1OP8A

Crystal structure of human granzyme a
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
234
structure length
234
Chain Sequence
IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme A
publication title Crystal structure of the apoptosis-inducing human granzyme A dimer
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 234
sequence length 234
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.4.21.78: Granzyme A.
pdb deposition date 2003-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1op8A02
2GZ8A 2XC0A 1BHXB 4MPVA 2K1QA 2ZU4A 1Z1JA 1D6RA 3M61U 3S7KB 3P92A 5A8YA 2BD7A 4UE7H 4CH8B 1UVUH 3MNCA 3SN8A 1ID5H 1OYQA 1QB6A 3ZZBA 1F0RA 4Y8ZA 1C5WB 1GMDF 3E91A 4RN6A 3RXPA 1OWDA 4A1VA 5AHGH 3BG4B 1GBEA 2FMJA 3QLPH 3T26A 1P3CA 1ZSLA 1IQLA 2WYJA 3SHAH 1NTPA 3RMOH 3QUMP 4JCNA 1EOLA 2FOHA 1MKWH 3PYHA 3UWJH 3LH3A 5A8ZA 3ATLA 1DITH 1HGTH 3BTDE 1NESE 1DT2A 2Z9JA 5DGJA 3RXSA 3PLBA 4JZEH 5EW2H 2ODYB 3GCTF 4I8JA 5L2ZH 4IC5A 4THNH 3T29A 1AVXA 5J4QA 4ABIA 2AIQA 3ZZ5A 1XXFA 4Y11E 1SI5H 1ZLRA 3ZV8A 1VITG 4DVAU 1SSXA 2ZI2H 3SU2A 1C1RA 2BDHA 1ZTKA 1A5GH 2UWPA 3BTQE 3ZVEA 1GI2A 1HAXB 1AZ8A 4NA9H 4HI3A 2FTLE 3V12A 1HBTH 1FLEE 3D65E 1HAOH 1PPEE 4FU9A 2AEIH 1GCTB 5HMAA 2BDCA 4XBBA 1NFUA 5AF9H 2CHAC 2PUQH 1EATA 4AFUA 2F9UA 2G5NA 1AN1E 3PROA 4UFFH 3EA8A 4Z0KA 3A89A 2CF8H 1DWBH 1KXDA 1TONA 1AE8H 2Z7FE 3PMJA 2V35A 2FP7B 2HRVA 5GCHG 1LHFH 3SOSA 4WJG2 1FV9A 4GAWA 3GCHC 1LQDB 3KQCA 3Q3XA 3P70B 1K28D 4RKJB 3SV2H 5C5NA 5JBBS 3MU5A 4X2VA 1ZSJA 2ZA5A 1XXDA 4GSOA 2C4FH 5J4SA 4BTUB 1D3TB 3GYMA 1O2HA 4JZIA 3LGTA 3M5OA 1DWDH 2Y7XA 3MH7A 2P8OC 4D76A 4FUHA 2ANMH 5EG4A 1O3AA 1C5LH 1TNKA 1YKTA 2GX4A 3KQDA 1C4V2 3LGIA 1HAVA 2D26C 2Y82A 1O34A 3U1IB 2TGTA 3SNCA 4A92A 1GHAF 1TNGA 1O2IA 2AMPA 2A5IA 1AFEH 1Z8GA 1SVPA 4IBLH 3RC4A 1MTNC 1O3CA 1QBNA 4ZXYH 1W11U 2FX6A 2JKHA 3A7VA 3ATKA 4J2YB 1O2ZA 1CHGA 1HIAA 1OP2A 1XUJA 1YGCH 1GMHG 1O3GA 3A87A 2PSYA 2ZIQH 3FANA 3BIVH 1OS8A 4NCYA 2HWLB 2TBSA 1F5KU 3CS7A 1XMNB 2ODPA 2A7CA 2GD4B 2F3CE 1WQVH 1C2DA 1O2XA 1THPB 3Q3KA 3C1KA 1BBRK 3CENA 1HCGA 3FVFB 3ZVCA 3KGPA 4CRAA 1Y5AT 1DOJA 1GBHA 2ZTYA 5A2MH 3MNBA 5TCCA 4I8LA 1BITA 1T4UH 4TWWA 1SC8U 1CSOE 1RTLA 1GVKB 2BDGA 2HLCA 1HAGE 3EYDA 3UOUA 2G4UA 3JZ1B 1FAKH 3GY7A 4MNYA 2NU2E 1MD8A 3E8LA 4K2YA 3MO6A 1SL3A 2P16A 4NSYA 1DICA 4IMQA 5IDKA 2GMTB 4WH6A 1AY6H 1DX5M 2XW9A 1GI5A 3SHCH 3LU9B 3KHVA 1GJ7B 3SJOA 4WMFA 4FUDA 1QRXA 4IGDA 1HAHH 1FY5A 3RXKA 1ZRKA 4YLQH 1MAXA 5EOKA 1UTOA 1QBVH 2BY8X 3U98H 3SV6A 3SJIA 2Z9LA 3PMBB 3K65B 1ZYOA 4U2WA 1QBOA 3RXCA 1F7ZA 4Q2KA 2RG3A 1ELEE 1P2JA 1TE0A 1S6HA 1RS0A 1O3JA 3NZIA 4AB9A 3GCNA 1HAVB 1QNJA 2J38A 1SLVB 3H5CB 1O2JA 5A0AE 1GBAA 1BBRE 1Z8JB 3O8DA 3VXFH 1IQIA 1DLKB 3TITA 2ZQ2A 2VB0A 2VGCC 