1OP8A

Crystal structure of human granzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
234
structure length
234
Chain Sequence
b'IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme A
publication title Crystal structure of the apoptosis-inducing human granzyme A dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.78: Granzyme A.
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A02
1S85A 4JYUH 2F9OA 1GMDG 1V2LT 3GDUA 3M35A 4ZH8A 1K2I1 3LGYA 3QGNB 1BRAA 3LGTA 1N6XA 1HIAA 1Y59T 2ZHWH 2F9PA 4ISLA 1LPZB 3EA8A 2HALA 4F49A 1CSOE 3BTQE 1GJ9B 4WMEA 3S7HB 1ELBA 1LPKB 2Y5FA 1O3PB 1QB1A 2SGEE 1LKBA 2M5TA 3GCHB 3MO6A 3ZV8A 4CR5A 2FTLE 3LGVA 2G00A 4ABGA 1GBDA 3LC5A 3P8OA 3E6PH 3A87A 2BMGB 6CHAC 4A1TA 3PM3A 4FUFA 1SFIA 3RXVA 1V2ST 1Z8GA 1THPB 2CHAC 1D6WA 4MTBA 1TMTH 1S6FA 1FI8A 1GI1A 2FLBH 3DT0H 1G3BA 3SU2A 1C5YB 1GHYH 1GHAG 3BEIB 3RXQA 1DSTA 1TMBH 1E0FD 2Q6FA 1MZDA 1XVMA 2O8MA 1DLEA 5FCRA 1EP6A 3BN9A 5LH8A 2ZU2A 3B8JA 3VEQB 2QXHA 3RXUA 3PMJA 3M36A 1B0FA 2XC0A 4B75A 5L2YH 3FP6E 1EP5A 4NFEA 2PSYA 5DK1A 1OX1A 3RMNH 3VB5A 1F7ZA 3E91A 3QK1A 1NRPH 2VWMA 3MNBA 1D3QB 1O2MA 3UY9A 1CHGA 2HRVA 4TPYA 4I31A 2TGTA 3RXKA 1FIZA 4Q2KA 3ZZAA 1AU8A 4CBOA 3AAUA 1VGCB 5JDUB 3DUXH 2Y5GA 2BQ7B 4NFFA 3GCNA 1VITH 2GMTB 1TB6H 1TNIA 5TCAA 1AWHB 5HM9A 2ZC9H 4YZUA 1EKBB 4XSKU 3BF6H 1MUEB 1GBTA 4YT7H 3RXGA 4I33A 5E8EH 3Q77A 3RXEA 1O31A 5E2PA 2EI6A 3ENSB 2P95A 2BZ6H 3SNEA 1DVAH 1GJ4H 3RMMH 3PYHA 1VJ9U 1GI9B 1QL7A 2VIDA 3DFJA 1DY9A 4ISIH 7GCHG 5DKMA 3S69A 3ZYDA 1E36B 1OWJA 1VJAU 1AQ7A 1Z8IB 3I77A 1Z1JA 5DP4A 1EASA 4CREA 4Y79A 2IPHA 1O2OA 4Y8XA 2Z9JA 1UMAH 2ULLA 1BRCE 4ABHA 1VZQH 2A31A 3LKWA 4MG3A 3FAOA 3RU4D 5C1YA 1ZJDA 2OINA 3SUFA 1RJXB 4OS1A 3SNBA 3M7QA 1O2YA 1SVPA 1QTFA 2ZDLA 2Q6DA 1T31A 4GAWA 1BIOA 1O2XA 1O5FH 2G4UA 4WH8A 1SLVB 1V2UT 1E38B 1XUGA 2AEIH 3P17H 2XYAA 1IHTH 1LHGH 4CR9A 2W26A 4Z6AH 2SGFE 1TGCA 3TGKE 2IJOB 2SGPE 3U9AH 1UTQA 2BY7X 1IHSH 1A0HB 1BBRE 1GGDC 1GBKA 1W12U 1MKXK 2FOCA 3SUDA 3LJOA 1T7CA 2VWOA 1GVLA 3NPSA 4FVDA 3KN2A 6GCHF 3LH1A 1D3TB 3UPEA 1YCPH 1IQJA 1C5XB 3RXJA 4ABEA 2AIPA 5HGGA 4DURA 2ZFRH 1O3FA 1G9IE 1KLJH 3F6UH 4CH8B 3IITA 1SGNE 4X2WA 1QB6A 2BTCE 1HDTH 3ATMA 1UTOA 1EPTB 1Y8TA 8ESTE 1NROH 2W7UA 1A46H 4D76A 1O5EH 2C4FH 4YM9A 2ZTZA 1CO7E 1GHVH 1ESAA 1X7AC 2ANYA 3ZZ9A 1O3DA 3UOPA 1FONA 1H9LB 3LH3A 2FX4A 3KHVA 1QY6A 3SBKA 1ZSJA 2YNBA 2IN2A 2AH4X 2WYGA 4KP0A 5LGOA 3NZIA 4I32A 2ZCKP 5TCCA 3RXMA 1AKSB 1C1VH 1LKAA 2OLGA 3F1SB 3OSYA 2CMYA 1DFPA 4ASHA 2W5EA 3B23B 3A80A 1G3DA 2VVVA 4DT7B 1OWHA 1GCTC 3QZRA 1AB9C 2BXTH 3C27B 1MCTA 2WPLS 2WV4A 1ELGA 1O39A 2NU1E 3Q76A 2RCEA 4Z0KA 3U8OH 3ZV9A 3RXSA 3U1IB 3UQOA 1GMCF 3H7OA 4GUXA 2WPKS 4NA9H 1KXFA 4NIYA 2Z9KA 1EZQA 1ZPBA 1HCGA 7ESTE 1PPEE 2FESH 5SGAE 1SGRE 1AN1E 4B2BA 2D1JA 1L2EA 1Z6JH 1FAKH 4KTUA 4NWKA 2ALVA 1ZHPA 3VGCC 3KL6A 1LMWB 2ZGBH 1S5SA 1GI8B 1SGFA 4TYDA 4JZIA 4D7GA 1BMMH 1XM1A 2VWNA 4KTCA 5FPTA 4AB9A 4ZHLU 1BTHH 2OC1A 2FOEA 4Y10E 4ISNA 1M9UA 2WUCA 2HGTH 2NU0E 1C5QA 1JOUB 3D65E 1V2RT 1FQ3A 1EB1H 3SQEE 1KDQA 1AI8H 2GT7A 3SJOA 1UK4A 3OU0A 1OOKB 4IGDA 1SGTA 2ZTYA 4MNYA 1A0LA 2O8LA 3ZVCA 1QL8A 2OD3B 4CBNA 3LONA 2CHAB 1O2WA 5HXFA 1NT1A 4FUEA 3EE0B 2XC4A 3SZNA 1FV9A 3UR9A 1JWTA 1UTKA 1HB0B 2ZGHA 1TNLA 4NIWA 1SLXB 3A89A 1ZGIA 4ABJA 4Y71A 2BLOA 4MPWA 4OS7A 3LJJA 2CV3A 3ZVDA 5EPNA 3C1KA 4BAQB 2NU2E 2ANWA 3KEEA 3RP2A 2ZWLH 2Z6BD 3RXHA 4AFZA 5JYIA 2EEKA 5IDKA 1MBMA 2BD2A 2AS9A 4MQAA 5GPIB 3ZVEA 1EAUA 1W13U 1VITF 1GDNA 1UK2A 3SGQE 1SGPE 5A0CA 1W7XH 1P8VC 3PO1C 3QDZB 1DUEA 2AGGX 1HPGA 5BPEA 5DP3A 3E0PB 2ZDVH 2V3HH 5EW2H 1GBJA 1LHDH 1TGSZ 2HPPH 1T8LA 3A84A 1BITA 4Y6DA 2FZZA 3PLBA 1A1RA 2WV5A 1TYNA 1C5WB 2CJIA 5GDSH 1QQUA 4BAOB 2ZECA 2OQ5A 4JYTA 1XKBC 4FU9A 1VGCC 1C5OH 1PPBH 2I6QA 3RMLH 1SGFG 1CA0C 2F3CE 3SW2B 1BZXE 4GCHG 4NCYA 3PWBA 3VXFH 2ASUB 2F9NA 4BOHA 3H5CB 1RIWC 1A2CH 1GBBA 1J8AA 5DP8A 1ETSH 3LU9B 3S9AA 1CHOF 4AN7A 1O2UA 4K60A 4XFQA 4YO9A 1BTYA 1AMHA 3GICB 4B1TA 1F92A 1ARBA 3M61U 3W94A 2BYAX 1YPHE 3QTVH 1P57B 1SMFE 2NU3E 2H6MA 1WU1A 1EX3A 4RKOB 2P59A 6LPRA 2LPRA 4JZEH 2ZFSA 5ABWA 3TJNA 3CS7A 1O5DH 2R2WU 2EI8A 2GV7A 1DM4B 1CGIE 1IQKA 2PKSC 1UO6A 2A2QH 4O97A 1G30B 1RTFB 1EQ9A 1Z8JB 2ZFPH 1CU1A 1YLDA 2Y7ZA 1IQEA 1GGDB 4WXIA 1GJ8B 1AO5A 4YOGA 1C5MD 1AUJA 1DLKB 2KAIA 5A0AE 3U1JB 2R2MB 2XBXA 5E0JA 1YPMH 2OQUA 1C1OA 1D3DB 1J16A 1MD7A 1AZZA 1THSH 1GJCB 2O9QA 4R0IA 4X1RU 4FXGH 4AOQA 2EI7A 4Q80A 3UWIA 5DP5A 2BVXH 5L6NH 1J14A 4K8YA 2VIWA 1PPGE 4NIVA 1YLCA 1QJ1B 1ZSKA 3QUMP 2Y7XA 2XBVA 1EXFA 1ZR0A 1WUNH 1MD8A 2XTTB 1NC6A 3P92A 2H9HA 1ZTLA 2LNCA 1IAUA 4ISOA 1S84A 1Z7KA 2GCHG 3BTME 3M5MA 1QJ6B 1BCUH 1C2LA 4SGBE 4AGJA 1EJAA 2EA3A 1C1PA 4UFEH 1HIAB 1LPGB 1SOZA 3GY3A 1W0ZU 1A5IA 1NFYA 2G55A 2FOMB 3RC6A 4D9RA 1O5GH 1RTLA 1JXPA 4ZHAA 3RXTA 4NIXA 2HNTC 2ZPSA 1VCQA 5A2MH 1GHBG 1DWDH 2VIOA 5EQQA 1LVMA 3GOVB 1GCTB 1AB9B 2BDYA 1D6RA 1K1OA 1OYTH 4I8LA 3W95A 4IMQA 3GISB 2ODPA 1GL0E 4HTCH 3HGNA 1LHFH 3KQDA 2QYIA 1QRXA 1V2OT 1ESBA 1UVUH 3ITIA 1C9TA 2FWWA 1C2KA 1FJSA 4A5TS 4UFDH 3TGJE 1YM0A 1BTZA 1C2DA 2P3FH 1SGIB 