1OP8A

Crystal structure of human granzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
234
structure length
234
Chain Sequence
IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the apoptosis-inducing human granzyme A dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Granzyme A
total genus 50
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.78: Granzyme A.
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A02
3TITA 1YPEH 4WMEA 4CRDA 3TGKE 1TX6A 2OC0A 3S7KB 4IMZA 1Y3YA 3U8OH 4AG2A 2BB4A 4YTAA 1WTHD 1QB9A 2IPHA 1EAWA 4NA8A 1LCYA 1WU1A 1NRRH 1Y3VA 1BTWA 3Q3YA 1TNLA 3IG6B 4DY7B 3LC5A 3SI4H 1T4UH 5DGJA 1DSUA 1ZJDA 2EI7A 4WWYA 4AOQA 2TPIZ 3MOCA 2WINI 4I8LA 3M5NA 1EZUC 2TGTA 3WY8A 1V2QT 1ARBA 1TMUH 3A7WA 2ZFRH 4XBCA 1DUAA 4NSYA 2G5NA 3C27B 4GCHF 2BX3A 1O3AA 1PYTC 8KME2 1IHSH 1DDJA 1GJ7B 3E1XB 5JBBS 1A0JA 1RIWB 3A8AA 4CBNA 3PWBA 2HNTE 3SNCA 3B8JA 1YPHE 2A31A 2R0KA 4J2YB 4OS2A 2JH0D 1J14A 3ZZ5A 1ZSLA 2A45B 4AGKA 2QXGA 3SJOA 1SLVB 4BTIB 1MTNC 1QRWA 4I33A 3SGQE 3GY5A 2C3SA 4LK4A 3Q00A 1QB1A 2DE8A 5E2OA 4YOIA 1C5NH 3VFEA 3MFJA 1GMHG 1BTHH 4Q7YA 1PPHE 4DIIH 3M37A 2FOCA 3MU8A 1UTKA 3EQ0H 1S84A 1P12E 4X6OA 3SN8A 1GJ6A 6GCHG 3SV8A 1UVTH 1TPOA 1HAZB 1Y5AT 4KTCA 4AYYB 1MZAA 4IBLH 1LPKB 4SGBE 1O2XA 4B71A 1O2IA 2SGEE 3K65B 8ESTE 2VVVA 3URCA 2VWMA 4A1VA 2PKAB 1O3CA 2AYWA 1XVMA 4ASHA 3LPRA 5GCHG 3T26A 1GCTB 5F8ZA 2ANKH 1SGFG 3VB4A 3UNRA 1GBLA 1NO9H 5GPIB 1DLKB 2GX4A 5TJXA 3A7TA 1UCYH 3FFGA 5HGGA 3SUEA 2ILNA 2R0LA 1FY1A 1C5OH 1BRBE 3VEQB 1QRZA 2PSYA 1A1RA 5AFZH 4YM9A 1K1OA 2M5TA 1ZMLA 1AMHA 5GIBA 3K9XB 3PLKA 3TJVA 3RXBA 1UTMA 1BJVA 3ATMA 2WPLS 4O9VA 1JXPA 1V2MT 5AFYH 1UHBB 2BOKA 1DICA 1O3FA 1LHCH 2XBVA 5DJ7A 1C5XB 1Z8RA 1OX1A 1P09A 3RM0H 1DWCH 3OY5U 3RXMA 1ELCA 1AZ8A 2VB0A 1CT2E 1Z6JH 2ZU2A 1TBZH 3ZZCA 1EOJA 1KY9A 3TPIZ 4X1RU 2GCHF 4NIVA 1EATA 1EASA 3E8LA 3QO6A 4IN1A 5JDUB 3QUMP 1OP8A 2GV6A 3TGIE 1PPGE 4H6TA 1SGQE 1T7CA 5E0HA 4GUXA 3VB5A 1P2IA 5K7RA 4K8YA 1MQ6A 3FZDA 1EPTA 4FUJA 1XUFA 1A5IA 1K1IA 2FM2A 2ULLA 1G9IE 2VGCC 1WYKA 3BTTE 1DXPA 2QGRA 5AHGH 2SFAA 1F5RA 1W10U 1C1RA 4GLYA 2B0FA 4YOGA 1YKTA 1RJXB 4F49A 4X1SU 2STAE 2C8ZB 5FX5A 1C2KA 5JBAS 2PHBA 5GJ4B 4X2VA 1UTLM 4X2WA 2V3OH 2FXRA 1ELGA 1ELVA 2V3HH 3NCLA 2NU1E 3MU4A 1AVGH 2A1DB 1D4PB 4YO9A 1DITH 1E37B 2H9TH 3O8DA 2PW8H 4UFEH 5E8EH 1AD8H 4DJZB 3RLYH 3RXTA 2GV7A 1ZPZA 4NZQA 2J95A 1SBWA 1MD7A 1KLJH 4ABEA 3ZZ7A 1O3IA 1VCQA 1GL1A 4H6SB 3RM2H 4Q2KA 3KNXA 1VJ9U 3T27A 1WAYB 1XX9A 5LPRA 5FPYA 3S9CA 3QGNB 1O2UA 2O8TA 1HCGA 1NRQH 2R9PA 1C2MA 3E16B 5EXNA 4HI3A 1BCUH 1DVAH 2JKHA 4KELA 1J17T 2HLCA 3QK1A 1JMOH 1P02A 1K21H 4PROA 3K2UA 1TOMH 1TRYA 4FVBA 2PFEA 2OBOA 1TRMA 1IQMA 5L30H 4JK6A 1O3MA 1QJ7B 2BXTH 2C8WB 1GI8B 3UNSA 1F0UA 2ODYB 1GG6B 2Y7ZA 4NZLA 3SJKA 1MBQA 2EA3A 6CHAC 3ZZ8A 3F9GA 2AERH 2ASUB 4X1QU 3T5FH 4BAQB 3ZZ6A 1NROH 3A7VA 4ABGA 1QBNA 3D62A 2P93A 1PPCE 3RXAA 1ANCA 4AX9H 1AWFH 2QN5T 1ZRBA 4AYVB 1FAXA 3MH6A 1ZMJA 2OCVB 1MU6B 4CRGA 1OWIA 4OGYA 5A2MH 1UVSH 3RXOA 1GMCF 2ZDNA 2UWLA 2A32A 4O03A 1JIMA 2QXHA 3E91A 1HAIH 3SI3H 4OS1A 3UOUA 1E34B 3MNBA 1FN8A 4ZHLU 1SR5C 1P2QA 5CHAC 3AVZA 2ZDLA 5IDKA 2WPIS 4BTTB 1IQKA 2PGQB 3AW1A 5EW2H 2FIRH 2XBWA 1LPGB 1GDQA 4ABBA 3RMLH 2A4GA 4MG3A 2VVCA 4B76A 2ZFQH 2XYAA 1K9OE 2FWWA 2ZFTA 2XTTB 4AB9A 4XE4A 1BHXF 2BY7X 1V2KT 4A7IB 4A5TS 2WUCA 1P3CA 1W14U 1KLIH 3NKKA 3ZZ3A 1IQJA 1NRSH 2Q6GA 3P8NA 1EAIA 4FU7A 1S0RA 1GBHA 3H5CB 1A5HA 1TLDA 1UCYK 3FP6E 2ZZUH 4TY6A 4O3UA 1MKXH 1HUTH 1V2PT 2TIOA 2A0QB 3RXFA 3TK5A 1FQ3A 1AU8A 4ZAEA 4UE7H 1GBJA 2ZC9H 4HZHA 4A6LA 4H42U 3BG4C 3S7HB 2IOTA 5I46H 1EKBB 1TNGA 1SG8B 4ZHAA 4ABAA 2VH0A 2ZF0H 1PQ7A 2OINA 3P6ZB 3GOVB 3EE0B 1T4VH 4BAMB 1GHBF 2VIPA 1B0EA 1KXAA 1MTUA 1P10A 1OWJA 1SVPA 1G3BA 1SSXA 2P8OB 2K1QA 1A4WH 3NZIA 3RXCA 5EODA 4CHAB 2PGBB 3A81A 2XCNA 4LXBH 1O38A 3BTGE 5T6FA 1GJ4H 3U8TH 1A7SA 4ABIA 2G00A 4YOJA 3Q3KA 2F9BH 1MUEB 2AMPA 3JZ1B 1Z8IB 2GMTC 3ZVGA 1SGEE 1O3JA 1QA0A 2SGDE 3SU2A 4FU9A 2P3UB 1BTUA 4YT6H 3MO9A 1OWEA 1FJSA 2SGQE 2FPZA 1GI5A 3E3TA 3VGCC 2QCYA 3A7YA 1K1PA 3U1IB 1M9UA 2ZHEH 4BXWA 5L2ZH 5CHAB 2PKAA 2H2ZA 3RXGA 4JYVH 3LGVA 4ZHMU 4GHTA 1V2OT 2IJOB 3BTME 2Z3EA 4CH8B 1BHXB 4BAKB 2VIVA 2LNCA 5F8TA 4CH2B 1TNHA 3PO1C 1E35B 3F68H 5HXFA 2FODA 1THSH 1O36A 5LGOA 2UUJB 1FY3A 3S0NA 3BF6H 4OS7A 3D65E 1O3DA 3U8RH 1C5UA 5DP5A 5FHTA 2P3TB 2D1JA 1TGCA 1LHFH 2F91A 1QL9A 2XWBI 3P8OA 1UK3A 1C2GA 2ZFSA 3MNSA 1HXEH 5EW1H 2A4QA 2CJIA 2ZHQH 3BN9A 4Y11E 1LVYA 4SGAE 3A80A 3A8BA 1SMFE 1YCPK 1F0TA 1GBIA 2GZ9A 3M7TA 4I8HA 2ZU4A 1H4WA 1CO7E 3LIWA 1W2KH 2XCFA 4GSOA 3OY6U 1FY5A 2AIQA 2Y82A 1C4Y2 1OSSA 4TWYA 2BDCA 1TAWA 2PR3A 1A3BH 2OC8A 5EQQA 2Y81A 1BRUP 5L2YH 1BIOA 2NWNA 3HK6B 3ZZDA 3BTKE 3ATWA 5EPYA 2A4OA 4Y0YE 1UJ1A 1ELBA 1YC0A 4E06H 5JPMH 2BD9A 3ZYDA 3B9FH 5FAHA 1GCDA 1SGTA 1V3XA 3M3TA 5LPFA 1AHTH 1G3CA 1MAXA 3SORA 5A0CA 1ZMNA 2RA0A 3ZVDA 4ZROA 4JCNA 4D7FA 1P2JA 2VIDA 1F5LA 4ISOA 4WVPE 4Y8ZA 1BTXA 1DWEH 4R8TB 3KL6A 5C5OA 1NC6A 2TGAA 3Q3XA 4RKOB 2A7HA 2W3IA 1Y8TA 4IMQA 3DFJA 3RU4E 1ESTA 1SGYE 5HM9A 1V2UT 3A88A 2ZFFH 6LPRA 1HIAB 