3AVZA 3HKIB 1D3DB 1UCYE 3SQEE 4I8HA 2R0KA 4X6PA 2XWAA 1NZQH 1HIAB 1SGYE 4A5TS 2FOMB 4K8BA 1TQ0B 1ELFA 1L1JA 1RTFB 2C3SA 4Y6DA 1CT2E 4YLUA 3TJNA 4YZUA 3RXUA 2XCFA 1KLIH 4NIYA 4UDWH 4X1RU 2FDAA 4KTUA 1GHBF 1D3PB 1KXFA 2WUBA 1UO6A 5SGAE 1HJAB 1DY9A 3NCLA 3SBKA 3M3SA 1GBLA 2VJ1A 4AGKA 1PQ8A 1SG8B 3F9FA 1GBDA 4ABHA 3A8BA 1O2GH 2V3OH 1AQ7A 1GI0A 1CA8B 3RP2A 5GWZA 1NROH 1Z1IA 2G81E 2QIQA 2WV5A 2UUKB 2BX3A 1OKXA 5C3NA 5HM9A 1YPEH 5E0GA 1GJCB 2WPIS 2XRCA 1O3LA 6LPRA 4JMYA 1KXCA 1PYTC 4UD9H 2V3HH 1O35A 1A3BH 1O37A 2AFQB 2VVVA 2RA0A 1SQAA 1F5RA 1C1SA 1E37B 3KIDU 4BNRA 2Y5FA 2PGBB 6CHAC 1THSH 1A3EH 4K69A 1ZPCA 4K1SA 2BQ7B 2ZTZA 4YOGA 1C9PA 1DSTA 3BG8A 2AIPA 3R0FA 1GI4A 4YTAA 1YCPM 3LJJA 4LOYH 3SUGA 3P6ZB 1GJ4H 2OP9A 5F8ZA 1GHYH 1SGFG 2TPIZ 2F9OA 4AG1A 1A0JA 5FPYA 1BTYA 2R3UA 3UR9A 2ZDLA 1NS3A 3BG4C 4TYDA 1EAIA 3KQBA 1FQ3A 1WU1A 2BD9A 2XTTB 2P8OB 2F9BH 4BAQB 1MCTA 3S69A 2QY0B 3WY8A 3ZZ4A 5I46H 7LPRA 4Q7ZA 1Y3VA 1N8OC 4DURA 1O2PA 3UR6A 2FWWA 2J2UA 1C1VH 3GISB 4GUXA 1ZPBA 3AW1A 3L3TA 1CGIE 4Y71A 4R8TB 1DXPA 2GVFA 1B0FA 2ZC9H 1QJ1B 1SGNE 3ZVDA 1ABIH 3UREA 1C2EA 1HB0B 3V0XA 4ISNA 1JMOH 4OS6A 3MYWA 2VWOA 5AVDA 4AZ2B 3GY3A 3SUFA 1W7XH 3EDXB 4MNWA 3V13A 1A4WH 3MU4A 4GHQA 3UIRA 4MPXA 1XUKA 1LKBA 1UK3A 1FPCH 5JPMH 1JRTA 2R3YA 1TB6H 1G3BA 4MDSA 2FZZA 1K1JA 3TH3H 1O3OA 1DVAH 2CJIA 1C5TA 1V2JT 4DIIH 4CRDA 1IQKA 3PMAB 3RXGA 3QN7A 1UVSH 3BN9A 1GCTC 1O2UA 4U32A 4IMZA 2CV3A 2G51A 3Q00A 2BLQA 2ZHEH 4D9RA 2FLBH 4K1EA 2UWOA 1MTSA 1NN6A 4GVUA 3Q76A 1UTQA 5DP9A 1V2RT 2IPHA 1SGTA 4D9QA 1SQTA 5DP5A 1ELAA 2BY7X 1DXWA 3MOCA 1LHCH 2TIOA 3ZVAA 3TIUA 1TGSZ 4YO9A 2HNTC 1EAUA 1NFWA 2BLOA 3F68H 3LC5A 1HNEE 3RMMH 1C2LA 1E38B 1O0DH 2FXRA 4O03A 2ZKSA 2P95A 3DD2H 2VVUA 3LPRA 1D9IA 3STIA 1C2FA 2Q6DA 1GCDA 2QA9E 1TRMA 1S82A 4XSKU 2PKAA 1V2OT 2AGEX 5LGOA 1V6DA 3ZZCA 2FIRH 1BOQA 1QL9A 2ZDKA 3OSYA 1CE5A 4WF8A 1VITH 3UQOA 1ZHPA 2STBE 1M9UA 4TPYA 1NM6A 1GBKA 3M7UA 1BTUA 3TGIE 1T8LA 1BJUA 3T2NA 3RXEA 2YNBA 2P3UB 1W10U 2Y6TA 5T6FA 2OD3B 1EASA 2D8WA 3M5LA 2Q6FA 2B0FA 3P95A 3A83A 3PO1C 5GXPA 2F83A 1J17T 3KNXA 2VGCB 1S0QA 2FOFA 3IG6B 4GCHG 2BTCE 1AVWA 4NG9H 3SGQE 3H7TA 4X8SH 1TGTA 4WMEA 2A32A 1CBWB 4OGXA 1HAPH 3T28A 4FVDA 2H6MA 1QRZA 1VITF 2FEQH 4NIVA 4NA7A 1UTPA 2LNCA 3Q3YA 1NRNH 2F9VA 1PPBH 4FU8A 3TPIZ 4I8GA 2J94A 2C8WB 5JB9S 1UHBA 1LVYA 4E7RG 1GJDB 3SU5A 1O33A 2FYQA 2AMDA 4H42U 3ENSB 2ZHDA 4X6NA 1UTMA 2FOCA 4AGJA 3A7YA 4NIWA 2BXUH 1W0ZU 3AW0A 2NWNA 2BZ6H 1EP5A 2YNAA 1Z7KA 1TPOA 4ZROA 2GMTC 1MUEB 1OWIA 1CGHA 3HKJB 4MPWA 1L1NA 3K6ZA 1BBRH 4ASHA 2VNTA 1C1OA 5ESBA 5FCKA 2Y80A 4FUEA 1LTOA 3GY2A 4HFPB 5GCHF 2OLGA 4DIHH 1K2I1 2CF9H 1O3HA 3LH1A 5LPFA 2PKAB 1ZR0A 3TK5A 3LDXH 5DP8A 1B5GH 1TPAE 1EX3A 1D6WA 5DK1A 1SGIB 1OOKB 1V2ST 