1OP8A

Crystal structure of human granzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
234
structure length
234
Chain Sequence
IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the apoptosis-inducing human granzyme A dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Granzyme A
total genus 50
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.78: Granzyme A.
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A02
1ABJH 3QGJA 1MBMA 2GVFA 1W7GH 2WPJS 5F8ZA 3K2UA 4RN6A 1G30B 4Q7ZA 5FHTA 3VXFH 1AE5A 1OXGA 3TIUA 5CHAC 1ZLRA 2ZFRH 3HGPA 1F5RA 2QC2A 5GPIB 2Y7XA 4ABEA 3QGNB 1C5ZB 4QT8C 1GBTA 4CRGA 1GBAA 1TX6A 1XX9A 1XXFA 2R2MB 1TGTA 4NIXA 2TPIZ 1SGTA 1GI9B 1GI3A 1V2VT 4ABIA 1T31A 1GG6B 1DITH 4UE7H 1A5GH 3AVZA 3OTJE 1XM1A 4JZEH 2H5DA 3SHAH 1LHDH 2BXTH 5A0CA 5DP9A 3GYMA 3GY5A 2J92A 2H9EH 1XUHA 2C8YB 5HYOA 2FOBA 1X7AC 1P2OA 1WYKA 2P93A 3LKWA 3UOPA 1GHYH 1O3CA 1P11E 1D4PB 1ETTH 1NN6A 1TFXA 4J1YA 5C1XA 5SGAE 2EI7A 6GCHG 1ZJKA 4JZDH 3E0PB 1MZDA 3ZZDA 3URDA 1C1MA 4TPIZ 3O8RA 5J4SA 5JBBS 1HDTH 2ZP0H 1Z8IB 4J2YB 1GI2A 4X2XA 1DOJA 3MH6A 2A1DB 4NG9H 1TA6A 1FPCH 1GMHF 2BLQA 5L2YH 2PUQH 3TPIZ 1RXPA 1V2JT 5FCRA 3LT3A 1TX7A 4GAWA 4FU9A 4AYYB 2FZZA 1C1TA 3A7VA 1LHFH 2ZTZA 4ABBA 2BOKA 4NGAH 3ZVAA 2H5CA 2PLXA 5JYIA 5DP4A 1SLWB 1PPFE 4GSOA 4GHTA 4IN1A 1IQMA 2C4FH 1AZ8A 5AHGH 1SLUB 3SU2A 1VCQA 2B8OH 2A4QA 2BY8X 4IC5A 3P8OA 1QFKH 1ELBA 1ZTLA 4MDSA 1DVAH 1TQ7B 1Y3XA 1O3DA 2XBVA 4HI3A 3ZVEA 2R2WU 1C5SA 2ZGXH 4U32A 4IMQA 1OKXA 3K9XB 1W12U 1AWFH 1Q3XA 4DW2U 1RD3B 2UWOA 4KTSA 1GPZA 2ZTYA 1GBCA 1ZRKA 1K2I1 2IN2A 1HUTH 4DURA 1UVPA 3MNXA 4PROA 1P9UA 3CS7A 1AD8H 1CT2E 3FZDA 3GISB 2ZPSA 5AFZH 1AUTC 4K2YA 1AE8H 1V2OT 2UUFB 1GDNA 1TPOA 1P03A 4YO9A 1DDJA 3LPRA 3VB6A 3GCHC 1O2OA 1P10A 1TNJA 1O5FH 1BUIA 3A86A 5C20A 4I8JA 1GMDF 2ZG0H 2BD4A 5E2OA 3S9AA 3SQEE 1NESE 2J94A 2H9HA 1V2RT 2D26C 2UWLA 5ESBA 4B2BA 5J4QA 1AKSA 2FI3E 4ZH8A 3BG8A 1MD7A 3BIUH 3SUGA 1FIWA 1F7ZA 1O34A 2AMDA 2OD3B 2R0KA 2ZC9H 3TH2H 1O3KA 2BY6X 1LPKB 1TNIA 4K1TA 2ZGCA 3MWIU 4CRFA 1ZMNA 4MNVA 5JB8S 3HGNA 1C2GA 1BT7A 1AVXA 2QXJA 1QTFA 4B75A 2SNWA 1MUEB 1DFPA 3BEFB 2JH5D 5TCCA 1K1IA 2Z3DA 2AMPA 2DE8A 3NCLA 3W95A 3QX5H 2EI6A 4JK6A 3LH3A 3LGIA 1ZYOA 4XSKU 1PQ7A 4E7NA 1EPTC 1G3BA 1QQUA 3BV9B 1GVLA 3RMMH 1HAZB 1GJ7B 3PTNA 3SJKA 4TWWA 2Z7FE 3NXPA 3S69A 5I46H 1DY8A 2BHGA 1C5WB 1FNIA 3RXGA 3SU3A 4X2VA 2BY5X 3TK9A 5FPSA 4IMZA 4O3TA 1AFQB 1AQ7A 1P02A 3L6PA 1Z6JH 1OYTH 3QZQA 5HGGA 3QTOH 1SQAA 3V7TA 1O30A 5L2ZH 2WV4A 5DKMA 2JETC 2Z9JA 3F68H 5GCHF 2A7HA 3I77A 4CRDA 2OLGA 4OS6A 1TRNA 2SGPE 3MH7A 2XC5A 1C1WH 2AGIX 4I8HA 3G01A 8LPRA 2PGQB 3GICB 1P2JA 1LQEA 1J8AA 1DICA 2XBYA 1LVMA 3V0XA 1OWHA 1F5LA 5L6NH 3ZZ6A 2Z9GA 4WXVA 1QA7A 4NFFA 1LHGH 1SBWA 1OWEA 3MH5A 3TJUA 3BTGE 3MMGA 4HZHA 4Q80A 3TH4H 1P06A 2P3TB 3C27B 1TABE 4IS5A 1Z1JA 2ILNA 3RXBA 2OC8A 1QB9A 1P3EA 5C1YA 1GBFA 1NRNH 1UVUH 1O2SA 3O8CA 1VJAU 1NROH 3EA7A 3A7ZA 1K1MA 2V6NA 3V13A 1OP0A 3Q3YA 1QJ7B 1D9IA 6GCHF 4F49A 4H6TA 1TGSZ 1PPGE 1SI5H 1AUJA 2ZU3A 1JBUH 2CGAA 2A4GA 1GHAF 4BNRA 3RXTA 2ZFTA 1IHSH 3T5FH 1DWBH 2OQUA 2QY0B 1A3EH 3SGAE 4A7IB 1ZPBA 2BDAA 3TK5A 1QQ4A 4NA7A 1BMLA 1A2CH 1BTXA 4I8KA 3BEUA 1GJCB 5FX5A 2A5IA 4ZXXH 1ZGIA 2ZTXA 1THRH 1KIGH 2J38A 3P8GA 4TPYA 2A4OA 3DA9B 5EXMA 4AFZA 1KXFA 1GJDB 2WPIS 1BOQA 5C67A 2JKHA 1PPEE 1VCWA 1C5RA 1K9OE 3KHVA 4ESTE 2B0FA 2BMGB 4H4FA 1DWEH 1QY6A 4YESB 1TGBA 4DG4A 1XUFA 1IQEA 2FX6A 2Q1JA 1HYLA 4ABDA 4LK4A 1PPHE 1MZAA 1T8OA 2ZCHP 1A0HB 1WQVH 5EOKA 3UQOA 2XC4A 4D7FA 1B0EA 1ZOMA 4OGXA 1O2ZA 3MO6A 1CHGA 2ZDAH 2STBE 3SU4A 3P8FA 2CJIA 1ZRBA 3RP2A 1HJ9A 1F0SA 3LDXH 3VFEA 1HAXB 2LPRA 1OYQA 1QL8A 1AZZA 1O2NA 2GT8A 2ZPQA 5DPAA 1W2KH 1W8BH 3MU4A 5EODA 5ABWA 4XBBA 4Y7AA 1LO6A 1MKWH 1NFWA 1K1LA 2GCTC 1O5EH 1OP8A 6CHAC 8GCHG 1GBEA 1O36A 3SUDA 1TIOA 3SNAA 3SGBE 1ZHRA 1O39A 2B7DH 2BZAA 1J14A 1MU8B 2DE9A 1A7SA 3A8BA 1AMHA 1H9HE 1JMOH 1E34B 4YOJA 4JYTA 3ENSB 1G3EA 3GY2A 1BBRH 1P0SH 3H7OA 4FUBA 3M35A 2UUYA 2G5VA 1QR3E 1C5XB 1GJ8B 1P3CA 2HGTH 1TQ0B 1VCPA 3A82A 2WUBA 1W11U 2P8OB 4BAHB 1EZXC 2R0LA 2Z9KA 1UK4A 1O3HA 4ZKSU 4Y79A 3QK1A 3QN7A 1HIAA 4GHQA 1XUKA 1SGEE 5E2PA 3F9HA 3RXQA 3SJOA 4RSPA 1WTHD 1GG6C 2OP9A 2R3UA 1DS2E 1DSUA 2VIVA 4X6NA 4ZHAA 1UTNA 1FN8A 2O8UA 1WAYB 3LJOA 2UUJB 1TOCB 4GUXA 1SVPA 1JWTA 1L4ZA 3U1JB 4I7YH 1SGQE 1MTSA 1XUGA 4ISNA 2WPHS 2GDEH 5T6FA 3EDXB 1O2XA 3SI4H 1S83A 1Y5AT 3LU9B 4GCHF 2BDGA 1DT2A 1Z8RA 2RCEA 3M5LA 2RA3A 1CQQA 1GHAG 1V2PT 1N6YA 1HB0B 2XTTB 4FUHA 3QZRA 1KTSB 1MTWA 4FUJA 2CV3A 3M5NA 3NWUA 1T4UH 1C5LH 4I32A 2FXRA 2STAE 3ZVFA 4ZXYH 1IAUA 2GT7A 1C5UA 4WVPE 4CHAC 4MPUA 2VIWA 4MQAA 2HVXA 4LXBH 2FOAA 3KNXA 2BY9X 2G00A 1LVYA 1W14U 2QF0A 1TPPA 2Y5HA 1CGIE 1XVMA 3MYWA 4UFGH 1SQOA 1HLTH 5C5OA 3FP8E 5FCKA 3UQVA 4BTUB 3ZZ9A 3TU7H 1PJPA 4A92A 1EP5A 3SU6A 1P04A 1FLEE 1IQIA 2BYAX 1MBQA 2OC0A 3T28A 2C8WB 3PLBA 1MTVA 4I31A 2Y5GA 3JZ2B 1QGFA 1E35B 1O2IA 1CT0E 2GV6A 1BHXB 4X8VH 2TRMA 4WF8A 4I33A 5EG4A 4X6PA 1RIWB 2J34A 2ZWLH 4YOGA 2QXGA 5DP6A 4IW4E 1J17T 3UOUA 5EQQA 1GCDA 1QB1A 2GGVB 4E7RG 5A8ZA 1TRMA 3SU0A 4Y76A 