2FEQH 2PWXA 2GDEH 1GJ9B 1O2ZA 1T8LA 2GCTB 4CR5A 3KCGH 1LHEH 9LPRA 2NU3E 1OKXA 1SPJA 1SQOA 2BDAA 4GCHG 3NXPA 3S69A 3RXKA 1NU9A 3UNQA 1O3NA 2QC2A 1TYNA 3LGIA 1ELDE 1JRTA 2Z6BD 1IQIA 4H4FA 1KXDA 3GISB 5T6GA 1P2OA 2ODQA 1BDAA 1IOEA 1RGQA 1ZPBA 2BZ6H 3GDUA 4U30A 3GY8A 1GVLA 5T6DA 3QDZB 1FPCH 2BVRH 4Y0ZE 1AI8H 1W0ZU 1PPEE 3AAVA 5A0BA 2P59A 1BBRE 1TNJA 2FLBH 2FOAA 1EP6A 3HPTB 1O2MA 1SGCA 3PM3A 4Y7AA 1ZRKA 2O9QA 4XBBA 1YLDA 3F6UH 2FZZA 1P01A 2Z9GA 3EGKH 2ZHDA 1C5VA 8GCHG 2QF3A 1UO6A 2D26C 2Q1JA 3MWIU 3A84A 1EAUA 2GT8A 3RMMH 1SB1H 3MU1A 3O8CA 1GMCG 4VGCC 3RMOH 3A8DA 3ATLA 3TLOA 1Y3WA 1ZSJA 2STBE 3RC6A 1N8OC 5A8YA 1N6YA 4XDEA 4MQAA 2H5DA 3MU0A 1W7XH 4GHQA 1F92A 1HJAB 3T25A 3QLPH 1J15A 4CBOA 1DUEA 1DXWA 3SU5A 1LVBA 1GI2A 1Z1IA 4NFEA 1TMTH 4U01A 2QA9E 4FUEA 1O5EH 1E0FD 3TH4H 2XC0A 1YPMH 2A5KA 1TX8A 3MMGA 1DWDH 2V35A 3BTDE 1GHZA 3UY9A 1TQ7B 3G01A 2FMJA 1H9LB 2QAAA 1TA2A 4RKJB 1GVZA 2V0BA 3TJUA 3VGCB 1C1NA 3ZZ4A 3KQBA 5A8ZA 1VZQH 4OS4A 3TK6A 3SJ8A 4YZUA 2HPQH 2VVUA 4Y7BA 3RU4T 3LJJA 1EZXC 1D3QB 1O37A 4WXIA 5F03A 5HM2A 2GMTB 2XC5A 4INKA 3SV2H 2AGEX 1H9IE 2Y6TA 1W13U 1QL8A 2OQ5A 3ZV9A 4Y8YA 1O5DH 3QZRA 1ANBA 3P17H 4CHAC 1QTFA 2BD5A 2Y5FA 1EP5A 3SGAE 4B73A 1P9SA 2SGPE 1V2NT 5E0JA 1G32B 1CBWC 1EOLA 2GZ7A 1D6RA 3LH3A 4MDSA 1LVMA 2BDIA 2W7SA 3UIRA 3UWJH 1GMDG 2VU8E 2V6NA 3DUXH 3SV6A 3LH1A 2BLOA 2EI6A 1ZYOA 1K2I1 3MI4A 1SGDE 3LGYA 1WCZA 2W26A 2J94A 4B75A 3M3SA 1C2LA 1C2IA 3T28A 2ZTYA 1S5SA 4MPUA 4ZXYH 3A89A 3VB3A 2FDAA 3ZYEA 1QB6A 1A3EH 1WOFA 2RA3A 1G2MA 1PJPA 1MTSA 5BRRE 1GDUA 1P06A 4DGJA 1LHDH 2QY0B 1GJ5H 4JZEH 1GGDB 1DY9A 2TRMA 3LDXH 4FUFA 6CHAB 1RTLA 1SQAA 2BLVA 3V0XA 1ELEE 3PMBB 2OUAA 1BMNH 1AUTC 1ELFA 2ZI2H 3STIA 1TBRH 1WTGH 1BQYA 1HJAC 2W3KA 4E7NA 5TCAA 4KKDA 1GHYH 2Z3CA 1MH0A 2GTBA 3T29A 2CHAC 2SGFE 3EYDA 5C1YA 1O2KA 3ZV8A 2AH4X 5F6MA 2PLXA 3VPKA 1BZXE 1O2QA 1C1OA 1BMLA 3EA8A 1F5KU 1KXEA 3E90B 3OTJE 3QGJA 1L2EA 1FLEE 1SOTA 2WUBA 5DP7A 4UFGH 3RXUA 1YYY1 1GI1A 3SNAA 1B0FA 4KTSA 3RXIA 1ZGVA 2RDLA 1UTJA 4X2YA 1HXFH 1BT7A 5E2PA 2ZTZA 5C1XA 1LVOA 1T32A 4KP0A 1EB2A 1BJUA 1IQNA 1UHBA 3ESTA 3GDSA 3QN7A 1VR1H 2H6MA 3F9EA 2OC1A 1QCPA 1XVOA 1D9IA 1ELAA 3ZZ9A 1C1WH 2UUYA 2G4TA 1EXFA 1PQ8A 3RLWH 5C20A 2FI5E 4RN6A 2OC7A 2R3UA 1RXPA 1CA0C 5JYIA 4BAHB 3SUDA 2F83A 2FS9A 1VCWA 1BTPA 2G8TA 3M35A 3LKWA 4YLQH 3F9FA 2UUFB 6GCHF 3U69H 1W12U 2D2DA 2KAIA 1N1LA 2BVXH 3V7TA 3V3MA 4LZ1H 2VGCB 5FXLA 1SGRE 1ANDA 5GCHF 1C2JA 4OS5A 1OXGA 2ZHFH 5TCCA 1TALA 1YCPM 1EZQA 1TABE 1YPKH 4M7GA 3UR9A 1KSNA 1GBTA 3A86A 1S85A 3H7OA 1CHOF 1BA8B 1LKAA 1O3BA 3KEEA 5GXPA 1DLEA 1OYTH 4JMYA 1O2HA 1GHVH 1C4U2 2Z7FE 3JZ2B 3OX7U 3MH4A 3GYMA 3P8GA 1NY22 4CR9A 1HAPH 4BXSA 1LQDB 2ZP0H 4X6MA 3PMJA 3HATH 4CRFA 1H8IH 3UUZA 1S83A 3TNSA 1GJ8B 3FZZA 2RCEA 2WV5A 4UFDH 1AIXH 1C9PA 2FOEA 3GCOA 3L3TA 5HMAA 1ARCA 2YNAA 4CRCA 2Y80A 3M36A 4WF8A 1FIWA 1EJNA 3MO3A 3M5OA 4MTBA 1AKSB 1HRTH 1MKXK 3SUGA 2O8WA 4TPIZ 3DFLA 3R0FA 2PTCE 1SFQB 2NU4E 3SNDA 1VITH 3D23A 5B6OA 5LPEA 1SGPE 4X1PU 1RTFB 2ZU5A 2ZDMA 3PMHB 1C1UH 1J8AA 2OTVA 2BHGA 5FPTA 1GJDB 1B7XB 1PPBH 1ELTA 5EQRA 1C9TA 1W3CA 3BEUA 2HRVA 1L4DA 3MYWA 4X8VH 3ZVBA 2B9LA 1P03A 2YNBA 2H5CA 3SUFA 1P05A 1LQEA 3RMNH 1ZPCA 1C4V2 1THPB 7KMEH 1XUJA 1HLTH 3TJNA 2J4IA 3MTYA 5EXMA 3OU0A 7GCHF 4ABJA 4IW4E 1MMJN 2ZQ2A 4ABDA 1EUFA 2C4FH 2QXIA 1NT1A 3EDXB 1BITA 3SJIA 1T8MA 1LMWB 1L1JA 2JETC 1EZSC 2NU2E 2F9UA 3KQCA 5FCKA 1C1MA 1LDTT 4WH6A 1EJAA 3QTOH 3UTUH 1QJ6B 2BD7A 2ANMH 4NG9H 1WQVH 1ZTJA 3I77A 1XM1A 2ZGXH 1AO5A 1MKWK 1S82A 3BEIB 2ZDAH 1TGBA 3URDA 2GVFA 1O5BB 5DG6A 1AE5A 2A7CA 2BXUH 4NA9H 3RU4D 1XMNB 4K1EA 5L6NH 1YP9A 1O5GH 1UTPA 1NN6A 1QHRB 4X8UH 2AEIH 4A1TA 3CS0A 4AFSA 3C1KA 3BIVH 4Y71A 1BUIA 3UOPA 3D49H 2CF8H 1KXCA 3PLBA 1J16A 3DT0H 4ISIH 1EX3A 2J38A 2ZKSA 3VXFH 2XC4A 1LTOA 4DVAU 1HBTH 4Y8XA 2WPHS 5T3HA 3V12A 5LH8A 1OOKB 2BD3A 4NIXA 2BD8A 2FESH 1IQEA 2FI4E 4QT8C 3LC3A 4B2AA 1E38B 2HPPH 3W94A 3EA7A 1GI4A 2VIQA 1PPFE 1KDQB 4K8BA 2BDBA 2P8OC 3LOXA 3BIUH 3TIUA 5JBCS 1TBQH 1P2NA 2G5VA 1XUHA 5C67A 1RIWC 2ZTXA 1CGIE 2D8WA 4MVNA 1MTNB 1AB9C 1O34A 1PYTD 4DOQA 1A5GH 1CA0B 5DP9A 2CXVA 3BTWE 5DP3A 3SNEA 1HAXB 1FV9A 1NFUA 1D3DB 2BX4A 1ZLRA 1EB1H 1D3TB 5DKMA 4BOHA 3GCNA 1MZDA 4FU8A 1OS8A 3SU4A 1RRKA 2B7DH 1HAOH 4Z6AH 2QYIA 1IQGA 1C1TA 2FX4A 4Q7XA 1QBVH 5G4BA 1GJCB 2Z9LA 1C5ZB 4MPVA 1G3DA 4J1YA 1NRNH 2A5IA 3GCHC 3RUOA 1N6XA 5C1UA 2ALPA 2FYQA 3CENA 1YGCH 2ANWA 3A85A 1BMMH 1L0ZA 2ZIQH 3RXVA 1BBRK 4K1TA 2C90B 4Y6DA 2O8UA 3T2NA 1Z1JA 3L33A 2ZDVH 3HK3B 1O5AB 4YT7H 1FY4A 1GVKB 1YPHC 1CHOG 3E0PB 1VCPA 4ISLA 2AMQA 3MU5A 2CHAB 3IWMA 4OGXA 3QTVH 2BY6X 2QF0A 3M5MA 2BD2A 5ETXA 2PKSB 1AE8H 1JOUB 3MH7A 1NFYA 4UEHH 1FZZA 3P70B 1Y5UT 1XXFA 4DW2U 1IAUA 1LO6A 4TYDA 1GBAA 2WV4A 1C5MD 4ISNA 1BMAA 3KN2A 1UK2A 4NIWA 1GG6C 1V6DA 3SQEE 3AAUA 3QZQA 3M5LA 8GCHF 2J34A 4K3JA 2YOLA 2GCHG 1NFXA 3QWCH 2F3CE 3U9AH 1AQ7A 2FS8A 1MD8A 1NS3A 1OWHA 1QGFA 3NUMA 1SHHB 4HTCH 5C5NA 4FVDA 1AFEH 3AASA 3PWCA 1KXFA 4UFFH 1C5SA 1Z8JB 1A61H 2FYRA 3LGTA 1HJ9A 4KTUA 3PV4A 3RXDA 2BOHB 3UREA 2G52A 1O2NA 4UONA 2VJ1A 3LONA 2G4UA 