3SU0A 1P05A 1NY22 1P09A 3E1XB 1YCPK 4O97A 2C90B 1SBWA 1YLCA 2GZ9A 2CN0H 1P2OA 3TH4H 3ZYEA 2WV4A 1AIXH 2OXSA 3RXIA 1BCUH 3SI3H 3TJOA 4XE4A 4AG2A 1T7CA 5FPSA 1TIOA 1GI8B 2GZ7A 5GJ4B 1T8NA 1TPPA 4WXVA 3M3VA 1A61H 3LGWA 3O8RA 3E90B 5HXFA 4YT7H 4A1XA 1GHXH 3EGKH 3EA9A 4X8VH 3BV9B 1SGPE 3U8RH 4ABGA 2HNTE 3DHKH 2XCNA 1Z6EA 2SNWA 2ZCKP 2Z3CA 1GMHF 1IQEA 2BQ6B 1JIMA 1W14U 2XC4A 2VWNA 1SPJA 1N8OB 3GY6A 3RC6A 1ZJKA 2OC1A 2GV7A 2QXGA 1ZJDA 4BAKB 1HJAC 2GKVE 1MD7A 1P10A 4XDEA 2BLWA 3BTGE 1UVTH 1ESTA 3RM0H 1UK4A 1XKBC 3DFJA 2RA3A 3SGBE 2J4IA 1YF4A 4WMDA 3KN2A 1C5PA 3TVJB 1J16A 4B1TA 2OTVA 1BB0B 2F91A 4H6TA 1E0FD 3NK8A 3URCA 1RIWB 2BD3A 1T31A 2C8YB 2ZHWH 1A46H 5FBEA 2RCEA 4TPIZ 1RGQA 3VB7A 2G4TA 3U1JB 4HZHA 3BIUH 2G52A 5GPIB 2Z9IA 3QZQA 2XBYA 1ZHRA 2HOBA 2GT7A 1LMWB 1EJAA 9ESTA 2NU0E 2LPRA 1TMUH 1QCPA 4J1YA 3OX7U 4BXSA 1YLDA 1P02A 1C1PA 1LHEH 1V2PT 1S5SA 1O2MA 1S84A 2BDIA 2BOHB 1V2MT 4KTSA 4K8YA 1FN6A 3LKWA 3F6UH 5LPEA 3PB1E 1YP9A 3RXBA 2KAIA 3K2UA 2TGAA 3P8GA 3QK1A 3S9CA 4JYVH 4CRBA 2G8TA 3VGCB 2XC5A 2A31A 4OS7A 1EUFA 1G37A 1JBUH 5F8XA 2VH0A 3RMNH 4B75A 1AWHB 1OWHA 2ZECA 1XVMA 2GCTC 3TNTA 4KELA 4E06H 1TGCA 3L33A 3I78A 4E7NA 1ELBA 4B2BA 4BTTB 4WH8A 1C2JA 1K1OA 1GBCA 1GJ8B 2AS9A 3TNSA 2FOBA 1FUJA 5DPAA 4Y76A 1B7XB 1P06A 4MG3A 2EEKA 4K60A 3VB3A 1VR1H 5CHAB 1E36B 5C1UA 1AVGH 1O2WA 4MTBA 1D3QB 4B2CA 3LIWA 3BSQA 2BDYA 2XBXA 3GDSA 1SLXB 3DUXH 1GBIA 3M5MA 1L1GA 2A4QA 2SGPE 3STJA 2ZWLH 1YYY1 1SGCA 2BXTH 3EE0B 1BUIA 3F1SB 4H6SB 2H1UA 2WINI 1TNJA 1SGDE 2VIPA 2DUCA 1EZUC 5EPNA 4ZKOU 3E6PH 3B8JA 3SW2B 1WQSA 3PO1B 1EPTA 4FUJA 2OINA 1GBJA 2SGQE 5FX5A 4D8NA 3AASA 1PFXC 4K1TA 4LXBH 3C27B 7GCHG 4ESTE 1O36A 1P11E 4B74A 1C4U2 1L4ZA 1TABE 1O2NA 2AGGX 3BTHE 3P8NA 2A1DB 1QIXB 2C8XB 1ESBA 1BT7A 1O2LA 1VJAU 3IITA 2VU8E 3BEUA 1C5ZB 2WPKS 1NFYA 1EJMA 4PROA 1IHTH 1SFIA 1V2QT 5ESTE 2SFAA 2I6SA 1UCYK 3QZRA 1C5YB 4OS4A 3E3TA 3A7XA 3A7WA 2Z3EA 4X1NU 4X6MA 2A4GA 4XBDA 5F6MA 1ZTJA 2KAIB 1E35B 4FU7A 3EQ0H 4ABAA 5EODA 2EA3A 3PM3A 3RXJA 1LQEA 5DP6A 3QDZB 4I33A 1TX6A 1BTZA 4DJZB 5HYOA 1EAXA 3RXHA 5A0CA 4BAHB 3F9GA 2JH5D 1SOTA 3ZV9A 1P9UA 4NZLA 4YM9A 4JZDH 2BB4A 1V2KT 4AFZA 1HLTH 1MZAA 2Q6GA 1O3BA 2J34A 1QJ6B 2ANWA 4QT8C 3UPEA 1TALA 1LVBA 4CBOA 3SU1A 3EAJA 1DUAA 1W0YH 3F9EA 4IN2A 1J14A 4Q7YA 4IN1A 1ELTA 4OS2A 3RU4T 2BVSH 1OWEA 3ATMA 1SLWB 3M5NA 1O3FA 4WWYA 4ISOA 4ABBA 4IC6A 3URDA 1Z6JH 1TX7A 1BJVA 2ALVA 2XNIA 3ODDA 4RKOB 5JYIA 1O2VA 4CHAB 4AFQA 2BOKA 2XWBI 1O30A 1HRTH 4A7IB 2HGTH 2Z3DA 1K1NA 4JZ1A 3IWMA 4AN7A 2IOTA 3RXMA 1KLTA 1O39A 4Y7AA 2BY5X 1KXAA 1EPTB 1O31A 5E8EH 1UTNA 1CBWC 1K1IA 2PLXA 2Z9KA 4UFGH 3VB5A 1CO7E 2BY6X 1NT1A 1KDQA 4KP0A 1P2KA 3S9BA 1NO9H 4CRCA 3VXEH 3D49H 1LDTT 2FOGA 1SFQB 2JH6D 1P01A 2ZDVH 1JXPA 1WSSH 