1OP8A

Crystal structure of human granzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
234
structure length
234
Chain Sequence
IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the apoptosis-inducing human granzyme A dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Granzyme A
total genus 50
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.78: Granzyme A.
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A02
1SGCA 4IW4E 1AE5A 1FAXA 1WV7H 1C2IA 3SJIA 5BRRE 3TNTA 1BHXF 1EJAA 1P9UA 3RXGA 3TJOA 2STBE 1GHWH 1T31A 2YOLA 5GJ4B 3V3MA 1XUIA 1W11U 1O39A 2OC0A 1ZMJA 2ZECA 1P2IA 2G81E 5AFYH 2VU8E 1M9UA 1GWAA 2BD2A 3GY6A 1KYNA 1IQEA 2P93A 3SNCA 1GHBF 2G51A 4H4FA 2FLRH 2HRVA 4A5TS 1WTHD 4YOGA 1C9PA 2F9VA 1ABIH 1IQGA 2H9HA 1HAVA 3ZVCA 4Z0KA 1AMHA 3LDXH 1NT1A 2ZPQA 1W0YH 3A89A 1L4DA 5E0JA 3RXVA 3Q3YA 4RN6A 1KXBA 2VWMA 1LVYA 1F2SE 1DWEH 1TNGA 3F68H 2BLOA 1HUTH 4ZMAH 2A4QA 3ESTA 4TYDA 1GDNA 1HJ8A 1MTVA 1THSH 2VB0A 2WINI 1AUJA 1TRYA 3ZZAA 1W13U 1AQ7A 3MO9A 1MMJN 1GBJA 1UK3A 2FWWA 2ZHQH 1RIWB 1YKTA 3GCTF 2A7JA 5T3HA 1V2VT 3TJVA 2WUBA 4CR5A 1BMLA 1VCPA 1XM1A 5FAHA 3SUFA 2FPZA 1DOJA 2FOEA 2ZA5A 5CE1A 5FCKA 1UTPA 1A1RA 2FYQA 3MH7A 3U1IB 2F9PA 1QHRB 4A92A 2O8WA 2WPJS 4DG4A 3STJA 2V3OH 1O3OA 3SUEA 2PTNA 3K2UA 2ZHFH 2A5IA 1BRUP 1P05A 2FESH 3FP6E 3QDZB 4KELA 1HAIH 5IDKA 1GMHF 4K8YA 1JWTA 1O5FH 1TPSA 4AZ2B 2J94A 1G2LA 2UWLA 1KIGH 1YPGH 4Q2KA 3EGKH 4ZKSU 1NFWA 3T27A 1V2QT 3TLOA 4GLYA 3A81A 2VH0A 1EP6A 1UCYH 2FOAA 4ZHAA 1BITA 2KAIA 1QFKH 2ZU1A 1GI9B 5DP5A 1KXEA 4YT6H 5EXLA 1BHXB 3A80A 1NFXA 2F83A 2VVVA 1DWDH 1WYKA 3Q3XA 1C5RA 4OGYA 3N7OA 3TH3H 4O3TA 2XCNA 4X2XA 4Q7XA 1C5QA 1A5GH 2C8WB 2FS8A 1P2OA 4Y6DA 3STIA 3CS7A 3P8FA 1L0ZA 3D49H 1TMUH 2GD4B 1P0SH 2OUAA 1DUEA 4Y8YA 4E06H 1D6RA 1OKXA 3LGIA 5L2YH 1FUJA 1HXEH 1EB1H 1QR3E 1WQVH 5T6GA 3P17H 2ZKSA 1EPTB 5CMXH 1G2MA 2FI4E 7KMEH 2ZTYA 2XWBI 4DCDA 3DT0H 2PLXA 1C5NH 3BTWE 4NZLA 2LPRA 3RU4D 4GHTA 1O5GH 5JPMH 3MU8A 2SGAA 4AFUA 2Y80A 3ZZCA 3I29A 4WF8A 4ZAEA 4B2AA 1Z71A 1P3CA 5FHTA 3T25A 3SUDA 2WUCA 3UQVA 3Q77A 2BD8A 1HAOH 2VIPA 1QB1A 2SGFE 2CV3A 2Q6FA 3RLYH 3URCA 2Z3DA 3ATMA 3M5MA 3ZVFA 1U6QA 7ESTE 3SBKA 1KXCA 2BD3A 2QXJA 3E8LA 2QF0A 2VIOA 2JH0D 1IHSH 3PWBA 5C5NA 3QUMP 1UTNA 3RC5A 3Q76A 4IMQA 1INCA 2QYIA 1LKBA 4OS5A 3TH4H 4O03A 1O2GH 5AHGH 4WY3A 1DDJA 1O5CB 1GDQA 1V2PT 1TGCA 1XMNB 1L1JA 2A31A 5JBCS 2GCTB 4ABGA 5L6NH 4WXIA 4HFPB 1WAYB 2W26A 3FP7E 1HDTH 1TNJA 4XDEA 1L4ZA 1GI2A 3F9EA 1BTYA 1A3BH 4RSPA 2WYGA 1W14U 3A83A 3ATWA 2F9BH 1ZTKA 1ZRKA 3RP2A 1QY6A 1TWXB 3H7TA 3OX7U 3B8JA 5GCHG 1N6YA 1SOZA 3SV9A 5EXNA 1ELGA 4X1NU 1DUAA 1JBUH 3M7TA 3NKKA 2FOMB 4NSVA 1V2NT 1AVWA 1O2RA 5F8ZA 2BX3A 5E0HA 3RXAA 2Y5FA 4Y10E 1VJAU 2G5NA 2ZDMA 4FUEA 2CF8H 3ZYDA 4JZEH 5E2OA 1TGBA 4NIYA 1F0TA 1IOEA 1TABE 2A4RA 3S7HB 3UY9A 5F8XA 3UFAA 3R3GB 1FXYA 2OBOA 1C5PA 1QBOA 1TNIA 4ABIA 2EI6A 1B5GH 2QA9E 1SR5C 1PPZA 1O2SA 1GBMA 1EJMA 3LGUA 2VJ1A 2W7SA 3C1KA 1O3BA 1HCGA 1UVSH 6ESTA 1EJNA 1E0FD 1BTWA 4ABEA 1O38A 1ZR0A 3BTHE 3ZZ7A 3TNSA 2VH6A 6GCHF 3ZZ9A 1ZGIA 3V7TA 1ZSLA 3A8AA 2ZGBH 1N8OC 1HBTH 3RXMA 1Y5AT 3RXPA 4JK6A 4YLUA 1O3EA 3S9BA 3E16B 4MPVA 5L30H 4ABBA 3PLKA 4LZ1H 1BRBE 3F6UH 1SOTA 2A5KA 2HLCA 4XBDA 3FANA 4J2YB 4MNXA 1E34B 1EASA 2ZDLA 3S9CA 2NU4E 2G8TA 2QF3A 5C1XA 3Q00A 4MVNA 2FMJA 4DIHH 4K8BA 1ZPZA 1KDQB 1RGQA 2ZU5A 2VWNA 1AKSB 2UUFB 2OCVB 1JRTA 3SORA 1OPHB 2A7HA 3VB3A 1TAWA 1IHTH 1C1OA 2PKAA 2AS9A 1HIAB 5I25A 5HMAA 1FIZA 1GDUA 1ZLRA 1XUFA 1LTOA 4AB8A 3RMNH 3WY8A 1O3NA 3A88A 4ASHA 1Z6JH 1FJSA 4CREA 1Y3XA 3AASA 3P8GA 1UHBB 3R0FA 1Y59T 1GJ8B 4ZHLU 3BTGE 5LGOA 4JK5A 4I33A 3M3SA 2CMYA 1MTSA 3QX5H 3MFJA 3E3TA 3HGNA 1LO6A 3PMJA 2BY9X 1JIMA 2JH6D 2XBWA 4NWLA 2PTCE 1O3LA 3F1SB 3PMAB 3SW2B 3RXEA 2BD4A 4BANB 1C2GA 3RM0H 3KGPA 1TBQH 5E0GA 1C1NA 3SHAH 1EZSC 1GBIA 4GPGA 1XVMA 3UR6A 4X6OA 2J2UA 1RXPA 1GBCA 1YPHE 2AGIX 3SNDA 2QC2A 4O97A 4INHA 3A8DA 4ZH8A 3SU2A 2H9EH 2ASUB 2OC1A 2VINA 1FN8A 1K1IA 3KNXA 4Z6AH 2HWLB 4TY6A 3MH5A 4NIWA 1E36B 1YPLH 1SGIB 2JETB 2AERH 1QQ4A 2OQ5A 3SU1A 4WXVA 3TJUA 4E7RG 1GI6A 1ZRBA 3M7UA 1HNEE 2RDLA 2Z9LA 2QN5T 4CRGA 3TH2H 1O37A 3MH6A 4Q7ZA 1HLTH 4ZHMU 5C67A 2A5AA 1O5EH 1KLIH 1ESAA 1AE8H 1AY6H 1BBRK 1EUFA 2QV1A 1D9IA 2VVCA 1GVZA 2QXGA 1ZZZA 2ODYB 1J9CH 2A4GA 1D3PB 5I46H 1FQ3A 2ZFFH 1GI3A 1UVOA 3SI4H 3I78A 1O2YA 3PLBA 5A8ZA 1EAXA 1ZTLA 1CHGA 2OC8A 3VFEA 2SNVA 1Y5UT 3MO3A 4X6NA 2FP7B 5DO4H 2GKVE 3UTUH 4WMEA 4ISOA 3SJ8A 1Z1JA 1QL7A 2BOKA 5C5OA 1SHHB 3RUOA 3A84A 4HZHA 3RDZA 1YF4A 3TK9A 1ORFA 1RJXB 1HFDA 1T8LA 3GCHB 1ESBA 4Y11E 3M61U 1NROH 4A1TA 2NWNA 3SJ9A 2ZQ1A 1SC8U 4ZXXH 1GBHA 2H6MA 4AGKA 3BTDE 2Y7ZA 3UNQA 1DICA 1A61H 5K7RA 5AFZH 1IQMA 1TQ0B 6CHAC 2XCFA 2XWAA 3P95A 2XBXA 4D8NA 1CE5A 5GWZA 3V12A 1CGHA 2QIQA 5DP3A 2VIQA 1MD8A 2GCHG 2OLGA 3M3TA 4FU7A 2AIPA 1AO5A 3UREA 3GYMA 1MAXA 3OTJE 1UCYK 3HK3B 1TX8A 3TGKE 2BVRH 1X7AC 4THNH 1F5LA 1SI5H 1O34A 4AFSA 3EQ0H 2ZDKA 1YGCH 1C5LH 3GY4A 3BEFB 3T2NA 2XC0A 4AFZA 3T62A 1KSNA 1BOQA 2A32A 1C1MA 1O3GA 1VZQH 1AVXA 2PWXA 2TGTA 3RXBA 3SV6A 4KTCA 5GCHF 1O3KA 1SLXB 3P6ZB 3RU4E 