1OP8A

Crystal structure of human granzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
234
structure length
234
Chain Sequence
IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme A
publication title Crystal structure of the apoptosis-inducing human granzyme A dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.78: Granzyme A.
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A02
1XVMA 1IQHA 3SU3A 3VB3A 3GY4A 3A7WA 4MDSA 1L2EA 4YO9A 1ZMNA 5T6GA 1AGJA 3SJ8A 2J94A 2XWBI 2FODA 1NFXA 3A7TA 2XBXA 2BDIA 5C3NA 1SB1H 2H5DA 4X6OA 2ZFTA 1C1QA 2Z9KA 2Y81A 1ANEA 1MKWK 1C5YB 1QGFA 3RXTA 3MYWA 3KIDU 1G3EA 4H4FA 2K1QA 1PPCE 2W3IA 1LHEH 1EB2A 3A81A 3SGQE 1EZUC 3SN8A 2ZU2A 1TRNA 1SHYA 5FBEA 1P11E 1YPJH 1C2FA 2Y5HA 1GG6B 4B74A 2FDAA 4MNVA 1MZDA 1OOKB 1ELEE 1SGCA 2BX4A 4NZLA 1FXYA 3ITIA 3LGIA 3RMMH 1Z8RA 3S7HB 5HM9A 3TU7H 1RFNA 3SHCH 2B5TB 4MLFB 1TWXB 2QA9E 3UWJH 1LTOA 1HJAB 2LNCA 5H4IB 4WXVA 1ZRBA 3RC4A 1Z1IA 1O3EA 6LPRA 1V2WT 2XCFA 3Q3XA 3O8RA 2FOFA 1KLIH 2W3KA 1T32A 1LMWB 1Y3UA 1NU7B 1FY1A 1AQ7A 2JETC 2CV3A 4JZFH 1BA8B 5GWZA 1ZYOA 3KGPA 1E0FD 2AEIH 3BTME 3STJA 1AE5A 3L33A 3RXBA 3KEEA 3ZYDA 1WV7H 5JBAS 1X7AC 1FV9A 3FZDA 1P2MA 4TYDA 5C5NA 5E0HA 5DGJA 1QNJA 1HIAB 1BTPA 2XBVA 1XUIA 2P3FH 1AMHA 2ANMH 1G30B 4DCDA 2GCHG 1CHGA 3ATMA 5F03A 1TMUH 3GCOA 2PKSB 4BTUB 7KMEH 3UOPA 1O38A 4GSOA 1A5GH 2DE9A 1HB0B 1P9UA 4DURA 1QL7A 3UR9A 1MKWH 3RXIA 3Q3YA 5K0HA 3VXFH 3KHVA 1C4V2 1O3DA 1F5KU 2EI7A 4NFEA 1Z6JH 1N1LA 1P06A 3ZZ3A 3RU4T 1P09A 3SJOA 1TB6H 1SOTA 1EP6A 4CRGA 3V7TA 1BJUA 1F5RA 2CHAB 3LGWA 2UWLA 2TBSA 1OSSA 1CBWB 4DVAU 2BXTH 2ZDMA 1LVOA 1V2JT 3SUDA 1OWIA 1BMNH 1VITG 2WPJS 2BD5A 1QA7A 2YNAA 1LKAA 2V3HH 1WTHD 3T5FH 8ESTE 3GYMA 1C2DA 2BVRH 1FY5A 1GI5A 1QRZA 7ESTE 2GZ8A 3VXEH 4BANB 3PLPA 5C2ZA 1O3KA 4ABDA 3KQEA 4YESB 5LH8A 2BD2A 1LQEA 2EI6A 1GJ6A 3K9XB 2HLCA 5F8ZA 1C5OH 4QT8C 3BG4C 4JZIA 3QTOH 5EW2H 3M5MA 2ZKSA 1BTZA 3SU1A 1C5UA 6ESTA 4X1SU 2P3UB 2ZPRA 4UFEH 3TJVA 2C4FH 3LT3A 3VB6A 1T8MA 4BAOB 3RM0H 1DWCH 3RP2A 3RXKA 1ETSH 3MI4A 4IW4E 4FU7A 1CT2E 3QZQA 5I25A 1GL0E 3A86A 3MMGA 2ODQA 3PLBA 1OKXA 2IPHA 1GVZA 5C5OA 1RTLA 3BG8A 2ZU3A 4HI3A 1Y8TA 4WMDA 1ZSKA 1INCA 2SGPE 5E2PA 1GI7B 2R0KA 1O30A 1TPSA 4FU8A 1NFYA 4ZHLU 5C1UA 2TGAA 4X6NA 1GBBA 4E7RG 2GV7A 1K2I1 1BB0B 1EATA 1GI8B 3GCNA 3I29A 1K9OE 2O8TA 1Y5UT 2A7HA 1O5FH 5C67A 2SGDE 4IN2A 1LVYA 3SV2H 1UCYE 3OSYA 1O5CB 1QA0A 3M5OA 2BX3A 3ZZ4A 1HAXB 1WU1A 1NRQH 3RXCA 2FYRA 2ZC9H 3E0PB 1O39A 3SORA 4K3JA 5L2ZH 4I32A 1O2XA 2NU0E 1DICA 3EE0B 5DP8A 1GMDF 1OWKA 4X6MA 3SU0A 3GY2A 1O35A 2AMQA 3GYLB 1CT0E 1Y3XA 1TRYA 1HAHH 1THSH 3BTEE 3T26A 1ORFA 1HCGA 4GHTA 1EUFA 4F49A 3U8OH 1O37A 1QCPA 1GBCA 2H5CA 2J2UA 1P0SH 4X8SH 2OC1A 1ELGA 3RXLA 2VVUA 1S0RA 1O5GH 3RXRA 2VVCA 3OU0A 1C2EA 2H2ZA 2P93A 4O3UA 1ZR0A 2J95A 1MTNC 3E8LA 1V2OT 4CHAC 4INLA 2GCTC 4B75A 2ULLA 2AGEX 1C2HA 1GI9B 5DP6A 2B7DH 2GZ9A 2C8YB 1NU9A 1EB1H 3E91A 3SV8A 2FLRH 4CRBA 2CN0H 3P8FA 1D6RA 1LPZB 2BQ6B 1E35B 3IG6B 4JZ1A 4Y8YA 2VWNA 1MZAA 1P10A 4I8JA 3RXGA 4U32A 4BNRA 5AF9H 1CE5A 1BTUA 1MKXK 1YCPM 4B2BA 1NTPA 2ZG0H 3UNSA 5CMXH 1BTYA 1DT2A 2W26A 3SZNA 1WYKA 2EA3A 1EX3A 1LDTT 2Y6TA 3SW2B 1OXGA 2NU3E 2G4UA 1GHVH 3SNDA 3PO1C 1AUTC 1SPJA 1W13U 1CQQA 1GJAB 3RXAA 1QQ4A 2FOCA 2Y7ZA 3EYDA 1IHTH 1W10U 2A7JA 4TPYA 7GCHG 1MQ6A 1V2TT 4I8HA 1SLXB 4OS1A 4Z6AH 1P3CA 4LOYH 4FUDA 3G01A 2ZWLH 1Z8GA 4BTIB 1GVLA 2A2QH 3FZZA 1IQGA 3BTGE 4GHQA 3ZZ5A 1IQFA 3V13A 1C5MD 1DM4B 1EKBB 2F3CE 1Z8IB 2VGCC 3JZ1B 1O34A 4BAKB 1BUIA 3H7OA 1ZTLA 1TPOA 2VIPA 3BF6H 1BT7A 1S81A 2H9EH 2O8LA 4AB8A 3FAOA 1MU8B 1VGCC 3MU5A 4UFFH 4NG9H 4DJZB 1ZRKA 1L1NA 1CO7E 3U98H 1XXDA 1BDAA 1NY22 4Q2KA 4YOGA 1H9HE 3ENSB 1BZXE 1SLVB 3RXPA 2P95A 2A1DB 4ZKSU 1G37A 2CF9H 4PROA 1YF4A 3ZVBA 1EOJA 2P3TB 3LGTA 4JYTA 1A5IA 2BZ6H 1MD8A 2ZDLA 3M3SA 2PLXA 1QQUA 2PTNA 1QHRB 4B2AA 3HPTB 3A87A 2CMYA 1QURH 1F0UA 2D1JA 1UJ1A 4GCHG 3UPEA 1GGDC 2QIQA 2WV4A 2V6NA 5ESTE 1MKXH 2AMPA 4YZUA 1GDUA 4INKA 1O33A 3DUXH 4DG4A 1EZXC 3LOXA 2BB4A 3BIVH 5L30H 1NC6A 4CH8B 1HAVB 3SOSA 2BD3A 1IOEA 4X2XA 3ZV8A 1GBDA 1W8BH 2GP9B 5A0AE 2GMTB 1RRKA 3PWBA 1ARCA 1BHXB 5EQRA 2FEQH 1G36A 1AE8H 1EJNA 4Y8ZA 3SBKA 3D62A 1GMCG 1ETTH 1O3IA 4CREA 1BRBE 1P05A 3NUMA 1XXFA 1SI5H 1T8LA 3LJOA 2H9HA 2HRVA 3SQEE 1AKSA 1DOJA 4UFDH 2AFQB 4IBLH 4ABFA 2ZTXA 2BY8X 2IJOB 1AO5A 2FTMA 3PROA 3GCTG 1NO9H 1KLJH 1O3AA 3ZZ6A 3S9AA 5GXPA 4ABAA 3NZIA 1C9TA 2OC8A 1XUKA 2ZZUH 2HVXA 3SQHE 5AHGH 3SGBE 3ZVAA 1UTNA 2A4GA 1C5XB 1KTSB 1ANCA 1C5LH 2QF3A 4ABGA 1QR3E 1BHXF 1ZGIA 2G00A 4IMQA 4WF8A 1F92A 1JIRA 5A8XA 1PYTD 1FY3A 3SJ9A 1XKAC 1C5SA 3VGCB 3ATWA 2WPKS 1UMAH 4U30A 3HKJB 1BOQA 3SNAA 3GCHB 4IC5A 2NU2E 2AH4X 1TIOA 1RIWB 3RLWH 2A4RA 1ZPBA 2V35A 2BOKA 4NIWA 2STAE 2ZPSA 3HATH 2W7SA 1MTSA 4VGCC 5FXLA 1GI2A 2ZU4A 1ZHRA 2FI4E 1DUAA 4YOIA 1AVXA 3EDXB 2Z3DA 4Y0ZE 1C1PA 1SGQE 5BPEA 2THFB 1UTJA 2C8ZB 1BMAA 3PV4A 4WJG2 3TPIZ 2LPRA 3SI4H 2BLQA 2XC5A 3P92A 2PKAB 1AVWA 1MUEB 4ZKOU 1FPHH 4Y76A 2GT7A 1YPMH 2P16A 1HGTH 4K60A 1TAWA 1T7CA 2ZHDA 3A7YA 1QRXA 5G4BA 1ELTA 3D23A 4ZUHA 4XBCA 3ZZDA 3Q3KA 