3BTEE 5F8XA 4TYDA 2Y5FA 2ULLA 2OC7A 4FVBA 5K7RA 3UR6A 1THSH 1BIOA 1NM6A 1QJ1B 3PMJA 2QN5T 1WQSA 4NA8A 1CSOE 1EOLA 1GJBB 2XC0A 3GCTF 3SORA 3SNEA 1LHEH 1S6HA 2V35A 2QXIA 3A83A 1O3EA 4M7GA 1O3MA 1S84A 1BRAA 1JRSA 2PW8H 5CMXH 5FBIA 4D9RA 3UPEA 4X1PU 3OY6U 1SL3A 2P8OC 1MU6B 5DJ7A 1KXBA 2D1JA 1LVOA 4UD9H 4CH2B 1DLKB 5PTPA 4YT7H 1A0LA 1ARBA 2EC9H 1AY6H 1F5KU 3M5OA 1FPHH 5AVDA 4FUCA 4ZMAH 1KXAA 1HFDA 1TALA 3E8LA 4Y6DA 2F91A 1EAWA 2ZU4A 3RXCA 4INKA 5LH8A 1NTPA 1A5HA 4U30A 4XOJA 3SV6A 1EJAA 4ASHA 3S9CA 2BQ6B 3S9BA 1TB6H 2O8MA 2VJ1A 4H6SB 1GCTC 1NFXA 4NIYA 3M3VA 1SOTA 2ZHWH 1A3BH 2VIQA 1S85A 1UTKA 3SOSA 4B1TA 3QWCH 1C1RA 4UDWH 2GCTB 2P16A 3Q76A 1O2TA 4NZQA 4AORA 1HV7A 1C2JA 4X2WA 1EKBB 2G8TA 4FUEA 3KIDU 2G4UA 1BZXE 2DUCA 2GMTB 3RXAA 4JMYA 6CHAB 3EAJA 1PPZA 1ZGVA 5LGOA 3E6PH 2ANMH 2FOCA 1O37A 3F9FA 1MTNB 1GMCF 1Z71A 4XE4A 1HAPH 3VPKA 3KGPA 1ZZZA 2WPLS 2M5TA 1NZQH 1GHBG 2W5EA 3PWBA 3DD2H 3GY7A 3KQCA 3LGYA 2V0BA 4CBNA 1YF4A 1NRSH 2QA9E 4AX9H 3MTYA 1IQHA 7LPRA 4ZUHA 3KEEA 1S5SA 1FV9A 4IBLH 2ZA5A 1O0DH 1O38A 3FVFB 3TH3H 1ZR0A 2Z3CA 1FONA 1E36B 2JETB 3RXPA 5EXNA 3UNSA 2FIRH 1ABIH 1W7XH 2ANWA 6LPRA 2BD8A 3D49H 1WV7H 4U2WA 3AW1A 3O8DA 2TBSA 5GXPA 2ZF0H 2AIPA 3T2NA 2FESH 3TITA 1P09A 3UR9A 1OS8A 1GI6A 2AEIH 3LH1A 1UCYH 1CO7E 3TJOA 2FOGA 4X1QU 4WY3A 5T6DA 2XWAA 3EA8A 3RM0H 3RXKA 2FYRA 2R9PA 2XBWA 3PLPA 2ZDVH 2JH0D 4NA9H 4RKJB 4Y0ZE 4F4OC 2J2UA 1A4WH 1BRCE 1C5PA 1FIZA 2ALVA 3U98H 2XWBI 4NFEA 1C1VH 2H1UA 1FDPA 3A85A 1HAOH 1PYTC 4BAKB 1O3FA 4A1TA 1YCPK 3SNCA 3VB4A 1C9PA 1AB9B 1E37B 2IPHA 1HAGE 2VVUA 1S6FA 1CBWB 1J16A 4A6LA 4YLQH 1XXDA 3PMBB 1FUJA 3E90B 3RXMA 1MQ5A 1SQTA 2G5NA 3A7WA 1VGCC 2G81E 3BTHE 3SJIA 1G3CA 1Q31A 1NRQH 1QNJA 1N6XA 2AMQA 5DG6A 4ABFA 1Z7KA 3S0NA 2VNTA 2GZ8A 3A8CA 4ZKOU 2HNTF 3U8OH 1C1NA 1GHWH 3ZZ7A 1QB6A 3E3TA 1V2LT 3MNCA 5I25A 1SGDE 2W7UA 2EA3A 1G32B 1SMFE 3ZVGA 3RXFA 1TBZH 4X1RU 5DO4H 5A8XA 1YGCH 1K22H 2J9NA 2ZHEH 1GBHA 1YPLH 1BB0B 1TMBH 3UREA 2FDAA 2VINA 1YM0A 1FI8A 2Y81A 1S81A 1EPTA 2ZECA 1QBVH 1J15A 3M7QA 1RGQA 8KME2 3RXOA 3GY8A 1DM4B 3MU0A 1A46H 2FS9A 1MKXK 2TGDA 3MU5A 3ODFA 4MPVA 1GHXH 3RU4T 3VB5A 1O2QA 1Y5BT 2ZFSA 3FFGA 1PFXC 4DY7B 2UUKB 3RXLA 1QIXB 2VH6A 2ZNKH 5JDUB 1BTWA 3MU8A 1GMDG 2VH0A 4B2AA 4ABGA 1NT1A 1DXWA 3SJ9A 3OY5U 2VWMA 2QV1A 2ZGBH 1BRBE 6ESTA 2QF3A 2FTMA 3OU0A 3BTFE 1G36A 1C5QA 2BD2A 2OBQA 1C5NH 1DANH 1LPZB 1UCYK 2I6SA 2PKSC 3M36A 4AB9A 3U8TH 1SPJA 1SGFA 2CHAB 2PV9B 1O2LA 5T3HA 2XRCA 3F6UH 3ZZBA 1C4U2 3LGUA 1UVOA 1GBJA 4MNWA 1SGIB 1H8DH 4MNXA 2ZI2H 4NZLA 5AF9H 4VGCB 1BQYA 4UEHH 4NWLA 3RU4D 3RDZA 2PSXA 1V2WT 2K1QA 2OINA 3E91A 1D3DB 5F03A 2FOMB 3KCGH 1G2LA 2R3YA 1OSSA 3LC3A 4NIVA 1AKSB 3ZZ3A 1WOFA 3SNDA 1UHBA 1C5VA 4THNH 1KXDA 1JIMA 2ZHDA 4X2YA 2BOHB 1DUEA 5FAHA 1P2NA 4UONA 1O2VA 2HALA 1C1QA 2FP7B 1HJ8A 1PPBH 4WMDA 3FANA 1JIRA 1G9IE 3L33A 5GIBA 4YOIA 3LGTA 4DJZB 3M7TA 4GLYA 1ZSJA 2TGAA 3BF6H 3LGVA 1ANCA 3KL6A 4GVUA 3PV4A 2A5AA 4D7GA 4Y8YA 3MFJA 1RTKA 1T4VH 2ZDKA 5CE1A 1MAXA 2BD5A 1LPGB 1TMUH 5EU8A 1OWIA 4X6OA 3UWJH 1Y5UT 3P8NA 4AN7A 1D6WA 4DOQA 3P70B 2RG3A 1F92A 3C1KA 1CU1A 1D3PB 1C1UH 3B23B 2PKAB 1C2KA 1H9LB 1GCTB 2ZDMA 1UHBB 2AGGX 3QDZB 1NRRH 1BDAA 1O35A 1C2DA 1DLEA 3E16B 3SV9A 1DX5M 1ORFA 2ZHFH 1JOUB 2BLVA 3E1XB 2F9VA 1Y3WA 3A81A 1BTUA 2BM2A 2PGBB 2O8WA 4LZ4B 2SGFE 1E38B 1HAIH 1P05A 4ZKRU 3ZZCA 1BTYA 2Z3EA 1GL0E 2ASUB 5DP8A 3STJA 3AASA 2BX3A 2P3FH 2VB0A 4B73A 1OPHB 4Q7XA 1C1OA 2Q6FA 1ZPZA 3PWCA 3LOXA 1SG8B 4JZIA 3MO9A 2PUXB 2Z94A 4MNYA 1BJVA 2CF8H 3ZV8A 4AG1A 3W94A 1A1RA 2F83A 1UCYE 3TVJB 4X1NU 2OTVA 3EGKH 1U6QA 4RKOB 5JB9S 3BIVH 2BX4A 1QRXA 1ACBE 2BB4A 3FP7E 1MQ6A 2V3OH 1T8LA 1UTLM 2QCYA 2BLWA 2FOHA 3ATMA 2XYAA 3RXJA 1FAXA 3RXIA 1P2KA 4OS7A 5DP7A 2PR3A 2W3KA 1KY9A 1B7XB 3BEIB 2W26A 3RXSA 3T27A 2CN0H 1MH0A 1H9IE 2A5KA 4YZUA 1BTPA 5BPEA 2YNAA 1CVWH 4Q2KA 2D2DA 4BXSA 2HOBA 2ZHQH 1W10U 7KMEH 1RJXB 3RMOH 1WU1A 4HTCH 5T6GA 1G3DA 1O3GA 4X0WU 2P94A 4WJG2 5GDSH 2NU1E 4OS2A 3SUEA 1QURH 1DY9A 4NSVA 3F1SB 1GHZA 1AHTH 1RFNA 2BVSH 1AGJA 1B0FA 3AAVA 2AH4X 4NWKA 1ELCA 3GCHB 1OWKA 2FS8A 3HKJB 1RRKA 4DT7B 3I78A 1VZQH 3V3MA 5B6OA 1CA0B 2F9BH 1HXEH 4I8GA 1RTFB 1EAUA 1FJSA 4Z6AH 1HCGA 2BZ6H 1C5YB 1KLJH 3T29A 4K1SA 1TPSA 1C5TA 4UFEH 2ZQ2A 2WYGA 5EGMA 1VGCB 3SW2B 4Y10E 1N1LA 2NU0E 1OP2A 4WH8A 3DFJA 4D76A 2C8XB 1F2SE 1AU8A 3BTME 1EUFA 1W0YH 1XKAC 4XBDA 2A31A 1UVSH 5LPRA 1F0TA 1MKXH 2KAIB 2QYIA 3M5MA 2QIQA 9LPRA 1NRPH 1QL9A 3NPSA 2A2XH 5JBTA 1EB2A 1P12E 3TGKE 1V2QT 2PSYA 2AGEX 4LZ1H 1PYTD 2THFB 1C9TA 1B5GH 1HAYB 2BD3A 4XFQA 4LOYH 3VB3A 3NKKA 1S0QA 1MCTA 4FUFA 1K28D 1LKBA 1EOJA 5JBAS 2HWLB 3TK6A 4KELA 2LNCA 4Y8XA 1FY1A 3S7HB 4NCYA 3LJJA 4MTBA 3SV7A 2C8ZB 3DUXH 1BTHH 1L1GA 2KAIA 1SR5C 1QBNA 3OSYA 4BOHA 2D8WA 2I6QA 2ZU2A 3SZNA 4ISHH 1FN6A 4FUIA 1CE5A 1J9CH 3LGWA 1DPOA 3ZZAA 1DWCH 3QUMP 3GDSA 1FQ3A 1DXPA 2RA0A 1UTJA 2PKSB 4AYVB 1O3OA 5EPNA 4K60A 2SGEE 1SSXA 4KGAA 5HM9A 1EASA 3ATLA 5TCAA 4ZHLU 1O3AA 1V2TT 2C3SA 5HM2A 2ODPA 1BHXF 2PFEA 3OYPA 4Y7BA 1V2KT 2NU4E 2F9PA 2O9QA 3IWMA 1UTMA 2FI4E 4FU7A 3SJ8A 2AS9A 7ESTE 1ZMLA 3K6ZA 1TLDA 