4YM9A 2XRCA 3QTVH 1F5RA 4K5ZA 1C9TA 1L1GA 1DSTA 1JXPA 1MZAA 2FZZA 3EE0B 4IC5A 4YESB 1AB9C 1O2TA 1GMCF 3MH4A 4YTAA 1EAUA 1ANEA 1GBEA 2QXIA 2W5EA 2FLBH 1SSXA 3ATKA 2F91A 3EAJA 5EXMA 3RC4A 1ABJH 4ISLA 4BNRA 2BZAA 1K28D 5DP8A 4K2YA 3KQDA 1MCVA 1BMAA 2ZF0H 4I31A 2ZGCA 1OWJA 1NPMA 1ZMNA 5C20A 1HAVB 1Y3UA 2VIVA 3RXCA 1PFXC 1DVAH 4TWYA 2HNTC 2ZU4A 4R8TB 1KXAA 3NWUA 1T8MA 1C5ZB 3TIUA 1GCTC 4LZ4B 3E0NB 1YLDA 3TK5A 3SNEA 4D76A 1VGCC 1OYQA 1TONA 1O2VA 2VWLA 3CS0A 1BZXE 4AX9H 1PQAA 1C1RA 3TITA 4E05H 4I8LA 5DG6A 4I32A 2D1JA 5T6DA 2J38A 2TIOA 3BIVH 4U01A 1W10U 4BAOB 1TX6A 1GHXH 1UHBA 1BBRE 2RA3A 1AZZA 1QRZA 2D26C 1CBWC 1SL3A 4MLFB 1FIWA 2R3YA 2XYAA 2JKHA 1F7ZA 4CR9A 3RC6A 1TMBH 4MQAA 1HAZB 1ZSJA 4ABAA 5BPEA 1TBRH 4X6MA 1F0SA 2ZPSA 2UUJB 2O8TA 5LPRA 3UNSA 2R9PA 3SN8A 4D9QA 3BF6H 1DXWA 3OY6U 1TLDA 2FX4A 2C90B 1NFYA 4GAWA 2C93B 1LDTT 3MMGA 1GGDB 2OINA 1EXFA 1MTNB 1WTGH 3ZZ8A 1G3DA 4NGAH 4FUDA 1J8AA 1GG6B 3TPIZ 2WPLS 4CH2B 2BVXH 1NRNH 3BTKE 2YNBA 2DUCA 2PKSC 4BXSA 1EB2A 8KME2 2FTMA 2HNTF 1AFQC 1FMGA 1PYTD 4K60A 4U2WA 1O2IA 1V2MT 1FAKH 2G4UA 5CHAC 2Z7FE 4F49A 3E91A 2AGEX 1XVOA 1GI0A 2XBYA 1QQUA 2ALPA 4OS2A 2ZCKP 3U9AH 3KL6A 2BLWA 2AFQB 4MTBA 1HV7A 1P2KA 3E0PB 1AVGH 3K6YA 1UO6A 4HI3A 3PMBB 4CBNA 1SGDE 1HXFH 1H9HE 2OTVA 1YCPK 1MTNC 1BTHH 2Q6GA 2G55A 1DWCH 2Y6TA 2YNAA 3SGQE 4A7IB 4WMFA 2BDBA 1A5HA 1ZJKA 3SNBA 1MAYA 2P95A 1HJ9A 1TNLA 2ILNA 1Y3WA 1A0LA 4NG9H 5TJXA 4FUBA 3L33A 1EZXC 2P3TB 1O3IA 1A5IA 1TGSZ 1TPAE 4CBOA 3A7VA 3ELAH 1IQKA 1SGQE 1LPGB 3GY3A 1GHBG 1NRSH 1VR1H 1CSOE 4VGCC 1C1UH 3T26A 1GI7B 4VGCB 1QL8A 3EA8A 4JZDH 1ZJDA 1K1MA 3SU0A 4YOJA 5LPFA 4BAKB 3F9FA 1Z8IB 3MYWA 1AHTH 2NU2E 1OWIA 4X1QU 2IN2A 4ABJA 1KY9A 4D9RA 1YM0A 1ZHMA 4D7FA 1W7XH 2DE9A 2O8UA 3RXHA 3MU5A 1EX3A 1DSUA 3UIRA 1AWHB 1D6WA 2GGVB 3Q3KA 3PLPA 1FDPA 2NU3E 1P09A 3GY5A 4IBLH 3VEQB 4NIXA 3QLPH 2THFB 1OWHA 4MG3A 1S5SA 1ZHPA 2CF9H 2FI5E 3JZ2B 4K1EA 1HYLA 1C1WH 1P3EA 1GMDF 1WU1A 1ELVA 1QB6A 4JZIA 1XKBC 1O2WA 1AD8H 4B1TA 2FOHA 5A0BA 1C1PA 4KP0A 2PHBA 2CGAA 2FOFA 1F0RA 1Z8JB 2SGPE 2ZTXA 1SGYE 2BOHB 3SOSA 8ESTE 2PKSB 1GPZA 2FDAA 4NIVA 1V3XA 2BQ6B 1K9OE 1MU6B 4ZKNU 4KTSA 1GMDG 1MQ6A 1JIRA 1W2KH 1TA6A 2B0FA 4GVUA 3VGCC 1C5MD 1YP9A 4AG1A 2O8LA 2BX4A 1SB1H 1BT7A 1YPJH 2A0QB 4LXBH 2QCYA 3SQHE 1EPTA 5J4QA 3MU1A 3KIDU 4IMZA 1EQ9A 3M3VA 2W7UA 1MKWK 3OY5U 2Q1JA 1SLWB 1NZQH 2BY8X 1ELBA 1SQAA 4H42U 4I8JA 1UMAH 1PPEE 1V2TT 1GBLA 3EYDA 1K1NA 5EPNA 5FPYA 1O5AB 5IYTA 3SQEE 4HTCH 4SGBE 3RXUA 1GVLA 2TGAA 1S84A 5ESBA 3RXFA 2C8YB 3LH3A 1C5XB 1OP8A 3UQOA 5GPIB 1C5WB 4X2VA 1HAXB 4YLQH 5SGAE 3LC3A 1MTWA 4NWKA 4WJG2 3ZVGA 2EEKA 1C2FA 1EPTC 2BY6X 3C27B 3PTNA 1HAPH 1GJ7B 3ITIA 4LOYH 1GHZA 1TFXA 3VB7A 3SU5A 2H9TH 1H8DH 2GX4A 1O2LA 5HXFA 2FO9A 2ZFRH 1HJAC 1O2HA 1O5DH 4Q7YA 2DE8A 4B76A 4JYVH 4ISIH 2RA0A 2G5VA 2H1UA 1IQJA 1FONA 4ZXYH 4GCHG 1W0ZU 1TA2A 2ZG0H 1VITG 1MZDA 1LKAA 4NFEA 1Y3VA 1BUIA 2Z94A 1K1JA 2Z3CA 2R0KA 4BOHA 1K2I1 2C3SA 8GCHG 4UFDH 3RMLH 2HPPH 2C8XB 4NZQA 4B74A 3PO1C 3KQCA 3LJJA 4DIIH 3PROA 3UOUA 4ZUHA 1C5OH 3M7QA 3UPEA 1BTXA 1CA8B 1Z1IA 3ZV8A 1O2MA 1PPHE 1GBTA 3GDSA 3TGIE 3F9GA 1RTFB 2XBVA 5EQSA 1O3JA 1GHVH 1WSSH 1GCTB 3GICB 2Z9GA 1GHAF 2BDAA 4X8SH 4O9VA 1V2LT 4NA9H 1YC0A 1S81A 3QK1A 2NU1E 2V35A 2WPKS 4SGAE 3M36A 1NM6A 3W94A 3MNCA 2PKAB 3A82A 1TMTH 4B71A 3T29A 3QO6A 1TNKA 3BTME 3O8DA 2GT7A 1WCZA 1NU9A 3B23B 3DD2H 1OSSA 3MU4A 1SMFE 2GV7A 4RKOB 3ATIA 1XUJA 1MKXK 2J34A 2BD5A 1ELCA 1MBMA 1C5UA 1G3BA 1G3CA 5EPYA 4CRFA 3SV2H 1W12U 1AB9B 2BQ7B 3PYHA 1MTUA 5EG4A 4FXGH 5AVDA 4DT7B 1DS2E 3VB4A 2TBSA 1O3HA 1RD3B 2BDYA 1G37A 1IQFA 1DITH 4UD9H 1V6DA 3HPTB 1ELFA 1AKSA 4X1PU 3SV7A 1Y5BT 2SGDE 5ETXA 2QAAA 4A6LA 2IPHA 3MNSA 1OP2A 2H2ZA 2F3CE 3P8NA 5DK1A 3ZVAA 3MTYA 4K3JA 4QT8C 2ZDVH 1HB0B 4Y8ZA 5EGMA 2CJIA 2ZFPH 1O3AA 2ANMH 1PPCE 4GSOA 3ZZ4A 3ZYEA 5EW2H 4ABHA 2BY5X 1PQ5A 1GBAA 3RLWH 1Z8GA 1D3TB 1CBWB 2BDGA 4BAQB 5FPSA 1FLEE 1DXPA 4FUFA 1QRXA 1O5BB 1AFQB 1VCWA 3SI3H 3M37A 1N6XA 4B75A 3VXEH 1KTTB 1XX9A 3LONA 1SLVB 3W95A 1LPZB 3ZVBA 5DP7A 1V2UT 4IN2A 4M7GA 3IITA 1LVMA 1GJAB 3U8RH 2D8WA 2PSXA 2ZI2H 1V2RT 1UK2A 3RMMH 5C1UA 1TNHA 1ID5H 2SNWA 1UTOA 2VGCC 2GCTC 4DW2U 1NC6A 2XNIA 3AW1A 1WOFA 3BSQA 3E1XB 2AIQA 3FAOA 2I6QA 1OX1A 4IN1A 2B9LA 1C4Y2 4KTUA 1NO9H 1QL9A 4JYTA 3KHVA 3D65E 2J9NA 1TRMA 3O8RA 5FPTA 4AN7A 3A7WA 1K22H 1ZMLA 3GDUA 3ODDA 1QB9A 1HJAB 2C8ZB 3VB5A 3AAUA 1PPGE 1E38B 5A09A 4OS6A 3IG6B 1SQTA 4X8VH 1TOMH 3QTOH 3LC5A 4JMYA 3RXQA 1TGNA 4AFQA 2UWOA 4UONA 2BLQA 2XC4A 3TJNA 1SFQB 2ANYA 1BRCE 2B5TB 1C2DA 4MPUA 1PQ7A 2BY7X 3A8BA 3GDVA 2ZDAH 3G01A 1A0JA 4I8KA 3RXDA 3GCNA 1Q31A 1P2MA 1QA7A 1S6FA 1UTQA 1GI5A 4YO9A 1ELEE 2W3KA 1TPPA 3JZ1B 4R0IA 1C5SA 1DE7H 4MNWA 3ZVDA 1RTKA 1ZYOA 3S7KB 4UFFH 5DGJA 1O35A 1THRH 3LH1A 1PPBH 2Z6BD 5A0CA 2ZCLP 3E90B 2FM2A 4B2CA 1C2KA 4X8UH 5C1YA 1S6HA 1IQIA 2O9QA 1V2JT 4NCYA 1CA0B 3SU4A 2XW9A 3UOPA 4MPXA 2GT8A 4MPWA 2OP9A 4Y8XA 3OU0A 3H7OA 2ZHWH 1ESTA 2Q6DA 4XBBA 4Y0ZE 4BTIB 1DWBH 3ZZ6A 1Z6EA 3QGNB 3ZZBA 1EAWA 3EDXB 3LGTA 4WMDA 1GJ6A 1NY22 1S0QA 3U8OH 5A0AE 1TX7A 2XXLA 2AH4X 1LVOA 1A46H 