1C1MA 1OWHA 2HALA 1TNJA 1HBTH 2C90B 3SNBA 1O2WA 4E7NA 1Z7KA 3A7XA 4A1TA 3ZVGA 2AGGX 1MAYA 3BEUA 3GY5A 3KCGH 1Z1JA 1ZMJA 3SJIA 1K28D 3HGNA 2VWMA 1J17T 2F83A 2C93B 1NFWA 4X6PA 1A46H 3UY9A 4AOQA 2A31A 2FWWA 1G9IE 1SGFG 4X8VH 5DP5A 3QGNB 2CGAA 5EQQA 4D7FA 1O3FA 1NN6A 6CHAB 1YC0A 3F68H 3I78A 4CRAA 1B5GH 1TMBH 5E2OA 1B7XB 4IN1A 1BTXA 1P2KA 3SGAE 4NFFA 5CHAC 3ESTA 1O2UA 1OPHB 1QL9A 5LPRA 4D9QA 1DS2E 1HJ8A 2RG3A 2ZDAH 1IAUA 3RMLH 3KQBA 2AIQA 1TQ0B 4X1PU 1C1VH 1GJ8B 1O2PA 5EW1H 1BTWA 2WV5A 3DHKH 1VJAU 5FPSA 1FONA 2C8XB 2CJIA 5TCAA 3ZZCA 4DIIH 1DPOA 5CE1A 1MD7A 5A8YA 1E36B 1DE7H 1YLDA 4IC6A 1VJ9U 3PLKA 1AFQC 5JYIA 4I8GA 2WPMS 3UTUH 1JWTA 2GD4B 1EXFA 4E05H 2BY6X 4UE7H 1UTMA 3MU4A 3U1JB 1GI1A 4X8UH 1KTTB 1KXFA 1NROH 4NA9H 1K1MA 1JXPA 3KF2A 1DFPA 3RXMA 3BTTE 5HMAA 1J16A 1SGTA 2G8TA 3M35A 1H8DH 1MCVA 3F1SB 2ZQ2A 1SGFA 1Q31A 1SLUB 1VCWA 2JETB 1FAXA 3UNQA 2BVXH 1GHYH 4K8YA 1V2QT 3TH2H 1WTGH 2I6SA 1SQTA 2EEKA 2FTLE 4JCNA 1BJVA 1PQ5A 1C1OA 1GHWH 1T4VH 1ZSLA 1TOMH 1BMLA 1EPTC 2FOHA 4X1QU 1XVOA 3R3GB 1ZOMA 2ZGJA 1B0EA 1C5WB 1JRSA 1TNIA 1P2JA 2ZDNA 1DDJA 2W7UA 3O8DA 3N7OA 3MU8A 2BM2A 4HFPB 1HRTH 3W94A 3EA9A 4ZKNU 1OWDA 1UCYK 2F9UA 4M7GA 2ZGHA 5JBTA 2QXJA 1YPHE 3MO9A 5GIBA 3A7VA 3SNEA 2RA3A 2SNVA 1QBVH 3TJOA 1ELFA 2H6MA 1MTWA 1PPZA 2XBWA 4Y6DA 3LC3A 1O2TA 1ANBA 2BQ7B 2QCYA 2F9BH 2ZCHP 1TFXA 3SNCA 1Q3XA 3RXVA 1FMGA 1HIAA 1W0YH 3V3MA 1GJBB 1O2JA 1TOCB 3PTNA 4NSVA 5DP3A 1TA2A 2KAIB 3AW1A 4YLQH 5IYTA 4A92A 3SV6A 3RC5A 3VPKA 1AD8H 3LGVA 4ABBA 4NSYA 2P8OC 3BTKE 3VFEA 1F0TA 1D4PB 1O2IA 1QFKH 2SFAA 2QGRA 2SGFE 2OCVB 1O2VA 1TNGA 2Y7XA 1AN1E 1UVPA 4AFUA 3SU2A 1C1TA 2BHGA 3RXEA 3DFJA 1O5BB 1A3EH 3BG4B 3DA9B 3MFJA 2OC7A 1T8OA 1TONA 1TNHA 1GMDG 3NK8A 3MH7A 1EZQA 1TNKA 2ZHWH 4D7GA 3DT0H 1TPAE 2ZEBA 4GAWA 5ESBA 2ZHEH 2GVFA 3A80A 5DP7A 4CBNA 3M5NA 1UTQA 5IDKA 2WPLS 2F91A 1FI8A 1K1NA 2Z9GA 1IQNA 1OP2A 5EXLA 4WH8A 2QXHA 1LPKB 2OD3B 1LHGH 2XNIA 3ZVCA 1WAYB 3P95A 2J92A 2OBQA 2OP9A 4K2YA 2ZCLP 1GHAF 2W5EA 3F9GA 5DK1A 1XUGA 2VU8E 1LHCH 1FDPA 2D2DA 1YBWA 2Z3EA 1HJ9A 1SC8U 4NZQA 2XXLA 1AIXH 2PKSC 4XDEA 4TPIZ 2FI3E 5E0GA 3TK9A 1AFEH 1D3TB 2G5VA 5AVDA 4I8KA 3S9CA 2FS8A 1JIMA 1TBRH 2YOLA 1BCUH 3M7UA 4ZHMU 1TX6A 1BBRK 2PV9B 3ZZBA 1HPGA 1TX8A 2NWNA 3ZZ7A 2CHAC 2Q1JA 1S6FA 3PM3A 1TNLA 3PMBB 1W12U 1W2KH 2VB0A 4BAHB 3P8OA 5HXFA 4ZHAA 3MNBA 1CBWC 5FPYA 3I77A 3PMJA 2OXSA 1RTKA 1Z71A 2CXVA 1QY6A 1P2NA 3BTQE 4BTTB 1NT1A 4FUCA 1YM0A 2A5AA 1DWBH 1S6HA 1V3XA 1GPZA 3IITA 5B6OA 2ZECA 1EAUA 2P94A 4RN6A 4CHAB 2GCTB 1RGQA 4FUHA 1O2RA 5A8ZA 3BTHE 1K1IA 1C4Y2 1N8OC 3SU5A 4IS5A 2PW8H 5LGOA 3ATIA 1GI4A 1XMNB 3P8GA 2C3SA 5HYOA 2FX6A 1C1WH 1C2GA 4AFSA 1ZMLA 1N6XA 2SGAA 1PPFE 1UTLM 4AG1A 1ZJDA 4ZAEA 1Y3VA 2VIDA 3TH4H 1GJDB 1EJAA 4ISNA 1A5HA 2OQUA 1A0LA 1GCTC 4KELA 1LCYA 1UTPA 4XOJA 5EQSA 1EQ9A 3RXUA 1PQ8A 3SUFA 3A8DA 1G3DA 3KL6A 3PO1B 1AZZA 1KXAA 4YLUA 5T6FA 3KN2A 1A3BH 1PPEE 4ISHH 5DP9A 1J15A 4GPGA 3BV9B 4SGBE 1LVMA 2R0LA 4X0WU 5T6DA 1BBRH 1TX7A 1E38B 4H6TA 4DOQA 5JBBS 3A8AA 4IGDA 4DW2U 4U2WA 1DVAH 1TE0A 1Y3WA 4OS7A 3TK5A 1PJPA 1O0DH 2V3OH 2VGCB 2Z9IA 2JH0D 9LPRA 1A4WH 3LGYA 2UUJB 1HDTH 3LPRA 2FOBA 3T28A 1KDQB 3K6YA 1Z8JB 2BMGB 5GCHF 3EQ0H 2A4OA 3LKWA 4X2WA 2VINA 1VGCB 4ISOA 4Y8XA 2BOHB 3KQCA 5JB8S 1IQLA 6GCHF 1ABIH 2QY0B 3A89A 4GLYA 1C1SA 1YCPK 2OBOA 1OYTH 4X8TH 1FY8E 5FPTA 1V2KT 4K8BA 2Q6DA 2H9TH 3LIWA 1DWDH 1TPPA 1C1NA 1YP9A 1AB9C 2HNTE 1FJSA 1L1JA 1TRMA 1NPMA 1PPBH 2SGEE 4DGJA 5A0CA 1TA6A 5E8EH 4THNH 2SGQE 3TVJB 1YPHC 1ZGVA 3RXJA 4ESTE 4ZKRU 1SR5C 4LZ4B 3QN7A 3GOVB 4YM9A 1ZTKA 2BLWA 2FX4A 5E0JA 3U8RH 1EAXA 1T4UH 1Y59T 1UTOA 2QAAA 2A45B 1EZSC 1SOZA 3P17H 1P02A 1UK3A 3EGKH 2ZO3H 1YPGH 1OYQA 1BITA 2ZFPH 1C2MA 3BEFB 4KTSA 1ESBA 4MPWA 1HAGE 3F6UH 1CT4E 1UHBB 4HZHA 1J9CH 2EC9H 1AWHB 1MU6B 3B9FH 3LONA 4AFZA 1PPHE 4ASHA 1S0QA 1YPEH 2FXRA 1V2RT 2WPIS 2PFEA 1QB1A 1P03A 5JPMH 1CHOF 2ZFSA 2XW9A 3PWCA 5EPYA 2BTCE 1C4U2 2Y5FA 2P59A 1WQVH 1HAVA 1CGJE 8LPRA 3ODFA 4X2YA 3LGUA 1F7ZA 4A7IB 1Y3YA 2Q6GA 3MU0A 1W0ZU 5EODA 3GDVA 2PUQH 2AERH 3STIA 3PYHA 1O5EH 5AFYH 1Y5BT 2RDLA 2VH6A 2BD7A 2GGVB 1GVKB 1ZLRA 1P9SA 1D3PB 3BTFE 1ANDA 2PUXB 3P70B 2UUFB 2VIVA 5TJXA 1DSUA 2ZF0H 4MVNA 3U9AH 1ESTA 3OY6U 4K69A 2XCNA 4VGCB 3S0NA 2F9OA 1ZZZA 2ZNKH 1GDQA 3K2UA 2A4QA 3O8CA 3URDA 4FUFA 3QDZB 3URCA 4WXIA 1TLDA 3A85A 3M37A 1O2LA 1FN8A 4GVUA 3P8NA 3TNSA 1FN6A 2TIOA 2ZDKA 2VNTA 1V2MT 3E1XB 1AHTH 2ZU5A 3P6ZB 1GHBF 2G51A 2XYAA 3L6PA 3MWIU 3DD2H 2FYQA 1ZTJA 1SQAA 2O8WA 3C1KA 2J34A 3PB1E 1O2MA 2QV1A 1MTVA 3E16B 1QRWA 4ISIH 2VIQA 3QWCH 1HXFH 4R0IA 1ETRH 3E6PH 3EAJA 1DX5M 2R2MB 1W7GH 1GWAA 1O2HA 1P04A 3ATLA 5C20A 3M7QA 1RJXB 5LPEA 1BRAA 4BXSA 1FZZA 4LK4A 3UUZA 3BSQA 2ZU1A 3SO3A 2TGDA 1G3BA 2GMTC 1MBQA 4HTCH 3UFAA 1KXBA 1G2MA 1SSXA 1CGIE 4Y10E 1V6DA 1V2UT 3B23B 3RXDA 1O3OA 1BMMH 2A5KA 2PKAA 2QYIA 3ZVEA 5LPFA 1UVUH 1V2NT 2BY7X 4RKOB 1J8AA 4NWKA 4Y79A 1TQ7B 4TWYA 4BAMB 4B76A 1C5NH 3UWIA 5EG4A 1HUTH 2FMJA 1LQDB 2F9PA 1P12E 2ZHQH 1W3CA 1MBMA 2B0FA 2B8OH 8GCHF 2HGTH 3TK6A 3FP7E 2OINA 4X1RU 3L3TA 3JZ2B 1RD3B 5L6NH 2ZP0H 4MQAA 1OWJA 