2O8LA 5EPYA 3RXUA 1GI0A 3KQDA 1QHRB 2H9TH 3M7UA 1O2HA 3CENA 4UFFH 3ZV9A 1HXFH 3TJVA 1H8IH 1TBRH 1ZTJA 1YPHC 3K65B 1C1SA 4GCHG 2JH6D 1QRWA 2HNTC 3SU1A 5GJ4B 1KLIH 2VIPA 3L3TA 1S0RA 1EZQA 1AO5A 3ELAH 3UY9A 3SV2H 3GYLB 2PWXA 1RS0A 1IQNA 2WPKS 1TNKA 1JRTA 3I29A 1NY22 4OGYA 2F9NA 1TNGA 4BXWA 3RMNH 2RDLA 1C2EA 1PQAA 3GY3A 2O8TA 3BG4B 1Z6EA 4ZHMU 3QO6A 1WBGB 4FVDA 2PTCE 2YNBA 5ESTE 2BVXH 3VGCC 3R3GB 3GDVA 4B76A 2G4TA 1BITA 4AFQA 3BN9A 1GI7B 1HJAB 1BBRK 1WUNH 5FBEA 1TX8A 2W7SA 2PTNA 1YPGH 3FP6E 5E0GA 4MPXA 2GCHF 1AB9C 4CRBA 1ESBA 1E0FD 1AVWA 4Y11E 3U69H 3RLYH 4O9VA 2CHAC 2J4IA 4MPWA 1GDQA 1O3PB 2GX4A 3RXDA 2GD4B 1IQFA 4R0IA 4WH6A 5GCHG 1V2NT 2BTCE 3H7TA 1FZZA 4FU8A 3UTUH 2Y80A 1A0JA 2BDBA 3SBKA 3A8DA 2FPZA 3UIRA 1N8OB 3LONA 1P8VC 1QL7A 1F0RA 1Y3VA 3ZZ8A 1L1JA 2ZU5A 1TOMH 2BD9A 1YPEH 3UFAA 3MO3A 3E0NB 1NPMA 1EJNA 3Q00A 4I8LA 1ELGA 1Z8GA 2A4RA 3B9FH 1GVZA 1UJ1A 1YC0A 3VGCB 1SHHB 4CH8B 1GBIA 4ZROA 7GCHF 1WSSH 1DE7H 1KYNA 3ATWA 5HMAA 4AFUA 1VITG 2FLRH 3H5CB 4JZ1A 2A2QH 5GWZA 1ELAA 1IQKA 1O31A 3RXEA 3MH4A 1GI8B 2HRVA 2ZDNA 1KXCA 1BRUP 2BLOA 2OCVB 1ETSH 4VGCC 1YPHE 4CHAB 3P6ZB 1Z1IA 1P57B 3PTBA 1UTQA 4X1SU 3MOCA 1YYY1 5FPTA 1C5OH 3ESTA 1GJ9B 2FX4A 2FLBH 4R8TB 3SGQE 5EQRA 1GI5A 1AFQC 1DUAA 3TGIE 1C2FA 5HXFA 1NFYA 3GY4A 2IJOB 1HAHH 5EQSA 3AW0A 3U1IB 1O5DH 3CS0A 1Q2WA 1KLTA 2ESTE 1C4V2 3U9AH 3ITIA 3RLWH 3ATKA 4WWYA 2V3HH 1H1BA 1H4WA 1MTNC 2SFAA 1LDTT 3RC4A 1P01A 1A5IA 1O2KA 4IGDA 2C93B 4OS5A 4BAOB 4WXIA 1TGCA 4K8YA 4AZ2B 1BCUH 3ZVBA 1P2QA 1EAIA 3PB1E 4ZAEA 3KN2A 1QJ6B 4FXGH 1O3IA 4TWYA 2ZZUH 2Z9IA 2NU3E 1ELEE 4UFDH 2WUCA 4SGAE 2UWPA 2ZIQH 4BAMB 1C4Y2 3TLOA 3FAOA 1ZSKA 4CREA 1K1NA 1V2MT 5G4BA 2WPMS 1O2WA 3A84A 1K1PA 3M3SA 3RXRA 3ZYEA 4B74A 3CP7A 1LQDB 3SQHE 3MNBA 1MCVA 1NS3A 4WMEA 3SN8A 2G52A 1TWXB 5EXLA 3P95A 1HIAB 4IN2A 5AFYH 2Z6BD 1UTPA 1EATA 1O2PA 2F3CE 2OBOA 2XBXA 1K21H 2A7JA 1L1NA 2XW9A 2ZDLA 3ZVDA 1FY5A 1O2YA 4CRAA 3UNQA 3A89A 1ELVA 1GVKB 2XCFA 3A7XA 1O3NA 2OUAA 2GCHG 2VU8E 1ELDE 3ATIA 3GOVB 3PYHA 1GBKA 2ZFPH 4XDEA 4HGCA 1O32A 1CT4E 1ZHMA 1Y8TA 2FMJA 1GBMA 1EP6A 1SLVB 3F9EA 2GMTC 1F0UA 1SOZA 5C1UA 2EEKA 2OQ5A 1YCPM 8ESTE 1EZUC 1S82A 1D3TB 1TA2A 1YLCA 1GMHG 4BAQB 5TJXA 2BVRH 4O03A 2QAAA 4MVNA 3D23A 1ZSLA 2WINI 3RC6A 4A5TS 1EJMA 2ZO3H 2HPQH 4DIIH 1C2IA 2Y6TA 1QBOA 1KDQA 1HJAC 4JYUH 3KQEA 4Z0KA 3ZZ5A 4CBOA 2F9OA 1AI8H 1GGDB 1XUJA 3BTTE 4YTAA 1INCA 3URCA 5FPYA 1P2IA 2A45B 1GHBF 2ZKSA 3DT0H 1CA0C 3RMLH 4YM9A 3NK8A 1HAVB 3HATH 1AVGH 2G55A 4AG2A 4XBCA 1HPGA 2P3UB 3GCOA 1GGDC 3TNSA 1CGHA 5FX6A 4OS1A 3KQBA 2HPPH 3VXEH 4NSYA 2A0QB 3QTVH 1SFQB 2F9UA 5A0AE 5DK1A 4DIHH 1SGNE 3A88A 3ODDA 3TNTA 2FTLE 2VWNA 1LKAA 2BDHA 1GBBA 3P17H 1L0ZA 1IOEA 3S7KB 1SHYA 1TRYA 1ANBA 1BJUA 1N8OC 3BTQE 2FO9A 1CBWC 2OC1A 3A8AA 3T26A 1PQ5A 5EW2H 2Y7ZA 2BY7X 1VITH 2FWWA 1SGCA 4K69A 4K3JA 3A7YA 3UUZA 1LCYA 2ZFFH 4AGJA 1WTGH 1Y59T 2ZEBA 2TGTA 4YT6H 1V3XA 3UWIA 4U01A 1O5GH 1NFUA 1LHCH 7GCHG 1OWDA 3QLPH 4MG3A 3PO1B 1QA0A 2SNVA 1NC6A 1O2GH 1KDQB 1DWDH 5A09A 1EZSC 2ODYB 2BQ7B 1VITF 3PM3A 4HFPB 3MI4A 1IQGA 3F9GA 1KTTB 2SGQE 4BTIB 5LPFA 1NU9A 1CGJE 1OOKB 3TGJE 3MHWU 2BDYA 2TGPZ 1T7CA 1G2MA 5IYTA 3NUMA 4WMFA 1FAKH 3PLKA 1DSTA 2WV5A 1GMCG 3GY6A 1AWHB 4YLUA 2PKAA 1FMGA 2Q6GA 2QGRA 1BBRE 4ABJA 1SGYE 4BTTB 4AOQA 4E06H 3Q3XA 2GZ9A 4A1XA 3PMHB 3HK3B 1L4DA 1MTUA 1TYNA 3EE0B 5IDKA 2YOLA 4ZKNU 1SGFG 1O3BA 1YPJH 1T32A 5A2MH 1XVOA 3O8BA 3SNBA 2SGAA 4CRCA 1YCPH 3T62A 5H4IB 1P2MA 4X6MA 3BTKE 1O2JA 4FUDA 3SU5A 3A87A 3RU4E 3RUOA 1GI1A 1WCZA 2GDDA 4ABAA 1SLXB 1GJ4H 2VWOA 1ANDA 1C2MA 1TNHA 5BRRE 1FY4A 5E0JA 1ZTKA 1KSNA 5E8EH 4AFSA 2AYWA 3LIWA 1QRZA 3NZIA 2WYJA 1P9SA 3U8RH 3GCNA 1SGRE 2ANYA 5JPMH 1GL1A 4FUGA 1BMAA 1EAXA 4Y0YE 4Y8ZA 1W3CA 1ZPCA 5DP5A 5A8YA 2XCNA 1W13U 4MLFB 4O3UA 1AN1E 1RTLA 4X8UH 1GJAB 2SGDE 3ZZ4A 2C90B 2ZQ1A 1LVBA 1Z8JB 2H6MA 3GCTG 2G51A 1PPCE 2XNIA 1O3LA 1O2UA 3D62A 3RM2H 3HKIB 1CHOG 2ZCKP 1TONA 1UK2A 3N7OA 2GTBA 3IITA 1GJ6A 1XMNB 4TY7A 5LPEA 3EYDA 2NWNA 1GBDA 1BA8B 1SGPE 2GV7A 1UTOA 2OXSA 1EB1H 1Y3YA 3OX7U 1FXYA 3M3TA 4X8TH 5E0HA 4JYVH 3BTDE 1V6DA 3K6YA 1TBQH 2VGCB 2ZGJA 3ZVCA 4DGJA 1CA8B 1TNLA 2BDCA 4KP0A 1LMWB 2B5TB 2BDIA 4H42U 1K1JA 2AFQB 3PROA 1MMJN 2HNTE 4Q7YA 4AGKA 3PMAB 2H2ZA 3SHCH 3TJNA 3ZYDA 2Q6DA 2VWLA 2VIDA 3A80A 1OX1A 1HBTH 2CF9H 4D8NA 1PQ8A 1C1PA 1MD8A 1OWJA 1T8MA 3DHKH 1O5AB 4B71A 5K0HA 2A32A 2B9LA 3P92A 1TPAE 1ELTA 4O97A 1RIWC 4KTUA 1VJ9U 2IOTA 1G37A 1W0ZU 1TAWA 2FYQA 2CMYA 1TE0A 3D65E 3HK6B 3FZZA 1D6RA 2ALPA 4ISLA 1C2LA 1Y3UA 2AERH 1GHVH 4OS4A 1D3QB 1K1OA 5FXLA 2FOEA 1M9UA 4NIWA 3SV8A 3AAUA 2ZGHA 2BXUH 1EQ9A 1CHOF 2FI5E 2VVVA 1AFEH 1HAVA 4AB8A 2BD7A 2EI8A 3VB7A 1AIXH 3B8JA 5ETXA 3R0FA 3SO3A 5C2ZA 5JBCS 3Q77A 2QXHA 5DP3A 1V2UT 3DFLA 3EA9A 1TGNA 4KKDA 2ZCLP 4ISOA 4K5ZA 3M37A 3BSQA 1YP9A 1V2ST 1IQJA 5L30H 1GI4A 1IHTH 4B2CA 1NO9H 1ZMJA 3IG6B 4KTCA 1FY8E 2GP9B 1A61H 3T25A 1O5CB 1HRTH 4TY6A 4D9QA 2GZ7A 3EQ0H 2TIOA 2P95A 1MKWK 5DGJA 3SUFA 5F8TA 1O2MA 1T8NA 1XKBC 1YPKH 3PO1C 3RC5A 4K1EA 1XUIA 2FM2A 1FY3A 1JXPA 1MAYA 1YKTA 1ZHPA 1ETRH 2FEQH 2VIOA 3UNRA 1ESAA 1NU7B 1ID5H 3GDUA 1O33A 5C3NA 2ZFQH 5C5NA 1KXEA 4INLA 3Q3KA 1LTOA 1BMNH 2Z9LA 3A7TA 4K8BA 9ESTA 4DCDA 4X8SH 1HNEE 1QCPA 4JCNA 4ABHA 4DVAU 2NU2E 1EXFA 2HLCA 2Y82A 3MNSA 1O5BB 5EW1H 3WY8A 1UK3A 1ELFA 1SB1H 2W3IA 4CR5A 5CHAB 4Y71A 3M61U 2ZPRA 1YPMH 3HPTB 3LC5A 4CR9A 2FOFA 1EX3A 1YBWA 8GCHF 1GWAA 4IC6A 3JZ1B 1SFIA 1ANEA 1SC8U 3RXVA 4SGBE 4A1VA 1GBLA 4E05H 1VR1H 4INHA 3RXHA 5A0BA 1UMAH 2ANKH 1L2EA 2CXVA 2J95A 3V12A 3MU1A 1ESTA 4GPGA 3BG4C 2GKVE 1BTZA 1ARCA 1UVTH 2A7CA 2PHBA 3SI3H 4JK5A 1C5MD 1TMTH 2VGCC 1ZJDA 3VEQB 2P59A 1O3JA 2BQWB 2XXLA 1HGTH 3KF2A 2ZU1A 1IQLA 1GJ5H 4JZFH 3BTWE 3STIA 2VVCA 1YLDA 5F6MA 1GDUA 1UO6A 2ODQA 1C2HA 1O2RA 2FODA 1EPTB 4BANB 1BMMH 1THPB 4ISIH 2AIQA