3QWCH 1P03A 3UOPA 2C93B 1UK2A 2A7HA 3QGJA 2BD8A 2GV6A 5CMXH 1S0RA 2W7SA 5EPYA 1XUGA 5JBTA 1T4VH 1V2LT 2A4OA 2GT8A 1P2NA 1DLEA 2YOLA 4X8UH 1RRKA 5TJXA 2VWLA 3SJKA 4BAOB 1QR3E 2PR3A 2ZEBA 2G00A 1TNHA 1LKAA 2Z6BD 5BPEA 4Z6AH 3DA9B 3HPTB 2A5KA 3O8CA 5K7RA 4ZKRU 5T6GA 4JK5A 4U30A 2BD5A 5FCRA 4AYYB 1PJPA 2JETC 3ZVBA 2SGAA 2H9EH 3P17H 4NZQA 3A85A 2FTMA 3BTTE 4FXGH 2AH4X 4DG4A 2A2QH 3P8FA 1U6QA 2GGVB 3RMLH 1X7AC 1MTUA 1NRRH 4JK6A 1HV7A 2GCTB 1GJ9B 3S0NA 3UNQA 4NIXA 3W95A 2Z9GA 1N6YA 1YPKH 5EQRA 7ESTE 1YPJH 2NU3E 2D1JA 4BTIB 1V2NT 2OC0A 1S83A 3PV4A 3PMHB 2B7DH 2VIOA 1B0EA 1PYTD 1SGQE 1VGCB 2ZDAH 2FOEA 3R3GB 2DE9A 1A1RA 2PKSB 4R0IA 1ZOMA 1YCPH 1IQJA 3RXDA 4GCHF 1O3EA 1YPHC 1OSSA 3A82A 1DWCH 4X1SU 1HUTH 1O2RA 1G3CA 4AYVB 4UFDH 1LO6A 5TCAA 4B2AA 1C1WH 3MNSA 1N1LA 1W2KH 1KDQB 4YESB 1C5OH 2QC2A 2VVCA 4BAMB 1IAUA 2BHGA 2ZDMA 1C5NH 1FZZA 2QXHA 4K3JA 5EQQA 1PQAA 4U01A 4AORA 1P9SA 1YBWA 1Q31A 2QGRA 3RU4D 2A0QB 2FX4A 1Y8TA 1AUTC 1RIWC 4TWYA 4CH2B 5AFZH 1PPHE 1E34B 5DKMA 1C9TA 1GHVH 4O3TA 1O3IA 3PWCA 1FN8A 2BM2A 2BLVA 4MQAA 1GHZA 1H8DH 5GDSH 4YOJA 2Y7ZA 5A8XA 2PWXA 2O8WA 1GHWH 3T27A 4INHA 3ZVGA 1FI8A 3U69H 3KCGH 1OPHB 3DT0H 2A5AA 2BD4A 1XM1A 1JRSA 1D4PB 2FLRH 3LC3A 3VGCC 2ODQA 1BIOA 1Y5UT 3A8AA 3MMGA 3TGKE 4MVNA 4TY6A 5C2ZA 2UUJB 1O5BB 3LOXA 1QQUA 2J9NA 5AFYH 1QFKH 1AKSA 1O5DH 4KTCA 1CQQA 2WPJS 1SGFA 2GCHG 3M7TA 1O5FH 3ZZ9A 1BMMH 1BTPA 2RDLA 4D7GA 3RXTA 1C1UH 2XYAA 2BX4A 1BRCE 1ZSKA 1EZXC 1TRYA 1CA0C 3SQHE 1ZZZA 1W7GH 3QTVH 5CHAC 3ZVFA 3RDZA 1W8BH 1ELDE 4ABEA 8GCHG 1YPLH 1QHRB 1CU1A 2BD2A 1LPGB 2WPHS 9LPRA 5JB8S 1GI3A 1S81A 2BDAA 2H5CA 4GPGA 5F03A 4FUBA 3HK3B 2ZFFH 3MFJA 3ELAH 8LPRA 1GJ5H 1QA0A 2V0BA 3T5FH 1EZSC 1XUIA 3A7TA 3O8BA 3GYLB 3RM2H 4X2XA 1NU7B 3MO3A 1QL7A 1UVOA 4MNVA 2ZPSA 1GWAA 3SZNA 3T25A 3ZZAA 1XKAC 1RD3B 4ISIH 1K1MA 1GI7B 1ANBA 2AMQA 2TGDA 4ISHH 1V2VT 1VCQA 1AD8H 1O38A 1FIWA 3E0NB 3SNEA 1ANCA 1MU8B 2ZTXA 1NRPH 1Y3WA 1VCPA 2TGPZ 2A7JA 2UUYA 1NRQH 4ABDA 4XBCA 3ITIA 2ZF0H 4ZH8A 1HAYB 2P59A 1EZQA 1A2CH 1FY4A 1TGBA 1GI9B 1GI6A 2P94A 1LCYA 1EP6A 3PLKA 1O2KA 1S85A 1N6XA 1THRH 2R2WU 2ZFRH 4E05H 5LPRA 3T62A 1G32B 1QA7A 1YPHE 3M7QA 1IQMA 1RJXB 2DE8A 3E16B 1EQ9A 3QO6A 3AAVA 3EA7A 4ZXXH 5LH8A 4DOQA 4CREA 4LZ1H 3KF2A 4HTCH 4OGYA 1V3XA 2ZGBH 1VJ9U 1AKSB 4INLA 2PW8H 5E0JA 4FUFA 1ETSH 1JWTA 2ZU3A 3A84A 1LVOA 1UCYH 2QXIA 3RXQA 4JYTA 4XOJA 4UFEH 5C1YA 3OTJE 3OYPA 3SU6A 1QURH 1Y5BT 4FUIA 1H8IH 3BTKE 2G5VA 2W7UA 4AB8A 2ZZUH 3CS0A 1GBMA 3U8TH 2JETB 1Q3XA 1FAXA 1MQ5A 4UONA 1TGNA 2R0LA 2ZCLP 1ARCA 3QTOH 2ZPQA 3RXAA 3NWUA 3RXFA 3W94A 1DS2E 1K22H 2W3IA 2W5EA 1GJAB 1QB9A 1C5RA 2VIQA 1TFXA 5PTPA 1TA2A 1KYNA 1KSNA 4I32A 2P3TB 4CHAC 3B23B 1LPKB 2SGFE 1FJSA 4FVBA 1WYKA 4JYUH 4I7YH 2J95A 1EJNA 1EOJA 