2AYWA

Crystal structure of the complex formed between trypsin and a designed synthetic highly potent inhibitor in the presence of benzamidine at 0.97 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Structure of the complex of trypsin with a highly potent synthetic inhibitor at 0.97 A resolution.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA02
6GCHG 1O3DA 4ZAEA 4JZEH 5FXLA 2O8LA 1G9IE 3LGIA 2QXHA 2ZI2H 3UR9A 2PUXB 3D49H 2ANYA 3E90B 4NSVA 2ZF0H 1QRWA 4MQAA 2JH0D 1HNEE 4ZHLU 2AIPA 1Y5AT 1WBGB 3B23B 2BDIA 3RXDA 1SGIB 2CHAB 4CRGA 2JETC 1XM1A 4ABFA 5EXMA 1HGTH 1HXEH 1LPGB 1HLTH 4CRFA 1K1NA 3HK6B 2ZIQH 3S7HB 2XYAA 1TPAE 1ELEE 5A8XA 2BY6X 1EOLA 5EOKA 3SU2A 5A8ZA 3URDA 3I77A 2UWPA 1AHTH 1T32A 2W3IA 1W7GH 1GHXH 1SGEE 1SC8U 3QLPH 1CVWH 4XBDA 5LH8A 1DXWA 1HRTH 1O3KA 2C8YB 1C2DA 4B76A 1C4V2 1O38A 5E2PA 1AKSB 3T62A 5GCHG 1YPMH 1H1BA 3F9EA 4LOYH 2GCTC 4NA8A 1A3EH 3TK6A 4E7NA 5F8ZA 3V12A 5LPEA 5EW1H 1CGIE 4YZUA 3VFEA 1C5ZB 3HKJB 4YOIA 3QN7A 2J4IA 3RXHA 4FUDA 1SHHB 1K1IA 2VINA 1A7SA 2UUYA 3BF6H 4B2AA 4JMYA 5FPSA 1EPTC 3BEIB 3GY4A 1QA7A 2XC4A 4I31A 5CHAB 5C67A 2B8OH 2Y5FA 2AMDA 5T6DA 3I78A 2P3UB 1W11U 4FUIA 3NWUA 2VIDA 1O5BB 1C1VH 1LPZB 3UPEA 3B8JA 1UHBB 5I25A 2Z9LA 1K1JA 5AFZH 3A87A 2O9QA 1ZTLA 3SGQE 3W94A 1YPGH 1A5IA 1OWIA 1MTSA 3SI4H 4BTIB 2FOFA 5EW2H 1L4ZA 2BDAA 4Y0YE 3E3TA 2C4FH 4K1SA 1BTYA 4IN1A 1EAWA 2IN2A 5JPMH 3EYDA 1SG8B 3KL6A 3ZZ7A 1CE5A 3SGBE 3A7YA 2SNVA 1K22H 3PMHB 1KTSB 2ZFFH 2HNTE 5FX6A 3A80A 2A7CA 2H9HA 1GBFA 1HFDA 1O5CB 3TJVA 1EASA 1QBNA 2F3CE 3A82A 2B5TB 1WTHD 1SLXB 2F9UA 1V2ST 1WCZA 4KTCA 5ABWA 2FODA 4AGJA 1VGCC 1TONA 3LH3A 3SORA 1ESBA 1O3NA 2XBVA 3SUFA 4B75A 3P8OA 3SNAA 2FYRA 1V2QT 1IOEA 1GMCG 5C5NA 2BDBA 1TA2A 3LGVA 2DE9A 4QT8C 3W95A 3KQCA 1OS8A 1XUFA 1C5RA 5JBAS 1ARBA 4GVUA 4UFGH 2RCEA 5E0HA 5H4IB 1DS2E 2BVSH 1T4UH 2Z94A 2FOHA 1O2RA 4K3JA 1QJ7B 2J38A 2VH6A 3ZVGA 1QHRB 2TGDA 1ABJH 3M3VA 1ELTA 4SGBE 4ZROA 1GHYH 3KQBA 1IQJA 3TIUA 1P2NA 3ZZDA 3QZQA 4AFQA 1MTWA 3GY5A 3ZV9A 3ZVEA 4FU8A 3P8NA 2GD4B 5EU8A 2B7DH 1DLKB 4D8NA 1UTMA 4XSKU 3VB3A 1DE7H 1GBAA 1N6YA 1NO9H 3F9FA 2J95A 3QX5H 3SUDA 3S9AA 1RXPA 3VB6A 1C1RA 1LPKB 3AVZA 5DPAA 3AAVA 3M7QA 1CBWC 4OS1A 2FOBA 2Z3DA 3BTFE 3R3GB 1Y3UA 2FDAA 1NFXA 1V3XA 3GYLB 1YP9A 3MTYA 2GCHF 1AFQC 1A61H 2PFEA 3O8DA 3VB7A 3ZVCA 1QQ4A 1HBTH 3A85A 1DWDH 1CSOE 2ZDKA 2Q1JA 1CHGA 1C9TA 1GMDF 2D2DA 3DT0H 4UFEH 5DP9A 1SL3A 2V35A 2A45B 4YLQH 2XCFA 1IQEA 4KKDA 4LK4A 4FVDA 1K1MA 2ANWA 3WY8A 4MPUA 5LGOA 2VNTA 1AU8A 1HIAB 3PO1C 1EXFA 1CT0E 2F83A 1J15A 2WV5A 3KHVA 2C3SA 5EPYA 3MI4A 1GI3A 5JYIA 3EE0B 2BLOA 1AZ8A 1YKTA 1GVLA 1V2KT 5L30H 1MQ6A 1XUIA 3UWIA 3ATLA 2GCHG 3Q77A 3RXGA 3MNCA 1SGTA 1P8VC 1C2EA 4FU9A 3MH4A 1MKXH 2J92A 1TMBH 3TH2H 1V2JT 3RM2H 3A84A 1GMDG 3PM3A 2W5EA 2F9NA 2G8TA 3SU5A 3A8CA 1BRAA 1SB1H 3EDXB 4GAWA 4UFFH 1H9LB 2UUFB 1LQDB 2R2MB 3RXJA 2QAAA 1PYTD 3HPTB 2ILNA 2PW8H 1VCWA 4NA9H 2KAIB 3LGTA 1W13U 2ALPA 4H4FA 4JK6A 4DCDA 3DUXH 1C5OH 1XUKA 1Y3VA 2GVFA 1O2NA 4K5ZA 2XC5A 3RXEA 1C5NH 7LPRA 1FIZA 1YC0A 3ZV8A 4GHTA 1UTLM 2BDHA 2AH4X 3K2UA 4B74A 1DX5M 4AZ2B 3RM0H 4J1YA 3LT3A 3BTME 1ELCA 1YPLH 1JOUB 3KCGH 3M5LA 4FU7A 1O31A 3BEUA 1EZUC 1YPKH 4A1VA 3MNXA 2EI7A 2NU1E 1GI8B 1GGDC 3ZZ9A 4NIWA 2BD4A 2ZHFH 1O3CA 1QL8A 1AB9C 4X1PU 3JZ1B 1LO6A 4ZHMU 2FXRA 1E38B 5I46H 3M7UA 6ESTA 3ZZ5A 2BY9X 2JKHA 1SQAA 2A5AA 4HZHA 4WJG2 1L2EA 2Y81A 4WXIA 1TGSZ 3BG4C 2CJIA 3EA7A 3UOPA 1TIOA 3E6PH 3A89A 1T7CA 1HJAB 3ZYEA 3VB4A 1PQ5A 2H5CA 4X6MA 1FN6A 2ZEBA 4I8GA 3SHAH 3RXTA 3NXPA 2QXJA 3NKKA 3BG8A 3FP6E 1NPMA 1ORFA 1XKAC 1SVPA 3P8FA 3P17H 4R8TB 4WMEA 3SV2H 2AS9A 2W3KA 3MHWU 4K1EA 4O97A 1IAUA 2WPKS 4Q80A 1WAYB 3PMBB 1PPBH 2GMTB 1MZAA 2BX4A 1NS3A 2NU2E 3KNXA 5FX5A 2GZ8A 5EGMA 3FP8E 2P3FH 5FPTA 3ATIA 3LGUA 1FI8A 2ZGXH 3SU3A 3QGNB 1C1WH 1GI0A 3A7VA 2CHAC 2BYAX 1VITH 3QUMP 4XE4A 1W7XH 1AN1E 2PSXA 1JIRA 4I8KA 2WPJS 2ZHDA 3TNTA 1ACBE 1O3HA 1B7XB 2AERH 3SV7A 4BAQB 1F5KU 1HPGA 3D65E 1A3BH 1DSUA 2A32A 1HAPH 5HXFA 4Y10E 3ZYDA 4NIVA 3RLYH 3UQOA 1MAYA 1FN8A 1O2MA 2FYQA 2VH0A 2ZKSA 1KDQA 3F9GA 1S5SA 1SFIA 1VCQA 2ZU2A 1V2WT 4Q7YA 2Y5GA 1UTJA 4KTSA 3ATWA 4OS2A 4MTBA 3K9XB 2HALA 4A1TA 1TNHA 3EQ0H 1QBVH 1P03A 4WF8A 1BITA 2TGTA 4YM9A 4YO9A 2ZFTA 1FY3A 3PTBA 4ABJA 1EQ9A 1O2VA 3H5CB 8GCHF 4X2YA 4IMZA 4NZQA 2SGFE 2OXSA 1O3JA 1Y8TA 1BTZA 1RRKA 1EP6A 1ZGVA 4ASHA 5L2YH 2VWLA 5GIBA 1C1UH 3M61U 1QRXA 1V2RT 3FFGA 2QIQA 2FMJA 1XVMA 1FY8E 4NSYA 1BTPA 1GBBA 1DT2A 1GMHF 5J4SA 1FJSA 1G3CA 4H42U 3L6PA 1C2LA 1Z8JB 2H6MA 3MOCA 3P8GA 4CBNA 1T4VH 4DOQA 3RC6A 1O2JA 1XUGA 4NIYA 1K2I1 4IW4E 2W7UA 1AGJA 1AKSA 3VB5A 8GCHG 1W3CA 2WV4A 2W7SA 3UNQA 3UY9A 3MWIU 4X6NA 1A0LA 1F0RA 3RC5A 1FY4A 1VR1H 1EJAA 1ZTJA 2Q6FA 1TMTH 4X6PA 1C4Y2 1O2KA 1THSH 4FUHA 1GJ7B 1UCYK 3SJ8A 2FS9A 4I33A 3BV9B 1YPHC 1EZQA 2GV7A 4U01A 2PUQH 2Y80A 1FDPA 4YESB 4H6TA 1S6FA 2EI6A 1YF4A 1LMWB 1V6DA 2PKAB 3V13A 1BHXB 3CS0A 1QL9A 3PYHA 1SSXA 4HGCA 1AVWA 1ZMNA 2XW9A 1K1OA 2F9PA 5DG6A 3A86A 1GHVH 1P2OA 2M5TA 5GJ4B 2HGTH 1THRH 3DA9B 2NWNA 1Y3WA 4K2YA 1NROH 1OWHA 1VITF 4DIIH 3E91A 1MD7A 