chains in the Genus database with same CATH superfamily
1ABJH 3QGJA 3MQKC 1MBMA 1SKYE 2GVFA 1W7GH 2WPJS 5F8ZA 3K2UA 4RN6A 2YMSD 1G30B 4Q7ZA 5FHTA 3VXFH 1AE5A 1OXGA 3KYFA 5CHAC 1ZLRA 3TIUA 4RT0A 2ZFRH 3HGPA 1F5RA 2QC2A 5GPIB 2Y7XA 4ABEA 3QGNB 1C5ZB 4QT8C 1GBTA 4CRGA 1GBAA 1TX6A 1XX9A 1XXFA 2R2MB 1TGTA 4NIXA 2TPIZ 1SGTA 1GI9B 1GI3A 1V2VT 4ABIA 1T31A 3N7EA 1GG6B 1DITH 4UE7H 1A5GH 3AVZA 3OTJE 1XM1A 4JZEH 2H5DA 3SHAH 1LHDH 2BXTH 5A0CA 5DP9A 3GYMA 3GY5A 2J92A 2H9EH 1XUHA 2C8YB 2LELA 5HYOA 2FOBA 1X7AC 1P2OA 1WYKA 2P93A 3LKWA 3UOPA 1GHYH 1O3CA 1P11E 1D4PB 1ETTH 1NN6A 1TFXA 4J1YA 5C1XA 5SGAE 2EI7A 6GCHG 1ZJKA 4JZDH 3E0PB 1MZDA 3ZZDA 3URDA 1C1MA 4Q4LA 4TPIZ 3O8RA 5J4SA 5JBBS 5HIZA 1HDTH 2ZP0H 1Z8IB 4J2YB 5KEDA 1GI2A 4X2XA 1DOJA 3MH6A 1YY3A 2A1DB 4NG9H 1TA6A 1FPCH 1GMHF 2BLQA 5L2YH 5DSFA 2PUQH 3TPIZ 1RXPA 1V2JT 5FCRA 3LT3A 1TX7A 4GAWA 4FU9A 4AYYB 2FZZA 1C1TA 3A7VA 1LHFH 2ZTZA 4ABBA 2BOKA 4ZCNA 3KYGA 4NGAH 3ZVAA 2H5CA 2PLXA 5JYIA 5DP4A 1SLWB 1PPFE 4GSOA 4GHTA 4IN1A 1IQMA 2C4FH 1AZ8A 5AHGH 1SLUB 3SU2A 1VCQA 2B8OH 2A4QA 2BY8X 4IC5A 3P8OA 1QFKH 1ELBA 1H8ED 1ZTLA 4MDSA 1DVAH 1TQ7B 1Y3XA 1O3DA 2XBVA 4HI3A 3ZVEA 2R2WU 1OHHD 1C5SA 2ZGXH 4U32A 4IMQA 1OKXA 3K9XB 2F4LA 1W12U 2J5UA 1AWFH 1Q3XA 4DW2U 1RD3B 2UWOA 5CHBA 4KTSA 1GPZA 2ZTYA 1GBCA 1ZRKA 1K2I1 2IN2A 1EFRD 1HUTH 4DURA 1UVPA 3MNXA 4PROA 1P9UA 3CS7A 1AD8H 1CT2E 3FZDA 3GISB 2ZPSA 5AFZH 3F0PA 1AUTC 4K2YA 1AE8H 1V2OT 2UUFB 1GDNA 1TPOA 1P03A 4YO9A 1DDJA 3LPRA 3VB6A 3GCHC 3F2FA 1O2OA 1P10A 1TNJA 1O5FH 1BUIA 3A86A 5C20A 4I8JA 1GMDF 4AC9A 3U28C 2ZG0H 2BD4A 5E2OA 3S9AA 3SQEE 1NESE 2J94A 2H9HA 1V2RT 2D26C 2UWLA 5ESBA 4B2BA 5J4QA 1AKSA 2FI3E 4ZH8A 3BG8A 1MD7A 3BIUH 3SUGA 1FIWA 1F7ZA 1O34A 2AMDA 2OD3B 2R0KA 2ZC9H 3TH2H 1O3KA 2BY6X 1LPKB 1TNIA 4K1TA 2ZGCA 3MWIU 4CRFA 1ZMNA 4MNVA 5JB8S 3HGNA 1C2GA 1BT7A 1AVXA 2QXJA 1QTFA 4B75A 2SNWA 1MUEB 1DFPA 3BEFB 2JH5D 5TCCA 1K1IA 2Z3DA 2AMPA 2DE8A 3NCLA 3W95A 3QX5H 2EI6A 4JK6A 3LH3A 3LGIA 1ZYOA 4XSKU 1PQ7A 4E7NA 1EPTC 1G3BA 1QQUA 3BV9B 1GVLA 3RMMH 1HAZB 1GJ7B 3PTNA 3SJKA 4TWWA 2Z7FE 3NXPA 3S69A 5I46H 1DY8A 2BHGA 1C5WB 1FNIA 3RXGA 3SU3A 4X2VA 2BY5X 3TK9A 5FPSA 4IMZA 4O3TA 1AFQB 1AQ7A 1P02A 3L6PA 1Z6JH 1OYTH 3QZQA 5HGGA 3QTOH 1SQAA 3V7TA 1O30A 5L2ZH 2WV4A 5DKMA 4B6EA 2JETC 2Z9JA 3F68H 5GCHF 2A7HA 3I77A 2GJGA 4CRDA 2OLGA 4OS6A 1TRNA 2SGPE 3MH7A 2XC5A 1C1WH 2AGIX 4I8HA 3G01A 8LPRA 2PGQB 3GICB 1P2JA 1LQEA 1J8AA 1S6LA 1DICA 2XBYA 1LVMA 3V0XA 1OWHA 1F5LA 5L6NH 3PRBA 3ZZ6A 2Z9GA 4WXVA 1QA7A 4NFFA 1LHGH 1SBWA 1OWEA 3MH5A 3TJUA 3BTGE 3MMGA 4HZHA 4Q80A 3TH4H 1P06A 1E1RD 2P3TB 3C27B 1TABE 4IS5A 1Z1JA 2ILNA 3RXBA 2OC8A 1QB9A 1P3EA 5C1YA 1GBFA 1NRNH 1UVUH 1O2SA 3O8CA 1VJAU 1NROH 3EA7A 3A7ZA 1K1MA 2V6NA 3V13A 1OP0A 3Q3YA 1QJ7B 5F53A 1D9IA 6GCHF 4F49A 4H6TA 3F2GA 1TGSZ 1PPGE 1SI5H 1AUJA 2ZU3A 1JBUH 2CGAA 2A4GA 1GHAF 4BNRA 3RXTA 2ZFTA 1IHSH 3T5FH 1DWBH 2OQUA 2QY0B 1A3EH 3SGAE 4A7IB 1ZPBA 2BDAA 3TK5A 1QQ4A 4NA7A 1BMLA 1A2CH 1BTXA 4I8KA 3BEUA 1GJCB 5FX5A 2A5IA 4ZXXH 1ZGIA 2ZTXA 1THRH 1KIGH 2J38A 3P8GA 4TPYA 2A4OA 3DA9B 5EXMA 4AFZA 1KXFA 1GJDB 2WPIS 1BOQA 5C67A 2JKHA 1PPEE 1VCWA 4XRNA 1C5RA 1K9OE 3DSGA 3KHVA 4ESTE 3OTPA 2B0FA 2K0QA 2BMGB 4H4FA 1DWEH 1QY6A 4YESB 1TGBA 4DG4A 1XUFA 1IQEA 2FX6A 2Q1JA 1HYLA 4ABDA 4LK4A 1PPHE 1MZAA 1T8OA 2ZCHP 1A0HB 1WQVH 5EOKA 3UQOA 2XC4A 4D7FA 1B0EA 1ZOMA 4OGXA 1O2ZA 3MO6A 1CHGA 2ZDAH 2STBE 3SU4A 3P8FA 2CJIA 1ZRBA 3RP2A 1HJ9A 1F0SA 3LDXH 3VFEA 1HAXB 2LPRA 1OYQA 2J97A 3FOAA 1QL8A 1AZZA 1O2NA 2GT8A 3VG8A 3PV5A 2ZPQA 5DPAA 1W2KH 1W8BH 3MU4A 5EODA 5ABWA 4XBBA 4Y7AA 1LO6A 1MKWH 1NFWA 1K1LA 2GCTC 1O5EH 1OP8A 6CHAC 8GCHG 1GBEA 1O36A 3SUDA 1TIOA 3SNAA 2L74A 3SGBE 1ZHRA 1O39A 2B7DH 2BZAA 1J14A 1MU8B 2DE9A 1A7SA 3A8BA 1AMHA 1H9HE 1JMOH 1E34B 4YOJA 4JYTA 3ENSB 1G3EA 3GY2A 1BBRH 1P0SH 3H7OA 4FUBA 3M35A 2UUYA 2G5VA 1QR3E 1C5XB 1GJ8B 1P3CA 2HGTH 1TQ0B 1VCPA 3A82A 2IJD1 2WUBA 1W11U 2P8OB 4BAHB 1EZXC 2R0LA 2Z9KA 1UK4A 1O3HA 4ZKSU 4Y79A 3QK1A 3QN7A 1HIAA 4GHQA 1XUKA 1SGEE 5E2PA 3F9HA 3RXQA 3SJOA 4RSPA 1WTHD 1GG6C 2OP9A 2R3UA 1DS2E 1DSUA 2VIVA 4X6NA 4ZHAA 1UTNA 1FN8A 2O8UA 1WAYB 3LJOA 2UUJB 1TOCB 4GUXA 1SVPA 1JWTA 1L4ZA 3U1JB 4I7YH 1SGQE 1MTSA 3DSPA 1XUGA 2PP6A 2KM0A 4ISNA 2WPHS 2GDEH 5T6FA 3EDXB 1O2XA 3SI4H 1S83A 1Y5AT 3LU9B 4GCHF 2BDGA 1DT2A 4XD7D 1Z8RA 2RCEA 3M5LA 2RA3A 1CQQA 1GHAG 1V2PT 1N6YA 1HB0B 