2Y81A 1CO7E 1QGFA 2FOGA 3BG4C 3ODFA 1FV9A 3MO6A 4OS1A 1GHAG 3KF2A 5EOKA 1NFUA 1EZUC 1P9SA 2P8OB 3GCHC 1BB0B 2Z9JA 1C5VA 2GZ8A 2J95A 2GP9B 1XKAC 1DM4B 3RXIA 1GJ5H 4FUCA 5F8TA 3GY8A 4NA8A 4O3UA 1EAIA 1XUKA 1SQOA 1LVBA 3TGJE 1AIXH 3BTFE 4A1XA 1S85A 3FP8E 2AYWA 1OS8A 4WH6A 1ELTA 1Y8TA 2H5CA 9ESTA 4GCHF 4INKA 1J17T 1AFEH 2BTCE 1GBBA 4IS5A 1AUTC 1ZPBA 1F0UA 3DFLA 1O2XA 2CXVA 4IC6A 4ZKOU 3SU6A 6LPRA 2HGTH 1FZZA 3P70B 5DP6A 3UWJH 3LPRA 1G3EA 5DP4A 1O2KA 2F9OA 4Y71A 1QURH 1BTPA 2IJOB 1EATA 2BDIA 6CHAB 1SGPE 1EP5A 3GISB 1ZSKA 3NXPA 1C2EA 2FODA 4DY7B 1DT2A 1GJCB 2GVFA 1O3MA 2BDCA 1OWEA 2A45B 4GUXA 1CGIE 7LPRA 2FOCA 2PSYA 2BM2A 3A86A 4UFGH 1C5TA 3LKWA 2UUKB 4UDWH 3DFJA 1CU1A 1FN6A 1T4VH 1FNIA 1T8NA 5G4BA 3QWCH 2Z9IA 1JMOH 1A3EH 1GI8B 1TBZH 2B7DH 2HNTE 5JBBS 2ZWLH 1VCQA 3BTEE 3UWIA 1ARCA 1YBWA 1S83A 2I6SA 2PGQB 1JRSA 2VWOA 4FU8A 4BAMB 1C4U2 1S0RA 4UE7H 5A8XA 3BG8A 4CH8B 1W8BH 1SG8B 3RXOA 3K65B 4Y7BA 1FY8E 2GZ7A 1A4WH 1SGTA 3VXFH 4CRCA 3A7XA 1L2EA 3A85A 3SGBE 3RXSA 2UWPA 1GJDB 4OS4A 2VIWA 1QBVH 4BTTB 1T7CA 4U30A 4NSYA 1C1VH 1QJ6B 1NN6A 4DJZB 3LU9B 1TALA 1FI8A 1CHOF 2ZHDA 2F9NA 5JB9S 2Y82A 1T32A 2G4TA 2VIDA 1UJ1A 5A8YA 4FUIA 1BIOA 1QTFA 5FXLA 7GCHF 4XBCA 3H5CB 2HVXA 3U1JB 1GBKA 3UNRA 3AAVA 1WQSA 2FEQH 3AVZA 4K69A 1SHYA 1GBFA 4ISHH 1O31A 5B6OA 1NESE 2PUQH 1B7XB 4TY7A 2BDHA 1GMHG 1P06A 1QJ1B 2FYRA 3PV4A 1O3CA 2PGBB 3T28A 4I8GA 1O3DA 1P02A 1C1SA 1BJVA 1PJPA 2A2XH 1RIWC 1BTUA 3RXKA 2PUXB 1LHGH 1OP0A 1MKWH 1UTJA 1VITH 4WVPE 4Y0YE 5DP9A 2QY0B 3PO1B 2ZGXH 3LGWA 1E37B 4AGJA 1H9LB 8GCHF 1P8VC 1OWDA 2HOBA 1ANCA 1GI1A 2XTTB 3TVJB 4MNVA 2PFEA 3KCGH 2AMPA 5T6FA 1VITF 4FUHA 2KAIB 1MBQA 1A0HB 2V0BA 3ZV9A 1KXFA 3AW0A 4X8TH 1O2UA 4AYVB 3M5OA 1VGCB 1KTSB 1DY8A 2WPHS 2GTBA 1ETTH 4FU9A 1KDQA 3RXJA 1NTPA 4PROA 1YPKH 1V2WT 1O30A 1O33A 2FIRH 2WV5A 1DLEA 1ZHRA 2P16A 1K1OA 2FS9A 3HGPA 1Q2WA 5GXPA 2BB4A 2JH5D 3TU7H 3D23A 1O2ZA 1SGNE 3BG4B 2TRMA 2SFAA 1ZPCA 5EU8A 3BV9B 3M35A 1P2JA 2BHGA 3HK6B 2ZC9H 3RU4T 4CHAC 2CN0H 1EKBB 3NCLA 5JYIA 2BD7A 4JYUH 2AEIH 4OGXA 2ZGHA 3BTQE 5JB8S 1Z8RA 1FPHH 3L3TA 5PTPA 2GZ9A 4AOQA 3U8TH 4XFQA 1NRRH 2ULLA 2OQUA 1BBRH 1LCYA 2OC7A 4DOQA 2ZNKH 4YZUA 5K0HA 1LHCH 2P3FH 3FZDA 3MNXA 1NRPH 4J1YA 3SJOA 4JZFH 3MHWU 8LPRA 4ABFA 2BVSH 5CHAB 2FTLE 2Y5HA 2CHAC 1BMMH 3OYPA 1QJ7B 4X1SU 1ETRH 2WPMS 3I77A 4X2YA 1GHYH 3F9HA 3ZZ3A 1G30B 2M5TA 1CA0C 1SBWA 3TK6A 1F92A 2A4OA 2CHAB 2HALA 3PB1E 3SNAA 4JCNA 1MH0A 5GDSH 4CRAA 1SGEE 1QA0A 2STAE 2PV9B 1O2QA 2WPIS 3ATLA 1A7SA 1TIOA 4RKJB 1DANH 4U32A 1L1NA 1HAGE 5FX6A 3SV8A 1FPCH 1V2ST 3A87A 1KLTA 3GOVB 1B0FA 1NU7B 4TPIZ 5LPEA 1MKXH 1HGTH 2R3UA 3GY7A 2AMQA 1XXDA 3KN2A 4FVDA 2B8OH 4UFEH 1GJ4H 2GDDA 1SGFA 1W7GH 2P8OC 3MOCA 1YPMH 4Y76A 1YLCA 3ZZDA 1P57B 4X6PA 3U69H 2R0LA 2PR3A 1MU8B 2V6NA 1TGTA 1OYTH 4JZ1A 5ESTE 2SGEE 2ZEBA 3KQBA 3E6PH 3S69A 3HKIB 2ZQ2A 1GVKB 2UUYA 1YYY1 3DHKH 3A7TA 5EODA 2WV4A 1GMCG 1Q3XA 1UVPA 1JOUB 4Y79A 2D2DA 1BCUH 1NS3A 1HPGA 1ZTJA 1UTLM 5E2PA 1D3DB 3RMOH 1NRQH 1CGJE 1H8IH 1E35B 4D7GA 2ZHEH 1BTZA 3NK8A 2ZFTA 4F4OC 3S0NA 4CRBA 3ENSB 3U98H 1P01A 5AF9H 1TOCB 1EOJA 3LGYA 3NZIA 3EA7A 3P8OA 2ODPA 3A7YA 2RCEA 3B9FH 1LPKB 1MCTA 1DLKB 4DURA 4WH8A 4E7NA 1FY1A 3MWIU 4I8HA 1BDAA 3T5FH 4CRDA 1G36A 2LNCA 1ZGVA 3ZVEA 1AGJA 1V2OT 5TCCA 3SUGA 5J4SA 2TPIZ 5A2MH 1BMNH 1AN1E 4DVAU 2ESTE 1XUHA 1WBGB 1UTKA 2GCHF 1OOKB 5F6MA 1YPEH 1O2OA 1ETSH 2ZP0H 1DY9A 2OXSA 5HGGA 3VB6A 1P12E 2K1QA 1PQ8A 1CQQA 2ZCHP 4ZKRU 2OD3B 2TGPZ 1PYTC 3LIWA 2BZ6H 2H5DA 1AU8A 1FY5A 2P59A 1RTLA 1EOLA 1QRWA 1RFNA 1GL0E 4K1TA 2FXRA 4Y7AA 5GIBA 4B73A 1D3QB 2PW8H 1A2CH 1GBDA 3SU3A 1GJBB 1H4WA 3KEEA 5EQRA 1V2KT 1ZOMA 1G9IE 1P2QA 1O36A 1O32A 1HAYB 1UTMA 4FUGA 1ELAA 3MI4A 1TB6H 1C1QA 3O8CA 1B0EA 4ISNA 4XSKU 4ZROA 3BTTE 2SGQE 1AWFH 1O0DH 3FVFB 1DX5M 2ZIQH 3M5LA 4HGCA 3LGVA 1CT4E 3FZZA 1C2LA 1FY4A 3SO3A 1P11E 1GL1A 3VPKA 1ELDE 4TPYA 3V13A 4FVBA 4B2BA 3OSYA 4TWWA 3RXRA 5ABWA 4NA7A 4X0WU 1KXDA 3URDA 2ZFQH 3HKJB 2FX6A 2EC9H 1BRAA 3K9XB 3RXLA 3SZNA 2ZO3H 1VJ9U 1QNJA 1DFPA 1P03A 1C2JA 1J15A 3K6ZA 2ZFSA 1QIXB 2BLVA 4KGAA 4AORA 1UVTH 2J92A 3DA9B 1SPJA 3RXTA 3SJKA 1K1PA 2G52A 4FUJA 3QZQA 4YOIA 3PM3A 1GG6C 5FBEA 2ZDNA 2AMDA 4BTUB 1YPHC 4GHQA 2R2MB 1TRNA 3MU0A 4BXWA 3V0XA 3PMHB 1GGDC 2BQWB 1J16A 2A7CA 2AGGX 1IQHA 2Y7XA 5C2ZA 1C2MA 1BA8B 1ANDA 3UUZA 4ABDA 5EQQA 1S82A 2GMTB 1FY3A 2BXTH 2C4FH 3CENA 3S9AA 1SFIA 4K1SA 2IOTA 2QXHA 1HAHH 1W3CA 5FX5A 1O3PB 1O2PA 1TE0A 2FOBA 5C3NA 2QGRA 1P04A 2RG3A 5H4IB 1LQEA 5HM2A 1C2HA 1CT0E 1P2NA 1H9IE 2ODQA 1DPOA 3MNBA 4Q80A 5DPAA 1RS0A 4BAHB 5JBTA 1ACBE 3CP7A 2ZTZA 2Z3EA 4AG2A 2EI7A 1TPOA 3QZRA 2ZU3A 4ESTE 1OXGA 5EW1H 3NUMA 2ZGJA 1GCDA 1CVWH 3BN9A 4UEHH 1QBNA 3EA9A 1Y3YA 1MD7A 1C5YB 1O2JA 2ZZUH 3GYLB 3LT3A 3P92A 1KLJH 2GDEH 2W3IA 2ZPRA 4OS7A 2G00A 1TYNA 5FCRA 4CHAB 3LOXA 2FI3E 7GCHG 3NPSA 4H6SB 3UR9A 1LMWB 3PTBA 1THPB 5F03A 1P10A 3O8BA 1CHOG 2A2QH 1C4V2 4A1VA 1O2NA 1TQ7B 5TCAA 4XOJA 2P94A 1K1LA 5L2ZH 1XUGA 1MQ5A 2A1DB 1IQNA 2ANWA 3DUXH 3QN7A 6GCHG 2BMGB 3ZZ5A 1RRKA 4I7YH 2XC5A 2VNTA 3LJOA 5JBAS 1LHFH 1O3FA 1Z7KA 3RM2H 9LPRA 1H1BA 2WYJA 2EI8A 2GMTC 4LK4A 2BXUH 1WUNH 2JETC 2P3UB 3GCTG 4DGJA 1GJ9B 1N1LA 2HPQH 3PWCA 1IAUA 3GY2A 4MDSA 1HRTH 1SLUB 2Z9KA 1LHDH 1AI8H 3D62A 2BD9A 3GCOA 3BIUH 2ALVA 1AZ8A 3BEUA 1ANBA 2TGDA 4YT7H 1LHEH 4AYYB 4IGDA 3SGAE 2J4IA 4X1RU 3A7ZA 2OBQA 3KQEA 3QGJA 1IQLA 2ZU2A 1K21H 2V3HH 1UK4A 1CT2E 5JDUB 4KKDA 1UCYE 1GI4A 1UVUH 4WWYA 1J14A 1F5KU 1SVPA 3SHCH 4XE4A 3IWMA 5E8EH 1EZQA 1D4PB 5DKMA 1C1TA 2O8MA 3FFGA 4NFFA 1SGRE 1YCPH 4MNYA 2VGCB 1BJUA 1HIAA 1N8OB 1YCPM 5DJ7A 1ARBA 1XXFA 5HM9A 2Y5GA 5FBIA 1PPFE 3BEIB 3HATH 1MUEB 1T4UH 2GV6A 1OWKA 2VVUA 3M5NA 4H6TA 4AB9A 3VGCB 2F9UA 1SGFG 5HYOA 4INLA 5LH8A 2NU0E 2ANKH 2EA3A 1LQDB 3L6PA 4X2WA 1G32B 1T8OA 3A8CA 2BYAX 1BQYA 2R2WU 1QCPA