1P2MA 2WYGA 1G9IE 8KME2 2CMYA 3ODFA 1G2MA 2O9QA 4Y8YA 1YC0A 1EPTC 1V2TT 1BTXA 1XVOA 1IQHA 2JH0D 3AAUA 1DWEH 3SV9A 1YPGH 4CR9A 3I77A 2F9PA 5DO4H 2Z94A 1HXFH 1O2YA 7GCHF 4B76A 1V2UT 1AHTH 2QF0A 1O5CB 2ZFQH 2Y81A 1HXEH 2D2DA 2O8UA 2VIDA 5EXNA 2W3KA 2H2ZA 1DY8A 3MU8A 1P2QA 2ZU5A 3PTBA 3LGVA 1Q2WA 3ZYDA 1F0UA 2O8MA 3RLYH 1GBBA 1MTVA 1QRWA 1VCWA 4YOIA 4GLYA 3RXLA 2R9PA 3ATWA 1KTTB 3RUOA 1AU8A 6GCHG 3RC5A 1UHBB 1BMLA 2QV1A 3M35A 1EXFA 1WUNH 2O8TA 1G30B 1AWFH 1GBFA 2HVXA 1XUHA 3A80A 4KGAA 1K9OE 1A7SA 3MWIU 1UTJA 1DM4B 4X2YA 2ZNKH 3GY5A 2ZP0H 2BZAA 5H4IB 2M5TA 4LZ4B 5FAHA 2I6QA 1GJBB 1O32A 3VB4A 1SGRE 2OC8A 3TJVA 5F8TA 2FESH 4XFQA 3ZZ8A 1G2LA 3I29A 1S6FA 1GDQA 5JBCS 2XBWA 3M36A 2PFEA 3K9XB 1GMCG 1SHHB 1C2GA 2OBOA 1HJ9A 3MHWU 2NU1E 1UJ1A 4X2WA 1P2IA 5A09A 1CHOG 3MH6A 2EI8A 4X1QU 1AZZA 2FO9A 4IS5A 3MU0A 3ATIA 3SU3A 4NGAH 5EXMA 4CRFA 1SR5C 3S7HB 1K21H 1MQ6A 1GDNA 1MH0A 1ZGVA 4LK4A 4F49A 3VFEA 1GPZA 2FI3E 8ESTE 1F0SA 1GGDC 1VGCC 1CA0B 4SGAE 1XX9A 1C5QA 1V2WT 4ZHLU 1SMFE 3FP7E 4ZUHA 2PKSC 1Y3UA 1NFXA 1KLJH 1H9LB 2B8OH 1BMAA 1LPZB 5FHTA 1LHDH 1IHSH 4B73A 1DSUA 1O3NA 5C67A 2GTBA 1CT0E 2XXLA 1SLUB 1DPOA 2AGIX 5JDUB 1PQ5A 2ZCHP 1L0ZA 3SI4H 1FONA 1DANH 1O3PB 3GDVA 1AGJA 5EQSA 1Z71A 4NA8A 3SUDA 1CT4E 5T6DA 1PPGE 2OCVB 1MKXK 1BQYA 4WXIA 1OWJA 1AB9B 3M3TA 1P04A 2A4RA 1ZMLA 1A5IA 1TPSA 1IQGA 3A81A 4B71A 1AFQB 2B9LA 2J92A 3UUZA 3BEIB 1DE7H 1ZTLA 2UUFB 1ABJH 4DW2U 3VEQB 1A0HB 2SGEE 3SNAA 4ZMAH 1GMDG 2ZG0H 4DT7B 1XUFA 1BRBE 5I25A 3MU1A 2FS9A 4AFSA 6ESTA 3D23A 1C2KA 4ABFA 1ANEA 1MCVA 4WVPE 1WCZA 1IOEA 3NPSA 3QX5H 5DP4A 5ETXA 2GP9B 3GICB 5HM2A 2ZQ1A 3HGNA 4ABJA 1G3EA 1OXGA 2FS8A 4CR5A 3MI4A 1MBQA 1C2MA 3SJ9A 2PSXA 3FP8E 1TBZH 1ZMNA 1BDAA 1NC6A 2ZGJA 3SO3A 2H5DA 1FIZA 3OY6U 1KIGH 5E2OA 1CVWH 1JIRA 1H9HE 1O3MA 1O2SA 1WBGB 1HJ8A 1ZPZA 2PUXB 3GCTG 5FX6A 1AI8H 1YPMH 1MAYA 3UTUH 2PHBA 3SORA 2BYAX 3BF6H 1UVPA 2A2XH 4JZFH 3ESTA 2VIWA 1AE5A 4Y10E 1ETRH 1HAIH 1ZHMA 3LT3A 1OWKA 4Y79A 5C1XA 2HPQH 1O5GH 1KXEA 2Q1JA 4ZHMU 1Z8IB 3TK6A 2QN5T 1ETTH 1P57B 1TQ7B 1IQNA 2EC9H 3MH5A 3M37A 1BZXE 4ZHAA 4A1TA 3U8OH 2PGQB 2VIVA 3LJOA 2AYWA 7KMEH 5L6NH 3GOVB 1WOFA 1P3EA 5C20A 3PWBA 1EKBB 4AX9H 4ISLA 1LVMA 1QJ7B 1C2IA 2ZU1A 1INCA 1C5VA 1ARBA 1FNIA 2VH6A 1C5XB 2FOAA 5K0HA 1WTGH 2ZFTA 1W13U 1VZQH 1MKWK 2ZDNA 5BRRE 4GHTA 1GBTA 1BHXF 1EAWA 1G3DA 2Y5HA 2SNVA 2STAE 2ZO3H 3KQEA 4A6LA 1L4DA 1C4Y2 3F9HA 4KKDA 3NKKA 1TAWA 1QL8A 5FPTA 4VGCC 2FI4E 1ANDA 1TOMH 1RTKA 5IYTA 5FXLA 1A5HA 1MTWA 1C5UA 3HK6B 4OS1A 2GDDA 3GY8A 1CGJE 3SV7A 5A0BA 1GHAG 1MZDA 3NUMA 3UFAA 4X6OA 1GG6C 3TU7H 2OUAA 3SJ8A 2PV9B 3ZZ7A 3BEFB 1FY3A 1IQFA 2TRMA 2GCHF 3A8DA 4UEHH 3TK9A 4Y7BA 1TNIA 4K5ZA 1P8VC 4ZAEA 3BTWE 1HDTH 1SOZA 1TRNA 5EW1H 4Y0ZE 4BOHA 1O2QA 2NU4E 3FZDA 