4CRDA 7GCHF 4KP0A 5T6FA 1GG6C 4BOHA 1HAVA 2Y7ZA 1F0SA 1O37A 1YLDA 4O9VA 2HLCA 3RXAA 2O8WA 3IWMA 4Y71A 5JBBS 1SHYA 3F9HA 5FHTA 1GBDA 1KYNA 4B73A 1BBRK 2ZP0H 3A7TA 3SU0A 3RXQA 2OUAA 1MTNB 1THPB 4FUJA 1P0SH 2W26A 4ISHH 5FBIA 1QNJA 5T6GA 2ZQ1A 1TGCA 1F0TA 2OC0A 3URCA 2FO9A 1D6WA 5DP6A 4ZXYH 1UTNA 4CRBA 4MG3A 2OQUA 3M5MA 1XXDA 1VITG 1UK3A 1ABIH 2ZDMA 2ZPRA 1Y3YA 4DJZB 1OWEA 1PJPA 3SI3H 2CXVA 1MAXA 1C1TA 1O5FH 1P2JA 4IBLH 5FAHA 2ODPA 1ESTA 2SGQE 1UVUH 3JZ2B 4OGXA 3LGWA 2O8MA 3IG6B 4X0WU 1UCYH 2D1JA 1PPEE 4KTUA 9LPRA 2SGAA 1K1PA 1K9OE 2BXUH 3OYPA 2QF0A 1GI6A 3BTHE 4HI3A 1MH0A 4NGAH 1TRYA 2BD5A 4ABEA 1C2MA 5F6MA 2SGDE 1FONA 4NG9H 2BTCE 4WH8A 3SW2B 3U8RH 2ZC9H 1YLCA 4UE7H 5AHGH 3RXFA 1IQGA 2HPQH 2HOBA 2WYJA 3MH6A 1O5DH 3AASA 3MU0A 1MU6B 4ZKOU 1AVXA 1VZQH 1DDJA 4A5TS 5BRRE 2AMQA 1DVAH 1BMMH 1G37A 1EAUA 2ANKH 2BY8X 4ABAA 4DT7B 2K1QA 1SGRE 4RKOB 4FUFA 5EQRA 4LZ4B 1BTWA 2VWNA 3STJA 1YYY1 5AVDA 1TFXA 2YNBA 1GBIA 2G52A 3PWCA 2LNCA 1Z71A 3NUMA 1GI7B 3QTVH 3BTDE 1DM4B 2VIOA 2GT7A 3TJOA 4B1TA 1HIAA 1BBRH 4BXWA 4K69A 3M37A 1P2QA 3QZRA 4CH8B 1O3LA 2Z9IA 1FLEE 5A2MH 3V0XA 8KME2 2OQ5A 3H7TA 1FQ3A 1KLTA 3HATH 3RU4T 4RKJB 1O2LA 1SLUB 2EA3A 1GBMA 1TOMH 1O5EH 4ZKRU 1AWHB 1YBWA 3KIDU 2BXTH 3OU0A 1UVSH 1S83A 1WU1A 4O3TA 5ETXA 1C2IA 1TX6A 3STIA 3UR6A 3UTUH 1AUTC 1DY8A 2GDDA 2VB0A 3RU4E 1A5HA 3MMGA 2R0LA 1BJUA 1GJ4H 1PYTC 1Y5BT 1P9UA 3SV9A 1XKBC 2TBSA 5T3HA 3SQHE 2XCNA 3SHCH 1ELGA 3TGIE 4INHA 1VCPA 2ZU5A 4IGDA 1O2QA 2A2XH 4D76A 2RA0A 3C1KA 1C2HA 1FXYA 1TX8A 3RMLH 2ZTYA 4MNYA 2BZ6H 1ZZZA 1NESE 1OPHB 2EEKA 1DY9A 1XUJA 2GMTC 4Y7BA 1S82A 1EPTA 1L0ZA 4ESTE 1F2SE 1BRCE 1HYLA 4FUBA 2CMYA 1UCYE 2H2ZA 1QCPA 4WMDA 1TA6A 3NPSA 2OLGA 2BOKA 1T8NA 1ZGIA 4RN6A 3FZDA 1HJ9A 4UEHH 1TRMA 1NY22 2H9TH 4GCHF 5DP8A 4X8UH 1K1LA 1G36A 1SI5H 3CS7A 3OY6U 4TWWA 4XFQA 4MPXA 2VVVA 1GBJA 1CA0B 3QK1A 3VXFH 1BUIA 1MKXK 3MO3A 2NU4E 4WH6A 2BLQA 1FZZA 3RMMH 1MD8A 3U1IB 3QTOH 4ABIA 2IOTA 1A0HB 4O03A 8ESTE 1QIXB 2A7JA 4JZFH 2CF8H 1BZXE 4CH2B 1OXGA 3GY2A 2G4UA 1JRSA 1P2MA 3SNCA 1GJCB 1ZSJA 3OSYA 5E2OA 1HUTH 1L1JA 2D8WA 2TGPZ 3RXUA 1TPOA 1YPHE 1O2GH 4FUGA 1MCTA 4YOJA 4BXSA 3TU7H 7ESTE 4GCHG 1LCYA 1FY5A 2LPRA 1KXDA 2A4GA 2BM2A 1BBRE 2CF9H 1UTOA 2FWWA 5HMAA 1TX7A 3IITA 1A0JA 3M7TA 4DW2U 1Z1IA 4XDEA 1XUHA 4NFEA 3T29A 1ELBA 1C9PA 4OGYA 3SQEE 2ZDLA 1UK2A 4ZMAH 1GDQA 1J16A 2FM2A 2XNIA 1BIOA 2Z3EA 1O3FA 3GDUA 1VJ9U 2PTNA 1F7ZA 1TNIA 2V0BA 1HJ8A 3GDVA 1O2XA 1V2PT 1C5TA 3UOUA 3UREA 4F4OC 2J9NA 3EA9A 4AB9A 1CHOF 4FUCA 3VPKA 5A09A 1C4U2 1WYKA 2C8XB 1SOTA 3RMNH 1C5YB 2FLBH 3BTEE 1NN6A 1O0DH 2ZFPH 4MNWA 5FBEA 3SNDA 2RG3A 1TE0A 4DVAU 3ZZCA 2QCYA 2F9OA 1X7AC 2VVCA 4AG2A 2IJOB 5E0JA 4BTUB 4D9RA 3GISB 1O2IA 1H8IH 2ZHEH 4WVPE 1DICA 2BVXH 3Q3XA 5HGGA 2JH5D 2GP9B 3ODFA 4RSPA 1XXFA 5HM9A 2ZFRH 1V2TT 4X1SU 1IQKA 5ESBA 2ZZUH 3M3SA 2DE8A 2F9BH 1GJBB 3TITA 2THFB 3UWJH 2AFQB 2FX6A 3P6ZB 1CGHA 1CHOG 1Z1JA 1IQHA 1KY9A 3ZVBA 3KQEA 2WUCA 1C5PA 1EUFA 2H9EH 1RTFB 1AUJA 1J14A 2J94A 5DJ7A 3CP7A 1PPFE 4THNH 1O2YA 1DUAA 2VIWA 4GSOA 2FS8A 4K8BA 3TH4H 4Y79A 4X8TH 2UUKB 3PMJA 4Y6DA 1O3PB 4A1XA 5SGAE 1TAWA 2FI5E 2ZHWH 1YPEH 1DITH 4OS4A 1UTPA 3T25A 1B5GH 1MUEB 3QGJA 1GBKA 4X6OA 3GICB 1O2SA 5DP4A 2Y82A 1BQYA 2FOMB 1WOFA 4OS5A 2FOEA 1HAZB 1D4PB 1Z7KA 3VXEH 2FOCA 2R2WU 2BD9A 2XWBI 1NFYA 3HGPA 3K65B 3ZVDA 2VGCB 1MQ5A 1MTNC 1N8OB 2TGAA 3SNEA 2O8UA 5E8EH 4A92A 1GDUA 1ETRH 1P3EA 2PKAA 3BTWE 1CU1A 1GL0E 4WMFA 3S69A 1GHBF 4INKA 1BOQA 1HAOH 1AQ7A 1DANH 1TPPA 3FP7E 3U1JB 2XBYA 1Q3XA 2G81E 1G32B 3UIRA 1O5GH 3LC3A 1SBWA 4DY7B 4MPVA 1FV9A 3SZNA 2FLRH 2ALVA 3NCLA 5F8XA 4B2CA 3U98H 3HKIB 3BTTE 1C5XB 1GDNA 1UVOA 5EQQA 1OYTH 2B0FA 5A0CA 4AX9H 4U30A 4AOQA 2I6QA 5A0BA 2WYGA 1GL1A 1NTPA 2BQ6B 1PQ8A 2OTVA 5TCCA 3BN9A 1NRPH 5JBCS 2C90B 4BAHB 5C20A 4JYTA 2HWLB 4VGCB 1EJMA 2ZQ2A 1QGFA 4K1TA 1GBLA 2UWLA 1MBMA 5L6NH 2ZECA 2ZTZA 2CV3A 2AMPA 1CT4E 2BOHB 2QV1A 1C1MA 3KEEA 1OP8A 2BQ7B 1IHSH 1H9IE 2BX3A 4ABGA 1GVZA 1PPHE 1OX1A 3MH5A 5DP7A 5J4QA 1GCTB 3LOXA 1ANEA 2SFAA 4DURA 1O3EA 1S6HA 2V3OH 5ESTE 1S84A 3SU1A 2ZTXA 4BTTB 1C2JA 2ESTE 5AFYH 1MMJN 1O3IA 1C1PA 4HTCH 2FOGA 1LVOA 2C93B 4UD9H 4AFSA 1TNGA 1TQ7B 4D7GA 1Q31A 2ZA5A 1L1GA 2PHBA 2BD3A 1P10A 3RXPA 2OC7A 5C1XA 1O33A 3ATKA 4KGAA 4X1QU 1TB6H 4Y8YA 3FANA 4YTAA 1AO5A 1A2CH 1RIWB 2H5DA 5CHAC 3PTNA 3GY3A 1MZDA 2Y5HA 1AFEH 2J2UA 1WTGH 1GJ6A 3A81A 2J34A 3QDZB 3T27A 4DGJA 1WQVH 2Z3CA 2HNTC 1P2IA 1WSSH 1JMOH 3DFJA 3ITIA 1TMUH 3TJUA 1U6QA 1F0UA 4WY3A 2QC2A 3LKWA 1D3QB 2ZGHA 1FPCH 2DUCA 2XTTB 3FVFB 3RXSA 3MO6A 5L2ZH 3BTKE 2PTCE 4JCNA 4XBCA 2RA3A 4BAMB 4I8LA 2VWOA 2A1DB 3ZZ3A 1P05A 3RXKA 4CHAB 3EAJA 3SN8A 2YOLA 1LDTT 3AW0A 3QWCH 2HRVA 1ZSKA 3E8LA 3S0NA 3BSQA 2QA9E 5GWZA 2OCVB 4YT7H 4B71A 1GPZA 1ZMLA 2ZCKP 2FOAA 2WPMS 3RXLA 2QF3A 2NU3E 1GMHG 3VGCB 1BTHH 4JYVH 1TNLA 4XBBA 1FAKH 1P06A 1UHBA 4E7RG 3LH1A 1HV7A 2JH6D 3O8CA 4BAKB 3SOSA 4H6SB 1O3BA 1TOCB 1GI4A 1TGBA 1UK4A 2P16A 4O3UA 1ANBA 1O5AB 3K6ZA 1HCGA 4MDSA 1A1RA 2VVUA 1H8DH 4GLYA 1NU9A 1QBOA 4NCYA 1OOKB 1C1OA 4NIXA 2G4TA 3GCHB 3TLOA 5JDUB 1SFQB 2OP9A 1OWKA 2Z9JA 