2AYWA

Crystal structure of the complex formed between trypsin and a designed synthetic highly potent inhibitor in the presence of benzamidine at 0.97 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of trypsin with a highly potent synthetic inhibitor at 0.97 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA02
1QRWA 1T4VH 2ESTE 3QGJA 1P0SH 3TK9A 2TGTA 2BVRH 2W3KA 3QK1A 4FUEA 3DUXH 2BDAA 1GJ9B 1C5MD 1NROH 4Y0YE 1XX9A 1GMCG 1P2KA 1W0ZU 1GHBF 3TNSA 4X1RU 1GJ6A 1O0DH 2TGDA 2ODQA 4H6TA 3ZVFA 1KXBA 1P57B 4WMEA 4WF8A 5JBBS 2O8LA 1SGCA 1KTSB 4ABHA 1D3QB 2A0QB 3NCLA 1FY1A 1TNHA 1HAIH 3RC6A 2OXSA 1W7GH 3BV9B 1NU9A 2C3SA 1BBRE 2FMJA 2ZEBA 4ZHLU 1C1QA 1MCVA 2ALVA 3NXPA 1OWIA 1GJ7B 2XCNA 1DITH 1H4WA 1VITF 4KP0A 1O34A 5J4QA 3BSQA 3UNQA 4GPGA 2BD8A 2ZO3H 3BTGE 4UFEH 4CR9A 2A32A 3UREA 4ZKNU 3SNDA 5SGAE 4GCHF 2BQ6B 4NIYA 4BTIB 1ZTKA 4IBLH 4B2AA 3SV9A 3VGCB 4FVBA 5GCHF 1TNIA 3S0NA 1DXWA 2FOAA 1WQSA 1ANBA 1AGJA 2J94A 3A83A 1C5TA 2GMTB 4R8TB 4FU9A 3RXUA 3GYLB 3PM3A 5ABWA 1WBGB 1Y3XA 1OX1A 1GDNA 4YO9A 2PUQH 1RRKA 1DICA 1NRQH 5HGGA 1GCTB 3MU4A 2BY6X 3UR6A 2FX6A 4TWYA 1QJ6B 1BBRH 1C5YB 2JETC 1AY6H 2Y5HA 4OGYA 1A0LA 2FYRA 1EOJA 1YCPK 2Z94A 4ABFA 1UVOA 2ZNKH 1DPOA 3GY8A 1O3MA 2GKVE 1FPCH 4AGJA 2WINI 2ZDVH 4ZH8A 1O3OA 1DLEA 1GHAF 2O8MA 1P04A 3M61U 3QDZB 3VB7A 5PTPA 5GJ4B 2J38A 3B9FH 1FIZA 1H8IH 2VJ1A 1YPHC 3EDXB 1P2QA 1TOMH 3HK6B 4WXVA 3RXEA 2ODYB 2ZU3A 1Z8JB 1MTNC 1Z7KA 5HMAA 1TALA 2J92A 5LGOA 1OYTH 4Z0KA 1GMDG 2ZZUH 4H6SB 2ZGCA 2P3FH 1BMLA 4YOJA 2ZFPH 1J9CH 4H4FA 4GLYA 1UHBB 2I6SA 1PQ5A 3A8CA 1C1UH 5T6FA 1ESAA 2OUAA 1FQ3A 4D76A 3NUMA 1B7XB 1NTPA 1VR1H 1C1RA 5E0HA 1SFQB 3NWUA 2PLXA 3SUGA 2BY8X 3SUDA 1GI8B 1O2XA 2CF9H 1ZHRA 2JH6D 2H9HA 4X2XA 5H4IB 2D26C 5A8XA 1UVUH 1VCWA 3GY6A 1L1NA 3PV4A 4AGKA 4CBOA 3BEUA 5FPYA 1T32A 3RMOH 4MNYA 1K1IA 1O2UA 1GMDF 1OWEA 3R0FA 1F5LA 1KLJH 2FM2A 3SGBE 1QBNA 1GHXH 3M5MA 2VH0A 4WMFA 1VZQH 5EODA 3QTVH 3SO3A 4GHQA 5C20A 2FI3E 2DE8A 1KLTA 2RCEA 3PWBA 4AG1A 4NZLA 1MTNB 1C5QA 3HATH 1JBUH 3M3TA 1BRBE 5EQRA 3KQDA 1PPBH 1HJ9A 1TA6A 4K1TA 2G55A 1FY5A 1RXPA 2WV5A 1O2KA 1SHHB 1O5BB 1TNGA 3M5LA 2Z3DA 1NPMA 1CVWH 1OWHA 4M7GA 5FPTA 2M5TA 3WY8A 2XWAA 4DOQA 3I29A 1C1NA 4ABIA 4Q2KA 1W13U 2R2MB 2FOBA 1E0FD 1HDTH 1C5ZB 1MKWH 1PPEE 4WWYA 3SI4H 2VH6A 2VGCC 3L33A 4FUIA 1MCTA 2ZG0H 1AO5A 3Q77A 1EAUA 2AERH 1DWEH 2BQWB 2NU4E 4HFPB 3ZVCA 3SORA 3EYDA 1ZRKA 1ZGIA 2GDDA 3FANA 1IQNA 2H6MA 1NFYA 2Z7FE 1Z6EA 1TONA 2B9LA 4JZIA 5DKMA 2A4QA 3SNCA 5L6NH 4ZKRU 1XM1A 3FVFB 2V0BA 2ZU1A 1D3DB 3MO6A 5EQQA 3BTDE 1GJ4H 5GDSH 2R3YA 2O8UA 3MU8A 2AIPA 1TGNA 1BTYA 3UY9A 1LVYA 3AVZA 3QTOH 4XFQA 1BHXF 3RXOA 4NFEA 3CS7A 3GCHB 5AFZH 1P9UA 4JYTA 1FV9A 1D4PB 4FUJA 1GBFA 3Q76A 3MTYA 2GDEH 4GCHG 3ZZ3A 1O3EA 1GI1A 1Z71A 3SU6A 3ZV9A 4KTCA 1GCDA 3LU9B 1TNJA 2SNWA 3U69H 3UQVA 1O3BA 1G32B 2SGQE 3LGTA 1DWBH 1SLXB 1Y5AT 2D2DA 2OINA 1H9LB 1LHDH 1E35B 2XBVA 1UTNA 3KQBA 2XBWA 4WH6A 1O5CB 2ZGXH 3LONA 5LPEA 2JH0D 2SGEE 1GJCB 3TK6A 2Z9LA 1C5PA 2PWXA 1F0RA 1PQAA 2OC7A 2WPJS 2RA0A 3QGNB 3OTJE 1SC8U 3LDXH 3MI4A 4AFUA 5C3NA 1AE5A 1DWCH 1K1OA 2ANMH 1LVBA 1GI5A 4NA7A 3A82A 1NO9H 1RGQA 3GDUA 3KN2A 1GVLA 4ZXYH 1V2UT 1CHGA 1XXDA 1ELBA 1ETRH 1A5HA 1FZZA 2VWLA 2AS9A 3C1KA 3SNBA 1GPZA 5FBEA 6GCHG 1PJPA 4YT7H 4D7GA 1G9IE 2Y80A 1RIWB 3K6YA 1QQUA 4TPYA 1ELAA 4RKOB 1FY3A 4F4OC 4UD9H 2BDBA 1FDPA 1W8BH 2GD4B 5DP6A 3MH6A 1HNEE 1HUTH 4JYVH 1GJAB 2DUCA 2O8TA 4BOHA 2V3HH 1A7SA 1O31A 4J1YA 1TIOA 1CGJE 2NU3E 1V2KT 2H9EH 2FIRH 2J2UA 2PUXB 1WUNH 2QA9E 3SQHE 3UIRA 4K1SA 5CMXH 2AGIX 4FVDA 2GV7A 1EKBB 3R3GB 1OP8A 3MWIU 1O3NA 1NS3A 2OP9A 3UR9A 3OY5U 1UTOA 2FS8A 1DFPA 5EW1H 3GY2A 1TX7A 4BAHB 1AFQB 4Y7AA 4IN2A 3Q00A 1TBRH 3M7TA 1XUJA 3OSYA 2UWPA 2Z9GA 1AB9B 2R3UA 1S82A 1SI5H 3SGAE 1V2VT 3BN9A 1RJXB 4ISHH 3ZYEA 2BMGB 1KY9A 1IHTH 3C27B 1TA2A 5LH8A 4UONA 3MU1A 1YBWA 3MO9A 1QL9A 4IS5A 3P8GA 3TJVA 1C2KA 1V2ST 3V7TA 1Y3YA 3T5FH 5EPYA 1O2PA 2PKAA 3SU5A 4BTUB 1P2JA 2BOKA 5C1XA 5BRRE 1K1MA 5JDUB 3EA7A 4D9RA 4MPWA 1H9HE 3HPTB 1LVOA 4KELA 1OP0A 1GHYH 1J17T 1CT4E 3SV6A 2GVFA 1QA0A 2JETB 1L4DA 2VIOA 1W2KH 4THNH 4CRAA 1AWHB 2HNTC 4R0IA 4A92A 1ANDA 2C8ZB 2SGFE 1OYQA 3VB4A 4NZQA 1NRSH 2ZKSA 3PMJA 4VGCC 3ELAH 2PW8H 2EI7A 1XKBC 1KXAA 1SLWB 1LKBA 1TQ7B 4KTSA 2QF3A 1GBIA 1E34B 2BHGA 1QFKH 1ZSLA 2G8TA 4U32A 2VIWA 3TVJB 1XUIA 1FY4A 2SGAA 4JK6A 1DX5M 3T27A 1CA0C 2UWOA 1TLDA 1MD8A 4UFDH 1YC0A 1Z8GA 1SGFA 4AFSA 2GCHF 1MBMA 4CRDA 1BJVA 4Y79A 3S7HB 1Y3UA 1OXGA 3TGKE 2BD3A 3A7VA 1UMAH 1GJ5H 2BLWA 3RXBA 2XWBI 2ZQ2A 4MG3A 2A4GA 1MQ6A 2ZHEH 1O5EH 3S9CA 4GHTA 1O3FA 1TRMA 1GHZA 2P16A 1FIWA 1UK3A 1PPGE 4INLA 3BG4C 1UCYK 3A8BA 1QR3E 1GBKA 4NA9H 1SQAA 2BDGA 1C1WH 3BF6H 1C1OA 1CA0B 1B0EA 1K21H 2ZHWH 3QLPH 3BIUH 3M5NA 2VINA 4K1EA 4NIWA 1G3CA 4MNWA 1TMUH 1OKXA 1PFXC 4YOIA 1UTMA 1UCYH 2A5IA 4ZXXH 1S5SA 1O5DH 3KF2A 4WMDA 3RXMA 4UFGH 1FPHH 1V2PT 1UJ1A 2C4FH 1BCUH 1KXEA 4ESTE 1HAOH 4CHAB 3E16B 2VIQA 4GAWA 1SPJA 2BLQA 2NU0E 4ISIH 1S0QA 2QIQA 1VJ9U 3PTNA 1C5VA 6LPRA 1MKXH 1EQ9A 1C5RA 5IDKA 3G01A 3PROA 5FX5A 3T25A 2XC4A 4CREA 4HTCH 4BANB 