1DPOA 1THRH 1ZJKA 4NSVA 1O3KA 1BBRH 1O2VA 1XUKA 1TIOA 1TONA 2GD4B 2F9OA 1TNIA 2WPJS 1OP0A 3MHWU 5K0HA 3BG4B 4A1XA 4B2BA 1QY6A 2B8OH 5DP6A 4NFFA 3NWUA 3ODDA 1D6WA 2BM2A 2BVSH 3SNBA 1UVPA 2R3YA 2JETB 1MCVA 1NFWA 2UWPA 3L6PA 1ZTKA 2OLGA 2VINA 1OWKA 5F8XA 4MPWA 3GICB 4WY3A 1CT4E 4U2WA 1GI7B 2THFB 1O3HA 5J4QA 1F0RA 2TGPZ 2ZPQA 1K1JA 3M3VA 2FO9A 1O3PB 1CQQA 3IITA 4Z0KA 1Z8GA 1S0QA 1CHGA 1C1QA 3U98H 9ESTA 3B23B 1TRNA 2DUCA 3SW2B 2J2UA 3SZNA 3HGPA 2OQUA 4NWKA 3MH5A 1O3EA 1O0DH 4X0WU 1SLXB 4E7RG 2ZU3A 4YLUA 3VB7A 3ZVFA 1DY8A 1SOZA 2A5AA 1BB0B 1W11U 3M7QA 1DANH 3ZVAA 1JBUH 4AORA 1GBDA 2OXSA 3K6YA 4WJG2 3LU9B 1MTVA 4BNRA 2BTCE 4FUBA 3ENSB 1CSOE 1C5QA 1XXDA 3BEFB 1O2WA 1RFNA 4AB8A 2P16A 2ZPSA 1YLCA 3SGBE 4E05H 2BY9X 3KQEA 3SQHE 1MAYA 1KIGH 1C2EA 1VJAU 3HKIB 1AN1E 4ZH8A 2SNWA 4DCDA 2C8XB 3LGWA 4XSKU 4ZKSU 1KLTA 5EQSA 4AN7A 3STJA 1HAVA 3TJOA 5BPEA 1TGNA 1Q31A 1YPJH 4FXGH 1DOJA 2BY8X 4ABHA 1H1BA 2VIWA 1AUJA 3GY6A 3RXQA 1DE7H 4K1SA 2QIQA 5A8XA 3SHCH 1XKAC 3GY2A 3ITIA 4JZIA 3I29A 3ZVCA 5EG4A 2H9HA 3GY4A 1RTKA 1T31A 4THNH 1IQLA 3V13A 2BDGA 2AMDA 1GBEA 1LHGH 1B5GH 2O8LA 1V2TT 2EC9H 2ZGBH 5IYTA 2ZG0H 4X8TH 1O2LA 1HAGE 1YPLH 1Y3XA 2P94A 1SGNE 1GHWH 1QL7A 1TPAE 2BLQA 1C2FA 1ABIH 1NU7B 3FAOA 2EI8A 1GI0A 4BANB 3K6ZA 1C5LH 1ZGIA 1Z7KA 2VNTA 1EQ9A 1DSTA 2BQ7B 4UD9H 5C2ZA 8LPRA 4I8JA 1O2GH 4Q7ZA 1LPZB 2A2XH 3LJOA 5JB8S 3FVFB 1O2OA 4ISHH 1AZZA 1ZSKA 3ATIA 1ZOMA 1U6QA 3VXEH 3OSYA 1QQUA 3FP8E 3BSQA 4JYUH 3M7UA 2G51A 3PTNA 4K69A 1C2HA 3GYLB 1C5YB 1ID5H 4U32A 1VITG 1FN6A 1XKBC 2BY5X 4I32A 4NIYA 1K1MA 1UCYE 5FCRA 1QIXB 1FY8E 1PQAA 1J9CH 2KAIB 4GPGA 1V2LT 2GGVB 4JZDH 1SI5H 2FI3E 1CGHA 1O3OA 1AWHB 1G30B 1GJBB 3DD2H 2FOBA 4I8KA 1HIAA 5FX6A 4WXVA 5DK1A 2Y7XA 1HAVB 3LT3A 1X7AC 1HAHH 1G3EA 1P11E 1ESBA 2XW9A 1O3LA 4Q80A 5A0AE 4X2XA 3S9AA 2ZFPH 1CA8B 5ESBA 3UPEA 4WH8A 4AG1A 1WV7H 2BDYA 4LZ4B 3NK8A 3MNCA 4FUHA 1GBMA 4MLFB 2B5TB 3RXEA 2PKSC 4R0IA 3HGNA 1TGSZ 1ZTLA 4YESB 1ETTH 1SLWB 4CRAA 3PYHA 3NPSA 4TPYA 4INHA 1CGJE 1DX5M 1NRPH 1SLUB 1GI9B 2QV1A 1L1NA 4AFZA 1OYQA 4ZXXH 3BG8A 1L4ZA 1BTYA 1GGDC 1QNJA 2FOFA 2GZ8A 4X1NU 3RXSA 3OYPA 2ZCKP 4IS5A 1CE5A 4JYTA 1SHYA 3F1SB 3GCHB 3QX5H 1EJMA 4IC6A 5FBIA 1F7ZA 1UVOA 1O39A 2Z9IA 3A8CA 1MCTA 4IN2A 2ZA5A 1ZHRA 3A82A 2VWLA 2FTMA 1MQ5A 3PO1B 2A7JA 4WMDA 1WUNH 1Z71A 1SQTA 1P9UA 2XWAA 1GCTC 3EA9A 1OPHB 4D76A 1GHXH 2BDHA 1TMBH 3F9HA 1DWBH 3RC5A 3E0NB 1MKWH 3A7XA 1TPSA 3UWIA 1HDTH 2ZWLH 3HKJB 1BRAA 3BTFE 3RXRA 1C5PA 2XBXA 2VIOA 4O97A 3SOSA 1GMHF 1S6FA 2HGTH 2TGDA 4HFPB 1CT0E 4DURA 3TNTA 3BTHE 1L1GA 2Z3DA 2ZQ1A 1W7GH 3GCTG 3ZZBA 2BYAX 5I25A 1O2PA 1C5RA 1CVWH 1C5TA 3DA9B 5EU8A 3VB6A 3TH2H 3UR6A 5JB9S 4X8SH 1A0LA 1ZHPA 4NGAH 3RXLA 1T8OA 5H4IB 1G36A 1K1LA 4D9QA 2JH5D 1GBKA 1SFIA 4INLA 2P3FH 1G37A 2ZPRA 5DP4A 3T62A 2F9PA 1K22H 1NPMA 5EPNA 3TK9A 3ZZAA 1K1NA 1UMAH 1O31A 2XNIA 4I8GA 3BTEE 2NU0E 1SL3A 3CP7A 1ORFA 1O5FH 1H8DH 1V2ST 2ZGHA 3ELAH 5CE1A 4VGCB 4OS6A 4AFUA 1JWTA 1WQSA 2ANYA 2ZGCA 3FANA 3SV9A 4IC5A 2CMYA 1EPTB 1QJ1B 2Z94A 3LGUA 5AVDA 1HPGA 1S6HA 1GHAG 1AVXA 5C3NA 2PUQH 2GP9B 4B74A 1PPZA 2OP9A 3TGJE 2J92A 3TH3H 4AGJA 4DG4A 2P95A 4AFQA 3O8BA 2W7UA 3BTQE 1DM4B 1ABJH 1V2JT 2OD3B 5EGMA 5FPSA 1ZR0A 2WPKS 1TQ0B 3MNXA 1JRSA 1RS0A 3KQDA 5E0GA 1Y59T 2HNTF 1QRXA 1KXBA 3S9BA 3UFAA 3BV9B 3P95A 1GL0E 4K5ZA 1HGTH 3ATKA 2Q6FA 1INCA 2Y5HA 7LPRA 4WMFA 3H7TA 1UTOA 3SO3A 1ACBE 2XBYA 1MU8B 2ZCHP 1GI6A 2F9VA 3SU6A 1O2TA 2JH6D 1GHBG 2AGGX 1AFQB 1QFKH 2BQ6B 3A87A 2PV9B 5SGAE 1HYLA 5DO4H 1IHTH 1IQHA 1P3EA 3FP7E 2G81E 3SV7A 1O2YA 3EAJA 1UTQA 1GMDF 4B1TA 1C1SA 3SU0A 3RP2A 1HNEE 1JIRA 1MBMA 2QXJA 2GCTC 3N7OA 2WYGA 1EAXA 1TX7A 1H9HE 1VGCB 4FUIA 1FUJA 2AGIX 1NZQH 1A0HB 4ZKRU 1C1VH 1AGJA 1V2RT 4MNVA 1FDPA 4FUGA 1XUIA 5ABWA 4JZFH 1FAKH 3A7ZA 1T8NA 7GCHG 1FNIA 4CREA 1FMGA 1OP2A 2FLRH 1P04A 1GBFA 3ODFA 1YCPH 4FUDA 1YBWA 4MPXA 1GJAB 1ETSH 2WPMS 4D7GA 3SU3A 2BD4A 2DE9A 2PUXB 2ZECA 1OWDA 1O30A 5PTPA 2ZGJA 1HFDA 1LKBA 4ZKNU 7ESTE 2AFQB 1BRCE 1IQFA 3KHVA 1A2CH 2WYJA 2CN0H 2GDDA 3RDZA 1AVWA 1W8BH 2ZHWH 2ZO3H 2CV3A 2FOHA 1GBCA 2ZCLP 2C93B 1G2LA 1C5WB 1GDNA 1TFXA 4F4OC 2Q6DA 2GT7A 1V2VT 3I78A 2H1UA 2IN2A 1HB0B 6ESTA 5ESTE 5FBEA 1Y5BT 3GY7A 2A4RA 1O2SA 5JBTA 2HWLB 4ZUHA 2H9EH 3M61U 5AF9H 2BMGB 3U1JB 4UDWH 4I31A 1O5CB 2ESTE 2BLWA 4XFQA 1TOCB 4XOJA 1TNKA 1PFXC 1SGIB 1YPGH 1BTZA 4Y10E 3KGPA 1S81A 2HALA 2HNTC 1QR3E 2G55A 1QURH 1DS2E 1EPTC 1GPZA 3SBKA 1KYNA 2ZEBA 4XBDA 2I6SA 1YF4A 1Y3UA 5DPAA 3TVJB 1P0SH 5DP8A 4IGDA 2A2QH 4MNWA 3RXHA 1NTPA 1TE0A 1FONA 1CU1A 2ZDKA 4ZKOU 2FP7B 1AKSA 2AS9A 1AY6H 2Y5GA 2Z9KA 5GWZA 1V2WT 4TY7A 3UQOA 3E6PH 3O8RA 1F2SE 1ZZZA 1ESAA 1HV7A 4GVUA 2GKVE 2O8MA 3Q76A 4Y76A 4NWLA 1NESE 4A92A 4CRBA 3SJ9A 4AZ2B 1GHAF 1P2KA 2R2WU 2SNVA 1W0YH 1XUGA 1AB9B 2AIPA 1O32A 4RSPA 1QBOA 1D3PB 4Y79A 2XRCA 1RD3B 2EEKA 4FUCA 1QQ4A 3A83A 1A46H 2HVXA 2BZAA 3CS7A 1NM6A 2TBSA 1TWXB 1C1PA 2BQWB 1MTWA 3GDVA 3RC4A 4NCYA 3Q77A 4B2CA 5EOKA 1UTNA 1F0SA 1K28D 1UK4A 2Z9JA 3ZVEA 3KF2A 4I7YH 4K60A 4ESTE 1GWAA 1O33A 1TA6A 1P57B 1O2RA 2VWNA 1KTSB 1BOQA 4KGAA 2FX6A 2SGAA 4DT7B 1O2JA 4LOYH 4X6NA 1FPHH 1TGTA 3P92A 3GY3A 1O35A 1FI8A 3SU1A 1CBWB 2XXLA 1DFPA 3R3GB 5EXLA 4D9RA 3DHKH 2VWOA 1FIZA 2HOBA 1KDQA 1HJ8A 3MO6A 1KTTB 1TB6H 2PSXA 3GCTF 4JZ1A 4TWWA 4BAOB 1Q2WA 2VH6A 3W95A 2LPRA 1N8OB 1QA7A 1VGCC 3P8FA 2FOGA 4MNXA 1YM0A 1ANEA 2UWOA 2ALVA 4NA7A 5GDSH 1VITF 1P2MA 1FXYA 1P8VC 3AW0A 3PLPA 2F9NA 4D8NA 1SGFA 1GI3A 4GAWA 1WSSH 4ABFA 3UQVA 3PROA 4K2YA 1O3GA 1UVUH 1AFQC 2W5EA 1GBBA 3RXJA 1C2DA 4X6PA 2CGAA 1PQ5A 3SHAH 1DT2A 3PB1E 2ZU1A 4HGCA 5CMXH 1E36B 3KIDU 1Q3XA 2ODPA 4BTUB 2FTLE 5J4SA 4O3TA 2PTNA 5HYOA 2C8YB 1HAYB 5A09A 4JK5A 2FOMB 2J9NA 2UUKB 1ZHMA 3PMAB 1WBGB 3PTBA 4MNYA 2R2MB 3RXPA 3TU7H 2CF9H 2I6QA 4ZMAH 4DIHH 2ZNKH 1ETRH 1SC8U 2RG3A 2OBQA 1TPPA 1Z6EA