3RXCA 5FAHA 1ABIH 3P95A 2H2ZA 5EQRA 3A7WA 4LK4A 1SOTA 4UDWH 1ZSLA 4K3JA 3UNQA 3JZ1B 4XOJA 2V0BA 1ZPCA 2PWXA 4AX9H 2BDAA 3RXLA 2P3TB 1OWIA 4MLFB 1PQAA 2PFEA 1E37B 2VNTA 1MZAA 1S81A 1L4DA 1DANH 1T4UH 2BOKA 2CF9H 3ATLA 2BD4A 1BMNH 3TK9A 2GZ9A 1AWFH 3MNCA 1HJAC 3SJ9A 2BD7A 1XXDA 2W3IA 3BTWE 5C5NA 3H7TA 4XBBA 1F5LA 3AVZA 1MKWH 3NXPA 1CBWC 1O3GA 1QIXB 5A8YA 1LO6A 4WVPE 4BTUB 2PSXA 1INCA 1DT2A 2H5CA 1YCPM 3MH6A 3VB7A 1PFXC 2SNVA 3CS0A 2F83A 2BB4A 3KQBA 3A8DA 2PTNA 3S9BA 1AE5A 4DGJA 5LPFA 3URCA 1OS8A 1B5GH 1ARCA 2ZP0H 3BIVH 1WTHD 2FS8A 1NRSH 4XDEA 1YPGH 1WQSA 4GHQA 5E0GA 2ZF0H 2FS9A 1EJMA 3MU5A 4K2YA 3ELAH 1WOFA 2ZQ2A 3HK3B 4ZKNU 3PO1B 1DICA 1P02A 4IC6A 1VR1H 3SGBE 3ZZ4A 1O2IA 4I7YH 2QIQA 1OP2A 3FVFB 2FP7B 4HZHA 1WYKA 1SFQB 1Y3UA 1FXYA 3BTHE 2F9VA 1ZZZA 2AFQB 3PLPA 1V2TT 1GMHF 1CGJE 2FOAA 1ELFA 2QCYA 3QWCH 1LTOA 5FPYA 2BDBA 5GCHG 5HM2A 4U01A 2H9TH 1ZHRA 3BTTE 2DUCA 2J2UA 1V3XA 1MMJN 2YNAA 1TQ0B 3R3GB 2BY9X 1C5VA 4GLYA 1O2PA 4QT8C 3SV8A 1C5SA 2BLQA 1QHRB 2FODA 1BT7A 3VFEA 1CA0B 4OGXA 1HXFH 3TJVA 1HFDA 2BQ6B 3K6YA 3LDXH 3MI4A 1F0RA 4RSPA 1RIWB 1HAGE 2D26C 1IQHA 5HYOA 3GYMA 1TALA 1GBIA 2PV9B 3P8NA 2NWNA 1FIWA 1P04A 1WCZA 3RXOA 4DOQA 4I8HA 1OYQA 1GBLA 2GT8A 1TGNA 5A09A 2C90B 3QTOH 1RD3B 2BHGA 4M7GA 1JRTA 3UFAA 2ZFTA 1MTSA 4KKDA 2ZPRA 2PGBB 3UQVA 5EU8A 1QL9A 1F0SA 2ZG0H 1BMLA 2PKSB 2UUKB 2FEQH 2DE9A 3E90B 4WXVA 3V7TA 1BBRH 4KTSA 3D62A 1IQIA 5T6GA 2P93A 4AYYB 3NK8A 2Q1JA 1W0YH 3F9FA 1UVSH 1Y5AT 1GBEA 4D7FA 1Z6EA 3RXPA 1GG6B 1GMDF 5CHAB 3T25A 1S82A 1QNJA 4PROA 2ALPA 1FY8E 2ZFFH 1GI4A 1HRTH 1SHHB 1RS0A 1XUKA 3RC5A 1FAXA 2BD9A 2ZFQH 1QURH 1CA8B 4NGAH 2ZA5A 1OSSA 1IQNA 1C5LH 5F8ZA 1H9IE 1KLIH 1GBAA 1T32A 2B8OH 2WPIS 2XRCA 3ZVAA 2Z9LA 1BMAA 2QN5T 1D3PB 4TWYA 4X6NA 1O36A 1ELDE 4K1TA 1NFUA 3SNDA 4E7RG 1G3EA 2G51A 5AFYH 1SB1H 1GBFA 1ANEA 5EOKA 1C4Y2 1ETTH 2Z94A 4JCNA 3FANA 3ESTA 3SUEA 4CRGA 3SJIA 3BTDE 1O2HA 4MPXA 5C1UA 2ZU3A 1GI2A 1MTVA 1GHAF 1V2KT 3U98H 1GJ7B 4MNWA 3V12A 4THNH 1UHBA 2ODYB 1P9SA 3VB6A 4ABIA 2A5AA 3K65B 4NSVA 2SGDE 2ZKSA 8GCHG 2AMPA 1KDQB 3ZVFA 3Q00A 1FUJA 4MVNA 4ABAA 1C5TA 2V35A 4BAKB 1ETRH 3TJOA 2P8OB 3MTYA 2OP9A 1FPHH 1TONA 3VPKA 4YESB 2UWLA 5L2ZH 1UTMA 3SHCH 3T62A 2GV6A 3RMOH 3EQ0H 1C9PA 1TGTA 1A3EH 1TNGA 1TRNA 3PV4A 3TIUA 4AFUA 2ANMH 4O3TA 1C5RA 3TU7H 4IC5A 2P16A 2A7JA 1SL3A 1YYY1 1YKTA 5T3HA 5GIBA 1WAYB 1OWKA 2FIRH 3EA9A 2XWBI 2TGDA 4JMYA 1GHWH 4UFGH 1H8DH 3TITA 4SGAE 4FUCA 4YTAA 1O32A 3RXRA 5I46H 1ELEE 1FN6A 1QBOA 2ZCHP 3O8BA 3SQHE 1EAIA 1QCPA 1O3NA 2PUXB 2ESTE 1GI3A 2A4RA 3EAJA 3BIUH 2B0FA 3EDXB 4GSOA 2BX3A 5CMXH 1HJAB 5FXLA 2Z7FE 1AFEH 1JMOH 4DY7B 4K5ZA 3TGIE 3IWMA 5DP9A 1CBWB 2FM2A 4KELA 3VB3A 1O2JA 3DA9B 1YPKH 2G52A 2WPJS 3KQEA 3TH2H 1IOEA 1WV7H 2ZCLP 1O2GH 1BRBE 4NA8A 4R8TB 1A5HA 3JZ2B 4K69A 1CHOG 4AORA 3S9CA 1DSUA 3T5FH 1P11E 1LHEH 1YBWA 3S0NA 3FFGA 1UCYK 4MNVA 1C1UH 4NA7A 1UJ1A 1XXFA 3HKJB 3SI4H 4Q7YA 4Y76A 3SNCA 3A86A 4HFPB 3MMGA 1O3AA 1S6HA 2VVCA 4B71A 1P2IA 1UTLM 1F5KU 5FBEA 1O5BB 3SHAH 1D4PB 4Y11E 1LHCH 2BLVA 1NRNH 1H1BA 2SNWA 1HAYB 1PPFE 1UTNA 1TX6A 3UOUA 2Y81A 4A7IB 1AVXA 4INHA 1O5AB 5EXNA 1HV7A 3QLPH 4ZAEA 1HJ9A 1TRYA 5EPYA 1O3IA 5K0HA 2P94A 3SU5A 1RRKA 2PHBA 3TPIZ 3FZZA 1CVWH 2QF0A 2CF8H 4X6OA 2OC7A 3MU0A 3BV9B 1MKXH 4K1SA 1GJDB 3ZZDA 2FDAA 2ZZUH 1PJPA 4UFFH 4Y0ZE 2UWOA 1AD8H 1SGYE 2KAIB 1MBQA 1TNKA 3PWCA 2OC0A 2QXJA 2A2XH 1K1IA 1Y5UT 2J92A 3BEFB 2HVXA 4KGAA 8KME2 3CP7A 4Y7BA 3FZDA 1KXEA 2RDLA 1O2SA 3A82A 1C5UA 4U2WA 4U30A 2QV1A 1K9OE 1PQ5A 5E2OA 1GDQA 4Q7XA 5E0HA 4XBCA 3UTUH 2QXGA 2XBWA 3RM2H 3RU4E 3ATWA 4UE7H 1GHXH 4HI3A 2R0LA 4LXBH 1N6YA 2BY8X 2QC2A 4MDSA 2C93B 2VB0A 3T28A 2PKAA 3A8AA 4ZKSU 1UVTH 5C67A 5F8TA 3HATH 5C2ZA 5JB9S 4JYVH 1Q3XA 1Y5BT 1P10A 4OS2A 1NPMA 1C1QA 1QBVH 1BDAA 4MPUA 4ABBA 3E0NB 2GDDA 4CRCA 2QGRA 4WMDA 2AMDA 1SGCA 1G2MA 2WYJA 2J34A 1P3EA 1GBMA 1GJBB 1WQVH 1TA2A 1S0QA 3KGPA 1TPOA 2OCVB 5A8ZA 3AW0A 1IQGA 5FX5A 1SGDE 2ZIQH 1HAPH 1ID5H 1RGQA 1TWXB 4DJZB 2F9UA 1ZMNA 4A1VA 3U69H 1ZLRA 1SI5H 2W3KA 4IW4E 3OY6U 1Z8RA 2B5TB 3A7TA 1K1LA 1W2KH 2Z3CA 5EODA 3GCTG 1LQDB 1BTPA 1DWCH 1K1JA 1C2HA 1FY5A 3GDSA 1J15A 1H9HE 2VIPA 1GG6C 1O3JA 1TFXA 5CHAC 1TBQH 3RXFA 4DVAU 1KLTA 3MU8A 3SU6A 2QY0B 3A7YA 1NFXA 1B0EA 3K6ZA 3SU1A 3GDVA 3L3TA 3UNRA 1FY1A 2IOTA 3RM0H 2D8WA 3PLKA 1TNJA 2H1UA 3RU4T 3EGKH 5JB8S 3KQCA 3OYPA 1A5GH 4JK6A 2O8TA 3ATIA 5F03A 3UR6A 1C5ZB 2A5KA 4ZROA 1GVKB 3F9GA 1UTPA 2PTCE 4AFSA 4E7NA 5F6MA 2ZU5A 4O03A 1LVOA 4AGKA 1DX5M 1J17T 2A5IA 3AAVA 4ZXYH 2DE8A 1HAOH 4FU8A 2CN0H 1UVPA 3OTJE 2UUYA 3LGUA 1DITH 1PPHE 1Q31A 2OC8A 3B9FH 1TX7A 3TNSA 4NZLA 1TRMA 2JH6D 3A83A 1EB2A 3D49H 5AVDA 2JETC 2A45B 3M7TA 1IQMA 2AERH 3BTFE 1HYLA 1O35A 1ZTKA 4YLQH 1ACBE 1MAXA 4OS6A 3UUZA 4E06H 2ZNKH 3TLOA 2FYQA 1YP9A 2FI5E 2FI3E 2PLXA 1NTPA 2V6NA 4WF8A 3P8GA 5JPMH 4ZMAH 1HAHH 1TIOA 5CE1A 2TIOA 2P8OC 3MH5A 4LZ1H 3MWIU 1AFQC 1RTKA 1MAYA 1L4ZA 1HBTH 4ABDA 4X1PU 1C2FA 1RXPA 4GCHF 2ZPQA 2BY5X 1LDTT 3SU3A 1DS2E 1YPEH 2HNTF 2G4TA 3BG4C 2BDCA 2SGQE 1O2RA 5AFZH 1NY22 1N8OC 2BQWB 3EYDA 4ZUHA 1TOMH 4CRDA 2VGCC 5FPSA 1AIXH 