPE 2RA3A 3PMAB 3PWCA 6CHAB 1E0FD 4GHTA 3SORA 1ACBE 3SU0A 4FU7A 2A0QB 1S6HA 3P8NA 4Y8XA 1X7AC 2FO9A 3GY3A 3RXAA 2ANWA 2CMYA 3RXDA 1ELTA 1G2MA 4DJZB 4I8GA 2FOMB 3M61U 2BY7X 1BOQA 4TWYA 1TGNA 2QV1A 1AI8H 4NIXA 3NZIA 1LPKB 1WQSA 1GI6A 2P8OB 2ZTYA 1GHBF 1UO6A 2ZPQA 3QTOH 5C1YA 2AGEX 2PR3A 1P0SH 4B75A 5DP9A 1P2IA 1BHXB 2ZP0H 4CBOA 2ZIQH 2AIQA 2QXHA 2ZG0H 5E0HA 1DANH 1BMLA 1TGBA 4K69A 3B9FH 2SNWA 3RMMH 2OQUA 4UE7H 3E6PH 3RC6A 1C1SA 2Y5FA 1CGHA 3RXPA 5HYOA 1JXPA 3TGIE 4Y8YA 4XBCA 2THFB 2ZCHP 5A0AE 2UUJB 2VH0A 2C8XB 5AFYH 5L30H 4AFUA 3MYWA 5EGMA 2PSXA 2ZTZA 5LPRA 1WSSH 3PB1E 3ATMA 1F0RA 1YGCH 2VINA 1MQ6A 1W13U 2XC0A 2A45B 1TNJA 5EQSA 1Z8JB 4DGJA 2QC2A 1MMJN 1L2EA 2Z6BD 3SU4A 1TONA 1NRNH 1FPHH 2Q6FA 3VGCC 1GMHF 1ELFA 4GAWA 2OD3B 1GBTA 3CENA 1UJ1A 4ZKSU 1C1PA 3VB4A 3RXJA 1TMTH 3NK8A 1B5GH 2BDAA 1DWCH 1LPZB 1TA6A 1VITF 5DK1A 1UK4A 2ZDMA 1CVWH 1TX8A 2W3KA 1O38A 4Y8ZA 3SU2A 1AB9C 2WUBA 5I46H 1C1TA 3ZZDA 1WQVH 3R3GB 4YO9A 3PMBB 4IGDA 1LHDH 3H5CB 1ELCA 1HDTH 5DP8A 4E05H 4NFEA 3ZZ9A 4IN2A 3SU3A 4RKOB 3PV4A 4OS4A 2B5TB 3M7UA 4ZH8A 1SLXB 1C2DA 2CV3A 5GWZA 3BTQE 1T32A 2OBOA 2HNTF 2GZ8A 3ZZAA 2BOHB 2NU2E 3PLKA 2DE8A 4ESTE 3U1IB 5EQQA 3UIRA 3EA7A 1V2MT 3SOSA 5C20A 5G4BA 1BRUP 2A31A 1MTWA 1N8OC 1DX5M 1MCVA 5FX5A 3T25A 2HPQH 3A80A 4X8UH 3BTTE 1NZQH 1P3CA 1V6DA 3F9EA 4IN1A 4E7NA 1GI5A 2RA0A 1CA0B 2F9PA 1E36B 4Y7AA 3BTHE 1ZTJA 1Z1IA 4RSPA 3IITA 4FUBA 4BTUB 2ZC9H 1S5SA 3ZZBA 4XOJA 1IQGA 2ZHQH 2HVXA 1H9HE 5PTPA 2GV7A 2R9PA 1K1JA 2XXLA 1SG8B 3A7WA 1ZPBA 3MHWU 3ELAH 4UONA 4I33A 1O2YA 3SI3H 3G01A 4FUDA 1MBQA 2TGPZ 1C5SA 3HGPA 2GCTC 3TGKE 1P2KA 1TWXB 1QBNA 2VWOA 1S85A 1LMWB 2H2ZA 1J15A 1EZXC 3Q77A 1P01A 2ZQ1A 1JWTA 2A2QH 2NU0E 1ZHMA 1C5YB 2TRMA 4DURA 1KTSB 5F6MA 2BVRH 2GKVE 1JRSA 1GI3A 2VVUA 2YNBA 2PUXB 1BBRH 2OC7A 1SGCA 3UFAA 2QYIA 1Y3XA 1KLJH 1D3QB 1HAGE 1T4UH 5DP4A 5BPEA 5GPIB 1FN6A 5K7RA 1BBRE 1O3HA 3Q3XA 1O5CB 2IJOB 3WY8A 4E7RG 5EW1H 4JK6A 1TBRH 3JZ2B 1GJ6A 1O2ZA 1PQ7A 3BTME 1EZUC 2O8LA 4X6OA 1VCPA 3GCOA 2CXVA 4INKA 2OCVB 4ZROA 3A89A 3T5FH 2FOCA 1LKBA 3NWUA 2BY6X 3FP7E 1LQEA 1CT4E 2D8WA 3A8DA 1LVOA 3BIUH 4DCDA 4U2WA 2NU3E 1GJ5H 3PO1C 1TAWA 8GCHG 1SOZA 2Y80A 7GCHF 1E37B 1C5LH 1GHZA 4B74A 1O2TA 2W7UA 2PKAB 2FS9A 1RXPA 5ESBA 3JZ1B 1LHCH 4LZ4B 1P2NA 4AG2A 1S0QA 3FAOA 4WMFA 3U8TH 3UWJH 3GCNA 2BDCA 1G37A 1QJ7B 1S0RA 2HOBA 1DWBH 1XKAC 2I6SA 1FV9A 2ODYB 3BTDE 1O30A 1TX6A 3KCGH 3TH2H 4BTIB 1L1NA 5DGJA 2WPHS 1TPOA 3AAUA 3MO9A 8KME2 1AFQB 1HJ9A 4DVAU 1EAUA 4Y0ZE 2VJ1A 1MTUA 2BOKA 3KEEA 1ZHRA 4CHAC 1IOEA 1GBBA 2OQ5A 3K6YA 1NY22 1O2VA 2GDEH 2Z3EA 1UCYK 4WMEA 2R0KA 4O03A 5F8XA 3ZV8A 1C1VH 2QXGA 2QIQA 2FI5E 3IWMA 5DKMA 4I8JA 4GSOA 3O8RA 2PV9B 1DXPA 2AS9A 3VPKA 4UDWH 1O3JA 3EGKH 2ZKSA 4X2XA 3UOPA 1GI7B 3SGQE 2R2WU 1XXFA 2P16A 1LVYA 1HIAA 5FPSA 4CR5A 1IQIA 3F9HA 5SGAE 3ZYEA 4FU9A 3FVFB 1EPTC 3TJUA 4XFQA 2W3IA 5JPMH 1BRCE 2XC4A 1Y3WA 2FX4A 4X1NU 1S81A 4FUIA 1FDPA 1TMBH 1B7XB 5IDKA 4CRFA 2GP9B 2BY5X 5ETXA 2J92A 3TPIZ 1K28D 3BIVH 1SGNE 1TNIA 1NFYA 2BLOA 3UOUA 1LCYA 3UQOA 4NSVA 3S69A 2F9NA 1MQ5A 3ESTA 2BHGA 2HPPH 1XUHA 3RXIA 1BB0B 2Z9KA 5ABWA 1KXAA 1N6XA 3SNAA 1NRRH 5DP6A 1LPGB 1SHHB 1M9UA 2Z3CA 2BD9A 4WXIA 4YLUA 1AZ8A 1DPOA 3V7TA 1AWHB 4K2YA 2XBYA 2ZTXA 1OX1A 3F68H 1ZJDA 2G81E 3MMGA 4YM9A 2FYRA 3SBKA 4I7YH 2A7CA 2AYWA 2EEKA 1LHGH 4JZIA 3I77A 4Y71A 2CN0H 4BNRA 3S0NA 1VJ9U 5FBEA 2XC5A 4K8YA 1HFDA 4X2YA 3RXSA 1TABE 3RM0H 1G3DA 1A0LA 1BDAA 4MDSA 3LGYA 4Y7BA 3A85A 2J94A 2JKHA 2QF3A 1SMFE 1TRNA 1K1MA 1P10A 1MZDA 3QLPH 3B8JA 1XUGA 1GGDC 2VIOA 1EKBB 1W12U 2VIQA 4K1TA 2G4TA 3Q76A 2GZ9A 2DE9A 1GI1A 2BD8A 4AGKA 3GDSA 3RXQA 4E06H 4ZKRU 1V2OT 2J95A 1QBOA 1TGCA 4JYTA 2UWLA 1K22H 1C1UH 3RMNH 1ABIH 3UR6A 2IOTA 4NA7A 5EU8A 2SGQE 1DS2E 3ZVBA 4B2AA 2EC9H 2VGCB 3ZVEA 3HGNA 2ZU5A 1P57B 1HXEH 1W14U 1O2OA 3W95A 1YCPM 1BHXF 2A4QA 2AEIH 3U8RH 1SGFG 1V2UT 4ZXYH 1Y5UT 1ORFA 5FXLA 1QCPA 3BF6H 3VB3A 3M5OA 1LVBA 1QA7A 2OINA 4MLFB 1O35A 4HGCA 1Z8IB 2BD2A 3SNEA 2F83A 1QNJA 2B7DH 1AMHA 2KAIA 4UEHH 3RU4T 1GCTC 2PUQH 1SGYE 3LH3A 3P8OA 2SFAA 1E34B 3LOXA 2W7SA 2ZFSA 3UQVA 4GVUA 3AVZA 1GI2A 3ODFA 3SV7A 3M3SA 4IC6A 4AFQA 2P95A 