chains in the Genus database with same CATH superfamily
1SGCA 4IW4E 1AE5A 1FAXA 1WV7H 1C2IA 3SJIA 5BRRE 3TNTA 1BHXF 1EJAA 1P9UA 3RXGA 3TJOA 1H8HD 2STBE 1GHWH 1T31A 2YOLA 3EE7A 5GJ4B 3V3MA 1XUIA 1W11U 1O39A 2OC0A 1ZMJA 2ZECA 1P2IA 2G81E 5AFYH 2VU8E 1M9UA 1GWAA 2BD2A 3GY6A 1KYNA 1IQEA 2P93A 3SNCA 1GHBF 2G51A 4H4FA 2FLRH 2HRVA 4A5TS 1WTHD 4YOGA 1C9PA 2F9VA 1ABIH 1IQGA 2H9HA 1HAVA 3ZVCA 4Z0KA 1AMHA 2IJD1 3LDXH 1NT1A 2ZPQA 1W0YH 3A89A 1L4DA 5E0JA 3RXVA 3Q3YA 4RN6A 1KXBA 2VWMA 1LVYA 1F2SE 1DWEH 1TNGA 3F68H 2BLOA 1HUTH 1VKYA 4ZMAH 2A4QA 3ESTA 4TYDA 5HIZA 3DCLA 1GDNA 5B6LA 2L74A 1HJ8A 1MTVA 1THSH 2VB0A 2WINI 1AUJA 1TRYA 3ZZAA 1W13U 1AQ7A 3MO9A 1MMJN 1GBJA 1UK3A 2FWWA 2ZHQH 1RIWB 1YKTA 3GCTF 2A7JA 5T3HA 1V2VT 3TJVA 2WUBA 4CR5A 1BMLA 1VCPA 1XM1A 5FAHA 3SUFA 2FPZA 1DOJA 2FOEA 2ZA5A 5CE1A 5FCKA 3NRLA 1UTPA 1A1RA 2FYQA 3MH7A 3U1IB 2F9PA 1QHRB 4A92A 2O8WA 2WPJS 4DG4A 3STJA 2V3OH 1O3OA 5DSFA 2HLDD 3SUEA 2PTNA 3K2UA 2ZHFH 2A5IA 1BRUP 1P05A 2FESH 3FP6E 3UAIC 3QDZB 4KELA 1HAIH 5IDKA 1GMHF 4K8YA 1JWTA 1O5FH 1TPSA 4AZ2B 2J94A 1G2LA 2UWLA 1KIGH 1YPGH 2RFKC 4Q2KA 1MABB 3EGKH 4ZKSU 1NFWA 3T27A 1V2QT 3TLOA 4GLYA 3A81A 2VH0A 1EP6A 1UCYH 2FOAA 4ZHAA 1BITA 2KAIA 1QFKH 2ZU1A 1GI9B 5DP5A 1KXEA 4YT6H 5EXLA 1BHXB 3A80A 1NFXA 2F83A 2VVVA 1DWDH 1WYKA 3Q3XA 1C5RA 4OGYA 3N7OA 3TH3H 4O3TA 2XCNA 4X2XA 4Q7XA 1C5QA 1A5GH 2C8WB 2FS8A 1P2OA 4Y6DA 3STIA 3CS7A 3P8FA 1L0ZA 3D49H 1TMUH 2GD4B 1P0SH 2OUAA 1DUEA 4Y8YA 4E06H 1D6RA 1OKXA 3LGIA 5L2YH 1FUJA 1HXEH 1EB1H 1QR3E 1WQVH 5T6GA 3P17H 2ZKSA 1EPTB 5CMXH 1G2MA 4P00A 2FI4E 7KMEH 3F0PA 2ZTYA 2XWBI 4AC9A 4DCDA 3DT0H 2PLXA 1C5NH 2GJGA 3BTWE 2LPRA 4NZLA 3RU4D 4GHTA 1O5GH 5JPMH 3MU8A 2SGAA 4AFUA 2Y80A 3ZZCA 3I29A 4WF8A 4ZAEA 4B2AA 1Z71A 1P3CA 5FHTA 3T25A 3SUDA 2WUCA 3UQVA 3Q77A 2BD8A 1HAOH 2VIPA 1QB1A 2SGFE 2CV3A 2Q6FA 2YMSD 3RLYH 3CNRA 3URCA 2Z3DA 3ATMA 3M5MA 3ZVFA 1U6QA 7ESTE 5KECA 3SBKA 1KXCA 2BD3A 2QXJA 3E8LA 2QF0A 2VIOA 2JH0D 1IHSH 3PWBA 5C5NA 3QUMP 1UTNA 3RC5A 3Q76A 4IMQA 1INCA 2QYIA 1LKBA 3OAAD 4OS5A 3TH4H 4O03A 1O2GH 5AHGH 4WY3A 1DDJA 1O5CB 1GDQA 1V2PT 1TGCA 1XMNB 1L1JA 2A31A 5JBCS 2GCTB 4ABGA 5L6NH 4WXIA 4HFPB 1WAYB 2W26A 3FP7E 1HDTH 1TNJA 4XDEA 1L4ZA 1GI2A 3F9EA 1BTYA 1A3BH 4RSPA 4Z1MD 2WYGA 2QF4A 1W14U 3A83A 3ATWA 2F9BH 1ZTKA 1ZRKA 3RP2A 1QY6A 1TWXB 3H7TA 3PRDA 3OX7U 3B8JA 5GCHG 1N6YA 1SOZA 3SV9A 5EXNA 1ELGA 4X1NU 1DUAA 1JBUH 3M7TA 3NKKA 2FOMB 4NSVA 1V2NT 1AVWA 2WPDD 1O2RA 5F8ZA 2BX3A 5E0HA 3RXAA 2Y5FA 4Y10E 1VJAU 2G5NA 2ZDMA 4FUEA 3N99A 2CF8H 3ZYDA 4RI0A 4JZEH 5E2OA 1TGBA 4NIYA 1F0TA 1IOEA 1TABE 2A4RA 3S7HB 3UY9A 5F8XA 3UFAA 3R3GB 1FXYA 2OBOA 1C5PA 1QBOA 1TNIA 4ABIA 2EI6A 1B5GH 2QA9E 5IK2D 2V7QD 1SR5C 1PPZA 1O2SA 3MQKC 1GBMA 1EJMA 3LGUA 2VJ1A 2W7SA 3C1KA 1O3BA 1HCGA 1UVSH 6ESTA 1EJNA 1E0FD 1BTWA 4ABEA 1O38A 1ZR0A 3BTHE 3ZZ7A 3TNSA 2VH6A 6GCHF 3ZZ9A 1ZGIA 3V7TA 1ZSLA 3SYJA 3A8AA 2ZGBH 1N8OC 1HBTH 3RXMA 1Y5AT 3RXPA 4JK6A 4YLUA 1O3EA 3S9BA 3E16B 4MPVA 5L30H 4ABBA 3PLKA 4LZ1H 1BRBE 3F6UH 1SOTA 2A5KA 2HLCA 4XBDA 2JDID 3FANA 4J2YB 4MNXA 1E34B 1EASA 2ZDLA 3S9CA 2NU4E 2G8TA 2QF3A 5C1XA 3Q00A 4MVNA 2FMJA 4DIHH 4K8BA 1ZPZA 1KDQB 1RGQA 2ZU5A 2VWNA 1AKSB 2UUFB 2OCVB 1JRTA 3SORA 1OPHB 2A7HA 3VB3A 1TAWA 1IHTH 1C1OA 2PKAA 2AS9A 1HIAB 5I25A 5HMAA 1FIZA 1GDUA 1ZLRA 1XUFA 1LTOA 4AB8A 3RMNH 3WY8A 1O3NA 3A88A 4ASHA 1Z6JH 1FJSA 4CREA 1Y3XA 3AASA 3P8GA 1UHBB 3R0FA 1Y59T 1GJ8B 4ZHLU 3BTGE 5LGOA 4JK5A 4I33A 3M3SA 2CMYA 2J98A 1K0HA 1MTSA 3QX5H 3MFJA 3E3TA 3HGNA 1LO6A 3PMJA 2BY9X 1JIMA 2JH6D 2XBWA 4NWLA 2PTCE 1O3LA 2KR7A 3F1SB 3PMAB 3SW2B 2J97A 3RXEA 2BD4A 4BANB 1C2GA 3RM0H 3KGPA 1TBQH 5E0GA 1C1NA 3SHAH 1EZSC 1GBIA 4GPGA 1XVMA 3UR6A 1E1RD 1WDIA 4X6OA 2J2UA 1RXPA 2J98B 1GBCA 1YPHE 2AGIX 3SNDA 2QC2A 4O97A 4INHA 3A8DA 4ZH8A 3SU2A 2H9EH 2ASUB 2OC1A 2VINA 1FN8A 1K1IA 3KNXA 4Z6AH 2HWLB 4TY6A 3MH5A 4NIWA 1E36B 1YPLH 1SGIB 2JETB 2AERH 1QQ4A 2OQ5A 3SU1A 4WXVA 3TJUA 4E7RG 1GI6A 1ZRBA 3M7UA 5F53A 1HNEE 2RDLA 2Z9LA 2QN5T 4CRGA 3TH2H 1O37A 3MH6A 3N7EA 4Q7ZA 1HLTH 4ZHMU 5C67A 2A5AA 1O5EH 1KLIH 1ESAA 1AE8H 1AY6H 1BBRK 1EUFA 2QV1A 1D9IA 2JIZD 2VVCA 1GVZA 2QXGA 1ZZZA 2ODYB 1J9CH 2A4GA 1D3PB 5I46H 1FQ3A 2ZFFH 1GI3A 1UVOA 1FX0B 3SI4H 3I78A 3N7DA 1O2YA 3PLBA 5A8ZA 1EAXA 3F3BA 2OK5A 1ZTLA 1CHGA 2OC8A 3VFEA 2SNVA 1Y5UT 3MO3A 4X6NA 2FP7B 5DO4H 2GKVE 3UTUH 4WMEA 4ISOA 3SJ8A 1Z1JA 1QL7A 2BOKA 