2AYWA

Crystal structure of the complex formed between trypsin and a designed synthetic highly potent inhibitor in the presence of benzamidine at 0.97 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Structure of the complex of trypsin with a highly potent synthetic inhibitor at 0.97 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2aywA02
4KP0A 1SI5H 4O03A 3TH3H 4ABEA 1C1MA 1BDAA 3VB6A 1E35B 2HGTH 1O2SA 7LPRA 2O8UA 1GMCF 3LC5A 4AG1A 1V3XA 1OWDA 4DY7B 1DXPA 5TCCA 3SNCA 4GUXA 2PSXA 1VCQA 2PKSC 3KQCA 1PYTC 4UDWH 1HXFH 3MYWA 4XOJA 3SNDA 3TITA 4Y0ZE 2W7UA 4TPYA 3MWIU 3NXPA 4YLQH 1UVPA 1TBQH 2ASUB 4ASHA 3GY5A 2Z7FE 1O37A 1IQJA 2HWLB 1W10U 2A2QH 1ETRH 3P8GA 3BTFE 4WVPE 1SGEE 1GMHG 2LPRA 3M3TA 1GHBF 3MNCA 3M3SA 3TU7H 4ABAA 4I7YH 1ZSJA 1FY4A 1D6WA 5JBCS 1C5TA 1O2QA 3LPRA 5E8EH 2ZDKA 2BHGA 1BQYA 1NC6A 1QJ1B 1C1VH 3ATIA 1DE7H 4Y0YE 1TNHA 4FUBA 2Y5GA 2ZU3A 4YM9A 1HCGA 1YM0A 4FU7A 1G9IE 3U9AH 1YF4A 1C2LA 3TJOA 1OPHB 3SOSA 3UR9A 1XUIA 3GICB 1C5VA 2THFB 1L2EA 4ISNA 1IQHA 4GLYA 3ZZ6A 5FHTA 4D7FA 1HUTH 1MTNC 2G4UA 3SUDA 5I46H 4ABFA 2ZCKP 4WXIA 2ULLA 3TIUA 1NS3A 1HV7A 2XC5A 4X8UH 1O2JA 2QAAA 4B2BA 1DWCH 3PYHA 1AHTH 1UHBB 4CHAC 2Y81A 3GCNA 1EQ9A 1F5LA 1AU8A 1K21H 2QXIA 2YOLA 1P9UA 2PKAB 3A8BA 1FDPA 1UK3A 1K9OE 3P70B 3QN7A 7KMEH 2V3OH 4D76A 1GI4A 1EZUC 1O3JA 2BD3A 2G52A 8GCHG 3URDA 1O2OA 4ZKSU 3QZQA 1NY22 1MBMA 1TPAE 1KXDA 3GDVA 4I32A 3RXDA 1C2GA 3RXFA 1LVBA 1ZTJA 4AG2A 3AW1A 1GBTA 4TWYA 3QLPH 1DWBH 1CA0B 3HATH 1WSSH 1LHEH 3PMAB 1EAWA 2H1UA 1FN6A 1L1JA 3UPEA 1W2KH 4AZ2B 3BTKE 1HAHH 1TNJA 5BRRE 2WUBA 2H6MA 4ISHH 2ZA5A 3FP7E 5CMXH 4CBOA 2JH5D 3CP7A 4FU9A 1T8NA 4WH8A 1T32A 3B9FH 1CBWC 3UNRA 1GCTB 1F92A 2TGPZ 2VVCA 1IQMA 4X1RU 1YYY1 2GCHG 5HM2A 2Z3DA 1LHCH 2CHAB 1SGIB 1GG6B 3IWMA 3VPKA 1J8AA 1DY9A 2P3UB 4B2CA 2W3KA 2FWWA 1O3OA 1RTLA 4CRDA 4DJZB 1O2YA 1AIXH 2ANWA 1KXBA 1O5DH 4A1XA 3LC3A 1C1UH 4VGCB 1VITH 3QK1A 4IMZA 1NFXA 2AERH 4WH6A 4K5ZA 1GDUA 2VH0A 1SGQE 3CENA 1O5EH 1O2GH 1SGNE 5F03A 4Y71A 4ZMAH 1WU1A 5ESTE 4ESTE 2OINA 1GMCG 1BBRK 3K2UA 2HNTE 2ZGBH 1O3LA 1INCA 1GJDB 1K22H 2BX4A 4NIVA 1C1QA 1M9UA 2FM2A 3W95A 3SUGA 2G55A 2P8OB 1QQ4A 3SU6A 3Q3KA 1O3FA 4CRGA 1TA2A 2A7HA 1QB6A 3KQBA 2W3IA 2D1JA 1C2FA 1L4ZA 2CJIA 2ZF0H 3ZZ9A 2ZC9H 1FPHH 4GCHG 2RA3A 3NCLA 1O33A 1J16A 2EC9H 1XUKA 1CA8B 4WY3A 1Q3XA 4R8TB 4MNXA 4NIWA 1ZHRA 3SHCH 1NZQH 5DP6A 1OYQA 5DK1A 1GI9B 3V13A 1V2RT 1L1GA 1PJPA 1V6DA 1ZGIA 1GI7B 2XWAA 1O30A 5AF9H 1GHBG 1QL8A 1AKSB 3OU0A 5FPSA 4NIXA 5PTPA 3KF2A 2HPQH 5FX6A 4B2AA 4ISOA 3TLOA 2BD9A 5EU8A 4K69A 4WWYA 1ELEE 3FP8E 1RFNA 1J17T 1AQ7A 2BD2A 4NZLA 4AB8A 1AKSA 1NROH 1O5BB 1UTQA 4Q7XA 4RKJB 3Q3XA 1D6RA 3E91A 2JETB 1GJ5H 3WY8A 2F91A 1CQQA 1SVPA 3S9AA 1ORFA 1QR3E 4NWLA 1RS0A 4AYVB 2GTBA 3ZVGA 4BXSA 1S5SA 1G37A 3SQEE 2ZTXA 1MKXK 2VWMA 1BHXF 1AN1E 1J15A 1O35A 5EPYA 1Z1JA 1GI5A 4CRBA 1YKTA 4ISLA 1ACBE 1G30B 5GWZA 1TYNA 1G3BA 3GOVB 1WTGH 2G8TA 1Q31A 4QT8C 1GWAA 4A6LA 3I77A 1WOFA 3GCHC 1C1RA 3A87A 1UTNA 4B76A 2ZGXH 1TMUH 1NRRH 5ETXA 1VGCC 1O2RA 1CO7E 4B75A 1GGDB 2BD7A 1OP0A 1RIWB 1AFQB 1K1OA 1V2WT 3LGUA 2WYGA 4MVNA 4I8JA 3SU3A 1P04A 1ZSKA 4CH8B 4IN1A 1TONA 1CT4E 2PW8H 4I8KA 4BNRA 1TLDA 4Y8ZA 2VIPA 2ODYB 3UQOA 2QIQA 5DP3A 1SOZA 3LU9B 3T29A 1AVGH 1TRNA 2GV7A 5AFZH 4Z0KA 3TK9A 1IQIA 4K8BA 3MU0A 2VB0A 1HNEE 3P8FA 4Z6AH 2FMJA 1GJ7B 1NM6A 4IMQA 1VCWA 4Y10E 5DP5A 1QA0A 1HAVB 1JIMA 3CS0A 1ZMLA 2Q6DA 1ANCA 3W94A 2FLRH 1OOKB 2G5NA 2CMYA 4WJG2 1GVZA 1NRQH 1TA6A 5GCHF 4AORA 5JBTA 3BTGE 1WYKA 1HAVA 4ZXXH 4AGJA 2G51A 1CGIE 3PTNA 1QFKH 5SGAE 3QWCH 4K8YA 2ZDNA 1FZZA 3MTYA 1C5MD 1GPZA 1LHDH 3MO9A 2PTCE 4HTCH 4IGDA 2CN0H 4AFZA 1CGHA 3SU1A 1BITA 2XC0A 4FUFA 4AFUA 2A0QB 1AVWA 3UIRA 2EI6A 2Z9LA 1P2MA 5DP9A 2FXRA 1O2UA 2A2XH 3M36A 2GCTC 4B71A 1AWHB 4MDSA 1NPMA 1ELCA 3PM3A 3QTVH 1DICA 1HJAB 1L0ZA 3UFAA 1S6HA 1KXFA 2GT8A 1Z8IB 4JZIA 4TWWA 1ELAA 4X8TH 2P59A 4YOGA 1J9CH 5JYIA 2WPIS 1QL9A 3PLBA 1SGFG 3FZZA 8ESTE 5HM9A 4FUGA 4ABIA 2AIPA 3EA8A 3FP6E 1F2SE 4Y76A 4Y8XA 1AB9B 1IHTH 2FIRH 3TH2H 2WPLS 1BRCE 1BIOA 1CT2E 1NFUA 2AGIX 1EZQA 2FOAA 2V0BA 2JKHA 3D23A 4MTBA 2A7CA 2QXHA 3TJUA 1UVOA 4SGBE 1OXGA 4Q80A 1BRUP 4XBDA 4NFEA 1UTMA 5DJ7A 4I8GA 1T8MA 2Z9IA 1UVTH 1P12E 1TNIA 2ILNA 1ELBA 2BQ6B 3A89A 3VB4A 3M35A 4TY7A 2FI3E 2YNBA 1SGPE 2O9QA 2ZTYA 3BTWE 5ESBA 1BHXB 2ZPQA 1E0FD 3S7KB 4BAKB 1W8BH 2CV3A 1A0LA 4I31A 3RC4A 2ZDAH 3HK3B 1LKAA 1PQAA 1GBLA 4F49A 2GD4B 1BTUA 3EE0B 3E8LA 1FIZA 1XXDA 4JZFH 3ZZ7A 5JB8S 4DT7B 4KGAA 3MU8A 5LPFA 1TRYA 1MD7A 3ATWA 4UEHH 1W7XH 1BB0B 2XCFA 1GJAB 1LPGB 4BTUB 2ZFPH 3VXFH 4H42U 2G4TA 1JXPA 2AMPA 2WPHS 2WV5A 4ZUHA 3STJA 5LH8A 3U1JB 2Y80A 1DPOA 2P16A 1W0ZU 1MTWA 3F9HA 1YPGH 1FY8E 3A8CA 1Y8TA 3LGWA 1ZRBA 1DM4B 5LPEA 2SGEE 3RC5A 1FNIA 1EAUA 5C2ZA 2XBYA 2C3SA 2FS8A 5C5OA 4X2YA 1HRTH 5DKMA 1E34B 3M7UA 1THRH 1ZHMA 1QA7A 4NZQA 1WQVH 5EQQA 1YC0A 3SJKA 2J92A 4CR5A 1IQKA 2VIVA 2V3HH 2ZPSA 3BTTE 3T62A 1OWEA 2GZ9A 2FOGA 1G3CA 2J2UA 3KIDU 1SMFE 5DPAA 2FO9A 3LOXA 1YPEH 1LKBA 3BEUA 5DGJA 4CR9A 4GHTA 4X2VA 1GJ9B 1JWTA 4YOIA 4AOQA 3T5FH 3LH3A 1E38B 1MTUA 2KAIB 