3LC3A 2G81E 1BBRK 4LZ4B 1ELCA 4VGCC 1E34B 5DJ7A 3TVJB 1EAXA 1P0SH 4X8VH 2GP9B 2GKVE 4YOIA 1SHYA 3SORA 1C1RA 3GYLB 3IG6B 2HPQH 3PB1E 3Q3YA 5BRRE 2BY6X 3KF2A 3M5NA 4YLUA 2XBYA 4JZFH 3RLWH 3F9EA 1NO9H 1ELAA 1O3CA 2GZ8A 2R3YA 3K2UA 4AB8A 3ZZ8A 1ORFA 3UNSA 1S83A 4A6LA 1DWEH 2OBQA 2VINA 1K22H 2JH0D 1F5RA 4FUDA 5F8XA 1NU7B 1YPHC 2W7SA 1SG8B 1O2NA 1SQOA 1G3CA 4CHAB 2JH5D 3BSQA 2AMQA 4IN2A 1EZXC 2AYWA 1EATA 4BAHB 3F68H 3M5OA 3MOCA 2ZDNA 5FBIA 1YCPK 3MNSA 1C2MA 4TWWA 1C2GA 1ANBA 1GJAB 1C1TA 1ZHMA 1SC8U 2ZO3H 5JBAS 1QFKH 4X1NU 3GY8A 3VXEH 1YPJH 1B7XB 4TPIZ 1WSSH 3GY2A 5EQSA 1O34A 1LVBA 2G5NA 1G37A 3M3VA 1MCVA 3TH4H 3LOXA 2GCHF 2Y80A 3A7ZA 3ODDA 2VU8E 2TBSA 4X6MA 3S7KB 3NCLA 3ZZ7A 1W11U 4X8SH 1O2KA 3KIDU 3MHWU 1OXGA 2P3UB 1V2JT 1JRSA 2HLCA 3RXAA 6GCHG 1LCYA 2J4IA 3G01A 2FXRA 1A0JA 4ISHH 1GHBF 2ZDKA 3MU1A 1C1WH 5DPAA 1MTWA 1TPAE 2VJ1A 1QRWA 3LIWA 1V2WT 1CT0E 5JBCS 1Y3XA 4AG1A 5LPRA 3KNXA 1BJUA 1TE0A 2TPIZ 1O37A 2J95A 4YOJA 5ESBA 2FI4E 4LOYH 3M3SA 3V13A 2G5VA 1GI0A 2Z9GA 3A81A 4K1EA 3ZZ5A 2ODQA 3BG8A 3HK6B 2QF3A 1SQAA 2K1QA 3ZVBA 3MO3A 5TJXA 1QGFA 4I8GA 4E05H 9LPRA 1KXCA 2BX4A 1UHBB 1O2QA 1HAVA 3SI3H 4A1XA 3SNAA 3NUMA 4FUGA 1P2QA 1YF4A 4TY6A 5GXPA 2FPZA 2H9EH 1HLTH 1T8NA 2UWPA 2VIVA 2BD8A 1L0ZA 1H4WA 3ODFA 3P6ZB 1PPCE 3VB4A 3QX5H 4ABFA 1QBNA 5A0BA 2FOBA 2WPHS 2GGVB 1TA6A 1ANCA 3U8TH 3QZQA 1C2EA 1C1MA 3MFJA 1GMCG 1TLDA 1MQ5A 5LPEA 5C3NA 1KXDA 2RA3A 3A88A 1G2LA 1XUJA 4H42U 4FUIA 2ZQ1A 4BXWA 2PUQH 1MU8B 3OY5U 3SJKA 1F2SE 1TOCB 2TGPZ 4FUBA 5ETXA 2C8XB 1A7SA 2J9NA 3TK6A 3RUOA 1K1NA 1O33A 1JBUH 1T8OA 2HWLB 3PTNA 1TGBA 2HOBA 5EGMA 3N7OA 1NZQH 1AZ8A 1FDPA 5J4QA 3OX7U 1EOJA 2ZDMA 4CRAA 5FCKA 3SV9A 4B73A 2RG3A 2PW8H 1MU6B 3SV2H 4GPGA 1DUAA 1TAWA 5JBBS 1BRUP 1SGQE 4UD9H 1P2JA 1GI7B 3WY8A 2ZU4A 2Y82A 9ESTA 1SBWA 2V3OH 2A7HA 3A8BA 1BQYA 1FZZA 3M7UA 2BD5A 2Y5HA 4XBDA 1CT2E 1NRRH 1AE8H 4ESTE 2FYRA 1C4V2 1NN6A 1NM6A 1V6DA 2JETB 1AY6H 2AGIX 1MTUA 3FP8E 4NZQA 1JIRA 1OKXA 4AG2A 4A92A 2VIQA 1ELTA 1E35B 1OPHB 2FOHA 4AFQA 4UONA 5GCHF 3T29A 1BA8B 2SGAA 4JZ1A 2ZHEH 2EC9H 2ZGXH 3AW1A 1SLUB 1UTJA 1O5CB 4F4OC 4Q7ZA 1SR5C 2RA0A 6ESTA 1OP0A 1BTXA 5J4SA 1G36A 1ZPZA 3CENA 4WY3A 1AFQB 4ZKRU 1BHXF 1O2VA 3SN8A 1BTWA 1EZUC 1GJ6A 3P8FA 1UK3A 3GY4A 1CE5A 1KSNA 1O2TA 1GL1A 1VITG 2B9LA 3O8DA 4WJG2 2R9PA 3PTBA 4ZHMU 3KCGH 1GHZA 2FO9A 2A4OA 4RKJB 2I6SA 2XNIA 2CGAA 3BG4B 2OTVA 4X8UH 4WWYA 2ZI2H 1QRZA 2BVRH 3LGWA 3M3TA 3NWUA 1N8OB 4X0WU 2O8WA 2A7CA 4K8BA 2H5DA 3BEUA 1T8MA 2VGCB 3PMBB 3A85A 4NG9H 3LGIA 1L1JA 4MPVA 3TNTA 3SGAE 2FOFA 4X8TH 7GCHF 1Y3YA 2ZHDA 4VGCB 1F0TA 1HXEH 3E16B 2BOHB 2O8UA 2XC5A 1NESE 1GPZA 4FUHA 1CT4E 5T6DA 3T2NA 1MTNC 1RFNA 1Y3WA 3GY5A 1TPSA 1EJNA 1FLEE 2FMJA 3SV7A 4D8NA 3TH3H 4IS5A 2JKHA 2THFB 3QO6A 2TRMA 2R0KA 2BVSH 4J1YA 3MYWA 3AASA 4IN1A 3ZZBA 5EW1H 1K21H 1VCWA 4BTIB 2BDIA 1F0UA 2WINI 1DXWA 1AVGH 1UVOA 2FOGA 4B74A 1XMNB 3PMHB 1W8BH 4O3UA 1V2NT 3MNXA 1O38A 2GCTC 1A4WH 1P03A 2BZAA 3HKIB 2STBE 1TPPA 4INLA 2PKAB 1G32B 3A7XA 2NU4E 1K1MA 3ZVGA 1GI6A 3SV6A 3A7VA 4OS5A 1EOLA 2FLRH 1HJ8A 4X2XA 4BAMB 1C2IA 4NSYA 1EAWA 3MU4A 4AZ2B 1P2OA 1TABE 2GD4B 1EPTA 2XW9A 1TQ7B 1CQQA 2ZEBA 3Q3KA 1TNHA 1ZRBA 3V0XA 1XVOA 4I8JA 1BTUA 2A4QA 7KMEH 2AGEX 2BDGA 4X1SU 2ZGJA 5GWZA 1DE7H 6CHAB 3O8CA 1W7GH 1C4U2 1U6QA 2SFAA 4GHTA 3RXDA 4CHAC 5FHTA 4FUJA 3ZZ3A 3E1XB 4GVUA 2Y6TA 2UUFB 4CH2B 3RLYH 5K7RA 1YGCH 2OXSA 4DG4A 4IBLH 1AKSA 5DP7A 1HUTH 5C20A 2HNTE 1NS3A 2C3SA 8GCHF 1FMGA 5C1XA 1C1SA 1O3EA 3UWJH 3V3MA 4NWLA 1BUIA 1W3CA 2GZ7A 1GBCA 1SPJA 1ZMJA 3GCHC 4OGYA 1ZRKA 3SU4A 3ATKA 5AHGH 3MO9A 4HGCA 1ANDA 3PROA 1V2QT 2GX4A 1P3CA 1QB9A 1WTGH 1PQ7A 2UUJB 4Y8YA 3UIRA 3M37A 1LVYA 2Q6GA 1GVZA 2A32A 2Z9IA 4Y0YE 4YT6H 1OWEA 1HAZB 4BXSA 2BD3A 1HGTH 4BANB 2PR3A 1O0DH 2F9BH 1P12E 1QR3E 3L33A 1W10U 1Q2WA 1C5NH 3I78A 2J38A 1WBGB 3MH4A 3RXIA 8LPRA 2GTBA 1PPZA 1HNEE 1KXBA 4UEHH 1L1NA 1W14U 2A4GA 1EZSC 1TMUH 3O8RA 4X2VA 3SU0A 1XUFA 2A1DB 1L1GA 1OP8A 1AHTH 1PYTC 1O2ZA 2GDEH 5EXLA 1K28D 1NU9A 4Y8ZA 3P70B 3GY6A 5EG4A 3NKKA 2GMTC 2XCNA 3DFLA 1IQLA 3STJA 2QAAA 2VWLA 1XUHA 1ZGVA 1GWAA 3BTEE 1O30A 1T4VH 1HAXB 3TJUA 1KYNA 2FTMA 1ZOMA 1K1PA 1P06A 5A8XA 3BTKE 4D9QA 3I29A 1MQ6A 1IQFA 2ILNA 3U8RH 2PGQB 1MKWK 1QA7A 2ZGCA 5H4IB 1S0RA 4DIHH 2R3UA 1A61H 3GCOA 4J2YB 1V2MT 3R0FA 3ZZCA 3T26A 1C1NA 1P09A 1O3OA 1FN8A 5ESTE 3D23A 2STAE 1FY4A 1P05A 1GBHA 1KXAA 4FVBA 1DY8A 1GJ5H 5PTPA 1BHXB 2XWAA 2B7DH 5T6FA 3QGJA 5DO4H 1QA0A 1QJ7B 1V2VT 4WMFA 1HAIH 4BTTB 1ZMLA 1AVWA 1DDJA 2ZHQH 2TGAA 5EXMA 3E8LA 1O3KA 1YPLH 3HGPA 1UCYH 1SGEE 3RC4A 3PMAB 1J9CH 1Y3VA 2Z3EA 2XXLA 4AYVB 5I25A 4WH6A 3TK5A 1NRQH 3E3TA 3QN7A 5DGJA 4H6TA 5GJ4B 3RXBA 3SJ8A 4I8KA 1Z1IA 1VCPA 3LT3A 4MNXA 1ESTA 3F9HA 4X6PA 1P2NA 3K9XB 2BXUH 1FY3A 2D2DA 2OBOA 1BJVA 1AUTC 4DIIH 1KIGH 2FX6A 4X1QU 2ZTXA 4B76A 1O3BA 1V2PT 1PQ8A 1QQ4A 3DHKH 1O3HA 1TX8A 2ZDAH 4JZDH 2VH0A 2ZHFH 2BLWA 1GCDA 2Z3DA 4OS4A 1P01A 2VH6A 4X2YA 3DD2H 5IYTA 3LPRA 1SSXA 1MH0A 2VVUA 3STIA 4XE4A 1UCYE 4JK5A 2GVFA 1LQEA 4RN6A 5JBTA 3MH7A 1YC0A 1P9UA 3L6PA 1GMHG 1TBRH 1KTSB 2A0QB 5HMAA 4DW2U 3ZZ6A 1GI5A 2AIQA 1GDUA 3T27A 1SLWB 1DXPA 2C8WB 3Q3XA 4TY7A 1P2MA 1EPTC 4IMZA 4H6SB 3FP7E 1KTTB 1KY9A 2BDHA 1OWDA 2YOLA 1XKAC 1TBZH 3BTGE 5G4BA 1MTNB 2WUBA 2BM2A 4CRFA 5AF9H 1O3MA 1D9IA 1A3BH 2CXVA 1P2KA 3HPTB 4BNRA 4U32A 1ELVA 3RDZA 5L30H 4FU7A 5DG6A 4H4FA 4ZKOU 1H8IH 2XCFA 1FPCH 1ABJH 2QA9E 4O9VA 1CGHA 1C2JA 1C5PA 1NFWA 1ZTJA 4B2AA 5FX6A 2GCTB 3SOSA 4CRBA 4ZXXH 1BOQA 1JIMA 3URDA 5C5OA 2ZU1A 3VGCB 1THRH 4INKA 4DCDA 1XX9A 1BB0B 2ANKH 1O3LA 1DWBH 1ZYOA 3GY7A 1EUFA 2WPMS 3UREA 2C8YB 1PYTD 2C8ZB 2OUAA 4Y7AA 1Z71A 4B2CA 5B6OA 5DP6A 3SUGA 3GCTF 2J94A 1FNIA 1DPOA 2F91A 3ZYEA 3M5LA 2G8TA 1HAVB 1SQTA 7LPRA 1N1LA 3EA7A 3SO3A 1DOJA 1XUIA 3A8CA 1ZJKA 2QXIA 1AGJA 1O2LA