2XTTB 4FUHA 3QZRA 1KTSB 1MTWA 4FUJA 2CV3A 3M5NA 3NWUA 1T4UH 1C5LH 4I32A 2M2AA 2FXRA 2STAE 3ZVFA 4ZXYH 1IAUA 2GT7A 1C5UA 4WVPE 4CHAC 4MPUA 2VIWA 4MQAA 2HVXA 4LXBH 2FOAA 3KNXA 2BY9X 3N99A 2G00A 1LVYA 1W14U 2QF0A 1TPPA 2Y5HA 1CGIE 1XVMA 2QE7D 3MYWA 1SQOA 1HLTH 4Q63A 4UFGH 5C5OA 3FP8E 5FCKA 3UQVA 4BTUB 3ZZ9A 3TU7H 1PJPA 4A92A 1EP5A 3SU6A 1P04A 1FLEE 1IQIA 5C0TA 2BYAX 1MBQA 2OC0A 3T28A 2C8WB 3PLBA 1MTVA 4I31A 2Y5GA 3JZ2B 1QGFA 1E35B 1O2IA 2J98B 1CT0E 2GV6A 1BHXB 2EQNA 4X8VH 2TRMA 4WF8A 4I33A 5EG4A 4X6PA 1RIWB 2J34A 2ZWLH 4YOGA 2QXGA 5T1VA 5DP6A 4IW4E 1J17T 3UOUA 5EQQA 1GCDA 1QB1A 2GGVB 4E7RG 5A8ZA 1TRMA 3SU0A 4Y76A 2V7QD 4B6FA 3BTEE 5F8XA 4TYDA 2Y5FA 2ULLA 2WSSD 2OC7A 4FVBA 5K7RA 3UR6A 1THSH 1BIOA 1NM6A 1QJ1B 3PMJA 2QN5T 5EJLA 4F48B 1WQSA 4NA8A 1CSOE 1EOLA 1GJBB 2XC0A 3GCTF 3SORA 3SNEA 1LHEH 1S6HA 2V35A 2QXIA 3A83A 1O3EA 4M7GA 1O3MA 1S84A 1BRAA 1JRSA 2PW8H 5CMXH 5FBIA 4D9RA 3UPEA 4X1PU 3OY6U 1SL3A 2P8OC 1MU6B 5DJ7A 1KXBA 2D1JA 1LVOA 4UD9H 1E79D 4CH2B 2KCAA 1DLKB 5PTPA 4YT7H 1A0LA 1ARBA 2EC9H 1AY6H 1F5KU 3M5OA 1FPHH 5AVDA 4FUCA 2KR7A 4ZMAH 1KXAA 1HFDA 1TALA 3E8LA 4Y6DA 2F91A 1EAWA 2ZU4A 3RXCA 4INKA 5LH8A 1NTPA 1A5HA 4U30A 4XOJA 3SV6A 1EJAA 4ASHA 3S9CA 2BQ6B 3S9BA 1TB6H 2O8MA 2VJ1A 2YMSB 4H6SB 3PV2A 1GCTC 1NFXA 4NIYA 3M3VA 1SOTA 2ZHWH 1A3BH 2VIQA 1S85A 1UTKA 3SOSA 4B1TA 3QWCH 1C1RA 4UDWH 2GCTB 2P16A 3Q76A 1O2TA 4NZQA 4AORA 1HV7A 1C2JA 4X2WA 1EKBB 2G8TA 4FUEA 3KIDU 2G4UA 1BZXE 3AK5A 1UW7A 2DUCA 2GMTB 3RXAA 4JMYA 6CHAB 3EAJA 1PPZA 1ZGVA 5LGOA 3E6PH 2ANMH 2FOCA 1O37A 3F9FA 1MTNB 1GMCF 1Z71A 4XE4A 1HAPH 3VPKA 3KGPA 1ZZZA 2WPLS 2M5TA 1NZQH 1GHBG 2W5EA 3PWBA 3DD2H 3GY7A 3KQCA 3LGYA 2V0BA 4CBNA 1YF4A 1NRSH 3WWFA 2QA9E 4AX9H 3MTYA 1IQHA 7LPRA 4ZUHA 3KEEA 1S5SA 1FV9A 4IBLH 2ZA5A 1O0DH 1O38A 3FVFB 3TH3H 1ZR0A 2Z3CA 1FONA 1E36B 2JETB 3RXPA 5EXNA 3UNSA 2FIRH 2QF4A 1ABIH 1W7XH 2ANWA 6LPRA 2BD8A 3D49H 1WV7H 4U2WA 3ZIAD 3AW1A 3O8DA 2TBSA 5GXPA 2ZF0H 4F55A 2AIPA 3T2NA 2FESH 3TITA 1P09A 3UR9A 1OS8A 1GI6A 2AEIH 3LH1A 1UCYH 1CO7E 4OM9A 3TJOA 2FOGA 3SYJA 4X1QU 4WY3A 5T6DA 2XWAA 3EA8A 3RM0H 3RXKA 2FYRA 2R9PA 2XBWA 3PLPA 2ZDVH 2JH0D 4NA9H 4RKJB 4Y0ZE 4F4OC 2J2UA 1A4WH 1BRCE 1C5PA 1FIZA 2ALVA 3U98H 2XWBI 4NFEA 1C1VH 2H1UA 1FDPA 3A85A 5KGOA 1HAOH 1PYTC 4BAKB 1O3FA 4A1TA 1YCPK 3SNCA 3VB4A 1C9PA 1AB9B 4TSFD 1E37B 2IPHA 1HAGE 2VVUA 1S6FA 1CBWB 1J16A 4A6LA 4YLQH 1XXDA 3PMBB 1FUJA 3E90B 3RXMA 1MQ5A 1SQTA 2G5NA 3A7WA 1VGCC 2G81E 3BTHE 3SJIA 1G3CA 1Q31A 1NRQH 1QNJA 1N6XA 2AMQA 5DG6A 4ABFA 1Z7KA 3S0NA 2VNTA 2GZ8A 3A8CA 4ZKOU 2JIZD 2HNTF 3U8OH 1C1NA 1GHWH 3ZZ7A 1QB6A 3E3TA 1V2LT 3MNCA 5I25A 1SGDE 2W7UA 2EA3A 1G32B 1SMFE 3ZVGA 3RXFA 1TBZH 4X1RU 5DO4H 5A8XA 1YGCH 1K22H 2J9NA 3N7DA 2ZHEH 1GBHA 1YPLH 4ACBA 1BB0B 1TMBH 3UREA 2FDAA 2VINA 1YM0A 1FI8A 2Y81A 1S81A 1EPTA 2ZECA 1QBVH 1J15A 3M7QA 1RGQA 8KME2 3RXOA 3GY8A 1DM4B 3MU0A 3SZEA 1A46H 2FS9A 1MKXK 2TGDA 3MU5A 5DN6D 3ODFA 4MPVA 1GHXH 3RU4T 3VB5A 1O2QA 1Y5BT 2ZFSA 3FFGA 1PFXC 4DY7B 4YXWD 2UUKB 3RXLA 1QIXB 2VH6A 4RI0A 2ZNKH 5JDUB 1BTWA 3MU8A 1GMDG 2VH0A 4B2AA 4ABGA 1NT1A 1DXWA 3SJ9A 3OY5U 2VWMA 2QV1A 2ZGBH 1BRBE 6ESTA 2QF3A 2FTMA 3OU0A 3BTFE 1G36A 1C5QA 2BD2A 2OBQA 4I86A 1C5NH 1DANH 1LPZB 1UCYK 2I6SA 2PKSC 3M36A 4AB9A 3U8TH 1SPJA 2YMSC 1SGFA 4RT1A 2CHAB 2PV9B 1O2LA 5T3HA 2XRCA 3F6UH 3ZZBA 1C4U2 3LGUA 1UVOA 1GBJA 4MNWA 1SGIB 1H8DH 4MNXA 2QF5A 2ZI2H 4NZLA 5AF9H 4VGCB 1BQYA 4UEHH 4NWLA 3RU4D 3RDZA 2PSXA 1V2WT 2K1QA 2OINA 3E91A 1D3DB 5F03A 2FOMB 3KCGH 1G2LA 2R3YA 1OSSA 3LC3A 4NIVA 4HG6A 5C0UA 1AKSB 3ZZ3A 1WOFA 3SNDA 1UHBA 1C5VA 4THNH 1KXDA 1JIMA 2ZHDA 4X2YA 2BOHB 1DUEA 5FAHA 1P2NA 4UONA 1O2VA 2HALA 1C1QA 2FP7B 1W0JD 1HJ8A 1PPBH 4WMDA 3FANA 1JIRA 1G9IE 3L33A 5GIBA 4YOIA 3LGTA 4DJZB 3M7TA 5HKKD 4GLYA 1ZSJA 2TGAA 3BF6H 3LGVA 1ANCA 2K8IA 3KL6A 4GVUA 3PV4A 2A5AA 4D7GA 4Y8YA 3MFJA 1RTKA 1T4VH 2ZDKA 5CE1A 1MAXA 2BD5A 1LPGB 1TMUH 5EU8A 1OWIA 4X6OA 3UWJH 1Y5UT 3P8NA 4AN7A 1D6WA 2JDID 4DOQA 3P70B 2RG3A 1F92A 3C1KA 1CU1A 1D3PB 1C1UH 3B23B 2PKAB 1C2KA 1H9LB 1GCTB 2ZDMA 1UHBB 2AGGX 3QDZB 1NRRH 1BDAA 1O35A 1C2DA 1DLEA 3E16B 3SV9A 1DX5M 1ORFA 2ZHFH 1JOUB 5EJ1A 2BLVA 3E1XB 2F9VA 1Y3WA 3A81A 1BTUA 2BM2A 2PGBB 2O8WA 4LZ4B 2SGFE 1E38B 1HAIH 1P05A 4ZKRU 3ZZCA 1BTYA 2Z3EA 1GL0E 2ASUB 5DP8A 3STJA 3AASA 2WV9A 2RDEA 2BX3A 2P3FH 2VB0A 4B73A 1OPHB 4Q7XA 1C1OA 2Q6FA 1ZPZA 3WW7A 3PWCA 3LOXA 5KECA 1SG8B 4JZIA 3MO9A 2PUXB 2Z94A 4MNYA 1BJVA 2CF8H 3ZV8A 4AG1A 3W94A 1A1RA 2F83A 1UCYE 3TVJB 4X1NU 2OTVA 3EGKH 1U6QA 4RKOB 3UB0A 5JB9S 3BIVH 2BX4A 1QRXA 1ACBE 2BB4A 3FP7E 2KZ4A 4P02A 3KQ5A 1MQ6A 2V3OH 3DCLA 1T8LA 1UTLM 2QCYA 2BLWA 2FOHA 3ATMA 2XYAA 3RXJA 1FAXA 3RXIA 1P2KA 4OS7A 5DP7A 2PR3A 2W3KA 1KY9A 1B7XB 3BEIB 2W26A 3RXSA 3T27A 2CN0H 1MH0A 1H9IE 2A5KA 4YZUA 1BTPA 5BPEA 2YNAA 1CVWH 4Q2KA 2D2DA 2WPDD 4BXSA 2HOBA 2ZHQH 1W10U 7KMEH 1RJXB 3RMOH 1WU1A 4HTCH 5T6GA 1G3DA 1O3GA 4X0WU 2P94A 4WJG2 5GDSH 2NU1E 4OS2A 3SUEA 1QURH 1DY9A 4NSVA 3F1SB 1GHZA 1AHTH 1RFNA 2BVSH 1AGJA 1B0FA 1NBMD 3AAVA 2AH4X 4NWKA 1ELCA 3GCHB 1OWKA 2FS8A 3HKJB 3FKSD 1RRKA 4DT7B 3I78A 1VZQH 3V3MA 