2BVSH 1C2EA 3PV4A 3FANA 1HGTH 3E16B 3PTBA 3UR6A 1P2IA 1C5OH 1WUNH 5GCHG 1LMWB 1IQNA 3GCOA 3C1KA 2XBVA 3ZVBA 2KAIA 3D62A 4KTUA 3A85A 2WYJA 2VGCB 3RXEA 1PPBH 2GMTB 1ANEA 1TX8A 4K2YA 4TY6A 3RXVA 2QXJA 2FOEA 3RXGA 4ZHMU 2B5TB 1HBTH 3H5CB 1HAYB 3LGYA 3EDXB 3PMHB 4LOYH 3SGQE 1OYTH 5EXLA 4DVAU 1QURH 1FI8A 1OKXA 2ZTZA 1TNGA 5LGOA 2BMGB 1DXWA 1SGRE 4NA9H 1YPLH 3GYLB 1IQGA 5J4QA 1MKWH 5FAHA 3ZZCA 3I78A 3T2NA 1CA0C 1EASA 2VH6A 4WMEA 1PPCE 1OX1A 3NK8A 4MPWA 3LKWA 1GI6A 1KYNA 3MH7A 1JRTA 3A82A 1T4UH 1SLXB 2G5VA 5EQRA 1O5GH 1O36A 3ODDA 1BTZA 2A5IA 1CGJE 4FUCA 1GCTC 1QRZA 4OS2A 3RUOA 2I6QA 3RM2H 1FPCH 2CHAC 5BPEA 1GG6C 1BOQA 1ELGA 2QA9E 3K6ZA 1VITF 5A8YA 4OS1A 3U8RH 1MBQA 1QY6A 3LGVA 2BDBA 2GDEH 3P92A 4B1TA 1SSXA 1ZSLA 2XCNA 4VGCC 1MU6B 1ZJDA 1GJ4H 3GDUA 1Z1IA 2Z94A 1GVLA 2FOCA 1MAXA 1A1RA 3BTHE 2BD4A 1AY6H 4B74A 4E05H 3OSYA 1FY1A 1YPHE 2OXSA 1AO5A 2ALVA 1EB1H 2BYAX 1W3CA 2FTLE 2ZKSA 2HNTF 1G3DA 3O8CA 1YLDA 3PROA 2P8OC 1O2LA 2BX3A 2DE9A 3A7TA 1BRBE 3L6PA 1OP8A 3SV9A 1W13U 5C1XA 4ZROA 3ZYEA 1O2VA 3PO1C 4MNVA 1THPB 3E0PB 4DOQA 3RXUA 3E90B 1D3DB 1XVMA 1O5FH 2FYQA 5F6MA 4RN6A 1GBDA 3VGCB 2C4FH 2FEQH 1QRWA 3EQ0H 1RRKA 3E1XB 2A4OA 1UJ1A 1PPFE 2FESH 1C4U2 1MCTA 1Q2WA 1O5CB 1H8DH 2QV1A 1ESAA 2JETC 4X1QU 2TBSA 2ZHWH 4FU8A 5FBIA 2ZECA 4D7GA 1UHBA 2J94A 1ARBA 2ZFTA 2J95A 1VJAU 2WPJS 3MU1A 1P09A 2AS9A 2H9HA 1DX5M 2PKAA 3LDXH 2Y7ZA 5T6DA 4FVDA 3A88A 1DWEH 3RMOH 3DFJA 1YGCH 4K1TA 1MZAA 3SQHE 1TGCA 1A4WH 2ZCHP 3A8DA 1HAOH 1A0HB 2OLGA 2W26A 1QB1A 5HMAA 2ZU5A 2QGRA 1B5GH 1V2LT 3OYPA 1TX7A 3GY3A 1GGDC 1W12U 1RIWC 1AFQC 1PFXC 2A5KA 3A7WA 1SLWB 1GL1A 2UUFB 3ATMA 1MZDA 3M7QA 1MUEB 2B8OH 3CS7A 2GT7A 1IQLA 4GSOA 5GJ4B 1HYLA 2F3CE 1UCYE 1GHYH 1CSOE 1O2XA 5IYTA 8KME2 2PFEA 2W7SA 6ESTA 3KGPA 2PUQH 1C5QA 3ZYDA 1W7GH 2R2WU 3VB7A 3K65B 2BDGA 4FVBA 2AGGX 5EXMA 2ZGCA 3A7XA 1C5LH 2OQ5A 3S7HB 1ELDE 2LNCA 1TNKA 1UK2A 1AVXA 5B6OA 2AGEX 3QTOH 1YLCA 1UCYH 3LJJA 4K1SA 1UTPA 4M7GA 4E7NA 1AWFH 3SV8A 4K1EA 1SG8B 1C4V2 2VIWA 3QGNB 5L2YH 3V3MA 2ANYA 1HAGE 1GI3A 2WINI 3SN8A 1EZSC 1NO9H 1SBWA 1VITG 2BZAA 2GP9B 4Y8YA 3SV6A 2ZHEH 3RU4E 2BY6X 1KXEA 2OC1A 3RXRA 1DDJA 2QF0A 1NESE 2SGPE 2OD3B 2UWPA 3BTDE 7GCHF 4J2YB 4AX9H 2H9TH 1QBOA 2OP9A 4ABDA 4FUHA 1ELVA 3ENSB 4ZHAA 4BAHB 3AASA 4YOJA 1BTHH 2ZFSA 2ZDMA 1HJAC 4XBCA 1H9LB 1C5PA 1DS2E 1S82A 4X2WA 4GAWA 1SOTA 3RXKA 4I8LA 1GBKA 4XFQA 1BTYA 1DUAA 1F0RA 2A4GA 3URCA 1HAIH 2NWNA 2C8YB 3SU4A 3M37A 1ZTLA 4YTAA 5GIBA 4NIYA 1UTJA 1FQ3A 1GJCB 1AB9C 3M5OA 4JZEH 3O8DA 1C2DA 1O3AA 3F6UH 2C8WB 3I29A 2XXLA 2HOBA 1W14U 3UY9A 2G81E 1O0DH 4Y79A 1S81A 3EAJA 1SLUB 3O8RA 1V2MT 1C9PA 1AE5A 3BG8A 1P2QA 1P2OA 4I8HA 3O8BA 1HPGA 4JYUH 5JBBS 2A45B 3ZVFA 5A0AE 2FOMB 1P3CA 3BTEE 5A2MH 4UFDH 4CRFA 2IJOB 4O9VA 1BT7A 1V2QT 2Q6GA 3OX7U 2BLWA 1P9SA 4ZKRU 1EOLA 4HFPB 3TJNA 1Y5BT 4NWKA 3BG4B 2PWXA 2UUYA 3ZZAA 3R0FA 5E0JA 1HJ8A 1EZXC 3UREA 2ZU2A 1QCPA 5F8ZA 3TVJB 4F4OC 3QX5H 2JH0D 5FXLA 2M5TA 3ZZDA 2ZEBA 3BV9B 3KNXA 1PQ5A 1P2NA 3KCGH 1A2CH 4YESB 1N1LA 4X8VH 1DWDH 3HGNA 1N8OB 2H2ZA 1DSTA 4FUJA 1TPSA 4LXBH 1C1WH 1S84A 2EA3A 1DLEA 1PQ8A 2BDIA 2R0KA 3MNXA 3MI4A 5C67A 1G2MA 2A7JA 5EOKA 3RXPA 3VB3A 1TMBH 1GBJA 4KELA 3MU5A 1V2NT 3UWIA 2EI8A 1O32A 3L33A 3TJVA 2BY9X 2STAE 3GCTF 5A0CA 4X6PA 3RXAA 5I25A 4BANB 1BMLA 2FOBA 1MQ6A 4A92A 3IG6B 2NU2E 1Y3XA 1AGJA 1F5KU 2QC2A 1AFEH 3C27B 4AFSA 4OGXA 2XC4A 2SNVA 5LPRA 3RXLA 1EPTB 1KDQB 3TPIZ 1D3TB 2V35A 1N6YA 2C8XB 4Y7BA 5AVDA 4ISIH 3SHAH 2FX4A 3KQDA 1K1JA 1PPEE 3K6YA 1SB1H 1PYTD 1QRXA 3NPSA 1UVUH 1W0YH 1DVAH 1TABE 4O3UA 1LPZB 3SNAA 1MAYA 4H6TA 1XVOA 1K1NA 1F5RA 3MFJA 3A8AA 2RDLA 4INLA 1VCPA 1OWHA 5JPMH 9LPRA 1O3IA 6CHAB 2BD8A 3RXBA 1WQSA 3RLYH 2BLQA 3SU2A 1ID5H 1V2PT 2P3TB 3SGAE 3TNTA 3UTUH 4IS5A 3PWBA 4LK4A 1A5IA 1NRSH 4WXVA 1FY3A 1KY9A 2VGCC 4INKA 5TJXA 2GMTC 4CRCA 7GCHG 2RA0A 1HFDA 1THSH 1SGFA 1Y5AT 2BLVA 2ZU1A 1C4Y2 3R3GB 4THNH 3ZZ8A 1L1NA 4K60A 2QCYA 3P95A 4D9QA 1GJ6A 2BY5X 1DANH 2PUXB 1TRMA 3RU4D 4BTIB 1GBHA 3ATKA 3ZZ3A 3MNSA 1NRPH 1O39A 1GBEA 1HAXB 1GBIA 2HLCA 1C5ZB 3VFEA 3E0NB 5F8XA 1SQOA 3PLKA 5A8ZA 1S0QA 1O3HA 3FZDA 1ESBA 2I6SA 2Q6FA 2PR3A 3RMMH 1V2OT 1XUFA 1ETTH 1LQDB 2FTMA 1GBMA 4DIHH 1AZ8A 4AB9A 2G00A 2QY0B 1EJAA 3TH4H 2XBWA 2AFQB 4HZHA 5DG6A 1ABIH 1E37B 5EQSA 3EA7A 1TGSZ 5FX5A 2B0FA 3S69A 2F9OA 3GISB 1O3PB 3A7YA 3SO3A 2F9VA 1A3EH 2A32A 1CVWH 2Y5FA 3DFLA 2QF3A 1UK4A 1K2I1 1MQ5A 5L6NH 1G32B 3RXOA 1K1PA 1ZJKA 5CHAB 2GV6A 5FPTA 3Q77A 3V7TA 1MU8B 3KL6A 2F9PA 1O3DA 1O2HA 1XM1A 5IDKA 4YT7H 2D8WA 5HYOA 1GBCA 1TPPA 1H9HE 1AZZA 3MH6A 1ZPBA 2EEKA 1B0FA 3HKJB 3U98H 3BIUH 2BQ7B 1P57B 4JYTA 1YCPH 1QL7A 1HAPH 1FONA 5TCAA 1LVYA 2Y6TA 4LZ1H 2ODQA 1P2KA 2BVRH 1VR1H 5AFYH 1AUTC 5A09A 1JIRA 1KXCA 1SGYE 4KKDA 3V0XA 3PMBB 1ZLRA 2F9NA 4IC5A 3U8OH 2A4RA 3SU0A 1UTOA 1Y3WA 5H4IB 1T31A 4IBLH 2XNIA 1TGNA 4DGJA 3ZV8A 3D49H 3A80A 3T28A 3SJIA 3ZV9A 1C2IA 2OCVB 3GCTG 2XYAA 4ZKOU 1A3BH 1S6FA 2IOTA 1O3KA 2GZ7A 3MHWU 3TK5A 1P05A 1O2IA 1ELTA 4K3JA 4MPUA 4NGAH 1O3NA 3RDZA 2BOKA 1KTTB 3VGCC 2AIQA 2HVXA 1EB2A 3LGIA 2O8MA 1T7CA 4MQAA 2PV9B 4OS5A 3S9BA 