chains in the Genus database with same CATH superfamily
5HIZA 1S85A 4JYUH 2F9OA 1GMDG 1V2LT 3GDUA 3M35A 4ZH8A 1K2I1 3LGYA 3QGNB 1BRAA 2AHME 3LGTA 1N6XA 1HIAA 1Y59T 2ZHWH 2F9PA 4ISLA 1LPZB 3EA8A 2HALA 4F49A 2KX4A 1CSOE 3BTQE 1GJ9B 4WMEA 3S7HB 1FX0B 1ELBA 2CK3D 1LPKB 2Y5FA 1O3PB 1QB1A 2SGEE 1LKBA 2M5TA 3GCHB 3MO6A 3ZV8A 4CR5A 2FTLE 3LGVA 2G00A 4ABGA 1GBDA 3LC5A 3P8OA 3E6PH 3A87A 2BMGB 6CHAC 4A1TA 3PM3A 4FUFA 1SFIA 3RXVA 1V2ST 1Z8GA 1THPB 2CHAC 1D6WA 1H8ED 4MTBA 1TMTH 1S6FA 1FI8A 1GI1A 2FLBH 3DT0H 5KGOA 1G3BA 3SU2A 1C5YB 1GHYH 1GHAG 3BEIB 3RXQA 3GS9A 1DSTA 1TMBH 1E0FD 2Q6FA 1MZDA 1XVMA 2O8MA 1DLEA 5FCRA 1EP6A 3BN9A 3OE7D 2ZU2A 5LH8A 3B8JA 3VEQB 3F2GA 2QXHA 3RXUA 3PMJA 3M36A 3VG8A 1B0FA 2XC0A 4B75A 5L2YH 3FP6E 1EP5A 4NFEA 2PSYA 5DK1A 1OX1A 3RMNH 3VB5A 1F7ZA 3E91A 3QK1A 1NRPH 2VWMA 3MNBA 1D3QB 1O2MA 3UY9A 1CHGA 2HRVA 4TPYA 4I31A 2TGTA 3RXKA 1FIZA 4Q2KA 3ZZAA 1AU8A 4CBOA 3AAUA 1VGCB 5JDUB 3DUXH 2Y5GA 2BQ7B 4NFFA 3GCNA 1VITH 2GMTB 1TB6H 1TNIA 5TCAA 1AWHB 5HM9A 2ZC9H 4YZUA 1EKBB 4XSKU 3BF6H 1MUEB 1GBTA 4YT7H 3RXGA 4I33A 5E8EH 3Q77A 3RXEA 1O31A 5E2PA 2EI6A 3ENSB 2P95A 2BZ6H 5EIYA 3SNEA 1DVAH 1GJ4H 3RMMH 3PYHA 1VJ9U 1E79D 1GI9B 1QL7A 2VIDA 3DFJA 1DY9A 4ISIH 7GCHG 5DKMA 3S69A 3ZYDA 1E36B 3FO8D 1OWJA 1VJAU 1AQ7A 1Z8IB 3I77A 1Z1JA 5DP4A 1EASA 4CREA 4ZCNA 4Y79A 2IPHA 1O2OA 2QE7D 4Y8XA 2QF4A 2Z9JA 1UMAH 2ULLA 1BRCE 4ABHA 1VZQH 2KFWA 2A31A 3LKWA 4MG3A 3FAOA 3PV5A 5C1YA 3RU4D 1ZJDA 5C0TA 2OINA 3SUFA 1RJXB 4OS1A 3SNBA 3M7QA 1O2YA 1SVPA 1QTFA 2ZDLA 2Q6DA 1T31A 4GAWA 1BIOA 1O2XA 1O5FH 2G4UA 4WH8A 1SLVB 1V2UT 1E38B 1XUGA 2AEIH 3P17H 2XYAA 1IHTH 1LHGH 4TT3D 3N99A 4CR9A 2W26A 4Z6AH 2SGFE 1TGCA 3TGKE 2IJOB 4RI0A 2SGPE 3U9AH 1UTQA 2BY7X 1IHSH 2OK5A 1A0HB 1BBRE 1GGDC 5DSFA 1GBKA 1W12U 1MKXK 2FOCA 3SUDA 3LJOA 1T7CA 2VWOA 1GVLA 4XRNA 3NPSA 4FVDA 3KN2A 6GCHF 3LH1A 1D3TB 3UPEA 2L6OA 1YCPH 1IQJA 1C5XB 3RXJA 4ABEA 2AIPA 5HGGA 4DURA 2ZFRH 1O3FA 1G9IE 1KLJH 3F6UH 4CH8B 3IITA 1SGNE 4X2WA 1QB6A 2BTCE 1HDTH 3ATMA 1UTOA 1EPTB 1Y8TA 8ESTE 2W6JD 1NROH 2W7UA 1A46H 4D76A 1O5EH 2C4FH 2V3MA 4YM9A 2ZTZA 1CO7E 1GHVH 3KQ5A 1ESAA 1X7AC 2ANYA 3ZZ9A 1O3DA 3UOPA 1FONA 1H9LB 1EFRD 3LH3A 2FX4A 3KHVA 1QY6A 3SBKA 1ZSJA 2YNBA 2IN2A 2AH4X 2WYGA 4KP0A 5LGOA 3NZIA 4I32A 2ZCKP 5TCCA 3RXMA 4DT4A 1AKSB 1C1VH 1LKAA 2OLGA 3F1SB 3OSYA 2CMYA 3OFND 1DFPA 4ASHA 2W5EA 3B23B 3F0OA 3A80A 1G3DA 2VVVA 4DT7B 1OWHA 1GCTC 3QZRA 1AB9C 2BXTH 3C27B 1MCTA 2WHXA 2WPLS 2WV4A 1ELGA 1O39A 2NU1E 3Q76A 2RCEA 4Z0KA 3PV2A 3U8OH 3ZV9A 3RXSA 3U1IB 3UQOA 1GMCF 3H7OA 4FETA 4GUXA 2WPKS 4NA9H 1KXFA 4NIYA 2Z9KA 1EZQA 2GJGA 1ZPBA 1HCGA 7ESTE 1PPEE 2FESH 5SGAE 1SGRE 1AN1E 4B2BA 1W0JD 1L2EA 2D1JA 1Z6JH 1FAKH 4KTUA 4NWKA 2ALVA 1ZHPA 2KCAA 3VGCC 3KL6A 1LMWB 2ZGBH 1S5SA 1GI8B 1SGFA 4TYDA 4JZIA 4D7GA 1BMMH 1XM1A 2VWNA 4KTCA 5FPTA 4AB9A 4ZHLU 1BTHH 2OC1A 2FOEA 4Y10E 4ISNA 1M9UA 2WUCA 2HGTH 2NU0E 1C5QA 1JOUB 3D65E 1V2RT 1FQ3A 1EB1H 3SQEE 1KDQA 1AI8H 2GT7A 4FOUC 1UK4A 3OU0A 3SJOA 1OOKB 4IGDA 1SGTA 2ZTYA 4MNYA 1A0LA 2O8LA 5F53A 3ZVCA 2HVYB 1QL8A 2OD3B 4CBNA 3LONA 2CHAB 1O2WA 5HXFA 1NT1A 4FUEA 3EE0B 2XC4A 3PRBA 3SZNA 1FV9A 3UR9A 1JWTA 1UTKA 1HB0B 2ZGHA 1TNLA 4NIWA 1SLXB 3A89A 1ZGIA 4ABJA 4Y71A 2BLOA 4MPWA 4OS7A 3LJJA 2CV3A 3ZVDA 5EPNA 3C1KA 4BAQB 2NU2E 2ANWA 3KEEA 3RP2A 2ZWLH 2EQNA 2Z6BD 3RXHA 4AFZA 5JYIA 2EEKA 5IDKA 1MBMA 2BD2A 2AS9A 4MQAA 2KCPA 5GPIB 1EAUA 3ZVEA 1W13U 1VITF 1GDNA 1UK2A 3SGQE 1SGPE 5A0CA 1W7XH 1P8VC 3PO1C 3QDZB 1DUEA 2AGGX 1HPGA 2PP6A 5BPEA 5DP3A 3E0PB 2ZDVH 2F4LA 2V3HH 5EW2H 1GBJA 1LHDH 1TGSZ 2HPPH 1T8LA 3A84A 1BITA 4Y6DA 2FZZA 3PLBA 1A1RA 2WV5A 1TYNA 1C5WB 2CJIA 5GDSH 1QQUA 4BAOB 2ZECA 2OQ5A 4JYTA 1XKBC 4FU9A 1VGCC 5EJ1A 4XD7D 1C5OH 1PPBH 2I6QA 3RMLH 1SGFG 1CA0C 2F3CE 3SW2B 1BZXE 4GCHG 4NCYA 3PWBA 3VXFH 2ASUB 2F9NA 4BOHA 3H5CB 1RIWC 1A2CH 1GBBA 3F2HA 1J8AA 5DP8A 1ETSH 3LU9B 3S9AA 1CHOF 3FOAA 4AN7A 1O2UA 4K60A 4XFQA 4YO9A 1BTYA 1AMHA 3GICB 4B1TA 1F92A 1ARBA 2WZQA 3M61U 3DSPA 3W94A 2BYAX 1YPHE 3QTVH 1P57B 1SMFE 2NU3E 2H6MA 2JJ1D 1WU1A 1EX3A 4RKOB 2P59A 6LPRA 2LPRA 4JZEH 2ZFSA 5ABWA 3TJNA 3CS7A 1O5DH 2R2WU 2EI8A 2GV7A 1DM4B 1CGIE 1IQKA 2PKSC 1UO6A 2A2QH 4O97A 1G30B 1RTFB 1EQ9A 1Z8JB 2ZFPH 1CU1A 1YLDA 2Y7ZA 1IQEA 1GGDB 4WXIA 1GJ8B 2JDID 1AO5A 4YOGA 1C5MD 1AUJA 1DLKB 2KAIA 5A0AE 3U1JB 2R2MB 2XBXA 5E0JA 1YPMH 2OQUA 1C1OA 1D3DB 1J16A 1MD7A 1AZZA 1THSH 1GJCB 2O9QA 