5C5OA 1SHHB 3RUOA 3A84A 4HZHA 3RDZA 1YF4A 3TK9A 1ORFA 1RJXB 1HFDA 1T8LA 3GCHB 1ESBA 4Y11E 3M61U 1NROH 4A1TA 2NWNA 5EJLA 3SJ9A 2ZQ1A 1SC8U 4ZXXH 1GBHA 2H6MA 4AGKA 3BTDE 2Y7ZA 3UNQA 1DICA 1A61H 5K7RA 5AFZH 1IQMA 1TQ0B 6CHAC 2XCFA 2XWAA 3P95A 2XBXA 4D8NA 1CE5A 5GWZA 3V12A 1CGHA 2QIQA 5DP3A 2VIQA 1MD8A 2GCHG 2OLGA 3M3TA 4FU7A 2AIPA 1AO5A 3UREA 4TSFD 3GYMA 1MAXA 3OTJE 1UCYK 3HK3B 1TX8A 3TGKE 2BVRH 1X7AC 4THNH 1F5LA 1SI5H 1O34A 4AFSA 3EQ0H 2ZDKA 2HVYB 1YGCH 1C5LH 3GY4A 3BEFB 3T2NA 2XC0A 4AFZA 3T62A 1KSNA 1BOQA 2A32A 3DSGA 3GS9A 1C1MA 1O3GA 1VZQH 1AVXA 2PWXA 2TGTA 3RXBA 3SV6A 4KTCA 5GCHF 1O3KA 1SLXB 3P6ZB 3RU4E 4YM9A 1YLNA 2XRCA 3QTVH 1F5RA 3PRBA 4K5ZA 3OE7D 1C9TA 1L1GA 1DSTA 1JXPA 1MZAA 2FZZA 3EE0B 4IC5A 4YESB 1AB9C 1O2TA 1GMCF 3MH4A 4YTAA 1EAUA 1ANEA 1GBEA 2QXIA 2W5EA 2FLBH 1SSXA 3ATKA 2F91A 3EAJA 5C0UA 5EXMA 3RC4A 1ABJH 2KM0A 4ISLA 4BNRA 2BZAA 1K28D 5DP8A 4K2YA 3KQDA 1MCVA 1BMAA 2ZF0H 4I31A 2ZGCA 1OWJA 1NPMA 1ZMNA 4XD7D 5C20A 1HAVB 1Y3UA 2VIVA 3RXCA 1PFXC 1DVAH 4TWYA 2HNTC 2ZU4A 4R8TB 1KXAA 3NWUA 1T8MA 1C5ZB 3TIUA 1GCTC 4LZ4B 2W6JD 3E0NB 1YLDA 3TK5A 3SNEA 4D76A 1VGCC 4B6EA 1OYQA 1TONA 1O2VA 2VWLA 3CS0A 1BZXE 4AX9H 1PQAA 1C1RA 3TITA 4E05H 4I8LA 5DG6A 4I32A 2D1JA 5T6DA 2L6OA 1OHHD 2J38A 2TIOA 3BIVH 4U01A 3VG8A 2M2AA 1W10U 4BAOB 1TX6A 1GHXH 1UHBA 1BBRE 2RA3A 1AZZA 1QRZA 2D26C 1CBWC 1SL3A 4MLFB 3F2FA 1FIWA 2R3YA 2XYAA 2JKHA 1F7ZA 4CR9A 3RC6A 3KQ5A 1TMBH 4MQAA 1HAZB 4B6FA 1ZSJA 4ABAA 5BPEA 1TBRH 4X6MA 1F0SA 2ZPSA 2UUJB 2O8TA 5LPRA 3UNSA 2R9PA 3SN8A 4D9QA 3BF6H 1DXWA 3OY6U 1TLDA 2FX4A 2C90B 1NFYA 4GAWA 2C93B 1LDTT 3MMGA 1GGDB 2OINA 1EXFA 1MTNB 2EQNA 2W6ID 1WTGH 3ZZ8A 1G3DA 4NGAH 4FUDA 1J8AA 1GG6B 3TPIZ 2WPLS 4CH2B 2BVXH 1NRNH 3BTKE 2YNBA 2DUCA 2PKSC 4BXSA 1EB2A 8KME2 2FTMA 2HNTF 1AFQC 1FMGA 1PYTD 4K60A 4U2WA 1O2IA 1V2MT 1FAKH 2G4UA 5CHAC 2Z7FE 4F49A 3E91A 2AGEX 1XVOA 1GI0A 2XBYA 1QQUA 2ALPA 4OS2A 4ACBA 2ZCKP 3U9AH 3KL6A 2BLWA 1SQRA 2AFQB 4MTBA 1HV7A 1P2KA 3E0PB 1AVGH 3K6YA 1UO6A 4HI3A 3PMBB 4CBNA 1SGDE 1HXFH 3WWBA 1H9HE 5GNDA 2OTVA 1YCPK 1MTNC 1BTHH 2Q6GA 2G55A 1DWCH 2Y6TA 2YNAA 3SGQE 4A7IB 4WMFA 2BDBA 1A5HA 1ZJKA 3SNBA 1MAYA 2P95A 1HJ9A 1TNLA 2ILNA 1Y3WA 1A0LA 4NG9H 5TJXA 3OTPA 4FUBA 3L33A 1EZXC 2P3TB 1O3IA 1A5IA 1TGSZ 1TPAE 4CBOA 3A7VA 3ELAH 1IQKA 1SGQE 1LPGB 3GY3A 1GHBG 1NRSH 1VR1H 1CSOE 4VGCC 1C1UH 3T26A 1GI7B 4VGCB 1QL8A 3EA8A 4JZDH 1ZJDA 1K1MA 3SU0A 4YOJA 5LPFA 4BAKB 3F9FA 1Z8IB 4XRNA 3MYWA 1AHTH 2NU2E 1OWIA 4OM9A 4X1QU 2IN2A 4ABJA 2F43B 1KY9A 4D9RA 1YM0A 1ZHMA 4D7FA 1W7XH 1E1QD 2DE9A 2O8UA 3RXHA 3MU5A 1EX3A 1DSUA 3UIRA 1AWHB 1D6WA 2GGVB 3Q3KA 3PLPA 1FDPA 2NU3E 1P09A 3GY5A 4IBLH 3VEQB 4NIXA 3QLPH 2THFB 1OWHA 4MG3A 1S5SA 1ZHPA 2CF9H 2XOKD 2FI5E 3JZ2B 4K1EA 1HYLA 1C1WH 1P3EA 1GMDF 1WU1A 1UW7A 1ELVA 1QB6A 4JZIA 5KGOA 1XKBC 1O2WA 1AD8H 4B1TA 2FOHA 5A0BA 1C1PA 4KP0A 2PHBA 2CGAA 2FOFA 1F0RA 1Z8JB 3W1EA 2SGPE 2ZTXA 1SGYE 2BOHB 3SOSA 8ESTE 2PKSB 1GPZA 2FDAA 4NIVA 1V3XA 2BQ6B 1K9OE 1MU6B 4ZKNU 4KTSA 4ACAA 1GMDG 1MQ6A 1JIRA 1W2KH 1TA6A 2B0FA 4GVUA 3VGCC 1C5MD 1YP9A 4AG1A 2O8LA 2BX4A 1SB1H 1BT7A 1YPJH 2A0QB 4LXBH 2QCYA 3SQHE 1EPTA 5J4QA 3MU1A 3KIDU 4IMZA 1EQ9A 3M3VA 2W7UA 1MKWK 3OY5U 2Q1JA 1SLWB 1NZQH 2PP6A 2BY8X 1ELBA 1SQAA 4H42U 4I8JA 1UMAH 1PPEE 1V2TT 3F0OA 1GBLA 3EYDA 1BMFD 1K1NA 5EPNA 5FPYA 1O5AB 5IYTA 3SQEE 4HTCH 4SGBE 3RXUA 1GVLA 2TGAA 1S84A 5ESBA 3RXFA 2C8YB 3LH3A 1C5XB 1OP8A 3UQOA 5GPIB 2V3MA 1C5WB 4X2VA 1HAXB 4YLQH 5SGAE 3LC3A 1MTWA 4NWKA 4WJG2 3ZVGA 2EEKA 1C2FA 1EPTC 2BY6X 3C27B 3PTNA 1HAPH 1GJ7B 3ITIA 4LOYH 4HG6A 1GHZA 1TFXA 3WW7A 3VB7A 3SU5A 2H9TH 1H8DH 2GX4A 1O2LA 5C0TA 5HXFA 2FO9A 2ZFRH 1HJAC 1O2HA 1O5DH 4Q7YA 2DE8A 4B76A 4JYVH 4ISIH 2RA0A 2G5VA 2H1UA 1IQJA 1FONA 4ZXYH 2KZ4A 4F55A 4GCHG 1W0ZU 1TA2A 2ZG0H 1VITG 1MZDA 1LKAA 4NFEA 1Y3VA 1BUIA 2Z94A 1K1JA 2Z3CA 2R0KA 4BOHA 1K2I1 2C3SA 8GCHG 4UFDH 3RMLH 2HPPH 2C8XB 4NZQA 4B74A 3PO1C 3KQCA 3LJJA 4DIIH 3PROA 3UOUA 4ZUHA 1C5OH 3M7QA 3UPEA 1BTXA 1CA8B 1Z1IA 3ZV8A 1SKYE 1O2MA 1PPHE 1GBTA 3GDSA 3TGIE 3F9GA 1RTFB 2XBVA 5EQSA 1O3JA 1GHVH 1WSSH 1GCTB 3GICB 2Z9GA 1GHAF 2BDAA 4X8SH 4O9VA 1V2LT 4NA9H 1YC0A 1S81A 3QK1A 2NU1E 2V35A 2WPKS 4SGAE 3M36A 1NM6A 3W94A 3MNCA 2PKAB 3A82A 3KYFA 3F2HA 1TMTH 4B71A 3T29A 3QO6A 1TNKA 3BTME 3O8DA 2GT7A 2YMSB 1WCZA 1NU9A 3B23B 3DD2H 1OSSA 3MU4A 1SMFE 2GV7A 4RKOB 5DN6D 3ATIA 1XUJA 1MKXK 2J34A 2BD5A 1ELCA 1MBMA 1C5UA 1G3BA 1G3CA 5EPYA 4CRFA 3F2GA 3SV2H 1W12U 1AB9B 2BQ7B 3PYHA 1MTUA 5EG4A 4FXGH 5AVDA 3U28C 4DT7B 1DS2E 3VB4A 2TBSA 1O3HA 2AHME 4I86A 1RD3B 2BDYA 1G37A 1IQFA 1DITH 3FOAA 4UD9H 1V6DA 3HPTB 4F48B 1ELFA 1AKSA 1W0JD 4X1PU 3SV7A 1Y5BT 2SGDE 5ETXA 2QAAA 4A6LA 2IPHA 3MNSA 1OP2A 2H2ZA 2F3CE 3P8NA 5DK1A 3ZVAA 3MTYA 4K3JA 4QT8C 2ZDVH 1HB0B 4Y8ZA 5EGMA 2CJIA 2ZFPH 1O3AA 2ANMH 1PPCE 4GSOA 3ZZ4A 3ZYEA 5EW2H 4ABHA 2BY5X 1PQ5A 5EJ1A 1GBAA 3RLWH 1Z8GA 1D3TB 1CBWB 3H09A 2BDGA 4BAQB 5FPSA 1FLEE 1DXPA 4FUFA 1QRXA 1O5BB 1AFQB 1VCWA 3SI3H 3M37A 1N6XA 3UB0A 2F4LA 1NBMD 4B75A 3VXEH 1KTTB 1XX9A 3LONA 1SLVB 3W95A 1LPZB 3ZVBA 5DP7A 1V2UT 4IN2A 4M7GA 3IITA 1LVMA 1GJAB 3U8RH 