4YO9A 1TNLA 1K1LA 2GCTB 3GYMA 3H7TA 2B7DH 4MLFB 5FBEA 3RMLH 2R3YA 4BAQB 3ATLA 1MH0A 3M5NA 4ZH8A 2ZDLA 3U69H 3SW2B 1O34A 2IPHA 2SGDE 2TIOA 4IC6A 2AEIH 2GX4A 1JRSA 3RXTA 7ESTE 3LGTA 2GGVB 1A5GH 1QJ6B 1V2TT 1K1IA 1ZZZA 1BUIA 3DUXH 1G36A 1SHHB 5JB9S 3UNSA 3QDZB 3RMNH 1ZR0A 1C5SA 1LDTT 1FJSA 1UTKA 4U2WA 3N7OA 4X1PU 1O38A 1SGTA 3SORA 3E3TA 1GI1A 1O5AB 4TYDA 1QB9A 8LPRA 1XX9A 1EAXA 2BTCE 1WBGB 3FFGA 4E06H 1K28D 2YNAA 3GY2A 2WUCA 3SJ8A 1QIXB 1RTKA 1Y3UA 3ZZ4A 1SFIA 4ZXYH 2DUCA 1FY5A 2BDHA 1XMNB 4JCNA 2BB4A 1UMAH 4X6MA 1EP6A 1SC8U 4UFGH 1HJ9A 2VIDA 5EW1H 1ELFA 1VJ9U 2ZG0H 1O3CA 1ETSH 3PMJA 1A61H 1LCYA 1HXEH 5EXNA 1DY8A 1TIOA 3A81A 2AMQA 3BEIB 2ZNKH 1LHFH 1DUEA 1QHRB 1ZGVA 4WF8A 4Y11E 4TPIZ 1NFWA 5GXPA 1F7ZA 2QXGA 2C93B 4IN2A 2AH4X 1JMOH 3GY8A 1IOEA 2FOHA 1OS8A 2BY8X 3ITIA 3NUMA 4Q2KA 1TQ0B 4CREA 3BTQE 1O3MA 1SGCA 1T4VH 3K9XB 3V12A 1ZOMA 1EP5A 4X0WU 1F0SA 4YZUA 2VVUA 1W11U 4GPGA 2WV4A 1OSSA 2TGAA 3SBKA 1AI8H 1TGBA 3ZVCA 3ZVEA 2SGQE 3D65E 1SHYA 2ZGJA 3BEFB 2HRVA 1AE8H 1MKWK 1YPKH 4GCHF 5A8XA 5C20A 1TOMH 3F9EA 2JH6D 4NG9H 2BDCA 3RC6A 5FPYA 2VWNA 1O3GA 5HGGA 2ESTE 5EW2H 3TGJE 3MO6A 1PPHE 1TE0A 4JYVH 5E2PA 2ZFFH 2P95A 4XSKU 1KLTA 2GDDA 1FUJA 1EATA 3LT3A 3RXCA 2Y82A 4E7RG 4BTTB 5EG4A 2Z3EA 4ZHLU 1QJ7B 3AVZA 5HXFA 2ZI2H 1OP2A 1Z8GA 3P17H 2OQUA 4ABGA 2HNTC 1FN8A 3BF6H 1GI8B 3HGPA 4ABJA 4BAMB 2P94A 3SV2H 2ZHFH 2TGTA 1GHAF 1TGTA 1GCDA 2SGAA 5DP7A 1P10A 3T26A 2DE8A 2A5AA 1V2JT 1BMMH 3RP2A 1LPKB 2C90B 3F9GA 1IQFA 2VWOA 3UNQA 1V2VT 5JDUB 4MNYA 1BBRE 2EI7A 3JZ2B 4CH2B 1BJVA 4UONA 3EYDA 1SPJA 4NCYA 3HKIB 2NU1E 5FCKA 1RJXB 4X6NA 3DA9B 1TQ7B 3ZZBA 1AD8H 3M5LA 1P06A 2ZCLP 2BXTH 2FI5E 4FXGH 1DITH 3BG4C 3ELAH 4GVUA 3KEEA 1LO6A 4JZ1A 2FYRA 1GHXH 1N6XA 4MPXA 1Z71A 1D3PB 1Z8JB 3LONA 1EJNA 2CXVA 2VVVA 1Z6EA 2BY7X 1BBRH 1DLKB 1XKBC 3PWCA 2WPMS 1ZRKA 2BXUH 1GDQA 3RXJA 3IITA 4UD9H 2GKVE 1EXFA 1GVKB 3TK6A 1YPMH 1N8OC 4U01A 2BOHB 3RXQA 1PQ7A 2PGQB 2Z9KA 1LQEA 4XBBA 3Q76A 2O8TA 3UWJH 3VXEH 2BD5A 3QGJA 3RXMA 3RXIA 5T6FA 2VINA 1MTSA 5L2ZH 2OBQA 3NZIA 3BN9A 1P11E 5E0HA 2ZGHA 1H1BA 3SGBE 2BVXH 1G2LA 2C8ZB 1GJ8B 2ZZUH 2PKSB 5DP8A 4Y6DA 4X8SH 1TBRH 2D26C 3DT0H 4KTCA 1JOUB 5EPNA 1CHOF 1EPTC 1B0EA 3PB1E 1GBFA 1F0UA 2FLBH 4U32A 1FMGA 3JZ1B 1SR5C 3E6PH 1NT1A 1O2NA 4BAOB 3T27A 4FUEA 1CE5A 5A0BA 1X7AC 3MO3A 1MKXH 2H5DA 3RM0H 6LPRA 2J4IA 4LZ4B 1B7XB 1GI2A 1MCVA 2ZPRA 3S9CA 2ZFQH 5G4BA 2UWOA 6CHAC 1IHSH 1F0TA 4ZKNU 2ZHDA 4DIIH 4OS4A 2FDAA 4CBNA 4JZDH 1Y59T 2NU4E 4U30A 2F9UA 1C5NH 2OC7A 4ABHA 1OWJA 2F9BH 1ZTKA 2BLOA 3PO1B 1KSNA 1ABJH 2IN2A 4BXWA 1WTHD 5GDSH 1XUJA 1VZQH 1HB0B 3SI4H 3U1IB 2V6NA 2XTTB 1HLTH 3SNEA 1G3EA 4X1SU 3AAVA 1YP9A 4PROA 4WMFA 3SNBA 1QBVH 4B73A 1MTNB 1UCYK 3ZVAA 3QO6A 1SGDE 1FV9A 2XW9A 3SI3H 1GMDF 4UFFH 1LHGH 2OUAA 2TGDA 1PPZA 4X1NU 4INHA 2BDAA 4CHAB 2W5EA 5CE1A 1GL0E 2F83A 4IW4E 4OS6A 1BJUA 2HALA 1XKAC 2TPIZ 5J4SA 4SGAE 3QUMP 5T6GA 3LJOA 1BMNH 1Y5UT 2O8LA 1S83A 4J1YA 4HGCA 1KXAA 2CF9H 1GHAG 1P2JA 4NA7A 3UUZA 2OC8A 3STIA 1KLIH 1ZMJA 3A7VA 3OTJE 3EA9A 2ZFRH 2ZO3H 4O97A 1QNJA 2B9LA 2FX6A 2ANMH 4FUIA 1FAXA 1Z8RA 1TX6A 1MD8A 1TAWA 2Z3CA 1O3EA 1NTPA 1HDTH 1C2KA 1H9IE 3F68H 2A4QA 4JK6A 3UQVA 1ARCA 2P93A 1LVOA 4R0IA 3A84A 3OY6U 4A7IB 1C9TA 3A83A 1NU7B 1A7SA 2XRCA 2FPZA 2NU3E 1FXYA 3GDSA 5L30H 1BRAA 5CHAC 3TGIE 3ZVDA 1WV7H 1S85A 1C2HA 1YCPM 1EAIA 4FUDA 1ANBA 2UUJB 6GCHF 3H7OA 1IAUA 1QBNA 3OY5U 5E2OA 1CBWB 1O31A 3AAUA 1P01A 2OBOA 1KLJH 1YBWA 1TPOA 1RTFB 1TMTH 4OGYA 3MH4A 1P02A 3SUFA 2PLXA 2ZQ1A 1XUHA 1C1NA 1BMAA 1EUFA 2H9EH 2GVFA 3ESTA 4BOHA 1NFYA 4KTSA 1Y3VA 1L4DA 3HPTB 3M5MA 2Y7XA 3GY7A 4NSVA 1EJMA 1TWXB 5F8TA 4XDEA 2D2DA 4Q7ZA 4D8NA 1SQTA 3SJOA 1EPTA 1BZXE 1GBAA 1KDQA 2VJ1A 2ZIQH 1MTVA 1RD3B 4DCDA 4OS7A 1D9IA 1PPGE 1KIGH 2ALPA 4MNWA 3MMGA 3AW0A 3VEQB 2ZU4A 2SNWA 2A1DB 2A31A 1J14A 1O2PA 1Y3YA 2VNTA 2ZWLH 4MG3A 4X6OA 1C5WB 1LTOA 1OWIA 1T8LA 4NSYA 3NKKA 4O3TA 1GHWH 5EODA 3SJ9A 3RXSA 3T25A 3HK6B 2Z9GA 4DURA 5K0HA 1UVSH 4AFQA 1CHOG 2Q1JA 2P3FH 3UOUA 9ESTA 2Y5HA 2PTNA 5C3NA 2BM2A 2VU8E 3TGKE 1Z6JH 4A1TA 1YPJH 4NA8A 5C5NA 2VIQA 1HIAB 5DO4H 4CRAA 5C1YA 1ZMNA 2SFAA 3SUEA 1U6QA 2AYWA 2AMDA 1V2ST 1KTSB 1NRNH 5C1UA 4HI3A 3A7ZA 2H5CA 2GZ8A 1FAKH 2BDYA 1HIAA 2WPKS 3GY6A 3M7TA 1O2KA 1GJBB 2ZP0H 4Y7AA 1BTXA 2PSYA 2O8WA 1C2JA 1CT0E 5E0GA 4MPVA 4D9RA 1FIWA 2ZQ2A 5FCRA 2RG3A 1A5HA 2NU0E 3DD2H 2QYIA 3KHVA 3L3TA 3B23B 3LH1A 1ESTA 2ANKH 3MH5A 1DSUA 4XE4A 1C1SA 1GHVH 2ODPA 1SFQB 3QZRA 4UFEH 1ZYOA 2BQWB 1QGFA 1BTPA 5T3HA 3Q00A 1GMDG 1TOCB 1NN6A 5GPIB 1LVMA 3P6ZB 5DP4A 3SZNA 3GY4A 2ZHQH 2CGAA 3MOCA 1CU1A 1EKBB 2UUKB 2XBXA 1RGQA 4Q7YA 4NFFA 1P3EA 3NWUA 3FVFB 3GCHB 2R0LA 1GHZA 1SLVB 3BIVH 3P8NA 1H4WA 2J38A 1TB6H 1BTWA 1C5RA 3P8OA 1XXFA 1VGCB 4YT6H 4UE7H 5ABWA 1UO6A 3SV7A 5K7RA 1GMHF 2J9NA 4RSPA 3TNSA 2OTVA 1C5UA 1A46H 1T8OA 1H8IH 2Z6BD 3A86A 3G01A 3F9FA 1MMJN 3ODFA 2FOFA 4A1VA 4DG4A 1RXPA 2STBE 2XWBI 1P0SH 3DHKH 2R3UA 4RKOB 1E36B 2QN5T 4ZAEA 1TFXA 6GCHG 1C1OA 1SL3A 2CF8H 2FS9A 1BA8B 1O2TA 2UWLA 1GBBA 4H4FA 1V2KT 4JK5A 1WAYB 3Q3YA 1D3QB 3EGKH 1O2MA 2HPPH 1CHGA 2FI4E 4DW2U 3KN2A 1YPHC 1A0JA 3S0NA 1C1PA 1S0RA 3PLPA 1GI0A 1GDNA 2R9PA 1EOJA 2Z9JA 4X2XA 2BZ6H 1XUGA 4AYYB 2R2MB 2PGBB 1SQAA 2J34A 3BTME 1ANDA 2VWLA 4GHQA 4YLUA 8GCHF 1ZPZA 2ZDVH 2FZZA 3MNBA 3BSQA 3F1SB 2RCEA 1C1TA 1EX3A 1DFPA 2FODA 1Z7KA 3KQEA 3RXHA 2K1QA 1YCPK 1O2WA 1O3BA 3B8JA 4ABBA 2SGFE 3M3VA 4H6SB 1ZHPA 1QQUA 1BCUH 3RU4T 1AMHA 2OC0A 1TBZH 1QTFA 2FP7B 4AGKA 2TRMA 3VB5A 1P8VC 3SU5A 2PHBA 1JBUH 5AHGH 3RLWH 5JBAS 1TALA 4A5TS 4WMDA 2VIOA 1C5XB 1C5YB 1WCZA 1HAZB 1AUJA 1D4PB 3UOPA 1UTLM 1K1MA 1O2ZA 2GCHF 3M61U 1C2MA 1V2UT 1DOJA 1FLEE 3MU4A 1OWKA 4AN7A 3LIWA 1DT2A 1P03A 3FAOA 1ZPCA 3ZZ5A 1NU9A 3U8TH 4JMYA 5EGMA 4I33A 1IQEA