4R0IA 4X1RU 4FXGH 4AOQA 2EI7A 4Q80A 3UWIA 5DP5A 1OHHD 2BVXH 5L6NH 1J14A 4K8YA 2VIWA 1PPGE 4NIVA 1YLCA 1QJ1B 1ZSKA 2JJ2D 3QUMP 2Y7XA 2XBVA 1EXFA 1ZR0A 1WUNH 1MD8A 2XTTB 1NC6A 1YY3A 2H9HA 1ZTLA 2LNCA 3P92A 1IAUA 4ISOA 1S84A 1Z7KA 2GCHG 3BTME 3M5MA 1QJ6B 1BCUH 1C2LA 4SGBE 4AGJA 3PRDA 1EJAA 2EA3A 1C1PA 4UFEH 1HIAB 1LPGB 1SOZA 3GY3A 1W0ZU 1A5IA 1NFYA 2G55A 2FOMB 3RC6A 4D9RA 1O5GH 1RTLA 1JXPA 4ZHAA 3RXTA 4NIXA 2HNTC 2ZPSA 1VCQA 5A2MH 1GHBG 5IK2D 1DWDH 2VIOA 1E1QD 5EQQA 1LVMA 3GOVB 1GCTB 1AB9B 2BDYA 1D6RA 1K1OA 1OYTH 4I8LA 3W95A 4IMQA 3GISB 2ODPA 1GL0E 1UW7A 4HTCH 2LP6A 3HGNA 1LHFH 3WWBA 3KQDA 2QYIA 1QRXA 1V2OT 1ESBA 1UVUH 3ITIA 1C9TA 2FWWA 1C2KA 1FJSA 4A5TS 4UFDH 3TGJE 1YM0A 1BTZA 1C2DA 2P3FH 1SGIB 3RXCA 5FAHA 1ABIH 3P95A 2H2ZA 5EQRA 3A7WA 4LK4A 1SOTA 4UDWH 1ZSLA 4K3JA 3UNQA 4Q4LA 2W6ID 3JZ1B 4XOJA 2V0BA 1ZPCA 2PWXA 4AX9H 2BDAA 2KCOA 3RXLA 2P3TB 1OWIA 4MLFB 1PQAA 2PFEA 1E37B 2VNTA 1MZAA 1S81A 1L4DA 4B6FA 1DANH 1T4UH 2BOKA 2CF9H 3ATLA 3DSOA 2BD4A 1BMNH 3TK9A 2GZ9A 1AWFH 3MNCA 1HJAC 3SJ9A 2BD7A 1XXDA 2W3IA 3BTWE 5C5NA 3H7TA 4XBBA 1F5LA 3AVZA 1MKWH 3NXPA 1CBWC 1O3GA 1QIXB 5A8YA 1LO6A 4WVPE 4BTUB 2PSXA 1INCA 1DT2A 2H5CA 1YCPM 3MH6A 3VB7A 1PFXC 3NRLA 2SNVA 3CS0A 2F83A 2BB4A 3KQBA 3A8DA 2PTNA 3S9BA 1AE5A 4DGJA 5LPFA 3URCA 1OS8A 1B5GH 1ARCA 1NBMD 2ZP0H 3BIVH 1WTHD 2FS8A 1NRSH 3OAAD 1YPGH 4XDEA 1WQSA 4GHQA 5E0GA 2ZF0H 2FS9A 1EJMA 3MU5A 1WXRA 4K2YA 3ELAH 1WOFA 2ZQ2A 3HK3B 4ZKNU 3PO1B 1DICA 1P02A 4IC6A 1VR1H 3SGBE 3ZZ4A 1O2IA 4I7YH 2QIQA 1OP2A 3FVFB 2FP7B 4HZHA 5KECA 1WYKA 1SFQB 1Y3UA 1FXYA 3BTHE 2F9VA 1ZZZA 2AFQB 3PLPA 1V2TT 1GMHF 1CGJE 2FOAA 1ELFA 2QCYA 3QWCH 1LTOA 5FPYA 2BDBA 5GCHG 5HM2A 4U01A 2H9TH 1ZHRA 3BTTE 4F48B 2DUCA 2J2UA 1V3XA 1MMJN 2YNAA 5HIYA 1TQ0B 3R3GB 2BY9X 1C5VA 4GLYA 1O2PA 5EJLA 3DSGA 2XOKD 4QT8C 3SV8A 1C5SA 2BLQA 1QHRB 2FODA 1BT7A 3VFEA 1CA0B 4OGXA 1HXFH 3TJVA 5CDFE 1HFDA 2BQ6B 3K6YA 3LDXH 3MI4A 1F0RA 4RSPA 1RIWB 1HAGE 2D26C 1IQHA 5HYOA 3GYMA 1TALA 1GBIA 2PV9B 3P8NA 2NWNA 1FIWA 1P04A 1WCZA 3RXOA 4DOQA 4I8HA 1OYQA 1GBLA 2GT8A 1TGNA 5HKKD 5A09A 2C90B 3QTOH 1RD3B 2BHGA 4M7GA 2J5UA 1JRTA 3MQKC 3UFAA 2ZFTA 1MTSA 4KKDA 3W1EA 2EY4C 2ZPRA 2PGBB 3CNRA 5EU8A 1QL9A 1F0SA 2ZG0H 3UQVA 1BMLA 2PKSB 2UUKB 2FEQH 2DE9A 3E90B 4WXVA 3V7TA 1BBRH 4KTSA 3D62A 1IQIA 3DCLA 5T6GA 2P93A 3FKSD 3NK8A 4AYYB 2Q1JA 1W0YH 3F9FA 1UVSH 1Y5AT 1GBEA 4D7FA 1Z6EA 3RXPA 1GG6B 1GMDF 5CHAB 3T25A 1S82A 1QNJA 4PROA 2ALPA 1FY8E 2ZFFH 1GI4A 2IPQX 1HRTH 1SHHB 1RS0A 1XUKA 3RC5A 1FAXA 2BD9A 2ZFQH 1QURH 1CA8B 4NGAH 2ZA5A 1OSSA 1IQNA 2YMSC 1C5LH 5F8ZA 1H9IE 1KLIH 1GBAA 1T32A 2B8OH 2WPIS 2M2AA 2XRCA 3ZVAA 2Z9LA 1BMAA 2QN5T 1D3PB 4TWYA 4X6NA 1O36A 1ELDE 3KYFA 4K1TA 1NFUA 3SNDA 4E7RG 1G3EA 2G51A 5AFYH 1SB1H 1GBFA 1ANEA 5EOKA 1C4Y2 1ETTH 2Z94A 4JCNA 3FANA 3ESTA 4P00A 3SUEA 4CRGA 3SJIA 3BTDE 1O2HA 4MPXA 5C1UA 2ZU3A 1GI2A 1MTVA 1GHAF 1V2KT 3U98H 1GJ7B 4MNWA 3V12A 4THNH 1UHBA 2ODYB 1P9SA 3VB6A 4ABIA 2A5AA 3K65B 4TSFD 4NSVA 2SGDE 2ZKSA 8GCHG 2AMPA 1KDQB 3ZVFA 3Q00A 1FUJA 4MVNA 4ABAA 1C5TA 2V35A 4BAKB 2V7QD 1ETRH 3TJOA 2P8OB 3MTYA 2OP9A 1FPHH 1TONA 3VPKA 4YESB 2UWLA 5L2ZH 1UTMA 3SHCH 3T62A 3ZIAD 2GV6A 3RMOH 3EQ0H 1C9PA 1TGTA 1A3EH 1TNGA 1TRNA 3PV4A 3TIUA 4AFUA 2ANMH 4O3TA 1C5RA 3TU7H 4IC5A 2P16A 2A7JA 1SL3A 1YYY1 1YKTA 5T3HA 5GIBA 1WAYB 1OWKA 2FIRH 3EA9A 2XWBI 2TGDA 1SKYE 4JMYA 1GHWH 4UFGH 1H8DH 3TITA 4SGAE 4FUCA 4YTAA 1O32A 3RXRA 5I46H 1ELEE 1FN6A 1QBOA 2ZCHP 3O8BA 3SQHE 1EAIA 1QCPA 1O3NA 5C17A 2PUXB 2ESTE 1GI3A 2A4RA 3EAJA 3BIUH 2K0QA 2B0FA 3EDXB 4GSOA 2BX3A 5CMXH 1HJAB 2J97A 3SZEA 5FXLA 2Z7FE 1AFEH 1JMOH 4DY7B 4K5ZA 5GNDA 3TGIE 3IWMA 5DP9A 1CBWB 2FM2A 4KELA 3FN8A 3UB0A 1O2JA 3VB3A 3DA9B 1YPKH 2G52A 2WPJS 3KQEA 3OTPA 3TH2H 1IOEA 1WV7H 2ZCLP 1O2GH 1BRBE 4NA8A 4R8TB 1A5HA 3JZ2B 4K69A 1CHOG 4AORA 3S9CA 1DSUA 3T5FH 1P11E 1LHEH 1YBWA 3S0NA 3FFGA 1UCYK 4MNVA 1C1UH 4NA7A 1UJ1A 1XXFA 3HKJB 3SI4H 4Q7YA 4Y76A 3SNCA 3A86A 4HFPB 3MMGA 1O3AA 1S6HA 3WW7A 3SYJA 2VVCA 4B71A 1P2IA 1UTLM 1F5KU 5FBEA 1O5BB 2XNDD 3SHAH 1D4PB 4Y11E 1LHCH 2BLVA 1NRNH 1H1BA 2IJD1 2SNWA 1HAYB 1PPFE 1UTNA 1TX6A 3UOUA 2Y81A 4A7IB 1AVXA 4INHA 2YMSD 1O5AB 5EXNA 1HV7A 3QLPH 4ZAEA 1HJ9A 1TRYA 5EPYA 1O3IA 5K0HA 2P94A 3SU5A 1RRKA 2PHBA 3TPIZ 3FZZA 1CVWH 2WSSD 2QF0A 1S6LA 2CF8H 4X6OA 2OC7A 3MU0A 3BV9B 1MKXH 4K1SA 1GJDB 3ZZDA 2FDAA 2ZZUH 1PJPA 4UFFH 4Y0ZE 4I86A 2UWOA 1AD8H 1SGYE 2KAIB 1MBQA 1TNKA 3PWCA 2OC0A 2QXJA 2A2XH 1K1IA 1Y5UT 2J92A 3BEFB 2HVXA 4KGAA 8KME2 3CP7A 4AC9A 4Y7BA 3FZDA 1KXEA 1W0KD 2RDLA 1O2SA 3A82A 1C5UA 4U2WA 4U30A 2QV1A 1K9OE 1PQ5A 5E2OA 1GDQA 4Q7XA 5E0HA 4XBCA 3UTUH 2QXGA 2XBWA 3RM2H 3RU4E 3ATWA 4UE7H 1GHXH 4HI3A 2R0LA 4LXBH 1N6YA 2BY8X 2KM0A 2QC2A 4MDSA 2C93B 2VB0A 3T28A 2PKAA 3A8AA 4ZKSU 1UVTH 5C67A 5F8TA 3HATH 5C2ZA 5JB9S 4JYVH 1Q3XA 1Y5BT 1P10A 4OS2A 1NPMA 1C1QA 1QBVH 1BDAA 4MPUA 4ABBA 3E0NB 2GDDA 4CRCA 2QGRA 4WMDA 2AMDA 1SGCA 1G2MA 2WYJA 2J34A 1P3EA 1GBMA 1GJBB 1WQVH 1TA2A 1S0QA 3KGPA 1TPOA 2OCVB 5A8ZA 3AW0A 1IQGA 5FX5A 1SGDE 2YMSB 2ZIQH 1HAPH 1ID5H 1RGQA 1TWXB 4DJZB 2F9UA 1ZMNA 4A1VA 3U69H 1ZLRA 