4XBBA 1D3QB 1EOLA 2NU1E 2A7CA 2G55A 3GCHC 3QTVH 2QF0A 1GHXH 2OUAA 3RDZA 1AFQB 2A32A 2BLOA 1QJ6B 2QXGA 1PQ7A 1O2OA 2FOAA 1AWFH 1RTFB 3TGKE 1LKBA 1O3PB 1M9UA 2FESH 4AZ2B 3ELAH 1H1BA 1VZQH 2WUCA 3SHAH 1ESAA 4MTBA 1IQIA 5DKMA 1TGCA 2ODYB 4X2VA 2FZZA 5F6MA 2PR3A 5A0BA 4ZXYH 3S9BA 2ASUB 3D65E 5GDSH 1AUJA 1K1PA 3LH1A 1EPTB 1O2YA 4AYYB 1O2QA 3AASA 2BVSH 4UDWH 3HGPA 4UD9H 2UUYA 4FVBA 1HAZB 4LXBH 1O2KA 3E3TA 5DP4A 1V2ST 1NM6A 1SGEE 1MH0A 3QX5H 3BEIB 3TJUA 4ZXXH 1UK2A 3FANA 1HAYB 4XBDA 3BIUH 1NRSH 3SI3H 1FPCH 3VB5A 4MNYA 1QJ1B 1UTKA 2HNTC 1DLKB 1CA0C 4OS5A 4ISLA 4J1YA 1A61H 2ZQ1A 5C1YA 5AFZH 4BOHA 4BXWA 4AX9H 2WYGA 4ZROA 4CR5A 3NCLA 2ALVA 1CVWH 1ABJH 3EA7A 3T29A 1T8NA 3MH6A 1PQAA 1UVOA 3ZVFA 6CHAC 3OYPA 2VJ1A 3RXFA 2GTBA 3LJJA 1A2CH 3RUOA 1KXDA 1GJ9B 2SNWA 1AY6H 1ELDE 5A09A 3ZYEA 2PWXA 4MPXA 3M3VA 3U1IB 1EAIA 1A1RA 1GHAG 1O3NA 1GCDA 1T31A 4FUGA 4FUEA 3A84A 1S84A 5FHTA 5C1XA 2Z3CA 1KXEA 2Z94A 1C9PA 4OGXA 2GDEH 3CS0A 4SGAE 4DIHH 1GBFA 1GBLA 1DY9A 1THPB 2ZCKP 3LU9B 3O8BA 2ESTE 2ZTZA 1ZPCA 3ZV9A 1S85A 2P8OB 2BQWB 1GJ4H 4OS2A 2ZFFH 3RXHA 1ELCA 4I31A 1O31A 5FBIA 1TGSZ 3FP6E 2G81E 1SFIA 2TPIZ 1KXCA 1FY4A 5FAHA 1JMOH 1AU8A 2DE8A 2G52A 4DY7B 1SQOA 4O03A 2FIRH 2Q6FA 2O8UA 5GPIB 4B73A 4AG2A 1TGBA 1SGIB 5T3HA 3RLYH 4WMFA 3RMNH 5GJ4B 4Z0KA 3QZRA 2BXUH 1SGYE 1YLCA 3CS7A 1MTUA 3ZZ8A 2KAIA 3GY3A 4X1NU 1YPKH 4H42U 3NKKA 3U8TH 2CF8H 1KIGH 2VH0A 5EGMA 4Y11E 2H1UA 2XC4A 4ABIA 1ZHPA 4KTUA 1DY8A 1XM1A 1L1GA 4WVPE 1TBQH 1D9IA 5L2YH 4NCYA 3M7TA 2ZGBH 1MMJN 2R3UA 1LO6A 3RM2H 2ZFQH 1GG6C 5DO4H 8KME2 1F2SE 4K1EA 4UFGH 5ABWA 3BTWE 5DPAA 2BDGA 1C5RA 4OS4A 3VB7A 4Y0YE 2BLVA 2OLGA 1O3GA 3SJKA 1FIWA 3K65B 4K5ZA 2FS9A 2B9LA 4ABEA 1GJ7B 1P3EA 4ABJA 2TGPZ 2Z7FE 1HJAC 1BRUP 1KLTA 2Y5GA 2R3YA 1MQ5A 2A2XH 3GDUA 1ARBA 2ANYA 2OTVA 4NWLA 1GJ5H 1LHFH 2VWLA 1GI6A 4NA8A 2BDBA 1XUFA 1Y5AT 5F8TA 1BIOA 1UCYH 4F4OC 1DANH 4Y71A 1DUEA 1C1UH 2FLBH 1GMHG 2FPZA 2BD4A 3U69H 1QJ7B 2BYAX 1SBWA 4D9RA 1GJCB 1CA8B 1S82A 2FP7B 1CSOE 3MH5A 5FX6A 1VR1H 3M36A 2AMDA 1N8OB 1NRRH 1HFDA 2R2WU 5GCHG 3H5CB 4FUIA 1ACBE 3VEQB 3ZVDA 1P2OA 6GCHG 3NWUA 1F5LA 4D76A 1FNIA 1O2ZA 5PTPA 2C8WB 1SFQB 3SU6A 1UO6A 1KSNA 2Y80A 4AGKA 1GCTB 2FM2A 1TALA 5JB9S 5TCCA 4LZ1H 4B71A 1C2JA 1YPLH 4CRDA 1QB6A 1SGDE 4D8NA 3TGIE 2RCEA 3AAUA 1EAWA 2FOMB 1NESE 4JMYA 1O3MA 1C5VA 2BDHA 3MTYA 2QXIA 1FIZA 1GI3A 1WCZA 1EP5A 2HPQH 3PMAB 4UEHH 1UVTH 1TMTH 4YT6H 3QO6A 1MTNB 1G2LA 2ZPQA 3QGJA 4OGYA 2XWAA 3MU1A 1C1RA 2D26C 1XUHA 1K1JA 1OS8A 2PSXA 1G3CA 4AORA 1P8VC 3WY8A 3A7ZA 1SVPA 2GCHF 1SG8B 3QLPH 2ZIQH 1AZ8A 2BDAA 2OQ5A 4NIVA 1LPGB 2AYWA 3E90B 2GKVE 4J2YB 1PPGE 5A2MH 3SV9A 4BAQB 1IQMA 3H7TA 1JRTA 1HAIH 2J9NA 1OP0A 1ELVA 1YKTA 4RSPA 2AGIX 3IWMA 3R0FA 1ID5H 1KYNA 4JYVH 5FCKA 1XX9A 2ZI2H 1MCTA 1NRPH 1TGNA 2TRMA 1A0JA 1D6WA 2J38A 4FUJA 5F8XA 1GBHA 1GMHF 3QUMP 1CHOG 1GBAA 1AB9B 4O3TA 1HAOH 4INHA 1VITF 5J4SA 4MNXA 3LDXH 4WWYA 4A5TS 1HNEE 4XE4A 3D49H 2VWOA 3DFLA 3GY7A 2STBE 2ZA5A 1IHSH 1QB9A 2OC0A 2PTCE 1KY9A 1H4WA 1KDQA 4UONA 3Q00A 1ZPZA 1SHHB 4I8LA 1IQEA 1VCPA 1E37B 2GT8A 3ZZAA 1L0ZA 2Z9JA 1XUJA 3V12A 1WOFA 1SL3A 4MPUA 3LH3A 4AB9A 4CBOA 1O36A 3OX7U 1O3CA 3TITA 3A83A 3EA8A 1WQSA 4MNWA 3T25A 4KTCA 4H6SB 1UK4A 1BTHH 1OWEA 1V2VT 4AGJA 3TH3H 1PYTC 1W11U 1K21H 1JOUB 1SGRE 2G4TA 4FU9A 1XKBC 3M61U 2NU4E 2YNBA 1JBUH 2A0QB 2IN2A 4CR9A 3ATKA 1ELAA 1FAKH 3GY8A 1DLEA 4HGCA 1BQYA 1GHBG 2HPPH 3UQVA 1HLTH 2PGQB 1C5PA 1GGDB 1P2QA 5EU8A 4CH2B 3V0XA 4GUXA 3NPSA 2UWOA 2GDDA 1H9IE 3TNTA 3M5LA 3MH4A 4A6LA 3SU4A 3UREA 2PHBA 3GY6A 3KNXA 1TYNA 1GBTA 2ANKH 2D8WA 3HKIB 3RXSA 3UR6A 4WH6A 2ZGXH 1ZJKA 3Q76A 2FOEA 3MHWU 7LPRA 4JK5A 2ALPA 1DWEH 2PSYA 1BRCE 2A5IA 4ABHA 1C5QA 1UHBA 2FO9A 1DXWA 5ETXA 3TJNA 5DJ7A 1U6QA 1V2PT 2I6QA 2Z9LA 1EASA 3SV7A 1DXPA 3CENA 4FXGH 1GL1A 1V2LT 1NFUA 3B8JA 4DT7B 1TABE 4CRCA 1BBRE 3RXOA 4NIXA 3CP7A 1O5DH 2XRCA 4MPVA 2BZAA 1HYLA 1K1LA 3A82A 1WUNH 2AIPA 4FUBA 4JK6A 2JKHA 2ZHFH 4O97A 1EJMA 2R9PA 1N6YA 1O3BA 3AVZA 1J14A 1G32B 2QC2A 4ZH8A 4AYVB 3UQOA 3A8CA 3MNXA 4TY7A 3VB4A 1YCPH 1ELBA 1A0HB 8GCHG 2O8MA 1W14U 1C2LA 3LC5A 9ESTA 3QK1A 4RKJB 1C2IA 3RU4D 4A1VA 1C5TA 5BRRE 1QL8A 2QN5T 5I46H 2ODPA 2J4IA 3MNCA 1A7SA 2ZGCA 1DSTA 1H9LB 2BY5X 4Y7BA 3ZZ9A 4JZEH 3W95A 1F0SA 2PGBB 2UWPA 4KGAA 1O3HA 3MO6A 2HWLB 3BTDE 1FUJA 3GDSA 1ZHMA 1THRH 5HM2A 5EPNA 2ZDVH 4YTAA 1AKSB 5EXMA 1O5AB 5EOKA 1HXEH 2WYJA 2XC0A 4Y7AA 3SUEA 5SGAE 4A1XA 1P01A 2G5NA 1SGPE 2UUKB 2ZTYA 3FP8E 1QBOA 3MOCA 4OS6A 2TGTA 7GCHF 1GDNA 4YOJA 3Q77A 2GZ7A 3UOUA 3TIUA 4ZMAH 3ODDA 3S69A 2Z6BD 1NZQH 1AI8H 2BDYA 5J4QA 1D3DB 1GBMA 1O2NA 1SMFE 1WSSH 2V0BA 2HOBA 3OY5U 3A88A 3M3TA 4TWWA 3S7KB 3TGJE 4NIYA 4E06H 3FFGA 3GICB 3OTJE 1P57B 1PFXC 1SLWB 4JZDH 1W7XH 3T27A 2VIOA 4XSKU 4WMEA 3SUGA 3PMHB 4Q7XA 3TLOA 4R8TB 5CHAB 4CRFA 4KP0A 2BY9X 1GHZA 1MAXA 4Q7YA 2Y82A 3UNRA 3BN9A 2ILNA 5FCRA 3RXQA 3C27B 3UIRA 4Q80A 1SGNE 2WPHS 1GBEA 1VCQA 1AVGH 4I33A 3E0NB 4YT7H 4TY6A 3MNSA 2GV6A 1NRNH 1CGHA 4XFQA 5K7RA 2EI8A 3KQDA 4GCHF 3F9FA 4IMZA 1S83A 2IOTA 4K1SA 4AN7A 3VGCC 1VITH 1O2GH 3HK6B 1HAPH 2FOGA 1RS0A 1UVSH 4JYUH 1WBGB 1FQ3A 1LHDH 1GBJA 2JH5D 2F9NA 3A8BA 1IQJA 3GISB 1K1OA 2WINI 5JBCS 1RIWC 1S5SA 3MO3A 1C2KA 2VIWA 3F9HA 2XTTB 1YGCH 3PTBA 4KKDA 4B1TA 1GBKA 1QBNA 2BD8A 2ANWA 2JH6D 1Q2WA 3T62A 3RC6A 1DITH 1GI0A 5DG6A 5EXNA 2BD9A 1GMCF 4MG3A 1CA0B 4FVDA 1L4ZA 2M5TA 3AAVA 1TBZH 3HK3B 1QTFA 4I7YH 1OP8A 3NXPA 1Z6EA 5HGGA 1YYY1 1H8IH 3GCTF 1TGTA 1K22H 4WY3A 1E34B 2DUCA 3FVFB 1NS3A 1O3JA 1P2IA 1EPTA 3AW0A 2ZFRH 1FLEE 1F0RA 2O9QA 1QIXB 3F9EA 4U01A 4AFQA 1RXPA 4B2CA 2BDCA 4K1TA 2HNTF 4NGAH 1HV7A 1CU1A 1O2SA 2FI5E 3T2NA 3K6ZA 1O32A 1GBIA 2GX4A 2AS9A 1ZSJA 1OX1A 4O9VA 1LVBA 2F9VA 2VVVA 2RA0A 2XBYA 2WUBA 4Q7ZA 3RMOH 3RU4E 5JDUB 1C5ZB 4NA7A 5FX5A 1L4DA 1O3LA 1IQKA 1B0FA