5B6OA 1CA0B 2F9BH 1HXEH 4I8GA 1RTFB 1EAUA 1FJSA 4Z6AH 1HCGA 2BZ6H 1C5YB 1KLJH 3T29A 4K1SA 1TPSA 1C5TA 4UFEH 2ZQ2A 2WYGA 5EGMA 1VGCB 3SW2B 4Y10E 1N1LA 2NU0E 1OP2A 4WH8A 3GS9A 3DFJA 4D76A 2C8XB 1F2SE 1AU8A 3BTME 1EUFA 1W0YH 1XKAC 4XBDA 2A31A 1UVSH 5LPRA 1F0TA 1MKXH 2KAIB 2QYIA 3M5MA 5FL7D 2QIQA 9LPRA 1NRPH 3OE7D 1QL9A 3NPSA 2A2XH 5JBTA 1EB2A 1P12E 2VBCA 3TGKE 1V2QT 2PSYA 2AGEX 4LZ1H 1PYTD 2THFB 1C9TA 1B5GH 1HAYB 2BD3A 4XFQA 4LOYH 3VB3A 3NKKA 1S0QA 1MCTA 4FUFA 1K28D 1LKBA 1EOJA 5JBAS 2HVYB 1E1QD 2HWLB 3TK6A 4KELA 2LNCA 4Y8XA 1FY1A 4DT4A 3S7HB 4NCYA 3LJJA 4MTBA 3SV7A 2C8ZB 3DUXH 1BTHH 1L1GA 2KAIA 1SR5C 1KMHB 1QBNA 3OSYA 4BOHA 2D8WA 2I6QA 2ZU2A 3SZNA 4ISHH 1FN6A 4FUIA 1CE5A 2KFWA 1J9CH 3LGWA 1DPOA 3ZZAA 1DWCH 3QUMP 3GDSA 1FQ3A 1DXPA 2RA0A 1UTJA 2PKSB 4AYVB 1O3OA 1COWD 5EPNA 4K60A 2SGEE 3FO8D 1SSXA 4KGAA 5HM9A 2J98A 1EASA 3ATLA 5CDFE 5TCAA 4ZHLU 1O3AA 1V2TT 2C3SA 2W6JD 5HM2A 2ODPA 1MABB 1BHXF 2PFEA 3UAIC 3OYPA 4Y7BA 1V2KT 2NU4E 2F9PA 2O9QA 3IWMA 1UTMA 2FI4E 4FU7A 3SJ8A 2AS9A 7ESTE 1ZMLA 3OAAD 3K6ZA 1TLDA 2O8LA 5EPYA 3RXUA 1GI0A 3KQDA 1QHRB 2H9TH 3M7UA 1O2HA 3CENA 4UFFH 3ZV9A 1HXFH 3TJVA 1H8IH 1TBRH 1ZTJA 1YPHC 3K65B 1C1SA 4GCHG 2JH6D 1QRWA 2HNTC 3SU1A 5GJ4B 1KLIH 2VIPA 3L3TA 1S0RA 1EZQA 1AO5A 3ELAH 5C94A 3UY9A 3SV2H 3GYLB 2PWXA 1RS0A 2IPQX 1IQNA 2WPKS 1TNKA 1JRTA 3I29A 1NY22 4OGYA 2KX4A 2F9NA 1TNGA 4BXWA 3RMNH 2RDLA 1C2EA 1PQAA 3GY3A 2O8TA 2CK3D 3BG4B 1Z6EA 2WZQA 4ZHMU 3QO6A 1WBGB 4FVDA 2PTCE 2YNBA 5ESTE 2BVXH 3VGCC 3R3GB 3GDVA 4B76A 2G4TA 1BITA 1WDIA 4AFQA 3BN9A 1GI7B 1H8HD 1HJAB 1BBRK 1BMFD 1WUNH 5FBEA 1TX8A 2W7SA 2PTNA 1YPGH 3FP6E 5E0GA 4MPXA 2GCHF 1AB9C 4CRBA 1ESBA 1E0FD 1AVWA 4Y11E 3U69H 3RLYH 4O9VA 2CHAC 2HLDD 2J4IA 4MPWA 1GDQA 1O3PB 2GX4A 3RXDA 2GD4B 1IQFA 4R0IA 4WH6A 5GCHG 1V2NT 2BTCE 3H7TA 1WXRA 1FZZA 4FETA 4FU8A 3UTUH 2Y80A 1A0JA 2BDBA 3SBKA 5GNDA 3A8DA 2FPZA 3UIRA 1N8OB 1VKYA 3LONA 1P8VC 1QL7A 3PRDA 1F0RA 1Y3VA 3ZZ8A 1L1JA 2ZU5A 1TOMH 2BD9A 1YPEH 3UFAA 3MO3A 3E0NB 1NPMA 1EJNA 3Q00A 4I8LA 5HIYA 1YWUA 1ELGA 1Z8GA 2A4RA 3B9FH 1GVZA 1UJ1A 3F2HA 1YC0A 3VGCB 1SHHB 4CH8B 1GBIA 4ZROA 7GCHF 1WSSH 1DE7H 1KYNA 3ATWA 5HMAA 4AFUA 1VITG 2FLRH 2XOKD 3H5CB 4JZ1A 2A2QH 5GWZA 5EIYA 1ELAA 1IQKA 1O31A 3RXEA 3MH4A 1GI8B 2HRVA 2ZDNA 1KXCA 1BRUP 2BLOA 2OCVB 1ETSH 4VGCC 1YPHE 4CHAB 3P6ZB 1Z1IA 1P57B 3PTBA 1UTQA 4X1SU 3MOCA 1YYY1 5FPTA 1C5OH 3ESTA 1GJ9B 2FX4A 2FLBH 4R8TB 3SGQE 5EQRA 1GI5A 1AFQC 1DUAA 3TGIE 1C2FA 5HXFA 1NFYA 3GY4A 2IJOB 1HAHH 5EQSA 3AW0A 3U1IB 1O5DH 3CS0A 3NRLA 1Q2WA 1KLTA 2ESTE 1C4V2 3U9AH 3ITIA 3RLWH 3ATKA 4WWYA 2V3HH 1H1BA 1H4WA 1MTNC 2SFAA 1LDTT 3RC4A 4ASUD 1P01A 1A5IA 1O2KA 4IGDA 2C93B 4OS5A 4BAOB 4WXIA 4ACAA 1TGCA 4K8YA 4AZ2B 1BCUH 3ZVBA 1P2QA 1EAIA 3PB1E 4ZAEA 3DSOA 3KN2A 1QJ6B 4FXGH 1O3IA 4TWYA 2ZZUH 2Z9IA 2NU3E 1ELEE 4UFDH 2WUCA 4SGAE 2UWPA 2ZIQH 4BAMB 1C4Y2 3TLOA 3FAOA 1ZSKA 4CREA 1K1NA 2KCOA 1V2MT 5G4BA 2WPMS 1O2WA 3A84A 1K1PA 3M3SA 3RXRA 3ZYEA 4B74A 3CP7A 1LQDB 3SQHE 3MNBA 1MCVA 1NS3A 4WMEA 3SN8A 2G52A 1TWXB 5EXLA 3P95A 3OEED 1HIAB 4IN2A 5IK2D 5AFYH 2Z6BD 1UTPA 1EATA 3F0OA 1O2PA 2F3CE 2OBOA 2XBXA 1K21H 2A7JA 1L1NA 2XW9A 3F3BA 2ZDLA 3ZVDA 1FY5A 1O2YA 4CRAA 3UNQA 3A89A 1ELVA 1GVKB 2XCFA 3A7XA 1O3NA 2OUAA 2GCHG 2VU8E 1ELDE 3ATIA 3OEHD 3GOVB 3PYHA 1GBKA 2ZFPH 4XDEA 4HGCA 1O32A 1CT4E 2LP6A 1ZHMA 1Y8TA 2FMJA 1GBMA 1EP6A 1SLVB 3F9EA 2GMTC 1F0UA 1SOZA 5C1UA 2EEKA 2OQ5A 1YCPM 8ESTE 1EZUC 1S82A 1D3TB 1TA2A 1YLCA 1GMHG 4BAQB 5TJXA 2BVRH 4O03A 2QAAA 4MVNA 3D23A 2JJ1D 1ZSLA 2WINI 3RC6A 4A5TS 1EJMA 2ZO3H 2HPQH 4DIIH 1C2IA 2Y6TA 1QBOA 1KDQA 1HJAC 4JYUH 3KQEA 5EJZA 4Z0KA 3ZZ5A 4CBOA 2F9OA 1AI8H 1GGDB 1XUJA 3BTTE 4YTAA 1INCA 3URCA 5FPYA 1P2IA 2A45B 1GHBF 2ZKSA 3DT0H 1CA0C 3RMLH 4YM9A 3NK8A 1HAVB 3HATH 1AVGH 2G55A 3WWBA 4AG2A 4XBCA 1HPGA 2P3UB 3GCOA 1GGDC 3TNSA 1CGHA 5FX6A 4OS1A 3KQBA 2HPPH 3VXEH 4NSYA 2A0QB 3QTVH 1SFQB 2F9UA 5A0AE 1FX0B 5DK1A 4DIHH 1SGNE 3A88A 3ODDA 2KCPA 3TNTA 2FTLE 2VWNA 1LKAA 2BDHA 1GBBA 3P17H 1L0ZA 2AHME 1IOEA 3S7KB 1SHYA 1TRYA 1ANBA 1BJUA 1N8OC 3BTQE 2FO9A 1CBWC 2OC1A 3A8AA 3T26A 1PQ5A 5EW2H 2Y7ZA 2W6ID 2BY7X 1VITH 2FWWA 1SGCA 4K69A 4K3JA 3A7YA 3UUZA 1LCYA 2ZFFH 4AGJA 1WTGH 1Y59T 2ZEBA 2TGTA 4YT6H 1V3XA 3UWIA 4U01A 1O5GH 1NFUA 1LHCH 7GCHG 3EE7A 1K0HA 1OWDA 3QLPH 4MG3A 3PO1B 1QA0A 2SNVA 1NC6A 1O2GH 1KDQB 1DWDH 5A09A 1EZSC 2ODYB 2BQ7B 1VITF 3PM3A 4HFPB 3MI4A 1IQGA 3F9GA 1KTTB 2SGQE 4BTIB 5LPFA 1NU9A 1CGJE 1OOKB 3TGJE 3MHWU 2BDYA 2TGPZ 1T7CA 1G2MA 5IYTA 3NUMA 4WMFA 1FAKH 3PLKA 1DSTA 2WV5A 1GMCG 3GY6A 1AWHB 4YLUA 2PKAA 1FMGA 2Q6GA 2QGRA 1BBRE 4ABJA 1SGYE 4BTTB 4AOQA 4E06H 3Q3XA 2GZ9A 4A1XA 3PMHB 3HK3B 1L4DA 1MTUA 1TYNA 3EE0B 5IDKA 2YOLA 4ZKNU 1SGFG 1O3BA 1YPJH 4M9FA 1T32A 2KCYA 5A2MH 1XVOA 3O8BA 3SNBA 2SGAA 4CRCA 1W0KD 1YCPH 3T62A 5H4IB 1P2MA 4X6MA 3BTKE 1O2JA 4FUDA 3SU5A 4P00A 3A87A 3RU4E 3RUOA 1GI1A 1WCZA 2GDDA 4ABAA 1SLXB 1GJ4H 2VWOA 1ANDA 1C2MA 1TNHA 5BRRE 1FY4A 5E0JA 1ZTKA 1KSNA 5E8EH 4AFSA 2AYWA 3LIWA 1QRZA 3NZIA 2WYJA 1P9SA 3U8RH 3GCNA 1SGRE 2ANYA 5JPMH 1GL1A 4FUGA 1BMAA 5C17A 1EAXA 4Y0YE 4Y8ZA 1W3CA 