1IQIA 2A7HA 2TPIZ 1DWEH 1NT1A 5AF9H 1UVPA 2IPHA 4ZXXH 1C2KA 2AGIX 3PB1E 2FZZA 1HDTH 2ZG0H 5GPIB 1LHDH 1ARCA 3V7TA 1JBUH 3BIVH 2XWAA 3ZVAA 4AB8A 3RXRA 3PWBA 4ISIH 2VIQA 4JYUH 3BTGE 1NC6A 3O8BA 4Q2KA 3A8DA 1CO7E 1RS0A 3KN2A 1HAGE 1C5VA 1KXFA 1ZHMA 3KGPA 4OS6A 3ZZ6A 1OKXA 1W0YH 2H1UA 1O2PA 1LHFH 3N7OA 1Z8IB 1TABE 1J17T 1ZRBA 4ABBA 1GGDB 1RTKA 1ZSLA 3PROA 4ISOA 4JK5A 1BTUA 2FP7B 1C5MD 4GPGA 2HPPH 1NZQH 1BHXF 2Q6GA 2QYIA 2FTMA 2STBE 4CR9A 7GCHG 2STAE 3GY8A 1C2GA 4AFUA 2ZU4A 1QR3E 3F68H 4TY6A 3ESTA 4M7GA 5C1YA 4ABDA 2QXIA 1TQ0B 1RTLA 1GBTA 2GDEH 1Y5UT 2PR3A 4K8YA 3SBKA 5IDKA 2BY5X 4LZ1H 2A0QB 1SGPE 1P57B 2BDYA 1ZPCA 4LXBH 4I7YH 5TCAA 4INLA 3G01A 1GJ9B 3ZZ8A 1OYQA 2G5NA 1LVYA 2VWMA 1MU8B 1W0ZU 1OP0A 4ZHAA 3LDXH 1Z8RA 4K60A 2P93A 3T5FH 3A8AA 5DP5A 1ELFA 5PTPA 1C5LH 1YGCH 2HVXA 4IC5A 1TALA 2ZDAH 5EODA 2P94A 4ISLA 2Z9KA 3EA8A 1TRNA 3GY7A 2C8WB 5GCHF 1J8AA 1KLJH 2BD8A 1YCPK 1V2MT 1IHTH 1GBEA 3S7KB 2WUBA 1O32A 1ZHPA 2ULLA 1T8MA 4TY7A 1GHZA 1DLEA 2AYWA 2QY0B 2PKSB 4X1RU 1EAXA 3M5NA 2A31A 1L1NA 3TPIZ 1NRRH 2GZ9A 3RDZA 3RC4A 3RXIA 4CRCA 2ZDNA 3Q3YA 3DHKH 9ESTA 2BVRH 3RUOA 4CBOA 1GWAA 4U32A 1SOZA 1S85A 1CT2E 1WUNH 2R0KA 1O2UA 1TWXB 3R0FA 3AAUA 1BTXA 1O3AA 3QO6A 3MU1A 2VGCC 1F5LA 1OP2A 1OWDA 1Z6JH 1N8OC 2V3HH 1EX3A 4BANB 1YM0A 4NFFA 1C5QA 1H4WA 2KAIA 1EZXC 3F1SB 5E0GA 4DIHH 5DO4H 2Q6DA 1ZTKA 3E0PB 1HJAC 1SQOA 1W12U 5A0AE 1ANDA 1W8BH 4FXGH 3U8OH 4IS5A 3SJ9A 4TWYA 1MTVA 4D9QA 3H7OA 3DD2H 1GMCF 1IQNA 2G00A 1D6RA 1C1QA 2R3YA 1FY1A 1AWFH 2QN5T 4KELA 5JBTA 3RLWH 4TYDA 4X8VH 2VJ1A 2P3TB 3HK3B 5C1UA 3ODDA 3D23A 3LGYA 3RXVA 5K7RA 1YCPH 2P59A 1BDAA 1MBQA 2P8OB 5EQSA 3LJJA 4E05H 4ZH8A 1P04A 4AORA 5EPNA 2A4QA 1SQTA 4UONA 3PMAB 4Y76A 2P95A 3TGKE 1C1NA 1UJ1A 4VGCC 1HAVB 3D62A 2YNAA 1F92A 3LONA 2AEIH 3L3TA 2HNTF 4ZKSU 1SPJA 2R9PA 1LVMA 3AW1A 1GJ5H 3M36A 3U9AH 3MFJA 1VJAU 1AE5A 1HAIH 4UFDH 1QRZA 4Y8XA 2NU0E 2FIRH 1ETTH 2ZGCA 1ZJKA 2ZCHP 3SU6A 4MLFB 4CR5A 1GCTC 2EI8A 3LIWA 1G3EA 3OX7U 1CGJE 2ZDVH 4FVBA 1TNJA 1E36B 1LQEA 1TBQH 2ASUB 1AVGH 2XC0A 4Y0ZE 2BZAA 4NWKA 1UO6A 2ZCLP 1YPJH 2OBOA 1AD8H 1QFKH 4X2VA 1KXEA 3C27B 3Q76A 5JB9S 2A5IA 1A5GH 1G30B 1SGFA 3MNBA 5G4BA 3OY5U 1NRSH 1BT7A 1GG6B 1RIWC 1V2NT 4IN2A 2BB4A 1O36A 2XXLA 1QA0A 2ZNKH 3HGNA 2FESH 2RDLA 1TNKA 5GDSH 1C5SA 1GI5A 4Q7ZA 3KF2A 3P70B 1QJ1B 4DG4A 1QURH 2GZ7A 3SJOA 2ZHQH 5F8TA 2ZO3H 4I8HA 2BD2A 1AY6H 4NWLA 2VIPA 3TK5A 1DSTA 1TBZH 1N6XA 1OWJA 1P02A 3BTQE 3A88A 3OTJE 2Y6TA 6CHAB 2SNWA 2BLWA 1EOJA 4Y11E 2A4OA 5IYTA 1BRUP 2ANMH 3P95A 1NFUA 1GHAF 1EJNA 4F49A 5BPEA 2PLXA 3ZZBA 4CHAC 3ZZAA 3RMOH 2C8ZB 3I29A 1E35B 1O2ZA 2WPLS 1XVOA 1HAYB 2GT8A 4OS7A 5HM2A 2ZFQH 3LJOA 3UNSA 1BMNH 3TH3H 1N1LA 4ZKNU 2AGGX 3RXMA 4JZ1A 1AIXH 5EG4A 3E0NB 1KTTB 2BDCA 2PGQB 3VGCC 2ODYB 2A5KA 3GY6A 1JRTA 1C5UA 2PGBB 2R3UA 1DPOA 3LU9B 4I8JA 3TJNA 3GCNA 2JETB 2CGAA 4SGAE 1LKAA 1TLDA 2BD7A 4NZLA 1QL7A 1BA8B 5DP3A 5CMXH 1PPCE 2GX4A 1EP5A 1GBCA 1ZLRA 1LHGH 1GHAG 1ZMJA 4WWYA 2FEQH 3BEFB 1BCUH 5F03A 4CREA 4JZDH 5DK1A 3GCHC 1ANCA 2G5VA 5CE1A 1BJVA 3SJKA 1CQQA 3SV8A 4J2YB 1G2MA 2TRMA 3SU4A 4AN7A 1SLVB 1FIWA 1GJDB 5C2ZA 1V2LT 2O8TA 1K28D 1SMFE 4NA7A 3RP2A 3E1XB 1QQUA 1H9HE 2GCTB 1Y3XA 2Y7XA 2Z7FE 3S9CA 3M5OA 1P09A 5GXPA 2XRCA 3T28A 1Y59T 4Z6AH 1P3CA 1T8OA 2AGEX 1QB9A 1NFWA 1RFNA 4MVNA 1ELAA 4Q7XA 3LPRA 3GDSA 1EPTB 4AYVB 1V2OT 2F9VA 1PPGE 1TGNA 3SUEA 1TPSA 4Z0KA 1EB1H 1LHCH 1RD3B 1KXCA 1O30A 1W2KH 1BMLA 1DWCH 1UMAH 1A4WH 3Q00A 1OSSA 3SJIA 1T31A 4WXVA 3TVJB 3K6YA 3A83A 1GHWH 4ZUHA 8LPRA 1ZOMA 1Q2WA 4E06H 5DGJA 5LPFA 1EB2A 3B9FH 2WPIS 3EGKH 1JXPA 1BB0B 4PROA 1WQSA 2ZGBH 1GCDA 4AG1A 1TGTA 1O2WA 1SR5C 3GCTF 2PV9B 2F91A 3A8BA 1W14U 3Q3KA 1XMNB 4MNVA 1ZYOA 2QXGA 4TPIZ 1GJAB 1J9CH 1Z8GA 1LHEH 1M9UA 2WINI 5TJXA 3U8TH 1AZZA 3L33A 2CN0H 5K0HA 3PV4A 3MYWA 1GHBG 4BNRA 1S0RA 2GKVE 1BRBE 2GGVB 1NU7B 1VGCB 1C2FA 1D3PB 3GYMA 1ZPBA 1O35A 3ATMA 1IQLA 4D7FA 3ZZ4A 1IQMA 4I32A 1E37B 3GOVB 3NZIA 1V2UT 3KQDA 2AIQA 1HB0B 5FCKA 3GCTG 4HFPB 2TIOA 3MU5A 1B0FA 2V6NA 3MH7A 1AE8H 2ZU3A 1GI1A 3V3MA 1P11E 2PKSC 3M3TA 1SLWB 2SGEE 1MCVA 4IMQA 2OC8A 2ZGJA 1WV7H 4U2WA 3MU4A 2OINA 1EKBB 2FPZA 1E0FD 1KLIH 5A8YA 4CRAA 1JWTA 3E16B 4A7IB 2BY7X 2BMGB 2WPHS 1ZHRA 2I6SA 3UNRA 1PPZA 4X2XA 3CENA 1HAHH 2UUJB 2OD3B 1FPHH 1QJ6B 4B2BA 2PWXA 1CA8B 3BIUH 1NRNH 1YCPM 2ZPQA 1CBWB 4AYYB 1LKBA 1DUEA 1KIGH 2SGPE 5C3NA 2BLVA 2EC9H 1LTOA 1MKWK 1A46H 1G2LA 1RGQA 3T26A 1RJXB 1GJ8B 1AFQB 1INCA 1HAXB 1P12E 1QB1A 2B9LA 2FI3E 5EXNA 2PSYA 1AMHA 2Z6BD 3UUZA 3GCOA 1EATA 3UFAA 2XBXA 3PLBA 1KXAA 1T8LA 1SGFG 1DXPA 3A7WA 3SO3A 1DWBH 3A7XA 1QB6A 2VU8E 3P92A 2FI4E 1O39A 1PQAA 3DFLA 3TK9A 1DOJA 2A2QH 1S81A 5FPYA 2ZU1A 3FAOA 3PO1B 7KMEH 1SGYE 1IQFA 2ZFSA 1HXFH 3ENSB 2P8OC 3PLKA 1ELDE 1P01A 2BQWB 1SGCA 1FNIA 1L4DA 3ZVFA 1PQ7A 1ETSH 1V2VT 4BAOB 2OBQA 1PFXC 1NM6A 1ZRKA 2UWOA 3MU8A 1ZJDA 1CA0C 1DFPA 1B0EA 4X2WA 1O2HA 3SGAE 2VIVA 5LPRA 3RXBA 4AFZA 1GVKB 2G55A 3RXOA 3RXCA 4ABHA 3TGJE 2FTLE 4GUXA 5C5OA 1EAIA 4JZIA 3UQVA 4AGKA 1ELVA 1SGQE 3MNSA 1O3GA 4IC6A 3LC5A 1FUJA 5FCRA 4YT6H 1GI9B 1ID5H 2ZPSA 3ELAH 1KSNA 4TPYA 4FUEA 1F5RA 2GV6A 1TYNA 1NRQH 1UVTH 4YLUA 2FX4A 1S0QA 1LVBA 1O3OA 1G3BA 1UTQA 1MKWH 5B6OA 1O2OA 1FMGA 3O8RA 4UDWH 4Y7AA 1O2TA 1E34B 1QY6A 5HYOA 3M35A 4YOGA 1O3MA 1FAXA 1G3DA 3PLPA 4A6LA 1ZPZA 1ESAA 4R0IA 2XBWA 3SUGA 1D3TB 1MTUA 3NK8A 6GCHF 1C1SA 2ODQA 1GI2A 3MO9A 2QGRA 2ZWLH 1D9IA 4MNXA 1TBRH 3T2NA 1AB9B 1BMAA 1ZR0A 3S9BA 1C5WB 4ISNA 4XOJA 3TNSA 1XX9A 2G51A 4X1NU 6LPRA 3FZZA 1P9SA 1O34A 2A4RA 4X8SH 3SV6A 2BHGA 1Z6EA 3SNBA 3F6UH 3BG4B 1QTFA 6CHAC 5DKMA 1SGNE 1D3DB 4GHQA 1K21H 2OC1A 4MPWA 3U69H 1EZSC 1UTKA 3A7ZA 5EXLA 3RU4D 2GTBA 3VEQB 1KXBA 1GBHA 2Z9GA 1SGDE 2BDGA 2D26C 1P2KA 1KDQB 1W10U 1JIMA 1AI8H 4Y8ZA 5JB8S