chains in the Genus database with same CATH superfamily
4KP0A 1SI5H 4O03A 3TH3H 4ABEA 1C1MA 1BDAA 3VB6A 1E35B 2HGTH 1O2SA 7LPRA 2O8UA 1GMCF 1UW7A 3LC5A 4AG1A 1V3XA 1OWDA 4DY7B 1DXPA 5TCCA 3SNCA 4GUXA 2PSXA 1VCQA 2PKSC 3KQCA 1PYTC 4UDWH 1HXFH 3MYWA 4XOJA 3SNDA 1BMFD 4Y0ZE 3TITA 2W7UA 4TPYA 3MWIU 3NXPA 4YLQH 1UVPA 1TBQH 2ASUB 4ASHA 3GY5A 2Z7FE 1O37A 1IQJA 1KMHB 1W10U 2HWLB 2A2QH 1ETRH 4ACBA 3P8GA 3BTFE 4WVPE 3WW7A 1SGEE 1GMHG 2LPRA 3M3TA 1GHBF 3MNCA 3M3SA 3TU7H 4ABAA 4I7YH 1ZSJA 1FY4A 1D6WA 5JBCS 1C5TA 1O2QA 3LPRA 5E8EH 2ZDKA 2BHGA 1BQYA 1NC6A 1QJ1B 1C1VH 3ATIA 1DE7H 4Y0YE 1TNHA 4FUBA 2Y5GA 1YLNA 2ZU3A 4YM9A 1HCGA 1YM0A 4FU7A 1G9IE 3U9AH 1YF4A 1C2LA 3TJOA 1OPHB 3SOSA 3UR9A 1XUIA 3GICB 1C5VA 2HLDD 2THFB 1L2EA 4ISNA 1IQHA 4GLYA 3ZZ6A 5FHTA 4D7FA 1HUTH 1MTNC 2G4UA 3SUDA 5I46H 4ABFA 2ZCKP 4WXIA 2ULLA 3TIUA 1NS3A 1HV7A 2XC5A 4X8UH 1O2JA 2QAAA 4B2BA 1DWCH 3PYHA 1AHTH 1UHBB 4CHAC 2Y81A 3GCNA 1EQ9A 1F5LA 1AU8A 1K21H 2QXIA 2YOLA 1P9UA 2PKAB 3A8BA 1FDPA 2XNDD 1UK3A 1K9OE 3P70B 3QN7A 7KMEH 2V3OH 4D76A 5C0UA 1GI4A 1EZUC 1O3JA 2BD3A 2G52A 8GCHG 3URDA 1O2OA 4ZKSU 3QZQA 1NY22 1MBMA 1TPAE 1KXDA 3GDVA 4I32A 3RXDA 1C2GA 3RXFA 1LVBA 1ZTJA 2YMSC 4AG2A 4XD7D 3AW1A 1GBTA 4TWYA 3QLPH 1DWBH 1CA0B 3HATH 1WSSH 1LHEH 3PMAB 1EAWA 2H1UA 1FN6A 1L1JA 3UPEA 1W2KH 4AZ2B 3BTKE 5F53A 1HAHH 1TNJA 5BRRE 2WUBA 2H6MA 4ISHH 2ZA5A 3FP7E 5CMXH 3PV5A 4CBOA 2JH5D 3CP7A 4FU9A 1T8NA 4WH8A 1T32A 3B9FH 1CBWC 3UNRA 1GCTB 1F92A 3FOAA 2TGPZ 2VVCA 1IQMA 4X1RU 1YYY1 2GCHG 5HM2A 2Z3DA 1LHCH 2CHAB 1SGIB 1GG6B 3IWMA 3VPKA 1J8AA 1DY9A 2P3UB 4B2CA 2W3KA 2FWWA 1O3OA 1RTLA 4CRDA 4DJZB 1O2YA 1AIXH 2ANWA 1KXBA 1O5DH 4A1XA 3LC3A 1C1UH 4VGCB 1VITH 3QK1A 4IMZA 1NFXA 2AERH 2PP6A 4WH6A 4K5ZA 1GDUA 2VH0A 1SGQE 3CENA 1O5EH 1O2GH 1SGNE 5F03A 4Y71A 4ZMAH 1WU1A 5ESTE 4ESTE 2OINA 1GMCG 1BBRK 3K2UA 2HNTE 2ZGBH 1O3LA 1INCA 1GJDB 1K22H 2BX4A 4NIVA 1C1QA 1M9UA 2EY4C 2FM2A 3W95A 3SUGA 2G55A 2P8OB 1QQ4A 3SU6A 3Q3KA 1O3FA 2WV9A 3FO8D 4CRGA 1TA2A 2A7HA 1QB6A 3KQBA 2W3IA 2D1JA 1C2FA 1L4ZA 2CJIA 2ZF0H 3ZZ9A 2ZC9H 1FPHH 4GCHG 2RA3A 3NCLA 1O33A 1J16A 2EC9H 1XUKA 1CA8B 4WY3A 1Q3XA 4R8TB 4MNXA 4NIWA 1ZHRA 3SHCH 1NZQH 5DP6A 1OYQA 5DK1A 1GI9B 3V13A 1V2RT 1L1GA 1PJPA 1V6DA 1ZGIA 1GI7B 2XWAA 1O30A 5AF9H 1GHBG 1QL8A 1AKSB 3OU0A 5FPSA 4NIXA 5PTPA 3KF2A 2HPQH 5FX6A 4B2AA 4ISOA 3TLOA 2BD9A 5EU8A 4K69A 4WWYA 1ELEE 3FP8E 1RFNA 1J17T 1AQ7A 2BD2A 4NZLA 3UAIC 4AB8A 1AKSA 1NROH 1O5BB 1UTQA 4Q7XA 4RKJB 3Q3XA 5KEDA 1D6RA 3E91A 2JETB 1GJ5H 3WY8A 2V3MA 2F91A 1CQQA 1SVPA 3S9AA 1ORFA 1QR3E 4NWLA 1RS0A 4AYVB 2GTBA 3ZVGA 4BXSA 1S5SA 1G37A 3SQEE 2ZTXA 1MKXK 2VWMA 5CDFE 3N7EA 1BHXF 1AN1E 1J15A 1O35A 5KGOA 2VBCA 5EPYA 1Z1JA 1GI5A 4CRBA 1YKTA 4ISLA 1ACBE 1G30B 5GWZA 1TYNA 1G3BA 3GOVB 1WTGH 2G8TA 1Q31A 4QT8C 1GWAA 4A6LA 3I77A 1WOFA 3GCHC 1C1RA 3A87A 1UTNA 4B76A 2ZGXH 1TMUH 1NRRH 5ETXA 1VGCC 1O2RA 1CO7E 4B75A 1GGDB 2BD7A 1OP0A 1RIWB 1AFQB 1K1OA 1V2WT 3LGUA 2WYGA 4MVNA 4I8JA 3SU3A 1P04A 1ZSKA 4CH8B 4IN1A 1TONA 1CT4E 2PW8H 4I8KA 4BNRA 1TLDA 2QF4A 4Y8ZA 3OEHD 2VIPA 2ODYB 3UQOA 2QIQA 2W6JD 5DP3A 1SOZA 3LU9B 3T29A 1AVGH 1TRNA 2GV7A 5AFZH 4Z0KA 3TK9A 1IQIA 4K8BA 3MU0A 3VG8A 2VB0A 1HNEE 3P8FA 4Z6AH 2FMJA 1GJ7B 2KCPA 1NM6A 4IMQA 1VCWA 4Y10E 5DP5A 1QA0A 1HAVB 1JIMA 3CS0A 1ZMLA 2Q6DA 1ANCA 3W94A 2FLRH 1OOKB 2G5NA 2CMYA 4WJG2 1GVZA 4ACAA 1NRQH 1TA6A 5GCHF 4AORA 5JBTA 3BTGE 1WYKA 1HAVA 4ZXXH 4AGJA 2G51A 1CGIE 3PTNA 1QFKH 5SGAE 3QWCH 4K8YA 2ZDNA 1FZZA 5C0TA 3MTYA 1C5MD 1GPZA 1LHDH 3MO9A 2PTCE 4HTCH 4IGDA 2CN0H 4AFZA 1CGHA 3SU1A 1BITA 2XC0A 4FUFA 4AFUA 2A0QB 4FETA 1AVWA 3UIRA 2EI6A 2Z9LA 1P2MA 5DP9A 2FXRA 1O2UA 2A2XH 3M36A 2GCTC 4B71A 1AWHB 4MDSA 1NPMA 1ELCA 3PM3A 3QTVH 1DICA 1HJAB 1L0ZA 3UFAA 1S6HA 1KXFA 2GT8A 1Z8IB 4JZIA 4TWWA 1ELAA 4X8TH 2P59A 4YOGA 1J9CH 2KR7A 5JYIA 2WPIS 1QL9A 3PLBA 1SGFG 3FZZA 2WZQA 8ESTE 5HM9A 4FUGA 4ABIA 1H8HD 2AIPA 3EA8A 3FP6E 1F2SE 4Y76A 1S6LA 1AB9B 1IHTH 4Y8XA 2FIRH 3TH2H 2WPLS 1BRCE 1BIOA 1CT2E 3EE7A 1NFUA 2AGIX 1EZQA 2FOAA 2V0BA 2JKHA 3FN8A 3D23A 4MTBA 2A7CA 2QXHA 3TJUA 3F0OA 1UVOA 4SGBE 1OXGA 4Q80A 1BRUP 4XBDA 4NFEA 1UTMA 5DJ7A 4I8GA 1T8MA 2Z9IA 1UVTH 1P12E 1TNIA 1W0KD 2ILNA 1ELBA 2BQ6B 3A89A 3VB4A 3M35A 4TY7A 2FI3E 1VKYA 1SGPE 2YNBA 2O9QA 2ZTYA 3BTWE 5ESBA 1BHXB 2ZPQA 1E0FD 3S7KB 4BAKB 1W8BH 2CV3A 1A0LA 4I31A 3RC4A 2ZDAH 3HK3B 1LKAA 1PQAA 1GBLA 4F49A 2GD4B 1BTUA 3EE0B 3E8LA 4YXWD 1FIZA 1XXDA 4JZFH 3ZZ7A 5JB8S 