3MNXA 1TWXB 1QB1A 2ESTE 1BTWA 1WV7H 8GCHF 5CE1A 1FMGA 1QQ4A 4WY3A 2P3FH 2P93A 4I31A 1F0TA 2VWMA 4NWLA 1KY9A 2QXJA 3H7OA 4Q80A 2CXVA 3VPKA 1F5LA 1SB1H 3OU0A 2CHAB 3FZZA 1RXPA 3OY5U 1ACBE 2FM2A 3TH2H 1C1MA 1NPMA 2O8LA 3LGYA 4IW4E 3SGAE 2PTCE 2BVRH 3RLWH 3SNBA 3BTFE 1GGDB 1A0LA 1J15A 4CRGA 1BRUP 3SU4A 4Y8XA 3FAOA 3VB6A 4AOQA 1UTLM 3UWIA 5G4BA 2ZU2A 2R2MB 3GCOA 2HNTF 2W26A 3GCHB 2H9TH 1TA6A 2QYIA 3LGUA 4M7GA 1GL1A 1QY6A 1OX1A 1OP8A 4DY7B 5EXLA 1K1LA 2ZGCA 4MPUA 5B6OA 2BY9X 4H4FA 1JOUB 2WUCA 4RSPA 5ABWA 1O3DA 3BTEE 3QGNB 4BXWA 3MH4A 2ZFPH 3RXVA 1NU9A 1O5AB 1TNLA 3K6YA 1LHGH 3PLPA 5L30H 4O9VA 2A45B 1BMNH 1OYTH 2BDBA 2OBQA 2IN2A 4HGCA 1DDJA 5GIBA 1C2HA 1O2OA 1EB1H 2ANYA 4I8KA 1MTNB 4Y0YE 1PQ7A 3ZZDA 1W12U 4O3UA 1GJ6A 1TLDA 1F2SE 1H4WA 3P8OA 4BANB 2ZFSA 1QTFA 1EB2A 1O5EH 1P12E 3SV8A 3UY9A 2IJOB 4MNXA 1GHBG 3L6PA 5HGGA 1K1PA 1YM0A 1WAYB 2QF3A 2WPMS 1Y3YA 3RXOA 2CGAA 2C8ZB 5T3HA 2ZGXH 1C1TA 2F9NA 2QCYA 2SGDE 3SUEA 1GL0E 3N7OA 5E0HA 1ESAA 4MLFB 3UNRA 3FP6E 2G55A 4YT6H 3A7ZA 1O3KA 1H1BA 1W3CA 2ULLA 4DGJA 1PPCE 1GI1A 1ZGIA 2ALPA 1SHYA 3TLOA 4Q7XA 1KTSB 1SQOA 3UNSA 2FODA 5C5OA 1C5SA 1PPFE 1GDUA 2VINA 3MO9A 1UMAH 2ILNA 1DFPA 3FFGA 1L2EA 1NRSH 4NFEA 1ORFA 2BQWB 1WTHD 3TGJE 3V7TA 1H9IE 3ZZ3A 3RXRA 1J8AA 1AO5A 1TBRH 1TMBH 2THFB 3GDUA 4D7FA 5E2PA 3LONA 2FYRA 2HPPH 4OS5A 1ELGA 1GVZA 4TY7A 2ZHFH 3TJUA 1AB9C 3UQVA 1T32A 2OQUA 1FDPA 2EI6A 3MTYA 2Y5GA 1HYLA 2FPZA 3NXPA 2V6NA 6GCHF 5L2YH 1AFQC 4SGBE 3SNDA 4FUGA 1ELCA 5JBAS 1KXBA 1AMHA 3CP7A 1TX8A 2OQ5A 1BRAA 2GDEH 1MBMA 1TBQH 1FY8E 3DFLA 4DCDA 3V3MA 2QAAA 1Y59T 3E0PB 2ZPRA 1MKXH 2B5TB 3PTNA 1AUJA 4VGCB 2AERH 2PTNA 3RU4E 1TOCB 1Y3XA 3KEEA 1GMCF 3A86A 3HGPA 1GVLA 1UTKA 4ZKSU 3A88A 1F92A 2ASUB 3S9AA 5EU8A 4NFFA 1CHOF 1ELVA 2ANKH 3KL6A 3U9AH 1GG6B 1MMJN 1J9CH 1RFNA 1HFDA 3HATH 2H9HA 4X1PU 2WPLS 2ZGHA 1HPGA 4NWKA 4NSVA 3GY4A 1QGFA 5DJ7A 2FI5E 1C1NA 1ZMJA 4INKA 3G01A 3A8CA 4CBNA 1P0SH 1C1QA 1C5MD 1HAZB 1TYNA 2UWLA 3Q77A 5EGMA 2HALA 3ZZ6A 4F4OC 2OC7A 1T8OA 1SGEE 2ZHQH 1O2TA 2BMGB 3BTME 5DP7A 4X8TH 3B9FH 1BTHH 1DUEA 1G36A 5DG6A 2XBVA 6CHAB 4X0WU 1TMTH 1FXYA 2BVXH 3JZ2B 5DP3A 1ZRBA 1MU6B 1Z8RA 1PPZA 3D62A 1FPHH 4FUCA 2EI7A 4ZKNU 1T8MA 5FBIA 1FY1A 1OP0A 1BA8B
chains in the Genus database with same CATH superfamily
2GZ8A 2XC0A 1BHXB 4MPVA 2K1QA 3GS9A 2ZU4A 1Z1JA 1D6RA 3DSPA 3M61U 3P92A 3S7KB 5A8YA 2BD7A 4UE7H 4CH8B 1UVUH 3MNCA 3SN8A 1ID5H 1OYQA 1QB6A 5B6LA 3ZZBA 1F0RA 4Y8ZA 1C5WB 1GMDF 3E91A 4RN6A 3RXPA 1OWDA 4A1VA 5AHGH 3BG4B 1GBEA 2FMJA 3QLPH 3T26A 1P3CA 1ZSLA 1IQLA 2WYJA 3SHAH 1NTPA 3RMOH 3QUMP 4JCNA 1EOLA 2FOHA 1MKWH 3PYHA 3UWJH 3LH3A 5A8ZA 3ATLA 1DITH 1HGTH 3BTDE 1NESE 1DT2A 2Z9JA 5DGJA 3RXSA 3PLBA 4JZEH 5EW2H 2ODYB 3GCTF 4I8JA 5L2ZH 4IC5A 4THNH 