4Q7YA 2FX4A 1NRRH 3OU0A 3A8AA 1IQEA 4FUGA 3TLOA 1ESBA 1QTFA 2CV3A 2IOTA 3E0NB 4ZROA 1ZSKA 4Y76A 2FTLE 1XUHA 1IQLA 1Y5BT 3D49H 2VWOA 1O2SA 2RG3A 1SGPE 4TY6A 4B2BA 3IWMA 1TABE 2ZWLH 1BRUP 3TPIZ 1TRYA 1Z6JH 1TGSZ 1BDAA 2VB0A 1RD3B 2ZECA 4WVPE 1SQOA 2ZGHA 1K1LA 2WPHS 1J16A 4XSKU 3PMAB 1GGDB 1F0SA 3H7TA 2GT8A 1UK4A 2C93B 5HM9A 1TNKA 3KIDU 1AFQC 1A3BH 3LGYA 1HAVA 2ILNA 2PKSB 1DS2E 3F68H 2P8OC 4K60A 4CR5A 1HRTH 1MTVA 3DHKH 4HGCA 1LMWB 3ZV8A 2WPLS 3GOVB 5FAHA 2ZDNA 3SW2B 4E05H 2FODA 2ZHDA 5DGJA 1BUIA 1C4U2 5AVDA 1C5UA 3RXRA 2BD5A 2FOHA 3I77A 5A2MH 5IYTA 3LKWA 3H5CB 3BTHE 4KGAA 5K0HA 1T8OA 1C2HA 1L1GA 1UTKA 5C1YA 3BG8A 3DT0H 2SGDE 5CE1A 2PV9B 1MAXA 1J15A 3O8RA 1MZDA 1GI6A 1GL1A 1YKTA 2V35A 2C8XB 1BA8B 2GZ7A 4Y8XA 2OD3B 1W11U 5A09A 1QL8A 2K1QA 2FXRA 1YPLH 5TCCA 3SJKA 2VVCA 3FZDA 1TPSA 1AWFH 4AB9A 1C9TA 3RXKA 1MUEB 4A6LA 5DJ7A 1QB1A 1EJMA 1C4V2 1QA7A 4LK4A 5DP7A 3ODFA 4B75A 4X8VH 1YPJH 3PO1B 1FLEE 8GCHF 4FUBA 4X1PU 4AORA 1UVSH 1QQ4A 5CHAC 2XBYA 3V13A 1C2FA 1PQ7A 3F9GA 4UFFH 1SL3A 1O2JA 1ZGVA 1TE0A 4ZUHA 4BXWA 1KSNA 3LGUA 3ATIA 4U30A 4ISNA 2A5KA 1Z1IA 1SBWA 2AMPA 3MMGA 1XMNB 3RM2H 3ZVEA 4CRCA 1LTOA 1LHFH 2Y82A 2BDYA 3LGIA 2QXJA 3MNBA 1EZUC 3ZZ9A 1CT2E 3FP7E 5JBCS 1TQ0B 2YNBA 4X6OA 1C5XB 1CU1A 3U8TH 1WTHD 1JOUB 2NU2E 2BXUH 1BTXA 3P8NA 5A0BA 3SV8A 4IMQA 5E0JA 3S9AA 1V2QT 1DT2A 1O3IA 3E90B 1HIAB 1GBBA 3E1XB 4NIVA 1GJ8B 3TITA 3MH7A 5GCHG 1SGRE 3VEQB 3RXTA 5CHAB 3A7XA 1O2MA 3KQCA 3O8BA 2ZFSA 4OS6A 3RLWH 1E38B 2GGVB 1MQ5A 3MO3A 3TIUA 2Z3EA 4I8GA 3SNEA 3BTME 2OQUA 1HFDA 4MPVA 5E0GA 3MH5A 1O2ZA 2A4OA 3SU0A 1MH0A 3E91A 1HGTH 1NRNH 1UHBA 1XUGA 4Y8ZA 2TBSA 2Y7XA 4DVAU 1GMHF 1HIAA 1C5LH 1EASA 1F5RA 1VITG 1O2NA 1EP5A 5DG6A 5DPAA 2JKHA 3BTEE 1BBRK 2BY7X 3ZVGA 3K9XB 3RMNH 1P05A 1BQYA 1P8VC 1OPHB 1TBQH 5JBAS 3STJA 2KAIB 3M3VA 3V12A 4Q80A 4X1QU 1GHAG 3M7QA 5DK1A 1F2SE 1SB1H 1Q2WA 4UEHH 2ZTXA 1GL0E 3ZVAA 5EQSA 4YOGA 1GBHA 2FTMA 1O33A 2J9NA 4J2YB 5F03A 1ABIH 3NPSA 1NC6A 8LPRA 1O2GH 3LH1A 2XXLA 2G5NA 2JH5D 1ESTA 1BZXE 1BMAA 1WU1A 4X8TH 4XBCA 1O3KA 1LQEA 1ANCA 7LPRA 1PYTD 1ORFA 1C9PA 1CBWB 4CRGA 2FOMB 4K3JA 3RXCA 5A8YA 5FX6A 2A7CA 4UDWH 3SBKA 2GCTC 4K2YA 2BY5X 1F5KU 1P2MA 2FS9A 5E2PA 1Y59T 1CE5A 1FAKH 2WV4A 1AZ8A 3RU4D 4CHAC 2FWWA 3RXHA 5F8ZA 1NM6A 1W7XH 5AFYH 3PLPA 1IQHA 1A5IA 1KLIH 5LPFA 2QY0B 3MH4A 2G52A 1O2VA 8GCHG 3A84A 3ESTA 4AG2A 4MLFB 1K28D 4MQAA 1P06A 1JIRA 5FBIA 1O3HA 4XE4A 5ESTE 3SHCH 1VGCC 2XC0A 1K1NA 1DVAH 2C8WB 1SFIA 3GCOA 4I7YH 1D6RA 2TIOA 1YP9A 3D65E 5L2YH 2ODPA 1TGBA 1S81A 2F9OA 3ZZCA 4E7RG 4INKA 1OWJA 1ZJKA 5C67A 3U9AH 1QJ1B 2QYIA 1XUKA 1C2EA 4CRFA 3BTFE 2AMQA 3P17H 2ZIQH 2HOBA 1BHXB 1XUFA 1EPTB 1GBCA 1QB6A 1C5OH 2WUCA 6ESTA 1IQKA 3A89A 2ANWA 1BTUA 2VIDA 1QJ7B 2ZGBH 2CN0H 1C1SA 1XVOA 2W7SA 1ZTJA 2V6NA 3EQ0H 7KMEH 1O3JA 1O2QA 1RTLA 3F9HA 1KTTB 1TMTH 2GP9B 2UUKB 3LC5A 1WAYB 1MZAA 4WY3A 1BB0B 2HPQH 3VB3A 1IHSH 4WH8A 3RLYH 1ID5H 4A7IB 1W10U 2QN5T 3LIWA 5F8TA 1NESE 1THRH 1BITA 1AMHA 2CMYA 3MNCA 1OS8A 1RTKA 1F0UA 3CP7A 2ZFTA 1TYNA 3Q3YA 1YPHE 1MMJN 3M3SA 3QO6A 4O9VA 3OYPA 3RU4T 3W95A 3ZZ5A 3F9FA 4DCDA 1HYLA 1YPMH 1GI7B 2ZA5A 1CQQA 3K2UA 1H9IE 5DO4H 2EA3A 1OWDA 3RXIA 2BY9X 2AIQA 2HNTE 5B6OA 3UUZA 1TBZH 4AYYB 5F6MA 4I8JA 5DP8A 1EJNA 1ELCA 3RXGA 1T8NA 1ETSH 4VGCB 1SLUB 4LOYH 5L2ZH 3GY7A 3EGKH 1AN1E 1ARBA 3HK3B 2YNAA 4Q7ZA 4MNVA 1SGNE 3RM0H 1QB9A 3ZZ4A 1XKAC 3RXPA 2BLVA 1HAHH 1F92A 3ZVDA 1KDQB 2ZCHP 4FUFA 3RDZA 1P10A 1DE7H 2HRVA 1O3LA 5T6DA 4NCYA 3RXSA 2ZI2H 1IAUA 1SQTA 2YOLA 1FI8A 2Y81A 1W14U 1S83A 3ZZAA 1OSSA 5EU8A 4YLUA 2XCFA 2CHAC 3A7ZA 4OS2A 3TGJE 1O5AB 3HGNA 5AF9H 1WTGH 1GVZA 1CA8B 2AH4X 1RFNA 1NFWA 1CO7E 1SG8B 1TX6A 1UTJA 2BDHA 3BEFB 3GY5A 1TFXA 4K69A 3D62A 3ATKA 1O30A 1EPTC 2F9VA 3Q3KA 1BRCE 3MU0A 5JB9S 5EPNA 4CRBA 3RC5A 2PSYA 2LNCA 2GT7A 1AUTC 3ATLA 2OC1A 1MTWA 3TNTA 3EAJA 1HXFH 4OS7A 2BD7A 4JZDH 2A4RA 1IQJA 3PB1E 1X7AC 5I25A 2UUJB 3EA9A 2FP7B 2G81E 1G30B 2QXHA 4IN1A 2FOFA 1L0ZA 2H5CA 1JRSA 1AKSB 3UTUH 3CENA 3NK8A 2WPIS 4X2VA 4JZEH 3LH3A 3SU3A 2IJOB 4B74A 5FCKA 1QHRB 4NFFA 4NWLA 1ZMNA 3UFAA 5FCRA 4DURA 1BT7A 4BAOB 1FAXA 1GI3A 2Z9IA 3BEIB 3K6ZA 2FZZA 1WV7H 1BMNH 3IG6B 4I8LA 4JK5A 4OS1A 5TJXA 2F91A 2WUBA 2FI4E 3RXJA 2IPHA 4AFZA 1AFEH 1S85A 4DT7B 1A2CH 5C5OA 1OWKA 1CHOF 2BB4A 2P93A 3ZZ7A 4K8YA 5FXLA 1K22H 4YESB 4ZKOU 1O36A 2Y5GA 3O8CA 2F83A 2GV6A 1PPCE 3LGVA 4AX9H 1GBDA 3AASA 4Y7BA 3VB6A 3A80A 1WQVH 5A8ZA 1NZQH 3FP8E 1SSXA 3A86A 5EGMA 1BTZA 3KHVA 3MU5A 3RC4A 1V6DA 4X1NU 1GG6C 1SOTA 2BM2A 1G3DA 2VVUA 2WPKS 5TCAA 3OY6U 1NN6A 1LCYA 3SNAA 3SJ8A 4U01A 1LPZB 1FN8A 2QGRA 1EP6A 2BD2A 4NSYA 1DDJA 1G3EA 1FN6A 2BQ7B 1P9SA 5JYIA 2B7DH 3UQOA 1K2I1 2NWNA 3MHWU 1C2LA 2ZFQH 4CH2B 1Z8RA 1N8OB 1HPGA 4LZ1H 1O37A 3DD2H 3A88A 4X6PA 1CSOE 5ESBA 1PPZA 2WYJA 2W5EA 3SZNA 5EW2H 2CHAB 1G2LA 4K5ZA 1GDQA 3RXQA 1VCPA 1UVPA 1P02A 3SOSA 1QRZA 1A0JA 2ZDLA 2FOGA 3DFLA 4ZHMU 2G51A 3RMMH 1DSTA 1A61H 4OS5A 4ABDA 3KNXA 1GMCF 2P94A 3T26A 1O2YA 1KXCA 1ABJH 4B1TA 1QBVH 5E2OA 3BTQE 1SGEE 1OP2A 1AIXH 1GBEA 8KME2 3QN7A 1EATA 1N8OC 4BAQB 2G4TA 1A46H 2AYWA 1GBMA 1TRNA 