4XDEA 2QAAA 1F5KU 1XUKA 3Q3YA 4K8BA 4MNVA 1DLEA 1LHFH 1MTSA 1EP6A 3LGTA 2GGVB 3S9AA 3GDVA 1FONA 2BM2A 2G51A 3ZYDA 1O2SA 3A8CA 3TLOA 2W26A 2BD4A 1BZXE 4UFEH 1C5RA 1FQ3A 2V3HH 3LDXH 1V2NT 4ZHAA 3HKJB 4Y76A 2SGAA 4Q7YA 1YPKH 1FI8A 2QA9E 1TE0A 5HMAA 1O3GA 2ZGBH 4H42U 2J2UA 2Z9GA 1THRH 1JIRA 1PQ5A 4MNYA 5T3HA 3RXEA 1AU8A 2J38A 1TPAE 1A4WH 2ANKH 2BQ7B 3FP6E 3SNBA 2FOFA 5GXPA 1XUIA 3GCTF 1W0YH 2OC8A 2O9QA 3RXGA 1L4ZA 2G5NA 5EPYA 1VZQH 6ESTA 1G36A 1BTYA 2H6MA 4XSKU 4TY6A 3ZZ7A 1O3BA 4CR9A 3RLWH 1BIOA 1DM4B 2HLCA 1YKTA 2FYQA 1O33A 1SSXA 2H5CA 1WAYB 1O3AA 1DY9A 4DT7B 1D4PB 1OS8A 3SJ9A 2V35A 2Y81A 2ZCLP 1NESE 3A82A 1ZMJA 1XVOA 1GJCB 1YP9A 1C2MA 2GV6A 2R3YA 2WPLS 1C9PA 3VFEA 3LJOA 4WXVA 1MU6B 4NG9H 1HUTH 4B71A 7GCHG 3S7HB 2C3SA 3TJOA 1E38B 3LPRA 4KKDA 1BQYA 5BRRE 1KDQB 2AFQB 5HGGA 1GHXH 1O2NA 2A4OA 1IQKA 2J34A 4UD9H 2TGAA 4YT6H 2P59A 4ZHMU 1GBMA 2F91A 1GVZA 4R0IA 2STBE 2FTLE 4U01A 2ZDNA 5A8YA 2C8WB 4ZMAH 1K2I1 1FY4A 4GCHF 1YCPH 1MKWH 5LGOA 4YOIA 5E0GA 5JDUB 3LC5A 1AB9B 2ANYA 1MU8B 1AQ7A 1ZJKA 2O8UA 5EXLA 1D6RA 4NIWA 1S84A 2ZPSA 1FPCH 1GDNA 2V6NA 1VJAU 3HATH 1DWDH 3B23B 3EAJA 3RXCA 4CREA 1C5VA 3P8GA 2ZFTA 5L6NH 4A6LA 3SUEA 4I8HA 1C1RA 1SOTA 2ALVA 3S9CA 2UUFB 1N8OB 1TBZH 3T2NA 3UUZA 4XBDA 1YC0A 1EAWA 1P2MA 1V2TT 3A81A 4AB8A 2P93A 1P8VC 3HPTB 3MNSA 4YZUA 1VR1H 3MH4A 1Z71A 4K5ZA 4OS6A 2TBSA 2RCEA 1EAXA 5FAHA 4JZ1A 2BLQA 1TPSA 2D2DA 2QGRA 1Q31A 2O8WA 4NIYA 2JETC 1IAUA 3BTKE 1HPGA 1AKSA 1Q3XA 2UWPA 4THNH 4ZKNU 1UTQA 1AUTC 2XTTB 1A5GH 1H4WA 4A92A 1UTMA 2WPMS 2ZFQH 1J17T 1NU9A 1WBGB 2ODQA 4ABHA 1HNEE 5JBBS 2WPJS 1Y59T 1TYNA 3RXKA 1HAVB 3ATIA 1P02A 1T7CA 1PPZA 1QQUA 3SV6A 2UWOA 4BTTB 4B73A 3TH4H 3VB7A 1PPBH 5C2ZA 5TCCA 4OGYA 3SUGA 3RXMA 4CRAA 3S9BA 1GHYH 4Y10E 1ZRKA 1BMMH 1DXWA 1V2VT 3MNBA 1ZRBA 1P12E 3ZZ5A 2H9HA 2A5AA 3MO3A 2BZ6H 3M5MA 1RIWC 3KN2A 3KF2A 1W2KH 2QXJA 2A32A 1FZZA 3FANA 5EPNA 3V0XA 2ZA5A 4YLQH 2JH6D 5GCHF 1Z8RA 3TNTA 1UTPA 3DHKH 1O3CA 4TY7A 2BQ6B 4K60A 2XWAA 1P2JA 2FESH 3LGIA 1HJ8A 1FXYA 2Q6DA 1RD3B 4MPUA 1J8AA 5EG4A 3E90B 5E2PA 4X2VA 1GBJA 1MH0A 1MZAA 1QGFA 3FZDA 3DT0H 2BTCE 2ZU3A 1FUJA 3PO1B 1JIMA 2XBXA 3GDUA 1DE7H 2XNIA 1NTPA 4ZHLU 4A7IB 1EASA 2PKSC 1NT1A 2GD4B 3FZZA 1V2PT 1BRBE 3ZVAA 1AD8H 5DJ7A 5CE1A 1Z7KA 2I6QA 1UTKA 1KTTB 3VXFH 2WPIS 4XBBA 3M7QA 3TK6A 3ZZ4A 1HBTH 4RKJB 4KGAA 2ZQ2A 3E0PB 4TYDA 4BAHB 3VB5A 5J4QA 3SV8A 4A1TA 1F5LA 3RC5A 4KTUA 1AIXH 1DUAA 4F4OC 7LPRA 3A88A 1HAIH 1TPPA 4CHAB 2EI7A 1O3FA 1EJMA 2ZO3H 1ZGIA 2CHAC 3L6PA 4ABFA 3PLBA 3KHVA 1C4Y2 2FM2A 1SFQB 2ZFPH 2Z9LA 3OX7U 3BV9B 1MTVA 1FAXA 3M3VA 1EOJA 1B0FA 1HAYB 2G5VA 3QN7A 3D65E 3UTUH 1O3EA 2A7HA 3K2UA 4WMDA 4ZUHA 4TWWA 1INCA 4WWYA 1EZQA 1ANCA 5DP7A 1O0DH 3MU5A 3RXVA 1K9OE 2FMJA 1GBEA 3LH1A 1QFKH 2JH5D 3ODDA 1QIXB 1SGTA 1EPTB 1GBLA 2STAE 1UK2A 2O8MA 2V3OH 4ZAEA 5A8XA 2WUCA 2Y5HA 1C4U2 4K1EA 3M5NA 1ZSJA 1LVMA 3U98H 1SBWA 2BX3A 1QRZA 1CHOG 4JK5A 3GCTG 1H9LB 2PW8H 3RC4A 1G32B 1NRSH 1EP5A 2BD7A 4CRBA 2PTNA 3CS0A 3CP7A 5TCAA 2OC1A 3UPEA 1MD7A 1FIZA 5GDSH 1OXGA 1TGSZ 1GHAF 1D6WA 3MNXA 1E35B 1G30B 5DO4H 2BDBA 1Z8GA 4NSYA 1QA0A 2Y82A 1PJPA 1MUEB 4U30A 3KL6A 3TK9A 4OS2A 1Z6JH 4CRCA 1MD8A 2HGTH 1CBWC 1O2KA 1O3KA 1P05A 4Y6DA 4O9VA 1O5FH 2VVCA 3QGNB 1TOMH 1XX9A 1HYLA 2FOEA 3CS7A 2C90B 1JBUH 5HXFA 2AGIX 2C8ZB 3TNSA 5JB9S 1QTFA 1THPB 2VIWA 1P06A 1C1OA 1GGDB 1O39A 3P17H 2BDIA 3HKIB 1EX3A 2WV4A 1SHYA 5LH8A 1FN8A 2A4GA 2ILNA 4YT7H 1FNIA 1RS0A 4X8SH 3LGUA 2XBVA 3U69H 2AERH 3LGWA 4AGJA 1CA8B 2ZCKP 4SGBE 1QR3E 4NZLA 3A7XA 4BOHA 3P70B 3SHCH 1OSSA 1FY5A 4X1SU 3UR9A 3O8BA 2TIOA 4QT8C 4WJG2 2PHBA 3PMJA 5DP3A 3Q3KA 5CHAC 4Z6AH 4IMQA 1V2JT 4ISLA 1A5HA 1WYKA 1ESBA 1CT2E 2GMTC 2QN5T 3K65B 2BYAX 5T6FA 1C2KA 1UTLM 1QB9A 1CE5A 1NS3A 1YYY1 1DSTA 3TH3H 3TK5A 4MQAA 3EE0B 4NCYA 2YOLA 3DD2H 2FOBA 1SQAA 2ZNKH 2B9LA 4KTCA 4MNWA 2SGEE 2WPKS 2RDLA 1FY8E 3BTWE 1UVSH 2SNVA 3RXHA 1PYTC 1MAXA 3IG6B 3ZVGA 1V2KT 1BRAA 3R0FA 1HLTH 1WUNH 1G2LA 3QDZB 2EA3A 2JH0D 3AW1A 2FODA 1RTFB 1GHBG 1LDTT 2TGDA 3SNCA 1V3XA 4MG3A 1GMCF 3RXLA 3QUMP 1EQ9A 1LKAA 3ZV9A 4HFPB 1G3BA 1C5PA 2A2XH 3N7OA 4OS1A 1NROH 1D3PB 1AO5A 1AHTH 3MU0A 1O36A 5A8ZA 1O3MA 3U1JB 5GJ4B 3D49H 1UVTH 2F3CE 1OP8A 1TBQH 3SQHE 1GL0E 2XRCA 2ZU4A 1WTHD 1OPHB 1ETSH 4B1TA 2BX4A 1O2WA 1GPZA 1D9IA 2PTCE