2D8WA 4ZCNA 2PSXA 2ZI2H 1V2RT 1UK2A 3RMMH 5C1UA 1TNHA 1ID5H 2SNWA 1UTOA 2VGCC 2GCTC 4DW2U 1NC6A 2XNIA 3AW1A 1WOFA 3BSQA 3E1XB 2AIQA 3FAOA 2XNDD 2I6QA 1OX1A 4IN1A 2B9LA 1C4Y2 2CK3D 4KTUA 1NO9H 1QL9A 1YWUA 4JYTA 3KHVA 3D65E 2YMSC 2J9NA 1TRMA 3O8RA 5FPTA 4AN7A 3A7WA 1K22H 1ZMLA 3GDUA 3ODDA 1QB9A 1HJAB 2C8ZB 3VB5A 3AAUA 1PPGE 1E38B 5A09A 4OS6A 3IG6B 1SQTA 4X8VH 1TOMH 3QTOH 3LC5A 4JMYA 3RXQA 1TGNA 4AFQA 2UWOA 3PV5A 1EFRD 2JJ2D 4UONA 2QE7D 2BLQA 2XC4A 3TJNA 1SFQB 2ANYA 1BRCE 2B5TB 1C2DA 4MPUA 1PQ7A 2BY7X 3A8BA 3GDVA 2ZDAH 3G01A 1A0JA 4I8KA 3RXDA 1COWD 3GCNA 1Q31A 1P2MA 1QA7A 1S6FA 3OFND 1UTQA 2KCOA 1GI5A 4YO9A 1ELEE 2W3KA 1TPPA 3JZ1B 4RT1A 4R0IA 1C5SA 1DE7H 4MNWA 3ZVDA 1QZ8A 1RTKA 1ZYOA 3S7KB 4UFFH 5DGJA 5KEDA 1O35A 1THRH 3LH1A 1PPBH 2Z6BD 5A0CA 2ZCLP 3E90B 3AK5A 2FM2A 4B2CA 1C2KA 4X8UH 5C1YA 1S6HA 1IQIA 2O9QA 1V2JT 4NCYA 1CA0B 3SU4A 2XW9A 3UOPA 4MPXA 2WZQA 2GT8A 4MPWA 2OP9A 4Y8XA 3OU0A 3H7OA 2ZHWH 1ESTA 2Q6DA 4XBBA 4Y0ZE 4BTIB 1DWBH 3ZZ6A 1Z6EA 3QGNB 3ZZBA 1EAWA 3EDXB 3LGTA 4WMDA 1GJ6A 1NY22 1S0QA 3U8OH 5A0AE 1TX7A 2XXLA 2AH4X 1LVOA 2J5UA 1A46H 2Y81A 1CO7E 1QGFA 2FOGA 3BG4C 3ODFA 1FV9A 4DT4A 3MO6A 4OS1A 1GHAG 3KF2A 5EOKA 1NFUA 1EZUC 1P9SA 2P8OB 3GCHC 2KX4A 1BB0B 2Z9JA 1C5VA 2GZ8A 2J95A 2GP9B 1XKAC 1DM4B 3RXIA 1GJ5H 4FUCA 5F8TA 3GY8A 4NA8A 4O3UA 1EAIA 1XUKA 1SQOA 1LVBA 3TGJE 1AIXH 3BTFE 4A1XA 1S85A 3FP8E 2AYWA 1OS8A 4WH6A 1ELTA 1Y8TA 2H5CA 9ESTA 4GCHF 4INKA 1J17T 1AFEH 2BTCE 1GBBA 4IS5A 1AUTC 1ZPBA 1F0UA 3DFLA 1O2XA 2CXVA 4IC6A 4ZKOU 3SU6A 6LPRA 2HGTH 1FZZA 3P70B 5DP6A 3UWJH 3LPRA 1G3EA 5DP4A 1O2KA 2F9OA 4Y71A 5T1VA 1QURH 1BTPA 2IJOB 1EATA 2BDIA 6CHAB 1SGPE 1EP5A 3GISB 1ZSKA 3NXPA 2K0QA 1C2EA 2FODA 4DY7B 1DT2A 1GJCB 2GVFA 1O3MA 2BDCA 1OWEA 2A45B 4GUXA 1CGIE 7LPRA 2FOCA 2PSYA 2BM2A 3A86A 4UFGH 1C5TA 3LKWA 2UUKB 4UDWH 3DFJA 1CU1A 1FN6A 1T4VH 1FNIA 1T8NA 5G4BA 3QWCH 2Z9IA 1JMOH 1A3EH 1GI8B 1TBZH 2B7DH 2HNTE 5JBBS 2ZWLH 1VCQA 3BTEE 3DSOA 3UWIA 1ARCA 1YBWA 1S83A 2I6SA 2PGQB 1JRSA 2VWOA 4FU8A 4BAMB 1C4U2 1S0RA 4UE7H 5FL7D 3BG8A 5A8XA 4CH8B 1W8BH 1SG8B 3RXOA 3K65B 4Y7BA 1FY8E 2GZ7A 1A4WH 1SGTA 3VXFH 4CRCA 3A7XA 1L2EA 3A85A 3SGBE 3RXSA 2UWPA 1GJDB 4OS4A 2VIWA 1QBVH 4BTTB 1T7CA 4U30A 4NSYA 1C1VH 1QJ6B 1NN6A 4DJZB 3LU9B 1TALA 4ASUD 1FI8A 5HIYA 1CHOF 2ZHDA 2F9NA 5JB9S 2Y82A 1T32A 2G4TA 2VIDA 1UJ1A 3OEHD 5A8YA 2KCYA 4FUIA 1BIOA 1QTFA 5FXLA 7GCHF 4XBCA 3H5CB 2HVXA 3U1JB 1GBKA 3UNRA 5EJZA 3AAVA 1WQSA 2FEQH 3AVZA 4K69A 1SHYA 1GBFA 4ISHH 1O31A 5B6OA 1S6LA 1NESE 2RDEA 1B7XB 2PUQH 4TY7A 2BDHA 1GMHG 1P06A 1QJ1B 2FYRA 3PV4A 1O3CA 2PGBB 3T28A 4I8GA 1O3DA 1P02A 1C1SA 1BJVA 1PJPA 2A2XH 1RIWC 1BTUA 3RXKA 2PUXB 1LHGH 1OP0A 1MKWH 1UTJA 1VITH 4WVPE 4Y0YE 5DP9A 2QY0B 3PO1B 2ZGXH 3LGWA 1E37B 4AGJA 1H9LB 8GCHF 1P8VC 1OWDA 2HOBA 1ANCA 1GI1A 2XTTB 3TVJB 4MNVA 2PFEA 3KCGH 2AMPA 5T6FA 1VITF 4FUHA 2KAIB 1MBQA 1A0HB 2V0BA 3ZV9A 1KXFA 3AW0A 4X8TH 3DSPA 1O2UA 4AYVB 3M5OA 1VGCB 1KTSB 1DY8A 2LELA 2GTBA 1ETTH 2WPHS 1KDQA 4FU9A 3RXJA 1NTPA 4PROA 1YPKH 1V2WT 1O30A 1O33A 2FIRH 2WV5A 1DLEA 1ZHRA 2P16A 1K1OA 2FS9A 3HGPA 1Q2WA 5GXPA 2BB4A 2JH5D 3TU7H 3D23A 1O2ZA 1SGNE 3BG4B 2TRMA 2SFAA 1ZPCA 5EU8A 3BV9B 3M35A 1H8ED 1P2JA 2BHGA 3HK6B 2ZC9H 3RU4T 4CHAC 2CN0H 1EKBB 1KMHB 3NCLA 5JYIA 2BD7A 4JYUH 2AEIH 4OGXA 2ZGHA 2VBCA 3BTQE 5JB8S 1Z8RA 1FPHH 3L3TA 5PTPA 2GZ9A 4AOQA 3U8TH 4XFQA 1NRRH 2ULLA 2OQUA 1BBRH 1LCYA 2OC7A 4DOQA 2ZNKH 4YZUA 5K0HA 1LHCH 2P3FH 3FZDA 3MNXA 1NRPH 4J1YA 3FKSD 3SJOA 4JZFH 3MHWU 8LPRA 4ABFA 2BVSH 5CHAB 2FTLE 2JJ1D 2Y5HA 2CHAC 1BMMH 3OYPA 1QJ7B 4X1SU 1ETRH 2WPMS 3I77A 4X2YA 1GHYH 3F9HA 3ZZ3A 1G30B 2M5TA 1CA0C 1SBWA 3TK6A 1F92A 2A4OA 2CHAB 2HALA 3PB1E 3SNAA 4JCNA 1MH0A 5GDSH 4CRAA 1SGEE 1QA0A 2STAE 2PV9B 1O2QA 2WPIS 3ATLA 1A7SA 1TIOA 4RKJB 1DANH 4U32A 1L1NA 1HAGE 5FX6A 3SV8A 1FPCH 1V2ST 2WHXA 1KLTA 3A87A 3GOVB 1B0FA 1NU7B 4TPIZ 5LPEA 1MKXH 1HGTH 2R3UA 3GY7A 2AMQA 1XXDA 3KN2A 4FVDA 2B8OH 4UFEH 1GJ4H 2GDDA 1SGFA 1W7GH 2P8OC 3MOCA 1YPMH 4Y76A 1YLCA 3ZZDA 1P57B 4X6PA 3U69H 2R0LA 2PR3A 1MU8B 2EY4C 3OEED 2V6NA 1TGTA 1OYTH 4JZ1A 5ESTE 2SGEE 2ZEBA 3KQBA 3E6PH 3S69A 3HKIB 2KFWA 2ZQ2A 1GVKB 2UUYA 1YYY1 3DHKH 3A7TA 5EODA 2WV4A 1GMCG 1Q3XA 1UVPA 1JOUB 4Y79A 2D2DA 1BCUH 1NS3A 1HPGA 1ZTJA 1UTLM 5E2PA 1D3DB 3RMOH 1NRQH 1CGJE 1H8IH 1E35B 4D7GA 2ZHEH 1BTZA 3NK8A 2ZFTA 4F4OC 3S0NA 4CRBA 3ENSB 3U98H 1P01A 5AF9H 1TOCB 1EOJA 3LGYA 3KYGA 3EA7A 3NZIA 3P8OA 2ODPA 3A7YA 2RCEA 3B9FH 1LPKB 1W0KD 1MCTA 1DLKB 4DURA 5HKKD 4WH8A 4E7NA 2KCAA 1FY1A 3MWIU 4I8HA 1BDAA 3T5FH 4CRDA 1G36A 2LNCA 1ZGVA 3ZVEA 1AGJA 1V2OT 5TCCA 3SUGA 5J4SA 2TPIZ 5A2MH 1BMNH 1AN1E 4DVAU 2ESTE 4TT3D 1XUHA 1WBGB 1UTKA 2GCHF 1OOKB 5F6MA 1YPEH 1O2OA 1ETSH 2ZP0H 1DY9A 2OXSA 5HGGA 3VB6A 1P12E 2K1QA 1PQ8A 1CQQA 1WXRA 2ZCHP 4ZKRU 4RT0A 2OD3B 2TGPZ 1PYTC 3LIWA 2BZ6H 2H5DA 1AU8A 1FY5A 2P59A 1RTLA 1EOLA 1QRWA 1RFNA 1GL0E 4K1TA 2FXRA 5CDFE 4Y7AA 5GIBA 4B73A 1D3QB 2PW8H 1A2CH 1GBDA 3SU3A 1GJBB 1H4WA 3KEEA 5EQRA 1V2KT 1ZOMA 1G9IE 1P2QA 1O36A 1O32A 1HAYB 1UTMA 4FUGA 1ELAA 3MI4A 1TB6H 1C1QA 4M9FA 3O8CA 1B0EA 4ISNA 4XSKU 4ZROA 3BTTE 