3RP2A 3SV7A 1TMBH 4FUDA 1CBWC 2FOCA 1DANH 2OCVB 1K9OE 3V0XA 1IQFA 4DGJA 1D9IA 1AZZA 1ZJDA 3ITIA 1DSUA 1HB0B 1ZRBA 2FPZA 2A7HA 1GGDC 4KTUA 1PPHE 1UTLM 1AI8H 1FMGA 4I8HA 3S9BA 4X6NA 1Y8TA 5DP4A 3T29A 2CXVA 1MKWK 1V2TT 6GCHF 2O8WA 1YF4A 4A1TA 4AN7A 3F9EA 3RXVA 1Z1JA 2EI8A 3QZRA 2R0LA 5F8XA 1DY8A 1EB2A 4TY7A 1ARCA 1LDTT 3P8FA 1J14A 1AVWA 1ZPZA 3MNSA 3QUMP 9ESTA 4AZ2B 1UVTH 2PGQB 3SHAH 2H2ZA 1OOKB 2ZPRA 1RTFB 3U8OH 2PHBA 1YLCA 3RXAA 1G2MA 3A7YA 2XNIA 3K65B 4IW4E 1O38A 1O3CA 3ZZBA 5E8EH 2TGPZ 1P3CA 2ZHQH 1SR5C 7GCHF 1GBLA 1UTQA 1EX3A 2PKAB 3LPRA 2AEIH 3E3TA 1K1PA 2SFAA 1N1LA 2HNTF 2R2WU 2W7UA 3P92A 1YCPH 2OBOA 5C5NA 1P2IA 1GI2A 3U98H 3QX5H 1J8AA 4ISLA 2VIPA 1TOCB 1WCZA 4X8SH 3MFJA 2TRMA 2OBQA 7ESTE 4YTAA 3RMLH 2Y6TA 2Z9JA 4MDSA 2THFB 2ASUB 3RXDA 1SOZA 5FHTA 1DUAA 4RN6A 1DLKB 1O3AA 3B8JA 2H1UA 2TPIZ 1AVGH 1O2IA 4JMYA 1P12E 2Q6FA 1RIWC 1B5GH 1G36A 1O2WA 3UNSA 2BOHB 3FZZA 3ZYDA 3N7OA 1WSSH 4YZUA 2A7JA 1F0TA 1DM4B 2Z9KA 2PSXA 2A2QH 4FU8A 2BVXH 2BXTH 2FESH 2CGAA 1C1TA 3EE0B 3ZZ6A 4DW2U 1N6YA 3URDA 1YCPM 3BTWE 4Z6AH 3UPEA 3M7UA 4JYUH 4DY7B 1MKXK 3L6PA 1DUEA 2D8WA 4MNXA 1HAPH 1EAIA 2SNVA 3RXFA 1MTUA 4BAKB 3P95A 1KDQA 8ESTE 1TWXB 1JXPA 2ZCKP 5J4SA 1HAXB 1VITH 3ATMA 3P8OA 4X6MA 1O2OA 2GZ8A 4BTTB 1D3TB 4CH8B 2Q6DA 1EAXA 1EUFA 2J4IA 1SVPA 1TPOA 3F1SB 3LGWA 1HAVB 1BTWA 1W3CA 4QT8C 4FU7A 4ABEA 1Q31A 3D23A 2XYAA 6CHAB 1GG6B 1NRPH 4WXIA 2C90B 2HVXA 2QXIA 1BRAA 1QURH 1V2LT 2HALA 3BTTE 4A5TS 5JPMH 4ZHAA 1ZTLA 1ZHPA 5JBTA 1P09A 3SJIA 1P01A 5AHGH 3SV2H 1GBTA 2GCHG 2VVVA 1HJAC 3SJ9A 1O2TA 1QY6A 2B8OH 2ZC9H 3GISB 3SI3H 4ZMAH 1SGYE 3AW0A 3LOXA 1HAGE 1FNIA 1P3EA 4MPUA 4Y0ZE 2OQ5A 2ZPSA 1O2HA 2ANKH 1EZSC 2UUFB 3JZ1B 3TJUA 4E7NA 3UOUA 1AHTH 1C2JA 4D8NA 4Y71A 2FO9A 1Y5UT 1YLDA 1JIMA 4Y10E 3PMBB 2ZU4A 1EZXC 1MTSA 3MNXA 1P11E 1GHBG 1XVMA 2Q6GA 1TPPA 3GYMA 1IQIA 2XBXA 4O97A 3HKIB 1O32A 3M35A 3VGCC 4ASHA 1ACBE 5GWZA 1T4UH 4Y6DA 2BD9A 4X1SU 1AE8H 3MOCA 5DP3A 1ZOMA 1EAWA 1NFUA 1GI9B 1S0RA 2ZFFH 5DP5A 1K1JA 2BTCE 2XRCA 4CBNA 2SGPE 2FLBH 3PTBA 9LPRA 1MD7A 1ELFA 1C4Y2 4UE7H 1V2OT 4XDEA 1T8LA 3TU7H 4HZHA 1O39A 1A5GH 1Q3XA 1QBOA 3VFEA 3GICB 5G4BA 2VU8E 5HYOA 3PYHA 1O2LA 2D1JA 1SGTA 1GCTC 4BNRA 3ZZ8A 2G4UA 1TGCA 3URCA 1O3DA 3BIVH 5C1UA 1G37A 1YGCH 1CGIE 2UWLA 3E0PB 1QCPA 4TPIZ 2WYGA 4B2CA 1BMMH 3HKJB 1TNLA 1LHCH 3TK5A 4IC5A 3UWIA 4D9QA 2A45B 3MYWA 1S6HA 4Y11E 1WYKA 1GMHG 5GXPA 1ZSJA 2EEKA 1VCQA 2ZGJA 4ZKSU 1BJUA 3RU4E 4SGAE 2A2XH 1YPGH 2W3IA 1AD8H 5GIBA 4B71A 1BTPA 3AAUA 2GMTC 1L1JA 1T8MA 2ZTYA 1A1RA 4D7FA 7GCHG 3S7KB 5T6GA 2ZU5A 3V3MA 4H42U 3T2NA 4NA8A 1MAYA 1PPFE 1THSH 1UO6A 2VNTA 1H1BA 4GSOA 1HCGA 1QL7A 4NGAH 1T7CA 2B0FA 4K8BA 3UNRA 3AAVA 2R0KA 3O8DA 2F9NA 4RSPA 3PLBA 4AOQA 1BOQA 3QWCH 2NU1E 1SGQE 2CJIA 3VPKA 4DIIH 4JCNA 3VB5A 1C2DA 1FXYA 4XBBA 1RS0A 2PFEA 3RUOA 1DXPA 2P8OB 2FEQH 2RDLA 4NIXA 4X0WU 2FI5E 2A1DB 2R9PA 1ELVA 1LO6A 2ZQ1A 2C8YB 5A0AE 5DP9A 3GCHC 5HXFA 3A87A 5EXMA 1GWAA 2PTNA 2TGAA 3P70B 4KKDA 4I33A 3VXFH 1V2RT 3U1JB 1GI4A 4IC6A 2J95A 1W12U 2J34A 2XTTB 3NZIA 1EPTA 3W94A 1L2EA 2P59A 4NG9H 2STBE 2PGBB 4ABBA 2V3OH 2VIVA 2XW9A 3A7TA 2H9TH 3TH3H 2Z6BD 5EXLA 2O9QA 1Z8IB 1ZMLA 2QC2A 3QZQA 1V2JT 2ZPQA 3NKKA 4U2WA 2BDIA 1JMOH 1C5WB 3SGQE 1TPAE 3ODDA 2PKSC 2F9BH 3SN8A 2AMDA 1ZHMA 4X2YA 5BPEA 1YM0A 3M5OA 3SU1A 2QCYA 1JRTA 2W26A 2DE9A 2HWLB 2PTCE 4B73A 1GHWH 3FFGA 5I46H 1B0FA 1M9UA 2H5DA 2ALPA 2P3UB 4BAMB 3PWCA 3AW1A 3SU2A 2I6QA 1KXFA 4Y8YA 5LPRA 2Z3CA 1C2IA 1TGTA 3LJJA 3SU4A 2G5VA 1LHGH 1QGFA 3TJNA 3BG4B 1IQMA 1ELEE 1QIXB 1H8DH 1NY22 1O2RA 1AQ7A 3EA8A 1FUJA 2ULLA 3UWJH 3OX7U 1JWTA 1SGIB 4GVUA 3LT3A 2PR3A 3KCGH 1C5NH 4OS4A 1LKAA 1GDUA 3U1IB 3KQEA 1C1PA 3A8DA 1ZZZA 3GDSA 1GBJA 1C2GA 1SLVB 4AYVB 2F9UA 1MU6B 1LQDB 4I32A 4FUHA 2QF0A 2ZHFH 1FONA 1A4WH 1O35A 1EJAA 4DIHH 1YYY1 3BTKE 1C2MA 1EZQA 2AGEX 1DWDH 1FY8E 1ELTA 4ISOA 1F7ZA 3GCNA 2A5AA 2GZ9A 1EOLA 1C1MA 3A7WA 1MBQA 2KAIA 1BTHH 2BZAA 2P95A 3CS0A 3T28A 3TGIE 3GCTG 3PO1C 4IGDA 4E06H 2BZ6H 4I8KA 4DG4A 2F9PA 1HAYB 1P2OA 4NWKA 4IMZA 2BYAX 5HM2A 4X8UH 4A1XA 3DFJA 5ETXA 1ZLRA 1AUJA 4RKJB 1HV7A 2ZFRH 2HGTH 1PYTC 2VGCB 1TAWA 3F6UH 5C2ZA 3LC3A 1WOFA 4NSVA 4Q7XA 4FXGH 1S6FA 1W0YH 1HJAB 4MTBA 1LVMA 1LPGB 1NFXA 1BIOA 4HI3A 3B23B 2VWNA 1N6XA 1SGFG 4O03A 3KL6A 3GCTF 2ZU2A 3ZZDA 3KEEA 1AU8A 1DY9A 2OC0A 1A0HB 1ZPCA 1U6QA 3T62A 3HGPA 4LZ4B 1LPKB 2OC8A 1AKSA 1CT0E 3E8LA 1HJ8A 2P3TB 2OLGA 3ENSB 1DOJA 4F49A 1QRXA 1ETTH 4ABAA 2Y5FA 5K7RA 4A1VA 4X2WA 3GY3A 4GUXA 1V3XA 5EXNA 5T3HA 2BDCA 4I31A 3U8RH 3UOPA 1NU7B 3PMHB 1GVKB 4WJG2 1YPKH 2BVSH 1D6WA 2ZTZA 1T31A 3ZVBA 4LXBH 4O3UA 4B76A 1C1VH 2Y7ZA 1EXFA 3SUFA 3A81A 3PLKA 1O3PB 3H7OA 4ABGA 1HBTH 1HXEH 2STAE 3I78A 2BD4A 2ZDAH 1A3EH 4FUCA 4AB8A 1CGHA 3Q3XA 2ZF0H 4AFQA 1NT1A 2OTVA 1ANEA 1AB9C 1TX8A 2IN2A 1KXDA 2G00A 1O3GA 4XBDA 4MVNA 3GY4A 4JZ1A 6CHAC 1ELGA 2ZDMA 3RXLA 1O5GH 2HLCA 2BX3A 4YLQH 2CF8H 1INCA 1GBAA 2A31A 5L30H 2QXGA 1O5FH 2XC5A 1E37B 1G3BA 2LPRA 1ELDE 4PROA 3JZ2B 3P6ZB 2WPMS 2ANYA 1S84A 1FJSA 1KIGH 4MPXA 3SUEA 3M36A 1TB6H 2B5TB 1IQGA 2QV1A 3L3TA 2AFQB 4BXSA 5EOKA 2ZDKA 4TWWA 1V2MT 3FAOA 1D3PB 1SGDE 3ATWA 2HPPH 1HAZB 3A85A 1UK2A 1ZR0A 2UUYA 1VGCB 5EG4A 4TYDA 2FDAA 3E6PH 4JZFH 1UCYE 3GDVA 1C5SA 2EC9H 3SQEE 4OGXA 1PQ8A 1Y3VA 5A0CA 1ZPBA 2FLRH 1IOEA 1GJDB 1GHVH 1L4ZA 1MU8B 1P03A 3DA9B 3TH2H 2BX4A 2Q1JA 4ABJA 1SMFE 4INHA 2FYQA 2QAAA 5GPIB 4O3TA 1ZYOA 3TH4H 2GX4A 1VJAU 3LJOA 1GJBB 1GI0A 2F3CE 2RA3A 1Y3WA 3SJOA 1V2WT 4SGBE 1XXFA 1E36B 4YT6H 2BLOA 1QNJA 1SHYA 1UTPA 1ZMJA 3FP6E 5JB8S 1HLTH 2AGGX 2EI6A 2GTBA 4DJZB 1LHEH 4XOJA 3KGPA 1AVXA 4ZAEA 1KYNA 1EB1H 4YM9A 2ZCLP 1V2NT 5FPSA 2FOEA 3IITA 3M37A 2VWMA 3VXEH 3S69A 3TJOA 1THPB 2GCTB 1P2NA 3STIA 1YPEH 1CHOG 2ZP0H