chains in the Genus database with same CATH superfamily
6GCHG 1O3DA 4ZAEA 4JZEH 5FXLA 2O8LA 1G9IE 3LGIA 2QXHA 2ZI2H 3UR9A 2PUXB 3D49H 2ANYA 3E90B 4NSVA 2ZF0H 1QRWA 4MQAA 1BMFD 2JH0D 1HNEE 4ZHLU 2AIPA 1Y5AT 1WBGB 3B23B 2BDIA 3RXDA 1SGIB 2CHAB 4CRGA 2JETC 1XM1A 4ABFA 5EXMA 1HGTH 1HXEH 1LPGB 1HLTH 4CRFA 1K1NA 3HK6B 2ZIQH 3S7HB 2XYAA 5CDFE 1TPAE 1ELEE 5A8XA 2BY6X 1EOLA 5EOKA 3SU2A 2JJ1D 5A8ZA 3URDA 3I77A 2UWPA 1AHTH 1T32A 2W3IA 1W7GH 1GHXH 1SGEE 1SC8U 3QLPH 1CVWH 3W1EA 4XBDA 5LH8A 1DXWA 1HRTH 1O3KA 2C8YB 1C2DA 4B76A 1C4V2 1O38A 5E2PA 1AKSB 3T62A 5GCHG 1YPMH 1H1BA 3F9EA 4LOYH 2GCTC 4NA8A 1A3EH 3TK6A 4E7NA 5F8ZA 3V12A 5LPEA 5EW1H 1CGIE 4YZUA 3VFEA 1C5ZB 3HKJB 4YOIA 4DT4A 3QN7A 2J4IA 3RXHA 4FUDA 1SHHB 1K1IA 2VINA 1A7SA 2UUYA 3BF6H 4B2AA 4JMYA 5FPSA 4B6FA 1EPTC 3BEIB 3GY4A 1QA7A 2XC4A 4I31A 5CHAB 5C67A 2B8OH 2Y5FA 2AMDA 4XRNA 5T6DA 3I78A 2P3UB 1W11U 4FUIA 3NWUA 2VIDA 1O5BB 1C1VH 1LPZB 3UPEA 3B8JA 1UHBB 5I25A 2Z9LA 1K1JA 5AFZH 3A87A 2O9QA 1ZTLA 3SGQE 3W94A 1YPGH 1A5IA 1OWIA 1MTSA 3SI4H 4BTIB 2FOFA 5EW2H 1L4ZA 4Q63A 2BDAA 4Y0YE 3E3TA 2C4FH 4K1SA 2QF4A 1BTYA 4IN1A 1EAWA 5C0UA 2IN2A 5JPMH 3EYDA 1E1RD 1SG8B 3KL6A 3ZZ7A 1CE5A 3SGBE 3A7YA 2SNVA 1K22H 3PMHB 1KTSB 2ZFFH 2HNTE 5FX6A 3A80A 2A7CA 2H9HA 1GBFA 1HFDA 1O5CB 3TJVA 1EASA 1QBNA 2F3CE 3A82A 2B5TB 1WTHD 1SLXB 2F9UA 1V2ST 1WCZA 4KTCA 5ABWA 2FODA 4AGJA 1VGCC 1TONA 3LH3A 3SORA 1ESBA 1O3NA 2XBVA 3SUFA 4B75A 3P8OA 4RI0A 3SNAA 2FYRA 1V2QT 1IOEA 1GMCG 5C5NA 2BDBA 1TA2A 3LGVA 2DE9A 4QT8C 3W95A 3KQCA 1OS8A 1XUFA 1C5RA 5JBAS 1ARBA 4GVUA 4UFGH 2RCEA 5E0HA 5H4IB 1DS2E 2BVSH 1T4UH 2Z94A 2FOHA 1O2RA 4K3JA 1QJ7B 2J38A 2VH6A 3ZVGA 1QHRB 2TGDA 1ABJH 3M3VA 3FN8A 1ELTA 4SGBE 4ZROA 1GHYH 3KQBA 1IQJA 3TIUA 1P2NA 3ZZDA 3QZQA 4AFQA 1MTWA 3FKSD 3GY5A 3UAIC 3ZV9A 3ZVEA 4FU8A 3P8NA 2GD4B 5EU8A 2B7DH 1DLKB 4D8NA 1UTMA 4XSKU 3VB3A 1DE7H 1GBAA 1N6YA 1NO9H 2WZQA 3F9FA 2J95A 3QX5H 3SUDA 3S9AA 1RXPA 3VB6A 1C1RA 1LPKB 3AVZA 5DPAA 1WXRA 3AAVA 3M7QA 1CBWC 4OS1A 2FOBA 2Z3DA 3BTFE 3R3GB 1Y3UA 2FDAA 1NFXA 1V3XA 3GYLB 1YP9A 3MTYA 2GCHF 1AFQC 1A61H 2PFEA 3O8DA 3VB7A 3ZVCA 1QQ4A 1HBTH 3A85A 1DWDH 1CSOE 2ZDKA 2Q1JA 2QE7D 1CHGA 1C9TA 1GMDF 2PP6A 2D2DA 3DT0H 3PRDA 2AHME 4UFEH 5DP9A 1SL3A 2V35A 2A45B 4YLQH 2XCFA 1IQEA 3F2GA 4KKDA 4FVDA 1K1MA 2ANWA 4LK4A 3WY8A 3MQKC 4MPUA 5LGOA 2VNTA 1AU8A 1HIAB 3PO1C 1EXFA 1CT0E 2F83A 1J15A 2WV5A 3KHVA 2C3SA 5EPYA 3MI4A 1GI3A 5JYIA 3EE0B 2BLOA 1AZ8A 1YKTA 1GVLA 1V2KT 5L30H 1MQ6A 1XUIA 3UWIA 3ATLA 2GCHG 3Q77A 3RXGA 3MNCA 1SGTA 1P8VC 1C2EA 4FU9A 3MH4A 1MKXH 2J92A 1TMBH 3TH2H 1V2JT 3RM2H 3A84A 1GMDG 3PM3A 2W5EA 2F9NA 2G8TA 3SU5A 3A8CA 1BRAA 1SB1H 3EDXB 4GAWA 4UFFH 1H9LB 2UUFB 2RFKC 1LQDB 2R2MB 3RXJA 2QAAA 1PYTD 3HPTB 2ILNA 2PW8H 1VCWA 4NA9H 2KAIB 3LGTA 1W13U 2ALPA 4H4FA 1UW7A 4JK6A 4DCDA 3DUXH 1C5OH 1VKYA 1XUKA 1Y3VA 2GVFA 1O2NA 4K5ZA 2XC5A 3RXEA 1C5NH 7LPRA 1FIZA 1YC0A 3ZV8A 4GHTA 1UTLM 2BDHA 3FOAA 2AH4X 3K2UA 4B74A 1DX5M 4AZ2B 3RM0H 4J1YA 3LT3A 3EE7A 2XOKD 3BTME 3NRLA 1ELCA 1YPLH 1JOUB 3KCGH 3M5LA 4FU7A 1O31A 3BEUA 1EZUC 1YPKH 4A1VA 3MNXA 2EI7A 2NU1E 1GI8B 1GGDC 3ZZ9A 4NIWA 2BD4A 2ZHFH 1O3CA 1QL8A 1AB9C 4X1PU 3JZ1B 1LO6A 4ZHMU 2FXRA 1E38B 5I46H 2OK5A 3M7UA 6ESTA 3ZZ5A 2BY9X 2JKHA 1SQAA 2A5AA 3PV5A 5C94A 4HZHA 4WJG2 1L2EA 2Y81A 4WXIA 1TGSZ 3BG4C 2CJIA 3EA7A 3UOPA 1TIOA 3E6PH 3A89A 1T7CA 1HJAB 3ZYEA 3VB4A 1PQ5A 2H5CA 4X6MA 1FN6A 2ZEBA 4I8GA 3SHAH 3RXTA 2RDEA 2QXJA 3NXPA 3NKKA 3BG8A 3FP6E 1NPMA 1ORFA 1XKAC 1SVPA 3P8FA 3P17H 4R8TB 3SYJA 4WMEA 3U28C 3SV2H 2AS9A 2W3KA 3MHWU 4K1EA 4O97A 1IAUA 2WPKS 4Q80A 1WAYB 3PMBB 1PPBH 2GMTB 1MZAA 2BX4A 1NS3A 2NU2E 3KNXA 5FX5A 2GZ8A 5EGMA 3FP8E 2P3FH 5FPTA 3ATIA 3LGUA 1FI8A 2ZGXH 2F43B 3SU3A 3QGNB 1C1WH 1GI0A 3A7VA 2CHAC 2BYAX 1VITH 5IK2D 3QUMP 4XE4A 1W7XH 1AN1E 2PSXA 1JIRA 4I8KA 2WPJS 2ZHDA 3TNTA 1ACBE 1O3HA 1B7XB 2AERH 3SV7A 4BAQB 1F5KU 1HPGA 3D65E 1A3BH 1DSUA 2A32A 2JIZD 1HAPH 5HXFA 4Y10E 3ZYDA 4NIVA 3RLYH 3UQOA 1MAYA 1FN8A 4FOUC 1O2MA 2FYQA 2VH0A 2ZKSA 3DCLA 1KDQA 3F9GA 1S5SA 1SFIA 1VCQA 2ZU2A 1V2WT 4Q7YA 2Y5GA 1UTJA 4KTSA 3ATWA 4OS2A 4MTBA 3K9XB 2HALA 4A1TA 1TNHA 3EQ0H 1QBVH 1P03A 4WF8A 1BITA 2TGTA 4YM9A 4YO9A 2ZFTA 1FY3A 3PTBA 4ABJA 1EQ9A 1O2VA 3H5CB 8GCHF 4X2YA 4IMZA 4NZQA 2SGFE 2OXSA 1O3JA 1Y8TA 1BTZA 1RRKA 1EP6A 1ZGVA 4ASHA 5L2YH 2VWLA 5GIBA 1C1UH 3M61U 1QRXA 1V2RT 2K0QA 3FFGA 2F4LA 2QIQA 2FMJA 1XVMA 1FY8E 4NSYA 1BTPA 1GBBA 1DT2A 1GMHF 3VG8A 