chains in the Genus database with same CATH superfamily
3TITA 1YPEH 4WMEA 4CRDA 3TGKE 1TX6A 2OC0A 3S7KB 4IMZA 1Y3YA 3U8OH 4AG2A 5EJZA 2BB4A 4YTAA 1WTHD 1QB9A 2IPHA 1EAWA 4NA8A 1LCYA 1WU1A 1NRRH 1Y3VA 1BTWA 3Q3YA 1TNLA 3IG6B 4DY7B 3LC5A 3SI4H 1T4UH 5DGJA 1DSUA 1ZJDA 2EI7A 4WWYA 4AOQA 3F0PA 2TPIZ 3MOCA 3N7EA 2WINI 4I8LA 3M5NA 1EZUC 2TGTA 3WY8A 1V2QT 1ARBA 1TMUH 3A7WA 2ZFRH 4XBCA 1DUAA 4NSYA 2G5NA 3C27B 4GCHF 2BX3A 1O3AA 1PYTC 8KME2 1IHSH 1DDJA 1GJ7B 3E1XB 5JBBS 1A0JA 1RIWB 3A8AA 4CBNA 3PWBA 2HNTE 3SNCA 3B8JA 1YPHE 2CK3D 2A31A 2R0KA 4J2YB 4OS2A 2JH0D 1J14A 3ZZ5A 1ZSLA 2A45B 4AGKA 2QXGA 3SJOA 1SLVB 4BTIB 3KYGA 1MTNC 1QRWA 4I33A 3SGQE 3GY5A 2C3SA 4LK4A 3N99A 3Q00A 1QB1A 2DE8A 5E2OA 4YOIA 1C5NH 3VFEA 3MFJA 1GMHG 1BTHH 4Q7YA 1PPHE 4DIIH 3M37A 2FOCA 3MU8A 1UTKA 3EQ0H 4F55A 1S84A 1P12E 4X6OA 3SN8A 1GJ6A 6GCHG 3SV8A 1UVTH 1TPOA 1HAZB 1Y5AT 4KTCA 4AYYB 1MZAA 4IBLH 1LPKB 4SGBE 1O2XA 4B71A 1O2IA 2SGEE 3K65B 8ESTE 2VVVA 3URCA 2VWMA 4A1VA 2PKAB 1O3CA 2AYWA 1XVMA 4ASHA 3LPRA 5HKKD 5GCHG 3T26A 1GCTB 5F8ZA 2ANKH 1SGFG 3VB4A 3UNRA 1GBLA 2JIZD 1NO9H 5GPIB 1DLKB 2GX4A 5TJXA 3A7TA 1UCYH 3FFGA 5HGGA 3SUEA 2ILNA 2R0LA 1FY1A 1C5OH 1BRBE 3VEQB 1QRZA 2PSYA 1A1RA 5AFZH 4YM9A 1K1OA 2M5TA 1ZMLA 1AMHA 5GIBA 3K9XB 3PLKA 3TJVA 3RXBA 1UTMA 1BJVA 3ATMA 2WPLS 4O9VA 1JXPA 1V2MT 5AFYH 1UHBB 2JJ2D 2KCPA 2BOKA 1DICA 1O3FA 1LHCH 2XBVA 5DJ7A 1C5XB 1Z8RA 1OX1A 1P09A 3RM0H 1DWCH 3OY5U 3RXMA 1ELCA 1AZ8A 2VB0A 3SZEA 1CT2E 1Z6JH 2ZU2A 1TBZH 3ZZCA 1EOJA 1KY9A 3TPIZ 4X1RU 2GCHF 3F2FA 4NIVA 1EATA 1EASA 3E8LA 3QO6A 4IN1A 5JDUB 3QUMP 1OP8A 2GV6A 1FX0B 1PPGE 3GS9A 4H6TA 3TGIE 1SGQE 1T7CA 5E0HA 4GUXA 3VB5A 1P2IA 5K7RA 4K8YA 1MQ6A 3FZDA 1EPTA 4FUJA 1XUFA 1A5IA 1K1IA 2FM2A 2ULLA 1G9IE 2VGCC 1WYKA 2EY4C 3BTTE 1DXPA 2QGRA 5AHGH 2SFAA 1F5RA 1W10U 1C1RA 4GLYA 2B0FA 4YOGA 1YKTA 1RJXB 4F49A 4X1SU 2STAE 2C8ZB 2WZQA 5FX5A 1C2KA 5JBAS 2PHBA 5GJ4B 4X2VA 1UTLM 4X2WA 2V3OH 2FXRA 1ELGA 1ELVA 2V3HH 3NCLA 2NU1E 3MU4A 1AVGH 2A1DB 1D4PB 4YO9A 1DITH 1E37B 2H9TH 2XNDD 2PW8H 3O8DA 4UFEH 5E8EH 1AD8H 4DJZB 3RLYH 3RXTA 2GV7A 1ZPZA 4NZQA 2J95A 3UAIC 1SBWA 1MD7A 1KLJH 4ABEA 3ZZ7A 1O3IA 1VCQA 1GL1A 4H6SB 3RM2H 4Q2KA 3KNXA 1VJ9U 3T27A 1WAYB 1XX9A 5LPRA 5FPYA 3S9CA 3QGNB 1O2UA 2O8TA 1HCGA 1NRQH 2R9PA 1C2MA 3E16B 5EXNA 4HI3A 1BCUH 1DVAH 2JKHA 4KELA 1J17T 2HLCA 3QK1A 1JMOH 1P02A 1K21H 4PROA 3K2UA 1TOMH 1TRYA 4FVBA 2PFEA 2OBOA 1TRMA 3WWFA 1IQMA 5L30H 4JK6A 5T1VA 1O3MA 1E79D 1QJ7B 2BXTH 2C8WB 1GI8B 3SYJA 3UNSA 1F0UA 2ODYB 1GG6B 2Y7ZA 4NZLA 3SJKA 1MBQA 2EA3A 6CHAC 4DT4A 3ZZ8A 3F9GA 2AERH 2ASUB 4X1QU 5F53A 3T5FH 4BAQB 3ZZ6A 1NROH 3A7VA 4ABGA 1EFRD 5IK2D 1QBNA 3D62A 2P93A 1PPCE 3RXAA 1ANCA 4AX9H 1AWFH 2QN5T 1ZRBA 4AYVB 2WV9A 1FAXA 3MH6A 1ZMJA 2OCVB 1MU6B 4CRGA 2F4LA 1OWIA 4OGYA 5A2MH 1UVSH 3RXOA 1GMCF 2ZDNA 2UWLA 2A32A 4O03A 1JIMA 2QXHA 2KCAA 3E91A 1HAIH 3SI3H 4OS1A 3UOUA 1E34B 3MNBA 1FN8A 4ZHLU 1SR5C 1P2QA 5CHAC 3AVZA 2ZDLA 5IDKA 2WPIS 4BTTB 1IQKA 2PGQB 3AW1A 5EW2H 2FIRH 2XBWA 1LPGB 1GDQA 4ABBA 3RMLH 2A4GA 4MG3A 2VVCA 4B76A 2ZFQH 2XYAA 1K9OE 2FWWA 2ZFTA 2XTTB 4AB9A 4XE4A 1BHXF 2KZ4A 2BY7X 1V2KT 4A7IB 4A5TS 2WUCA 1P3CA 1W14U 1KLIH 4ACBA 3NKKA 3ZZ3A 1IQJA 1NRSH 2Q6GA 5KECA 3P8NA 1EAIA 4FU7A 1S0RA 1GBHA 3H5CB 1A5HA 1TLDA 1UCYK 2WPDD 3FP6E 2F43B 2ZZUH 4TY6A 4O3UA 4ASUD 1MKXH 1HUTH 1V2PT 2TIOA 2A0QB 3RXFA 3TK5A 1FQ3A 1AU8A 4ZAEA 4UE7H 1GBJA 2ZC9H 4HZHA 2QF4A 4A6LA 4H42U 3BG4C 3S7HB 2V7QD 2IOTA 5I46H 1YY3A 1EKBB 1TNGA 1SG8B 4ZHAA 4ABAA 2VH0A 2ZF0H 1PQ7A 1BMFD 2OINA 3P6ZB 3GOVB 3EE0B 1T4VH 4BAMB 1GHBF 1B0EA 1KXAA 2VIPA 1MTUA 1P10A 1OWJA 2JDID 1SVPA 1G3BA 1SSXA 2P8OB 2K1QA 1A4WH 3NZIA 3RXCA 5EODA 4CHAB 4I86A 2PGBB 3A81A 2XCNA 4LXBH 1O38A 3BTGE 5T6FA 1GJ4H 1H8ED 1A7SA 3U8TH 4ABIA 3UB0A 2G00A 4YOJA 3Q3KA 2F9BH 1MUEB 2AMPA 3JZ1B 1Z8IB 2GMTC 3ZVGA 1SGEE 1O3JA 1QA0A 2SGDE 3SU2A 4FU9A 2P3UB 1BTUA 4YT6H 3MO9A 1OWEA 1FJSA 2SGQE 2J98B 2FPZA 1GI5A 3E3TA 3VGCC 2QCYA 1NBMD 1K1PA 3A7YA 3U1IB 1M9UA 2KFWA 2ZHEH 4BXWA 5L2ZH 5CHAB 2PKAA 2H2ZA 3RXGA 4JYVH 3LGVA 4ZHMU 4GHTA 1V2OT 2IJOB 3BTME 2Z3EA 4AC9A 4CH8B 1BHXB 4BAKB 2VIVA 2XOKD 2LNCA 5F8TA 4CH2B 1TNHA 3PO1C 1E35B 3F68H 5HXFA 2FODA 1THSH 1O36A 5LGOA 2UUJB 1FY3A 3S0NA 4RT0A 3BF6H 4OS7A 3D65E 1O3DA 3U8RH 1C5UA 5DP5A 5FHTA 2P3TB 2D1JA 1TGCA 1LHFH 2F91A 1QL9A 2XWBI 3P8OA 1UK3A 1C2GA 2ZFSA 3MNSA 1HXEH 5EW1H 2A4QA 2CJIA 