chains in the Genus database with same CATH superfamily
1QRWA 1T4VH 2ESTE 3QGJA 1P0SH 3TK9A 5CHBA 2TGTA 2BVRH 2W3KA 3QK1A 2J97A 4FUEA 2JJ1D 3DUXH 2BDAA 1GJ9B 1C5MD 1NROH 4Y0YE 1XX9A 1GMCG 1P2KA 1W0ZU 1GHBF 3TNSA 4X1RU 1GJ6A 1O0DH 2TGDA 2ODQA 4H6TA 3ZVFA 1KXBA 1P57B 4WMEA 4WF8A 5JBBS 2O8LA 3WWFA 1SGCA 1KTSB 4ABHA 1D3QB 2A0QB 3NCLA 1FY1A 1TNHA 1HAIH 3RC6A 2OXSA 1W7GH 3BV9B 1NU9A 2C3SA 1BBRE 2FMJA 3PV5A 2ZEBA 4ZHLU 1C1QA 1MCVA 2ALVA 3NXPA 3WW7A 1OWIA 1GJ7B 1DITH 1H4WA 1VITF 2XCNA 4KP0A 1O34A 5J4QA 3BSQA 3UNQA 4GPGA 2BD8A 2ZO3H 3BTGE 4UFEH 4CR9A 2A32A 3UREA 4ZKNU 3SNDA 5SGAE 4GCHF 2BQ6B 4F48B 4NIYA 4BTIB 1ZTKA 4IBLH 4B2AA 3SV9A 3FKSD 3VGCB 4FVBA 5GCHF 1TNIA 3S0NA 1DXWA 2FOAA 1WQSA 1ANBA 1AGJA 2J94A 3A83A 1C5TA 2GMTB 4R8TB 4FU9A 3RXUA 3GYLB 3PM3A 5ABWA 1WBGB 1Y3XA 1OX1A 1GDNA 4YO9A 2PUQH 1RRKA 1DICA 1NRQH 1EFRD 5HGGA 1GCTB 3F0PA 3MU4A 2BY6X 3UR6A 2FX6A 4TWYA 1QJ6B 1BBRH 1C5YB 1WDIA 1AY6H 2JETC 2Y5HA 4OGYA 1A0LA 2QE7D 2FYRA 1EOJA 1YCPK 2Z94A 4ABFA 1UVOA 2ZNKH 1DPOA 3GY8A 1SKYE 1O3MA 2KCOA 2GKVE 1FPCH 4AGJA 2WINI 2ZDVH 4ZH8A 1O3OA 1DLEA 1GHAF 2O8MA 1P04A 3M61U 3QDZB 3VB7A 5PTPA 5GJ4B 2J38A 3B9FH 1FIZA 1H8IH 2VJ1A 1YPHC 3EDXB 1P2QA 1TOMH 3HK6B 4WXVA 3RXEA 2ODYB 2ZU3A 1Z8JB 1MTNC 1Z7KA 5HMAA 1TALA 2J92A 5LGOA 1OYTH 4Z0KA 1GMDG 2ZZUH 4H6SB 2ZGCA 2P3FH 1BMLA 2W6JD 4YOJA 5C94A 2ZFPH 1J9CH 4H4FA 4GLYA 1UHBB 2I6SA 1PQ5A 3A8CA 1C1UH 3FOAA 4YXWD 5T6FA 1ESAA 2OUAA 1FQ3A 4D76A 2WZQA 3NUMA 1B7XB 1NTPA 1VR1H 1C1RA 5E0HA 4ZCNA 1SFQB 3NWUA 2PLXA 3SUGA 2BY8X 3SUDA 1GI8B 3N99A 1O2XA 2CF9H 1ZHRA 2JH6D 2H9HA 4X2XA 5H4IB 2D26C 5A8XA 1UVUH 1VCWA 3GY6A 1L1NA 3PV4A 4AGKA 4CBOA 3BEUA 5FPYA 1T32A 3RMOH 4MNYA 1K1IA 1O2UA 1GMDF 1OWEA 3R0FA 1F5LA 2K8IA 1KLJH 2FM2A 3SGBE 1QBNA 1GHXH 3M5MA 2VH0A 4WMFA 1VZQH 5EODA 1SQRA 3QTVH 3SO3A 4GHQA 5C20A 3VG8A 2FI3E 2DE8A 1KLTA 2RCEA 3PWBA 4RT1A 4NZLA 4AG1A 1MTNB 1C5QA 3HATH 1JBUH 3M3TA 1BRBE 2IJD1 5EQRA 3KQDA 1PPBH 1HJ9A 1TA6A 4K1TA 2G55A 1FY5A 1RXPA 1O2KA 2WV5A 1SHHB 1O5BB 1TNGA 3M5LA 2Z3DA 1NPMA 1CVWH 1OWHA 4M7GA 5FPTA 2M5TA 3WY8A 2XWAA 4DOQA 2YMSC 3I29A 1C1NA 1KMHB 4ABIA 4Q2KA 1W13U 3DSOA 2R2MB 2FOBA 1E0FD 1HDTH 1C5ZB 1MABB 1MKWH 1PPEE 4WWYA 3SI4H 2VH6A 2VGCC 3L33A 4FUIA 1MCTA 2ZG0H 1AO5A 3Q77A 1EAUA 2AERH 1DWEH 2BQWB 2M2AA 2NU4E 4HFPB 3ZVCA 3SORA 3EYDA 1ZRKA 1ZGIA 3UAIC 3W1EA 2GDDA 3F2FA 3FANA 1IQNA 2H6MA 1NFYA 2Z7FE 1Z6EA 1TONA 2B9LA 4DT4A 4JZIA 5DKMA 2A4QA 3SNCA 5L6NH 3MQKC 4ZKRU 1XM1A 3FVFB 2V0BA 2ZU1A 1D3DB 3MO6A 5EQQA 3BTDE 5F53A 1GJ4H 5GDSH 2R3YA 2O8UA 3MU8A 2AIPA 1TGNA 1BTYA 3UY9A 1LVYA 3AVZA 3QTOH 4XFQA 1BHXF 3RXOA 4NFEA 3CS7A 3GCHB 5AFZH 2KCPA 1P9UA 4JYTA 1FV9A 1D4PB 4FUJA 1GBFA 3Q76A 3MTYA 2GDEH 4GCHG 3ZZ3A 1O3EA 1GI1A 1Z71A 3SU6A 3ZV9A 4KTCA 1GCDA 3LU9B 1TNJA 2SNWA 3U69H 3UQVA 1O3BA 1G32B 2SGQE 3LGTA 2GJGA 1DWBH 1SLXB 1Y5AT 2D2DA 2OINA 4TT3D 1H9LB 1LHDH 1E35B 2XBVA 1UTNA 3KQBA 2XBWA 4WH6A 1O5CB 2ZGXH 3LONA 5LPEA 2JH0D 2SGEE 1GJCB 3TK6A 2Z9LA 1C5PA 2PWXA 1F0RA 1PQAA 2OC7A 2RA0A 2WPJS 3QGNB 3OTJE 1SC8U 5DSFA 3LDXH 3MI4A 4AFUA 5C3NA 1AE5A 1DWCH 1K1OA 2ANMH 1LVBA 1GI5A 4NA7A 3A82A 1NO9H 1RGQA 3PV2A 3GDUA 3KN2A 1GVLA 4ZXYH 1V2UT 1CHGA 1XXDA 1ELBA 1ETRH 1A5HA 1FZZA 2VWLA 2AS9A 3C1KA 3SNBA 1GPZA 5FBEA 6GCHG 1PJPA 4YT7H 4D7GA 1G9IE 1S6LA 2Y80A 1RIWB 3K6YA 1QQUA 4TPYA 1ELAA 4RKOB 1FY3A 4F4OC 4UD9H 1W0KD 2BDBA 1FDPA 1W8BH 2GD4B 5DP6A 3MH6A 1HNEE 1HUTH 4JYVH 1GJAB 2DUCA 2O8TA 4BOHA 2V3HH 1A7SA 1O31A 4J1YA 1TIOA 1CGJE 2NU3E 1V2KT 2H9EH 2FIRH 2J2UA 2PUXB 1WUNH 2QA9E 3SQHE 3UIRA 4K1SA 5CMXH 2AGIX 4FVDA 2GV7A 1EKBB 3R3GB 1OP8A 3MWIU 1O3NA 1NS3A 2OP9A 3UR9A 3OY5U 1UTOA 2FS8A 1DFPA 5EW1H 3GY2A 1TX7A 4BAHB 1AFQB 4Y7AA 4IN2A 3Q00A 1TBRH 3M7TA 1XUJA 3OSYA 2UWPA 2Z9GA 1AB9B 2R3UA 1S82A 1SI5H 3SGAE 1V2VT 3SYJA 3BN9A 1RJXB 4ISHH 3ZYEA 2BMGB 1KY9A 1IHTH 3C27B 2RDEA 1TA2A 5LH8A 4UONA 3MU1A 1YBWA 3MO9A 1QL9A 4IS5A 3P8GA 3TJVA 5GNDA 1C2KA 1V2ST 3V7TA 1Y3YA 3T5FH 5EPYA 1O2PA 2PKAA 3SU5A 4BTUB 1P2JA 2BOKA 3DSPA 5C1XA 5BRRE 1K1MA 5JDUB 3EA7A 4D9RA 4MPWA 1H9HE 3HPTB 1LVOA 4KELA 1OP0A 1GHYH 1J17T 1CT4E 2XNDD 3SV6A 2GVFA 1QA0A 2JETB 1L4DA 2VIOA 1W2KH 4THNH 4CRAA 1AWHB 2HNTC 4R0IA 4A92A 3AK5A 1ANDA 2C8ZB 2SGFE 1OYQA 3VB4A 4NZQA 1NRSH 2ZKSA 3PMJA 4VGCC 3ELAH 2PW8H 2EI7A 1XKBC 5C17A 1KXAA 1SLWB 1LKBA 1TQ7B 4KTSA 2QF3A 1GBIA 1E34B 2BHGA 1QFKH 1ZSLA 2G8TA 4U32A 2VIWA 3TVJB 1XUIA 3OEHD 1FY4A 2SGAA 4JK6A 1DX5M 3T27A 1CA0C 2UWOA 1TLDA 1MD8A 4UFDH 