5J4SA 1FJSA 1G3CA 4H42U 3L6PA 1C2LA 1Z8JB 2H6MA 3MOCA 3P8GA 4CBNA 1T4VH 4DOQA 3RC6A 1O2JA 1XUGA 4NIYA 1K2I1 4IW4E 2W7UA 1AGJA 1AKSA 3VB5A 8GCHG 1W3CA 2WV4A 2W7SA 3PV2A 3UNQA 3UY9A 3MWIU 4X6NA 1A0LA 1F0RA 3RC5A 1FY4A 1VR1H 1EJAA 1ZTJA 2Q6FA 1TMTH 4X6PA 1C4Y2 1O2KA 1THSH 4FUHA 1GJ7B 1UCYK 3SJ8A 2FS9A 3UB0A 4I33A 3BV9B 1YPHC 1EZQA 2GV7A 4U01A 2PUQH 2Y80A 1FDPA 4YESB 4H6TA 1S6FA 2EI6A 1YF4A 1LMWB 1V6DA 2PKAB 3V13A 1BHXB 3CS0A 1QL9A 3F0PA 3PYHA 1SSXA 4HGCA 1AVWA 1ZMNA 2XW9A 1K1OA 2F9PA 5DG6A 3A86A 1GHVH 1P2OA 2M5TA 3SZEA 5GJ4B 2HGTH 1THRH 3DA9B 2NWNA 1Y3WA 4K2YA 1NROH 1OWHA 1VITF 4DIIH 3E91A 1MD7A 4CRDA 7GCHF 4KP0A 5T6FA 1GG6C 4BOHA 1HAVA 2Y7ZA 2V7QD 1F0SA 4I86A 1O37A 1YLDA 4O9VA 2HLCA 2HLDD 3RXAA 2O8WA 3IWMA 4RT0A 4Y71A 5JBBS 1SHYA 3F9HA 5FHTA 1GBDA 1KYNA 4B73A 1BBRK 2ZP0H 3A7TA 3SU0A 2KFWA 3RXQA 2OUAA 1MTNB 1THPB 4FUJA 1P0SH 2W26A 4ISHH 5FBIA 1QNJA 5T6GA 2ZQ1A 1TGCA 1F0TA 2OC0A 3URCA 2FO9A 1D6WA 5DP6A 4ZXYH 1UTNA 4CRBA 4MG3A 2OQUA 3M5MA 1XXDA 1VITG 1UK3A 1ABIH 2ZDMA 2ZPRA 1Y3YA 4DJZB 1OWEA 1PJPA 3SI3H 2CXVA 1MAXA 1C1TA 1O5FH 1P2JA 4IBLH 5FAHA 2ODPA 1ESTA 2SGQE 1UVUH 3JZ2B 4OGXA 3LGWA 2O8MA 3IG6B 4X0WU 1UCYH 2D1JA 1PPEE 4KTUA 9LPRA 2SGAA 1K1PA 1K9OE 2BXUH 3OYPA 2QF0A 1GI6A 3BTHE 4HI3A 1MH0A 4NGAH 1TRYA 2BD5A 4ABEA 4ACAA 1C2MA 5F6MA 2SGDE 1FONA 4NG9H 2BTCE 4WH8A 3SW2B 3U8RH 2ZC9H 1YLCA 4UE7H 5AHGH 3RXFA 4RT1A 1IQGA 2HPQH 2HOBA 2WYJA 3MH6A 1O5DH 3AASA 3MU0A 1MU6B 2LELA 4ZKOU 1AVXA 2L74A 1VZQH 1DDJA 4A5TS 5BRRE 2AMQA 1DVAH 1BMMH 1G37A 1EAUA 2ANKH 2BY8X 4ABAA 4DT7B 2K1QA 1SGRE 4RKOB 4FUFA 5EQRA 4LZ4B 1BTWA 2VWNA 3STJA 1YYY1 5AVDA 1TFXA 2YNBA 1GBIA 2G52A 3PWCA 2LNCA 1Z71A 3NUMA 1GI7B 2EQNA 3QTVH 3BTDE 1DM4B 2KCOA 2VIOA 2GT7A 3TJOA 4B1TA 1HIAA 1BBRH 3OFND 4BXWA 4K69A 3M37A 1P2QA 3QZRA 4CH8B 1O3LA 2Z9IA 1FLEE 5A2MH 3V0XA 8KME2 2OQ5A 3H7TA 1FQ3A 1KLTA 3HATH 3RU4T 4RKJB 1O2LA 1SLUB 2EA3A 1GBMA 1TOMH 1O5EH 4ZKRU 1AWHB 1YBWA 3KIDU 2BXTH 3OU0A 1UVSH 1S83A 1WU1A 4O3TA 5ETXA 1C2IA 1TX6A 3STIA 3UR6A 3UTUH 1AUTC 4OM9A 1DY8A 2GDDA 2VB0A 3RU4E 1A5HA 3MMGA 2R0LA 1BJUA 1GJ4H 1PYTC 1Y5BT 1P9UA 3OEHD 3SV9A 1XKBC 2TBSA 5T3HA 3SQHE 1NBME 2XCNA 3SHCH 1ELGA 3TGIE 4INHA 1VCPA 2ZU5A 4IGDA 1O2QA 2A2XH 4D76A 2RA0A 3C1KA 1C2HA 1FXYA 1TX8A 3RMLH 2ZTYA 4MNYA 2BZ6H 2M2AA 5DSFA 1ZZZA 3OEED 1NESE 1OPHB 2EEKA 1DY9A 1XUJA 2GMTC 4Y7BA 1OHHD 1EPTA 1S82A 1L0ZA 4ESTE 1F2SE 1BRCE 1HYLA 4FUBA 5C0TA 2CMYA 1UCYE 2H2ZA 1QCPA 4WMDA 1TA6A 3NPSA 2OLGA 2BOKA 1T8NA 1ZGIA 4RN6A 3FZDA 1HJ9A 4UEHH 1TRMA 1NY22 2H9TH 4GCHF 5DP8A 4X8UH 1K1LA 1G36A 1SI5H 3N7EA 3CS7A 3OY6U 4TWWA 4XFQA 4MPXA 2VVVA 4YXWD 1GBJA 1CA0B 3QK1A 3VXFH 1BUIA 1MKXK 3MO3A 2NU4E 4WH6A 2BLQA 1FZZA 3RMMH 1MD8A 3U1IB 3QTOH 4ABIA 2IOTA 1A0HB 4O03A 8ESTE 1QIXB 2A7JA 4JZFH 2CF8H 1BZXE 4CH2B 1OXGA 3GY2A 2G4UA 1JRSA 1P2MA 3SNCA 1GJCB 1ZSJA 3OSYA 5E2OA 1HUTH 1L1JA 2D8WA 2TGPZ 3RXUA 1TPOA 1YPHE 1O2GH 4FUGA 1MCTA 4YOJA 4BXSA 3TU7H 7ESTE 4GCHG 1LCYA 1FY5A 2LPRA 1KXDA 2A4GA 2BM2A 1BBRE 2CF9H 1UTOA 2FWWA 5HMAA 1TX7A 3IITA 1SQRA 1A0JA 3M7TA 4DW2U 1Z1IA 4XDEA 5KEDA 1XUHA 4NFEA 3T29A 1ELBA 1C9PA 2JDID 4OGYA 3SQEE 2ZDLA 1UK2A 4ZMAH 1GDQA 5EJLA 1J16A 2FM2A 2XNIA 1BIOA 2Z3EA 1O3FA 3GDUA 1VJ9U 2PTNA 1F7ZA 1TNIA 2V0BA 1HJ8A 3GDVA 1O2XA 1V2PT 1C5TA 3UOUA 3UREA 1E1QD 4F4OC 2J9NA 3EA9A 4AB9A 1CHOF 4FUCA 3VPKA 5A09A 1C4U2 1WYKA 2C8XB 1SOTA 3RMNH 1C5YB 2FLBH 3BTEE 1NN6A 1O0DH 2ZFPH 4MNWA 3ZIAD 5FBEA 3SNDA 2RG3A 1TE0A 4DVAU 3ZZCA 2QCYA 2F9OA 1X7AC 2VVCA 4AG2A 2IJOB 5E0JA 4BTUB 4D9RA 3GISB 1O2IA 1H8IH 2ZHEH 4WVPE 1DICA 2BVXH 3Q3XA 5HGGA 5HKKD 2JH5D 2GP9B 3ODFA 4RSPA 1XXFA 5HM9A 2ZFRH 1V2TT 4X1SU 4HG6A 1IQKA 5ESBA 2ZZUH 3M3SA 2DE8A 2F9BH 1GJBB 3TITA 2THFB 3UWJH 2AFQB 2FX6A 3P6ZB 1CGHA 1CHOG 1Z1JA 1IQHA 1KY9A 2IJD1 3ZVBA 3KQEA 2WUCA 1C5PA 2YMSC 1EUFA 2H9EH 1RTFB 1AUJA 1J14A 2J94A 5DJ7A 3CP7A 1PPFE 4THNH 1O2YA 1DUAA 2VIWA 4GSOA 2FS8A 4K8BA 3TH4H 4Y79A 4X8TH 2UUKB 3PMJA 4Y6DA 1O3PB 4A1XA 2KCYA 5SGAE 1TAWA 2FI5E 2ZHWH 1YPEH 1DITH 4OS4A 1UTPA 3T25A 1B5GH 1MUEB 3QGJA 1GBKA 4AC9A 4X6OA 3GICB 1O2SA 5DP4A 2Y82A 1BQYA 2FOMB 1WOFA 4OS5A 2FOEA 1HAZB 1D4PB 1Z7KA 3VXEH 2FOCA 2R2WU 2BD9A 2XWBI 3F0OA 1NFYA 3HGPA 3K65B 3ZVDA 2VGCB 1MQ5A 1MTNC 1N8OB 2TGAA 3SNEA 2O8UA 5E8EH 4A92A 1GDUA 1ETRH 1P3EA 2PKAA 3BTWE 1CU1A 1GL0E 4WMFA 3S69A 2J97A 1GHBF 4INKA 1BOQA 1HAOH 1AQ7A 1DANH 1TPPA 3FP7E 3U1JB 2XBYA 1Q3XA 2G81E 1G32B 3UIRA 1O5GH 3LC3A 1SBWA 4DY7B 5EJ1A 4MPVA 3WW7A 1FV9A 3SZNA 2FLRH 2ALVA 3OTPA 3NCLA 5F8XA 4B2CA 5C17A 3U98H 3HKIB 3BTTE 1C5XB 1GDNA 1UVOA 5EQQA 1OYTH 2B0FA 5A0CA 4AX9H 4U30A 4AOQA 2I6QA 5A0BA 2WYGA 1GL1A 1NTPA 2BQ6B 1PQ8A 2OTVA 5TCCA 3BN9A 1NRPH 5JBCS 2C90B 4BAHB 5C20A 3WWBA 2WHXA 4JYTA 1EFRD 2HWLB 4VGCB 1EJMA 2ZQ2A 2KM0A 1QGFA 4K1TA 1GBLA 2UWLA 1MBMA 5L6NH 2XNDD 2ZECA 2ZTZA 2CV3A 2AMPA 1CT4E 2BOHB 2QV1A 1C1MA 5B6LA 3KEEA 1OP8A 2BQ7B 1IHSH 1H9IE 2BX3A 1FX0B 1GVZA 1PPHE 4ABGA 1OX1A 3MH5A 5DP7A 5J4QA 1GCTB 3LOXA 1ANEA 2SFAA 4DURA 1O3EA 1S6HA 2V3OH 5ESTE 1S84A 3SU1A 2ZTXA 4BTTB 1C2JA 2ESTE 5AFYH 1MMJN 1O3IA 1C1PA 4HTCH 2FOGA 1LVOA 2C93B 4UD9H 