2YMSD 3CNRA 4KGAA 3MU8A 4DT7B 5LPFA 1TRYA 1MD7A 3ATWA 4UEHH 1W7XH 1BB0B 2XCFA 1GJAB 1LPGB 4BTUB 2J98B 2ZFPH 3VXFH 4H42U 2G4TA 1SKYE 1JXPA 2AMPA 2WPHS 2WV5A 4ZUHA 3STJA 4B6EA 5LH8A 3U1JB 2Y80A 1DPOA 2P16A 1W0ZU 1MTWA 3F9HA 1YPGH 1FY8E 3A8CA 1Y8TA 3LGWA 1ZRBA 1DM4B 2J98A 5LPEA 2SGEE 3RC5A 2WPDD 1FNIA 1EAUA 5C2ZA 5DN6D 2XBYA 2C3SA 2FS8A 5C5OA 4X2YA 1HRTH 5DKMA 1E34B 3M7UA 1THRH 1ZHMA 1QA7A 4NZQA 1WQVH 5EQQA 1YC0A 3SJKA 2J92A 4CR5A 1IQKA 2VIVA 2V3HH 3WWBA 2ZPSA 3BTTE 3T62A 1OWEA 2GZ9A 2FOGA 1G3CA 2J2UA 3KIDU 1SMFE 5DPAA 2FO9A 3LOXA 1YPEH 1LKBA 3BEUA 5DGJA 4CR9A 2KZ4A 4GHTA 4X2VA 1GJ9B 1JWTA 4YOIA 4AOQA 3T5FH 3LH3A 1E38B 1MTUA 2KAIB 2BVSH 1C2EA 3PV4A 3FANA 5IK2D 1HGTH 3E16B 3PTBA 3UR6A 1P2IA 1C5OH 1WUNH 5GCHG 1LMWB 1IQNA 3GCOA 3C1KA 2XBVA 3ZVBA 2KAIA 3D62A 4KTUA 3A85A 2WYJA 2VGCB 2CK3D 1PPBH 2GMTB 3RXEA 1MABB 1ANEA 1TX8A 4Q63A 4K2YA 4TY6A 3RXVA 2QXJA 2FOEA 3RXGA 4ZHMU 2B5TB 1HBTH 3H5CB 1HAYB 3LGYA 3EDXB 3PMHB 4LOYH 3SGQE 1OYTH 5EXLA 4DVAU 1YY3A 1QURH 1FI8A 1OKXA 2ZTZA 1TNGA 5LGOA 2BMGB 1DXWA 1SGRE 3KYFA 4NA9H 1YPLH 3GYLB 1IQGA 5J4QA 1MKWH 5FAHA 3ZZCA 3I78A 3T2NA 4P00A 1CA0C 1EASA 2VH6A 4WMEA 1PPCE 1OX1A 3NK8A 4MPWA 3LKWA 1GI6A 1KYNA 3MH7A 1JRTA 3A82A 1T4UH 1SLXB 2G5VA 5EQRA 1O5GH 1O36A 3ODDA 1BTZA 2A5IA 1CGJE 4FUCA 1GCTC 1QRZA 4OS2A 3RUOA 2I6QA 3RM2H 1FPCH 2CHAC 5BPEA 1GG6C 1BOQA 1ELGA 2QA9E 3K6ZA 1VITF 5A8YA 4OS1A 3U8RH 1MBQA 1QY6A 5EIYA 3LGVA 2BDBA 2GDEH 3P92A 4B1TA 1SSXA 1ZSLA 2XCNA 4VGCC 1MU6B 1ZJDA 1GJ4H 3GDUA 1Z1IA 2Z94A 1GVLA 2FOCA 1MAXA 1A1RA 3BTHE 2BD4A 1AY6H 4B74A 4E05H 3OSYA 1FY1A 1YPHE 2LELA 2OXSA 1AO5A 2ALVA 1EB1H 2BYAX 1W3CA 2FTLE 2ZKSA 2HNTF 1G3DA 3O8CA 1YLDA 3PROA 2P8OC 1W0JD 1O2LA 2BX3A 2DE9A 3A7TA 1BRBE 5FL7D 3L6PA 1OP8A 3SV9A 1W13U 5C1XA 4ZROA 3ZYEA 1O2VA 1QZ8A 3PO1C 4MNVA 1THPB 3E0PB 4DOQA 3RXUA 3E90B 1D3DB 1XVMA 1O5FH 2KCOA 2FYQA 5F6MA 4RN6A 1GBDA 3VGCB 2C4FH 2FEQH 1QRWA 3EQ0H 1RRKA 3E1XB 2A4OA 1UJ1A 1PPFE 2FESH 1C4U2 4M9FA 1MCTA 1Q2WA 1O5CB 1H8DH 2EQNA 2QV1A 1SQRA 1ESAA 2JETC 4X1QU 2TBSA 2ZHWH 4FU8A 5FBIA 2ZECA 4D7GA 1UHBA 2J94A 1ARBA 2ZFTA 2J95A 1VJAU 2WPJS 3MU1A 1P09A 2AS9A 2H9HA 1DX5M 2PKAA 3LDXH 2Y7ZA 5T6DA 4FVDA 4P02A 3A88A 1DWEH 2QE7D 3RMOH 3DFJA 1YGCH 4K1TA 1MZAA 3SQHE 1TGCA 1A4WH 2ZCHP 3A8DA 1HAOH 1A0HB 2OLGA 2W26A 1QB1A 2W6ID 5HMAA 2ZU5A 2QGRA 1B5GH 1V2LT 3OYPA 1TX7A 3GY3A 1GGDC 1W12U 1RIWC 1AFQC 1PFXC 2A5KA 3A7WA 1SLWB 1GL1A 2UUFB 3ATMA 1MZDA 3M7QA 1MUEB 2B8OH 3CS7A 2GT7A 1IQLA 4GSOA 5GJ4B 1HYLA 2F3CE 1UCYE 1GHYH 1CSOE 1O2XA 5IYTA 8KME2 2PFEA 2W7SA 6ESTA 3KGPA 2PUQH 1C5QA 3ZYDA 1W7GH 2R2WU 3VB7A 3K65B 2BDGA 4FVBA 3DSPA 2AGGX 4RT0A 5EXMA 2ZGCA 3A7XA 1C5LH 2OQ5A 3S7HB 1ELDE 2LNCA 1TNKA 1UK2A 1AVXA 5B6OA 2AGEX 3QTOH 1YLCA 1UCYH 3LJJA 4K1SA 1UTPA 4M7GA 4E7NA 1AWFH 3SV8A 4K1EA 1SG8B 1C4V2 2VIWA 3QGNB 5L2YH 3V3MA 2ANYA 1HAGE 1GI3A 2WINI 3SN8A 1EZSC 1NO9H 1SBWA 1VITG 2BZAA 2GP9B 4Y8YA 3SV6A 2ZHEH 3RU4E 2BY6X 1KXEA 2OC1A 3RXRA 1DDJA 2QF0A 4XRNA 5CHBA 1NESE 2SGPE 2OD3B 2UWPA 3BTDE 5B6LA 4J2YB 4AX9H 7GCHF 2H9TH 5EJZA 1QBOA 2OP9A 4ABDA 4FUHA 1ELVA 3ENSB 4ZHAA 4BAHB 3AASA 4YOJA 1BTHH 2ZFSA 2ZDMA 4OM9A 1HJAC 4XBCA 1H9LB 1C5PA 1DS2E 1S82A 4X2WA 4GAWA 1SOTA 1WXRA 3RXKA 4I8LA 1GBKA 4XFQA 1BTYA 1DUAA 1F0RA 2A4GA 3URCA 1HAIH 2NWNA 2C8YB 3SU4A 3SYJA 3M37A 4Z1MD 1ZTLA 4YTAA 5GIBA 4NIYA 1UTJA 1FQ3A 1GJCB 1AB9C 3M5OA 4JZEH 3O8DA 1C2DA 1O3AA 3F6UH 2C8WB 3I29A 1NBME 2XXLA 3PV2A 2HOBA 1W14U 3UY9A 2G81E 1O0DH 4Y79A 1S81A 3EAJA 1SLUB 3O8RA 1V2MT 1C9PA 2XOKD 1AE5A 3BG8A 1P2QA 1P2OA 4I8HA 3O8BA 1HPGA 4JYUH 5JBBS 2A45B 3ZVFA 5A0AE 2FOMB 1P3CA 3BTEE 5A2MH 4UFDH 4CRFA 2IJOB 4O9VA 1BT7A 1V2QT 2Q6GA 3OX7U 2BLWA 1P9SA 4ZKRU 1EOLA 4HFPB 3TJNA 1Y5BT 2WHXA 4NWKA 3W1EA 3BG4B 2PWXA 2UUYA 3ZZAA 3R0FA 5E0JA 1HJ8A 1EZXC 3UREA 2ZU2A 1QCPA 5F8ZA 3NRLA 3TVJB 4F4OC 3QX5H 2JH0D 5FXLA 2YMSB 2M5TA 2AHME 3ZZDA 2ZEBA 3BV9B 3KNXA 1PQ5A 1P2NA 3KCGH 1A2CH 4YESB 1N1LA 4X8VH 3AK5A 1DWDH 3HGNA 1N8OB 2H2ZA 1DSTA 4FUJA 1TPSA 4LXBH 1C1WH 2KCYA 1S84A 2EA3A 1DLEA 1PQ8A 2BDIA 2R0KA 3MNXA 3MI4A 5C67A 1G2MA 2A7JA 5EOKA 3RXPA 3VB3A 1TMBH 1GBJA 4KELA 3MU5A 1V2NT 3UWIA 2EI8A 2GJGA 1O32A 3L33A 3TJVA 2BY9X 2STAE 3GCTF 5A0CA 4X6PA 3RXAA 5I25A 4BANB 1BMLA 2FOBA 1MQ6A 4A92A 3IG6B 2NU2E 1Y3XA 3OFND 1AGJA 1F5KU 2QC2A 1COWD 1AFEH 3C27B 4AFSA 4OGXA 2XC4A 2SNVA 5LPRA 3RXLA 1EPTB 1KDQB 3TPIZ 1D3TB 2V35A 1N6YA 2C8XB 4Y7BA 5AVDA 4ISIH 3SHAH 2FX4A 3KQDA 1K1JA 1PPEE 1FX0B 3K6YA 1SB1H 1PYTD 1QRXA 3NPSA 1UVUH 1W0YH 1DVAH 1TABE 4O3UA 1LPZB 3SNAA 1MAYA 4H6TA 1XVOA 1K1NA 1F5RA 3MFJA 3A8AA 2RDLA 4INLA 1VCPA 1OWHA 5JPMH 9LPRA 1O3IA 6CHAB 2BD8A 3RXBA 1WQSA 3RLYH 2BLQA 3SU2A 3GS9A 1ID5H 1V2PT 2P3TB 3SGAE 2KM0A 3TNTA 3UTUH 4IS5A 3PWBA 4LK4A 1A5IA 1NRSH 4WXVA 2OK5A 5HIZA 1FY3A 1KY9A 2V7QD 2VGCC 4INKA 5TJXA 2GMTC 2L74A 4CRCA 3DSGA 2RA0A 7GCHG 1HFDA 1THSH 1SGFA 1Y5AT 2BLVA 2ZU1A 1C4Y2 3R3GB 4THNH 3ZZ8A 1L1NA 4K60A 5DSFA 2QCYA 3P95A 4D9QA 1GJ6A 2BY5X 1DANH 2PUXB 1TRMA 3RU4D 2L6OA 4BTIB 1GBHA 3ATKA 3ZZ3A 4FOUC 3MNSA 1NRPH 1O39A 1GBEA 1HAXB 1GBIA 2JJ2D 2HLCA 1C5ZB 3VFEA 3E0NB 5F8XA 