1YC0A 1Z8GA 1SGFA 1QZ8A 4AFSA 2GCHF 1MBMA 4CRDA 1BJVA 4Y79A 2JDID 3S7HB 1Y3UA 1OXGA 3TGKE 2BD3A 3A7VA 1UMAH 1GJ5H 2RFKC 2BLWA 2J98B 3RXBA 2XWBI 2ZQ2A 4MG3A 2A4GA 1MQ6A 2ZHEH 1O5EH 3S9CA 4GHTA 1O3FA 1TRMA 1GHZA 2P16A 1FIWA 1UK3A 1PPGE 4INLA 3BG4C 1UCYK 3A8BA 4M9FA 1QR3E 1GBKA 4NA9H 1SQAA 2BDGA 1C1WH 3BF6H 1C1OA 1CA0B 1B0EA 1K21H 1NBMD 2ZHWH 3QLPH 3BIUH 3M5NA 2VINA 4K1EA 4NIWA 1G3CA 4MNWA 1TMUH 1OKXA 1PFXC 2K0QA 4YOIA 1UTMA 1UCYH 2A5IA 4ZXXH 1S5SA 1O5DH 3KF2A 4WMDA 3RXMA 4UFGH 1FPHH 1V2PT 1UJ1A 2C4FH 1BCUH 1KXEA 4ESTE 1HAOH 4CHAB 3E16B 2VIQA 4GAWA 1SPJA 2BLQA 2NU0E 4ISIH 2V7QD 1S0QA 2QIQA 1VJ9U 3PTNA 1C5VA 6LPRA 1MKXH 1EQ9A 2CK3D 1C5RA 4AC9A 5IDKA 3G01A 3PROA 5FX5A 3T25A 2XC4A 4CREA 4HTCH 4BANB 4Q7YA 2FX4A 1NRRH 3OU0A 3A8AA 1IQEA 4FUGA 3TLOA 1ESBA 1QTFA 2CV3A 2IOTA 3E0NB 4ZROA 1ZSKA 3EE7A 4Y76A 2FTLE 1XUHA 1IQLA 1Y5BT 3D49H 2VWOA 1O2SA 2RG3A 1SGPE 4TY6A 4B2BA 3IWMA 1TABE 2ZWLH 1BRUP 3TPIZ 1TRYA 1Z6JH 1TGSZ 1K0HA 1BDAA 2VB0A 1RD3B 2ZECA 4WVPE 1SQOA 3UB0A 2ZGHA 4ACBA 1K1LA 2WPHS 1J16A 4XSKU 3PMAB 1GGDB 1F0SA 3H7TA 2GT8A 1UK4A 2C93B 5HM9A 1TNKA 3KIDU 1AFQC 1A3BH 1YY3A 2ILNA 1HAVA 2PKSB 1DS2E 3F68H 3LGYA 2P8OC 4K60A 4CR5A 1HRTH 1MTVA 3U28C 3DHKH 4HGCA 1LMWB 3ZV8A 2WPLS 3GOVB 5FAHA 2ZDNA 3SW2B 4E05H 2FODA 2ZHDA 5DGJA 1BUIA 1C4U2 5AVDA 1C5UA 3RXRA 2BD5A 2FOHA 3I77A 5A2MH 5IYTA 3LKWA 3H5CB 3BTHE 4KGAA 5K0HA 2J5UA 2KFWA 1T8OA 1C2HA 1L1GA 1UTKA 5C1YA 3BG8A 3DT0H 2SGDE 5CE1A 2PV9B 1MAXA 1J15A 3O8RA 1MZDA 1GI6A 1GL1A 1YKTA 2V35A 2C8XB 1BA8B 2GZ7A 4Y8XA 2OD3B 3H09A 1W11U 5A09A 5FL7D 1QL8A 2K1QA 2FXRA 1YPLH 5TCCA 3SJKA 2VVCA 3FZDA 1TPSA 1AWFH 4AB9A 1C9TA 3RXKA 1MUEB 4A6LA 5DJ7A 1QB1A 1EJMA 1C4V2 1QA7A 4LK4A 5DP7A 3ODFA 3F0OA 4B75A 4X8VH 1YPJH 3PO1B 1FLEE 8GCHF 4FUBA 4X1PU 4AORA 1UVSH 1QQ4A 5CHAC 2XBYA 3V13A 1C2FA 1PQ7A 3F9GA 4UFFH 1SL3A 1O2JA 1ZGVA 1TE0A 4ZUHA 4BXWA 1KSNA 3LGUA 3ATIA 4U30A 4ISNA 2A5KA 1Z1IA 1SBWA 2AMPA 3MMGA 1XMNB 5EIYA 3RM2H 2YMSD 2LELA 3ZVEA 2LP6A 1LTOA 1LHFH 4CRCA 2Y82A 2BDYA 3LGIA 2QXJA 3MNBA 2V3MA 1EZUC 3ZZ9A 1CT2E 2KX4A 3FP7E 5JBCS 1TQ0B 2YNBA 4X6OA 1C5XB 1CU1A 3U8TH 1WTHD 1JOUB 2YMSB 2NU2E 2BXUH 1BTXA 3P8NA 4FOUC 5A0BA 3SV8A 4IMQA 5E0JA 1H8ED 3S9AA 1V2QT 1DT2A 1O3IA 3E90B 1HIAB 1GBBA 3E1XB 4NIVA 1GJ8B 3TITA 3MH7A 5GCHG 1SGRE 3VEQB 3RXTA 5CHAB 3A7XA 1O2MA 5HKKD 3KQCA 3O8BA 2ZFSA 4OS6A 3RLWH 1E38B 2GGVB 1MQ5A 3MO3A 3TIUA 2Z3EA 4I8GA 3SNEA 3BTME 2OQUA 1HFDA 4MPVA 5E0GA 3MH5A 1O2ZA 2A4OA 3SU0A 1MH0A 3E91A 1HGTH 1NRNH 1UHBA 1XUGA 4Y8ZA 2TBSA 2Y7XA 4DVAU 5HIZA 1GMHF 1HIAA 1C5LH 1EASA 1F5RA 1VITG 1O2NA 1EP5A 5DG6A 5DPAA 2EQNA 2JKHA 3BTEE 1BBRK 2BY7X 3ZVGA 3K9XB 3RMNH 1P05A 1BQYA 1P8VC 1OPHB 4RT0A 1TBQH 5JBAS 4HG6A 3STJA 2KAIB 3M3VA 3V12A 4Q80A 4X1QU 2WPDD 1GHAG 3M7QA 5DK1A 1F2SE 1SB1H 1Q2WA 4UEHH 2ZTXA 1GL0E 3ZVAA 3N7EA 5EQSA 4YOGA 1GBHA 2FTMA 1O33A 2J9NA 4J2YB 5F03A 1ABIH 3NPSA 1NC6A 8LPRA 1O2GH 3LH1A 2XXLA 2G5NA 2JH5D 1ESTA 1BZXE 1BMAA 1WU1A 4X8TH 4XBCA 1O3KA 1LQEA 1ANCA 7LPRA 1PYTD 1ORFA 1C9PA 1CBWB 4CRGA 2FOMB 4K3JA 3OAAD 3RXCA 5A8YA 5FX6A 2A7CA 4UDWH 3SBKA 2GCTC 4K2YA 2BY5X 1F5KU 1P2MA 2FS9A 5E2PA 1Y59T 1CE5A 1FAKH 2WV4A 1AZ8A 3RU4D 4CHAC 2FWWA 3RXHA 5F8ZA 1NM6A 1W7XH 5AFYH 3PLPA 1IQHA 1A5IA 1KLIH 5LPFA 2QY0B 3MH4A 2G52A 1O2VA 8GCHG 3A84A 3ESTA 4AG2A 4MLFB 1K28D 4MQAA 1P06A 1JIRA 5FBIA 1O3HA 4XE4A 5ESTE 3SHCH 1VGCC 2XC0A 1K1NA 1DVAH 2C8WB 1SFIA 3GCOA 4I7YH 1D6RA 2TIOA 1YP9A 3D65E 5L2YH 2ODPA 1TGBA 3FO8D 1S81A 2F9OA 3ZZCA 4E7RG 4INKA 1OWJA 1ZJKA 5C67A 3U9AH 1QJ1B 2QYIA 1XUKA 1C2EA 4CRFA 3BTFE 1E79D 2AMQA 3P17H 2ZIQH 2HOBA 1BHXB 1XUFA 1EPTB 4TSFD 1GBCA 1QB6A 1C5OH 2WUCA 6ESTA 1IQKA 3A89A 1W0JD 2ANWA 1BTUA 2VIDA 1QJ7B 2ZGBH 2CN0H 1C1SA 1XVOA 2W7SA 1ZTJA 2V6NA 3EQ0H 2F43B 7KMEH 4XRNA 1O3JA 1O2QA 1RTLA 3F9HA 1KTTB 1TMTH 2GP9B 2UUKB 3LC5A 1WAYB 1MZAA 4WY3A 1BB0B 2HPQH 3VB3A 1IHSH 4WH8A 3WWBA 3RLYH 4Z1MD 5B6LA 1ID5H 4A7IB 1W10U 2QN5T 3LIWA 5F8TA 1NESE 1THRH 1BITA 1AMHA 2CMYA 3MNCA 1OS8A 1RTKA 1F0UA 3CP7A 2ZFTA 1TYNA 3Q3YA 1YPHE 1MMJN 3M3SA 3QO6A 4O9VA 3OYPA 3RU4T 3W95A 3ZZ5A 3F9FA 4DCDA 1HYLA 1YPMH 1GI7B 2ZA5A 1CQQA 2WHXA 3K2UA 1H9IE 5DO4H 2EA3A 4Q4LA 1OWDA 3RXIA 2BY9X 2AIQA 2HNTE 5B6OA 3UUZA 1TBZH 4AYYB 5F6MA 4I8JA 5DP8A 1EJNA 1ELCA 3RXGA 1T8NA 1ETSH 4B6FA 4VGCB 1SLUB 4LOYH 5L2ZH 3GY7A 3EGKH 1AN1E 1ARBA 3HK3B 2YNAA 4Q7ZA 4MNVA 1SGNE 3RM0H 1QB9A 3ZZ4A 1XKAC 3RXPA 5IK2D 2BLVA 1BMFD 1HAHH 1F92A 3ZVDA 1KDQB 2ZCHP 4FUFA 3RDZA 1P10A 1DE7H 2HRVA 1O3LA 5T6DA 4NCYA 3RXSA 2ZI2H 1IAUA 1SQTA 2YOLA 1FI8A 2Y81A 1W14U 1S83A 3ZZAA 1OSSA 5EU8A 4YLUA 2XCFA 2CHAC 3A7ZA 4OS2A 3TGJE 1O5AB 3HGNA 5AF9H 1WTGH 1GVZA 1CA8B 2AH4X 1RFNA 1NFWA 1CO7E 1SG8B 1TX6A 1UTJA 2BDHA 3BEFB 3GY5A 1TFXA 4K69A 3D62A 3ATKA 1O30A 1EPTC 2F9VA 3Q3KA 1BRCE 3DCLA 3MU0A 5JB9S 5EPNA 4CRBA 3RC5A 2PSYA 2LNCA 3KQ5A 2GT7A 1AUTC 3ATLA 2OC1A 1MTWA 3TNTA 3EAJA 1HXFH 4OS7A 2BD7A 4JZDH 2A4RA 1IQJA 3PB1E 1X7AC 5I25A 2UUJB 3EA9A 2FP7B 2G81E 5EJ1A 1G30B 2QXHA 4IN1A 2FOFA 1L0ZA 2H5CA 1JRSA 1AKSB 3UTUH 4ACAA 3CENA 3NK8A 2WPIS 4X2VA 4JZEH 3LH3A 3SU3A 2IJOB 4B74A 5FCKA 1QHRB 