2ZHQH 3BN9A 4Y11E 1LVYA 4SGAE 3A80A 3A8BA 1SMFE 1YCPK 1F0TA 1GBIA 2GZ9A 3M7TA 4I8HA 2ZU4A 1H4WA 1CO7E 3LIWA 1W2KH 2XCFA 4GSOA 3OY6U 1FY5A 2AIQA 2Y82A 1C4Y2 1OSSA 4TWYA 2BDCA 1TAWA 2PR3A 1A3BH 2OC8A 5EQQA 2Y81A 1BRUP 5L2YH 1BIOA 2NWNA 3HK6B 3ZZDA 5B6LA 3WWBA 3BTKE 3ATWA 5EPYA 1WXRA 2A4OA 4Y0YE 1UJ1A 1ELBA 1YC0A 4E06H 5JPMH 2BD9A 3ZYDA 3B9FH 5FAHA 1GCDA 1SGTA 1V3XA 2J98A 3M3TA 5LPFA 1AHTH 1G3CA 1MAXA 3SORA 5A0CA 1ZMNA 2RA0A 3ZVDA 4ZROA 4JCNA 4D7FA 1P2JA 2VIDA 1F5LA 4ISOA 4WVPE 2EQNA 1BTXA 4Y8ZA 1DWEH 4R8TB 3KL6A 5C5OA 1NC6A 2TGAA 3Q3XA 4RKOB 2A7HA 2W3IA 1Y8TA 4IMQA 3DFJA 3RU4E 1ESTA 1SGYE 5HM9A 1V2UT 1YLNA 3A88A 2ZFFH 6LPRA 1HIAB 2FEQH 2PWXA 2GDEH 1GJ9B 1O2ZA 1T8LA 2GCTB 4CR5A 3KCGH 1LHEH 1W0JD 9LPRA 2NU3E 2V3MA 1OKXA 1SPJA 1SQOA 2BDAA 5EJ1A 4GCHG 3NXPA 3S69A 3RXKA 1NU9A 3UNQA 1O3NA 2QC2A 1TYNA 3LGIA 1ELDE 1JRTA 2Z6BD 1IQIA 4H4FA 1KXDA 3GISB 5T6GA 1P2OA 2ODQA 1BDAA 1IOEA 1RGQA 1ZPBA 2BZ6H 3GDUA 4U30A 3GY8A 1GVLA 5T6DA 3QDZB 1FPCH 2BVRH 4Y0ZE 1AI8H 1W0ZU 1PPEE 3AAVA 5A0BA 2P59A 1BBRE 1TNJA 2FLBH 2FOAA 1EP6A 3HPTB 1O2MA 1SGCA 3PM3A 4Y7AA 1ZRKA 2O9QA 4XBBA 1YLDA 5DSFA 3F6UH 2FZZA 1P01A 2Z9GA 5FL7D 3EGKH 2ZHDA 1C5VA 8GCHG 2QF3A 1UO6A 2D26C 3DCLA 2Q1JA 3MWIU 3A84A 2LP6A 1EAUA 2GT8A 3RMMH 1SB1H 3MU1A 3O8CA 1GMCG 4VGCC 3RMOH 3A8DA 3ATLA 3TLOA 1Y3WA 1ZSJA 2STBE 3RC6A 1N8OC 5A8YA 1N6YA 4XDEA 4MQAA 2H5DA 3MU0A 1W7XH 4GHQA 1F92A 1HJAB 3T25A 3QLPH 1J15A 4CBOA 1DUEA 1DXWA 3SU5A 1LVBA 1GI2A 1Z1IA 4NFEA 1TMTH 4U01A 2QA9E 4FUEA 1O5EH 1E0FD 3TH4H 2XC0A 1YPMH 2A5KA 1QZ8A 1TX8A 3MMGA 1DWDH 2V35A 3BTDE 1GHZA 3UY9A 1TQ7B 3G01A 2FMJA 1H9LB 2QAAA 1TA2A 4RKJB 1GVZA 2V0BA 3TJUA 3VGCB 1C1NA 3ZZ4A 3KQBA 5A8ZA 1VZQH 2IJD1 4OS4A 3TK6A 3SJ8A 4YZUA 2HPQH 3F3BA 2VVUA 4Y7BA 3RU4T 3LJJA 1EZXC 1D3QB 1O37A 4WXIA 5F03A 5HM2A 2GMTB 2XC5A 4INKA 3SV2H 2AGEX 1H9IE 2Y6TA 1W13U 1QL8A 2OQ5A 3ZV9A 4Y8YA 2M2AA 1O5DH 3QZRA 1ANBA 3P17H 3PRBA 4CHAC 1QTFA 2BD5A 2Y5FA 1EP5A 3SGAE 4B73A 1P9SA 2SGPE 1V2NT 5E0JA 1G32B 1CBWC 1EOLA 2GZ7A 1D6RA 3LH3A 5C0UA 4MDSA 1LVMA 2BDIA 4RI0A 2W7SA 3UIRA 3UWJH 1GMDG 2VU8E 4FOUC 2V6NA 4FETA 3DUXH 3SV6A 3LH1A 2BLOA 2EI6A 1ZYOA 1K2I1 3MI4A 1SGDE 3LGYA 2J97A 1WCZA 2K8IA 2QF5A 2W26A 2J94A 4B75A 3M3SA 1C2LA 1C2IA 3T28A 2ZTYA 1S5SA 4MPUA 4ZXYH 3A89A 4OM9A 3VB3A 2FDAA 3ZYEA 1QB6A 1A3EH 1WOFA 2RA3A 1G2MA 1PJPA 1MTSA 2YMSD 5BRRE 1GDUA 1P06A 4DGJA 1LHDH 2QY0B 1GJ5H 4JZEH 1GGDB 1DY9A 2TRMA 3LDXH 4FUFA 6CHAB 1RTLA 1SQAA 2BLVA 3V0XA 1ELEE 3PMBB 2OUAA 1BMNH 1AUTC 1ELFA 3DSGA 2ZI2H 3STIA 1TBRH 1WTGH 1BQYA 1HJAC 2IPQX 2W3KA 4E7NA 5TCAA 4KKDA 1GHYH 2Z3CA 1K0HA 1MH0A 2GTBA 3T29A 2CHAC 2SGFE 3EYDA 5C1YA 1O2KA 3ZV8A 2AH4X 5F6MA 1E1RD 2PLXA 3VPKA 1BZXE 1O2QA 1C1OA 1BMLA 3EA8A 5C17A 1F5KU 1S6LA 1KXEA 3E90B 3OTJE 3QGJA 1L2EA 1FLEE 1SOTA 2WUBA 5DP7A 4UFGH 3RXUA 1YYY1 1GI1A 3SNAA 1B0FA 4KTSA 3RXIA 1ZGVA 2RDLA 1UTJA 4X2YA 2KCYA 3F2GA 1HXFH 1BT7A 5E2PA 2ZTZA 5C1XA 1LVOA 1T32A 4KP0A 1EB2A 1BJUA 1IQNA 1UHBA 3ESTA 3GDSA 3QN7A 1VR1H 2H6MA 3F9EA 2OC1A 1QCPA 1XVOA 1D9IA 1ELAA 3ZZ9A 1C1WH 2UUYA 2G4TA 1EXFA 1PQ8A 3RLWH 5C20A 3WW7A 3FKSD 2FI5E 4RN6A 4HG6A 2OC7A 4XD7D 2R3UA 1RXPA 1CA0C 5JYIA 4BAHB 3SUDA 2F83A 2FS9A 1VCWA 1BTPA 2G8TA 3M35A 3LKWA 4YLQH 5KEDA 3F9FA 2UUFB 6GCHF 3U69H 1W12U 2D2DA 2KAIA 1N1LA 2BVXH 3V7TA 3V3MA 4LZ1H 2VGCB 5FXLA 1SGRE 1ANDA 5EIYA 5GCHF 1C2JA 4OS5A 1OXGA 2ZHFH 5TCCA 4Z1MD 1TALA 1YCPM 1EZQA 1TABE 1YPKH 4M7GA 3UR9A 1KSNA 1GBTA 3A86A 1S85A 3H7OA 1CHOF 1BA8B 1LKAA 1O3BA 3KEEA 5GXPA 1DLEA 2KM0A 1OYTH 4JMYA 1O2HA 1GHVH 1C4U2 2Z7FE 3JZ2B 3OX7U 3MH4A 3GYMA 3P8GA 1NY22 4CR9A 1HAPH 4BXSA 1LQDB 2ZP0H 4X6MA 3PMJA 3HATH 4CRFA 1H8IH 3UUZA 1S83A 3TNSA 1GJ8B 3FZZA 2RCEA 2WV5A 3OAAD 4UFDH 1AIXH 1C9PA 2FOEA 3GCOA 3L3TA 5HMAA 1ARCA 2YNAA 4CRCA 2Y80A 3M36A 4WF8A 1FIWA 1EJNA 3MO3A 3M5OA 4MTBA 1AKSB 1HRTH 1MKXK 3SUGA 2O8WA 4TPIZ 3DFLA 3R0FA 3FOAA 2PTCE 1SFQB 2NU4E 3SNDA 1VITH 3D23A 5B6OA 5LPEA 1SGPE 4X1PU 1E1QD 1RTFB 2ZU5A 2ZDMA 3PMHB 1C1UH 1J8AA 2OTVA 2BHGA 5FPTA 1GJDB 1B7XB 1PPBH 1ELTA 5EQRA 1C9TA 1W3CA 3BEUA 2HRVA 1L4DA 3MYWA 4X8VH 3ZVBA 2B9LA 2WSSD 1P03A 2YNBA 2H5CA 3SUFA 1P05A 1LQEA 3RMNH 1ZPCA 1C4V2 1THPB 7KMEH 1XUJA 1HLTH 2YMSB 3TJNA 2J4IA 3MTYA 5EXMA 3OU0A 7GCHF 4ABJA 4IW4E 1MMJN 2ZQ2A 4ABDA 1EUFA 2C4FH 2QXIA 1NT1A 3EDXB 1BITA 3SJIA 4YXWD 1T8MA 1LMWB 3H09A 1L1JA 2L6OA 2JETC 1EZSC 2NU2E 2F9UA 3KQCA 5FCKA 1C1MA 1LDTT 4WH6A 1EJAA 3QTOH 3UTUH 1QJ6B 5GNDA 2BD7A 2ANMH 4NG9H 3AK5A 1WQVH 1ZTJA 2VBCA 3I77A 1XM1A 2ZGXH 1AO5A 1MKWK 1S82A 3BEIB 2ZDAH 1TGBA 3URDA 2GVFA 1O5BB 5DG6A 1AE5A 2A7CA 2BXUH 4NA9H 3RU4D 1XMNB 4K1EA 5L6NH 1YP9A 1O5GH 1UTPA 1NN6A 2OK5A 1QHRB 4X8UH 2AEIH 4A1TA 3CS0A 4AFSA 3C1KA 3BIVH 4Y71A 1BUIA 3UOPA 3D49H 2CF8H 1KXCA 3PLBA 1VKYA 1J16A 3DT0H 4ISIH 1EX3A 2J38A 2ZKSA 3VXFH 2XC4A 1LTOA 4DVAU 1HBTH 4Y8XA 2WPHS 5T3HA 3V12A 5LH8A 1OOKB 2BD3A 4NIXA 2BD8A 2FESH 1IQEA 2AHME 2FI4E 3LC3A 4QT8C 4B2AA 1E38B 2HPPH 3W94A 3EA7A 1GI4A 2VIQA 1PPFE 1KDQB 5CHBA 4XRNA 2KX4A 4K8BA 2BDBA 2P8OC 3LOXA 3BIUH 3TIUA 5JBCS 1TBQH 1P2NA 2G5VA 1XUHA 5C67A 1RIWC 2ZTXA 1CGIE 2D8WA 4MVNA 1MTNB 