1SQOA 3PLKA 5A8ZA 1S0QA 1O3HA 3FZDA 1ESBA 2I6SA 2Q6FA 2PR3A 3RMMH 1V2OT 1XUFA 1ETTH 1LQDB 2FTMA 2RDEA 1GBMA 4DIHH 1AZ8A 4AB9A 2G00A 2QY0B 2JDID 1EJAA 3TH4H 2XBWA 2AFQB 4HZHA 5DG6A 1ABIH 1E37B 3OE7D 1YWUA 3EA7A 1TGSZ 5EQSA 5FX5A 3F2FA 2B0FA 3S69A 2F9OA 3GISB 1O3PB 3A7YA 3SO3A 2F9VA 4HG6A 1A3EH 2A32A 1CVWH 2Y5FA 3DFLA 2QF3A 1UK4A 1K2I1 1NBMD 1MQ5A 5L6NH 1G32B 3RXOA 3DCLA 1K1PA 1ZJKA 5CHAB 2GV6A 5FPTA 3Q77A 3V7TA 1MU8B 3KL6A 2F9PA 1O3DA 5EJ1A 1O2HA 1XM1A 5IDKA 4YT7H 2D8WA 5HYOA 1GBCA 1TPPA 1H9HE 1AZZA 3MH6A 1ZPBA 2EEKA 1B0FA 3HKJB 3U98H 3BIUH 2BQ7B 1P57B 4JYTA 1YCPH 1QL7A 1HAPH 1FONA 5TCAA 1LVYA 4B6FA 2Y6TA 2WSSD 4LZ1H 2ODQA 1P2KA 2BVRH 1VR1H 5AFYH 1AUTC 5A09A 1JIRA 1KXCA 1SGYE 4KKDA 3V0XA 2F4LA 3PMBB 1ZLRA 2F9NA 2KFWA 4IC5A 3U8OH 2A4RA 3SU0A 1UTOA 1Y3WA 5H4IB 1T31A 4IBLH 2XNIA 1TGNA 3WWFA 4DGJA 3ZV8A 3D49H 3A80A 3T28A 3SJIA 3ZV9A 1C2IA 2OCVB 3GCTG 1H8ED 2XYAA 4ZKOU 1A3BH 1S6FA 2IOTA 1O3KA 2GZ7A 3H09A 3MHWU 3TK5A 1P05A 1O2IA 1ELTA 4K3JA 4MPUA 4NGAH 1O3NA 3RDZA 2BOKA 5HKKD 1KTTB 3VGCC 2AIQA 2HVXA 1EB2A 3LGIA 2O8MA 1T7CA 4MQAA 2PV9B 4OS5A 3S9BA 4YO9A 2K8IA 1TNLA 1K1LA 2GCTB 3GYMA 3H7TA 2B7DH 4MLFB 5FBEA 3RMLH 2R3YA 4BAQB 3ATLA 3PRDA 1MH0A 3M5NA 4ZH8A 2ZDLA 3U69H 3N7DA 3SW2B 1O34A 2IPHA 2SGDE 2TIOA 4IC6A 2AEIH 2GX4A 1JRSA 3RXTA 7ESTE 3LGTA 2GGVB 1A5GH 1QJ6B 1V2TT 1K1IA 1ZZZA 1BUIA 3DUXH 1G36A 1SHHB 5JB9S 3UNSA 3QDZB 3RMNH 4RT1A 1ZR0A 1C5SA 1LDTT 1FJSA 1UTKA 4U2WA 3N7OA 4X1PU 1O38A 1SGTA 3SORA 3E3TA 1GI1A 1O5AB 4TYDA 1QB9A 8LPRA 1XX9A 1EAXA 2BTCE 1WBGB 3FFGA 1E1RD 4E06H 1K28D 2YNAA 3GY2A 2WUCA 3SJ8A 1QIXB 1RTKA 1Y3UA 3ZZ4A 1SFIA 4ZXYH 2DUCA 1FY5A 2BDHA 1XMNB 4JCNA 2BB4A 4TSFD 1UMAH 4X6MA 1EP6A 1SC8U 4UFGH 1HJ9A 2VIDA 5EW1H 1ELFA 1VJ9U 2ZG0H 1O3CA 1ETSH 3PMJA 1A61H 1LCYA 1HXEH 5EXNA 1DY8A 1OHHD 1TIOA 3A81A 2AMQA 3UB0A 3BEIB 2ZNKH 1LHFH 1DUEA 1QHRB 1ZGVA 4WF8A 4Y11E 4TPIZ 1NFWA 5GXPA 1F7ZA 2QXGA 2C93B 4IN2A 2AH4X 1JMOH 3GY8A 1IOEA 2FOHA 1OS8A 2BY8X 3ITIA 3NUMA 4Q2KA 1TQ0B 4CREA 3BTQE 1O3MA 1SGCA 1T4VH 3K9XB 2QF5A 3V12A 1ZOMA 1EP5A 4X0WU 1F0SA 4YZUA 2VVUA 1W11U 4GPGA 2WV4A 1OSSA 2TGAA 3SBKA 1AI8H 1TGBA 3ZVCA 3ZVEA 2SGQE 3D65E 1SHYA 2ZGJA 3BEFB 2HRVA 1AE8H 1MKWK 1YPKH 4GCHF 5A8XA 5C20A 5C94A 1TOMH 3F9EA 2JH6D 4NG9H 2BDCA 3RC6A 5FPYA 2VWNA 1O3GA 5HGGA 2ESTE 5EW2H 3TGJE 3MO6A 4ASUD 1PPHE 1TE0A 4JYVH 5E2PA 2ZFFH 2P95A 4XSKU 1KLTA 2GDDA 1FUJA 1EATA 3LT3A 1E1QD 2Y82A 3RXCA 4E7RG 4BTTB 5EG4A 2Z3EA 4ZHLU 1QJ7B 3AVZA 5HXFA 2ZI2H 1OP2A 1Z8GA 3P17H 2OQUA 4ABGA 2HNTC 1FN8A 3BF6H 1GI8B 3HGPA 4ABJA 4BAMB 2P94A 3SV2H 2ZHFH 2TGTA 1GHAF 1TGTA 1GCDA 2SGAA 5DP7A 1P10A 3T26A 2DE8A 2A5AA 1V2JT 1BMMH 3RP2A 1LPKB 2C90B 3F9GA 1IQFA 2VWOA 3UNQA 1V2VT 5JDUB 4MNYA 1BBRE 2EI7A 3JZ2B 4CH2B 1BJVA 4UONA 3EYDA 1SPJA 4NCYA 3HKIB 2NU1E 5FCKA 1RJXB 4X6NA 3DA9B 1TQ7B 3ZZBA 1AD8H 3M5LA 1P06A 2ZCLP 2BXTH 2FI5E 4FXGH 1DITH 3BG4C 3ELAH 4GVUA 3KEEA 1LO6A 4JZ1A 2FYRA 1GHXH 1N6XA 4MPXA 1Z71A 1D3PB 1Z8JB 3LONA 1EJNA 2CXVA 2VVVA 1Z6EA 2BY7X 1BBRH 1DLKB 1XKBC 3PWCA 2WPMS 1ZRKA 2BXUH 1GDQA 3RXJA 3IITA 4UD9H 2GKVE 1EXFA 1GVKB 3TK6A 1YPMH 1N8OC 4U01A 2BOHB 3RXQA 1PQ7A 2PGQB 2Z9KA 1LQEA 4XBBA 3Q76A 2O8TA 3UWJH 3VXEH 2BD5A 3QGJA 3RXMA 3RXIA 5T6FA 2VINA 1MTSA 5L2ZH 2OBQA 3NZIA 3BN9A 1P11E 5E0HA 2ZGHA 1H1BA 3SGBE 2BVXH 1G2LA 2C8ZB 1GJ8B 2ZZUH 2PKSB 5DP8A 4Y6DA 4X8SH 4F55A 1TBRH 2D26C 3DT0H 4KTCA 1JOUB 5EPNA 1CHOF 1EPTC 1B0EA 3PB1E 1GBFA 1F0UA 2FLBH 4U32A 1FMGA 3JZ1B 1SR5C 3E6PH 1NT1A 1O2NA 4BAOB 3T27A 4FUEA 1CE5A 5A0BA 1X7AC 3MO3A 1MKXH 3F2GA 2H5DA 3RM0H 6LPRA 2J4IA 2J97A 4LZ4B 1B7XB 1GI2A 1MCVA 2ZPRA 3S9CA 2ZFQH 5G4BA 2UWOA 6CHAC 1IHSH 1F0TA 4ZKNU 2ZHDA 4DIIH 4OS4A 2FDAA 4CBNA 4JZDH 1Y59T 2NU4E 4U30A 2F9UA 1C5NH 2OC7A 4ABHA 3ZIAD 4ZCNA 1OWJA 2F9BH 1ZTKA 2BLOA 3PO1B 1KSNA 1ABJH 2IN2A 4BXWA 5HIYA 1WTHD 5GDSH 1XUJA 1VZQH 1HB0B 3SI4H 3U1IB 2V6NA 2XTTB 1HLTH 3SNEA 1G3EA 4X1SU 3AAVA 3KYGA 1YP9A 4PROA 4WMFA 3SNBA 1QBVH 4B73A 1MTNB 1UCYK 3ZVAA 3QO6A 1SGDE 1FV9A 2XW9A 3SI3H 1GMDF 4UFFH 1LHGH 2OUAA 2TGDA 1PPZA 4X1NU 2K0QA 4INHA 2BDAA 4CHAB 2RFKC 2W5EA 5CE1A 1GL0E 2F83A 4IW4E 4OS6A 1BJUA 2HALA 1XKAC 2TPIZ 5J4SA 4SGAE 3F0PA 3QUMP 4TT3D 3F3BA 5T6GA 3LJOA 1BMNH 3F2HA 1Y5UT 2O8LA 1S83A 4J1YA 4HGCA 1KXAA 2CF9H 1GHAG 1P2JA 4NA7A 3UUZA 2OC8A 3STIA 1KLIH 1ZMJA 3A7VA 4AC9A 3OTJE 3EA9A 2ZFRH 2ZO3H 4O97A 1QNJA 2B9LA 2FX6A 3DSOA 2ANMH 4FUIA 1FAXA 1Z8RA 3OEED 1TX6A 1MD8A 1TAWA 2Z3CA 1O3EA 1NTPA 1HDTH 1C2KA 1H9IE 3F68H 2A4QA 4JK6A 3UQVA 1ARCA 2P93A 1LVOA 4R0IA 3A84A 3OY6U 4A7IB 1C9TA 3A83A 1NU7B 1A7SA 2XRCA 2FPZA 2NU3E 1FXYA 3GDSA 5L30H 1BRAA 5CHAC 3TGIE 3ZVDA 1WV7H 3KQ5A 1S85A 1C2HA 1YCPM 1EAIA 4FUDA 1ANBA 2UUJB 3PRBA 6GCHF 2HVYB 3H7OA 1IAUA 1QBNA 3OY5U 5E2OA 5KECA 1CBWB 1O31A 3AAUA 1P01A 2OBOA 1KLJH 1YBWA 1TPOA 1RTFB 1TMTH 4OGYA 3MH4A 1P02A 3SUFA 2PLXA 2ZQ1A 1XUHA 1C1NA 1BMAA 1EUFA 2H9EH 2GVFA 3ESTA 4BOHA 1NFYA 4KTSA 1Y3VA 1L4DA 3HPTB 3M5MA 2Y7XA 3GY7A 4NSVA 1EJMA 1EFRD 1TWXB 5F8TA 4XDEA 2D2DA 4Q7ZA 5C17A 4D8NA 1SQTA 3SJOA 1EPTA 1BZXE 1GBAA 1KDQA 2VJ1A 2ZIQH 1MTVA 1RD3B 4DCDA 4OS7A 1D9IA 1PPGE 