3T29A 1AVXA 5J4QA 4ABIA 2AIQA 3ZZ5A 1XXFA 4Y11E 1SI5H 1ZLRA 3ZV8A 1VITG 4DVAU 3N7DA 1SSXA 2ZI2H 3SU2A 1C1RA 2BDHA 1ZTKA 1A5GH 2UWPA 3BTQE 3ZVEA 1GI2A 1HAXB 1AZ8A 4NA9H 4HI3A 2FTLE 3V12A 1HBTH 1FLEE 3D65E 1HAOH 1PPEE 3FN8A 2AEIH 1GCTB 4FU9A 5HMAA 2BDCA 4XBBA 1NFUA 5AF9H 2CHAC 2PUQH 1EATA 4AFUA 2F9UA 2G5NA 1AN1E 3PROA 4UFFH 3EA8A 4Z0KA 3A89A 4HG6A 2CF8H 1DWBH 1KXDA 1TONA 1AE8H 2Z7FE 3PMJA 2V35A 2FP7B 2HRVA 5GCHG 1LHFH 3SOSA 4WJG2 1FV9A 4GAWA 3GCHC 1LQDB 3KQCA 3Q3XA 3P70B 1K28D 4RKJB 3SV2H 5C5NA 5JBBS 1YLNA 2W6JD 3MU5A 4X2VA 1ZSJA 5C0UA 2ZA5A 1XXDA 4GSOA 2C4FH 5J4SA 4BTUB 1D3TB 3GYMA 1O2HA 4JZIA 3LGTA 3M5OA 1DWDH 2Y7XA 5GNDA 3MH7A 2P8OC 4D76A 4FUHA 2ANMH 2KFWA 5EG4A 1O3AA 1C5LH 1YKTA 1TNKA 2GX4A 3KQDA 1C4V2 3LGIA 1HAVA 2RFKC 2D26C 2Y82A 1O34A 3U1IB 2TGTA 3SNCA 4A92A 1GHAF 1TNGA 1O2IA 2AMPA 2A5IA 1AFEH 1Z8GA 1SVPA 4IBLH 3RC4A 1MTNC 1O3CA 1QBNA 4ZXYH 1W11U 2FX6A 2JKHA 3A7VA 3ATKA 4J2YB 1O2ZA 1CHGA 1HIAA 1OP2A 1XUJA 1YGCH 1GMHG 1O3GA 3A87A 2PSYA 2ZIQH 2XOKD 3FANA 3BIVH 1OS8A 4NCYA 2HWLB 2TBSA 1F5KU 3CS7A 1XMNB 2ODPA 2A7CA 2GD4B 2F3CE 1WQVH 1C2DA 1O2XA 1THPB 3Q3KA 3C1KA 1BBRK 3CENA 1HCGA 3FVFB 3ZVCA 4TT3D 3KGPA 4CRAA 1Y5AT 1DOJA 1GBHA 2ZTYA 5A2MH 3MNBA 2KCOA 4I8LA 5TCCA 1BITA 1T4UH 4TWWA 1SC8U 1CSOE 1RTLA 1GVKB 2BDGA 2HLCA 5DSFA 1HAGE 3EYDA 2K8IA 3UOUA 4RI0A 2G4UA 3JZ1B 1FAKH 3GY7A 4MNYA 2NU2E 1MD8A 3E8LA 4K2YA 3MO6A 1SL3A 2P16A 2V3MA 4NSYA 1DICA 4IMQA 5IDKA 2GMTB 4WH6A 1AY6H 1DX5M 2XW9A 1GI5A 3SHCH 3LU9B 3KHVA 1GJ7B 4P00A 3SJOA 4WMFA 4FUDA 1QRXA 4IGDA 1HAHH 1FY5A 3RXKA 1ZRKA 4YLQH 1MAXA 5EOKA 1UTOA 1QBVH 2BY8X 3U98H 3SV6A 1COWD 3SJIA 2Z9LA 3PMBB 3K65B 1ZYOA 4U2WA 1QBOA 3RXCA 1F7ZA 4Q2KA 2RG3A 1ELEE 1P2JA 1TE0A 1S6HA 1RS0A 1O3JA 3NZIA 4AB9A 3GCNA 1HAVB 1QNJA 2J38A 1SLVB 3H5CB 1O2JA 5A0AE 1GBAA 1BBRE 1Z8JB 3O8DA 3VXFH 4YXWD 1IQIA 1DLKB 3TITA 2ZQ2A 3PRBA 2EY4C 2VB0A 2VGCC 3AVZA 3HKIB 1D3DB 1UCYE 3SQEE 4I8HA 2R0KA 4X6PA 2XWAA 1NZQH 1HIAB 1SGYE 4A5TS 2FOMB 4K8BA 1TQ0B 1ELFA 1L1JA 1RTFB 2C3SA 4Y6DA 1CT2E 3N99A 4YLUA 3TJNA 4YZUA 2JDID 3RXUA 2XCFA 1KLIH 4NIYA 4UDWH 4X1RU 2FDAA 2YMSD 4KTUA 1GHBF 1D3PB 1KXFA 2WUBA 1UO6A 5SGAE 1HJAB 1DY9A 3NCLA 3SBKA 3M3SA 1GBLA 2VJ1A 4AGKA 1PQ8A 1SG8B 3F9FA 1GBDA 2W6ID 4ABHA 3A8BA 1O2GH 2V3OH 1AQ7A 1GI0A 1CA8B 3RP2A 5GWZA 1NROH 1Z1IA 2G81E 2QIQA 2WV5A 2UUKB 2BX3A 1OKXA 5C3NA 5HM9A 1YPEH 5E0GA 1GJCB 4ACBA 2WPIS 2XRCA 1O3LA 6LPRA 4JMYA 1KXCA 1PYTC 4UD9H 2V3HH 1O35A 1A3BH 1O37A 2AFQB 2VVVA 2RA0A 1SQAA 3U28C 1F5RA 1C1SA 2KCYA 1E37B 3KIDU 4BNRA 2Y5FA 2PGBB 6CHAC 1THSH 2PP6A 1A3EH 4K69A 1ZPCA 4K1SA 1YWUA 2BQ7B 2ZTZA 4YOGA 1C9PA 1DSTA 3BG8A 2AIPA 3R0FA 1GI4A 1NBME 4YTAA 1YCPM 3LJJA 4LOYH 3SUGA 3P6ZB 1GJ4H 2OP9A 5F8ZA 1GHYH 1SGFG 2L6OA 2TPIZ 2F9OA 3UAIC 4AG1A 