1AB9C 1O34A 1PYTD 4DOQA 1A5GH 1CA0B 5DP9A 2CXVA 3BTWE 5DP3A 3SNEA 2HVYB 1HAXB 1FV9A 4ACAA 1NFUA 1D3DB 2BX4A 1ZLRA 4Q4LA 1EB1H 1D3TB 5DKMA 4BOHA 3GCNA 1MZDA 4FU8A 1OS8A 3SU4A 1RRKA 2B7DH 1HAOH 4Z6AH 2QYIA 1IQGA 1C1TA 2FX4A 4Q7XA 1QBVH 5G4BA 1GJCB 2Z9LA 1C5ZB 4MPVA 1G3DA 4J1YA 1NRNH 2A5IA 3GCHC 3RUOA 1N6XA 1YWUA 5C1UA 2ALPA 2FYQA 3CENA 1YGCH 2ANWA 3A85A 1BMMH 1L0ZA 2ZIQH 3RXVA 1BBRK 4K1TA 2C90B 4Y6DA 2O8UA 3FO8D 1Z1JA 3T2NA 3L33A 2ZDVH 3HK3B 1O5AB 4YT7H 1FY4A 1GVKB 1YPHC 1CHOG 5HIYA 3E0PB 1VCPA 4ISLA 2AMQA 3MU5A 3ZIAD 3F0OA 2CHAB 3IWMA 4OGXA 3QTVH 2BY6X 2QF0A 3M5MA 2BD2A 5ETXA 2PKSB 1AE8H 1JOUB 3MH7A 1NFYA 4UEHH 1FZZA 3P70B 1Y5UT 1XXFA 4DW2U 1IAUA 1LO6A 4TYDA 1GBAA 2WV4A 1C5MD 4ISNA 1BMAA 3KN2A 1UK2A 4NIWA 1GG6C 1V6DA 3SQEE 3AAUA 3QZQA 3M5LA 8GCHF 2J34A 4K3JA 2YOLA 2GCHG 1NFXA 3FN8A 3QWCH 2F3CE 3U9AH 1AQ7A 2FS8A 1MD8A 1NS3A 1OWHA 1QGFA 3NUMA 1SHHB 4HTCH 5C5NA 4FVDA 1AFEH 4F48B 3AASA 3PWCA 1KXFA 4UFFH 1C5SA 1Z8JB 1A61H 2FYRA 3LGTA 1HJ9A 4KTUA 3PV4A 3RXDA 2BOHB 3UREA 2G52A 1O2NA 4UONA 2VJ1A 1KMHB 3LONA 2G4UA 1DPOA 1THRH 1ZJKA 4NSVA 1O3KA 1BBRH 3N7DA 2RFKC 1O2VA 1XUKA 1TIOA 1TONA 2GD4B 2F9OA 1TNIA 2WPJS 1OP0A 3MHWU 4P02A 5K0HA 3BG4B 4A1XA 4B2BA 1QY6A 2B8OH 3OTPA 5DP6A 4NFFA 3NWUA 3ODDA 1D6WA 2BM2A 2RDEA 2BVSH 3SNBA 1UVPA 2R3YA 2JETB 1MCVA 1NFWA 2UWPA 3L6PA 1ZTKA 2OLGA 2VINA 1OWKA 5F8XA 4MPWA 3GICB 4WY3A 1CT4E 4U2WA 1GI7B 2THFB 1O3HA 3NRLA 1F0RA 2TGPZ 5J4QA 2ZPQA 1K1JA 3M3VA 2FO9A 1O3PB 1CQQA 3IITA 4Z0KA 1Z8GA 1S0QA 1CHGA 1C1QA 3U98H 4RT1A 9ESTA 3B23B 1TRNA 2DUCA 3SW2B 2J2UA 2J5UA 3SZNA 3HGPA 2OQUA 4NWKA 3MH5A 1O3EA 1O0DH 3KQ5A 4X0WU 1SLXB 4E7RG 2ZU3A 4YLUA 2YMSC 3VB7A 3ZVFA 1DY8A 1SOZA 2A5AA 1BB0B 1W11U 3M7QA 1DANH 3ZVAA 1JBUH 3PRDA 4AORA 1GBDA 2OXSA 3K6YA 4WJG2 3LU9B 1MTVA 4BNRA 2BTCE 4FUBA 3ENSB 1CSOE 1C5QA 1XXDA 3BEFB 1O2WA 1RFNA 4AB8A 2P16A 2ZPSA 1YLCA 3SGBE 4E05H 2BY9X 3KQEA 3SQHE 1MAYA 1KIGH 1C2EA 1VJAU 3HKIB 1AN1E 4ZH8A 2SNWA 4DCDA 2C8XB 3LGWA 4XSKU 4ZKSU 1KLTA 5EQSA 4AN7A 3STJA 1HAVA 3TJOA 3CNRA 3OFND 3OE7D 5BPEA 1TGNA 1Q31A 1YPJH 4FXGH 1DOJA 2BY8X 4ABHA 1H1BA 2VIWA 1AUJA 3GY6A 3RXQA 1DE7H 4K1SA 2QIQA 5A8XA 5HIZA 3SHCH 1XKAC 3GY2A 3ITIA 4JZIA 3I29A 3ZVCA 5EG4A 2H9HA 3GY4A 1RTKA 3U28C 1T31A 4THNH 1IQLA 3V13A 2BDGA 2AMDA 1GBEA 1LHGH 1B5GH 2O8LA 1V2TT 2EC9H 4B6FA 2ZGBH 5IYTA 2ZG0H 4X8TH 1O2LA 1HAGE 1YPLH 1Y3XA 2P94A 1SGNE 1GHWH 1QL7A 1TPAE 2BLQA 1C2FA 1ABIH 1NU7B 3FAOA 2EI8A 1GI0A 4P00A 3K6ZA 4BANB 1C5LH 1ZGIA 1Z7KA 2VNTA 4TT3D 1EQ9A 1DSTA 2BQ7B 4UD9H 5C2ZA 8LPRA 4I8JA 1O2GH 4Q7ZA 1LPZB 2A2XH 3LJOA 5JB8S 3FVFB 1O2OA 4ISHH 1AZZA 1ZSKA 3ATIA 1ZOMA 1U6QA 3VXEH 4ZCNA 3OSYA 1QQUA 3FP8E 3BSQA 4JYUH 3M7UA 2G51A 3PTNA 4K69A 1C2HA 3GYLB 1C5YB 1ID5H 4U32A 1VITG 1FN6A 1XKBC 5KGOA 2BY5X 4I32A 4NIYA 1K1MA 1UCYE 5FCRA 1COWD 1QIXB 1FY8E 1PQAA 1J9CH 2KAIB 4GPGA 1V2LT 2GGVB 4JZDH 1SI5H 2FI3E 1CGHA 1O3OA 1AWHB 1G30B 1GJBB 3F2HA 3DD2H 2FOBA 4I8KA 1HIAA 5FX6A 4WXVA 5DK1A 2Y7XA 1HAVB 3LT3A 1X7AC 1HAHH 1G3EA 1P11E 1ESBA 2XW9A 1O3LA 4Q80A 5A0AE 4X2XA 3S9AA 2ZFPH 1CA8B 5ESBA 3UPEA 4WH8A 4AG1A 1WV7H 2BDYA 4LZ4B 3NK8A 3MNCA 4FUHA 5C94A 1GBMA 4MLFB 2B5TB 3RXEA 2PKSC 4R0IA 3HGNA 1SKYE 1TGSZ 1ZTLA 4YESB 1ETTH 1SLWB 4CRAA 3PYHA 3NPSA 4TPYA 4INHA 1CGJE 1DX5M 1NRPH 1WDIA 1SLUB 1GI9B 2QV1A 1L1NA 4AFZA 1OYQA 4ZXXH 3BG8A 1L4ZA 1BTYA 1GGDC 1QNJA 2FOFA 2GZ8A 4X1NU 3RXSA 3PV2A 3OYPA 2ZCKP 4IS5A 1CE5A 4JYTA 1SHYA 3F1SB 2W6JD 3GCHB 3QX5H 1EJMA 4IC6A 5FBIA 1F7ZA 1UVOA 1O39A 2Z9IA 3A8CA 1MCTA 4IN2A 2GJGA 2ZA5A 1ZHRA 2PP6A 3A82A 2VWLA 2FTMA 3PV5A 1MQ5A 3PO1B 2A7JA 4WMDA 1WUNH 3OEED 1UW7A 1Z71A 1SQTA 1P9UA 2XWAA 1GCTC 2W6ID 1OPHB 3EA9A 4D76A 1GHXH 2BDHA 1TMBH 3F9HA 1DWBH 3RC5A 3E0NB 1MKWH 3A7XA 1TPSA 3UWIA 1HDTH 2ZWLH 3HKJB 1BRAA 3BTFE 3RXRA 1C5PA 2XBXA 2VIOA 4O97A 3SOSA 1GMHF 1S6FA 2HGTH 2TGDA 4HFPB 1W0KD 1CT0E 4DURA 3TNTA 3BTHE 1L1GA 2Z3DA 2ZQ1A 1W7GH 3GCTG 3ZZBA 2BYAX 5I25A 1O2PA 1C5RA 1CVWH 1C5TA 3DA9B 5EU8A 3VB6A 3TH2H 3UR6A 5JB9S 4X8SH 1A0LA 1ZHPA 4NGAH 3RXLA 1T8OA 5H4IB 1G36A 1K1LA 4D9QA 2JH5D 1GBKA 1SFIA 4INLA 5DN6D 2P3FH 1G37A 2ZPRA 5DP4A 3T62A 2F9PA 1K22H 1NPMA 5EPNA 1SQRA 3TK9A 3ZZAA 1K1NA 3EE7A 1UMAH 1O31A 2XNIA 4I8GA 3BTEE 2NU0E 1SL3A 3CP7A 1ORFA 1O5FH 1H8DH 1V2ST 2ZGHA 3ELAH 5CE1A 4VGCB 4OS6A 4AFUA 1JWTA 4B6EA 1WQSA 2ANYA 2ZGCA 3FANA 3SV9A 4IC5A 2CMYA 1EPTB 1QJ1B 2Z94A 3LGUA 5AVDA 1HPGA 1S6HA 1GHAG 1AVXA 5C3NA 2PUQH 2GP9B 4B74A 1PPZA 2OP9A 3TGJE 2J92A 3TH3H 4AGJA 4DG4A 2P95A 4AFQA 3O8BA 2W7UA 3BTQE 1DM4B 1ABJH 1V2JT 2OD3B 5EGMA 5FPSA 1ZR0A 2WPKS 1TQ0B 3MNXA 1JRSA 1RS0A 3KQDA 5E0GA 1Y59T 2HNTF 1QRXA 1KXBA 3S9BA 3MQKC 3UFAA 3BV9B 3P95A 1GL0E 4K5ZA 1HGTH 3ATKA 2Q6FA 1INCA 2Y5HA 7LPRA 4WMFA 3H7TA 1UTOA 3VG8A 3SO3A 1ACBE 1MU8B 2XBYA 2ZCHP 1GI6A 2F9VA 3SU6A 1O2TA 3KYFA 2JH6D 1GHBG 2AGGX 1AFQB 1QFKH 2BQ6B 3A87A 2PV9B 5SGAE 2WHXA 1HYLA 2LELA 5DO4H 1IHTH 1IQHA 1P3EA 3FP7E 2G81E 3SV7A 1O2YA 3EAJA 1UTQA 1GMDF 4B1TA 1C1SA 3SU0A 3RP2A 1HNEE 1JIRA 1MBMA 2QXJA 2GCTC 3N7OA 2WYGA 1EAXA 1TX7A 1H9HE 1VGCB 4FUIA 1FUJA 2AGIX 1NZQH 1A0HB 4ZKRU 1C1VH 1AGJA 1V2RT 4MNVA 