chains in the Genus database with same CATH superfamily
3TVJB 1F92A 5GNDA 1QQ4A 1CGJE 5A0BA 2DUCA 2HALA 1GMHG 1QL7A 1VITH 1SGIB 1SC8U 1OWHA 1O2QA 1SKYE 1V2ST 1YPMH 1ZPZA 2ZU1A 2YNAA 1VITG 4H6SB 2XWBI 2C93B 1TGTA 2CF9H 2VWLA 2R3UA 4FVDA 1EJAA 3VXEH 1TB6H 1EB2A 3RXBA 1Y5AT 1F2SE 1ARCA 3MU4A 2Q6GA 2HRVA 1RGQA 4K3JA 3EYDA 4YXWD 2A7JA 1K1NA 1IQFA 2BXTH 5T6GA 1W3CA 5HM2A 2FOGA 2HNTE 1O2HA 1PQAA 4FUHA 2LELA 4Q7ZA 1MKXK 1SQOA 4H6TA 6LPRA 4M9FA 1XMNB 2WINI 4AN7A 1UMAH 1BJUA 1PPCE 3OTJE 1Y3UA 1ANBA 3BEUA 1LTOA 2ANMH 4Z1MD 4X6NA 4U32A 4WY3A 3UNSA 2Y7ZA 4DOQA 1AN1E 1KLTA 1MTNB 1P2OA 1F0TA 1S6FA 4YESB 2ZFRH 3F1SB 2BQWB 1CHGA 2QF0A 4X0WU 4BAMB 4FXGH 4F49A 3F9GA 2SGFE 2Z3DA 3BTGE 2SGDE 2PLXA 3RXFA 5E0JA 1C5XB 5DG6A 1KYNA 4J1YA 3KQEA 3SUDA 1GJ4H 2ZEBA 3UNRA 1O34A 1GBFA 1QL9A 3AK5A 1AGJA 2XYAA 2HNTC 1JMOH 1O2UA 1XKBC 1EFRD 1CGIE 2PGBB 1EB1H 3SJIA 1V2RT 2VB0A 1A61H 1P03A 2ZGHA 3SU6A 3A86A 2A4RA 3SJKA 3AW0A 1EATA 3H7TA 1Y3YA 3GY7A 3QO6A 2Y6TA 3RLYH 4PROA 1HB0B 1O2PA 4D9QA 3RDZA 4A5TS 4UFGH 3E1XB 1O2GH 3LGVA 1HIAB 5FCRA 1AUJA 4ISHH 3BEIB 2JETB 1UTOA 1TA2A 2FS8A 4NA9H 3PWBA 1UCYH 3NRLA 1KXCA 1UW7A 3PV5A 3PYHA 4X8VH 1A3BH 3SW2B 2ZHFH 1WTGH 2H9EH 1UCYE 3GCHC 4JCNA 2A5IA 3SN8A 4D7FA 4IBLH 2D26C 4NWKA 3V12A 4RN6A 1GI9B 4KELA 1L0ZA 5EQRA 1GHAG 4BXWA 1XM1A 2BY9X 4CBNA 3GY5A 2ALPA 1MAYA 4UFFH 2AMQA 4BAOB 3EDXB 4NGAH 2KFWA 4I8KA 4ASHA 1H8IH 2ZWLH 1RIWB 1O3PB 3VGCB 3A7TA 3FOAA 4XD7D 3V3MA 3GYLB 3U9AH 1GG6C 2GT7A 4GLYA 1TNHA 1YPLH 1BTZA 4I31A 3NUMA 2VWMA 1QL8A 1C2HA 3KQBA 4OS7A 1RTLA 1T8LA 1QB6A 2UUYA 2RG3A 4I32A 3RMLH 1EPTA 3P95A 4X6PA 5KECA 4BANB 1NPMA 3RXTA 3SNDA 3EQ0H 1BTUA 1GMDF 2W5EA 5TJXA 4DIIH 1SLWB 4YOJA 4MVNA 1DICA 5EXMA 1N1LA 1IQLA 1ARBA 2EI6A 1QY6A 2PKSB 1RRKA 3PM3A 5CMXH 2GT8A 4R8TB 3STIA 4X1PU 1SB1H 2HWLB 1GJDB 1FIWA 1T4VH 1PYTD 3MFJA 3WWBA 4ZKOU 4MNXA 1ZMLA 2ZHEH 3M5LA 3P92A 3PROA 4DG4A 1ESTA 3I78A 3LKWA 4AORA 3C1KA 1GBKA 4AG1A 1DY8A 3I29A 3SJ8A 4TPIZ 3H7OA 3WWFA 5B6OA 1ANDA 4AB9A 2EI8A 2FPZA 1GHWH 4GHQA 1F7ZA 1OWJA 2M5TA 3URDA 2C4FH 1DUEA 3NCLA 1K1LA 1NO9H 1TLDA 3UNQA 3QTVH 1B0EA 1AVWA 2OXSA 1OWKA 4Z0KA 3EA9A 1UHBB 1A1RA 2OP9A 4Y0YE 2CHAB 5FBIA 2PKAA 3GY6A 1C4V2 1ANEA 3OY5U 3SO3A 1HAHH 3OSYA 1ZZZA 3KNXA 2BDGA 3KQDA 2YMSD 2FI3E 3RMOH 4K1SA 3ZZ6A 2GJGA 2TPIZ 1W11U 1QJ1B 4B76A 1PFXC 4HTCH 1KXFA 1ZSLA 1BTPA 2GCTB 1OWIA 1KLIH 4NIVA 2IN2A 1GL1A 1GMCG 1L1JA 2QCYA 1TOCB 1BTHH 3F0PA 1CT0E 4D7GA 2KAIB 1A46H 4VGCC 4JMYA 4B2BA 2VIPA 2O8TA 1C5MD 1GI4A 1KSNA 4FUJA 4A1VA 1P2QA 1MABB 2FWWA 4ASUD 5C5OA 2GZ7A 1KXBA 1ZSKA 5JYIA 1NRQH 1BJVA 5C0TA 1F0UA 2V0BA 2K1QA 1ZTLA 1A0HB 3TIUA 1BTXA 1G3CA 1MKXH 2WYGA 1VGCC 2K0QA 4NZQA 3URCA 2LNCA 3P6ZB 1PPHE 4KTSA 1YPGH 3T26A 1V2QT 2AIPA 2ASUB 1OHHD 1SQTA 2BXUH 5C67A 1GVKB 2G00A 4BAKB 1HJAC 4X1RU 4D9RA 1HXFH 1WOFA 1UK3A 3OFND 5F8TA 1O5EH 1ID5H 1K1IA 1O2XA 1T31A 1BCUH 3RU4D 4IC5A 1GBHA 4B2CA 3P8FA 1MCTA 2BY8X 4HZHA 1ZLRA 1GJBB 3LU9B 3UWIA 1PPEE 3BG4C 3MH5A 3ZVFA 2P3FH 1O5BB 1O2LA 2PFEA 3A7VA 3E91A 1O37A 3E16B 1VCWA 1VCQA 1HAZB 2NWNA 4AFSA 1CBWB 1DOJA 1HAXB 1QHRB 2D1JA 2XNDD 3LIWA 1TALA 3D23A 1QZ8A 4NFFA 4HI3A 2QXIA 5C1XA 5ESTE 1YF4A 2WV5A 1J9CH 5DPAA 3K9XB 4AZ2B 3CNRA 4IMZA 2H9TH 1RTKA 4ISOA 3ENSB 5F8ZA 5JBCS 2V7QD 1C2JA 6CHAC 3O8DA 1KY9A 1ZYOA 3FP8E 4ABGA 4XRNA 2OC0A 1SGFA 4F55A 2FLRH 3GISB 3BEFB 3EE7A 1CO7E 2BMGB 3BTFE 1C2GA 3BN9A 2ZDAH 3GICB 3SGAE 1HV7A 3SUFA 4DY7B 1KXEA 2TGTA 1EJNA 2P3UB 4A1XA 2OLGA 4CRDA 1ELBA 1W8BH 2P8OC 1J14A 1WCZA 1ETRH 1H8DH 3MH7A 3T28A 4D8NA 3F6UH 1O5GH 5EJLA 1SPJA 1YPJH 3BSQA 2GTBA 1DDJA 1O3OA 1T8MA 3E3TA 2FZZA 2ZHWH 3MU1A 4AFZA 4BAQB 2GVFA 4MPVA 5CHAB 3U28C 2XW9A 1O5DH 1ZHPA 2HLDD 3SV2H 2GMTB 3F2FA 1GVLA 1O2RA 5A09A 5T6DA 1BUIA 5E2OA 1P11E 4WH8A 2FP7B 2FLBH 3ZZ8A 3NKKA 5LPFA 5H4IB 1GHVH 1OYTH 4ISIH 2GCHF 5AHGH 2OUAA 3GY2A 2K8IA 1A0JA 1W7GH 5EODA 1UVOA 4X2WA 1C1WH 1ZMNA 3A7ZA 3TJVA 2ZHDA 2GX4A 1N6YA 5FX6A 3GY8A 4DIHH 2VWNA 1EXFA 1AE5A 2FI4E 4AOQA 1SLUB 1COWD 3PLPA 3VG8A 2PWXA 1C5QA 2VVVA 1TMUH 4I8LA 