2SGQE 1AWFH 1O0DH 3FVFB 1DX5M 2ZIQH 3M5LA 4HGCA 5C94A 3LGVA 1CT4E 3FZZA 1C2LA 1FY4A 3SO3A 1P11E 1GL1A 3VPKA 1ELDE 4TPYA 3V13A 4FVBA 4B2BA 3OSYA 4TWWA 3RXRA 5ABWA 4NA7A 4X0WU 1KXDA 3URDA 2ZFQH 3HKJB 2FX6A 2EC9H 1BRAA 3K9XB 3RXLA 3SZNA 2ZO3H 1VJ9U 1QNJA 1DFPA 1P03A 1C2JA 1J15A 3K6ZA 2ZFSA 1QIXB 2BLVA 4KGAA 4AORA 1UVTH 2J92A 3DA9B 1SPJA 3RXTA 1YY3A 3SJKA 1K1PA 2G52A 4FUJA 3QZQA 4YOIA 3PM3A 1GG6C 5FBEA 2ZDNA 2AMDA 1NBME 4BTUB 1YPHC 4GHQA 4Q4LA 2R2MB 1TRNA 3MU0A 4BXWA 3V0XA 3PMHB 1GGDC 2BQWB 1J16A 2A7CA 2AGGX 1IQHA 2Y7XA 5C2ZA 1C2MA 1BA8B 1ANDA 3UUZA 4ABDA 5EQQA 1S82A 2GMTB 1FY3A 2BXTH 2C4FH 2IPQX 3CENA 3S9AA 1SFIA 4K1SA 2IOTA 2QXHA 1HAHH 1W3CA 5FX5A 1O3PB 1O2PA 1TE0A 2FOBA 5C3NA 2QGRA 1P04A 2RG3A 5H4IB 1LQEA 2K8IA 2QF5A 5HM2A 1C2HA 1CT0E 1P2NA 1H9IE 4FETA 4P02A 2WV9A 5CHBA 3FN8A 2ODQA 1DPOA 3MNBA 4Q80A 5DPAA 1RS0A 4BAHB 5JBTA 1ACBE 3CP7A 2ZTZA 2Z3EA 4AG2A 2EI7A 1TPOA 3QZRA 2ZU3A 4ESTE 1OXGA 5EW1H 3NUMA 2ZGJA 1GCDA 1CVWH 3BN9A 4UEHH 1QBNA 3EA9A 1Y3YA 1MD7A 1C5YB 1O2JA 2ZZUH 3GYLB 3LT3A 3P92A 1KLJH 2GDEH 2W3IA 2ZPRA 3PV2A 4OS7A 4YXWD 2G00A 1TYNA 5FCRA 4CHAB 3LOXA 2FI3E 7GCHG 3NPSA 4H6SB 3UR9A 1LMWB 3PTBA 1THPB 5F03A 1P10A 3O8BA 1CHOG 2A2QH 1C4V2 4A1VA 4FOUC 1O2NA 1TQ7B 5TCAA 4XOJA 2P94A 1K1LA 5L2ZH 1XUGA 1MQ5A 2A1DB 1IQNA 2ANWA 3DUXH 3QN7A 6GCHG 2BMGB 3ZZ5A 1RRKA 4I7YH 2XC5A 2VNTA 3LJOA 3FO8D 5JBAS 1LHFH 1O3FA 1Z7KA 3RM2H 9LPRA 1E79D 1H1BA 2WYJA 2EI8A 2GMTC 4LK4A 2BXUH 1WUNH 2JETC 2P3UB 2KCPA 3WWFA 3GCTG 4DGJA 1GJ9B 1N1LA 2HPQH 3PWCA 1IAUA 3GY2A 4MDSA 1HRTH 1SLUB 2Z9KA 1LHDH 1AI8H 3D62A 2BD9A 3GCOA 3BIUH 2ALVA 1AZ8A 3BEUA 1ANBA 2TGDA 4YT7H 5C17A 1LHEH 4AYYB 4IGDA 3SGAE 5EIYA 2J4IA 4X1RU 3A7ZA 2OBQA 3KQEA 3QGJA 1IQLA 2ZU2A 1K21H 2V3HH 1UK4A 2LP6A 1CT2E 5JDUB 4KKDA 1UCYE 1GI4A 1UVUH 4WWYA 1J14A 1F5KU 1SVPA 3SHCH 4XE4A 3IWMA 5E8EH 1EZQA 1D4PB 5DKMA 1C1TA 2O8MA 3FFGA 4NFFA 1SGRE 1YCPH 4MNYA 2VGCB 1BJUA 1HIAA 3ZIAD 1N8OB 1YCPM 5DJ7A 3SZEA 1ARBA 1XXFA 5HM9A 2Y5GA 4Q63A 2WSSD 5FBIA 1PPFE 3BEIB 3HATH 1MUEB 1T4UH 2GV6A 1OWKA 2VVUA 3M5NA 4H6TA 4AB9A 3VGCB 2F9UA 1SGFG 5HYOA 4INLA 5LH8A 2NU0E 2ANKH 2EA3A 1LQDB 3L6PA 4X2WA 1G32B 1T8OA 3A8CA 2BYAX 1BQYA 2R2WU 1QCPA
chains in the Genus database with same CATH topology
1SGCA 4IW4E 1AE5A 1FAXA 1WV7H 1C2IA 3SJIA 5BRRE 3TNTA 1BHXF 1EJAA 1P9UA 3RXGA 3TJOA 2STBE 1GHWH 1T31A 2YOLA 5GJ4B 3V3MA 1XUIA 1W11U 1O39A 2OC0A 1ZMJA 2ZECA 1P2IA 2G81E 5AFYH 2VU8E 1M9UA 1GWAA 2BD2A 3GY6A 1KYNA 1IQEA 2P93A 3SNCA 1GHBF 2G51A 4H4FA 2FLRH 2HRVA 4A5TS 1WTHD 4YOGA 1C9PA 2F9VA 1ABIH 1IQGA 2H9HA 1HAVA 3ZVCA 4Z0KA 1AMHA 3LDXH 1NT1A 2ZPQA 1W0YH 3A89A 1L4DA 5E0JA 3RXVA 3Q3YA 4RN6A 1KXBA 2VWMA 1LVYA 1F2SE 1DWEH 1TNGA 3F68H 2BLOA 1HUTH 4ZMAH 2A4QA 3ESTA 4TYDA 1GDNA 1HJ8A 1MTVA 1THSH 2VB0A 2WINI 1AUJA 1TRYA 3ZZAA 1W13U 1AQ7A 3MO9A 1MMJN 1GBJA 1UK3A 2FWWA 2ZHQH 1RIWB 1YKTA 3GCTF 2A7JA 5T3HA 1V2VT 3TJVA 2WUBA 4CR5A 1BMLA 1VCPA 1XM1A 5FAHA 3SUFA 2FPZA 1DOJA 2FOEA 2ZA5A 5CE1A 5FCKA 1UTPA 1A1RA 2FYQA 3MH7A 3U1IB 2F9PA 1QHRB 4A92A 2O8WA 2WPJS 4DG4A 3STJA 2V3OH 1O3OA 3SUEA 2PTNA 3K2UA 2ZHFH 2A5IA 1BRUP 1P05A 2FESH 3FP6E 3QDZB 4KELA 1HAIH 5IDKA 1GMHF 4K8YA 1JWTA 1O5FH 1TPSA 4AZ2B 2J94A 1G2LA 2UWLA 1KIGH 1YPGH 4Q2KA 3EGKH 4ZKSU 1NFWA 3T27A 1V2QT 3TLOA 4GLYA 3A81A 2VH0A 1EP6A 1UCYH 2FOAA 4ZHAA 1BITA 2KAIA 1QFKH 2ZU1A 1GI9B 5DP5A 1KXEA 4YT6H 5EXLA 1BHXB 3A80A 1NFXA 2F83A 2VVVA 1DWDH 1WYKA 3Q3XA 1C5RA 4OGYA 3N7OA 3TH3H 4O3TA 2XCNA 4X2XA 4Q7XA 1C5QA 1A5GH 2C8WB 2FS8A 1P2OA 4Y6DA 3STIA 3CS7A 3P8FA 1L0ZA 3D49H 1TMUH 2GD4B 1P0SH 2OUAA 1DUEA 4Y8YA 4E06H 1D6RA 1OKXA 3LGIA 5L2YH 1FUJA 1HXEH 1EB1H 1QR3E 1WQVH 5T6GA 3P17H 2ZKSA 1EPTB 5CMXH 1G2MA 2FI4E 7KMEH 2ZTYA 2XWBI 4DCDA 3DT0H 2PLXA 1C5NH 3BTWE 4NZLA 2LPRA 3RU4D 4GHTA 1O5GH 5JPMH 3MU8A 2SGAA 4AFUA 2Y80A 3ZZCA 3I29A 4WF8A 4ZAEA 4B2AA 1Z71A 1P3CA 5FHTA 3T25A 3SUDA 2WUCA 3UQVA 3Q77A 2BD8A 1HAOH 2VIPA 1QB1A 2SGFE 2CV3A 2Q6FA 3RLYH 3URCA 2Z3DA 3ATMA 3M5MA 3ZVFA 1U6QA 7ESTE 3SBKA 1KXCA 2BD3A 2QXJA 3E8LA 2QF0A 2VIOA 2JH0D 1IHSH 3PWBA 5C5NA 3QUMP 1UTNA 3RC5A 3Q76A 4IMQA 1INCA 2QYIA 1LKBA 4OS5A 3TH4H 4O03A 1O2GH 5AHGH 4WY3A 1DDJA 1O5CB 1GDQA 1V2PT 1TGCA 1XMNB 1L1JA 2A31A 5JBCS 2GCTB 4ABGA 5L6NH 4WXIA 4HFPB 1WAYB 2W26A 3FP7E 1HDTH 1TNJA 4XDEA 1L4ZA 1GI2A 3F9EA 1BTYA 1A3BH 4RSPA 2WYGA 1W14U 3A83A 3ATWA 2F9BH 1ZTKA 1ZRKA 3RP2A 1QY6A 1TWXB 3H7TA 3OX7U 3B8JA 5GCHG 1N6YA 1SOZA 3SV9A 5EXNA 1ELGA 4X1NU 1DUAA 1JBUH 3M7TA 3NKKA 2FOMB 4NSVA 1V2NT 1AVWA 1O2RA 5F8ZA 2BX3A 5E0HA 3RXAA 2Y5FA 4Y10E 1VJAU 2G5NA 2ZDMA 4FUEA 2CF8H 3ZYDA 4JZEH 5E2OA 1TGBA 4NIYA 1F0TA 1IOEA 1TABE 2A4RA 3S7HB 3UY9A 5F8XA 3UFAA 3R3GB 1FXYA 2OBOA 1C5PA 1QBOA 1TNIA 4ABIA 2EI6A 1B5GH 2QA9E 1SR5C 1PPZA 1O2SA 1GBMA 1EJMA 3LGUA 2VJ1A 2W7SA 3C1KA 1O3BA 1HCGA 1UVSH 6ESTA 1EJNA 1E0FD 1BTWA 4ABEA 1O38A 1ZR0A 3BTHE 3ZZ7A 3TNSA 2VH6A 6GCHF 3ZZ9A 1ZGIA 3V7TA 1ZSLA 3A8AA 2ZGBH 1N8OC 1HBTH 3RXMA 1Y5AT 3RXPA 4JK6A 4YLUA 1O3EA 3S9BA 3E16B 4MPVA 5L30H 4ABBA 3PLKA 4LZ1H 1BRBE 3F6UH 1SOTA 2A5KA 2HLCA 4XBDA 3FANA 4J2YB 4MNXA 1E34B 1EASA 2ZDLA 3S9CA 2NU4E 