1ZPCA 5DP5A 5A8YA 2XCNA 1W13U 4MLFB 4O3UA 1AN1E 1RTLA 4X8UH 1GJAB 2SGDE 3ZZ4A 2C90B 2ZQ1A 1LVBA 2JJ2D 1Z8JB 2H6MA 3GCTG 2G51A 1PPCE 2XNIA 1O3LA 1O2UA 3D62A 3RM2H 3HKIB 1CHOG 2ZCKP 1TONA 1UK2A 3N7OA 2GTBA 3IITA 1GJ6A 1XMNB 4TY7A 1QZ8A 5LPEA 3EYDA 4Z1MD 2NWNA 1GBDA 1BA8B 1SGPE 2GV7A 1UTOA 2OXSA 1EB1H 1Y3YA 3OX7U 1FXYA 3M3TA 4X8TH 5E0HA 4JYVH 3BTDE 1V6DA 3K6YA 1TBQH 2VGCB 2ZGJA 3ZVCA 4DGJA 1CA8B 1TNLA 2BDCA 2XNDD 4KP0A 1LMWB 2EY4C 2B5TB 2BDIA 4H42U 1K1JA 2AFQB 3PROA 1MMJN 2HNTE 4Q7YA 4AGKA 3PMAB 2H2ZA 3SHCH 3TJNA 3ZYDA 2Q6DA 1YLNA 2VWLA 2VIDA 3A80A 1OX1A 1HBTH 3FN8A 2CF9H 4D8NA 1PQ8A 1C1PA 1MD8A 1OWJA 1T8MA 3DHKH 1O5AB 4B71A 5K0HA 2A32A 2B9LA 3P92A 1TPAE 1ELTA 4O97A 1RIWC 4KTUA 1VJ9U 2IOTA 1G37A 1W0ZU 1TAWA 2FYQA 2CMYA 1TE0A 3D65E 3HK6B 3FZZA 1D6RA 2ALPA 4ISLA 1C2LA 1Y3UA 2AERH 1GHVH 4OS4A 1D3QB 1K1OA 5FXLA 2FOEA 1M9UA 4NIWA 3SV8A 3AAUA 2ZGHA 2BXUH 1EQ9A 1CHOF 2FI5E 2VVVA 1AFEH 1HAVA 4AB8A 2BD7A 2EI8A 3VB7A 2F43B 1AIXH 3B8JA 5ETXA 3R0FA 3SO3A 5C2ZA 5JBCS 3Q77A 2QXHA 5DP3A 1V2UT 2L6OA 3DFLA 1TGNA 3EA9A 3OFND 4KKDA 2ZCLP 4ISOA 4K5ZA 3M37A 3BSQA 1YP9A 1V2ST 1IQJA 5L30H 1GI4A 1IHTH 4B2CA 1NO9H 1ZMJA 3IG6B 3W1EA 4KTCA 1FY8E 2GP9B 1A61H 3T25A 1O5CB 1HRTH 4TY6A 4D9QA 2GZ7A 3EQ0H 2TIOA 2P95A 1MKWK 4TT3D 5DGJA 3SUFA 5F8TA 1O2MA 1T8NA 1XKBC 1YPKH 3PO1C 3RC5A 2WHXA 4K1EA 1XUIA 2FM2A 1FY3A 1JXPA 1MAYA 1YKTA 1ZHPA 1ETRH 2OK5A 2FEQH 2VIOA 3UNRA 1ESAA 1NU7B 1ID5H 3GDUA 1NBME 1O33A 5C3NA 2ZFQH 5C5NA 1KXEA 4INLA 3Q3KA 1LTOA 3CNRA 1BMNH 2Z9LA 1SQRA 3A7TA 4K8BA 9ESTA 4DCDA 4X8SH 1HNEE 1QCPA 4JCNA 4ABHA 4DVAU 2NU2E 1EXFA 2HLCA 2Y82A 3MNSA 1O5BB 5EW1H 3WY8A 1UK3A 1ELFA 1SB1H 2W3IA 4CR5A 5CHAB 4Y71A 3M61U 2ZPRA 1YPMH 3HPTB 3LC5A 4CR9A 2FOFA 1EX3A 1YBWA 8GCHF 1GWAA 4IC6A 3JZ1B 1SFIA 1ANEA 1SC8U 3RXVA 4SGBE 4A1VA 1GBLA 4E05H 1VR1H 4INHA 3RXHA 5A0BA 5B6LA 1UMAH 2ANKH 1L2EA 2CXVA 2J95A 3V12A 3MU1A 1ESTA 4GPGA 3BG4C 2GKVE 1BTZA 1ARCA 2V3MA 1UVTH 2A7CA 2PHBA 3SI3H 4JK5A 1C5MD 1TMTH 2VGCC 1ZJDA 3VEQB 2P59A 1O3JA 2BQWB 2RFKC 2XXLA 1HGTH 3H09A 3KF2A 2ZU1A 1IQLA 1GJ5H 4JZFH 3BTWE 3STIA 2VVCA 1YLDA 5F6MA 1GDUA 1UO6A 2ODQA 1C2HA 1O2RA 2FODA 1EPTB 4BANB 1BMMH 1THPB 4ISIH 4FOUC 2AIQA
chains in the Genus database with same CATH topology
1ABJH 3QGJA 1MBMA 2GVFA 1W7GH 2WPJS 5F8ZA 3K2UA 4RN6A 1G30B 4Q7ZA 5FHTA 3VXFH 1AE5A 1OXGA 3TIUA 5CHAC 1ZLRA 2ZFRH 3HGPA 1F5RA 2QC2A 5GPIB 2Y7XA 4ABEA 3QGNB 1C5ZB 4QT8C 1GBTA 4CRGA 1GBAA 1TX6A 1XX9A 1XXFA 2R2MB 1TGTA 4NIXA 2TPIZ 1SGTA 1GI9B 1GI3A 1V2VT 4ABIA 1T31A 1GG6B 1DITH 4UE7H 1A5GH 3AVZA 3OTJE 1XM1A 4JZEH 2H5DA 3SHAH 1LHDH 2BXTH 5A0CA 5DP9A 3GYMA 3GY5A 2J92A 2H9EH 1XUHA 2C8YB 5HYOA 2FOBA 1X7AC 1P2OA 1WYKA 2P93A 3LKWA 3UOPA 1GHYH 1O3CA 1P11E 1D4PB 1ETTH 1NN6A 1TFXA 4J1YA 5C1XA 5SGAE 2EI7A 6GCHG 1ZJKA 4JZDH 3E0PB 1MZDA 3ZZDA 3URDA 1C1MA 4TPIZ 3O8RA 5J4SA 5JBBS 1HDTH 2ZP0H 1Z8IB 4J2YB 1GI2A 4X2XA 1DOJA 3MH6A 2A1DB 4NG9H 1TA6A 1FPCH 1GMHF 2BLQA 5L2YH 2PUQH 3TPIZ 1RXPA 1V2JT 5FCRA 3LT3A 1TX7A 4GAWA 4FU9A 4AYYB 2FZZA 1C1TA 3A7VA 1LHFH 2ZTZA 4ABBA 2BOKA 4NGAH 3ZVAA 2H5CA 2PLXA 5JYIA 5DP4A 1SLWB 1PPFE 4GSOA 4GHTA 4IN1A 1IQMA 2C4FH 1AZ8A 5AHGH 1SLUB 3SU2A 1VCQA 2B8OH 2A4QA 2BY8X 4IC5A 3P8OA 1QFKH 1ELBA 1ZTLA 4MDSA 1DVAH 1TQ7B 1Y3XA 1O3DA 2XBVA 4HI3A 3ZVEA 2R2WU 1C5SA 2ZGXH 4U32A 4IMQA 1OKXA 3K9XB 1W12U 1AWFH 1Q3XA 4DW2U 1RD3B 2UWOA 4KTSA 1GPZA 2ZTYA 1GBCA 1ZRKA 1K2I1 2IN2A 1HUTH 4DURA 1UVPA 3MNXA 4PROA 1P9UA 3CS7A 1AD8H 1CT2E 3FZDA 3GISB 2ZPSA 5AFZH 1AUTC 4K2YA 1AE8H 1V2OT 2UUFB 1GDNA 1TPOA 1P03A 4YO9A 1DDJA 3LPRA 3VB6A 3GCHC 1O2OA 1P10A 1TNJA 1O5FH 1BUIA 3A86A 5C20A 4I8JA 1GMDF 2ZG0H 2BD4A 5E2OA 3S9AA 3SQEE 1NESE 2J94A 2H9HA 1V2RT 2D26C 2UWLA 5ESBA 4B2BA 5J4QA 1AKSA 2FI3E 4ZH8A 3BG8A 1MD7A 3BIUH 3SUGA 1FIWA 1F7ZA 1O34A 2AMDA 2OD3B 2R0KA 2ZC9H 3TH2H 1O3KA 2BY6X 1LPKB 1TNIA 4K1TA 2ZGCA 3MWIU 4CRFA 1ZMNA 4MNVA 5JB8S 3HGNA 1C2GA 1BT7A 1AVXA 2QXJA 1QTFA 4B75A 2SNWA 1MUEB 1DFPA 3BEFB 2JH5D 5TCCA 1K1IA 2Z3DA 2AMPA 2DE8A 3NCLA 3W95A 3QX5H 2EI6A 4JK6A 3LH3A 3LGIA 1ZYOA 4XSKU 1PQ7A 4E7NA 1EPTC 1G3BA 1QQUA 3BV9B 1GVLA 3RMMH 1HAZB 1GJ7B 3PTNA 3SJKA 4TWWA 2Z7FE 3NXPA 3S69A 5I46H 1DY8A 2BHGA 1C5WB 1FNIA 3RXGA 3SU3A 4X2VA 2BY5X 3TK9A 5FPSA 4IMZA 4O3TA 1AFQB 1AQ7A 1P02A 3L6PA 1Z6JH 1OYTH 3QZQA 5HGGA 3QTOH 1SQAA 3V7TA 1O30A 5L2ZH 2WV4A 5DKMA 2JETC 2Z9JA 3F68H 5GCHF 2A7HA 3I77A 4CRDA 2OLGA 4OS6A 1TRNA 2SGPE 3MH7A 2XC5A 1C1WH 2AGIX 4I8HA 3G01A 8LPRA 2PGQB 3GICB 1P2JA 1LQEA 1J8AA 1DICA 2XBYA 1LVMA 3V0XA 1OWHA 1F5LA 5L6NH 3ZZ6A 2Z9GA 4WXVA 1QA7A 4NFFA 1LHGH 1SBWA 1OWEA 3MH5A 3TJUA 3BTGE 3MMGA 4HZHA 4Q80A 3TH4H 1P06A 2P3TB 3C27B 1TABE 4IS5A 1Z1JA 2ILNA 3RXBA 2OC8A 1QB9A 1P3EA 5C1YA 1GBFA 1NRNH 1UVUH 1O2SA 3O8CA 1VJAU 1NROH 3EA7A 3A7ZA 1K1MA 2V6NA 3V13A 1OP0A 3Q3YA 1QJ7B 1D9IA 6GCHF 4F49A 4H6TA 1TGSZ 1PPGE 1SI5H 1AUJA 2ZU3A 1JBUH 2CGAA 2A4GA 1GHAF 4BNRA 3RXTA 2ZFTA 1IHSH 3T5FH 1DWBH 2OQUA 2QY0B 1A3EH 3SGAE 4A7IB 1ZPBA 2BDAA 3TK5A 1QQ4A 4NA7A 1BMLA 1A2CH 1BTXA 4I8KA 3BEUA 1GJCB 5FX5A 2A5IA 4ZXXH 1ZGIA 2ZTXA 1THRH 1KIGH 2J38A 3P8GA 4TPYA 2A4OA 3DA9B 