4TSFD 1FDPA 4FUGA 1XUIA 5ABWA 4JZFH 1FAKH 3A7ZA 5CDFE 1T8NA 7GCHG 3OEHD 1FNIA 4CREA 1FMGA 1OP2A 2FLRH 1P04A 1GBFA 3ODFA 1YCPH 4FUDA 1YBWA 4MPXA 1GJAB 1ETSH 2WPMS 4D7GA 3SU3A 2BD4A 2DE9A 2PUXB 2ZECA 1OWDA 1O30A 4Q63A 5PTPA 2ZGJA 1HFDA 3DSPA 1LKBA 4ZKNU 7ESTE 2AFQB 1BRCE 1IQFA 3KHVA 1A2CH 2WYJA 2CN0H 2GDDA 3RDZA 1AVWA 1W8BH 2ZHWH 2ZO3H 2CV3A 2FOHA 1GBCA 2ZCLP 2C93B 1MABB 1G2LA 1C5WB 3DSOA 1GDNA 1TFXA 4F4OC 2Q6DA 2KR7A 2GT7A 1V2VT 3I78A 2H1UA 2K0QA 2IN2A 1HB0B 6ESTA 5ESTE 5FBEA 1Y5BT 3GY7A 2A4RA 1O2SA 5JBTA 2HWLB 4ZUHA 2H9EH 3M61U 5AF9H 2BMGB 3U1JB 4UDWH 4I31A 1O5CB 2ESTE 2BLWA 4XFQA 1TOCB 4XOJA 1TNKA 1PFXC 1SGIB 1YPGH 1BTZA 4Y10E 3KGPA 1S81A 2HALA 2HNTC 1QR3E 2G55A 1QURH 1DS2E 1EPTC 1GPZA 3SBKA 1KYNA 2ZEBA 4XBDA 2I6SA 1YF4A 1Y3UA 5DPAA 3TVJB 1P0SH 5DP8A 4IGDA 2A2QH 4MNWA 3RXHA 1NTPA 1TE0A 1FONA 1CU1A 2ZDKA 4ZKOU 2FP7B 1AKSA 2AS9A 1AY6H 2Y5GA 2Z9KA 5GWZA 1V2WT 4TY7A 3UQOA 3E6PH 3O8RA 1F2SE 1ZZZA 1ESAA 1HV7A 4GVUA 2GKVE 2O8MA 3Q76A 4Y76A 4NWLA 1NESE 4A92A 4CRBA 3SJ9A 4AZ2B 4M9FA 1GHAF 1H8HD 1P2KA 2R2WU 2SNVA 1W0YH 1XUGA 1AB9B 2AIPA 1O32A 2JJ1D 4RSPA 1QBOA 1D3PB 4Y79A 2XRCA 1RD3B 3W1EA 2EEKA 4FUCA 1QQ4A 3A83A 1A46H 2HVXA 2BZAA 3CS7A 1NM6A 2TBSA 1TWXB 1C1PA 2BQWB 1MTWA 3GDVA 3RC4A 4NCYA 3Q77A 4B2CA 5EOKA 1UTNA 1F0SA 2KCOA 1K28D 1UK4A 2Z9JA 3ZVEA 3KF2A 4I7YH 4K60A 4ESTE 1GWAA 1O33A 1TA6A 1P57B 1O2RA 2VWNA 1KTSB 1BOQA 4KGAA 2FX6A 2SGAA 4DT7B 1O2JA 4LOYH 4X6NA 1FPHH 1TGTA 3P92A 3GY3A 1O35A 1FI8A 3SU1A 1CBWB 1DFPA 2XXLA 3R3GB 5EXLA 4D9RA 3DHKH 2VWOA 1FIZA 2HOBA 1KDQA 1HJ8A 3MO6A 1KTTB 1TB6H 2PSXA 3GCTF 1NBME 4JZ1A 4TWWA 4BAOB 1Q2WA 2VH6A 3W95A 2LPRA 1N8OB 1QA7A 1VGCC 3P8FA 2HLDD 2FOGA 4MNXA 1YM0A 1ANEA 2UWOA 2ALVA 4NA7A 5GDSH 1VITF 1P2MA 1FXYA 1P8VC 3AW0A 3PLPA 2F9NA 4D8NA 1SGFA 1GI3A 4GAWA 1WSSH 4ABFA 5C0TA 3UQVA 3PROA 4K2YA 1O3GA 1UVUH 1AFQC 1OHHD 2W5EA 1GBBA 3RXJA 1C2DA 4X6PA 2CGAA 1PQ5A 3SHAH 1DT2A 5EJLA 3PB1E 2ZU1A 4HGCA 5CMXH 1E36B 3KIDU 1Q3XA 2ODPA 4BTUB 2FTLE 5J4SA 4O3TA 2PTNA 5HYOA 2C8YB 1HAYB 5A09A 4JK5A 2FOMB 2L74A 2J9NA 2UUKB 2QE7D 1ZHMA 3PMAB 1WBGB 3PTBA 4MNYA 2R2MB 3RXPA 3TU7H 2CF9H 2I6QA 4ZMAH 4DIHH 2ZNKH 1ETRH 1SC8U 2RG3A 2OBQA 1TPPA 1Z6EA
chains in the Genus database with same CATH topology
3TITA 1YPEH 4WMEA 4CRDA 3TGKE 1TX6A 2OC0A 3S7KB 4IMZA 1Y3YA 3U8OH 4AG2A 2BB4A 4YTAA 1WTHD 1QB9A 2IPHA 1EAWA 4NA8A 1LCYA 1WU1A 1NRRH 1Y3VA 1BTWA 3Q3YA 1TNLA 3IG6B 4DY7B 3LC5A 3SI4H 1T4UH 5DGJA 1DSUA 1ZJDA 2EI7A 4WWYA 4AOQA 2TPIZ 3MOCA 2WINI 4I8LA 3M5NA 1EZUC 2TGTA 3WY8A 1V2QT 1ARBA 1TMUH 3A7WA 2ZFRH 4XBCA 1DUAA 4NSYA 2G5NA 3C27B 4GCHF 2BX3A 1O3AA 1PYTC 8KME2 1IHSH 1DDJA 1GJ7B 3E1XB 5JBBS 1A0JA 1RIWB 3A8AA 4CBNA 3PWBA 2HNTE 3SNCA 3B8JA 1YPHE 2A31A 2R0KA 4J2YB 4OS2A 2JH0D 1J14A 3ZZ5A 1ZSLA 2A45B 4AGKA 2QXGA 3SJOA 1SLVB 4BTIB 1MTNC 1QRWA 4I33A 3SGQE 3GY5A 2C3SA 4LK4A 3Q00A 1QB1A 2DE8A 5E2OA 4YOIA 1C5NH 3VFEA 3MFJA 1GMHG 1BTHH 4Q7YA 1PPHE 4DIIH 3M37A 2FOCA 3MU8A 1UTKA 3EQ0H 1S84A 1P12E 4X6OA 3SN8A 1GJ6A 6GCHG 3SV8A 1UVTH 1TPOA 1HAZB 1Y5AT 4KTCA 4AYYB 1MZAA 4IBLH 1LPKB 4SGBE 1O2XA 4B71A 1O2IA 2SGEE 3K65B 8ESTE 2VVVA 3URCA 2VWMA 4A1VA 2PKAB 1O3CA 2AYWA 1XVMA 4ASHA 3LPRA 5GCHG 3T26A 1GCTB 5F8ZA 2ANKH 1SGFG 3VB4A 3UNRA 1GBLA 1NO9H 5GPIB 1DLKB 2GX4A 5TJXA 3A7TA 1UCYH 3FFGA 5HGGA 3SUEA 2ILNA 2R0LA 1FY1A 1C5OH 1BRBE 3VEQB 1QRZA 2PSYA 1A1RA 5AFZH 4YM9A 1K1OA 2M5TA 1ZMLA 1AMHA 5GIBA 3K9XB 3PLKA 3TJVA 3RXBA 1UTMA 1BJVA 3ATMA 2WPLS 4O9VA 1JXPA 1V2MT 5AFYH 1UHBB 2BOKA 1DICA 1O3FA 1LHCH 2XBVA 5DJ7A 1C5XB 1Z8RA 1OX1A 1P09A 3RM0H 1DWCH 3OY5U 3RXMA 1ELCA 1AZ8A 2VB0A 1CT2E 1Z6JH 2ZU2A 1TBZH 3ZZCA 1EOJA 1KY9A 3TPIZ 4X1RU 2GCHF 4NIVA 1EATA 1EASA 3E8LA 3QO6A 4IN1A 5JDUB 3QUMP 1OP8A 2GV6A 3TGIE 1PPGE 4H6TA 1SGQE 1T7CA 5E0HA 4GUXA 3VB5A 1P2IA 5K7RA 4K8YA 1MQ6A 3FZDA 1EPTA 4FUJA 1XUFA 1A5IA 1K1IA 2FM2A 2ULLA 1G9IE 2VGCC 1WYKA 3BTTE 1DXPA 2QGRA 5AHGH 2SFAA 1F5RA 1W10U 1C1RA 4GLYA 2B0FA 4YOGA 1YKTA 1RJXB 4F49A 4X1SU 2STAE 2C8ZB 5FX5A 1C2KA 5JBAS 2PHBA 5GJ4B 4X2VA 1UTLM 4X2WA 2V3OH 2FXRA 1ELGA 1ELVA 2V3HH 3NCLA 2NU1E 3MU4A 1AVGH 2A1DB 1D4PB 4YO9A 1DITH 1E37B 2H9TH 3O8DA 2PW8H 4UFEH 5E8EH 1AD8H 4DJZB 3RLYH 3RXTA 2GV7A 1ZPZA 4NZQA 2J95A 1SBWA 1MD7A 1KLJH 4ABEA 3ZZ7A 1O3IA 1VCQA 1GL1A 4H6SB 3RM2H 4Q2KA 3KNXA 1VJ9U 3T27A 1WAYB 1XX9A 5LPRA 5FPYA 3S9CA 3QGNB 1O2UA 2O8TA 1HCGA 1NRQH 2R9PA 1C2MA 3E16B 5EXNA 4HI3A 1BCUH 1DVAH 2JKHA 4KELA 1J17T 2HLCA 3QK1A 1JMOH 1P02A 1K21H 4PROA 3K2UA 1TOMH 1TRYA 4FVBA 2PFEA 2OBOA 1TRMA 1IQMA 5L30H 4JK6A 1O3MA 1QJ7B 2BXTH 2C8WB 1GI8B 3UNSA 1F0UA 2ODYB 1GG6B 2Y7ZA 4NZLA 3SJKA 1MBQA 2EA3A 6CHAC 3ZZ8A 3F9GA 2AERH 2ASUB 4X1QU 3T5FH 4BAQB 3ZZ6A 1NROH 3A7VA 4ABGA 1QBNA 3D62A 2P93A 1PPCE 3RXAA 1ANCA 4AX9H 1AWFH 2QN5T 1ZRBA 4AYVB 1FAXA 3MH6A 1ZMJA 2OCVB 1MU6B 4CRGA 1OWIA 4OGYA 5A2MH 1UVSH 3RXOA 1GMCF 2ZDNA 2UWLA 2A32A 4O03A 1JIMA 2QXHA 3E91A 1HAIH 3SI3H 4OS1A 3UOUA 1E34B 3MNBA 1FN8A 4ZHLU 1SR5C 1P2QA 5CHAC 3AVZA 2ZDLA 5IDKA 2WPIS 4BTTB 1IQKA 2PGQB 3AW1A 5EW2H 2FIRH 2XBWA 1LPGB 1GDQA 4ABBA 3RMLH 2A4GA 4MG3A 2VVCA 4B76A 2ZFQH 2XYAA 1K9OE 