1KIGH 2ALPA 5T1VA 4MNWA 3MMGA 3AW0A 3VEQB 2ZU4A 2SNWA 2A1DB 2A31A 1J14A 1O2PA 1Y3YA 2VNTA 2ZWLH 4MG3A 4X6OA 1C5WB 1LTOA 1OWIA 1T8LA 4NSYA 3NKKA 4O3TA 1GHWH 5EODA 3SJ9A 3RXSA 3T25A 3HK6B 2Z9GA 4DURA 5K0HA 1UVSH 4AFQA 1CHOG 2Q1JA 2P3FH 3UOUA 2IJD1 9ESTA 5EJLA 2J5UA 2Y5HA 2PTNA 5C3NA 2BM2A 2VU8E 3TGKE 1Z6JH 4A1TA 1YPJH 4NA8A 5C5NA 2VIQA 1HIAB 5DO4H 4CRAA 5C1YA 1ZMNA 2SFAA 3SUEA 1U6QA 2AYWA 2AMDA 1V2ST 1KTSB 1NRNH 5C1UA 4HI3A 3A7ZA 2H5CA 2GZ8A 1FAKH 2BDYA 1HIAA 2WPKS 3GY6A 3M7TA 1O2KA 1GJBB 2ZP0H 2JJ1D 3FKSD 4Y7AA 1BTXA 2PSYA 2O8WA 4I86A 1C2JA 1CT0E 5E0GA 4MPVA 4D9RA 1FIWA 2ZQ2A 5FCRA 1WDIA 2RG3A 1A5HA 2NU0E 3DD2H 2QYIA 3KHVA 3L3TA 3B23B 3LH1A 3N99A 1ESTA 2ANKH 3MH5A 1DSUA 4XE4A 1C1SA 1GHVH 2ODPA 1SFQB 3OAAD 3QZRA 4UFEH 1ZYOA 2BQWB 1QGFA 1BTPA 5T3HA 3Q00A 1GMDG 1TOCB 1NN6A 5GPIB 1LVMA 3P6ZB 5DP4A 3SZNA 3GY4A 2ZHQH 2CGAA 3MOCA 1CU1A 1EKBB 2UUKB 2XBXA 1RGQA 4Q7YA 4NFFA 1P3EA 3NWUA 3FVFB 3GCHB 2R0LA 1GHZA 1SLVB 3BIVH 3P8NA 1H4WA 2J38A 1TB6H 1BTWA 1C5RA 3P8OA 2JIZD 1XXFA 4Q4LA 1VGCB 4YT6H 4UE7H 5ABWA 1UO6A 3SV7A 5K7RA 1GMHF 3SZEA 2J9NA 4RSPA 3TNSA 2OTVA 1C5UA 1A46H 1T8OA 1H8IH 2Z6BD 4DT4A 3A86A 3G01A 3F9FA 1MMJN 3ODFA 2FOFA 4F48B 4A1VA 2LP6A 5GNDA 4DG4A 1RXPA 2STBE 2KCAA 2XWBI 1P0SH 3DHKH 2R3UA 4RKOB 1E36B 2QN5T 4ZAEA 1TFXA 6GCHG 1C1OA 1SL3A 2CF8H 2FS9A 1BA8B 1O2TA 1E79D 2UWLA 1GBBA 4H4FA 1V2KT 4JK5A 1WAYB 3Q3YA 1D3QB 3EGKH 1O2MA 2HPPH 1CHGA 2FI4E 4DW2U 3KN2A 1YPHC 1A0JA 3S0NA 1C1PA 1S0RA 3PLPA 1GI0A 1GDNA 2R9PA 1EOJA 2Z9JA 3U28C 4X2XA 2BZ6H 1XUGA 2F43B 4AYYB 2R2MB 2PGBB 1SQAA 2J34A 3BTME 1ANDA 2VWLA 4GHQA 4YLUA 8GCHF 1ZPZA 2ZDVH 2M2AA 2FZZA 3MNBA 3BSQA 3F1SB 2RCEA 1C1TA 1EX3A 1DFPA 2FODA 1Z7KA 3KQEA 3RXHA 2K1QA 1YCPK 1O2WA 1O3BA 3B8JA 4ABBA 2SGFE 3M3VA 4H6SB 1ZHPA 1K0HA 1QQUA 1BCUH 3RU4T 1AMHA 2OC0A 4RI0A 1TBZH 1QTFA 2FP7B 4AGKA 2TRMA 3VB5A 1P8VC 3SU5A 2PHBA 1JBUH 5AHGH 3RLWH 5JBAS 1TALA 4A5TS 4WMDA 2VIOA 3OTPA 1C5XB 1C5YB 1WCZA 1HAZB 3MQKC 1AUJA 2KX4A 1D4PB 3UOPA 1UTLM 1K1MA 1O2ZA 2GCHF 3M61U 1C2MA 1V2UT 1DOJA 2IPQX 1FLEE 3MU4A 1OWKA 4AN7A 3LIWA 1DT2A 1P03A 3FAOA 1ZPCA 3ZZ5A 1NU9A 3U8TH 4JMYA 5EGMA 4I33A 1IQEA
chains in the Genus database with same CATH topology
4KP0A 1SI5H 4O03A 3TH3H 4ABEA 1C1MA 1BDAA 3VB6A 1E35B 2HGTH 1O2SA 7LPRA 2O8UA 1GMCF 3LC5A 4AG1A 1V3XA 1OWDA 4DY7B 1DXPA 5TCCA 3SNCA 4GUXA 2PSXA 1VCQA 2PKSC 3KQCA 1PYTC 4UDWH 1HXFH 3MYWA 4XOJA 3SNDA 3TITA 4Y0ZE 2W7UA 4TPYA 3MWIU 3NXPA 4YLQH 1UVPA 1TBQH 2ASUB 4ASHA 3GY5A 2Z7FE 1O37A 1IQJA 2HWLB 1W10U 2A2QH 1ETRH 3P8GA 3BTFE 4WVPE 1SGEE 1GMHG 2LPRA 3M3TA 1GHBF 3MNCA 3M3SA 3TU7H 4ABAA 4I7YH 1ZSJA 1FY4A 1D6WA 5JBCS 1C5TA 1O2QA 3LPRA 5E8EH 2ZDKA 2BHGA 1BQYA 1NC6A 1QJ1B 1C1VH 3ATIA 1DE7H 4Y0YE 1TNHA 4FUBA 2Y5GA 2ZU3A 4YM9A 1HCGA 1YM0A 4FU7A 1G9IE 3U9AH 1YF4A 1C2LA 3TJOA 1OPHB 3SOSA 3UR9A 1XUIA 3GICB 1C5VA 2THFB 1L2EA 4ISNA 1IQHA 4GLYA 3ZZ6A 5FHTA 4D7FA 1HUTH 1MTNC 2G4UA 3SUDA 5I46H 4ABFA 2ZCKP 4WXIA 2ULLA 3TIUA 1NS3A 1HV7A 2XC5A 4X8UH 1O2JA 2QAAA 4B2BA 1DWCH 3PYHA 1AHTH 1UHBB 4CHAC 2Y81A 3GCNA 1EQ9A 1F5LA 1AU8A 1K21H 2QXIA 2YOLA 1P9UA 2PKAB 3A8BA 1FDPA 1UK3A 1K9OE 3P70B 3QN7A 7KMEH 2V3OH 4D76A 1GI4A 1EZUC 1O3JA 2BD3A 2G52A 8GCHG 3URDA 1O2OA 4ZKSU 3QZQA 1NY22 1MBMA 1TPAE 1KXDA 3GDVA 4I32A 3RXDA 1C2GA 3RXFA 1LVBA 1ZTJA 4AG2A 3AW1A 1GBTA 4TWYA 3QLPH 1DWBH 1CA0B 3HATH 1WSSH 1LHEH 3PMAB 1EAWA 2H1UA 1FN6A 1L1JA 3UPEA 1W2KH 4AZ2B 3BTKE 1HAHH 1TNJA 5BRRE 2WUBA 2H6MA 4ISHH 2ZA5A 3FP7E 5CMXH 4CBOA 2JH5D 3CP7A 4FU9A 1T8NA 4WH8A 1T32A 3B9FH 1CBWC 3UNRA 1GCTB 1F92A 2TGPZ 2VVCA 1IQMA 4X1RU 1YYY1 2GCHG 5HM2A 2Z3DA 1LHCH 2CHAB 1SGIB 1GG6B 3IWMA 3VPKA 1J8AA 1DY9A 2P3UB 4B2CA 2W3KA 2FWWA 1O3OA 1RTLA 4CRDA 4DJZB 1O2YA 1AIXH 2ANWA 1KXBA 1O5DH 4A1XA 3LC3A 1C1UH 4VGCB 1VITH 3QK1A 4IMZA 1NFXA 2AERH 4WH6A 4K5ZA 1GDUA 2VH0A 1SGQE 3CENA 1O5EH 1O2GH 1SGNE 5F03A 4Y71A 4ZMAH 1WU1A 5ESTE 4ESTE 2OINA 1GMCG 1BBRK 3K2UA 2HNTE 2ZGBH 1O3LA 1INCA 1GJDB 1K22H 2BX4A 4NIVA 1C1QA 1M9UA 2FM2A 3W95A 3SUGA 2G55A 2P8OB 1QQ4A 3SU6A 3Q3KA 1O3FA 4CRGA 1TA2A 2A7HA 1QB6A 3KQBA 2W3IA 2D1JA 1C2FA 1L4ZA 2CJIA 2ZF0H 3ZZ9A 2ZC9H 1FPHH 4GCHG 2RA3A 3NCLA 1O33A 1J16A 2EC9H 1XUKA 1CA8B 4WY3A 1Q3XA 4R8TB 4MNXA 4NIWA 1ZHRA 3SHCH 1NZQH 5DP6A 1OYQA 5DK1A 1GI9B 3V13A 1V2RT 1L1GA 1PJPA 1V6DA 1ZGIA 1GI7B 2XWAA 1O30A 5AF9H 1GHBG 1QL8A 1AKSB 3OU0A 5FPSA 4NIXA 5PTPA 3KF2A 2HPQH 5FX6A 4B2AA 4ISOA 3TLOA 2BD9A 5EU8A 4K69A 4WWYA 1ELEE 3FP8E 1RFNA 1J17T 1AQ7A 2BD2A 4NZLA 4AB8A 1AKSA 1NROH 1O5BB 1UTQA 4Q7XA 4RKJB 3Q3XA 1D6RA 3E91A 2JETB 1GJ5H 3WY8A 2F91A 1CQQA 1SVPA 3S9AA 1ORFA 1QR3E 4NWLA 1RS0A 4AYVB 2GTBA 3ZVGA 4BXSA 1S5SA 1G37A 3SQEE 2ZTXA 1MKXK 2VWMA 1BHXF 1AN1E 1J15A 1O35A 5EPYA 1Z1JA 1GI5A 4CRBA 1YKTA 4ISLA 1ACBE 1G30B 5GWZA 1TYNA 1G3BA 3GOVB 1WTGH 2G8TA 1Q31A 4QT8C 1GWAA 4A6LA 3I77A 1WOFA 3GCHC 1C1RA 3A87A 1UTNA 4B76A 2ZGXH 1TMUH 1NRRH 5ETXA 1VGCC 1O2RA 1CO7E 4B75A 1GGDB 2BD7A 1OP0A 1RIWB 1AFQB 1K1OA 1V2WT 3LGUA 2WYGA 4MVNA 4I8JA 3SU3A 1P04A 1ZSKA 4CH8B 4IN1A 1TONA 1CT4E 2PW8H 4I8KA 4BNRA 1TLDA 4Y8ZA 2VIPA 2ODYB 3UQOA 2QIQA 5DP3A 