chains in the Genus database with same CATH superfamily
5C0UA 1XVMA 1IQHA 3SU3A 3VB3A 3GY4A 3A7WA 4MDSA 3DSPA 1L2EA 4YO9A 1ZMNA 5T6GA 1AGJA 3SJ8A 2J94A 2XWBI 2FODA 1NFXA 3A7TA 2XBXA 2BDIA 5C3NA 1SB1H 2H5DA 4X6OA 2ZFTA 1C1QA 2Z9KA 2Y81A 1ANEA 1MKWK 1C5YB 1QGFA 3RXTA 3MYWA 3KIDU 1G3EA 4H4FA 2K1QA 1PPCE 2W3IA 1LHEH 1EB2A 3A81A 3SGQE 1EZUC 3SN8A 2ZU2A 1TRNA 1SHYA 5FBEA 1P11E 1YPJH 1C2FA 2Y5HA 1GG6B 4B74A 2FDAA 4MNVA 1MZDA 1OOKB 1ELEE 2K0QA 1SGCA 2BX4A 4NZLA 1FXYA 3ITIA 3LGIA 3RMMH 3FO8D 1Z8RA 3S7HB 5HM9A 3TU7H 1RFNA 3SHCH 2B5TB 4MLFB 1TWXB 2QA9E 3UWJH 1LTOA 1HJAB 2LNCA 5H4IB 4WXVA 1ZRBA 3RC4A 1Z1IA 1O3EA 6LPRA 1V2WT 2XCFA 3Q3XA 3O8RA 2FOFA 1KLIH 2W3KA 1T32A 1LMWB 3UAIC 1Y3UA 1NU7B 1FY1A 1AQ7A 2JETC 2CV3A 4JZFH 1BA8B 5GWZA 1ZYOA 3KGPA 1E0FD 2AEIH 3BTME 3STJA 1AE5A 3L33A 4HG6A 3RXBA 3KEEA 3ZYDA 1WV7H 5JBAS 1X7AC 1FV9A 3FZDA 1P2MA 4TYDA 5CHBA 5C5NA 5E0HA 5DGJA 1QNJA 1HIAB 1BTPA 2XBVA 1XUIA 2P3FH 1AMHA 2ANMH 1G30B 4DCDA 2GCHG 1CHGA 2IJD1 3ATMA 1TMUH 5F03A 3GCOA 2PKSB 4ASUD 4BTUB 7KMEH 3UOPA 1O38A 4GSOA 1A5GH 2DE9A 3NRLA 1HB0B 1P9UA 3VG8A 4DURA 1QL7A 3UR9A 5KEDA 1MKWH 3RXIA 3Q3YA 5K0HA 3VXFH 3KHVA 3OEHD 1C4V2 1O3DA 1F5KU 2EI7A 4TSFD 4NFEA 1Z6JH 3PV2A 1N1LA 1P06A 3ZZ3A 3RU4T 1P09A 3SJOA 1TB6H 1SOTA 1EP6A 4CRGA 3V7TA 2CK3D 1BJUA 1F5RA 2CHAB 3LGWA 2UWLA 2TBSA 1OSSA 1CBWB 4DVAU 2BXTH 2ZDMA 1LVOA 1V2JT 3SUDA 1OWIA 1BMNH 1VITG 2WPJS 2BD5A 1QA7A 2YNAA 1LKAA 2V3HH 1WTHD 3T5FH 8ESTE 3GYMA 1C2DA 1EFRD 2BVRH 1FY5A 1GI5A 1QRZA 2L74A 7ESTE 2GZ8A 3VXEH 4BANB 3PLPA 5C2ZA 2V3MA 1O3KA 4ABDA 3KQEA 4YESB 5LH8A 2BD2A 1LQEA 2EI6A 2J97A 1GJ6A 3K9XB 2HLCA 5F8ZA 1C5OH 4QT8C 3BG4C 4JZIA 3QTOH 5EW2H 3M5MA 2ZKSA 1BTZA 3SU1A 1C5UA 6ESTA 4X1SU 2P3UB 2ZPRA 4UFEH 3TJVA 2C4FH 5C0TA 3LT3A 3VB6A 1T8MA 4BAOB 3RM0H 1DWCH 3RP2A 3RXKA 1ETSH 3MI4A 4IW4E 4FU7A 1CT2E 3QZQA 5I25A 2WV9A 1GL0E 3A86A 3MMGA 2YMSD 2ODQA 3FKSD 3PLBA 1OKXA 2IPHA 1GVZA 5C5OA 1RTLA 3BG8A 2ZU3A 4HI3A 1Y8TA 4WMDA 1ZSKA 1INCA 2SGPE 5E2PA 1GI7B 2R0KA 1O30A 1TPSA 4FU8A 1NFYA 5KGOA 4ZHLU 5C1UA 2TGAA 4X6NA 1GBBA 4E7RG 2GV7A 1K2I1 1BB0B 1EATA 1GI8B 3GCNA 3I29A 1K9OE 2O8TA 1Y5UT 2A7HA 1O5FH 5C67A 2SGDE 4IN2A 1LVYA 3SV2H 1UCYE 3OSYA 5KECA 1O5CB 1QA0A 3M5OA 2BX3A 2KZ4A 3ZZ4A 1HAXB 1WU1A 1NRQH 3RXCA 2FYRA 4FETA 2ZC9H 3E0PB 1O39A 3SORA 4K3JA 4RT1A 4I32A 5L2ZH 1O2XA 2NU0E 1DICA 3EE0B 5DP8A 1GMDF 1OWKA 4X6MA 1YWUA 3SU0A 3GY2A 1O35A 2AMQA 3GYLB 1CT0E 1Y3XA 1TRYA 1HAHH 1THSH 3BTEE 3T26A 1ORFA 1HCGA 4GHTA 1EUFA 4F49A 3U8OH 1O37A 1QCPA 1GBCA 2H5CA 2J2UA 1P0SH 4X8SH 2OC1A 2OK5A 1ELGA 3RXLA 2VVUA 1S0RA 1O5GH 3F0OA 3RXRA 1E1RD 2VVCA 3OU0A 1C2EA 2H2ZA 2P93A 4O3UA 1ZR0A 2J95A 1MTNC 3E8LA 1V2OT 2IPQX 4CHAC 4INLA 2GCTC 4B75A 2ULLA 2AGEX 1C2HA 1GI9B 5DP6A 1H8HD 2B7DH 2GZ9A 2C8YB 1NU9A 1EB1H 3E91A 3SV8A 2FLRH 4CRBA 2CN0H 3P8FA 1D6RA 1LPZB 2BQ6B 1E35B 3IG6B 4JZ1A 4Y8YA 2VWNA 1MZAA 1P10A 4I8JA 3RXGA 1FX0B 4U32A 4BNRA 5AF9H 1CE5A 1BTUA 1MKXK 1YCPM 3UB0A 4B2BA 1NTPA 2ZG0H 3UNSA 5CMXH 1BTYA 1DT2A 2W26A 3SZNA 1WYKA 2EA3A 1EX3A 1LDTT 2Y6TA 3SW2B 1OXGA 2NU3E 2G4UA 1GHVH 3PRBA 3PO1C 1AUTC 3SNDA 3AK5A 1SPJA 1W13U 1CQQA 1GJAB 3RXAA 1QQ4A 2FOCA 2Y7ZA 3EYDA 1IHTH 1W10U 2A7JA 4RT0A 4TPYA 7GCHG 1MQ6A 1V2TT 4I8HA 1SLXB 4OS1A 4Z6AH 1P3CA 4LOYH 4FUDA 3G01A 2ZWLH 1Z8GA 4BTIB 1GVLA 2A2QH 3FZZA 1IQGA 2JJ1D 3BTGE 4GHQA 3ZZ5A 1IQFA 3V13A 1C5MD 1DM4B 1EKBB 2F3CE 1Z8IB 2VGCC 3JZ1B 1O34A 4BAKB 1BUIA 3H7OA 3WWBA 1ZTLA 1TPOA 2VIPA 3BF6H 1BT7A 2WHXA 1S81A 2H9EH 2O8LA 4AB8A 3FAOA 1MU8B 1VGCC 3MU5A 4UFFH 4NG9H 4DJZB 1ZRKA 1L1NA 1CO7E 4RI0A 3U98H 1XXDA 1BDAA 1NY22 4Q2KA 4YOGA 1H9HE 3ENSB 1BZXE 1SLVB 3RXPA 2P95A 2A1DB 4ZKSU 1G37A 2CF9H 4PROA 1YF4A 3ZVBA 1EOJA 2P3TB 5DSFA 3LGTA 4JYTA 5HIYA 1A5IA 2BZ6H 1MD8A 2ZDLA 3M3SA 2PLXA 1QQUA 2PTNA 1QHRB 4B2AA 3HPTB 3A87A 2CMYA 4XRNA 1QURH 1F0UA 2D1JA 1UJ1A 4GCHG 3UPEA 1GGDC 2QIQA 2WV4A 2V6NA 5ESTE 1MKXH 2AMPA 4YZUA 1GDUA 4INKA 1O33A 3FN8A 3DUXH 4DG4A 1EZXC 2EQNA 3LOXA 4F48B 2BB4A 3BIVH 5L30H 1NC6A 2V7QD 4CH8B 1HAVB 3SOSA 2BD3A 1IOEA 4X2XA 3ZV8A 4ACBA 1GBDA 1W8BH 2GP9B 5A0AE 2GMTB 1RRKA 3PWBA 1ARCA 1BHXB 5EQRA 2FEQH 1G36A 1AE8H 1EJNA 4Y8ZA 3SBKA 3D62A 1GMCG 1ETTH 1O3IA 4CREA 1BRBE 1P05A 3NUMA 1XXFA 1SI5H 1T8LA 3LJOA 2H9HA 2HRVA 3SQEE 1AKSA 1DOJA 4UFDH 2AFQB 4IBLH 4ABFA 2ZTXA 2BY8X 2IJOB 1AO5A 2FTMA 3PROA 3GCTG 1NO9H 4M9FA 1KLJH 1O3AA 3ZZ6A 3S9AA 5GXPA 4ABAA 3NZIA 1C9TA 