4AFSA 1TNGA 5HIZA 1TQ7B 4D7GA 1Q31A 2ZA5A 1L1GA 3GS9A 2PHBA 2BD3A 1P10A 3RXPA 2L6OA 2OC7A 5C1XA 1O33A 3ATKA 4KGAA 4X1QU 5DN6D 1TB6H 4Y8YA 3FANA 4YTAA 1AO5A 1A2CH 1RIWB 2H5DA 5CHAC 3PTNA 3GY3A 1MZDA 2Y5HA 3DSGA 1AFEH 2J2UA 1WTGH 1GJ6A 3A81A 4ZCNA 2J34A 3KYFA 3QDZB 3T27A 4DGJA 1WQVH 2Z3CA 2HNTC 1P2IA 1WSSH 1JMOH 3DFJA 3ITIA 1TMUH 3TJUA 1U6QA 1F0UA 4FETA 4WY3A 2QC2A 3LKWA 1D3QB 2ZGHA 1FPCH 2DUCA 2XTTB 3FVFB 3RXSA 3MO6A 5L2ZH 3BTKE 2PTCE 4JCNA 2EY4C 2KR7A 4XBCA 5EJZA 2RA3A 4BAMB 4I8LA 2VWOA 2A1DB 3ZZ3A 1P05A 3RXKA 4CHAB 3EAJA 3SN8A 2YOLA 1LDTT 3AW0A 3QWCH 2HRVA 1ZSKA 3E8LA 3S0NA 3BSQA 2QA9E 5GWZA 2OCVB 4YT7H 4B71A 1GPZA 1ZMLA 2ZCKP 2FOAA 2WPMS 3RXLA 2QF3A 2NU3E 1GMHG 2KZ4A 1BTHH 3VGCB 4JYVH 1TNLA 4XBBA 1FAKH 1P06A 1UHBA 4E7RG 3LH1A 1HV7A 2JH6D 3O8CA 4BAKB 3SOSA 4H6SB 1O3BA 1TOCB 1GI4A 1TGBA 1YWUA 1UK4A 2P16A 4O3UA 1ANBA 1O5AB 3K6ZA 1HCGA 4MDSA 1A1RA 2VVUA 1H8DH 4GLYA 1NU9A 1QBOA 4NCYA 1OOKB 1C1OA 4NIXA 2G4TA 3GCHB 3TLOA 5JDUB 1SFQB 2OP9A 1OWKA 2Z9JA 1IQIA 2A7HA 2TPIZ 1DWEH 1NT1A 5AF9H 1UVPA 2IPHA 4ZXXH 1C2KA 2AGIX 3PB1E 2FZZA 1HDTH 2ZG0H 5GPIB 1LHDH 1ARCA 3V7TA 1JBUH 3BIVH 2XWAA 3ZVAA 4AB8A 3RXRA 3PWBA 4ISIH 2VIQA 4JYUH 2W6ID 3BTGE 1NC6A 3O8BA 4Q2KA 3A8DA 1CO7E 1RS0A 3KN2A 1HAGE 1C5VA 1KXFA 1ZHMA 3KGPA 4OS6A 3ZZ6A 1OKXA 1W0YH 2H1UA 1W0KD 1O2PA 1LHFH 3N7OA 1Z8IB 1TABE 1J17T 1ZRBA 4ABBA 1GGDB 1RTKA 1ZSLA 3PROA 4ISOA 4JK5A 1BTUA 2FP7B 1C5MD 4GPGA 2HPPH 1NZQH 1BHXF 2Q6GA 2QYIA 2FTMA 2STBE 5F53A 4CR9A 7GCHG 2STAE 3GY8A 1C2GA 4AFUA 2ZU4A 1QR3E 3F68H 4TY6A 3ESTA 4M7GA 5C1YA 4ABDA 2QXIA 4TT3D 1TQ0B 1RTLA 1GBTA 2GDEH 1Y5UT 2PR3A 4K8YA 3SBKA 5IDKA 2BY5X 4LZ1H 2A0QB 1SGPE 1P57B 2BDYA 1ZPCA 4LXBH 4I7YH 5TCAA 4INLA 3G01A 1GJ9B 3ZZ8A 1OYQA 2G5NA 1LVYA 2VWMA 1MU8B 1W0ZU 1OP0A 4ZHAA 1NBMD 3LDXH 1Z8RA 4K60A 2P93A 3T5FH 3A8AA 5DP5A 1ELFA 5PTPA 1C5LH 1WDIA 4B6EA 1YGCH 2HVXA 3FO8D 4IC5A 1TALA 2ZDAH 5EODA 2P94A 4ISLA 2Z9KA 3EA8A 1TRNA 3GY7A 2C8WB 5GCHF 1J8AA 1KLJH 4ACBA 2BD8A 1YCPK 1V2MT 1IHTH 1GBEA 3S7KB 2WUBA 3CNRA 1E79D 1O32A 1ZHPA 2ULLA 1T8MA 4TY7A 1GHZA 1DLEA 2AYWA 2QY0B 4Z1MD 2PKSB 4X1RU 2GJGA 1EAXA 3M5NA 2A31A 1L1NA 3TPIZ 1NRRH 2GZ9A 3RDZA 3RC4A 3RXIA 4CRCA 2ZDNA 3Q3YA 3DHKH 9ESTA 2BVRH 3RUOA 4CBOA 1GWAA 4U32A 1SOZA 1S85A 2VBCA 1CT2E 3N7DA 1WUNH 2R0KA 1O2UA 1TWXB 3R0FA 3AAUA 1BTXA 1O3AA 3QO6A 3MU1A 2VGCC 1F5LA 1OP2A 1OWDA 1Z6JH 1N8OC 2V3HH 1EX3A 4BANB 1YM0A 4NFFA 4TSFD 1C5QA 1H4WA 2J98B 1YLNA 1EZXC 2KAIA 3F1SB 5E0GA 4DIHH 2WV9A 5DO4H 2Q6DA 1ZTKA 3E0PB 1HJAC 1SQOA 1K0HA 1H8HD 1W12U 5A0AE 1ANDA 1W8BH 4FXGH 3U8OH 4IS5A 3SJ9A 4TWYA 1MTVA 4D9QA 3H7OA 3DD2H 1GMCF 1IQNA 2G00A 1D6RA 1C1QA 2R3YA 1FY1A 1AWFH 2QN5T 4KELA 5JBTA 3RLWH 3OE7D 4TYDA 4X8VH 2VJ1A 5KECA 2P3TB 3HK3B 5C1UA 3ODDA 3D23A 3LGYA 3RXVA 5K7RA 1YCPH 1BDAA 2P59A 3F3BA 1MBQA 2P8OB 5EQSA 3LJJA 4E05H 4ZH8A 1P04A 4AORA 5EPNA 2A4QA 3F2FA 1SQTA 4UONA 3PMAB 4Y76A 2P95A 3TGKE 1C1NA 1UJ1A 4VGCC 1HAVB 3D62A 2YNAA 3AK5A 1F92A 2CK3D 3LONA 2AEIH 3L3TA 2HNTF 4ZKSU 1SPJA 2R9PA 1LVMA 3AW1A 1GJ5H 3M36A 3U9AH 3MFJA 1VJAU 1AE5A 1HAIH 4UFDH 1QRZA 4Y8XA 2NU0E 2FIRH 1ETTH 2ZGCA 1ZJKA 2ZCHP 3SU6A 4MLFB 4CR5A 1GCTC 3PRBA 2EI8A 3LIWA 1G3EA 3OX7U 1CGJE 2ZDVH 4FVBA 1TNJA 1E36B 1LQEA 1TBQH 2ASUB 1AVGH 2XC0A 4Y0ZE 2BZAA 4NWKA 1UO6A 2ZCLP 1YPJH 2OBOA 1AD8H 1QFKH 4X2VA 1KXEA 3C27B 3Q76A 5JB9S 2A5IA 1A5GH 1G30B 1KMHB 1SGFA 3MNBA 5G4BA 3OY5U 1NRSH 1BT7A 1GG6B 1RIWC 1V2NT 4IN2A 2BB4A 1O36A 2XXLA 1QA0A 2ZNKH 3HGNA 2FESH 2RDLA 1TNKA 5GDSH 1C5SA 1GI5A 4Q7ZA 3KF2A 3P70B 1QJ1B 4DG4A 1QURH 5KGOA 2GZ7A 3SJOA 2ZHQH 5F8TA 2ZO3H 4I8HA 2BD2A 1AY6H 4NWLA 2VIPA 3TK5A 1DSTA 1TBZH 1N6XA 1OWJA 1P02A 3BTQE 3A88A 3OTJE 2Y6TA 6CHAB 2SNWA 2BLWA 1EOJA 2JJ2D 4Y11E 2A4OA 3KYGA 5IYTA 1BRUP 2ANMH 3P95A 1NFUA 1GHAF 1EJNA 4F49A 5BPEA 2PLXA 3ZZBA 4CHAC 3ZZAA 3RMOH 2WSSD 2C8ZB 3I29A 1MABB 1E35B 1O2ZA 2WPLS 1XVOA 1HAYB 2GT8A 4OS7A 5HM2A 2ZFQH 3DSOA 3LJOA 3UNSA 1BMNH 3TH3H 1N1LA 4ZKNU 2AGGX 3RXMA 4JZ1A 5EIYA 1AIXH 5EG4A 3E0NB 1KTTB 2BDCA 2PGQB 3VGCC 2ODYB 2A5KA 3GY6A 1JRTA 1C5UA 2PGBB 2R3UA 1DPOA 3LU9B 4I8JA 3TJNA 3GCNA 2JETB 2CGAA 4SGAE 1LKAA 5HIYA 1YY3A 1TLDA 2BD7A 4NZLA 1QL7A 1BA8B 5DP3A 5CMXH 1PPCE 2GX4A 1EP5A 2IPQX 1GBCA 1ZLRA 1LHGH 1GHAG 1ZMJA 4WWYA 2FEQH 3BEFB 1BCUH 5F03A 4CREA 4JZDH 5DK1A 3GCHC 1ANCA 1H8ED 2G5VA 4P00A 4F48B 5CE1A 1BJVA 3SJKA 1CQQA 3SV8A 4J2YB 1G2MA 2TRMA 3SU4A 4AN7A 1SLVB 1FIWA 1GJDB 5C2ZA 1V2LT 3WWFA 2O8TA 3DSPA 1K28D 1SMFE 4NA7A 4Q4LA 3RP2A 3E1XB 1QQUA 1H9HE 2GCTB 1Y3XA 2Y7XA 2Z7FE 3S9CA 3M5OA 3F2HA 1P09A 5GXPA 2XRCA 3T28A 1Y59T 4Z6AH 1P3CA 1T8OA 2AGEX 1QB9A 1NFWA 1RFNA 4MVNA 2LP6A 1ELAA 4Q7XA 3LPRA 3GDSA 1EPTB 4AYVB 1V2OT 2F9VA 1PPGE 1TGNA 3SUEA 1TPSA 4Z0KA 1EB1H 1LHCH 1RD3B 1KXCA 1O30A 1W2KH 1BMLA 1DWCH 1UMAH 1A4WH 3Q00A 1OSSA 3SJIA 1T31A 4WXVA 3TVJB 3K6YA 3A83A 3H09A 1GHWH 4ZUHA 8LPRA 1ZOMA 1Q2WA 4E06H 5DGJA 5LPFA 1EB2A 3B9FH 2WPIS 3EGKH 1JXPA 1BB0B 4PROA 1WQSA 2ZGBH 1GCDA 4AG1A 1TGTA 1O2WA 1SR5C 3GCTF 2PV9B 2F91A 3A8BA 1W14U 3Q3KA 1XMNB 4MNVA 1ZYOA 2QXGA 4TPIZ 2HVYB 1GJAB 1J9CH 1Z8GA 1LHEH 1M9UA 2WINI 5TJXA 