5EXMA 4AFZA 1KXFA 1GJDB 2WPIS 1BOQA 5C67A 2JKHA 1PPEE 1VCWA 1C5RA 1K9OE 3KHVA 4ESTE 2B0FA 2BMGB 4H4FA 1DWEH 1QY6A 4YESB 1TGBA 4DG4A 1XUFA 1IQEA 2FX6A 2Q1JA 1HYLA 4ABDA 4LK4A 1PPHE 1MZAA 1T8OA 2ZCHP 1A0HB 1WQVH 5EOKA 3UQOA 2XC4A 4D7FA 1B0EA 1ZOMA 4OGXA 1O2ZA 3MO6A 1CHGA 2ZDAH 2STBE 3SU4A 3P8FA 2CJIA 1ZRBA 3RP2A 1HJ9A 1F0SA 3LDXH 3VFEA 1HAXB 2LPRA 1OYQA 1QL8A 1AZZA 1O2NA 2GT8A 2ZPQA 5DPAA 1W2KH 1W8BH 3MU4A 5EODA 5ABWA 4XBBA 4Y7AA 1LO6A 1MKWH 1NFWA 1K1LA 2GCTC 1O5EH 1OP8A 6CHAC 8GCHG 1GBEA 1O36A 3SUDA 1TIOA 3SNAA 3SGBE 1ZHRA 1O39A 2B7DH 2BZAA 1J14A 1MU8B 2DE9A 1A7SA 3A8BA 1AMHA 1H9HE 1JMOH 1E34B 4YOJA 4JYTA 3ENSB 1G3EA 3GY2A 1BBRH 1P0SH 3H7OA 4FUBA 3M35A 2UUYA 2G5VA 1QR3E 1C5XB 1GJ8B 1P3CA 2HGTH 1TQ0B 1VCPA 3A82A 2WUBA 1W11U 2P8OB 4BAHB 1EZXC 2R0LA 2Z9KA 1UK4A 1O3HA 4ZKSU 4Y79A 3QK1A 3QN7A 1HIAA 4GHQA 1XUKA 1SGEE 5E2PA 3F9HA 3RXQA 3SJOA 4RSPA 1WTHD 1GG6C 2OP9A 2R3UA 1DS2E 1DSUA 2VIVA 4X6NA 4ZHAA 1UTNA 1FN8A 2O8UA 1WAYB 3LJOA 2UUJB 1TOCB 4GUXA 1SVPA 1JWTA 1L4ZA 3U1JB 4I7YH 1SGQE 1MTSA 1XUGA 4ISNA 2WPHS 2GDEH 5T6FA 3EDXB 1O2XA 3SI4H 1S83A 1Y5AT 3LU9B 4GCHF 2BDGA 1DT2A 1Z8RA 2RCEA 3M5LA 2RA3A 1CQQA 1GHAG 1V2PT 1N6YA 1HB0B 2XTTB 4FUHA 3QZRA 1KTSB 1MTWA 4FUJA 2CV3A 3M5NA 3NWUA 1T4UH 1C5LH 4I32A 2FXRA 2STAE 3ZVFA 4ZXYH 1IAUA 2GT7A 1C5UA 4WVPE 4CHAC 4MPUA 2VIWA 4MQAA 2HVXA 4LXBH 2FOAA 3KNXA 2BY9X 2G00A 1LVYA 1W14U 2QF0A 1TPPA 2Y5HA 1CGIE 1XVMA 3MYWA 4UFGH 1SQOA 1HLTH 5C5OA 3FP8E 5FCKA 3UQVA 4BTUB 3ZZ9A 3TU7H 1PJPA 4A92A 1EP5A 3SU6A 1P04A 1FLEE 1IQIA 2BYAX 1MBQA 2OC0A 3T28A 2C8WB 3PLBA 1MTVA 4I31A 2Y5GA 3JZ2B 1QGFA 1E35B 1O2IA 1CT0E 2GV6A 1BHXB 4X8VH 2TRMA 4WF8A 4I33A 5EG4A 4X6PA 1RIWB 2J34A 2ZWLH 4YOGA 2QXGA 5DP6A 4IW4E 1J17T 3UOUA 5EQQA 1GCDA 1QB1A 2GGVB 4E7RG 5A8ZA 1TRMA 3SU0A 4Y76A 3BTEE 5F8XA 4TYDA 2Y5FA 2ULLA 2OC7A 4FVBA 5K7RA 3UR6A 1THSH 1BIOA 1NM6A 1QJ1B 3PMJA 2QN5T 1WQSA 4NA8A 1CSOE 1EOLA 1GJBB 2XC0A 3GCTF 3SORA 3SNEA 1LHEH 1S6HA 2V35A 2QXIA 3A83A 1O3EA 4M7GA 1O3MA 1S84A 1BRAA 1JRSA 2PW8H 5CMXH 5FBIA 4D9RA 3UPEA 4X1PU 3OY6U 1SL3A 2P8OC 1MU6B 5DJ7A 1KXBA 2D1JA 1LVOA 4UD9H 4CH2B 1DLKB 5PTPA 4YT7H 1A0LA 1ARBA 2EC9H 1AY6H 1F5KU 3M5OA 1FPHH 5AVDA 4FUCA 4ZMAH 1KXAA 1HFDA 1TALA 3E8LA 4Y6DA 2F91A 1EAWA 2ZU4A 3RXCA 4INKA 5LH8A 1NTPA 1A5HA 4U30A 4XOJA 3SV6A 1EJAA 4ASHA 3S9CA 2BQ6B 3S9BA 1TB6H 2O8MA 2VJ1A 4H6SB 1GCTC 1NFXA 4NIYA 3M3VA 1SOTA 2ZHWH 1A3BH 2VIQA 1S85A 1UTKA 3SOSA 4B1TA 3QWCH 1C1RA 4UDWH 2GCTB 2P16A 3Q76A 1O2TA 4NZQA 4AORA 1HV7A 1C2JA 4X2WA 1EKBB 2G8TA 4FUEA 3KIDU 2G4UA 1BZXE 2DUCA 2GMTB 3RXAA 4JMYA 6CHAB 3EAJA 1PPZA 1ZGVA 5LGOA 3E6PH 2ANMH 2FOCA 1O37A 3F9FA 1MTNB 1GMCF 1Z71A 4XE4A 1HAPH 3VPKA 3KGPA 1ZZZA 2WPLS 2M5TA 1NZQH 1GHBG 2W5EA 3PWBA 3DD2H 3GY7A 3KQCA 3LGYA 2V0BA 4CBNA 1YF4A 1NRSH 2QA9E 4AX9H 3MTYA 1IQHA 7LPRA 4ZUHA 3KEEA 1S5SA 1FV9A 4IBLH 2ZA5A 1O0DH 1O38A 3FVFB 3TH3H 1ZR0A 2Z3CA 1FONA 1E36B 2JETB 3RXPA 5EXNA 3UNSA 2FIRH 1ABIH 1W7XH 2ANWA 6LPRA 2BD8A 3D49H 1WV7H 4U2WA 3AW1A 3O8DA 2TBSA 5GXPA 2ZF0H 2AIPA 3T2NA 2FESH 3TITA 1P09A 3UR9A 1OS8A 1GI6A 2AEIH 3LH1A 1UCYH 1CO7E 3TJOA 2FOGA 4X1QU 4WY3A 5T6DA 2XWAA 3EA8A 3RM0H 3RXKA 2FYRA 2R9PA 2XBWA 3PLPA 2ZDVH 2JH0D 4NA9H 4RKJB 4Y0ZE 4F4OC 2J2UA 1A4WH 1BRCE 1C5PA 1FIZA 2ALVA 3U98H 2XWBI 4NFEA 1C1VH 2H1UA 1FDPA 3A85A 1HAOH 1PYTC 4BAKB 1O3FA 4A1TA 1YCPK 3SNCA 3VB4A 1C9PA 1AB9B 1E37B 2IPHA 1HAGE 2VVUA 1S6FA 1CBWB 1J16A 4A6LA 4YLQH 1XXDA 3PMBB 1FUJA 3E90B 3RXMA 1MQ5A 1SQTA 2G5NA 3A7WA 1VGCC 2G81E 3BTHE 3SJIA 1G3CA 1Q31A 1NRQH 1QNJA 1N6XA 2AMQA 5DG6A 4ABFA 1Z7KA 3S0NA 2VNTA 2GZ8A 3A8CA 4ZKOU 2HNTF 3U8OH 1C1NA 1GHWH 3ZZ7A 1QB6A 3E3TA 1V2LT 3MNCA 5I25A 1SGDE 2W7UA 2EA3A 1G32B 1SMFE 3ZVGA 3RXFA 1TBZH 4X1RU 5DO4H 5A8XA 1YGCH 1K22H 2J9NA 2ZHEH 1GBHA 1YPLH 1BB0B 1TMBH 3UREA 2FDAA 2VINA 1YM0A 1FI8A 2Y81A 1S81A 1EPTA 2ZECA 1QBVH 1J15A 3M7QA 1RGQA 8KME2 3RXOA 3GY8A 1DM4B 3MU0A 1A46H 2FS9A 1MKXK 2TGDA 3MU5A 3ODFA 4MPVA 1GHXH 3RU4T 3VB5A 1O2QA 1Y5BT 2ZFSA 3FFGA 1PFXC 4DY7B 2UUKB 3RXLA 1QIXB 2VH6A 2ZNKH 5JDUB 1BTWA 3MU8A 1GMDG 2VH0A 4B2AA 4ABGA 1NT1A 1DXWA 3SJ9A 3OY5U 2VWMA 2QV1A 2ZGBH 1BRBE 6ESTA 2QF3A 2FTMA 3OU0A 3BTFE 1G36A 1C5QA 2BD2A 2OBQA 1C5NH 1DANH 1LPZB 1UCYK 2I6SA 2PKSC 3M36A 4AB9A 3U8TH 1SPJA 1SGFA 2CHAB 2PV9B 1O2LA 5T3HA 2XRCA 3F6UH 3ZZBA 1C4U2 3LGUA 1UVOA 1GBJA 4MNWA 1SGIB 1H8DH 4MNXA 2ZI2H 4NZLA 5AF9H 4VGCB 1BQYA 4UEHH 4NWLA 3RU4D 3RDZA 2PSXA 1V2WT 2K1QA 2OINA 3E91A 1D3DB 5F03A 2FOMB 3KCGH 1G2LA 2R3YA 1OSSA 3LC3A 4NIVA 1AKSB 3ZZ3A 1WOFA 3SNDA 1UHBA 1C5VA 4THNH 1KXDA 1JIMA 2ZHDA 4X2YA 2BOHB 1DUEA 5FAHA 1P2NA 4UONA 1O2VA 2HALA 1C1QA 2FP7B 1HJ8A 1PPBH 4WMDA 3FANA 1JIRA 1G9IE 3L33A 5GIBA 4YOIA 3LGTA 4DJZB 3M7TA 4GLYA 1ZSJA 2TGAA 3BF6H 3LGVA 1ANCA 3KL6A 4GVUA 3PV4A 2A5AA 4D7GA 4Y8YA 3MFJA 1RTKA 1T4VH 2ZDKA 5CE1A 1MAXA 2BD5A 1LPGB 1TMUH 5EU8A 1OWIA 4X6OA 3UWJH 1Y5UT 3P8NA 4AN7A 1D6WA 4DOQA 3P70B 2RG3A 1F92A 3C1KA 1CU1A 1D3PB 1C1UH 3B23B 2PKAB 1C2KA 1H9LB 1GCTB 2ZDMA 1UHBB 2AGGX 3QDZB 1NRRH 1BDAA 1O35A 1C2DA 1DLEA 3E16B 3SV9A 1DX5M 1ORFA 2ZHFH 1JOUB 2BLVA 3E1XB 2F9VA 1Y3WA 3A81A