1SI5H 2W3KA 4IW4E 3OY6U 1Z8RA 2B5TB 3A7TA 1K1LA 1W2KH 2Z3CA 2LELA 5EODA 3GCTG 1LQDB 1BTPA 1DWCH 1K1JA 3F0PA 1C2HA 1FY5A 2VBCA 3GDSA 1J15A 1H9HE 2VIPA 1GG6C 1O3JA 1TFXA 5CHAC 1TBQH 3RXFA 4DVAU 1KLTA 3MU8A 3SU6A 2QY0B 3A7YA 1NFXA 1B0EA 3K6ZA 3SU1A 3GDVA 3L3TA 3UNRA 1FY1A 2IOTA 3RM0H 2D8WA 3PLKA 1TNJA 2H1UA 3RU4T 3EGKH 5JB8S 3KQCA 3OYPA 1A5GH 4JK6A 2O8TA 3ATIA 5F03A 3UR6A 1C5ZB 2A5KA 4ZROA 1GVKB 3F9GA 1UTPA 2PTCE 4AFSA 4E7NA 5F6MA 2ZU5A 4O03A 1LVOA 4AGKA 1DX5M 1J17T 2A5IA 3AAVA 4ZXYH 2DE8A 1HAOH 4FU8A 2CN0H 1UVPA 3OTJE 2UUYA 3LGUA 4ACAA 1DITH 1PPHE 1Q31A 2OC8A 3B9FH 1TX7A 3TNSA 4NZLA 1TRMA 2JH6D 3A83A 1EB2A 3D49H 5AVDA 2JETC 2A45B 3M7TA 1IQMA 2AERH 3BTFE 1HYLA 1O35A 2J98A 1ZTKA 4YLQH 1ACBE 1MAXA 4OS6A 3UUZA 4E06H 2ZNKH 3TLOA 3WWFA 2FYQA 1YP9A 2FI5E 2FI3E 2PLXA 1NTPA 2V6NA 4WF8A 3P8GA 5JPMH 4ZMAH 2KCYA 1HAHH 1TIOA 5CE1A 2TIOA 2P8OC 3MH5A 4LZ1H 3MWIU 3F3BA 1AFQC 1RTKA 1MAYA 1L4ZA 1HBTH 4ABDA 4X1PU 1C2FA 1RXPA 4GCHF 2ZPQA 2BY5X 1LDTT 3SU3A 1DS2E 1YPEH 2HNTF 2G4TA 3BG4C 2BDCA 2SGQE 5C94A 1O2RA 5AFZH 1NY22 1N8OC 2BQWB 3EYDA 4ZUHA 1TOMH 4CRDA 2VGCC 5FPSA 1AIXH 3LC3A 2G81E 1BBRK 4LZ4B 1ELCA 4VGCC 1E34B 5DJ7A 3TVJB 1EAXA 1P0SH 4X8VH 2GP9B 2GKVE 4YOIA 1SHYA 3SORA 1C1RA 3GYLB 3IG6B 2HPQH 3PB1E 3Q3YA 5BRRE 3KYGA 2BY6X 3KF2A 3M5NA 4YLUA 2XBYA 4JZFH 3RLWH 3F9EA 1NO9H 1ELAA 1O3CA 2GZ8A 2R3YA 3K2UA 4AB8A 3ZZ8A 1ORFA 3UNSA 1S83A 4A6LA 1DWEH 2OBQA 2VINA 1K22H 2JH0D 1F5RA 4FUDA 5F8XA 1NU7B 1YPHC 2W7SA 1SG8B 1O2NA 1SQOA 1G3CA 4CHAB 2JH5D 3BSQA 2AMQA 4IN2A 1EZXC 2AYWA 1EATA 4BAHB 3F68H 3M5OA 3MOCA 2ZDNA 5FBIA 1YCPK 3MNSA 1C2MA 4TWWA 1C2GA 1ANBA 1GJAB 1C1TA 1ZHMA 1SC8U 2ZO3H 5JBAS 1QFKH 4X1NU 3GY8A 3VXEH 1YPJH 1B7XB 4TPIZ 1WSSH 3GY2A 5EQSA 1O34A 1LVBA 2G5NA 1G37A 3M3VA 1MCVA 3TH4H 3LOXA 2GCHF 2Y80A 3A7ZA 3ODDA 2VU8E 1SQRA 2TBSA 4X6MA 3S7KB 3NCLA 3UAIC 3ZZ7A 1BMFD 1W11U 4X8SH 3AK5A 1O2KA 3KIDU 3MHWU 4RT0A 1OXGA 2P3UB 1V2JT 1JRSA 2HLCA 3RXAA 6GCHG 1LCYA 1YWUA 2J4IA 3G01A 2FXRA 1A0JA 1YLNA 4ISHH 1GHBF 2ZDKA 3MU1A 5KEDA 1C1WH 5DPAA 1MTWA 1TPAE 2VJ1A 1QRWA 3LIWA 1V2WT 1CT0E 5JBCS 1Y3XA 4AG1A 5LPRA 3KNXA 1BJUA 1TE0A 2TPIZ 1O37A 2J95A 4YOJA 5ESBA 2FI4E 4LOYH 3M3SA 3V13A 2G5VA 1GI0A 2Z9GA 3A81A 4K1EA 3ZZ5A 2ODQA 5T1VA 3BG8A 3HK6B 2QF3A 1SQAA 2K1QA 3ZVBA 3MO3A 5TJXA 1QGFA 4I8GA 4E05H 9LPRA 1KXCA 2BX4A 1UHBB 1O2QA 1HAVA 3SI3H 4A1XA 3SNAA 3NUMA 4P02A 4FUGA 1P2QA 1YF4A 2KR7A 4TY6A 4HG6A 5GXPA 2FPZA 2H9EH 1HLTH 1T8NA 2UWPA 2VIVA 2BD8A 1L0ZA 1H4WA 3ODFA 3P6ZB 1PPCE 3VB4A 3QX5H 4ABFA 1QBNA 5A0BA 2FOBA 1WDIA 2WPHS 2GGVB 1TA6A 1ANCA 3U8TH 3QZQA 4OM9A 1C2EA 1C1MA 1COWD 3MFJA 1GMCG 1TLDA 1MQ5A 5LPEA 5C3NA 1KXDA 2RA3A 3A88A 1E1RD 1G2LA 1XUJA 4FUIA 4H42U 2ZQ1A 4BXWA 2PUQH 4RT1A 1MU8B 3OY5U 3SJKA 1F2SE 1TOCB 2TGPZ 4FUBA 5ETXA 2C8XB 1A7SA 2J9NA 3TK6A 3RUOA 1K1NA 1O33A 1JBUH 1T8OA 4F55A 2HWLB 3PTNA 1TGBA 2HOBA 3F2FA 5EGMA 3N7OA 1NZQH 1AZ8A 1FDPA 3N7DA 5J4QA 3OX7U 1EOJA 2ZDMA 4CRAA 5FCKA 3SV9A 4B73A 2RG3A 2PW8H 1MU6B 3SV2H 4GPGA 1DUAA 1TAWA 5JBBS 1BRUP 1SGQE 4UD9H 1P2JA 1GI7B 3WY8A 2ZU4A 2Y82A 9ESTA 1SBWA 2V3OH 2A7HA 3A8BA 1BQYA 1FZZA 3M7UA 2BD5A 2Y5HA 4XBDA 1CT2E 1NRRH 1AE8H 4ESTE 2FYRA 1C4V2 1NN6A 1NM6A 1V6DA 2JETB 1AY6H 2AGIX 1MTUA 3FP8E 2QF5A 4NZQA 1JIRA 1OKXA 4AG2A 4A92A 2VIQA 1ELTA 1E35B 1OPHB 2FOHA 4AFQA 4UONA 5GCHF 3T29A 1BA8B 2SGAA 4JZ1A 2ZHEH 2EC9H 2ZGXH 3AW1A 1SLUB 1UTJA 1O5CB 4F4OC 4Q7ZA 1SR5C 2RA0A 6ESTA 1OP0A 1BTXA 5J4SA 1G36A 1ZPZA 3CENA 4WY3A 1AFQB 4ZKRU 1BHXF 1O2VA 3SN8A 1BTWA 1EZUC 3H09A 1GJ6A 3P8FA 1UK3A 3GY4A 1CE5A 1KSNA 1O2TA 1GL1A 1VITG 2B9LA 3O8DA 3EE7A 2R9PA 4WJG2 5FL7D 3PTBA 4ZHMU 3KCGH 1GHZA 2FO9A 2A4OA 4RKJB 2I6SA 2XNIA 2CGAA 3BG4B 2OTVA 4X8UH 4WWYA 2ZI2H 1QRZA 2BVRH 3LGWA 3M3TA 3NWUA 1N8OB 4X0WU 2O8WA 2A7CA 4K8BA 4YXWD 2H5DA 3BEUA 1T8MA 2VGCB 3PMBB 3A85A 4NG9H 3LGIA 1L1JA 4MPVA 3TNTA 3SGAE 2FOFA 4X8TH 7GCHF 1Y3YA 2ZHDA 4VGCB 1F0TA 1HXEH 3E16B 2BOHB 2O8UA 2XC5A 1NESE 1GPZA 4FUHA 1CT4E 5T6DA 3U28C 3T2NA 1MTNC 1RFNA 1Y3WA 3GY5A 1TPSA 2KZ4A 1EJNA 1FLEE 2FMJA 3SV7A 4D8NA 3TH3H 4IS5A 2JKHA 2THFB 3QO6A 2TRMA 2R0KA 2BVSH 1NBME 4J1YA 3MYWA 3AASA 4IN1A 3ZZBA 5EW1H 1K21H 1VCWA 4BTIB 2BDIA 1F0UA 2WINI 1DXWA 1AVGH 1UVOA 2FOGA 4B74A 1XMNB 3PMHB 1W8BH 4O3UA 1V2NT 3MNXA 1O38A 2GCTC 1A4WH 1P03A 2BZAA 3HKIB 2STBE 1TPPA 4INLA 2PKAB 1G32B 3A7XA 2NU4E 1K1MA 3ZVGA 1QZ8A 1GI6A 3SV6A 3A7VA 4OS5A 1EOLA 2FLRH 1HJ8A 4X2XA 4BAMB 1C2IA 4B6EA 4NSYA 1EAWA 3MU4A 4AZ2B 1P2OA 1TABE 2GD4B 1EPTA 2XW9A 1TQ7B 1CQQA 2ZEBA 3Q3KA 1TNHA 1ZRBA 3V0XA 1XVOA 4I8JA 2RFKC 5C0UA 1BTUA 2A4QA 7KMEH 2AGEX 2BDGA 4X1SU 2ZGJA 5GWZA 1DE7H 6CHAB 1H8HD 3O8CA 1W7GH 1C4U2 1U6QA 2SFAA 4GHTA 3RXDA 4CHAC 5FHTA 4FUJA 3ZZ3A 3E1XB 4GVUA 2Y6TA 2UUFB 4CH2B 3RLYH 5K7RA 1YGCH 2OXSA 4DG4A 4IBLH 1AKSA 5DP7A 1HUTH 5C20A 2HNTE 1NS3A 2C3SA 8GCHF 1FMGA 5C1XA 1C1SA 1O3EA 3UWJH 3V3MA 4NWLA 1BUIA 1W3CA 2GZ7A 1GBCA 1SPJA 1ZMJA 3GCHC 4OGYA 1ZRKA 3SU4A 3ATKA 5AHGH 1KMHB 3MO9A 4HGCA 1ANDA 3PROA 1V2QT 2GX4A 1P3CA 1QB9A 2JIZD 1WTGH 1PQ7A 2UUJB 4Y8YA 3UIRA 3M37A 1LVYA 2Q6GA 1GVZA 2A32A 2Z9IA 4Y0YE 4YT6H 1OWEA 1HAZB 