4NFFA 1H8HD 4NWLA 1ZMNA 3UFAA 5FCRA 4DURA 1BT7A 4BAOB 1FAXA 1GI3A 2Z9IA 3F2GA 3BEIB 3K6ZA 2FZZA 1WV7H 1BMNH 3IG6B 4I8LA 4JK5A 4OS1A 5TJXA 2F91A 2WUBA 3CNRA 2FI4E 3RXJA 2IPHA 4AFZA 1AFEH 1S85A 4DT7B 1A2CH 5C5OA 1OWKA 1CHOF 2BB4A 2P93A 3ZZ7A 4K8YA 5FXLA 1K22H 4YESB 4ZKOU 1O36A 2Y5GA 3O8CA 2F83A 2GV6A 1PPCE 3LGVA 4AX9H 1GBDA 3AASA 4Y7BA 3VB6A 3A80A 1WQVH 5A8ZA 1NZQH 3FP8E 1SSXA 3A86A 5EGMA 1BTZA 3KHVA 3MU5A 3RC4A 2WSSD 1V6DA 4X1NU 1GG6C 1SOTA 2BM2A 1G3DA 2VVUA 2WPKS 5TCAA 3OY6U 1NN6A 1LCYA 3SNAA 3SJ8A 4U01A 1LPZB 1FN8A 2QGRA 1EP6A 2BD2A 4NSYA 1DDJA 1G3EA 4B6EA 1FN6A 2BQ7B 1P9SA 5JYIA 2B7DH 3UQOA 1K2I1 2J98A 2NWNA 3MHWU 1C2LA 2ZFQH 4CH2B 1Z8RA 1N8OB 1HPGA 4LZ1H 1O37A 3DD2H 3A88A 4X6PA 1CSOE 5ESBA 1PPZA 2VBCA 2WYJA 2W5EA 3SZNA 5EW2H 2CHAB 1G2LA 4K5ZA 3SZEA 1GDQA 3RXQA 2WV9A 1VCPA 1UVPA 1P02A 3SOSA 1QRZA 1A0JA 2ZDLA 2FOGA 3DFLA 4ZHMU 2G51A 3RMMH 1DSTA 1A61H 4OS5A 4ABDA 3KNXA 1GMCF 2P94A 3T26A 1O2YA 1KXCA 1ABJH 4B1TA 1QBVH 5E2OA 3BTQE 1SGEE 1OP2A 1AIXH 1GBEA 8KME2 3QN7A 1EATA 1N8OC 4BAQB 2G4TA 1A46H 2AYWA 1GBMA 1TRNA 3RP2A 3SV7A 1TMBH 4FUDA 1CBWC 2FOCA 4RI0A 1DANH 3KYGA 2OCVB 1K9OE 1NBME 3V0XA 1IQFA 4DGJA 1D9IA 1AZZA 1ZJDA 3ITIA 1DSUA 1HB0B 1ZRBA 2FPZA 2A7HA 1GGDC 4KTUA 1PPHE 1UTLM 1AI8H 1FMGA 4I8HA 3S9BA 4X6NA 1Y8TA 5DP4A 3T29A 2QF5A 2CXVA 1MKWK 1V2TT 6GCHF 2O8WA 1YF4A 2KM0A 4A1TA 4AN7A 3F9EA 3RXVA 1Z1JA 2EI8A 3QZRA 2R0LA 5F8XA 1DY8A 1EB2A 4TY7A 1ARCA 1LDTT 2IPQX 3P8FA 1J14A 1AVWA 1ZPZA 3MNSA 3QUMP 9ESTA 1VKYA 4AZ2B 1UVTH 2PGQB 3SHAH 2H2ZA 1OOKB 2ZPRA 1RTFB 3U8OH 2PHBA 1YLCA 3RXAA 1G2MA 3A7YA 2XNIA 3K65B 4IW4E 1O38A 1O3CA 3ZZBA 5E8EH 2TGPZ 4XD7D 1P3CA 2ZHQH 1SR5C 7GCHF 1GBLA 1UTQA 1EX3A 2PKAB 3LPRA 2AEIH 3E3TA 1K1PA 2SFAA 1N1LA 2HNTF 2R2WU 2W7UA 3P92A 1YCPH 2OBOA 5KGOA 5C5NA 1P2IA 1GI2A 3U98H 3QX5H 1J8AA 1UW7A 4ISLA 2VIPA 1TOCB 1WCZA 4X8SH 3MFJA 2TRMA 2OBQA 7ESTE 4YTAA 3RMLH 2JIZD 2Y6TA 2Z9JA 2THFB 4MDSA 2ASUB 3RXDA 1SOZA 5FHTA 3PRBA 1DUAA 4RN6A 1DLKB 1O3AA 3B8JA 2H1UA 2TPIZ 1AVGH 1O2IA 4JMYA 1P12E 2Q6FA 1RIWC 1B5GH 1G36A 3NRLA 1O2WA 3UNSA 2BOHB 3FZZA 3ZYDA 3N7OA 1WSSH 4YZUA 2A7JA 1F0TA 1DM4B 2Z9KA 2PSXA 2A2QH 4FU8A 2BVXH 2BXTH 2FESH 2CGAA 1C1TA 3EE0B 3ZZ6A 4DW2U 1N6YA 3URDA 3KYFA 5T1VA 1YCPM 3BTWE 4Z6AH 3UPEA 3M7UA 4JYUH 4DY7B 1MKXK 3L6PA 1DUEA 2D8WA 4MNXA 1HAPH 1EAIA 2SNVA 3RXFA 1MTUA 4BAKB 3P95A 1KDQA 8ESTE 1TWXB 1JXPA 1YLNA 2ZCKP 5J4SA 1HAXB 1VITH 3ATMA 3P8OA 4X6MA 1O2OA 2GZ8A 4BTTB 1D3TB 4CH8B 2Q6DA 1EAXA 1EUFA 2J4IA 1SVPA 1TPOA 3F1SB 3LGWA 1HAVB 1WXRA 1BTWA 1W3CA 4QT8C 4FU7A 2HVYB 4ABEA 1Q31A 3D23A 2XYAA 6CHAB 1GG6B 1NRPH 4WXIA 2C90B 2HVXA 2QXIA 1BRAA 1QURH 1V2LT 2HALA 3BTTE 4A5TS 5JPMH 4ZHAA 1ZTLA 1ZHPA 5JBTA 1P09A 3SJIA 1P01A 5AHGH 3SV2H 1GBTA 2GCHG 2VVVA 1HJAC 3SJ9A 1O2TA 1QY6A 2B8OH 2ZC9H 3GISB 3SI3H 4ZMAH 1SGYE 3AW0A 3LOXA 1HAGE 1FNIA 1P3EA 3FN8A 4MPUA 4Y0ZE 2OQ5A 2ZPSA 1O2HA 2ANKH 3F3BA 2QF4A 1EZSC 2UUFB 3JZ1B 3TJUA 4E7NA 3UOUA 1AHTH 2KCAA 1C2JA 4D8NA 4Y71A 2FO9A 2L74A 1Y5UT 1YLDA 1JIMA 4Y10E 3PMBB 2ZU4A 1EZXC 1MTSA 3MNXA 1P11E 1GHBG 1XVMA 2Q6GA 5DN6D 1TPPA 3GYMA 1IQIA 5EJLA 2XBXA 4O97A 3HKIB 1O32A 3M35A 3VGCC 4ASHA 1ACBE 5GWZA 1T4UH 4Y6DA 2BD9A 4X1SU 1AE8H 3MOCA 5DP3A 1ZOMA 1EAWA 1NFUA 1GI9B 1S0RA 2ZFFH 5DP5A 1K1JA 2BTCE 2XRCA 4CBNA 2SGPE 2FLBH 3PTBA 9LPRA 1MD7A 1ELFA 1C4Y2 4UE7H 1V2OT 4XDEA 1T8LA 3TU7H 4HZHA 1O39A 1OHHD 1A5GH 1Q3XA 1QBOA 3VFEA 3GICB 5G4BA 2VU8E 5HYOA 3PYHA 1O2LA 2D1JA 1SGTA 1GCTC 4BNRA 3ZZ8A 2G4UA 1TGCA 3URCA 1O3DA 5EJZA 3BIVH 5C1UA 1G37A 1YGCH 1CGIE 2UWLA 3E0PB 1QCPA 4TPIZ 2WYGA 1E1QD 4B2CA 1BMMH 3HKJB 1TNLA 1LHCH 3TK5A 4IC5A 3UWIA 4D9QA 2A45B 3MYWA 1S6HA 4Y11E 1WYKA 1GMHG 5GXPA 1ZSJA 2EEKA 1VCQA 2ZGJA 4ZKSU 1BJUA 3RU4E 4SGAE 2A2XH 1YPGH 2W3IA 3F2HA 2OK5A 2HLDD 1AD8H 5GIBA 4B71A 1BTPA 3AAUA 2GMTC 1L1JA 1T8MA 5HIYA 2ZTYA 1A1RA 4D7FA 7GCHG 3S7KB 5T6GA 2ZU5A 3V3MA 1FX0B 4H42U 4NA8A 1MAYA 3T2NA 5KEDA 1PPFE 1THSH 1UO6A 2VNTA 1H1BA 4GSOA 1HCGA 1QL7A 4NGAH 4F55A 1T7CA 2B0FA 4K8BA 3UNRA 3AAVA 3OTPA 2R0KA 3O8DA 2F9NA 4RSPA 3PLBA 4AOQA 5C0TA 1BOQA 3QWCH 2NU1E 1SGQE 2CJIA 3VPKA 4DIIH 4JCNA 3VB5A 1C2DA 1FXYA 4XBBA 1RS0A 2PFEA 3RUOA 1DXPA 2P8OB 2FEQH 2RDLA 4NIXA 4X0WU 2FI5E 2A1DB 2R9PA 1ELVA 1LO6A 3PRDA 2ZQ1A 2C8YB 1YWUA 5A0AE 5DP9A 3GCHC 5HXFA 3A87A 5EXMA 1GWAA 2PTNA 2TGAA 3P70B 3N7DA 4KKDA 4I33A 3VXFH 1V2RT 3U1JB 1GI4A 4IC6A 2J95A 1W12U 2J34A 2XTTB 3NZIA 1EPTA 3W94A 1L2EA 2P59A 4NG9H 2STBE 2PGBB 4ABBA 2V3OH 2VIVA 2XW9A 3A7TA 2H9TH 3TH3H 2Z6BD 5EXLA 2O9QA 1Z8IB 1ZMLA 2QC2A 3QZQA 1V2JT 2ZPQA 3NKKA 4U2WA 2BDIA 1JMOH 1C5WB 2F4LA 3SGQE 4P02A 1TPAE 3ODDA 2PKSC 2F9BH 3SN8A 2AMDA 1ZHMA 4X2YA 5BPEA 1YM0A 3M5OA 3SU1A 2QCYA 1JRTA 2W26A 2DE9A 2HWLB 2PTCE 4B73A 1GHWH 3FFGA 5I46H 1B0FA 1M9UA 2KCYA 2H5DA 2ALPA 2P3UB 4BAMB 3PWCA 3AW1A 3SU2A 2I6QA 1KXFA 4Y8YA 5LPRA 2Z3CA 1C2IA 1TGTA 3LJJA 3SU4A 2G5VA 1LHGH 1QGFA 3TJNA 3BG4B 1IQMA 4OM9A 1ELEE 1QIXB 1H8DH 4P00A 1NY22 1O2RA 1AQ7A 3EA8A 1FUJA 2ULLA 3UWJH 3OX7U 1JWTA 1SGIB 4GVUA 3LT3A 2PR3A 3KCGH 1C5NH 4OS4A 1LKAA 1GDUA 3U1IB 3KQEA 1C1PA 3A8DA 2KR7A 1ZZZA 3GDSA 