3U8TH 1AZZA 3L33A 2QF5A 2CN0H 5K0HA 3PV4A 3MYWA 1W0JD 1GHBG 4BNRA 1S0RA 2GKVE 1BRBE 2GGVB 1NU7B 1VGCB 1C2FA 1D3PB 3GYMA 1ZPBA 1O35A 3ATMA 1IQLA 4D7FA 3ZZ4A 1IQMA 4I32A 1E37B 3GOVB 3NZIA 1V2UT 4P02A 3KQDA 2AIQA 1HB0B 5T1VA 2KX4A 5FCKA 3GCTG 4HFPB 2TIOA 3MU5A 1B0FA 2V6NA 3MH7A 1AE8H 5CHBA 2ZU3A 1GI1A 3V3MA 1P11E 2PKSC 3M3TA 1SLWB 2SGEE 1MCVA 4IMQA 4ASUD 2OC8A 2ZGJA 1WV7H 4F55A 4U2WA 1COWD 3MU4A 2OINA 1EKBB 2FPZA 1E0FD 1KLIH 5A8YA 4CRAA 1JWTA 3E16B 4A7IB 2BY7X 2BMGB 2WPHS 1ZHRA 2I6SA 3UNRA 1PPZA 4X2XA 3CENA 1HAHH 2UUJB 2OD3B 1FPHH 1QJ6B 4B2BA 2PWXA 3KQ5A 1CA8B 3BIUH 1NRNH 1YCPM 2ZPQA 1CBWB 4AYYB 1LKBA 1DUEA 1KIGH 2SGPE 5C3NA 2BLVA 2EC9H 1LTOA 1MKWK 1A46H 1G2LA 1RGQA 3T26A 1RJXB 1GJ8B 1AFQB 2V3MA 1INCA 1HAXB 1P12E 1QB1A 2B9LA 2FI3E 5EXNA 2PSYA 1AMHA 2Z6BD 3UUZA 3GCOA 1EATA 2YMSD 2XBXA 3UFAA 3PLBA 1KXAA 1T8LA 1SGFG 1DXPA 3A7WA 3SO3A 1DWBH 3A7XA 1QB6A 2VU8E 3P92A 2FI4E 1O39A 1PQAA 3DFLA 3OAAD 3TK9A 1DOJA 2A2QH 1S81A 5FPYA 2ZU1A 3FAOA 3PO1B 7KMEH 1SGYE 1IQFA 2ZFSA 4M9FA 2K8IA 1HXFH 3ENSB 2P8OC 3PLKA 1ELDE 1P01A 2BQWB 1SGCA 1FNIA 1L4DA 3ZVFA 1PQ7A 1ETSH 1V2VT 4BAOB 2OBQA 1PFXC 1NM6A 2KCAA 1ZRKA 2UWOA 3MU8A 1ZJDA 1CA0C 1DFPA 1B0EA 4X2WA 2J5UA 1O2HA 3SGAE 2VIVA 2J98A 3RXBA 5LPRA 4AFZA 1GVKB 2G55A 3RXOA 3RXCA 1S6LA 4ABHA 3TGJE 2FTLE 4GUXA 5C5OA 1EAIA 4JZIA 3UQVA 4AGKA 1ELVA 1SGQE 3MNSA 1O3GA 4IC6A 3LC5A 1FUJA 5FCRA 2YMSB 4YT6H 1GI9B 1ID5H 2ZPSA 3ELAH 1KSNA 4TPYA 4FUEA 1F5RA 2GV6A 1TYNA 1NRQH 1UVTH 4YLUA 2FX4A 1S0QA 1LVBA 1O3OA 1G3BA 1UTQA 1MKWH 5B6OA 1O2OA 1FMGA 3O8RA 4UDWH 4Y7AA 1O2TA 1E34B 1QY6A 5HYOA 3M35A 4YOGA 1O3MA 1FAXA 1G3DA 3PLPA 4A6LA 1ZPZA 1ESAA 4R0IA 1SKYE 2XBWA 1D3TB 1MTUA 3NK8A 3SUGA 6GCHF 1C1SA 2ODQA 4XD7D 1GI2A 3MO9A 2QGRA 2ZWLH 1D9IA 2KCPA 2WPDD 4MNXA 1TBRH 3T2NA 1AB9B 1BMAA 1ZR0A 3S9BA 1C5WB 4ISNA 4XOJA 3TNSA 1QZ8A 1XX9A 5FL7D 2G51A 3N99A 4X1NU 6LPRA 3FZZA 1P9SA 1O34A 2A4RA 4X8SH 3SV6A 2BHGA 1Z6EA 3SNBA 3F6UH 3BG4B 1QTFA 6CHAC 5DKMA 2W6JD 1SGNE 1D3DB 4GHQA 5GNDA 1K21H 2OC1A 4MPWA 3U69H 1EZSC 1UTKA 3A7ZA 5EXLA 3RU4D 2GTBA 3VEQB 1KXBA 1GBHA 2Z9GA 1SGDE 2BDGA 2D26C 1P2KA 1KDQB 1W10U 1JIMA 1AI8H 4Y8ZA 5JB8S
chains in the Genus database with same CATH topology
6GCHG 1O3DA 4ZAEA 4JZEH 5FXLA 2O8LA 1G9IE 3LGIA 2QXHA 2ZI2H 3UR9A 2PUXB 3D49H 2ANYA 3E90B 4NSVA 2ZF0H 1QRWA 4MQAA 2JH0D 1HNEE 4ZHLU 2AIPA 1Y5AT 1WBGB 3B23B 2BDIA 3RXDA 1SGIB 2CHAB 4CRGA 2JETC 1XM1A 4ABFA 5EXMA 1HGTH 1HXEH 1LPGB 1HLTH 4CRFA 1K1NA 3HK6B 2ZIQH 3S7HB 2XYAA 1TPAE 1ELEE 5A8XA 2BY6X 1EOLA 5EOKA 3SU2A 5A8ZA 3URDA 3I77A 2UWPA 1AHTH 1T32A 2W3IA 1W7GH 1GHXH 1SGEE 1SC8U 3QLPH 1CVWH 4XBDA 5LH8A 1DXWA 1HRTH 1O3KA 2C8YB 1C2DA 4B76A 1C4V2 1O38A 5E2PA 1AKSB 3T62A 5GCHG 1YPMH 1H1BA 3F9EA 4LOYH 2GCTC 4NA8A 1A3EH 3TK6A 4E7NA 5F8ZA 3V12A 5LPEA 5EW1H 1CGIE 4YZUA 3VFEA 1C5ZB 3HKJB 4YOIA 3QN7A 2J4IA 3RXHA 4FUDA 1SHHB 1K1IA 2VINA 1A7SA 2UUYA 3BF6H 4B2AA 4JMYA 5FPSA 1EPTC 3BEIB 3GY4A 1QA7A 2XC4A 4I31A 5CHAB 5C67A 2B8OH 2Y5FA 2AMDA 5T6DA 3I78A 2P3UB 1W11U 4FUIA 3NWUA 2VIDA 1O5BB 1C1VH 1LPZB 3UPEA 3B8JA 1UHBB 5I25A 2Z9LA 1K1JA 5AFZH 3A87A 2O9QA 1ZTLA 3SGQE 3W94A 1YPGH 1A5IA 1OWIA 1MTSA 3SI4H 4BTIB 2FOFA 5EW2H 1L4ZA 2BDAA 4Y0YE 3E3TA 2C4FH 4K1SA 1BTYA 4IN1A 1EAWA 2IN2A 5JPMH 3EYDA 1SG8B 3KL6A 3ZZ7A 1CE5A 3SGBE 3A7YA 2SNVA 1K22H 3PMHB 1KTSB 2ZFFH 2HNTE 5FX6A 3A80A 2A7CA 2H9HA 1GBFA 1HFDA 1O5CB 3TJVA 1EASA 1QBNA 2F3CE 3A82A 2B5TB 1WTHD 1SLXB 2F9UA 1V2ST 1WCZA 4KTCA 5ABWA 2FODA 4AGJA 1VGCC 1TONA 3LH3A 3SORA 1ESBA 1O3NA 2XBVA 3SUFA 4B75A 3P8OA 3SNAA 2FYRA 1V2QT 1IOEA 1GMCG 5C5NA 2BDBA 1TA2A 3LGVA 2DE9A 4QT8C 3W95A 3KQCA 1OS8A 1XUFA 1C5RA 5JBAS 1ARBA 4GVUA 4UFGH 2RCEA 5E0HA 5H4IB 1DS2E 2BVSH 1T4UH 2Z94A 2FOHA 1O2RA 4K3JA 1QJ7B 2J38A 2VH6A 3ZVGA 1QHRB 2TGDA 1ABJH 3M3VA 1ELTA 4SGBE 4ZROA 1GHYH 3KQBA 1IQJA 3TIUA 1P2NA 3ZZDA 3QZQA 4AFQA 1MTWA 3GY5A 3ZV9A 3ZVEA 4FU8A 3P8NA 2GD4B 5EU8A 2B7DH 1DLKB 4D8NA 1UTMA 4XSKU 3VB3A 1DE7H 1GBAA 1N6YA 1NO9H 3F9FA 2J95A 3QX5H 3SUDA 3S9AA 1RXPA 3VB6A 1C1RA 1LPKB 3AVZA 5DPAA 3AAVA 3M7QA 1CBWC 4OS1A 2FOBA 2Z3DA 3BTFE 3R3GB 1Y3UA 2FDAA 1NFXA 1V3XA 3GYLB 1YP9A 3MTYA 2GCHF 1AFQC 1A61H 2PFEA 3O8DA 3VB7A 3ZVCA 1QQ4A 1HBTH 3A85A 1DWDH 1CSOE 2ZDKA 2Q1JA 1CHGA 1C9TA 1GMDF 2D2DA 3DT0H 4UFEH 5DP9A 1SL3A 2V35A 2A45B 4YLQH 2XCFA 1IQEA 4KKDA 4LK4A 4FVDA 1K1MA 2ANWA 3WY8A 4MPUA 5LGOA 2VNTA 1AU8A 1HIAB 3PO1C 1EXFA 1CT0E 2F83A 1J15A 2WV5A 3KHVA 2C3SA 5EPYA 3MI4A 1GI3A 5JYIA 3EE0B 2BLOA 1AZ8A 1YKTA 1GVLA 1V2KT 5L30H 1MQ6A 1XUIA 3UWIA 3ATLA 2GCHG 3Q77A 3RXGA 3MNCA 1SGTA 1P8VC 1C2EA 4FU9A 3MH4A 1MKXH 2J92A 1TMBH 3TH2H 1V2JT 3RM2H 3A84A 1GMDG 3PM3A 2W5EA 2F9NA 2G8TA 3SU5A 3A8CA 1BRAA 1SB1H 3EDXB 4GAWA 4UFFH 1H9LB 2UUFB 1LQDB 2R2MB 3RXJA 2QAAA 1PYTD 3HPTB 2ILNA 2PW8H 1VCWA 4NA9H 2KAIB 3LGTA 1W13U 2ALPA 4H4FA 4JK6A 4DCDA 3DUXH 1C5OH 1XUKA 1Y3VA 2GVFA 1O2NA 4K5ZA 2XC5A 3RXEA 1C5NH 7LPRA 1FIZA 1YC0A 3ZV8A 4GHTA 1UTLM 2BDHA 2AH4X 3K2UA 4B74A 1DX5M 4AZ2B 3RM0H 4J1YA 3LT3A 3BTME 1ELCA 1YPLH 1JOUB 3KCGH 3M5LA 4FU7A 1O31A 3BEUA 1EZUC 1YPKH 4A1VA 3MNXA 2EI7A 2NU1E 1GI8B 