2OC8A 1XUKA 2RFKC 2ZZUH 2HVXA 3SQHE 5AHGH 3SGBE 3ZVAA 1UTNA 2A4GA 1C5XB 1KTSB 1ANCA 1C5LH 2QF3A 4ABGA 5DN6D 1QR3E 1BHXF 1ZGIA 2G00A 4IMQA 4WF8A 1F92A 1JIRA 5A8XA 1PYTD 1FY3A 3SJ9A 1XKAC 1C5SA 3VGCB 3ATWA 2WPKS 1UMAH 4OM9A 4U30A 3HKJB 1BOQA 3SNAA 3GCHB 4IC5A 2NU2E 2AH4X 1TIOA 1RIWB 3RLWH 2A4RA 1ZPBA 2V35A 2BOKA 4NIWA 2STAE 2ZPSA 3HATH 4I86A 2W7SA 1MTSA 4VGCC 5FXLA 1GI2A 2ZU4A 1ZHRA 2FI4E 1DUAA 4YOIA 1AVXA 3EDXB 2Z3DA 4Y0ZE 1C1PA 1SGQE 5BPEA 2THFB 1UTJA 2C8ZB 1BMAA 3PV4A 4WJG2 3TPIZ 2LPRA 3SI4H 2BLQA 1S6LA 2XC5A 3P92A 2PKAB 1AVWA 1MUEB 4ZKOU 1FPHH 4Y76A 2GT7A 1YPMH 5B6LA 2P16A 1HGTH 4K60A 1TAWA 1T7CA 2ZHDA 3A7YA 1QRXA 5G4BA 1ELTA 3D23A 4ZUHA 4XBCA 3ZZDA 2J98B 3Q3KA 1C1MA 1OWHA 2HALA 1TNJA 1HBTH 2C90B 3SNBA 1O2WA 4E7NA 1Z7KA 3A7XA 4A1TA 3ZVGA 2AGGX 1MAYA 3BEUA 3GY5A 3KCGH 1Z1JA 1ZMJA 3SJIA 1K28D 3HGNA 1VKYA 2VWMA 2LELA 1J17T 2F83A 2C93B 1NFWA 4X6PA 1A46H 3UY9A 4AOQA 2A31A 2VBCA 2FWWA 1G9IE 1SGFG 4X8VH 5DP5A 3QGNB 2CGAA 5EQQA 4D7FA 1O3FA 1NN6A 6CHAB 1YC0A 3F68H 4B6EA 3I78A 4CRAA 1B5GH 1TMBH 5E2OA 1B7XB 4IN1A 1BTXA 1P2KA 3SGAE 4NFFA 5CHAC 3ESTA 1O2UA 1OPHB 1QL9A 5LPRA 4ZCNA 4D9QA 1DS2E 1HJ8A 2RG3A 2ZDAH 1IAUA 3RMLH 3KQBA 2AIQA 1TQ0B 4X1PU 1C1VH 3DCLA 1GJ8B 1O2PA 5EW1H 1BTWA 2WV5A 1E79D 3DHKH 1VJAU 5FPSA 1FONA 2C8XB 2CJIA 5TCAA 3ZZCA 4DIIH 1DPOA 5CE1A 1MD7A 5A8YA 1E36B 1DE7H 1YLDA 4IC6A 1VJ9U 3PLKA 1AFQC 5JYIA 2KX4A 4I8GA 2WPMS 3UTUH 1JWTA 2GD4B 1EXFA 4E05H 2BY6X 4UE7H 1UTMA 3MU4A 3U1JB 1GI1A 4X8UH 1KTTB 1KXFA 1NROH 4NA9H 1K1MA 1JXPA 3KF2A 1DFPA 3RXMA 3BTTE 5HMAA 1J16A 1SGTA 2G8TA 3M35A 1H8DH 1BMFD 1MCVA 3F1SB 2ZQ2A 1SGFA 1Q31A 1SLUB 1VCWA 2JETB 1FAXA 3UNQA 2BVXH 1GHYH 4K8YA 1V2QT 3TH2H 1WTGH 2I6SA 3N7DA 1SQTA 2EEKA 2FTLE 4JCNA 1BJVA 1PQ5A 1C1OA 1GHWH 1T4VH 1ZSLA 1TOMH 1BMLA 1EPTC 2FOHA 4X1QU 1XVOA 3R3GB 1ZOMA 2ZGJA 1B0EA 1C5WB 1JRSA 1TNIA 1P2JA 2ZDNA 1DDJA 2W7UA 3O8DA 3N7OA 3MU8A 2BM2A 4HFPB 1HRTH 3W94A 3EA9A 4ZKNU 1OWDA 1UCYK 2F9UA 4M7GA 2F4LA 2ZGHA 5JBTA 2QXJA 1YPHE 3MO9A 5GIBA 3A7VA 3SNEA 5EJLA 2RA3A 2SNVA 1QBVH 2YMSC 3TJOA 1ELFA 2H6MA 1MTWA 1PPZA 2XBWA 4Y6DA 3LC3A 1O2TA 5CDFE 1ANBA 2BQ7B 2QCYA 2F9BH 3W1EA 2ZCHP 1TFXA 3SNCA 1Q3XA 3RXVA 1FMGA 1HIAA 1W0YH 3V3MA 1GJBB 1O2JA 1TOCB 3PTNA 4NSVA 5DP3A 1TA2A 2J5UA 2KAIB 3AW1A 4YLQH 5IYTA 2KCYA 4A92A 3SV6A 3RC5A 3VPKA 1AD8H 3LGVA 4ABBA 4NSYA 2P8OC 3BTKE 3VFEA 1F0TA 1D4PB 1O2IA 1QFKH 2SFAA 3F0PA 2QGRA 2SGFE 2OCVB 3DSOA 1O2VA 1TNGA 2Y7XA 1AN1E 1UVPA 4AFUA 3SU2A 1C1TA 2BHGA 3RXEA 3DFJA 1O5BB 1A3EH 3BG4B 3DA9B 3MFJA 4P00A 2OC7A 1T8OA 1TONA 1TNHA 1GMDG 3NK8A 3MH7A 1EZQA 5EIYA 1TNKA 2ZHWH 4D7GA 3DT0H 1TPAE 2ZEBA 4GAWA 5ESBA 2ZHEH 2GVFA 3A80A 5DP7A 4CBNA 3M5NA 1UTQA 5IDKA 2WPLS 2F91A 1FI8A 1K1NA 2Z9GA 1IQNA 1OP2A 5EXLA 3F2FA 4WH8A 2QXHA 1LPKB 2OD3B 1LHGH 2XNIA 3ZVCA 1WAYB 3P95A 2J92A 2OBQA 2OP9A 4K2YA 2ZCLP 1GHAF 2W5EA 3F9GA 5DK1A 1XUGA 2VU8E 1LHCH 1FDPA 2D2DA 1YBWA 2Z3EA 1HJ9A 1SC8U 4NZQA 2XXLA 2WSSD 1AIXH 2PKSC 4XDEA 4TPIZ 2FI3E 5E0GA 3TK9A 1AFEH 4AC9A 1D3TB 2G5VA 5AVDA 4I8KA 3S9CA 2FS8A 1JIMA 1TBRH 2YOLA 1BCUH 3M7UA 4ZHMU 1TX6A 1BBRK 2PV9B 3OAAD 3ZZBA 1HPGA 1TX8A 2NWNA 3ZZ7A 2CHAC 2Q1JA 1S6FA 3PM3A 1TNLA 3PMBB 1W12U 1W2KH 2VB0A 4BAHB 3P8OA 5HXFA 4ZHAA 3MNBA 1CBWC 5FPYA 3I77A 4Z1MD 3PMJA 2OXSA 1RTKA 1Z71A 2CXVA 1QY6A 1P2NA 3BTQE 4BTTB 1NT1A 4FUCA 1YM0A 2A5AA 1DWBH 1S6HA 1V3XA 1GPZA 3IITA 5B6OA 1COWD 2ZECA 1EAUA 2P94A 4RN6A 4CHAB 2GCTB 1RGQA 4FUHA 1O2RA 5A8ZA 3BTHE 1K1IA 1C4Y2 1N8OC 3SU5A 4IS5A 2PW8H 5LGOA 3OE7D 3ATIA 1GI4A 1XMNB 3P8GA 2C3SA 5HYOA 2FX6A 1C1WH 1C2GA 4AFSA 1ZMLA 1N6XA 2SGAA 1PPFE 1UTLM 4AG1A 1ZJDA 4ZAEA 1Y3VA 2VIDA 3TH4H 1GJDB 1EJAA 4ISNA 1A5HA 2OQUA 1A0LA 1GCTC 4KELA 1LCYA 1UTPA 4XOJA 5EQSA 1EQ9A 3RXUA 1PQ8A 3SUFA 3A8DA 1G3DA 3KL6A 3PO1B 1AZZA 1KXAA 4YLUA 5T6FA 3KN2A 2WPDD 1A3BH 3OTPA 1PPEE 4ISHH 1YLNA 3H09A 5DP9A 1J15A 4GPGA 3BV9B 3PRDA 4SGBE 1LVMA 2R0LA 4X0WU 5T6DA 1BBRH 1TX7A 1E38B 4H6TA 4DOQA 5JBBS 3A8AA 1KMHB 4IGDA 4DW2U 4U2WA 1DVAH 1TE0A 1Y3WA 4OS7A 3TK5A 1PJPA 1O0DH 2V3OH 2VGCB 2Z9IA 2JH0D 9LPRA 1A4WH 3LGYA 2UUJB 1HDTH 3LPRA 2FOBA 3T28A 1KDQB 3K6YA 1Z8JB 2BMGB 5GCHF 3EQ0H 2A4OA 3LKWA 4X2WA 2VINA 1VGCB 4ISOA 4Y8XA 2BOHB 3KQCA 5JB8S 1IQLA 6GCHF 1ABIH 2QY0B 3A89A 4GLYA 1C1SA 3F2HA 1YCPK 2OBOA 1OYTH 4X8TH 1FY8E 5FPTA 1V2KT 4K8BA 2Q6DA 2H9TH 3LIWA 1DWDH 1TPPA 1C1NA 1YP9A 1AB9C 2HNTE 1FJSA 2QF4A 3FOAA 1L1JA 1TRMA 1NPMA 1PPBH 2SGEE 4DGJA 5A0CA 1TA6A 5E8EH 4THNH 2SGQE 3TVJB 1YPHC 1ZGVA 3RXJA 4ESTE 4ZKRU 1SR5C 4LZ4B 3QN7A 3GOVB 4YM9A 1ZTKA 2BLWA 2FX4A 5E0JA 3U8RH 1EAXA 1T4UH 1Y59T 1UTOA 2QAAA 2A45B 1EZSC 1SOZA 3P17H 1P02A 1UK3A 3EGKH 2ZO3H 1YPGH 1OYQA 1BITA 2PP6A 2ZFPH 1C2MA 3BEFB 4KTSA 1ESBA 4MPWA 1HAGE 3F6UH 1CT4E 1UHBB 4HZHA 1J9CH 2EC9H 1AWHB 1MU6B 3B9FH 3LONA 4AFZA 1PPHE 4ASHA 1S0QA 1YPEH 2FXRA 1V2RT 2WPIS 2PFEA 1QB1A 1P03A 3N99A 5JPMH 1CHOF 2ZFSA 2XW9A 3PWCA 5EPYA 2BTCE 2JIZD 1C4U2 2Y5FA 2P59A 1WQVH 1HAVA 3WW7A 1CGJE 8LPRA 3ODFA 4X2YA 3LGUA 1F7ZA 4A7IB 1Y3YA 2Q6GA 3MU0A 1W0ZU 5EODA 3GDVA 3PV5A 2PUQH 1K0HA 2AERH 3STIA 3PYHA 1O5EH 5AFYH 1Y5BT 2RDLA 2VH6A 2BD7A 1NBMD 