2G8TA 2QF3A 5C1XA 3Q00A 4MVNA 2FMJA 4DIHH 4K8BA 1ZPZA 1KDQB 1RGQA 2ZU5A 2VWNA 1AKSB 2UUFB 2OCVB 1JRTA 3SORA 1OPHB 2A7HA 3VB3A 1TAWA 1IHTH 1C1OA 2PKAA 2AS9A 1HIAB 5I25A 5HMAA 1FIZA 1GDUA 1ZLRA 1XUFA 1LTOA 4AB8A 3RMNH 3WY8A 1O3NA 3A88A 4ASHA 1Z6JH 1FJSA 4CREA 1Y3XA 3AASA 3P8GA 1UHBB 3R0FA 1Y59T 1GJ8B 4ZHLU 3BTGE 5LGOA 4JK5A 4I33A 3M3SA 2CMYA 1MTSA 3QX5H 3MFJA 3E3TA 3HGNA 1LO6A 3PMJA 2BY9X 1JIMA 2JH6D 2XBWA 4NWLA 2PTCE 1O3LA 3F1SB 3PMAB 3SW2B 3RXEA 2BD4A 4BANB 1C2GA 3RM0H 3KGPA 1TBQH 5E0GA 1C1NA 3SHAH 1EZSC 1GBIA 4GPGA 1XVMA 3UR6A 4X6OA 2J2UA 1RXPA 1GBCA 1YPHE 2AGIX 3SNDA 2QC2A 4O97A 4INHA 3A8DA 4ZH8A 3SU2A 2H9EH 2ASUB 2OC1A 2VINA 1FN8A 1K1IA 3KNXA 4Z6AH 2HWLB 4TY6A 3MH5A 4NIWA 1E36B 1YPLH 1SGIB 2JETB 2AERH 1QQ4A 2OQ5A 3SU1A 4WXVA 3TJUA 4E7RG 1GI6A 1ZRBA 3M7UA 1HNEE 2RDLA 2Z9LA 2QN5T 4CRGA 3TH2H 1O37A 3MH6A 4Q7ZA 1HLTH 4ZHMU 5C67A 2A5AA 1O5EH 1KLIH 1ESAA 1AE8H 1AY6H 1BBRK 1EUFA 2QV1A 1D9IA 2VVCA 1GVZA 2QXGA 1ZZZA 2ODYB 1J9CH 2A4GA 1D3PB 5I46H 1FQ3A 2ZFFH 1GI3A 1UVOA 3SI4H 3I78A 1O2YA 3PLBA 5A8ZA 1EAXA 1ZTLA 1CHGA 2OC8A 3VFEA 2SNVA 1Y5UT 3MO3A 4X6NA 2FP7B 5DO4H 2GKVE 3UTUH 4WMEA 4ISOA 3SJ8A 1Z1JA 1QL7A 2BOKA 5C5OA 1SHHB 3RUOA 3A84A 4HZHA 3RDZA 1YF4A 3TK9A 1ORFA 1RJXB 1HFDA 1T8LA 3GCHB 1ESBA 4Y11E 3M61U 1NROH 4A1TA 2NWNA 3SJ9A 2ZQ1A 1SC8U 4ZXXH 1GBHA 2H6MA 4AGKA 3BTDE 2Y7ZA 3UNQA 1DICA 1A61H 5K7RA 5AFZH 1IQMA 1TQ0B 6CHAC 2XCFA 2XWAA 3P95A 2XBXA 4D8NA 1CE5A 5GWZA 3V12A 1CGHA 2QIQA 5DP3A 2VIQA 1MD8A 2GCHG 2OLGA 3M3TA 4FU7A 2AIPA 1AO5A 3UREA 3GYMA 1MAXA 3OTJE 1UCYK 3HK3B 1TX8A 3TGKE 2BVRH 1X7AC 4THNH 1F5LA 1SI5H 1O34A 4AFSA 3EQ0H 2ZDKA 1YGCH 1C5LH 3GY4A 3BEFB 3T2NA 2XC0A 4AFZA 3T62A 1KSNA 1BOQA 2A32A 1C1MA 1O3GA 1VZQH 1AVXA 2PWXA 2TGTA 3RXBA 3SV6A 4KTCA 5GCHF 1O3KA 1SLXB 3P6ZB 3RU4E 4YM9A 2XRCA 3QTVH 1F5RA 4K5ZA 1C9TA 1L1GA 1DSTA 1JXPA 1MZAA 2FZZA 3EE0B 4IC5A 4YESB 1AB9C 1O2TA 1GMCF 3MH4A 4YTAA 1EAUA 1ANEA 1GBEA 2QXIA 2W5EA 2FLBH 1SSXA 3ATKA 2F91A 3EAJA 5EXMA 3RC4A 1ABJH 4ISLA 4BNRA 2BZAA 1K28D 5DP8A 4K2YA 3KQDA 1MCVA 1BMAA 2ZF0H 4I31A 2ZGCA 1OWJA 1NPMA 1ZMNA 5C20A 1HAVB 1Y3UA 2VIVA 3RXCA 1PFXC 1DVAH 4TWYA 2HNTC 2ZU4A 4R8TB 1KXAA 3NWUA 1T8MA 1C5ZB 3TIUA 1GCTC 4LZ4B 3E0NB 1YLDA 3TK5A 3SNEA 4D76A 1VGCC 1OYQA 1TONA 1O2VA 2VWLA 3CS0A 1BZXE 4AX9H 1PQAA 1C1RA 3TITA 4E05H 4I8LA 5DG6A 4I32A 2D1JA 5T6DA 2J38A 2TIOA 3BIVH 4U01A 1W10U 4BAOB 1TX6A 1GHXH 1UHBA 1BBRE 2RA3A 1AZZA 1QRZA 2D26C 1CBWC 1SL3A 4MLFB 1FIWA 2R3YA 2XYAA 2JKHA 1F7ZA 4CR9A 3RC6A 1TMBH 4MQAA 1HAZB 1ZSJA 4ABAA 5BPEA 1TBRH 4X6MA 1F0SA 2ZPSA 2UUJB 2O8TA 5LPRA 3UNSA 2R9PA 3SN8A 4D9QA 3BF6H 1DXWA 3OY6U 1TLDA 2FX4A 2C90B 1NFYA 4GAWA 2C93B 1LDTT 3MMGA 1GGDB 2OINA 1EXFA 1MTNB 1WTGH 3ZZ8A 1G3DA 4NGAH 4FUDA 1J8AA 1GG6B 3TPIZ 2WPLS 4CH2B 2BVXH 1NRNH 3BTKE 2YNBA 2DUCA 2PKSC 4BXSA 1EB2A 8KME2 2FTMA 2HNTF 1AFQC 1FMGA 1PYTD 4K60A 4U2WA 1O2IA 1V2MT 1FAKH 2G4UA 5CHAC 2Z7FE 4F49A 3E91A 2AGEX 1XVOA 1GI0A 2XBYA 1QQUA 2ALPA 4OS2A 2ZCKP 3U9AH 3KL6A 2BLWA 2AFQB 4MTBA 1HV7A 1P2KA 3E0PB 1AVGH 3K6YA 1UO6A 4HI3A 3PMBB 4CBNA 1SGDE 1HXFH 1H9HE 2OTVA 1YCPK 1MTNC 1BTHH 2Q6GA 2G55A 1DWCH 2Y6TA 2YNAA 3SGQE 4A7IB 4WMFA 2BDBA 1A5HA 1ZJKA 3SNBA 1MAYA 2P95A 1HJ9A 1TNLA 2ILNA 1Y3WA 1A0LA 4NG9H 5TJXA 4FUBA 3L33A 1EZXC 2P3TB 1O3IA 1A5IA 1TGSZ 1TPAE 4CBOA 3A7VA 3ELAH 1IQKA 1SGQE 1LPGB 3GY3A 1GHBG 1NRSH 1VR1H 1CSOE 4VGCC 1C1UH 3T26A 1GI7B 4VGCB 1QL8A 3EA8A 4JZDH 1ZJDA 1K1MA 3SU0A 4YOJA 5LPFA 4BAKB 3F9FA 1Z8IB 3MYWA 1AHTH 2NU2E 1OWIA 4X1QU 2IN2A 4ABJA 1KY9A 4D9RA 1YM0A 1ZHMA 4D7FA 1W7XH 2DE9A 2O8UA 3RXHA 3MU5A 1EX3A 1DSUA 3UIRA 1AWHB 1D6WA 2GGVB 3Q3KA 3PLPA 1FDPA 2NU3E 1P09A 3GY5A 4IBLH 3VEQB 4NIXA 3QLPH 2THFB 1OWHA 4MG3A 1S5SA 1ZHPA 2CF9H 2FI5E 3JZ2B 4K1EA 1HYLA 1C1WH 1P3EA 1GMDF 1WU1A 1ELVA 1QB6A 4JZIA 1XKBC 1O2WA 1AD8H 4B1TA 2FOHA 5A0BA 1C1PA 4KP0A 2PHBA 2CGAA 2FOFA 1F0RA 1Z8JB 2SGPE 2ZTXA 1SGYE 2BOHB 3SOSA 8ESTE 2PKSB 1GPZA 2FDAA 4NIVA 1V3XA 2BQ6B 1K9OE 1MU6B 4ZKNU 4KTSA 1GMDG 1MQ6A 1JIRA 1W2KH 1TA6A 2B0FA 4GVUA 3VGCC 1C5MD 1YP9A 4AG1A 2O8LA 2BX4A 1SB1H 1BT7A 1YPJH 2A0QB 4LXBH 2QCYA 3SQHE 1EPTA 5J4QA 3MU1A 3KIDU 4IMZA 1EQ9A 3M3VA 2W7UA 1MKWK 3OY5U 2Q1JA 1SLWB 1NZQH 2BY8X 1ELBA 1SQAA 4H42U 4I8JA 1UMAH 1PPEE 1V2TT 1GBLA 3EYDA 1K1NA 5EPNA 5FPYA 1O5AB 5IYTA 3SQEE 4HTCH 4SGBE 3RXUA 1GVLA 2TGAA 1S84A 5ESBA 3RXFA 2C8YB 3LH3A 1C5XB 1OP8A 3UQOA 5GPIB 1C5WB 4X2VA 1HAXB 4YLQH 5SGAE 3LC3A 1MTWA 4NWKA 4WJG2 3ZVGA 2EEKA 1C2FA 1EPTC 2BY6X 3C27B 3PTNA 1HAPH 1GJ7B 3ITIA 4LOYH 1GHZA 1TFXA 3VB7A 3SU5A 2H9TH 1H8DH 2GX4A 1O2LA 5HXFA 2FO9A 2ZFRH 1HJAC 1O2HA 1O5DH 4Q7YA 2DE8A 4B76A 4JYVH 4ISIH 2RA0A 2G5VA 2H1UA 1IQJA 1FONA 4ZXYH 4GCHG 1W0ZU 1TA2A 2ZG0H 1VITG 1MZDA 1LKAA 4NFEA 1Y3VA 1BUIA 2Z94A 1K1JA 2Z3CA 2R0KA 4BOHA 1K2I1 2C3SA 8GCHG 4UFDH 3RMLH 2HPPH 2C8XB 4NZQA 4B74A 3PO1C 3KQCA 3LJJA 4DIIH 3PROA 3UOUA 4ZUHA 1C5OH 3M7QA 3UPEA 1BTXA 1CA8B 1Z1IA 3ZV8A 1O2MA 1PPHE 1GBTA 3GDSA 3TGIE 3F9GA 1RTFB 2XBVA 5EQSA 1O3JA 1GHVH 1WSSH 1GCTB 3GICB 2Z9GA 1GHAF 2BDAA 4X8SH 4O9VA 1V2LT 4NA9H 1YC0A 1S81A 3QK1A 2NU1E 2V35A 2WPKS 4SGAE 3M36A 1NM6A