5HM9A 5K0HA 2GDDA 1K1PA 2FEQH 3ATKA 1ELEE 5F53A 1QBVH 4AYYB 4KP0A 1TNGA 6GCHF 2BD5A 2FTMA 1DWEH 1OP0A 2BVXH 3GOVB 3T27A 5FCKA 3SZNA 1TQ0B 4CRGA 5A2MH 1QJ6B 2VH6A 5IYTA 1GJAB 1DLKB 3A87A 2BB4A 1MBMA 1BTWA 3VB6A 4UFDH 4Y79A 1DITH 2EQNA 1HCGA 3OYPA 1NN6A 3V13A 5L2ZH 2B0FA 3RXUA 4FETA 1OOKB 1AKSB 1SFIA 1ELGA 2RFKC 2PSYA 1IHTH 1RJXB 1SGRE 1W0JD 4MPXA 5LPEA 1C5WB 4AYVB 1LO6A 2VNTA 4BXSA 3MTYA 4LZ1H 1S82A 5DN6D 1O3NA 4CH8B 9LPRA 3D62A 5JBTA 4FUFA 1IQMA 1Q2WA 1O31A 2ZZUH 1CA0C 2XBWA 4H4FA 4NA8A 3HK3B 4GCHG 3PRDA 1OP2A 4WH6A 1PQ8A 3VEQB 2CGAA 3A8BA 3F9FA 3U8OH 3TITA 3STJA 1L4DA 1GMDG 3S7KB 1DSUA 3BG8A 1YBWA 3QX5H 1YM0A 1RFNA 2BVSH 4MTBA 3L33A 1XUJA 3AAVA 1AY6H 2BLWA 3ZZCA 3MWIU 1VKYA 1GJ7B 4JYVH 2F4LA 3M36A 2BD3A 7ESTE 1L1GA 1D3TB 1BMAA 1NC6A 2R0LA 1NU7B 3M35A 1P09A 1A7SA 5FPYA 3RP2A 1GCTB 1TRYA 2XCFA 2F9UA 1C5UA 4FVBA 2IJD1 3M7TA 1O2MA 2VIVA 8LPRA 2KCOA 4O3UA 2P94A 1AZZA 3LT3A 1Y5BT 2PGQB 4SGAE 5EXNA 1C2FA 1DFPA 1Z6EA 5JB8S 1XVMA 1ZR0A 2WYJA 1BT7A 1C9TA 1YLDA 2Z9JA 4NWLA 4INHA 2F9BH 2UUKB 1KDQA 3EA8A 3NPSA 1YCPK 1JRTA 1MKWK 1SR5C 1SLVB 4IS5A 1Y3VA 1A2CH 2ZU2A 3KQ5A 1O3IA 2ZDVH 3L3TA 2AH4X 3M37A 2J9NA 1GBDA 2YMSC 3KIDU 5C17A 2ZECA 3QGJA 1AVXA 3FFGA 1TFXA 3RU4E 4FUCA 2W6ID 1DT2A 3A84A 1BMNH 4IW4E 2BZAA 2QY0B 3RUOA 5FPTA 3RXOA 2NU4E 5HIYA 3C27B 1J16A 3K6ZA 2VIDA 3SU1A 3M3TA 1OWDA 1ELDE 3MH6A 3MU8A 5GCHG 3TU7H 1PPGE 1HAPH 5AVDA 1GBCA 1UVUH 1AFQC 2FDAA 1ELVA 2H5DA 1SI5H 1Y8TA 1YPHE 1PPFE 4JZEH 3PV2A 3MO6A 1O32A 4X1QU 3NXPA 2ODPA 3BTEE 1Z1JA 3GCHB 2BDHA 2F9VA 1HRTH 3LJJA 3O8CA 1ETTH 1SGDE 1GDUA 1BA8B 5CDFE 5E8EH 3MI4A 3OU0A 2IPHA 1YPEH 5EOKA 1A3EH 4Q4LA 5AFZH 2G4UA 1IQEA 1T8OA 2KR7A 5C3NA 1UHBA 3ZVDA 1TX7A 2OTVA 2CF8H 3DUXH 1H9IE 2AGGX 1NRPH 1O3LA 2AMDA 3QWCH 4ABJA 2CJIA 3QK1A 2Y7XA 1NFUA 1DVAH 1QRWA 1HGTH 1YLCA 1FMGA 1KIGH 5I25A 2A1DB 1JOUB 1FJSA 3TGJE 1GI8B 1W7XH 4AX9H 1C2LA 1WV7H 4JYUH 1GG6B 1HAVA 3Q00A 3UREA 1NM6A 3QZRA 3RXRA 4ISNA 2G8TA 3LC3A 1GCDA 3SI4H 1ABJH 1YPHC 1QURH 3F2HA 4O3TA 1P9SA 5L2YH 5C5NA 5EW2H 1AVGH 2BDYA 1OWEA 3OE7D 1GWAA 4TPYA 7KMEH 2ESTE 3GY4A 1IQJA 2NU1E 1K1OA 1AWFH 1XXDA 1XUFA 2FOAA 1TNLA 5GIBA 1U6QA 2Y5GA 5FL7D 1ZGVA 1ZTKA 4Q7XA 1FY3A 2Q1JA 3ITIA 1F0SA 2C8YB 1C2IA 3ATLA 2Z7FE 1P9UA 2P3TB 4ABBA 1G9IE 1D3DB 1IQNA 2A5KA 3GYMA 1TIOA 4JZFH 1C2EA 3HK6B 3SHAH 4OGXA 4D76A 1SGEE 3KYGA 1C1MA 1V2WT 1ESAA 2FOHA 4JZDH 1GBAA 2AMPA 1FY1A 4X6MA 4GPGA 1C1QA 2ZFFH 5J4SA 4CH2B 3SGBE 2GCHG 2WSSD 1CHOF 2FXRA 2G52A 2Z94A 2LPRA 2ZGCA 1H1BA 1C1NA 1UTNA 1TRMA 2SGPE 4Q2KA 2G55A 4FUGA 1C5NH 4ABIA 1EUFA 1CU1A 1P3EA 4J2YB 3UB0A 8ESTE 1O2JA 1GI0A 1EOLA 5C94A 1LHEH 3A83A 1KXDA 1AE8H 1THSH 3A7YA 1SVPA 1ZPCA 3PTBA 1K21H 1SL3A 3W94A 1EZSC 1W0ZU 2WPDD 5DP5A 1C5OH 3SJOA 3RM2H 8GCHF 1CSOE 2VGCC 4DW2U 4ABAA 4VGCB 2B8OH 3A8AA 3MOCA 3T29A 3LONA 1T8NA 4RT1A 4LOYH 3UY9A 2J4IA 4B6FA 1QRXA 1SGQE 1WU1A 6GCHG 4MPWA 1O5AB 1OKXA 2XCNA 4YOGA 2R2MB 4TSFD 3MNCA 3TJNA 3DFLA 1C5TA 9ESTA 4ABEA 1TNKA 1BBRK 3ATWA 2ZDLA 1IHSH 4OS5A 3AASA 1G3EA 1NFWA 4WF8A 1NFXA 3PTNA 3KYFA 3SV9A 3N99A 4Y11E 1VGCB 1C5ZB 2ULLA 1CQQA 2ZDKA 2ZF0H 1LQDB 4WVPE 5AF9H 1EAIA 4O97A 4YTAA 1UTJA 1O2IA 4X8TH 2BLVA 1HJAB 2VU8E 2ZI2H 4FU8A 1UVPA 1ELAA 1QB1A 3PMHB 4FUEA 1TQ7B 5F03A 3KGPA 5FHTA 1AFEH 1GDQA 1FLEE 2Z9IA 1S83A 2ZGXH 2OBQA 2H1UA 3T62A 3KQCA 1GBIA 3ZVCA 2FX6A 5A0CA 1MTNC 1K0HA 1OYQA 4Q80A 1V2LT 1P04A 1F5RA 4INLA 4ABDA 5C1UA 3BG4B 1O3DA 2ZGJA 1BITA 4XE4A 4LK4A 1ZOMA 4LXBH 1A5IA 2ZPRA 4HG6A 3OY6U 1GJ8B 4I86A 4GUXA 2FIRH 3E0NB 3E8LA 2F9OA 4M7GA 1FAKH 1IQHA 1GJ9B 3SU5A 5JBAS 3DFJA 3SQEE 1HAOH 1W10U 4ZXXH 2QF4A 3DA9B 3QZQA 3ZZ3A 1SGPE 2RA3A 3PMAB 3PWCA 6CHAB 1E0FD 4GHTA 3SORA 1ACBE 3SU0A 2QF5A 4FU7A 2A0QB 1S6HA 3P8NA 4Y8XA 1X7AC 2FO9A 3GY3A 1WDIA 3RXAA 2ANWA 3ZIAD 2CMYA 3RXDA 1ELTA 1G2MA 4DJZB 4I8GA 2FOMB 3M61U 2BY7X 1BOQA 4TWYA 1TGNA 2QV1A 1AI8H 4NIXA 3NZIA 1LPKB 1WQSA 1GI6A 2P8OB 2ZTYA 1GHBF 1UO6A 2ZPQA 3QTOH 5C1YA 2AGEX 2PR3A 1P0SH 4B75A 5DP9A 1P2IA 1BHXB 2ZP0H 4CBOA 2ZIQH 2AIQA 2QXHA 2ZG0H 5E0HA 1DANH 1BMLA 1TGBA 4K69A 3B9FH 2SNWA 3RMMH 2OQUA 4UE7H 3E6PH 3RC6A 1C1SA 2Y5FA 1CGHA 3RXPA 5HYOA 1JXPA 3TGIE 4Y8YA 4XBCA 