1GBJA 3GS9A 1C2GA 1SLVB 4AYVB 2F9UA 1MU6B 1LQDB 4I32A 4FUHA 2QF0A 3ZIAD 2ZHFH 1FONA 1A4WH 1O35A 1EJAA 4DIHH 1YYY1 3BTKE 1C2MA 1EZQA 2AGEX 1DWDH 1FY8E 1ELTA 4ISOA 1F7ZA 3GCNA 2A5AA 2GZ9A 1EOLA 1C1MA 3A7WA 1MBQA 2KAIA 1BTHH 2BZAA 2P95A 3CS0A 3T28A 3TGIE 3GCTG 3PO1C 4IGDA 4E06H 2BZ6H 4I8KA 4DG4A 2F9PA 1HAYB 1P2OA 4NWKA 4IMZA 2BYAX 5HM2A 4X8UH 4A1XA 3DFJA 5ETXA 1ZLRA 1AUJA 4RKJB 1HV7A 2ZFRH 2HGTH 1PYTC 2VGCB 1TAWA 3F6UH 5C2ZA 3LC3A 1WOFA 3OFND 4NSVA 4Q7XA 4FXGH 1S6FA 1W0YH 1HJAB 4MTBA 1LVMA 1LPGB 1NFXA 1BIOA 4HI3A 3B23B 2XOKD 2VWNA 2L6OA 1N6XA 1SGFG 4O03A 3KL6A 3GCTF 2ZU2A 3ZZDA 3KEEA 1AU8A 1DY9A 2OC0A 1A0HB 3DSGA 1ZPCA 1U6QA 3T62A 3HGPA 4LZ4B 1LPKB 2OC8A 1AKSA 1CT0E 3E8LA 1HJ8A 2P3TB 2OLGA 3ENSB 1DOJA 4F49A 1QRXA 1ETTH 4Q63A 4ABAA 2Y5FA 5K7RA 4A1VA 4X2WA 3GY3A 4GUXA 1V3XA 5EXNA 5T3HA 2BDCA 4I31A 3U8RH 3UOPA 1NU7B 3PMHB 1GVKB 4WJG2 1YPKH 2BVSH 1D6WA 2ZTZA 1T31A 3ZVBA 4LXBH 4O3UA 4B76A 1C1VH 2Y7ZA 1EXFA 3SUFA 3A81A 3PLKA 1O3PB 3H7OA 4ABGA 1HBTH 1HXEH 2STAE 3I78A 2BD4A 2ZDAH 1A3EH 4FUCA 4AB8A 2KZ4A 1CGHA 2JJ2D 3Q3XA 2ZF0H 4AFQA 1NT1A 2OTVA 1ANEA 1AB9C 3OEED 1TX8A 2IN2A 1KXDA 2G00A 1O3GA 4XBDA 4MVNA 2PP6A 3GY4A 1E1RD 4JZ1A 6CHAC 1ELGA 2ZDMA 3RXLA 1O5GH 2HLCA 2BX3A 4YLQH 2CF8H 1INCA 1GBAA 2A31A 5L30H 2QXGA 1O5FH 2XC5A 1E37B 1COWD 1G3BA 2LPRA 1ELDE 4PROA 3JZ2B 3P6ZB 2WPMS 2ANYA 1S84A 1FJSA 1KIGH 4MPXA 3SUEA 3M36A 1TB6H 2B5TB 1IQGA 4FETA 5CDFE 2QV1A 3L3TA 2AFQB 4BXSA 5EOKA 2ZDKA 4TWWA 1V2MT 3FAOA 1D3PB 1SGDE 3ATWA 2HPPH 1HAZB 3A85A 1UK2A 1ZR0A 2UUYA 1VGCB 5EG4A 4TYDA 2FDAA 3E6PH 4JZFH 1UCYE 3GDVA 1C5SA 2EC9H 3SQEE 4OGXA 1PQ8A 1Y3VA 5A0CA 4ASUD 2W6ID 1ZPBA 2FLRH 1IOEA 1GJDB 1GHVH 1L4ZA 1MU8B 1P03A 3DA9B 3TH2H 2BX4A 2Q1JA 4ABJA 1SMFE 4INHA 2FYQA 2QAAA 5GPIB 4O3TA 1ZYOA 3TH4H 2GX4A 1VJAU 3LJOA 4I86A 1GJBB 1GI0A 2F3CE 2RA3A 1Y3WA 3SJOA 1V2WT 4SGBE 1XXFA 1E36B 5C0UA 4YT6H 2BLOA 1QNJA 1SHYA 1UTPA 1ZMJA 3FP6E 5JB8S 1HLTH 2AGGX 2EI6A 2GTBA 4DJZB 5KECA 1LHEH 4XOJA 3KGPA 1AVXA 4ZAEA 1KYNA 1EB1H 4YM9A 2EY4C 2ZCLP 3OE7D 1V2NT 5FPSA 2FOEA 3IITA 3M37A 2VWMA 3VXEH 3S69A 3TJOA 1THPB 2AHME 2GCTB 1P2NA 3STIA 1YPEH 1CHOG 2ZP0H
chains in the Genus database with same CATH topology
1QRWA 1T4VH 2ESTE 3QGJA 1P0SH 3TK9A 2TGTA 2BVRH 2W3KA 3QK1A 4FUEA 3DUXH 2BDAA 1GJ9B 1C5MD 1NROH 4Y0YE 1XX9A 1GMCG 1P2KA 1W0ZU 1GHBF 3TNSA 4X1RU 1GJ6A 1O0DH 2TGDA 2ODQA 4H6TA 3ZVFA 1KXBA 1P57B 4WMEA 4WF8A 5JBBS 2O8LA 1SGCA 1KTSB 4ABHA 1D3QB 2A0QB 3NCLA 1FY1A 1TNHA 1HAIH 3RC6A 2OXSA 1W7GH 3BV9B 1NU9A 2C3SA 1BBRE 2FMJA 2ZEBA 4ZHLU 1C1QA 1MCVA 2ALVA 3NXPA 1OWIA 1GJ7B 2XCNA 1DITH 1H4WA 1VITF 4KP0A 1O34A 5J4QA 3BSQA 3UNQA 4GPGA 2BD8A 2ZO3H 3BTGE 4UFEH 4CR9A 2A32A 3UREA 4ZKNU 3SNDA 5SGAE 4GCHF 2BQ6B 4NIYA 4BTIB 1ZTKA 4IBLH 4B2AA 3SV9A 3VGCB 4FVBA 5GCHF 1TNIA 3S0NA 1DXWA 2FOAA 1WQSA 1ANBA 1AGJA 2J94A 3A83A 1C5TA 2GMTB 4R8TB 4FU9A 3RXUA 3GYLB 3PM3A 5ABWA 1WBGB 1Y3XA 1OX1A 1GDNA 4YO9A 2PUQH 1RRKA 1DICA 1NRQH 5HGGA 1GCTB 3MU4A 2BY6X 3UR6A 2FX6A 4TWYA 1QJ6B 1BBRH 1C5YB 2JETC 1AY6H 2Y5HA 4OGYA 1A0LA 2FYRA 1EOJA 1YCPK 2Z94A 4ABFA 1UVOA 2ZNKH 1DPOA 3GY8A 1O3MA 2GKVE 1FPCH 4AGJA 2WINI 2ZDVH 4ZH8A 1O3OA 1DLEA 1GHAF 2O8MA 1P04A 3M61U 3QDZB 3VB7A 5PTPA 5GJ4B 2J38A 3B9FH 1FIZA 1H8IH 2VJ1A 1YPHC 3EDXB 1P2QA 1TOMH 3HK6B 4WXVA 3RXEA 2ODYB 2ZU3A 1Z8JB 1MTNC 1Z7KA 5HMAA 1TALA 2J92A 5LGOA 1OYTH 4Z0KA 1GMDG 2ZZUH 4H6SB 2ZGCA 2P3FH 1BMLA 4YOJA 2ZFPH 1J9CH 4H4FA 4GLYA 1UHBB 2I6SA 1PQ5A 3A8CA 1C1UH 5T6FA 1ESAA 2OUAA 1FQ3A 4D76A 3NUMA 1B7XB 1NTPA 1VR1H 1C1RA 5E0HA 1SFQB 3NWUA 2PLXA 3SUGA 2BY8X 3SUDA 1GI8B 1O2XA 2CF9H 1ZHRA 2JH6D 2H9HA 4X2XA 5H4IB 2D26C 5A8XA 1UVUH 1VCWA 3GY6A 1L1NA 3PV4A 4AGKA 4CBOA 3BEUA 5FPYA 1T32A 3RMOH 4MNYA 1K1IA 1O2UA 1GMDF 1OWEA 3R0FA 1F5LA 1KLJH 2FM2A 3SGBE 1QBNA 1GHXH 3M5MA 2VH0A 4WMFA 1VZQH 5EODA 3QTVH 3SO3A 4GHQA 5C20A 2FI3E 2DE8A 1KLTA 2RCEA 3PWBA 4AG1A 4NZLA 1MTNB 1C5QA 3HATH 1JBUH 3M3TA 1BRBE 5EQRA 3KQDA 1PPBH 1HJ9A 1TA6A 4K1TA 2G55A 1FY5A 1RXPA 2WV5A 1O2KA 1SHHB 1O5BB 1TNGA 3M5LA 2Z3DA 1NPMA 1CVWH 1OWHA 4M7GA 5FPTA 2M5TA 3WY8A 2XWAA 4DOQA 3I29A 1C1NA 4ABIA 4Q2KA 1W13U 2R2MB 2FOBA 1E0FD 1HDTH 1C5ZB 1MKWH 1PPEE 4WWYA 3SI4H 2VH6A 2VGCC 3L33A 4FUIA 1MCTA 2ZG0H 1AO5A 3Q77A 1EAUA 2AERH 1DWEH 2BQWB 2NU4E 4HFPB 3ZVCA 3SORA 3EYDA 1ZRKA 1ZGIA 2GDDA 3FANA 1IQNA 2H6MA 1NFYA 2Z7FE 1Z6EA 1TONA 2B9LA 4JZIA 5DKMA 2A4QA 3SNCA 5L6NH 4ZKRU 1XM1A 3FVFB 2V0BA 2ZU1A 1D3DB 3MO6A 5EQQA 3BTDE 1GJ4H 5GDSH 2R3YA 2O8UA 3MU8A 2AIPA 1TGNA 1BTYA 3UY9A 1LVYA 3AVZA 3QTOH 4XFQA 1BHXF 3RXOA 4NFEA 3CS7A 3GCHB 5AFZH 1P9UA 4JYTA 1FV9A 1D4PB 4FUJA 1GBFA 3Q76A 3MTYA 2GDEH 4GCHG 3ZZ3A 1O3EA 1GI1A 1Z71A 3SU6A 3ZV9A 4KTCA 1GCDA 3LU9B 1TNJA 2SNWA 3U69H 3UQVA 1O3BA 1G32B 2SGQE 3LGTA 1DWBH 1SLXB 1Y5AT 2D2DA 2OINA 1H9LB 1LHDH 1E35B 2XBVA 1UTNA 3KQBA 2XBWA 4WH6A 1O5CB 2ZGXH 3LONA 5LPEA 2JH0D 2SGEE 1GJCB 3TK6A 2Z9LA 1C5PA 2PWXA 1F0RA 1PQAA 2OC7A 2WPJS 2RA0A 3QGNB 3OTJE 1SC8U 3LDXH 3MI4A 4AFUA 5C3NA 1AE5A 1DWCH 1K1OA 2ANMH 1LVBA 1GI5A 4NA7A 3A82A 1NO9H 1RGQA 3GDUA 3KN2A 1GVLA 4ZXYH 1V2UT 1CHGA 1XXDA 1ELBA 1ETRH 