2GGVB 1GVKB 1ZLRA 1P9SA 1D3PB 3BTFE 1ANDA 2PUXB 3P70B 2UUFB 2VIVA 5TJXA 1DSUA 2ZF0H 4MVNA 3U9AH 1ESTA 3OY6U 4K69A 2XCNA 4VGCB 3S0NA 2F9OA 3KYGA 1ZZZA 2ZNKH 1GDQA 3K2UA 2A4QA 3O8CA 3URDA 4FUFA 3QDZB 3URCA 5F53A 4WXIA 1TLDA 3A85A 3M37A 1O2LA 1FN8A 4GVUA 3P8NA 3TNSA 1FN6A 2TIOA 2ZDKA 2VNTA 1V2MT 3E1XB 1YY3A 1AHTH 2ZU5A 3P6ZB 1GHBF 2G51A 2XYAA 3L6PA 3MWIU 3DD2H 2FYQA 1ZTJA 1SQAA 2O8WA 3C1KA 5C17A 2J34A 3PB1E 1O2MA 2QV1A 1MTVA 3E16B 1QRWA 4ISIH 2VIQA 3QWCH 1HXFH 4R0IA 1ETRH 3E6PH 3EAJA 2QF5A 1DX5M 2R2MB 1W7GH 1GWAA 1O2HA 1P04A 3ATLA 5C20A 3M7QA 1RJXB 5LPEA 1BRAA 4BXSA 1FZZA 4LK4A 3UUZA 3BSQA 2ZU1A 3SO3A 2TGDA 1G3BA 2GMTC 1MBQA 4HTCH 3UFAA 1KXBA 1G2MA 1SSXA 1CGIE 4Y10E 1V6DA 1V2UT 1QZ8A 3B23B 2RDEA 3RXDA 1O3OA 1BMMH 2A5KA 2PKAA 2QYIA 3ZVEA 5LPFA 1UVUH 1V2NT 2BY7X 4RKOB 1J8AA 4NWKA 4Y79A 2J98A 1TQ7B 3ZIAD 4TWYA 4BAMB 4B76A 1C5NH 3UWIA 5EG4A 1HUTH 2FMJA 1LQDB 2F9PA 1P12E 2W6JD 2ZHQH 3CNRA 1W3CA 1MBMA 4Q4LA 2B0FA 2B8OH 8GCHF 2HGTH 3TK6A 3FP7E 5HIZA 2OINA 1SQRA 4X1RU 3L3TA 3JZ2B 1RD3B 5L6NH 2EY4C 2ZP0H 4MQAA 1OWJA 4XBBA 1D3QB 1EOLA 2NU1E 2A7CA 2G55A 3GCHC 3QTVH 2QF0A 1GHXH 3SYJA 2OUAA 3RDZA 1AFQB 2A32A 2BLOA 1QJ6B 2QXGA 1PQ7A 1O2OA 2FOAA 1AWFH 1RTFB 4B6FA 3TGKE 1LKBA 1O3PB 1M9UA 2FESH 4AZ2B 5FL7D 3ELAH 1H1BA 1VZQH 2WUCA 3SHAH 1ESAA 4MTBA 1IQIA 5DKMA 1TGCA 2ODYB 1H8ED 4X2VA 2FZZA 5F6MA 2PR3A 5A0BA 4ZXYH 3S9BA 2ASUB 3D65E 5GDSH 1AUJA 1K1PA 3LH1A 1EPTB 1O2YA 4AYYB 1O2QA 3AASA 2BVSH 4UDWH 3HGPA 4UD9H 2UUYA 4FVBA 1HAZB 4LXBH 1O2KA 3E3TA 5DP4A 1V2ST 3EE7A 1NM6A 1SGEE 1MH0A 3QX5H 3BEIB 3TJUA 4ZXXH 1UK2A 3FANA 1HAYB 2KR7A 4XBDA 3BIUH 1NRSH 3SI3H 1FPCH 3VB5A 4MNYA 1QJ1B 1UTKA 2HNTC 1DLKB 1CA0C 4F55A 4OS5A 4ISLA 4J1YA 1A61H 2ZQ1A 5C1YA 5AFZH 4BOHA 4BXWA 2YMSB 4AX9H 2WYGA 4ZROA 4CR5A 3NCLA 2ALVA 1CVWH 1ABJH 3EA7A 3T29A 1T8NA 3MH6A 1PQAA 1UVOA 3ZVFA 6CHAC 3OYPA 2VJ1A 3RXFA 2GTBA 3LJJA 1A2CH 3RUOA 1KXDA 1GJ9B 2SNWA 1AY6H 2GJGA 1ELDE 5A09A 3ZYEA 2PWXA 4MPXA 3M3VA 3SZEA 3U1IB 1EAIA 1A1RA 1GHAG 1O3NA 1GCDA 1T31A 4FUGA 4FUEA 3A84A 1S84A 5FHTA 5C1XA 2Z3CA 1KXEA 2Z94A 1C9PA 4OGXA 2GDEH 3CS0A 4SGAE 4DIHH 1GBFA 1GBLA 1DY9A 1THPB 2ZCKP 3LU9B 3O8BA 2ESTE 2ZTZA 1ZPCA 3ZV9A 1S85A 2P8OB 2BQWB 1GJ4H 4OS2A 2ZFFH 3RXHA 1ELCA 4I31A 1O31A 5FBIA 1TGSZ 3FP6E 2G81E 1SFIA 2TPIZ 1KXCA 1W0KD 1FY4A 5FAHA 1JMOH 1AU8A 2DE8A 2G52A 4DY7B 1SQOA 4O03A 2FIRH 2Q6FA 2O8UA 5GPIB 4B73A 4AG2A 1TGBA 1SGIB 2W6ID 5T3HA 3RLYH 4WMFA 3RMNH 5GJ4B 4Z0KA 3QZRA 2BXUH 1SGYE 3U28C 1YLCA 3CS7A 1MTUA 3ZZ8A 2KAIA 3GY3A 4X1NU 1YPKH 4H42U 3NKKA 3U8TH 2CF8H 1KIGH 2VH0A 1UW7A 5EGMA 2HLDD 4Y11E 2H1UA 2XC4A 4ABIA 1ZHPA 4KTUA 1DY8A 1XM1A 1L1GA 4WVPE 1TBQH 1D9IA 2JJ2D 5L2YH 4NCYA 3M7TA 2ZGBH 1MMJN 2R3UA 1LO6A 3RM2H 2ZFQH 1GG6C 5DO4H 8KME2 1F2SE 4K1EA 4UFGH 5ABWA 3BTWE 5DPAA 2BDGA 1C5RA 4OS4A 3VB7A 4Y0YE 2BLVA 2OLGA 1O3GA 3SJKA 1FIWA 3K65B 4K5ZA 2FS9A 5IK2D 2B9LA 4ABEA 1GJ7B 1P3EA 4ABJA 2TGPZ 2Z7FE 1HJAC 1BRUP 1KLTA 2Y5GA 2R3YA 1MQ5A 2A2XH 3GDUA 1ARBA 2ANYA 2OTVA 4NWLA 1GJ5H 1LHFH 2VWLA 1GI6A 4NA8A 2BDBA 1XUFA 1Y5AT 5F8TA 1BIOA 1UCYH 4F4OC 3DSGA 1DANH 2HVYB 4Y71A 1DUEA 1C1UH 3KQ5A 2FLBH 1GMHG 2FPZA 2BD4A 3U69H 2KFWA 1QJ7B 2BYAX 1SBWA 4D9RA 1GJCB 1CA8B 1S82A 2FP7B 1CSOE 3MH5A 5FX6A 1VR1H 3M36A 2AMDA 1N8OB 1NRRH 1HFDA 2R2WU 5GCHG 3H5CB 4FUIA 1ACBE 3VEQB 3ZVDA 1P2OA 6GCHG 3NWUA 1F5LA 4D76A 1FNIA 1O2ZA 5PTPA 2C8WB 4DT4A 1SFQB 3SU6A 1UO6A 1KSNA 2Y80A 4AGKA 1GCTB 2FM2A 3OEED 1TALA 5JB9S 5TCCA 4LZ1H 4B71A 1C2JA 1YPLH 4CRDA 1QB6A 1SGDE 4D8NA 3TGIE 2RCEA 3AAUA 1EAWA 2FOMB 2QE7D 1NESE 4Q63A 4JMYA 1O3MA 1C5VA 2BDHA 3MTYA 2QXIA 1FIZA 1GI3A 1WCZA 1EP5A 2JDID 2HPQH 3PMAB 4UEHH 1UVTH 1TMTH 4YT6H 3QO6A 1MTNB 1G2LA 2ZPQA 3QGJA 4OGYA 2XWAA 3MU1A 1C1RA 2D26C 1XUHA 1K1JA 1OS8A 2PSXA 1G3CA 2WZQA 2XNDD 1P8VC 3WY8A 4AORA 3OFND 3A7ZA 1SVPA 2GCHF 1SG8B 3QLPH 2ZIQH 1AZ8A 2BDAA 2OQ5A 4NIVA 1LPGB 2AYWA 3E90B 1W0JD 2GKVE 2L6OA 4J2YB 1PPGE 3WWFA 5A2MH 3SV9A 4BAQB 1IQMA 3H7TA 1JRTA 1HAIH 2J9NA 1OP0A 1ELVA 1YKTA 4RSPA 2AGIX 3IWMA 3R0FA 1ID5H 1KYNA 4JYVH 5FCKA 1XX9A 2ZI2H 1MCTA 1NRPH 1TGNA 2TRMA 1A0JA 1D6WA 2J38A 4FUJA 5F8XA 1GBHA 1GMHF 3QUMP 1CHOG 1GBAA 1AB9B 4O3TA 1HAOH 4INHA 1VITF 5J4SA 3F3BA 4MNXA 4TT3D 3LDXH 3N7EA 4WWYA 4A5TS 1HNEE 4XE4A 3D49H 2VWOA 3DFLA 3GY7A 2STBE 2ZA5A 1IHSH 1QB9A 2OC0A 2PTCE 1KY9A 1H4WA 1KDQA 4UONA 3Q00A 1ZPZA 1SHHB 3KYFA 1IQEA 4I8LA 1VCPA 5EJ1A 1E37B 2GT8A 3ZZAA 1L0ZA 2Z9JA 1XUJA 3V12A 1WOFA 1SL3A 4MPUA 3LH3A 4AB9A 4CBOA 1O36A 3OX7U 1O3CA 3TITA 3A83A 3EA8A 1WQSA 4MNWA 3T25A 4KTCA 4ACAA 4H6SB 1UK4A 1BTHH 1OWEA 1V2VT 4AGJA 3TH3H 1PYTC 1W11U 1K21H 1JOUB 1SGRE 2G4TA 4FU9A 1XKBC 3M61U 2NU4E 2YNBA 1JBUH 2A0QB 2IN2A 4CR9A 3ATKA 1ELAA 1FAKH 3GY8A 1DLEA 4HGCA 1BQYA 1GHBG 2HPPH 3UQVA 1HLTH 2PGQB 1C5PA 1GGDB 1P2QA 5EU8A 4CH2B 3V0XA 4GUXA 2KCAA 2KM0A 3NPSA 2UWOA 2GDDA 1H9IE 3TNTA 3M5LA 3MH4A 4A6LA 3SU4A 3UREA 2PHBA 3GY6A 3KNXA 1TYNA 1GBTA 2ANKH 2D8WA 3HKIB 3RXSA 3UR6A 4WH6A 2ZGXH 1ZJKA 3Q76A 2FOEA 3MHWU 7LPRA 4JK5A 2ALPA 1DWEH 2PSYA 1BRCE 2A5IA 4ABHA 2M2AA 1C5QA 1UHBA 2FO9A 3MQKC 1DXWA 5ETXA 3TJNA 5DJ7A 1U6QA 