2THFB 2ZCHP 5A0AE 2UUJB 2VH0A 2C8XB 5AFYH 5L30H 4AFUA 3MYWA 5EGMA 2PSXA 2ZTZA 5LPRA 1WSSH 3PB1E 3ATMA 1F0RA 1YGCH 2VINA 1MQ6A 1W13U 2XC0A 2A45B 1TNJA 5EQSA 1Z8JB 4DGJA 2QC2A 1MMJN 1L2EA 2QE7D 2Z6BD 4FOUC 3SU4A 1TONA 1NRNH 1FPHH 2Q6FA 3VGCC 1GMHF 1ELFA 4GAWA 2OD3B 1GBTA 3CENA 1UJ1A 4ZKSU 1C1PA 3VB4A 3RXJA 1TMTH 3NK8A 1B5GH 2BDAA 1DWCH 1LPZB 1TA6A 1VITF 5DK1A 2F43B 1UK4A 2ZDMA 5KEDA 1CVWH 1TX8A 2W3KA 1O38A 4Y8ZA 3SU2A 4ACBA 1AB9C 2WUBA 5I46H 1C1TA 3ZZDA 1WQVH 3R3GB 4YO9A 3PMBB 4IGDA 1LHDH 3H5CB 1ELCA 1HDTH 5DP8A 4E05H 4NFEA 3ZZ9A 4IN2A 3SU3A 4RKOB 3PV4A 4OS4A 2B5TB 3M7UA 5HIZA 4ZH8A 1SLXB 1C2DA 2CV3A 5GWZA 3BTQE 1T32A 2OBOA 2HNTF 2GZ8A 3ZZAA 2BOHB 2NU2E 3PLKA 2DE8A 4ESTE 3U1IB 5EQQA 3UIRA 3EA7A 1V2MT 3SOSA 5C20A 5G4BA 1BRUP 2A31A 1MTWA 1N8OC 1DX5M 1MCVA 5FX5A 3T25A 2HPQH 3A80A 4X8UH 3BTTE 1NZQH 1P3CA 1V6DA 3F9EA 4IN1A 4E7NA 1GI5A 3F0OA 2RA0A 1CA0B 2F9PA 1E36B 3UAIC 4Y7AA 3BTHE 1ZTJA 1Z1IA 4RSPA 3IITA 4FUBA 4BTUB 2ZC9H 1S5SA 3ZZBA 4XOJA 1IQGA 2ZHQH 5KGOA 2HVXA 3N7EA 1H9HE 5PTPA 2GV7A 2R9PA 1K1JA 2XXLA 1SG8B 2AHME 3A7WA 1ZPBA 3MHWU 3ELAH 4UONA 4I33A 1O2YA 2RDEA 3SI3H 3G01A 4FUDA 1YWUA 1MBQA 2TGPZ 1C5SA 3HGPA 2GCTC 3TGKE 1P2KA 1TWXB 1QBNA 2VWOA 1S85A 1LMWB 2H2ZA 1J15A 1EZXC 3Q77A 1P01A 2ZQ1A 1JWTA 2A2QH 2NU0E 1ZHMA 1C5YB 2TRMA 4DURA 1KTSB 5F6MA 2BVRH 2GKVE 1JRSA 1GI3A 2VVUA 2YNBA 2PUXB 1BBRH 2OC7A 1SGCA 3UFAA 2QYIA 1Y3XA 1KLJH 1D3QB 1HAGE 1T4UH 5DP4A 5BPEA 5GPIB 1FN6A 5K7RA 1BBRE 1O3HA 3Q3XA 1O5CB 2IJOB 3WY8A 4E7RG 5EW1H 4JK6A 1TBRH 3JZ2B 1GJ6A 1O2ZA 1PQ7A 3BTME 1EZUC 2O8LA 4X6OA 1VCPA 3GCOA 2CXVA 4INKA 2OCVB 4ZROA 3A89A 3T5FH 2FOCA 1LKBA 3NWUA 2WHXA 2BY6X 1E1QD 3FP7E 1W0KD 1LQEA 1CT4E 2D8WA 3A8DA 3SZEA 1LVOA 3BIUH 2L74A 2YMSB 4DCDA 4U2WA 2NU3E 1GJ5H 3PO1C 1TAWA 8GCHG 1SOZA 2Y80A 7GCHF 1E37B 1C5LH 2KX4A 5EIYA 1GHZA 4B74A 1O2TA 2W7UA 2PKAB 2FS9A 1RXPA 5ESBA 3JZ1B 1LHCH 4LZ4B 1H8ED 1P2NA 4AG2A 1S0QA 3FAOA 4WMFA 3U8TH 3UWJH 3GCNA 2BDCA 1G37A 1QJ7B 1S0RA 2HOBA 1DWBH 1XKAC 2I6SA 1FV9A 2ODYB 3BTDE 1O30A 1TX6A 3KCGH 3TH2H 4BTIB 1L1NA 5DGJA 2WPHS 1TPOA 3AAUA 3MO9A 8KME2 1AFQB 1HJ9A 4DVAU 1EAUA 4Y0ZE 2VJ1A 1MTUA 2BOKA 3KEEA 1ZHRA 4CHAC 3FKSD 1IOEA 1GBBA 2OQ5A 3K6YA 5HKKD 1NY22 1O2VA 2GDEH 2Z3EA 1UCYK 4WMEA 2R0KA 4O03A 5F8XA 3ZV8A 1C1VH 2IPQX 2QXGA 2QIQA 2FI5E 3IWMA 5DKMA 4I8JA 4GSOA 3O8RA 2PV9B 1DXPA 2AS9A 3VPKA 4UDWH 1O3JA 3EGKH 2ZKSA 4X2XA 3UOPA 1GI7B 3SGQE 2R2WU 1XXFA 2P16A 1LVYA 1HIAA 5FPSA 4CR5A 1IQIA 3F9HA 5SGAE 3ZYEA 4FU9A 3FVFB 1EPTC 4P00A 3TJUA 4XFQA 2W3IA 5JPMH 1BRCE 1H8HD 2XC4A 1Y3WA 2FX4A 4X1NU 1S81A 4FUIA 1FDPA 1TMBH 1B7XB 5IDKA 4CRFA 2GP9B 2BY5X 5ETXA 2J92A 3TPIZ 1K28D 3BIVH 1SGNE 1TNIA 1NFYA 2BLOA 3UOUA 1LCYA 3UQOA 4NSVA 3S69A 2F9NA 1MQ5A 3ESTA 2KCYA 2BHGA 2HPPH 1XUHA 3RXIA 1BB0B 2Z9KA 5ABWA 1KXAA 1N6XA 3SNAA 1NRRH 5DP6A 1LPGB 1SHHB 1M9UA 2Z3CA 2BD9A 4WXIA 4YLUA 1AZ8A 1DPOA 3V7TA 1AWHB 4K2YA 2XBYA 2ZTXA 1OX1A 4AC9A 3F68H 1ZJDA 2G81E 3MMGA 4YM9A 2FYRA 3DSOA 3SBKA 4I7YH 2A7CA 2AYWA 2EEKA 1LHGH 4JZIA 3I77A 4Y71A 2CN0H 3OEED 4BNRA 3S0NA 1VJ9U 5FBEA 2XC5A 4K8YA 1HFDA 4X2YA 3FO8D 3RXSA 1TABE 3RM0H 1G3DA 1A0LA 1BDAA 4MDSA 3LGYA 4Y7BA 3A85A 2J94A 2JKHA 2QF3A 1SMFE 1TRNA 1K1MA 1P10A 1MZDA 2EY4C 5C0UA 3QLPH 3B8JA 1XUGA 1GGDC 2VIOA 1EKBB 1W12U 2VIQA 4K1TA 2G4TA 3Q76A 2GZ9A 2DE9A 1GI1A 2BD8A 4AGKA 3GDSA 3RXQA 4E06H 4ZKRU 1V2OT 2J95A 1QBOA 1TGCA 4JYTA 2UWLA 5EJZA 1K22H 2OK5A 1C1UH 3RMNH 1ABIH 3UR6A 2IOTA 2VBCA 4NA7A 5EU8A 2SGQE 1DS2E 3ZVBA 4B2AA 2EC9H 2VGCB 3ZVEA 3HGNA 2ZU5A 1P57B 1HXEH 1W14U 1O2OA 3W95A 1YCPM 1BHXF 2A4QA 2AEIH 3U8RH 1SGFG 1V2UT 4ZXYH 1Y5UT 1ORFA 2M2AA 5FXLA 1QCPA 3BF6H 3VB3A 3OTPA 3M5OA 1LVBA 1QA7A 2OINA 4MLFB 1O35A 4HGCA 1Z8IB 2BD2A 3SNEA 2F83A 1QNJA 3WW7A 2B7DH 1AMHA 2KAIA 4UEHH 3RU4T 1GCTC 2PUQH 1SGYE 3LH3A 3N7DA 3P8OA 2SFAA 1E34B 3LOXA 2W7SA 2ZFSA 3UQVA 4GVUA 3AVZA 1GI2A 3ODFA 3SV7A 1SQRA 3M3SA 4IC6A 4AFQA 2P95A 4XDEA 3OEHD 2QAAA 1F5KU 1XUKA 3Q3YA 4K8BA 4MNVA 1DLEA 1LHFH 1MTSA 1EP6A 3LGTA 2GGVB 3S9AA 3GDVA 1FONA 2BM2A 2G51A 3ZYDA 1O2SA 3A8CA 3TLOA 2J98B 2W26A 2BD4A 1BZXE 4UFEH 1C5RA 1FQ3A 2V3HH 3LDXH 1V2NT 4ZHAA 3HKJB 4Y76A 2SGAA 4Q7YA 