4BXSA 2BD3A 1HGTH 4BANB 2PR3A 1O0DH 4ASUD 2F9BH 1P12E 1QR3E 3L33A 4M9FA 1VKYA 1W10U 1Q2WA 1C5NH 3I78A 2J38A 1WBGB 3MH4A 3RXIA 8LPRA 2GTBA 1PPZA 2F43B 1HNEE 5DN6D 1KXBA 4UEHH 2L74A 1L1NA 3OEED 1W14U 2A4GA 1EZSC 1TMUH 2WV9A 3O8RA 4X2VA 3SU0A 1XUFA 2A1DB 1L1GA 4ACBA 1OP8A 1AHTH 1PYTC 1O2ZA 2GDEH 5EXLA 1K28D 1NU9A 4Y8ZA 3P70B 2J98B 3GY6A 5EG4A 3NKKA 2GMTC 2XCNA 3DFLA 1IQLA 3STJA 2QAAA 2VWLA 1XUHA 1ZGVA 1GWAA 3BTEE 1O30A 1T4VH 1HAXB 4Q63A 3TJUA 1KYNA 2FTMA 1ZOMA 1K1PA 1P06A 3N7EA 5A8XA 3BTKE 4D9QA 3I29A 1MQ6A 1IQFA 2ILNA 3U8RH 2PGQB 1MKWK 1QA7A 2ZGCA 5H4IB 1S0RA 4DIHH 2R3UA 1A61H 3GCOA 4J2YB 1V2MT 3R0FA 3ZZCA 3T26A 1C1NA 1P09A 1O3OA 1FN8A 5ESTE 3D23A 2STAE 1FY4A 1P05A 1GBHA 1KXAA 3OEHD 4FVBA 1DY8A 1GJ5H 4Z1MD 5PTPA 1BHXB 2XWAA 2B7DH 5T6FA 3QGJA 5DO4H 1QA0A 1QJ7B 1V2VT 4WMFA 1HAIH 4BTTB 1ZMLA 1AVWA 1DDJA 2ZHQH 5B6LA 2TGAA 5EXMA 3E8LA 1O3KA 1YPLH 3HGPA 1UCYH 1SGEE 3RC4A 3PMAB 1J9CH 1Y3VA 2Z3EA 2XXLA 4AYVB 2K8IA 5I25A 4WH6A 3TK5A 1NRQH 3E3TA 3QN7A 5DGJA 4H6TA 5GJ4B 3RXBA 3SJ8A 4I8KA 1Z1IA 1VCPA 3LT3A 4MNXA 1ESTA 3F9HA 4X6PA 1P2NA 3K9XB 2BXUH 1FY3A 2D2DA 2OBOA 1BJVA 1AUTC 4DIIH 1KIGH 2FX6A 4X1QU 2ZTXA 4B76A 1O3BA 1V2PT 1PQ8A 1QQ4A 3DHKH 1O3HA 1TX8A 5EJZA 2ZDAH 4JZDH 2VH0A 2ZHFH 2BLWA 1GCDA 2Z3DA 4OS4A 1P01A 2VH6A 4X2YA 2HLDD 5IYTA 3DD2H 3LPRA 1SSXA 1MH0A 2VVUA 3STIA 4XE4A 1UCYE 4JK5A 2GVFA 1LQEA 4RN6A 5JBTA 3MH7A 1YC0A 1P9UA 3L6PA 1GMHG 1TBRH 1KTSB 2A0QB 5HMAA 4DW2U 3ZZ6A 1GI5A 2AIQA 1GDUA 3T27A 1SLWB 5CHBA 1DXPA 2C8WB 3Q3XA 4TY7A 1P2MA 1EPTC 4IMZA 4H6SB 3FP7E 1KTTB 1KY9A 2BDHA 1OWDA 2YOLA 1XKAC 1TBZH 3BTGE 5G4BA 1MTNB 2WUBA 2WPDD 2BM2A 4CRFA 5AF9H 1O3MA 1D9IA 1A3BH 2CXVA 1P2KA 3HPTB 4BNRA 4U32A 1ELVA 3RDZA 5L30H 4FU7A 5DG6A 4H4FA 4ZKOU 1H8IH 2XCFA 1FPCH 1ABJH 2QA9E 4O9VA 1CGHA 1C2JA 1C5PA 1NFWA 1ZTJA 4B2AA 5FX6A 2GCTB 2RDEA 3SOSA 4CRBA 4ZXXH 1BOQA 1JIMA 3URDA 5C5OA 2ZU1A 3VGCB 1THRH 4INKA 4DCDA 1XX9A 1BB0B 2ANKH 1O3LA 1DWBH 1ZYOA 3GY7A 1EUFA 2WPMS 3UREA 2C8YB 1PYTD 1K0HA 1MABB 2C8ZB 2OUAA 4Y7AA 1Z71A 4B2CA 5B6OA 5DP6A 3SUGA 3GCTF 2J94A 1FNIA 1DPOA 2F91A 3ZYEA 3M5LA 2G8TA 1HAVB 1SQTA 7LPRA 1N1LA 3EA7A 3SO3A 1DOJA 1XUIA 3A8CA 1ZJKA 2QXIA 1AGJA 1O2LA
chains in the Genus database with same CATH topology
1S85A 4JYUH 2F9OA 1GMDG 1V2LT 3GDUA 3M35A 4ZH8A 1K2I1 3LGYA 3QGNB 1BRAA 3LGTA 1N6XA 1HIAA 1Y59T 2ZHWH 2F9PA 4ISLA 1LPZB 3EA8A 2HALA 4F49A 1CSOE 3BTQE 1GJ9B 4WMEA 3S7HB 1ELBA 1LPKB 2Y5FA 1O3PB 1QB1A 2SGEE 1LKBA 2M5TA 3GCHB 3MO6A 3ZV8A 4CR5A 2FTLE 3LGVA 2G00A 4ABGA 1GBDA 3LC5A 3P8OA 3E6PH 3A87A 2BMGB 6CHAC 4A1TA 3PM3A 4FUFA 1SFIA 3RXVA 1V2ST 1Z8GA 1THPB 2CHAC 1D6WA 4MTBA 1TMTH 1S6FA 1FI8A 1GI1A 2FLBH 3DT0H 1G3BA 3SU2A 1C5YB 1GHYH 1GHAG 3BEIB 3RXQA 1DSTA 1TMBH 1E0FD 2Q6FA 1MZDA 1XVMA 2O8MA 1DLEA 5FCRA 1EP6A 3BN9A 5LH8A 2ZU2A 3B8JA 3VEQB 2QXHA 3RXUA 3PMJA 3M36A 1B0FA 2XC0A 4B75A 5L2YH 3FP6E 1EP5A 4NFEA 2PSYA 5DK1A 1OX1A 3RMNH 3VB5A 1F7ZA 3E91A 3QK1A 1NRPH 2VWMA 3MNBA 1D3QB 1O2MA 3UY9A 1CHGA 2HRVA 4TPYA 4I31A 2TGTA 3RXKA 1FIZA 4Q2KA 3ZZAA 1AU8A 4CBOA 3AAUA 1VGCB 5JDUB 3DUXH 2Y5GA 2BQ7B 4NFFA 3GCNA 1VITH 2GMTB 1TB6H 1TNIA 5TCAA 1AWHB 5HM9A 2ZC9H 4YZUA 1EKBB 4XSKU 3BF6H 1MUEB 1GBTA 4YT7H 3RXGA 4I33A 5E8EH 3Q77A 3RXEA 1O31A 5E2PA 2EI6A 3ENSB 2P95A 2BZ6H 3SNEA 1DVAH 1GJ4H 3RMMH 3PYHA 1VJ9U 1GI9B 1QL7A 2VIDA 3DFJA 1DY9A 4ISIH 7GCHG 5DKMA 3S69A 3ZYDA 1E36B 1OWJA 1VJAU 1AQ7A 1Z8IB 3I77A 1Z1JA 5DP4A 1EASA 4CREA 4Y79A 2IPHA 1O2OA 4Y8XA 2Z9JA 1UMAH 2ULLA 1BRCE 4ABHA 1VZQH 2A31A 3LKWA 4MG3A 3FAOA 3RU4D 5C1YA 1ZJDA 2OINA 3SUFA 1RJXB 4OS1A 3SNBA 3M7QA 1O2YA 1SVPA 1QTFA 2ZDLA 2Q6DA 1T31A 4GAWA 1BIOA 1O2XA 1O5FH 2G4UA 4WH8A 1SLVB 1V2UT 1E38B 1XUGA 2AEIH 3P17H 2XYAA 1IHTH 1LHGH 4CR9A 2W26A 4Z6AH 2SGFE 1TGCA 3TGKE 2IJOB 2SGPE 3U9AH 1UTQA 2BY7X 1IHSH 1A0HB 1BBRE 1GGDC 1GBKA 1W12U 1MKXK 2FOCA 3SUDA 3LJOA 1T7CA 2VWOA 1GVLA 3NPSA 4FVDA 3KN2A 6GCHF 3LH1A 1D3TB 3UPEA 1YCPH 1IQJA 1C5XB 3RXJA 4ABEA 2AIPA 5HGGA 4DURA 2ZFRH 1O3FA 1G9IE 1KLJH 3F6UH 4CH8B 3IITA 1SGNE 4X2WA 1QB6A 2BTCE 1HDTH 3ATMA 1UTOA 1EPTB 1Y8TA 8ESTE 1NROH 2W7UA 1A46H 4D76A 1O5EH 2C4FH 4YM9A 2ZTZA 1CO7E 1GHVH 1ESAA 1X7AC 2ANYA 3ZZ9A 1O3DA 3UOPA 1FONA 1H9LB 3LH3A 2FX4A 3KHVA 1QY6A 3SBKA 1ZSJA 2YNBA 2IN2A 2AH4X 2WYGA 4KP0A 5LGOA 3NZIA 4I32A 2ZCKP 5TCCA 3RXMA 1AKSB 1C1VH 1LKAA 2OLGA 3F1SB 3OSYA 2CMYA 1DFPA 4ASHA 2W5EA 3B23B 3A80A 1G3DA 2VVVA 4DT7B 1OWHA 1GCTC 3QZRA 1AB9C 2BXTH 3C27B 1MCTA 2WPLS 2WV4A 1ELGA 1O39A 2NU1E 3Q76A 2RCEA 4Z0KA 3U8OH 3ZV9A 3RXSA 3U1IB 3UQOA 1GMCF 3H7OA 4GUXA 2WPKS 4NA9H 1KXFA 4NIYA 2Z9KA 1EZQA 1ZPBA 1HCGA 7ESTE 1PPEE 2FESH 5SGAE 1SGRE 1AN1E 4B2BA 2D1JA 1L2EA 1Z6JH 1FAKH 4KTUA 4NWKA 2ALVA 1ZHPA 3VGCC 3KL6A 1LMWB 2ZGBH 1S5SA 1GI8B 1SGFA 4TYDA 4JZIA 4D7GA 1BMMH 1XM1A 2VWNA 4KTCA 5FPTA 4AB9A 4ZHLU 1BTHH 2OC1A 2FOEA 4Y10E 4ISNA 1M9UA 2WUCA 2HGTH 2NU0E 1C5QA 1JOUB 3D65E 1V2RT 1FQ3A 1EB1H 3SQEE 1KDQA 1AI8H 2GT7A 3SJOA 1UK4A 3OU0A 1OOKB 4IGDA 1SGTA 2ZTYA 4MNYA 1A0LA 2O8LA 3ZVCA 1QL8A 2OD3B 4CBNA 3LONA 2CHAB 1O2WA 5HXFA 1NT1A 4FUEA 3EE0B 2XC4A 3SZNA 1FV9A 3UR9A 1JWTA 1UTKA 