1GGDC 3ZZ9A 4NIWA 2BD4A 2ZHFH 1O3CA 1QL8A 1AB9C 4X1PU 3JZ1B 1LO6A 4ZHMU 2FXRA 1E38B 5I46H 3M7UA 6ESTA 3ZZ5A 2BY9X 2JKHA 1SQAA 2A5AA 4HZHA 4WJG2 1L2EA 2Y81A 4WXIA 1TGSZ 3BG4C 2CJIA 3EA7A 3UOPA 1TIOA 3E6PH 3A89A 1T7CA 1HJAB 3ZYEA 3VB4A 1PQ5A 2H5CA 4X6MA 1FN6A 2ZEBA 4I8GA 3SHAH 3RXTA 3NXPA 2QXJA 3NKKA 3BG8A 3FP6E 1NPMA 1ORFA 1XKAC 1SVPA 3P8FA 3P17H 4R8TB 4WMEA 3SV2H 2AS9A 2W3KA 3MHWU 4K1EA 4O97A 1IAUA 2WPKS 4Q80A 1WAYB 3PMBB 1PPBH 2GMTB 1MZAA 2BX4A 1NS3A 2NU2E 3KNXA 5FX5A 2GZ8A 5EGMA 3FP8E 2P3FH 5FPTA 3ATIA 3LGUA 1FI8A 2ZGXH 3SU3A 3QGNB 1C1WH 1GI0A 3A7VA 2CHAC 2BYAX 1VITH 3QUMP 4XE4A 1W7XH 1AN1E 2PSXA 1JIRA 4I8KA 2WPJS 2ZHDA 3TNTA 1ACBE 1O3HA 1B7XB 2AERH 3SV7A 4BAQB 1F5KU 1HPGA 3D65E 1A3BH 1DSUA 2A32A 1HAPH 5HXFA 4Y10E 3ZYDA 4NIVA 3RLYH 3UQOA 1MAYA 1FN8A 1O2MA 2FYQA 2VH0A 2ZKSA 1KDQA 3F9GA 1S5SA 1SFIA 1VCQA 2ZU2A 1V2WT 4Q7YA 2Y5GA 1UTJA 4KTSA 3ATWA 4OS2A 4MTBA 3K9XB 2HALA 4A1TA 1TNHA 3EQ0H 1QBVH 1P03A 4WF8A 1BITA 2TGTA 4YM9A 4YO9A 2ZFTA 1FY3A 3PTBA 4ABJA 1EQ9A 1O2VA 3H5CB 8GCHF 4X2YA 4IMZA 4NZQA 2SGFE 2OXSA 1O3JA 1Y8TA 1BTZA 1RRKA 1EP6A 1ZGVA 4ASHA 5L2YH 2VWLA 5GIBA 1C1UH 3M61U 1QRXA 1V2RT 3FFGA 2QIQA 2FMJA 1XVMA 1FY8E 4NSYA 1BTPA 1GBBA 1DT2A 1GMHF 5J4SA 1FJSA 1G3CA 4H42U 3L6PA 1C2LA 1Z8JB 2H6MA 3MOCA 3P8GA 4CBNA 1T4VH 4DOQA 3RC6A 1O2JA 1XUGA 4NIYA 1K2I1 4IW4E 2W7UA 1AGJA 1AKSA 3VB5A 8GCHG 1W3CA 2WV4A 2W7SA 3UNQA 3UY9A 3MWIU 4X6NA 1A0LA 1F0RA 3RC5A 1FY4A 1VR1H 1EJAA 1ZTJA 2Q6FA 1TMTH 4X6PA 1C4Y2 1O2KA 1THSH 4FUHA 1GJ7B 1UCYK 3SJ8A 2FS9A 4I33A 3BV9B 1YPHC 1EZQA 2GV7A 4U01A 2PUQH 2Y80A 1FDPA 4YESB 4H6TA 1S6FA 2EI6A 1YF4A 1LMWB 1V6DA 2PKAB 3V13A 1BHXB 3CS0A 1QL9A 3PYHA 1SSXA 4HGCA 1AVWA 1ZMNA 2XW9A 1K1OA 2F9PA 5DG6A 3A86A 1GHVH 1P2OA 2M5TA 5GJ4B 2HGTH 1THRH 3DA9B 2NWNA 1Y3WA 4K2YA 1NROH 1OWHA 1VITF 4DIIH 3E91A 1MD7A 4CRDA 7GCHF 4KP0A 5T6FA 1GG6C 4BOHA 1HAVA 2Y7ZA 1F0SA 1O37A 1YLDA 4O9VA 2HLCA 3RXAA 2O8WA 3IWMA 4Y71A 5JBBS 1SHYA 3F9HA 5FHTA 1GBDA 1KYNA 4B73A 1BBRK 2ZP0H 3A7TA 3SU0A 3RXQA 2OUAA 1MTNB 1THPB 4FUJA 1P0SH 2W26A 4ISHH 5FBIA 1QNJA 5T6GA 2ZQ1A 1TGCA 1F0TA 2OC0A 3URCA 2FO9A 1D6WA 5DP6A 4ZXYH 1UTNA 4CRBA 4MG3A 2OQUA 3M5MA 1XXDA 1VITG 1UK3A 1ABIH 2ZDMA 2ZPRA 1Y3YA 4DJZB 1OWEA 1PJPA 3SI3H 2CXVA 1MAXA 1C1TA 1O5FH 1P2JA 4IBLH 5FAHA 2ODPA 1ESTA 2SGQE 1UVUH 3JZ2B 4OGXA 3LGWA 2O8MA 3IG6B 4X0WU 1UCYH 2D1JA 1PPEE 4KTUA 9LPRA 2SGAA 1K1PA 1K9OE 2BXUH 3OYPA 2QF0A 1GI6A 3BTHE 4HI3A 1MH0A 4NGAH 1TRYA 2BD5A 4ABEA 1C2MA 5F6MA 2SGDE 1FONA 4NG9H 2BTCE 4WH8A 3SW2B 3U8RH 2ZC9H 1YLCA 4UE7H 5AHGH 3RXFA 1IQGA 2HPQH 2HOBA 2WYJA 3MH6A 1O5DH 3AASA 3MU0A 1MU6B 4ZKOU 1AVXA 1VZQH 1DDJA 4A5TS 5BRRE 2AMQA 1DVAH 1BMMH 1G37A 1EAUA 2ANKH 2BY8X 4ABAA 4DT7B 2K1QA 1SGRE 4RKOB 4FUFA 5EQRA 4LZ4B 1BTWA 2VWNA 3STJA 1YYY1 5AVDA 1TFXA 2YNBA 1GBIA 2G52A 3PWCA 2LNCA 1Z71A 3NUMA 1GI7B 3QTVH 3BTDE 1DM4B 2VIOA 2GT7A 3TJOA 4B1TA 1HIAA 1BBRH 4BXWA 4K69A 3M37A 1P2QA 3QZRA 4CH8B 1O3LA 2Z9IA 1FLEE 5A2MH 3V0XA 8KME2 2OQ5A 3H7TA 1FQ3A 1KLTA 3HATH 3RU4T 4RKJB 1O2LA 1SLUB 2EA3A 1GBMA 1TOMH 1O5EH 4ZKRU 1AWHB 1YBWA 3KIDU 2BXTH 3OU0A 1UVSH 1S83A 1WU1A 4O3TA 5ETXA 1C2IA 1TX6A 3STIA 3UR6A 3UTUH 1AUTC 1DY8A 2GDDA 2VB0A 3RU4E 1A5HA 3MMGA 2R0LA 1BJUA 1GJ4H 1PYTC 1Y5BT 1P9UA 3SV9A 1XKBC 2TBSA 5T3HA 3SQHE 2XCNA 3SHCH 1ELGA 3TGIE 4INHA 1VCPA 2ZU5A 4IGDA 1O2QA 2A2XH 4D76A 2RA0A 3C1KA 1C2HA 1FXYA 1TX8A 3RMLH 2ZTYA 4MNYA 2BZ6H 1ZZZA 1NESE 1OPHB 2EEKA 1DY9A 1XUJA 2GMTC 4Y7BA 1S82A 1EPTA 1L0ZA 4ESTE 1F2SE 1BRCE 1HYLA 4FUBA 2CMYA 1UCYE 2H2ZA 1QCPA 4WMDA 1TA6A 3NPSA 2OLGA 2BOKA 1T8NA 1ZGIA 4RN6A 3FZDA 1HJ9A 4UEHH 1TRMA 1NY22 2H9TH 4GCHF 5DP8A 4X8UH 1K1LA 1G36A 1SI5H 3CS7A 3OY6U 4TWWA 4XFQA 4MPXA 2VVVA 1GBJA 1CA0B 3QK1A 3VXFH 1BUIA 1MKXK 3MO3A 2NU4E 4WH6A 2BLQA 1FZZA 3RMMH 1MD8A 3U1IB 3QTOH 4ABIA 2IOTA 1A0HB 4O03A 8ESTE 1QIXB 2A7JA 4JZFH 2CF8H 1BZXE 4CH2B 1OXGA 3GY2A 2G4UA 1JRSA 1P2MA 3SNCA 1GJCB 1ZSJA 3OSYA 5E2OA 1HUTH 1L1JA 2D8WA 2TGPZ 3RXUA 1TPOA 1YPHE 1O2GH 4FUGA 1MCTA 4YOJA 4BXSA 3TU7H 7ESTE 4GCHG 1LCYA 1FY5A 2LPRA 1KXDA 2A4GA 2BM2A 1BBRE 2CF9H 1UTOA 2FWWA 5HMAA 1TX7A 3IITA 1A0JA 3M7TA 4DW2U 1Z1IA 4XDEA 1XUHA 4NFEA 3T29A 1ELBA 1C9PA 4OGYA 3SQEE 2ZDLA 1UK2A 4ZMAH 1GDQA 1J16A 2FM2A 2XNIA 1BIOA 2Z3EA 1O3FA 3GDUA 1VJ9U 2PTNA 1F7ZA 1TNIA 2V0BA 1HJ8A 3GDVA 1O2XA 1V2PT 1C5TA 3UOUA 3UREA 4F4OC 2J9NA 3EA9A 4AB9A 1CHOF 4FUCA 3VPKA 5A09A 1C4U2 1WYKA 2C8XB 1SOTA 3RMNH 1C5YB 2FLBH 3BTEE 1NN6A 1O0DH 2ZFPH 4MNWA 5FBEA 3SNDA 2RG3A 1TE0A 4DVAU 3ZZCA 2QCYA 2F9OA 1X7AC 2VVCA 4AG2A 2IJOB 5E0JA 4BTUB 4D9RA 3GISB 1O2IA 1H8IH 2ZHEH 4WVPE 1DICA 2BVXH 3Q3XA 5HGGA 2JH5D 2GP9B 3ODFA 4RSPA 1XXFA 5HM9A 2ZFRH 1V2TT 4X1SU 1IQKA 5ESBA 2ZZUH 3M3SA 2DE8A 2F9BH 1GJBB 3TITA 2THFB 3UWJH 2AFQB 2FX6A 3P6ZB 1CGHA 1CHOG 1Z1JA 1IQHA 1KY9A 3ZVBA 3KQEA 2WUCA 1C5PA 1EUFA 2H9EH 1RTFB 1AUJA 1J14A 2J94A 5DJ7A 3CP7A 1PPFE 4THNH 1O2YA 1DUAA 2VIWA 4GSOA 2FS8A 4K8BA 3TH4H 4Y79A 4X8TH 2UUKB 3PMJA 4Y6DA 1O3PB 4A1XA 5SGAE 1TAWA 2FI5E 2ZHWH 1YPEH 1DITH 4OS4A 1UTPA 3T25A 1B5GH 1MUEB 3QGJA 1GBKA 4X6OA 3GICB 1O2SA 5DP4A 2Y82A 1BQYA 2FOMB