1YPKH 1FI8A 2QA9E 1TE0A 5HMAA 1O3GA 2ZGBH 4H42U 2J2UA 2Z9GA 1THRH 1JIRA 1PQ5A 4MNYA 5T3HA 3RXEA 1AU8A 2J38A 1TPAE 1A4WH 2ANKH 2BQ7B 3FP6E 3SNBA 2FOFA 5GXPA 1XUIA 3GCTF 1W0YH 2OC8A 2O9QA 3RXGA 1L4ZA 2G5NA 5EPYA 2J97A 5DSFA 1VZQH 6ESTA 1G36A 1BTYA 2H6MA 4XSKU 4TY6A 3ZZ7A 1O3BA 4CR9A 3RLWH 1BIOA 1DM4B 2HLCA 1YKTA 2FYQA 1O33A 1SSXA 4OM9A 2H5CA 1WAYB 1O3AA 1DY9A 4DT7B 1D4PB 1OS8A 3SJ9A 2V35A 2Y81A 2ZCLP 1NESE 3A82A 1ZMJA 1XVOA 1GJCB 1YP9A 1C2MA 3OAAD 2GV6A 2R3YA 2WPLS 1C9PA 3VFEA 3LJOA 4WXVA 1MU6B 4NG9H 1HUTH 4B71A 7GCHG 3S7HB 1KMHB 2C3SA 3TJOA 1E38B 2JDID 3LPRA 4KKDA 2HVYB 1BQYA 5BRRE 1KDQB 2AFQB 5HGGA 1GHXH 1O2NA 2A4OA 5CHBA 1IQKA 2J34A 1E79D 4UD9H 4ACAA 2TGAA 4YT6H 2P59A 4ZHMU 1GBMA 2F91A 1GVZA 4R0IA 2STBE 2FTLE 4U01A 2ZDNA 3GS9A 5A8YA 2C8WB 4ZMAH 1K2I1 1FY4A 2JJ1D 4GCHF 1YCPH 1MKWH 5LGOA 4YOIA 5E0GA 2V3MA 5JDUB 3LC5A 1AB9B 2ANYA 1MU8B 1AQ7A 1WXRA 1ZJKA 2O8UA 5EXLA 1D6RA 4NIWA 1NBMD 1S84A 2ZPSA 3F2GA 1FPCH 1GDNA 2V6NA 1VJAU 3HATH 1DWDH 3B23B 3EAJA 3RXCA 1S6LA 4CREA 1C5VA 3P8GA 2ZFTA 5L6NH 4A6LA 4RI0A 3SUEA 4I8HA 1C1RA 1SOTA 2ALVA 3S9CA 2UUFB 1N8OB 1TBZH 3T2NA 4RT0A 3UUZA 4XBDA 1YC0A 1EAWA 1P2MA 1V2TT 3A81A 4AB8A 2P93A 1P8VC 3HPTB 3MNSA 4YZUA 1VR1H 3MH4A 2LP6A 1Z71A 4K5ZA 4OS6A 2TBSA 2RCEA 1EAXA 5FAHA 4JZ1A 2BLQA 1TPSA 2D2DA 2QGRA 1Q31A 2O8WA 4NIYA 2JETC 1IAUA 3BTKE 1HPGA 1AKSA 1Q3XA 2UWPA 4THNH 4ZKNU 1UTQA 1AUTC 2XTTB 1A5GH 1H4WA 4A92A 3DCLA 1UTMA 2WPMS 2ZFQH 2KCAA 1J17T 1NU9A 1WBGB 2ODQA 4ABHA 1HNEE 5JBBS 2WPJS 1Y59T 1TYNA 3RXKA 1HAVB 3ATIA 1P02A 1T7CA 1PPZA 1QQUA 3SV6A 2UWOA 4BTTB 4B73A 3TH4H 3VB7A 5IK2D 3MQKC 1PPBH 5C2ZA 5TCCA 4OGYA 3SUGA 3RXMA 4CRAA 3S9BA 1GHYH 4Y10E 1ZRKA 1BMMH 4F48B 1DXWA 1V2VT 3MNBA 1ZRBA 1P12E 3ZZ5A 2H9HA 2A5AA 3MO3A 2BZ6H 3M5MA 1RIWC 3KN2A 3KF2A 1W2KH 1E1RD 2QXJA 2A32A 1FZZA 3FANA 5EPNA 3V0XA 2ZA5A 4YLQH 2JH6D 5GCHF 1Z8RA 3TNTA 1UTPA 3DHKH 1O3CA 4TY7A 2BQ6B 4K60A 1BMFD 2XWAA 1P2JA 2FESH 3LGIA 1HJ8A 1FXYA 3W1EA 2Q6DA 1RD3B 4MPUA 1J8AA 5EG4A 3E90B 5E2PA 4X2VA 1GBJA 1MH0A 1MZAA 1QGFA 3FZDA 1YY3A 2WV9A 2BTCE 2ZU3A 1FUJA 3DT0H 2KZ4A 3PO1B 1JIMA 2XBXA 3GDUA 1DE7H 2XNIA 1NTPA 4ZHLU 4A7IB 1EASA 2PKSC 1NT1A 2GD4B 3FZZA 1V2PT 1BRBE 3ZVAA 1AD8H 5DJ7A 5CE1A 1Z7KA 2I6QA 1UTKA 2JJ2D 1KTTB 3VXFH 2WPIS 4XBBA 3M7QA 3TK6A 3ZZ4A 1HBTH 4RKJB 4KGAA 2ZQ2A 3E0PB 4TYDA 4BAHB 3VB5A 4B6EA 5J4QA 3SV8A 4A1TA 1F5LA 3RC5A 4KTUA 1AIXH 1DUAA 4F4OC 7LPRA 3A88A 1HAIH 1TPPA 4CHAB 2EI7A 1O3FA 2WZQA 1EJMA 2ZO3H 1ZGIA 2CHAC 3L6PA 4ABFA 3PLBA 3KHVA 1C4Y2 2FM2A 1SFQB 2ZFPH 2Z9LA 3OX7U 3BV9B 1MTVA 1FAXA 3M3VA 1EOJA 1B0FA 1HAYB 2G5VA 3QN7A 3D65E 3UTUH 1O3EA 2A7HA 3K2UA 4WMDA 4ZUHA 4TWWA 1INCA 4WWYA 1EZQA 1ANCA 5DP7A 1O0DH 5T1VA 3MU5A 3RXVA 1K9OE 2FMJA 1GBEA 3LH1A 1QFKH 2JH5D 3ODDA 1QIXB 1YLNA 1SGTA 1EPTB 1GBLA 2STAE 1UK2A 2O8MA 2V3OH 4ZAEA 5A8XA 2WUCA 4TT3D 2Y5HA 1C4U2 4K1EA 3M5NA 1ZSJA 1LVMA 3U98H 3DSPA 1SBWA 2BX3A 1QRZA 1CHOG 4JK5A 3GCTG 1H9LB 2PW8H 3RC4A 1G32B 1NRSH 1EP5A 4Q63A 2BD7A 4CRBA 2PTNA 3CS0A 2XOKD 3CP7A 5TCAA 2OC1A 3UPEA 1MD7A 1FIZA 5GDSH 1OXGA 1TGSZ 1GHAF 2JIZD 5B6LA 1D6WA 4P02A 3MNXA 1E35B 1G30B 5DO4H 2BDBA 1Z8GA 4NSYA 1QA0A 2Y82A 1PJPA 1MUEB 4U30A 3KL6A 3TK9A 4OS2A 1Z6JH 4CRCA 1MD8A 2HGTH 1CBWC 1O2KA 1O3KA 2L6OA 2J5UA 1P05A 4Y6DA 4O9VA 1O5FH 2VVCA 3QGNB 1NBME 1TOMH 1XX9A 1HYLA 2FOEA 3CS7A 2C90B 1JBUH 5HXFA 2AGIX 2C8ZB 3TNSA 5JB9S 1QTFA 1THPB 2VIWA 1P06A 1C1OA 2KM0A 1GGDB 3DSGA 1O39A 3P17H 4DT4A 2BDIA 3HKIB 1EX3A 2WV4A 1SHYA 4ZCNA 5LH8A 2J98A 1FN8A 2A4GA 2ILNA 4YT7H 1FNIA 1RS0A 4X8SH 3LGUA 2XBVA 3U69H 2AERH 3LGWA 4AGJA 1CA8B 2ZCKP 4SGBE 1QR3E 4NZLA 3A7XA 4BOHA 3P70B 3SHCH 1OSSA 1FY5A 4X1SU 3UR9A 3O8BA 2TIOA 3PRBA 4QT8C 4WJG2 2PHBA 3PMJA 5DP3A 2KCPA 3Q3KA 5CHAC 4Z6AH 4IMQA 1V2JT 4ISLA 1A5HA 1WYKA 1ESBA 1CT2E 2GMTC 2QN5T 3K65B 2BYAX 5T6FA 1C2KA 1UTLM 1QB9A 1CE5A 1NS3A 1YYY1 1DSTA 3TH3H 3TK5A 4MQAA 3EE0B 4NCYA 2W6JD 2YOLA 3DD2H 2FOBA 1SQAA 2ZNKH 3FN8A 3SYJA 2B9LA 4KTCA 4MNWA 2SGEE 2WPKS 2RDLA 1FY8E 3BTWE 1UVSH 2SNVA 3RXHA 1PYTC 1MAXA 3IG6B 3ZVGA 1V2KT 1BRAA 3H09A 1HLTH 3R0FA 1WUNH 1G2LA 2PP6A 3QDZB 2EA3A 2JH0D 3AW1A 2FODA 1RTFB 1GHBG 1LDTT 2TGDA 3SNCA 1V3XA 4MG3A 1GMCF 2CK3D 3RXLA 3QUMP 1EQ9A 1LKAA 3ZV9A 4HFPB 1G3BA 1C5PA 2A2XH 3N7OA 4OS1A 1NROH 1D3PB 1AO5A 1AHTH 3MU0A 1O36A 5A8ZA 1O3MA 3U1JB 3F3BA 5GJ4B 3D49H 1FX0B 1UVTH 2F3CE 1OP8A 1TBQH 3SQHE 1GL0E 2XRCA 2ZU4A 1WTHD 5EJ1A 1OPHB 1ETSH 4B1TA 2BX4A 1O2WA 1GPZA 1D9IA 2PTCE