1V2PT 2I6QA 2Z9LA 5GNDA 1EASA 3SV7A 1DXPA 3CENA 4FXGH 1GL1A 1WDIA 1V2LT 1NFUA 3B8JA 4DT7B 4YXWD 1TABE 4CRCA 1BBRE 3RXOA 4NIXA 3CP7A 1O5DH 2XRCA 4MPVA 2BZAA 1HYLA 1K1LA 3A82A 1WUNH 2AIPA 4FUBA 4JK6A 2JKHA 2ZHFH 4O97A 1EJMA 2R9PA 1N6YA 1O3BA 3AVZA 1J14A 1G32B 2QC2A 4ZH8A 4AYVB 2KCOA 3UQOA 3A8CA 3MNXA 4TY7A 3VB4A 1YCPH 1ELBA 4FOUC 5C94A 1A0HB 8GCHG 2O8MA 1W14U 1C2LA 3LC5A 5T1VA 9ESTA 3QK1A 4RKJB 1C2IA 3RU4D 4A1VA 1C5TA 5BRRE 1QL8A 2QN5T 5I46H 1E1QD 2ODPA 2J4IA 3MNCA 1A7SA 2ZGCA 1DSTA 1H9LB 2BY5X 4Y7BA 3ZZ9A 4JZEH 2AHME 3W95A 1F0SA 2PGBB 2UWPA 4KGAA 1O3HA 3MO6A 2HWLB 3BTDE 1FUJA 3GDSA 1ZHMA 1THRH 5HM2A 5EPNA 2ZDVH 4YTAA 1AKSB 5EXMA 1O5AB 5EOKA 1HXEH 2WYJA 2XC0A 4Y7AA 3SUEA 2F43B 5SGAE 4A1XA 1P01A 2G5NA 1SGPE 2UUKB 2ZTYA 3FP8E 1QBOA 3MOCA 4OS6A 2TGTA 7GCHF 1GDNA 4YOJA 3Q77A 2GZ7A 3UOUA 3TIUA 4ZMAH 3ODDA 3S69A 2Z6BD 1NZQH 1AI8H 2BDYA 5J4QA 1D3DB 1GBMA 1O2NA 1SMFE 1WSSH 2V0BA 2HOBA 3OY5U 3A88A 3M3TA 4TWWA 3S7KB 3TGJE 4NIYA 4E06H 3FFGA 3GICB 3OTJE 1P57B 1PFXC 1SLWB 4JZDH 1W7XH 3T27A 2VIOA 1WXRA 4XSKU 4WMEA 3SUGA 3PMHB 4Q7XA 2XOKD 4R8TB 5CHAB 3TLOA 4KP0A 2BY9X 1GHZA 4CRFA 1MAXA 4Q7YA 2Y82A 5HKKD 3UNRA 3BN9A 4P02A 2ILNA 5FCRA 3RXQA 3C27B 3UIRA 4Q80A 1SGNE 2WPHS 1GBEA 1VCQA 1AVGH 4I33A 3E0NB 4YT7H 4TY6A 3MNSA 2GV6A 1NRNH 1CGHA 4XFQA 5K7RA 2EI8A 3KQDA 4GCHF 3F9FA 4IMZA 1S83A 2IOTA 4K1SA 4AN7A 3VGCC 1VITH 1O2GH 3HK6B 1HAPH 2FOGA 1RS0A 1UVSH 4JYUH 1WBGB 1FQ3A 1LHDH 1GBJA 2JH5D 2F9NA 3F2GA 3A8BA 1IQJA 3GISB 1K1OA 2KCPA 2WINI 5JBCS 1RIWC 1S5SA 3MO3A 1C2KA 2VIWA 3F9HA 2XTTB 1YGCH 3PTBA 4KKDA 4B1TA 1GBKA 1QBNA 2BD8A 2ANWA 2JH6D 1Q2WA 3T62A 3RC6A 1DITH 1GI0A 5DG6A 5EXNA 2BD9A 1GMCF 1MABB 4MG3A 1CA0B 4FVDA 1L4ZA 2M5TA 3AAVA 1TBZH 3HK3B 2LP6A 1QTFA 4I7YH 1OP8A 3NXPA 1Z6EA 5HGGA 1YYY1 1H8IH 3GCTF 1TGTA 1K22H 2K8IA 3GS9A 4WY3A 1E34B 2DUCA 3FVFB 1NS3A 1O3JA 1P2IA 1EPTA 3AW0A 2ZFRH 1FLEE 1F0RA 5EJZA 2O9QA 1QIXB 3F9EA 4U01A 4AFQA 1RXPA 4B2CA 2BDCA 4K1TA 2HNTF 4NGAH 1HV7A 1CU1A 1O2SA 1OHHD 2FI5E 3T2NA 3K6ZA 1O32A 1GBIA 2GX4A 2AS9A 1ZSJA 1OX1A 4O9VA 1LVBA 2F9VA 2VVVA 1NBME 2RA0A 1SKYE 2XBYA 2WUBA 4Q7ZA 3RMOH 3RU4E 5JDUB 1C5ZB 4NA7A 4XD7D 5FX5A 1L4DA 1O3LA 1IQKA 1B0FA
chains in the Genus database with same CATH topology
1XVMA 1IQHA 3SU3A 3VB3A 3GY4A 3A7WA 4MDSA 1L2EA 4YO9A 1ZMNA 5T6GA 1AGJA 3SJ8A 2J94A 2XWBI 2FODA 1NFXA 3A7TA 2XBXA 2BDIA 5C3NA 1SB1H 2H5DA 4X6OA 2ZFTA 1C1QA 2Z9KA 2Y81A 1ANEA 1MKWK 1C5YB 1QGFA 3RXTA 3MYWA 3KIDU 1G3EA 4H4FA 2K1QA 1PPCE 2W3IA 1LHEH 1EB2A 3A81A 3SGQE 1EZUC 3SN8A 2ZU2A 1TRNA 1SHYA 5FBEA 1P11E 1YPJH 1C2FA 2Y5HA 1GG6B 4B74A 2FDAA 4MNVA 1MZDA 1OOKB 1ELEE 1SGCA 2BX4A 4NZLA 1FXYA 3ITIA 3LGIA 3RMMH 1Z8RA 3S7HB 5HM9A 3TU7H 1RFNA 3SHCH 2B5TB 4MLFB 1TWXB 2QA9E 3UWJH 1LTOA 1HJAB 2LNCA 5H4IB 4WXVA 1ZRBA 3RC4A 1Z1IA 1O3EA 6LPRA 1V2WT 2XCFA 3Q3XA 3O8RA 2FOFA 1KLIH 2W3KA 1T32A 1LMWB 1Y3UA 1NU7B 1FY1A 1AQ7A 2JETC 2CV3A 4JZFH 1BA8B 5GWZA 1ZYOA 3KGPA 1E0FD 2AEIH 3BTME 3STJA 1AE5A 3L33A 3RXBA 3KEEA 3ZYDA 1WV7H 5JBAS 1X7AC 1FV9A 3FZDA 1P2MA 4TYDA 5C5NA 5E0HA 5DGJA 1QNJA 1HIAB 1BTPA 2XBVA 1XUIA 2P3FH 1AMHA 2ANMH 1G30B 4DCDA 2GCHG 1CHGA 3ATMA 5F03A 1TMUH 3GCOA 2PKSB 4BTUB 7KMEH 3UOPA 1O38A 4GSOA 1A5GH 2DE9A 1HB0B 1P9UA 4DURA 1QL7A 3UR9A 1MKWH 3RXIA 3Q3YA 5K0HA 3VXFH 3KHVA 1C4V2 1O3DA 1F5KU 2EI7A 4NFEA 1Z6JH 1N1LA 1P06A 3ZZ3A 3RU4T 1P09A 3SJOA 1TB6H 1SOTA 1EP6A 4CRGA 3V7TA 1BJUA 1F5RA 2CHAB 3LGWA 2UWLA 2TBSA 1OSSA 1CBWB 4DVAU 2BXTH 2ZDMA 1LVOA 1V2JT 3SUDA 1OWIA 1BMNH 1VITG 2WPJS 2BD5A 1QA7A 2YNAA 1LKAA 2V3HH 1WTHD 3T5FH 8ESTE 3GYMA 1C2DA 2BVRH 1FY5A 1GI5A 1QRZA 7ESTE 2GZ8A 3VXEH 4BANB 3PLPA 5C2ZA 1O3KA 4ABDA 3KQEA 4YESB 5LH8A 2BD2A 1LQEA 2EI6A 1GJ6A 3K9XB 2HLCA 5F8ZA 1C5OH 4QT8C 3BG4C 4JZIA 3QTOH 5EW2H 3M5MA 2ZKSA 1BTZA 3SU1A 1C5UA 6ESTA 4X1SU 2P3UB 2ZPRA 4UFEH 3TJVA 2C4FH 3LT3A 3VB6A 1T8MA 4BAOB 3RM0H 1DWCH 3RP2A 3RXKA 1ETSH 3MI4A 4IW4E 4FU7A 1CT2E 3QZQA 5I25A 1GL0E 3A86A 3MMGA 2ODQA 3PLBA 1OKXA 2IPHA 1GVZA 5C5OA 1RTLA 3BG8A 2ZU3A 4HI3A 1Y8TA 4WMDA 1ZSKA 1INCA 2SGPE 5E2PA 1GI7B 2R0KA 1O30A 1TPSA 4FU8A 1NFYA 4ZHLU 5C1UA 2TGAA 4X6NA 1GBBA 4E7RG 2GV7A 1K2I1 1BB0B 1EATA 1GI8B 3GCNA 3I29A 1K9OE 2O8TA 1Y5UT 2A7HA 1O5FH 5C67A 2SGDE 4IN2A 1LVYA 3SV2H 1UCYE 3OSYA 1O5CB 1QA0A 3M5OA 2BX3A 3ZZ4A 1HAXB 1WU1A 1NRQH 3RXCA 2FYRA 2ZC9H 3E0PB 1O39A 3SORA 4K3JA 5L2ZH 4I32A 1O2XA 2NU0E 1DICA 3EE0B 5DP8A 1GMDF 1OWKA 4X6MA 3SU0A 3GY2A 1O35A 2AMQA 3GYLB 1CT0E 1Y3XA 1TRYA 1HAHH 1THSH 3BTEE 3T26A 1ORFA 1HCGA 4GHTA 1EUFA 4F49A 3U8OH 1O37A 1QCPA 1GBCA 2H5CA 2J2UA 1P0SH 4X8SH 2OC1A 1ELGA 3RXLA 2VVUA 1S0RA 1O5GH 3RXRA 2VVCA 3OU0A 1C2EA 2H2ZA 2P93A 4O3UA 1ZR0A 2J95A 1MTNC 3E8LA 1V2OT 4CHAC 4INLA 2GCTC 4B75A 2ULLA 2AGEX 1C2HA 1GI9B 5DP6A 2B7DH 2GZ9A 2C8YB 1NU9A 1EB1H 3E91A 3SV8A 2FLRH 4CRBA 2CN0H 3P8FA 1D6RA 1LPZB 2BQ6B 1E35B 3IG6B 4JZ1A 4Y8YA 2VWNA 1MZAA 1P10A 4I8JA 3RXGA 4U32A 4BNRA 5AF9H 1CE5A 1BTUA 1MKXK 1YCPM 4B2BA 1NTPA 2ZG0H 3UNSA 5CMXH 1BTYA 1DT2A 2W26A 3SZNA 1WYKA 2EA3A 1EX3A 1LDTT 2Y6TA 3SW2B 1OXGA 2NU3E 2G4UA 1GHVH 3SNDA 3PO1C 1AUTC 1SPJA 1W13U 1CQQA 1GJAB 