2FWWA 2ZFTA 2XTTB 4AB9A 4XE4A 1BHXF 2BY7X 1V2KT 4A7IB 4A5TS 2WUCA 1P3CA 1W14U 1KLIH 3NKKA 3ZZ3A 1IQJA 1NRSH 2Q6GA 3P8NA 1EAIA 4FU7A 1S0RA 1GBHA 3H5CB 1A5HA 1TLDA 1UCYK 3FP6E 2ZZUH 4TY6A 4O3UA 1MKXH 1HUTH 1V2PT 2TIOA 2A0QB 3RXFA 3TK5A 1FQ3A 1AU8A 4ZAEA 4UE7H 1GBJA 2ZC9H 4HZHA 4A6LA 4H42U 3BG4C 3S7HB 2IOTA 5I46H 1EKBB 1TNGA 1SG8B 4ZHAA 4ABAA 2VH0A 2ZF0H 1PQ7A 2OINA 3P6ZB 3GOVB 3EE0B 1T4VH 4BAMB 1GHBF 2VIPA 1B0EA 1KXAA 1MTUA 1P10A 1OWJA 1SVPA 1G3BA 1SSXA 2P8OB 2K1QA 1A4WH 3NZIA 3RXCA 5EODA 4CHAB 2PGBB 3A81A 2XCNA 4LXBH 1O38A 3BTGE 5T6FA 1GJ4H 3U8TH 1A7SA 4ABIA 2G00A 4YOJA 3Q3KA 2F9BH 1MUEB 2AMPA 3JZ1B 1Z8IB 2GMTC 3ZVGA 1SGEE 1O3JA 1QA0A 2SGDE 3SU2A 4FU9A 2P3UB 1BTUA 4YT6H 3MO9A 1OWEA 1FJSA 2SGQE 2FPZA 1GI5A 3E3TA 3VGCC 2QCYA 3A7YA 1K1PA 3U1IB 1M9UA 2ZHEH 4BXWA 5L2ZH 5CHAB 2PKAA 2H2ZA 3RXGA 4JYVH 3LGVA 4ZHMU 4GHTA 1V2OT 2IJOB 3BTME 2Z3EA 4CH8B 1BHXB 4BAKB 2VIVA 2LNCA 5F8TA 4CH2B 1TNHA 3PO1C 1E35B 3F68H 5HXFA 2FODA 1THSH 1O36A 5LGOA 2UUJB 1FY3A 3S0NA 3BF6H 4OS7A 3D65E 1O3DA 3U8RH 1C5UA 5DP5A 5FHTA 2P3TB 2D1JA 1TGCA 1LHFH 2F91A 1QL9A 2XWBI 3P8OA 1UK3A 1C2GA 2ZFSA 3MNSA 1HXEH 5EW1H 2A4QA 2CJIA 2ZHQH 3BN9A 4Y11E 1LVYA 4SGAE 3A80A 3A8BA 1SMFE 1YCPK 1F0TA 1GBIA 2GZ9A 3M7TA 4I8HA 2ZU4A 1H4WA 1CO7E 3LIWA 1W2KH 2XCFA 4GSOA 3OY6U 1FY5A 2AIQA 2Y82A 1C4Y2 1OSSA 4TWYA 2BDCA 1TAWA 2PR3A 1A3BH 2OC8A 5EQQA 2Y81A 1BRUP 5L2YH 1BIOA 2NWNA 3HK6B 3ZZDA 3BTKE 3ATWA 5EPYA 2A4OA 4Y0YE 1UJ1A 1ELBA 1YC0A 4E06H 5JPMH 2BD9A 3ZYDA 3B9FH 5FAHA 1GCDA 1SGTA 1V3XA 3M3TA 5LPFA 1AHTH 1G3CA 1MAXA 3SORA 5A0CA 1ZMNA 2RA0A 3ZVDA 4ZROA 4JCNA 4D7FA 1P2JA 2VIDA 1F5LA 4ISOA 4WVPE 4Y8ZA 1BTXA 1DWEH 4R8TB 3KL6A 5C5OA 1NC6A 2TGAA 3Q3XA 4RKOB 2A7HA 2W3IA 1Y8TA 4IMQA 3DFJA 3RU4E 1ESTA 1SGYE 5HM9A 1V2UT 3A88A 2ZFFH 6LPRA 1HIAB 2FEQH 2PWXA 2GDEH 1GJ9B 1O2ZA 1T8LA 2GCTB 4CR5A 3KCGH 1LHEH 9LPRA 2NU3E 1OKXA 1SPJA 1SQOA 2BDAA 4GCHG 3NXPA 3S69A 3RXKA 1NU9A 3UNQA 1O3NA 2QC2A 1TYNA 3LGIA 1ELDE 1JRTA 2Z6BD 1IQIA 4H4FA 1KXDA 3GISB 5T6GA 1P2OA 2ODQA 1BDAA 1IOEA 1RGQA 1ZPBA 2BZ6H 3GDUA 4U30A 3GY8A 1GVLA 5T6DA 3QDZB 1FPCH 2BVRH 4Y0ZE 1AI8H 1W0ZU 1PPEE 3AAVA 5A0BA 2P59A 1BBRE 1TNJA 2FLBH 2FOAA 1EP6A 3HPTB 1O2MA 1SGCA 3PM3A 4Y7AA 1ZRKA 2O9QA 4XBBA 1YLDA 3F6UH 2FZZA 1P01A 2Z9GA 3EGKH 2ZHDA 1C5VA 8GCHG 2QF3A 1UO6A 2D26C 2Q1JA 3MWIU 3A84A 1EAUA 2GT8A 3RMMH 1SB1H 3MU1A 3O8CA 1GMCG 4VGCC 3RMOH 3A8DA 3ATLA 3TLOA 1Y3WA 1ZSJA 2STBE 3RC6A 1N8OC 5A8YA 1N6YA 4XDEA 4MQAA 2H5DA 3MU0A 1W7XH 4GHQA 1F92A 1HJAB 3T25A 3QLPH 1J15A 4CBOA 1DUEA 1DXWA 3SU5A 1LVBA 1GI2A 1Z1IA 4NFEA 1TMTH 4U01A 2QA9E 4FUEA 1O5EH 1E0FD 3TH4H 2XC0A 1YPMH 2A5KA 1TX8A 3MMGA 1DWDH 2V35A 3BTDE 1GHZA 3UY9A 1TQ7B 3G01A 2FMJA 1H9LB 2QAAA 1TA2A 4RKJB 1GVZA 2V0BA 3TJUA 3VGCB 1C1NA 3ZZ4A 3KQBA 5A8ZA 1VZQH 4OS4A 3TK6A 3SJ8A 4YZUA 2HPQH 2VVUA 4Y7BA 3RU4T 3LJJA 1EZXC 1D3QB 1O37A 4WXIA 5F03A 5HM2A 2GMTB 2XC5A 4INKA 3SV2H 2AGEX 1H9IE 2Y6TA 1W13U 1QL8A 2OQ5A 3ZV9A 4Y8YA 1O5DH 3QZRA 1ANBA 3P17H 4CHAC 1QTFA 2BD5A 2Y5FA 1EP5A 3SGAE 4B73A 1P9SA 2SGPE 1V2NT 5E0JA 1G32B 1CBWC 1EOLA 2GZ7A 1D6RA 3LH3A 4MDSA 1LVMA 2BDIA 2W7SA 3UIRA 3UWJH 1GMDG 2VU8E 2V6NA 3DUXH 3SV6A 3LH1A 2BLOA 2EI6A 1ZYOA 1K2I1 3MI4A 1SGDE 3LGYA 1WCZA 2W26A 2J94A 4B75A 3M3SA 1C2LA 1C2IA 3T28A 2ZTYA 1S5SA 4MPUA 4ZXYH 3A89A 3VB3A 2FDAA 3ZYEA 1QB6A 1A3EH 1WOFA 2RA3A 1G2MA 1PJPA 1MTSA 5BRRE 1GDUA 1P06A 4DGJA 1LHDH 2QY0B 1GJ5H 4JZEH 1GGDB 1DY9A 2TRMA 3LDXH 4FUFA 6CHAB 1RTLA 1SQAA 2BLVA 3V0XA 1ELEE 3PMBB 2OUAA 1BMNH 1AUTC 1ELFA 2ZI2H 3STIA 1TBRH 1WTGH 1BQYA 1HJAC 2W3KA 4E7NA 5TCAA 4KKDA 1GHYH 2Z3CA 1MH0A 2GTBA 3T29A 2CHAC 2SGFE 3EYDA 5C1YA 1O2KA 3ZV8A 2AH4X 5F6MA 2PLXA 3VPKA 1BZXE 1O2QA 1C1OA 1BMLA 3EA8A 1F5KU 1KXEA 3E90B 3OTJE 3QGJA 1L2EA 1FLEE 1SOTA 2WUBA 5DP7A 4UFGH 3RXUA 1YYY1 1GI1A 3SNAA 1B0FA 4KTSA 3RXIA 1ZGVA 2RDLA 1UTJA 4X2YA 1HXFH 1BT7A 5E2PA 2ZTZA 5C1XA 1LVOA 1T32A 4KP0A 1EB2A 1BJUA 1IQNA 1UHBA 3ESTA 3GDSA 3QN7A 1VR1H 2H6MA 3F9EA 2OC1A 1QCPA 1XVOA 1D9IA 1ELAA 3ZZ9A 1C1WH 2UUYA 2G4TA 1EXFA 1PQ8A 3RLWH 5C20A 2FI5E 4RN6A 2OC7A 2R3UA 1RXPA 1CA0C 5JYIA 4BAHB 3SUDA 2F83A 2FS9A 1VCWA 1BTPA 2G8TA 3M35A 3LKWA 4YLQH 3F9FA 2UUFB 6GCHF 3U69H 1W12U 2D2DA 2KAIA 1N1LA 2BVXH 3V7TA 3V3MA 4LZ1H 2VGCB 5FXLA 1SGRE 1ANDA 5GCHF 1C2JA 4OS5A 1OXGA 2ZHFH 5TCCA 1TALA 1YCPM 1EZQA 1TABE 1YPKH 4M7GA 3UR9A 1KSNA 1GBTA 3A86A 1S85A 3H7OA 1CHOF 1BA8B 1LKAA 1O3BA 3KEEA 5GXPA 1DLEA 1OYTH 4JMYA 1O2HA 1GHVH 1C4U2 2Z7FE 3JZ2B 3OX7U 3MH4A 3GYMA 3P8GA 1NY22 4CR9A 1HAPH 4BXSA 1LQDB 2ZP0H 4X6MA 3PMJA 3HATH 4CRFA 1H8IH 3UUZA 1S83A 3TNSA 1GJ8B 3FZZA 2RCEA 2WV5A 4UFDH 1AIXH 1C9PA 2FOEA 3GCOA 3L3TA 5HMAA 1ARCA 2YNAA 4CRCA 2Y80A 3M36A 4WF8A 1FIWA 1EJNA 3MO3A 3M5OA 4MTBA 1AKSB 1HRTH 1MKXK 3SUGA 2O8WA 4TPIZ 3DFLA 3R0FA 2PTCE 1SFQB 2NU4E 3SNDA 1VITH 3D23A 5B6OA 5LPEA 1SGPE 4X1PU 1RTFB 2ZU5A 2ZDMA 3PMHB 1C1UH 1J8AA 2OTVA 2BHGA 5FPTA 1GJDB 1B7XB 1PPBH 1ELTA 5EQRA 1C9TA 1W3CA 3BEUA 2HRVA 1L4DA 3MYWA 4X8VH 3ZVBA 2B9LA 1P03A 2YNBA 2H5CA 3SUFA 1P05A 1LQEA 3RMNH 1ZPCA 1C4V2 1THPB 7KMEH 1XUJA 1HLTH 3TJNA 2J4IA 3MTYA 5EXMA 3OU0A 7GCHF