1HB0B 2ZGHA 1TNLA 4NIWA 1SLXB 3A89A 1ZGIA 4ABJA 4Y71A 2BLOA 4MPWA 4OS7A 3LJJA 2CV3A 3ZVDA 5EPNA 3C1KA 4BAQB 2NU2E 2ANWA 3KEEA 3RP2A 2ZWLH 2Z6BD 3RXHA 4AFZA 5JYIA 2EEKA 5IDKA 1MBMA 2BD2A 2AS9A 4MQAA 5GPIB 3ZVEA 1EAUA 1W13U 1VITF 1GDNA 1UK2A 3SGQE 1SGPE 5A0CA 1W7XH 1P8VC 3PO1C 3QDZB 1DUEA 2AGGX 1HPGA 5BPEA 5DP3A 3E0PB 2ZDVH 2V3HH 5EW2H 1GBJA 1LHDH 1TGSZ 2HPPH 1T8LA 3A84A 1BITA 4Y6DA 2FZZA 3PLBA 1A1RA 2WV5A 1TYNA 1C5WB 2CJIA 5GDSH 1QQUA 4BAOB 2ZECA 2OQ5A 4JYTA 1XKBC 4FU9A 1VGCC 1C5OH 1PPBH 2I6QA 3RMLH 1SGFG 1CA0C 2F3CE 3SW2B 1BZXE 4GCHG 4NCYA 3PWBA 3VXFH 2ASUB 2F9NA 4BOHA 3H5CB 1RIWC 1A2CH 1GBBA 1J8AA 5DP8A 1ETSH 3LU9B 3S9AA 1CHOF 4AN7A 1O2UA 4K60A 4XFQA 4YO9A 1BTYA 1AMHA 3GICB 4B1TA 1F92A 1ARBA 3M61U 3W94A 2BYAX 1YPHE 3QTVH 1P57B 1SMFE 2NU3E 2H6MA 1WU1A 1EX3A 4RKOB 2P59A 6LPRA 2LPRA 4JZEH 2ZFSA 5ABWA 3TJNA 3CS7A 1O5DH 2R2WU 2EI8A 2GV7A 1DM4B 1CGIE 1IQKA 2PKSC 1UO6A 2A2QH 4O97A 1G30B 1RTFB 1EQ9A 1Z8JB 2ZFPH 1CU1A 1YLDA 2Y7ZA 1IQEA 1GGDB 4WXIA 1GJ8B 1AO5A 4YOGA 1C5MD 1AUJA 1DLKB 2KAIA 5A0AE 3U1JB 2R2MB 2XBXA 5E0JA 1YPMH 2OQUA 1C1OA 1D3DB 1J16A 1MD7A 1AZZA 1THSH 1GJCB 2O9QA 4R0IA 4X1RU 4FXGH 4AOQA 2EI7A 4Q80A 3UWIA 5DP5A 2BVXH 5L6NH 1J14A 4K8YA 2VIWA 1PPGE 4NIVA 1YLCA 1QJ1B 1ZSKA 3QUMP 2Y7XA 2XBVA 1EXFA 1ZR0A 1WUNH 1MD8A 2XTTB 1NC6A 3P92A 2H9HA 1ZTLA 2LNCA 1IAUA 4ISOA 1S84A 1Z7KA 2GCHG 3BTME 3M5MA 1QJ6B 1BCUH 1C2LA 4SGBE 4AGJA 1EJAA 2EA3A 1C1PA 4UFEH 1HIAB 1LPGB 1SOZA 3GY3A 1W0ZU 1A5IA 1NFYA 2G55A 2FOMB 3RC6A 4D9RA 1O5GH 1RTLA 1JXPA 4ZHAA 3RXTA 4NIXA 2HNTC 2ZPSA 1VCQA 5A2MH 1GHBG 1DWDH 2VIOA 5EQQA 1LVMA 3GOVB 1GCTB 1AB9B 2BDYA 1D6RA 1K1OA 1OYTH 4I8LA 3W95A 4IMQA 3GISB 2ODPA 1GL0E 4HTCH 3HGNA 1LHFH 3KQDA 2QYIA 1QRXA 1V2OT 1ESBA 1UVUH 3ITIA 1C9TA 2FWWA 1C2KA 1FJSA 4A5TS 4UFDH 3TGJE 1YM0A 1BTZA 1C2DA 2P3FH 1SGIB 3RXCA 5FAHA 1ABIH 3P95A 2H2ZA 5EQRA 3A7WA 4LK4A 1SOTA 4UDWH 1ZSLA 4K3JA 3UNQA 3JZ1B 4XOJA 2V0BA 1ZPCA 2PWXA 4AX9H 2BDAA 3RXLA 2P3TB 1OWIA 4MLFB 1PQAA 2PFEA 1E37B 2VNTA 1MZAA 1S81A 1L4DA 1DANH 1T4UH 2BOKA 2CF9H 3ATLA 2BD4A 1BMNH 3TK9A 2GZ9A 1AWFH 3MNCA 1HJAC 3SJ9A 2BD7A 1XXDA 2W3IA 3BTWE 5C5NA 3H7TA 4XBBA 1F5LA 3AVZA 1MKWH 3NXPA 1CBWC 1O3GA 1QIXB 5A8YA 1LO6A 4WVPE 4BTUB 2PSXA 1INCA 1DT2A 2H5CA 1YCPM 3MH6A 3VB7A 1PFXC 2SNVA 3CS0A 2F83A 2BB4A 3KQBA 3A8DA 2PTNA 3S9BA 1AE5A 4DGJA 5LPFA 3URCA 1OS8A 1B5GH 1ARCA 2ZP0H 3BIVH 1WTHD 2FS8A 1NRSH 4XDEA 1YPGH 1WQSA 4GHQA 5E0GA 2ZF0H 2FS9A 1EJMA 3MU5A 4K2YA 3ELAH 1WOFA 2ZQ2A 3HK3B 4ZKNU 3PO1B 1DICA 1P02A 4IC6A 1VR1H 3SGBE 3ZZ4A 1O2IA 4I7YH 2QIQA 1OP2A 3FVFB 2FP7B 4HZHA 1WYKA 1SFQB 1Y3UA 1FXYA 3BTHE 2F9VA 1ZZZA 2AFQB 3PLPA 1V2TT 1GMHF 1CGJE 2FOAA 1ELFA 2QCYA 3QWCH 1LTOA 5FPYA 2BDBA 5GCHG 5HM2A 4U01A 2H9TH 1ZHRA 3BTTE 2DUCA 2J2UA 1V3XA 1MMJN 2YNAA 1TQ0B 3R3GB 2BY9X 1C5VA 4GLYA 1O2PA 4QT8C 3SV8A 1C5SA 2BLQA 1QHRB 2FODA 1BT7A 3VFEA 1CA0B 4OGXA 1HXFH 3TJVA 1HFDA 2BQ6B 3K6YA 3LDXH 3MI4A 1F0RA 4RSPA 1RIWB 1HAGE 2D26C 1IQHA 5HYOA 3GYMA 1TALA 1GBIA 2PV9B 3P8NA 2NWNA 1FIWA 1P04A 1WCZA 3RXOA 4DOQA 4I8HA 1OYQA 1GBLA 2GT8A 1TGNA 5A09A 2C90B 3QTOH 1RD3B 2BHGA 4M7GA 1JRTA 3UFAA 2ZFTA 1MTSA 4KKDA 2ZPRA 2PGBB 3UQVA 5EU8A 1QL9A 1F0SA 2ZG0H 1BMLA 2PKSB 2UUKB 2FEQH 2DE9A 3E90B 4WXVA 3V7TA 1BBRH 4KTSA 3D62A 1IQIA 5T6GA 2P93A 4AYYB 3NK8A 2Q1JA 1W0YH 3F9FA 1UVSH 1Y5AT 1GBEA 4D7FA 1Z6EA 3RXPA 1GG6B 1GMDF 5CHAB 3T25A 1S82A 1QNJA 4PROA 2ALPA 1FY8E 2ZFFH 1GI4A 1HRTH 1SHHB 1RS0A 1XUKA 3RC5A 1FAXA 2BD9A 2ZFQH 1QURH 1CA8B 4NGAH 2ZA5A 1OSSA 1IQNA 1C5LH 5F8ZA 1H9IE 1KLIH 1GBAA 1T32A 2B8OH 2WPIS 2XRCA 3ZVAA 2Z9LA 1BMAA 2QN5T 1D3PB 4TWYA 4X6NA 1O36A 1ELDE 4K1TA 1NFUA 3SNDA 4E7RG 1G3EA 2G51A 5AFYH 1SB1H 1GBFA 1ANEA 5EOKA 1C4Y2 1ETTH 2Z94A 4JCNA 3FANA 3ESTA 3SUEA 4CRGA 3SJIA 3BTDE 1O2HA 4MPXA 5C1UA 2ZU3A 1GI2A 1MTVA 1GHAF 1V2KT 3U98H 1GJ7B 4MNWA 3V12A 4THNH 1UHBA 2ODYB 1P9SA 3VB6A 4ABIA 2A5AA 3K65B 4NSVA 2SGDE 2ZKSA 8GCHG 2AMPA 1KDQB 3ZVFA 3Q00A 1FUJA 4MVNA 4ABAA 1C5TA 2V35A 4BAKB 1ETRH 3TJOA 2P8OB 3MTYA 2OP9A 1FPHH 1TONA 3VPKA 4YESB 2UWLA 5L2ZH 1UTMA 3SHCH 3T62A 2GV6A 3RMOH 3EQ0H 1C9PA 1TGTA 1A3EH 1TNGA 1TRNA 3PV4A 3TIUA 4AFUA 2ANMH 4O3TA 1C5RA 3TU7H 4IC5A 2P16A 2A7JA 1SL3A 1YYY1 1YKTA 5T3HA 5GIBA 1WAYB 1OWKA 2FIRH 3EA9A 2XWBI 2TGDA 4JMYA 1GHWH 4UFGH 1H8DH 3TITA 4SGAE 4FUCA 4YTAA 1O32A 3RXRA 5I46H 1ELEE 1FN6A 1QBOA 2ZCHP 3O8BA 3SQHE 1EAIA 1QCPA 1O3NA 2PUXB 2ESTE 1GI3A 2A4RA 3EAJA 3BIUH 2B0FA 3EDXB 4GSOA 2BX3A 5CMXH 1HJAB 5FXLA 2Z7FE 1AFEH 1JMOH 4DY7B 4K5ZA 3TGIE 3IWMA 5DP9A 1CBWB 2FM2A 4KELA 3VB3A 1O2JA 3DA9B 1YPKH 2G52A 2WPJS 3KQEA 3TH2H 1IOEA 1WV7H 2ZCLP 1O2GH 1BRBE 4NA8A 4R8TB 1A5HA 3JZ2B 4K69A 1CHOG 4AORA 3S9CA 1DSUA 3T5FH 1P11E 1LHEH 1YBWA 3S0NA 3FFGA 1UCYK 4MNVA 1C1UH 4NA7A 1UJ1A 1XXFA 3HKJB 3SI4H 4Q7YA 4Y76A 3SNCA 3A86A 4HFPB 3MMGA 1O3AA 1S6HA 2VVCA 4B71A 1P2IA 1UTLM 1F5KU 5FBEA 1O5BB 3SHAH 1D4PB 4Y11E 1LHCH 2BLVA 1NRNH 1H1BA 2SNWA 1HAYB 1PPFE 1UTNA 1TX6A 3UOUA 2Y81A 4A7IB 1AVXA 4INHA 1O5AB 5EXNA 1HV7A 3QLPH 4ZAEA 1HJ9A 1TRYA 5EPYA 1O3IA 5K0HA 2P94A 3SU5A 1RRKA 2PHBA 3TPIZ 3FZZA 1CVWH 2QF0A 2CF8H 4X6OA 2OC7A