3RXAA 1QQ4A 2FOCA 2Y7ZA 3EYDA 1IHTH 1W10U 2A7JA 4TPYA 7GCHG 1MQ6A 1V2TT 4I8HA 1SLXB 4OS1A 4Z6AH 1P3CA 4LOYH 4FUDA 3G01A 2ZWLH 1Z8GA 4BTIB 1GVLA 2A2QH 3FZZA 1IQGA 3BTGE 4GHQA 3ZZ5A 1IQFA 3V13A 1C5MD 1DM4B 1EKBB 2F3CE 1Z8IB 2VGCC 3JZ1B 1O34A 4BAKB 1BUIA 3H7OA 1ZTLA 1TPOA 2VIPA 3BF6H 1BT7A 1S81A 2H9EH 2O8LA 4AB8A 3FAOA 1MU8B 1VGCC 3MU5A 4UFFH 4NG9H 4DJZB 1ZRKA 1L1NA 1CO7E 3U98H 1XXDA 1BDAA 1NY22 4Q2KA 4YOGA 1H9HE 3ENSB 1BZXE 1SLVB 3RXPA 2P95A 2A1DB 4ZKSU 1G37A 2CF9H 4PROA 1YF4A 3ZVBA 1EOJA 2P3TB 3LGTA 4JYTA 1A5IA 2BZ6H 1MD8A 2ZDLA 3M3SA 2PLXA 1QQUA 2PTNA 1QHRB 4B2AA 3HPTB 3A87A 2CMYA 1QURH 1F0UA 2D1JA 1UJ1A 4GCHG 3UPEA 1GGDC 2QIQA 2WV4A 2V6NA 5ESTE 1MKXH 2AMPA 4YZUA 1GDUA 4INKA 1O33A 3DUXH 4DG4A 1EZXC 3LOXA 2BB4A 3BIVH 5L30H 1NC6A 4CH8B 1HAVB 3SOSA 2BD3A 1IOEA 4X2XA 3ZV8A 1GBDA 1W8BH 2GP9B 5A0AE 2GMTB 1RRKA 3PWBA 1ARCA 1BHXB 5EQRA 2FEQH 1G36A 1AE8H 1EJNA 4Y8ZA 3SBKA 3D62A 1GMCG 1ETTH 1O3IA 4CREA 1BRBE 1P05A 3NUMA 1XXFA 1SI5H 1T8LA 3LJOA 2H9HA 2HRVA 3SQEE 1AKSA 1DOJA 4UFDH 2AFQB 4IBLH 4ABFA 2ZTXA 2BY8X 2IJOB 1AO5A 2FTMA 3PROA 3GCTG 1NO9H 1KLJH 1O3AA 3ZZ6A 3S9AA 5GXPA 4ABAA 3NZIA 1C9TA 2OC8A 1XUKA 2ZZUH 2HVXA 3SQHE 5AHGH 3SGBE 3ZVAA 1UTNA 2A4GA 1C5XB 1KTSB 1ANCA 1C5LH 2QF3A 4ABGA 1QR3E 1BHXF 1ZGIA 2G00A 4IMQA 4WF8A 1F92A 1JIRA 5A8XA 1PYTD 1FY3A 3SJ9A 1XKAC 1C5SA 3VGCB 3ATWA 2WPKS 1UMAH 4U30A 3HKJB 1BOQA 3SNAA 3GCHB 4IC5A 2NU2E 2AH4X 1TIOA 1RIWB 3RLWH 2A4RA 1ZPBA 2V35A 2BOKA 4NIWA 2STAE 2ZPSA 3HATH 2W7SA 1MTSA 4VGCC 5FXLA 1GI2A 2ZU4A 1ZHRA 2FI4E 1DUAA 4YOIA 1AVXA 3EDXB 2Z3DA 4Y0ZE 1C1PA 1SGQE 5BPEA 2THFB 1UTJA 2C8ZB 1BMAA 3PV4A 4WJG2 3TPIZ 2LPRA 3SI4H 2BLQA 2XC5A 3P92A 2PKAB 1AVWA 1MUEB 4ZKOU 1FPHH 4Y76A 2GT7A 1YPMH 2P16A 1HGTH 4K60A 1TAWA 1T7CA 2ZHDA 3A7YA 1QRXA 5G4BA 1ELTA 3D23A 4ZUHA 4XBCA 3ZZDA 3Q3KA 1C1MA 1OWHA 2HALA 1TNJA 1HBTH 2C90B 3SNBA 1O2WA 4E7NA 1Z7KA 3A7XA 4A1TA 3ZVGA 2AGGX 1MAYA 3BEUA 3GY5A 3KCGH 1Z1JA 1ZMJA 3SJIA 1K28D 3HGNA 2VWMA 1J17T 2F83A 2C93B 1NFWA 4X6PA 1A46H 3UY9A 4AOQA 2A31A 2FWWA 1G9IE 1SGFG 4X8VH 5DP5A 3QGNB 2CGAA 5EQQA 4D7FA 1O3FA 1NN6A 6CHAB 1YC0A 3F68H 3I78A 4CRAA 1B5GH 1TMBH 5E2OA 1B7XB 4IN1A 1BTXA 1P2KA 3SGAE 4NFFA 5CHAC 3ESTA 1O2UA 1OPHB 1QL9A 5LPRA 4D9QA 1DS2E 1HJ8A 2RG3A 2ZDAH 1IAUA 3RMLH 3KQBA 2AIQA 1TQ0B 4X1PU 1C1VH 1GJ8B 1O2PA 5EW1H 1BTWA 2WV5A 3DHKH 1VJAU 5FPSA 1FONA 2C8XB 2CJIA 5TCAA 3ZZCA 4DIIH 1DPOA 5CE1A 1MD7A 5A8YA 1E36B 1DE7H 1YLDA 4IC6A 1VJ9U 3PLKA 1AFQC 5JYIA 4I8GA 2WPMS 3UTUH 1JWTA 2GD4B 1EXFA 4E05H 2BY6X 4UE7H 1UTMA 3MU4A 3U1JB 1GI1A 4X8UH 1KTTB 1KXFA 1NROH 4NA9H 1K1MA 1JXPA 3KF2A 1DFPA 3RXMA 3BTTE 5HMAA 1J16A 1SGTA 2G8TA 3M35A 1H8DH 1MCVA 3F1SB 2ZQ2A 1SGFA 1Q31A 1SLUB 1VCWA 2JETB 1FAXA 3UNQA 2BVXH 1GHYH 4K8YA 1V2QT 3TH2H 1WTGH 2I6SA 1SQTA 2EEKA 2FTLE 4JCNA 1BJVA 1PQ5A 1C1OA 1GHWH 1T4VH 1ZSLA 1TOMH 1BMLA 1EPTC 2FOHA 4X1QU 1XVOA 3R3GB 1ZOMA 2ZGJA 1B0EA 1C5WB 1JRSA 1TNIA 1P2JA 2ZDNA 1DDJA 2W7UA 3O8DA 3N7OA 3MU8A 2BM2A 4HFPB 1HRTH 3W94A 3EA9A 4ZKNU 1OWDA 1UCYK 2F9UA 4M7GA 2ZGHA 5JBTA 2QXJA 1YPHE 3MO9A 5GIBA 3A7VA 3SNEA 2RA3A 2SNVA 1QBVH 3TJOA 1ELFA 2H6MA 1MTWA 1PPZA 2XBWA 4Y6DA 3LC3A 1O2TA 1ANBA 2BQ7B 2QCYA 2F9BH 2ZCHP 1TFXA 3SNCA 1Q3XA 3RXVA 1FMGA 1HIAA 1W0YH 3V3MA 1GJBB 1O2JA 1TOCB 3PTNA 4NSVA 5DP3A 1TA2A 2KAIB 3AW1A 4YLQH 5IYTA 4A92A 3SV6A 3RC5A 3VPKA 1AD8H 3LGVA 4ABBA 4NSYA 2P8OC 3BTKE 3VFEA 1F0TA 1D4PB 1O2IA 1QFKH 2SFAA 2QGRA 2SGFE 2OCVB 1O2VA 1TNGA 2Y7XA 1AN1E 1UVPA 4AFUA 3SU2A 1C1TA 2BHGA 3RXEA 3DFJA 1O5BB 1A3EH 3BG4B 3DA9B 3MFJA 2OC7A 1T8OA 1TONA 1TNHA 1GMDG 3NK8A 3MH7A 1EZQA 1TNKA 2ZHWH 4D7GA 3DT0H 1TPAE 2ZEBA 4GAWA 5ESBA 2ZHEH 2GVFA 3A80A 5DP7A 4CBNA 3M5NA 1UTQA 5IDKA 2WPLS 2F91A 1FI8A 1K1NA 2Z9GA 1IQNA 1OP2A 5EXLA 4WH8A 2QXHA 1LPKB 2OD3B 1LHGH 2XNIA 3ZVCA 1WAYB 3P95A 2J92A 2OBQA 2OP9A 4K2YA 2ZCLP 1GHAF 2W5EA 3F9GA 5DK1A 1XUGA 2VU8E 1LHCH 1FDPA 2D2DA 1YBWA 2Z3EA 1HJ9A 1SC8U 4NZQA 2XXLA 1AIXH 2PKSC 4XDEA 4TPIZ 2FI3E 5E0GA 3TK9A 1AFEH 1D3TB 2G5VA 5AVDA 4I8KA 3S9CA 2FS8A 1JIMA 1TBRH 2YOLA 1BCUH 3M7UA 4ZHMU 1TX6A 1BBRK 2PV9B 3ZZBA 1HPGA 1TX8A 2NWNA 3ZZ7A 2CHAC 2Q1JA 1S6FA 3PM3A 1TNLA 3PMBB 1W12U 1W2KH 2VB0A 4BAHB 3P8OA 5HXFA 4ZHAA 3MNBA 1CBWC 5FPYA 3I77A 3PMJA 2OXSA 1RTKA 1Z71A 2CXVA 1QY6A 1P2NA 3BTQE 4BTTB 1NT1A 4FUCA 1YM0A 2A5AA 1DWBH 1S6HA 1V3XA 1GPZA 3IITA 5B6OA 2ZECA 1EAUA 2P94A 4RN6A 4CHAB 2GCTB 1RGQA 4FUHA 1O2RA 5A8ZA 3BTHE 1K1IA 1C4Y2 1N8OC 3SU5A 4IS5A 2PW8H 5LGOA 3ATIA 1GI4A 1XMNB 3P8GA 2C3SA 5HYOA 2FX6A 1C1WH 1C2GA 4AFSA 1ZMLA 1N6XA 2SGAA 1PPFE 1UTLM 4AG1A 1ZJDA 4ZAEA 1Y3VA 2VIDA 3TH4H 1GJDB 1EJAA 4ISNA 1A5HA 2OQUA 1A0LA 1GCTC 4KELA 1LCYA 1UTPA 4XOJA 5EQSA 1EQ9A 3RXUA 1PQ8A 3SUFA 3A8DA 1G3DA 3KL6A 3PO1B 1AZZA 1KXAA 4YLUA 5T6FA 3KN2A 1A3BH 1PPEE 4ISHH 5DP9A 1J15A 4GPGA 3BV9B 4SGBE 1LVMA 2R0LA 4X0WU 5T6DA 1BBRH 1TX7A 1E38B 4H6TA 4DOQA 5JBBS 3A8AA 4IGDA 4DW2U 4U2WA 1DVAH 1TE0A 1Y3WA 4OS7A 3TK5A 1PJPA 1O0DH 2V3OH 2VGCB 2Z9IA 2JH0D 9LPRA 1A4WH 3LGYA 2UUJB 1HDTH 3LPRA 2FOBA 3T28A 1KDQB 3K6YA 1Z8JB 2BMGB 5GCHF 3EQ0H 2A4OA 3LKWA 4X2WA 2VINA 1VGCB 4ISOA 4Y8XA 2BOHB