1A5HA 1FZZA 2VWLA 2AS9A 3C1KA 3SNBA 1GPZA 5FBEA 6GCHG 1PJPA 4YT7H 4D7GA 1G9IE 2Y80A 1RIWB 3K6YA 1QQUA 4TPYA 1ELAA 4RKOB 1FY3A 4F4OC 4UD9H 2BDBA 1FDPA 1W8BH 2GD4B 5DP6A 3MH6A 1HNEE 1HUTH 4JYVH 1GJAB 2DUCA 2O8TA 4BOHA 2V3HH 1A7SA 1O31A 4J1YA 1TIOA 1CGJE 2NU3E 1V2KT 2H9EH 2FIRH 2J2UA 2PUXB 1WUNH 2QA9E 3SQHE 3UIRA 4K1SA 5CMXH 2AGIX 4FVDA 2GV7A 1EKBB 3R3GB 1OP8A 3MWIU 1O3NA 1NS3A 2OP9A 3UR9A 3OY5U 1UTOA 2FS8A 1DFPA 5EW1H 3GY2A 1TX7A 4BAHB 1AFQB 4Y7AA 4IN2A 3Q00A 1TBRH 3M7TA 1XUJA 3OSYA 2UWPA 2Z9GA 1AB9B 2R3UA 1S82A 1SI5H 3SGAE 1V2VT 3BN9A 1RJXB 4ISHH 3ZYEA 2BMGB 1KY9A 1IHTH 3C27B 1TA2A 5LH8A 4UONA 3MU1A 1YBWA 3MO9A 1QL9A 4IS5A 3P8GA 3TJVA 1C2KA 1V2ST 3V7TA 1Y3YA 3T5FH 5EPYA 1O2PA 2PKAA 3SU5A 4BTUB 1P2JA 2BOKA 5C1XA 5BRRE 1K1MA 5JDUB 3EA7A 4D9RA 4MPWA 1H9HE 3HPTB 1LVOA 4KELA 1OP0A 1GHYH 1J17T 1CT4E 3SV6A 2GVFA 1QA0A 2JETB 1L4DA 2VIOA 1W2KH 4THNH 4CRAA 1AWHB 2HNTC 4R0IA 4A92A 1ANDA 2C8ZB 2SGFE 1OYQA 3VB4A 4NZQA 1NRSH 2ZKSA 3PMJA 4VGCC 3ELAH 2PW8H 2EI7A 1XKBC 1KXAA 1SLWB 1LKBA 1TQ7B 4KTSA 2QF3A 1GBIA 1E34B 2BHGA 1QFKH 1ZSLA 2G8TA 4U32A 2VIWA 3TVJB 1XUIA 1FY4A 2SGAA 4JK6A 1DX5M 3T27A 1CA0C 2UWOA 1TLDA 1MD8A 4UFDH 1YC0A 1Z8GA 1SGFA 4AFSA 2GCHF 1MBMA 4CRDA 1BJVA 4Y79A 3S7HB 1Y3UA 1OXGA 3TGKE 2BD3A 3A7VA 1UMAH 1GJ5H 2BLWA 3RXBA 2XWBI 2ZQ2A 4MG3A 2A4GA 1MQ6A 2ZHEH 1O5EH 3S9CA 4GHTA 1O3FA 1TRMA 1GHZA 2P16A 1FIWA 1UK3A 1PPGE 4INLA 3BG4C 1UCYK 3A8BA 1QR3E 1GBKA 4NA9H 1SQAA 2BDGA 1C1WH 3BF6H 1C1OA 1CA0B 1B0EA 1K21H 2ZHWH 3QLPH 3BIUH 3M5NA 2VINA 4K1EA 4NIWA 1G3CA 4MNWA 1TMUH 1OKXA 1PFXC 4YOIA 1UTMA 1UCYH 2A5IA 4ZXXH 1S5SA 1O5DH 3KF2A 4WMDA 3RXMA 4UFGH 1FPHH 1V2PT 1UJ1A 2C4FH 1BCUH 1KXEA 4ESTE 1HAOH 4CHAB 3E16B 2VIQA 4GAWA 1SPJA 2BLQA 2NU0E 4ISIH 1S0QA 2QIQA 1VJ9U 3PTNA 1C5VA 6LPRA 1MKXH 1EQ9A 1C5RA 5IDKA 3G01A 3PROA 5FX5A 3T25A 2XC4A 4CREA 4HTCH 4BANB 4Q7YA 2FX4A 1NRRH 3OU0A 3A8AA 1IQEA 4FUGA 3TLOA 1ESBA 1QTFA 2CV3A 2IOTA 3E0NB 4ZROA 1ZSKA 4Y76A 2FTLE 1XUHA 1IQLA 1Y5BT 3D49H 2VWOA 1O2SA 2RG3A 1SGPE 4TY6A 4B2BA 3IWMA 1TABE 2ZWLH 1BRUP 3TPIZ 1TRYA 1Z6JH 1TGSZ 1BDAA 2VB0A 1RD3B 2ZECA 4WVPE 1SQOA 2ZGHA 1K1LA 2WPHS 1J16A 4XSKU 3PMAB 1GGDB 1F0SA 3H7TA 2GT8A 1UK4A 2C93B 5HM9A 1TNKA 3KIDU 1AFQC 1A3BH 3LGYA 1HAVA 2ILNA 2PKSB 1DS2E 3F68H 2P8OC 4K60A 4CR5A 1HRTH 1MTVA 3DHKH 4HGCA 1LMWB 3ZV8A 2WPLS 3GOVB 5FAHA 2ZDNA 3SW2B 4E05H 2FODA 2ZHDA 5DGJA 1BUIA 1C4U2 5AVDA 1C5UA 3RXRA 2BD5A 2FOHA 3I77A 5A2MH 5IYTA 3LKWA 3H5CB 3BTHE 4KGAA 5K0HA 1T8OA 1C2HA 1L1GA 1UTKA 5C1YA 3BG8A 3DT0H 2SGDE 5CE1A 2PV9B 1MAXA 1J15A 3O8RA 1MZDA 1GI6A 1GL1A 1YKTA 2V35A 2C8XB 1BA8B 2GZ7A 4Y8XA 2OD3B 1W11U 5A09A 1QL8A 2K1QA 2FXRA 1YPLH 5TCCA 3SJKA 2VVCA 3FZDA 1TPSA 1AWFH 4AB9A 1C9TA 3RXKA 1MUEB 4A6LA 5DJ7A 1QB1A 1EJMA 1C4V2 1QA7A 4LK4A 5DP7A 3ODFA 4B75A 4X8VH 1YPJH 3PO1B 1FLEE 8GCHF 4FUBA 4X1PU 4AORA 1UVSH 1QQ4A 5CHAC 2XBYA 3V13A 1C2FA 1PQ7A 3F9GA 4UFFH 1SL3A 1O2JA 1ZGVA 1TE0A 4ZUHA 4BXWA 1KSNA 3LGUA 3ATIA 4U30A 4ISNA 2A5KA 1Z1IA 1SBWA 2AMPA 3MMGA 1XMNB 3RM2H 3ZVEA 4CRCA 1LTOA 1LHFH 2Y82A 2BDYA 3LGIA 2QXJA 3MNBA 1EZUC 3ZZ9A 1CT2E 3FP7E 5JBCS 1TQ0B 2YNBA 4X6OA 1C5XB 1CU1A 3U8TH 1WTHD 1JOUB 2NU2E 2BXUH 1BTXA 3P8NA 5A0BA 3SV8A 4IMQA 5E0JA 3S9AA 1V2QT 1DT2A 1O3IA 3E90B 1HIAB 1GBBA 3E1XB 4NIVA 1GJ8B 3TITA 3MH7A 5GCHG 1SGRE 3VEQB 3RXTA 5CHAB 3A7XA 1O2MA 3KQCA 3O8BA 2ZFSA 4OS6A 3RLWH 1E38B 2GGVB 1MQ5A 3MO3A 3TIUA 2Z3EA 4I8GA 3SNEA 3BTME 2OQUA 1HFDA 4MPVA 5E0GA 3MH5A 1O2ZA 2A4OA 3SU0A 1MH0A 3E91A 1HGTH 1NRNH 1UHBA 1XUGA 4Y8ZA 2TBSA 2Y7XA 4DVAU 1GMHF 1HIAA 1C5LH 1EASA 1F5RA 1VITG 1O2NA 1EP5A 5DG6A 5DPAA 2JKHA 3BTEE 1BBRK 2BY7X 3ZVGA 3K9XB 3RMNH 1P05A 1BQYA 1P8VC 1OPHB 1TBQH 5JBAS 3STJA 2KAIB 3M3VA 3V12A 4Q80A 4X1QU 1GHAG 3M7QA 5DK1A 1F2SE 1SB1H 1Q2WA 4UEHH 2ZTXA 1GL0E 3ZVAA 5EQSA 4YOGA 1GBHA 2FTMA 1O33A 2J9NA 4J2YB 5F03A 1ABIH 3NPSA 1NC6A 8LPRA 1O2GH 3LH1A 2XXLA 2G5NA 2JH5D 1ESTA 1BZXE 1BMAA 1WU1A 4X8TH 4XBCA 1O3KA 1LQEA 1ANCA 7LPRA 1PYTD 1ORFA 1C9PA 1CBWB 4CRGA 2FOMB 4K3JA 3RXCA 5A8YA 5FX6A 2A7CA 4UDWH 3SBKA 2GCTC 4K2YA 2BY5X 1F5KU 1P2MA 2FS9A 5E2PA 1Y59T 1CE5A 1FAKH 2WV4A 1AZ8A 3RU4D 4CHAC 2FWWA 3RXHA 5F8ZA 1NM6A 1W7XH 5AFYH 3PLPA 1IQHA 1A5IA 1KLIH 5LPFA 2QY0B 3MH4A 2G52A 1O2VA 8GCHG 3A84A 3ESTA 4AG2A 4MLFB 1K28D 4MQAA 1P06A 1JIRA 5FBIA 1O3HA 4XE4A 5ESTE 3SHCH 1VGCC 2XC0A 1K1NA 1DVAH 2C8WB 1SFIA 3GCOA 4I7YH 1D6RA 2TIOA 1YP9A 3D65E 5L2YH 2ODPA 1TGBA 1S81A 2F9OA 3ZZCA 4E7RG 4INKA 1OWJA 1ZJKA 5C67A 3U9AH 1QJ1B 2QYIA 1XUKA 1C2EA 4CRFA 3BTFE 2AMQA 3P17H 2ZIQH 2HOBA 1BHXB 1XUFA 1EPTB 1GBCA 1QB6A 1C5OH 2WUCA 6ESTA 1IQKA 3A89A 2ANWA 1BTUA 2VIDA 1QJ7B 2ZGBH 2CN0H 1C1SA 1XVOA 2W7SA 1ZTJA 2V6NA 3EQ0H 7KMEH 1O3JA 1O2QA 1RTLA 3F9HA 1KTTB 1TMTH 2GP9B 2UUKB 3LC5A 1WAYB 1MZAA 4WY3A 1BB0B 2HPQH 3VB3A 1IHSH 4WH8A 3RLYH 1ID5H 4A7IB 1W10U 2QN5T 3LIWA 5F8TA 1NESE 1THRH 1BITA 1AMHA 2CMYA 3MNCA 1OS8A 1RTKA 1F0UA 3CP7A 2ZFTA 1TYNA 3Q3YA 1YPHE 1MMJN 3M3SA 3QO6A 4O9VA 3OYPA 3RU4T 3W95A 3ZZ5A 3F9FA 4DCDA 1HYLA 1YPMH 1GI7B 2ZA5A 1CQQA 3K2UA 1H9IE 5DO4H 2EA3A 1OWDA 3RXIA 2BY9X 2AIQA 2HNTE 5B6OA 3UUZA