chains in the Genus database with same CATH topology
3TVJB 1F92A 1QQ4A 1CGJE 5A0BA 2DUCA 2HALA 1GMHG 1QL7A 1VITH 1SGIB 1SC8U 1OWHA 1O2QA 1V2ST 1YPMH 1ZPZA 2ZU1A 2YNAA 1VITG 4H6SB 2XWBI 2C93B 1TGTA 2CF9H 2VWLA 2R3UA 4FVDA 1EJAA 3VXEH 1TB6H 1EB2A 3RXBA 1Y5AT 1F2SE 1ARCA 3MU4A 2Q6GA 2HRVA 1RGQA 4K3JA 3EYDA 2A7JA 1K1NA 1IQFA 2BXTH 5T6GA 1W3CA 5HM2A 2FOGA 2HNTE 1O2HA 1PQAA 4FUHA 4Q7ZA 1MKXK 1SQOA 4H6TA 6LPRA 1XMNB 2WINI 4AN7A 1UMAH 1BJUA 1PPCE 3OTJE 1Y3UA 1ANBA 3BEUA 1LTOA 2ANMH 4X6NA 4U32A 4WY3A 3UNSA 2Y7ZA 4DOQA 1AN1E 1KLTA 1MTNB 1P2OA 1F0TA 1S6FA 4YESB 2ZFRH 3F1SB 2BQWB 1CHGA 2QF0A 4X0WU 4BAMB 4FXGH 4F49A 3F9GA 2SGFE 2Z3DA 3BTGE 2SGDE 2PLXA 3RXFA 5E0JA 1C5XB 5DG6A 1KYNA 4J1YA 3KQEA 3SUDA 1GJ4H 2ZEBA 3UNRA 1O34A 1GBFA 1QL9A 1AGJA 2XYAA 2HNTC 1JMOH 1O2UA 1XKBC 2PGBB 1CGIE 1EB1H 3SJIA 1V2RT 2VB0A 1A61H 1P03A 2ZGHA 3SU6A 3A86A 2A4RA 3SJKA 3AW0A 1EATA 3H7TA 1Y3YA 3GY7A 3QO6A 2Y6TA 3RLYH 4PROA 1HB0B 1O2PA 4D9QA 3RDZA 4A5TS 4UFGH 3E1XB 1O2GH 3LGVA 1HIAB 5FCRA 1AUJA 4ISHH 3BEIB 2JETB 1UTOA 1TA2A 2FS8A 4NA9H 3PWBA 1UCYH 1KXCA 3PYHA 4X8VH 1A3BH 3SW2B 2ZHFH 1WTGH 2H9EH 1UCYE 3GCHC 4JCNA 2A5IA 3SN8A 4D7FA 4IBLH 2D26C 4NWKA 3V12A 4RN6A 1GI9B 4KELA 1L0ZA 5EQRA 1GHAG 4BXWA 1XM1A 2BY9X 4CBNA 3GY5A 2ALPA 1MAYA 4UFFH 2AMQA 4BAOB 3EDXB 4NGAH 4I8KA 4ASHA 1H8IH 2ZWLH 1RIWB 1O3PB 3VGCB 3A7TA 3V3MA 3GYLB 3U9AH 1GG6C 2GT7A 4GLYA 1TNHA 1YPLH 1BTZA 4I31A 3NUMA 2VWMA 1QL8A 1C2HA 3KQBA 4OS7A 1RTLA 1T8LA 1QB6A 2UUYA 2RG3A 4I32A 3RMLH 1EPTA 3P95A 4X6PA 4BANB 1NPMA 3RXTA 3SNDA 3EQ0H 1BTUA 1GMDF 2W5EA 5TJXA 4DIIH 1SLWB 4YOJA 4MVNA 1DICA 5EXMA 1N1LA 1IQLA 1ARBA 2EI6A 1QY6A 2PKSB 1RRKA 3PM3A 5CMXH 2GT8A 4R8TB 3STIA 4X1PU 1SB1H 2HWLB 1GJDB 1FIWA 1T4VH 1PYTD 3MFJA 4ZKOU 4MNXA 1ZMLA 2ZHEH 3M5LA 3P92A 3PROA 4DG4A 1ESTA 3I78A 3LKWA 4AORA 3C1KA 1GBKA 4AG1A 1DY8A 3I29A 3SJ8A 4TPIZ 3H7OA 5B6OA 1ANDA 4AB9A 2EI8A 2FPZA 1GHWH 4GHQA 1F7ZA 1OWJA 2M5TA 3URDA 2C4FH 1DUEA 3NCLA 1K1LA 1NO9H 1TLDA 3UNQA 3QTVH 1B0EA 1AVWA 2OXSA 1OWKA 4Z0KA 3EA9A 1UHBB 1A1RA 2OP9A 4Y0YE 2CHAB 5FBIA 2PKAA 3GY6A 1C4V2 1ANEA 3OY5U 3SO3A 1HAHH 3OSYA 1ZZZA 3KNXA 2BDGA 3KQDA 2FI3E 3RMOH 4K1SA 3ZZ6A 2TPIZ 1W11U 1QJ1B 4B76A 1PFXC 4HTCH 1KXFA 1ZSLA 1BTPA 2GCTB 1OWIA 1KLIH 4NIVA 2IN2A 1GL1A 1GMCG 1L1JA 2QCYA 1TOCB 1BTHH 1CT0E 4D7GA 2KAIB 1A46H 4VGCC 4JMYA 4B2BA 2VIPA 2O8TA 1C5MD 1GI4A 1KSNA 4FUJA 4A1VA 1P2QA 2FWWA 5C5OA 2GZ7A 1KXBA 1ZSKA 5JYIA 1NRQH 1BJVA 1F0UA 2V0BA 2K1QA 1ZTLA 1A0HB 3TIUA 1BTXA 1G3CA 1MKXH 2WYGA 1VGCC 4NZQA 3URCA 2LNCA 3P6ZB 1PPHE 4KTSA 1YPGH 3T26A 1V2QT 2AIPA 2ASUB 1SQTA 2BXUH 5C67A 1GVKB 2G00A 4BAKB 1HJAC 4X1RU 4D9RA 1HXFH 1WOFA 1UK3A 5F8TA 1O5EH 1ID5H 1K1IA 1O2XA 1T31A 1BCUH 3RU4D 4IC5A 1GBHA 4B2CA 3P8FA 1MCTA 2BY8X 4HZHA 1ZLRA 1GJBB 3LU9B 3UWIA 1PPEE 3BG4C 3MH5A 3ZVFA 2P3FH 1O5BB 1O2LA 2PFEA 3A7VA 3E91A 1O37A 3E16B 1VCWA 1VCQA 1HAZB 2NWNA 4AFSA 1CBWB 1DOJA 1HAXB 1QHRB 2D1JA 3LIWA 1TALA 3D23A 4NFFA 4HI3A 2QXIA 5C1XA 5ESTE 1YF4A 2WV5A 1J9CH 5DPAA 3K9XB 4AZ2B 4IMZA 2H9TH 1RTKA 4ISOA 3ENSB 5F8ZA 5JBCS 1C2JA 6CHAC 3O8DA 1KY9A 1ZYOA 3FP8E 4ABGA 2OC0A 1SGFA 2FLRH 3GISB 3BEFB 1CO7E 2BMGB 3BTFE 1C2GA 3BN9A 2ZDAH 3GICB 3SGAE 1HV7A 3SUFA 4DY7B 1KXEA 2TGTA 1EJNA 2P3UB 4A1XA 2OLGA 4CRDA 1ELBA 1W8BH 2P8OC 1J14A 1WCZA 1ETRH 1H8DH 3MH7A 3T28A 4D8NA 3F6UH 1O5GH 1SPJA 1YPJH 3BSQA 2GTBA 1DDJA 1O3OA 1T8MA 3E3TA 2FZZA 2ZHWH 3MU1A 4AFZA 4BAQB 2GVFA 4MPVA 5CHAB 2XW9A 1O5DH 1ZHPA 3SV2H 2GMTB 1GVLA 1O2RA 5A09A 5T6DA 1BUIA 5E2OA 1P11E 4WH8A 2FP7B 2FLBH 3ZZ8A 3NKKA 5LPFA 5H4IB 1GHVH 1OYTH 4ISIH 2GCHF 5AHGH 2OUAA 3GY2A 1A0JA 1W7GH 5EODA 1UVOA 4X2WA 1C1WH 1ZMNA 3A7ZA 3TJVA 2ZHDA 2GX4A 1N6YA 5FX6A 3GY8A 4DIHH 2VWNA 1EXFA 1AE5A 2FI4E 4AOQA 1SLUB 3PLPA 2PWXA 1C5QA 2VVVA 1TMUH 4I8LA 5HM9A 5K0HA 2GDDA 1K1PA 2FEQH 3ATKA 1ELEE 1QBVH 4AYYB 4KP0A 1TNGA 6GCHF 2BD5A 2FTMA 