1SOZA 3LU9B 3T29A 1AVGH 1TRNA 2GV7A 5AFZH 4Z0KA 3TK9A 1IQIA 4K8BA 3MU0A 2VB0A 1HNEE 3P8FA 4Z6AH 2FMJA 1GJ7B 1NM6A 4IMQA 1VCWA 4Y10E 5DP5A 1QA0A 1HAVB 1JIMA 3CS0A 1ZMLA 2Q6DA 1ANCA 3W94A 2FLRH 1OOKB 2G5NA 2CMYA 4WJG2 1GVZA 1NRQH 1TA6A 5GCHF 4AORA 5JBTA 3BTGE 1WYKA 1HAVA 4ZXXH 4AGJA 2G51A 1CGIE 3PTNA 1QFKH 5SGAE 3QWCH 4K8YA 2ZDNA 1FZZA 3MTYA 1C5MD 1GPZA 1LHDH 3MO9A 2PTCE 4HTCH 4IGDA 2CN0H 4AFZA 1CGHA 3SU1A 1BITA 2XC0A 4FUFA 4AFUA 2A0QB 1AVWA 3UIRA 2EI6A 2Z9LA 1P2MA 5DP9A 2FXRA 1O2UA 2A2XH 3M36A 2GCTC 4B71A 1AWHB 4MDSA 1NPMA 1ELCA 3PM3A 3QTVH 1DICA 1HJAB 1L0ZA 3UFAA 1S6HA 1KXFA 2GT8A 1Z8IB 4JZIA 4TWWA 1ELAA 4X8TH 2P59A 4YOGA 1J9CH 5JYIA 2WPIS 1QL9A 3PLBA 1SGFG 3FZZA 8ESTE 5HM9A 4FUGA 4ABIA 2AIPA 3EA8A 3FP6E 1F2SE 4Y76A 4Y8XA 1AB9B 1IHTH 2FIRH 3TH2H 2WPLS 1BRCE 1BIOA 1CT2E 1NFUA 2AGIX 1EZQA 2FOAA 2V0BA 2JKHA 3D23A 4MTBA 2A7CA 2QXHA 3TJUA 1UVOA 4SGBE 1OXGA 4Q80A 1BRUP 4XBDA 4NFEA 1UTMA 5DJ7A 4I8GA 1T8MA 2Z9IA 1UVTH 1P12E 1TNIA 2ILNA 1ELBA 2BQ6B 3A89A 3VB4A 3M35A 4TY7A 2FI3E 2YNBA 1SGPE 2O9QA 2ZTYA 3BTWE 5ESBA 1BHXB 2ZPQA 1E0FD 3S7KB 4BAKB 1W8BH 2CV3A 1A0LA 4I31A 3RC4A 2ZDAH 3HK3B 1LKAA 1PQAA 1GBLA 4F49A 2GD4B 1BTUA 3EE0B 3E8LA 1FIZA 1XXDA 4JZFH 3ZZ7A 5JB8S 4DT7B 4KGAA 3MU8A 5LPFA 1TRYA 1MD7A 3ATWA 4UEHH 1W7XH 1BB0B 2XCFA 1GJAB 1LPGB 4BTUB 2ZFPH 3VXFH 4H42U 2G4TA 1JXPA 2AMPA 2WPHS 2WV5A 4ZUHA 3STJA 5LH8A 3U1JB 2Y80A 1DPOA 2P16A 1W0ZU 1MTWA 3F9HA 1YPGH 1FY8E 3A8CA 1Y8TA 3LGWA 1ZRBA 1DM4B 5LPEA 2SGEE 3RC5A 1FNIA 1EAUA 5C2ZA 2XBYA 2C3SA 2FS8A 5C5OA 4X2YA 1HRTH 5DKMA 1E34B 3M7UA 1THRH 1ZHMA 1QA7A 4NZQA 1WQVH 5EQQA 1YC0A 3SJKA 2J92A 4CR5A 1IQKA 2VIVA 2V3HH 2ZPSA 3BTTE 3T62A 1OWEA 2GZ9A 2FOGA 1G3CA 2J2UA 3KIDU 1SMFE 5DPAA 2FO9A 3LOXA 1YPEH 1LKBA 3BEUA 5DGJA 4CR9A 4GHTA 4X2VA 1GJ9B 1JWTA 4YOIA 4AOQA 3T5FH 3LH3A 1E38B 1MTUA 2KAIB 2BVSH 1C2EA 3PV4A 3FANA 1HGTH 3E16B 3PTBA 3UR6A 1P2IA 1C5OH 1WUNH 5GCHG 1LMWB 1IQNA 3GCOA 3C1KA 2XBVA 3ZVBA 2KAIA 3D62A 4KTUA 3A85A 2WYJA 2VGCB 3RXEA 1PPBH 2GMTB 1ANEA 1TX8A 4K2YA 4TY6A 3RXVA 2QXJA 2FOEA 3RXGA 4ZHMU 2B5TB 1HBTH 3H5CB 1HAYB 3LGYA 3EDXB 3PMHB 4LOYH 3SGQE 1OYTH 5EXLA 4DVAU 1QURH 1FI8A 1OKXA 2ZTZA 1TNGA 5LGOA 2BMGB 1DXWA 1SGRE 4NA9H 1YPLH 3GYLB 1IQGA 5J4QA 1MKWH 5FAHA 3ZZCA 3I78A 3T2NA 1CA0C 1EASA 2VH6A 4WMEA 1PPCE 1OX1A 3NK8A 4MPWA 3LKWA 1GI6A 1KYNA 3MH7A 1JRTA 3A82A 1T4UH 1SLXB 2G5VA 5EQRA 1O5GH 1O36A 3ODDA 1BTZA 2A5IA 1CGJE 4FUCA 1GCTC 1QRZA 4OS2A 3RUOA 2I6QA 3RM2H 1FPCH 2CHAC 5BPEA 1GG6C 1BOQA 1ELGA 2QA9E 3K6ZA 1VITF 5A8YA 4OS1A 3U8RH 1MBQA 1QY6A 3LGVA 2BDBA 2GDEH 3P92A 4B1TA 1SSXA 1ZSLA 2XCNA 4VGCC 1MU6B 1ZJDA 1GJ4H 3GDUA 1Z1IA 2Z94A 1GVLA 2FOCA 1MAXA 1A1RA 3BTHE 2BD4A 1AY6H 4B74A 4E05H 3OSYA 1FY1A 1YPHE 2OXSA 1AO5A 2ALVA 1EB1H 2BYAX 1W3CA 2FTLE 2ZKSA 2HNTF 1G3DA 3O8CA 1YLDA 3PROA 2P8OC 1O2LA 2BX3A 2DE9A 3A7TA 1BRBE 3L6PA 1OP8A 3SV9A 1W13U 5C1XA 4ZROA 3ZYEA 1O2VA 3PO1C 4MNVA 1THPB 3E0PB 4DOQA 3RXUA 3E90B 1D3DB 1XVMA 1O5FH 2FYQA 5F6MA 4RN6A 1GBDA 3VGCB 2C4FH 2FEQH 1QRWA 3EQ0H 1RRKA 3E1XB 2A4OA 1UJ1A 1PPFE 2FESH 1C4U2 1MCTA 1Q2WA 1O5CB 1H8DH 2QV1A 1ESAA 2JETC 4X1QU 2TBSA 2ZHWH 4FU8A 5FBIA 2ZECA 4D7GA 1UHBA 2J94A 1ARBA 2ZFTA 2J95A 1VJAU 2WPJS 3MU1A 1P09A 2AS9A 2H9HA 1DX5M 2PKAA 3LDXH 2Y7ZA 5T6DA 4FVDA 3A88A 1DWEH 3RMOH 3DFJA 1YGCH 4K1TA 1MZAA 3SQHE 1TGCA 1A4WH 2ZCHP 3A8DA 1HAOH 1A0HB 2OLGA 2W26A 1QB1A 5HMAA 2ZU5A 2QGRA 1B5GH 1V2LT 3OYPA 1TX7A 3GY3A 1GGDC 1W12U 1RIWC 1AFQC 1PFXC 2A5KA 3A7WA 1SLWB 1GL1A 2UUFB 3ATMA 1MZDA 3M7QA 1MUEB 2B8OH 3CS7A 2GT7A 1IQLA 4GSOA 5GJ4B 1HYLA 2F3CE 1UCYE 1GHYH 1CSOE 1O2XA 5IYTA 8KME2 2PFEA 2W7SA 6ESTA 3KGPA 2PUQH 1C5QA 3ZYDA 1W7GH 2R2WU 3VB7A 3K65B 2BDGA 4FVBA 2AGGX 5EXMA 2ZGCA 3A7XA 1C5LH 2OQ5A 3S7HB 1ELDE 2LNCA 1TNKA 1UK2A 1AVXA 5B6OA 2AGEX 3QTOH 1YLCA 1UCYH 3LJJA 4K1SA 1UTPA 4M7GA 4E7NA 1AWFH 3SV8A 4K1EA 1SG8B 1C4V2 2VIWA 3QGNB 5L2YH 3V3MA 2ANYA 1HAGE 1GI3A 2WINI 3SN8A 1EZSC 1NO9H 1SBWA 1VITG 2BZAA 2GP9B 4Y8YA 3SV6A 2ZHEH 3RU4E 2BY6X 1KXEA 2OC1A 3RXRA 1DDJA 2QF0A 1NESE 2SGPE 2OD3B 2UWPA 3BTDE 7GCHF 4J2YB 4AX9H 2H9TH 1QBOA 2OP9A 4ABDA 4FUHA 1ELVA 3ENSB 4ZHAA 4BAHB 3AASA 4YOJA 1BTHH 2ZFSA 2ZDMA 1HJAC 4XBCA 1H9LB 1C5PA 1DS2E 1S82A 4X2WA 4GAWA 1SOTA 3RXKA 4I8LA 1GBKA 4XFQA 1BTYA 1DUAA 1F0RA 2A4GA 3URCA 1HAIH 2NWNA 2C8YB 3SU4A 3M37A 1ZTLA 4YTAA 5GIBA 4NIYA 1UTJA 1FQ3A 1GJCB 1AB9C 3M5OA 4JZEH 3O8DA 1C2DA 1O3AA 3F6UH 2C8WB 3I29A 2XXLA 2HOBA 1W14U 3UY9A 2G81E 1O0DH 4Y79A 1S81A 3EAJA 1SLUB 3O8RA 1V2MT 1C9PA 1AE5A 3BG8A 1P2QA 1P2OA 4I8HA 3O8BA 1HPGA 4JYUH 5JBBS 2A45B 3ZVFA 5A0AE 2FOMB 1P3CA 3BTEE 5A2MH 4UFDH 4CRFA 2IJOB 4O9VA 1BT7A 1V2QT 2Q6GA 3OX7U 2BLWA 1P9SA 4ZKRU 1EOLA 4HFPB 3TJNA 1Y5BT 4NWKA 3BG4B 2PWXA 2UUYA 3ZZAA 3R0FA 5E0JA 1HJ8A 1EZXC 3UREA 2ZU2A 1QCPA 5F8ZA 3TVJB 4F4OC 3QX5H 2JH0D 5FXLA 2M5TA 3ZZDA 2ZEBA 3BV9B 3KNXA 1PQ5A 1P2NA 3KCGH 1A2CH 4YESB 1N1LA 4X8VH 1DWDH 3HGNA 1N8OB 2H2ZA 1DSTA 4FUJA 1TPSA 4LXBH 1C1WH 1S84A 2EA3A 1DLEA 1PQ8A 2BDIA 2R0KA 3MNXA 3MI4A 5C67A 1G2MA 2A7JA 5EOKA 3RXPA 3VB3A 1TMBH 1GBJA 4KELA 3MU5A 1V2NT 3UWIA 2EI8A 1O32A 3L33A 3TJV