1DWEH 1OP0A 2BVXH 3GOVB 3T27A 5FCKA 3SZNA 1TQ0B 4CRGA 5A2MH 1QJ6B 2VH6A 5IYTA 1GJAB 1DLKB 3A87A 2BB4A 1MBMA 1BTWA 3VB6A 4UFDH 4Y79A 1DITH 1HCGA 3OYPA 1NN6A 3V13A 5L2ZH 2B0FA 3RXUA 1OOKB 1AKSB 1SFIA 1ELGA 2PSYA 1IHTH 1RJXB 1SGRE 4MPXA 5LPEA 1C5WB 4AYVB 1LO6A 2VNTA 4BXSA 3MTYA 4LZ1H 1S82A 1O3NA 4CH8B 9LPRA 3D62A 5JBTA 4FUFA 1IQMA 1Q2WA 1O31A 2ZZUH 1CA0C 2XBWA 4H4FA 4NA8A 3HK3B 4GCHG 1OP2A 4WH6A 1PQ8A 3VEQB 2CGAA 3A8BA 3F9FA 3U8OH 3TITA 3STJA 1L4DA 1GMDG 3S7KB 1DSUA 3BG8A 1YBWA 3QX5H 1YM0A 1RFNA 2BVSH 4MTBA 3L33A 1XUJA 3AAVA 1AY6H 2BLWA 3ZZCA 3MWIU 1GJ7B 4JYVH 3M36A 2BD3A 7ESTE 1L1GA 1D3TB 1BMAA 1NC6A 2R0LA 1NU7B 3M35A 1P09A 1A7SA 5FPYA 3RP2A 1GCTB 1TRYA 2XCFA 2F9UA 1C5UA 4FVBA 3M7TA 1O2MA 2VIVA 8LPRA 4O3UA 2P94A 1AZZA 3LT3A 1Y5BT 2PGQB 4SGAE 5EXNA 1C2FA 1DFPA 1Z6EA 5JB8S 1XVMA 1ZR0A 2WYJA 1BT7A 1C9TA 1YLDA 2Z9JA 4NWLA 4INHA 2F9BH 2UUKB 1KDQA 3EA8A 3NPSA 1YCPK 1JRTA 1MKWK 1SR5C 1SLVB 4IS5A 1Y3VA 1A2CH 2ZU2A 1O3IA 2ZDVH 3L3TA 2AH4X 3M37A 2J9NA 1GBDA 3KIDU 2ZECA 3QGJA 1AVXA 3FFGA 1TFXA 3RU4E 4FUCA 1DT2A 3A84A 1BMNH 4IW4E 2BZAA 2QY0B 3RUOA 5FPTA 3RXOA 2NU4E 3C27B 1J16A 3K6ZA 2VIDA 3SU1A 3M3TA 1OWDA 1ELDE 3MH6A 3MU8A 5GCHG 3TU7H 1PPGE 1HAPH 5AVDA 1GBCA 1UVUH 1AFQC 2FDAA 1ELVA 2H5DA 1SI5H 1Y8TA 1YPHE 1PPFE 4JZEH 3MO6A 1O32A 4X1QU 3NXPA 2ODPA 3BTEE 1Z1JA 3GCHB 2BDHA 2F9VA 1HRTH 3LJJA 3O8CA 1ETTH 1SGDE 1GDUA 1BA8B 5E8EH 3MI4A 3OU0A 2IPHA 1YPEH 5EOKA 1A3EH 5AFZH 2G4UA 1IQEA 1T8OA 5C3NA 1UHBA 3ZVDA 1TX7A 2OTVA 2CF8H 3DUXH 1H9IE 2AGGX 1NRPH 1O3LA 2AMDA 3QWCH 4ABJA 2CJIA 3QK1A 2Y7XA 1NFUA 1DVAH 1QRWA 1HGTH 1YLCA 1FMGA 1KIGH 5I25A 2A1DB 1JOUB 1FJSA 3TGJE 1GI8B 1W7XH 4AX9H 1C2LA 1WV7H 4JYUH 1GG6B 1HAVA 3Q00A 3UREA 1NM6A 3QZRA 3RXRA 4ISNA 2G8TA 3LC3A 1GCDA 3SI4H 1ABJH 1YPHC 1QURH 4O3TA 1P9SA 5L2YH 5C5NA 5EW2H 1AVGH 2BDYA 1OWEA 4TPYA 1GWAA 7KMEH 2ESTE 3GY4A 1IQJA 2NU1E 1K1OA 1AWFH 1XXDA 1XUFA 2FOAA 1TNLA 5GIBA 1U6QA 2Y5GA 1ZGVA 1ZTKA 4Q7XA 1FY3A 2Q1JA 3ITIA 1F0SA 2C8YB 1C2IA 3ATLA 2Z7FE 1P9UA 2P3TB 4ABBA 1G9IE 1D3DB 1IQNA 2A5KA 3GYMA 1TIOA 4JZFH 1C2EA 3HK6B 3SHAH 4OGXA 4D76A 1SGEE 1C1MA 1V2WT 1ESAA 2FOHA 4JZDH 1GBAA 2AMPA 1FY1A 4X6MA 4GPGA 1C1QA 2ZFFH 5J4SA 4CH2B 3SGBE 2GCHG 1CHOF 2FXRA 2G52A 2Z94A 2LPRA 2ZGCA 1H1BA 1C1NA 1UTNA 1TRMA 2SGPE 4Q2KA 2G55A 4FUGA 1C5NH 4ABIA 1EUFA 1CU1A 1P3EA 4J2YB 8ESTE 1O2JA 1GI0A 1EOLA 1LHEH 3A83A 1KXDA 1AE8H 1THSH 3A7YA 1SVPA 1ZPCA 3PTBA 1K21H 1SL3A 3W94A 1EZSC 1W0ZU 5DP5A 1C5OH 3SJOA 3RM2H 8GCHF 1CSOE 2VGCC 4DW2U 4ABAA 4VGCB 2B8OH 3A8AA 3MOCA 3T29A 3LONA 1T8NA 4LOYH 3UY9A 2J4IA 1QRXA 1SGQE 1WU1A 6GCHG 4MPWA 1O5AB 1OKXA 2XCNA 4YOGA 2R2MB 3MNCA 3TJNA 3DFLA 1C5TA 9ESTA 4ABEA 1TNKA 1BBRK 3ATWA 2ZDLA 1IHSH 4OS5A 3AASA 1G3EA 1NFWA 4WF8A 1NFXA 3PTNA 3SV9A 4Y11E 1VGCB 1C5ZB 2ULLA 1CQQA 2ZDKA 2ZF0H 1LQDB 4WVPE 5AF9H 1EAIA 4O97A 4YTAA 1UTJA 1O2IA 4X8TH 2BLVA 1HJAB 2VU8E 2ZI2H 4FU8A 1UVPA 1ELAA 1QB1A 3PMHB 4FUEA 1TQ7B 5F03A 3KGPA 5FHTA 1AFEH 1GDQA 1FLEE 2Z9IA 1S83A 2ZGXH 2OBQA 2H1UA 3T62A 3KQCA 1GBIA 3ZVCA 2FX6A 5A0CA 1MTNC 1OYQA 4Q80A 1V2LT 1P04A 1F5RA 4INLA 4ABDA 5C1UA 3BG4B 1O3DA 2ZGJA 1BITA 4XE4A 4LK4A 1ZOMA 4LXBH 1A5IA 2ZPRA 3OY6U 1GJ8B 4GUXA 2FIRH 3E0NB 3E8LA 2F9OA 4M7GA 1FAKH 1IQHA 1GJ9B 3SU5A 5JBAS 3DFJA 3SQEE 1HAOH 1W10U 4ZXXH 3DA9B 3QZQA 3ZZ3A 1SGPE 2RA3A 3PMAB 3PWCA 6CHAB 1E0FD 4GHTA 3SORA 1ACBE 3SU0A 4FU7A 2A0QB 1S6HA 3P8NA 4Y8XA 1X7AC 2FO9A 3GY3A 3RXAA 2ANWA 2CMYA 3RXDA 1ELTA 1G2MA 4DJZB 4I8GA 2FOMB 3M61U 2BY7X 1BOQA 4TWYA 1TGNA 2QV1A 1AI8H 4NIXA 3NZIA 1LPKB 1WQSA 1GI6A 2P8OB 2ZTYA 1GHBF 1UO6A 2ZPQA 3QTOH 5C1YA 2AGEX 2PR3A 1P0SH 4B75A 5DP9A 1P2IA 1BHXB 2ZP0H 4CBOA 2ZIQH 2AIQA 2QXHA 2ZG0H 5E0HA 1DANH 1BMLA 1TGBA 4K69A 3B9FH 2SNWA 3RMMH 2OQUA 4UE7H 3E6PH 3RC6A 1C1SA 2Y5FA 1CGHA 3RXPA 5HYOA 1JXPA 3TGIE 4Y8YA 4XBCA 2THFB 2ZCHP 5A0AE 2UUJB 2VH0A 2C8XB 5AFYH 5L30H 4AFUA 3MYWA 5EGMA 2PSXA 2ZTZA 5LPRA 1WSSH 3PB1E 3ATMA 1F0RA 1YGCH 2VINA 1MQ6A 1W13U 2XC0A 2A45B 1TNJA 5EQSA 1Z8JB 4DGJA 2QC2A 1MMJN 1L2EA 2Z6BD 3SU4A 1TONA 1NRNH 1FPHH 2Q6FA 3VGCC 1GMHF 1ELFA 4GAWA 2OD3B 1GBTA 3CENA 1UJ1A 4ZKSU 1C1PA 3VB4A 3RXJA 1TMTH 3NK8A 1B5GH 2BDAA 1DWCH