1A0JA 5FPYA 3AK5A 1BTYA 2R3UA 3UR9A 2ZDLA 1NS3A 2QF4A 3BG4C 4TYDA 1EAIA 3KQBA 1FQ3A 1WU1A 2BD9A 2XTTB 2P8OB 2F9BH 4BAQB 1MCTA 3S69A 2QY0B 3WY8A 3ZZ4A 5I46H 7LPRA 4Q7ZA 4Z1MD 1QZ8A 1Y3VA 1N8OC 4DURA 1O2PA 3UR6A 2K0QA 2FWWA 2J2UA 1C1VH 3GISB 4GUXA 1ZPBA 3AW1A 3L3TA 1CGIE 4Y71A 4R8TB 1DXPA 2GVFA 1B0FA 2ZC9H 1QJ1B 1SGNE 3ZVDA 1ABIH 3UREA 1C2EA 1HB0B 3V0XA 4ISNA 1JMOH 4OS6A 3MYWA 2VWOA 5AVDA 4AZ2B 3GY3A 3SUFA 1W7XH 3EDXB 4MNWA 3V13A 1A4WH 3OEED 3MU4A 4GHQA 3UIRA 2JIZD 1XUKA 4MPXA 1LKBA 1UK3A 1FPCH 5JPMH 1JRTA 2R3YA 1TB6H 1G3BA 4MDSA 2FZZA 1K1JA 3TH3H 1O3OA 1DVAH 2CJIA 1C5TA 1V2JT 4DIIH 4CRDA 1IQKA 3PMAB 3RXGA 3QN7A 1UVSH 3BN9A 1GCTC 1O2UA 4U32A 4IMZA 2CV3A 2G51A 3Q00A 2BLQA 2ZHEH 4D9RA 2FLBH 4K1EA 2UWOA 1MTSA 1NN6A 4GVUA 3Q76A 1UTQA 3VG8A 1V2RT 5DP9A 2IPHA 1SGTA 4D9QA 1SQTA 5DP5A 1ELAA 2BY7X 3WW7A 1DXWA 3MOCA 1LHCH 2TIOA 3ZVAA 3TIUA 1TGSZ 4YO9A 2HNTC 1EAUA 1NFWA 2BLOA 3F68H 3LC5A 1HNEE 3RMMH 1C2LA 1E38B 1O0DH 2FXRA 4O03A 2ZKSA 2P95A 3DD2H 2VVUA 3LPRA 1D9IA 3STIA 1C2FA 2Q6DA 1GCDA 2QA9E 1TRMA 1S82A 4XSKU 2PKAA 1V2OT 2AGEX 5LGOA 1V6DA 3ZZCA 2FIRH 1BOQA 1QL9A 2ZDKA 3OSYA 1CE5A 4WF8A 1VITH 3UQOA 1ZHPA 2STBE 1M9UA 4TPYA 1NM6A 1GBKA 3M7UA 1BTUA 3TGIE 1T8LA 1BJUA 3T2NA 3RXEA 1H8HD 2YNBA 2P3UB 3NRLA 1W10U 2Y6TA 5T6FA 2OD3B 1EASA 2D8WA 3M5LA 2Q6FA 2B0FA 2YMSB 3P95A 3A83A 3PO1C 5GXPA 2F83A 1J17T 3KNXA 2VGCB 1S0QA 2FOFA 3IG6B 4GCHG 2BTCE 1AVWA 1WDIA 4NG9H 3SGQE 1K0HA 3H7TA 4X8SH 1TGTA 4WMEA 2J98B 2A32A 1CBWB 4OGXA 1HAPH 3T28A 4FVDA 2H6MA 1QRZA 1VITF 2FEQH 4NIVA 4NA7A 1UTPA 2LNCA 3Q3YA 1NRNH 2F9VA 1E1QD 1PPBH 4FU8A 3TPIZ 4I8GA 2J94A 2C8WB 5JB9S 3FOAA 1UHBA 1LVYA 4E7RG 1GJDB 1E79D 3SU5A 1O33A 2FYQA 2AMDA 4H42U 3ENSB 2ZHDA 4X6NA 1UTMA 2FOCA 4AGJA 3A7YA 4NIWA 2BXUH 1S6LA 1W0ZU 3AW0A 2NWNA 2BZ6H 1EP5A 2YNAA 1Z7KA 1TPOA 4ZROA 2GMTC 1MUEB 1OWIA 1CGHA 3CNRA 3HKJB 4MPWA 1L1NA 3K6ZA 1BBRH 5KECA 4ASHA 2VNTA 1C1OA 5ESBA 5FCKA 1EFRD 2Y80A 4FUEA 1LTOA 3GY2A 4HFPB 5GCHF 2OLGA 4DIHH 1K2I1 2CF9H 1O3HA 3LH1A 5LPFA 2PKAB 1ZR0A 2WZQA 3TK5A 3LDXH 3WWFA 5DP8A 1B5GH 1TPAE 1EX3A 1D6WA 5DK1A 1H8ED 1SGIB 1OOKB 1V2ST 3SU0A 1P05A 1NY22 1P09A 3E1XB 1YCPK 4O97A 2C90B 1SBWA 1YLCA 2GZ9A 2CN0H 1P2OA 3TH4H 3ZYEA 2WV4A 1AIXH 2OXSA 3RXIA 1BCUH 3SI3H 3TJOA 4XE4A 1E1RD 4AG2A 1T7CA 5FPSA 1TIOA 1GI8B 2GZ7A 5GJ4B 1T8NA 1TPPA 5CDFE 4WXVA 3M3VA 3SYJA 1A61H 3LGWA 2IJD1 3O8RA 3E90B 5HXFA 2KX4A 2KM0A 4YT7H 4A1XA 1GHXH 3EGKH 3EA9A 4X8VH 3BV9B 1SGPE 3U8RH 4ABGA 2HNTE 3DHKH 2XCNA 1Z6EA 2SNWA 2ZCKP 2Z3CA 1GMHF 1IQEA 3F2FA 2BQ6B 1JIMA 1W14U 2XC4A 2VWNA 1SPJA 1N8OB 3GY6A 3RC6A 1ZJKA 2OC1A 2GV7A 2QXGA 1ZJDA 4BAKB 1HJAC 5EJZA 2GKVE 1MD7A 1P10A 4XDEA 2BLWA 3BTGE 1UVTH 1ESTA 3RM0H 1UK4A 1XKBC 3DFJA 2RA3A 3SGBE 2J4IA 1YF4A 4WMDA 3KN2A 1C5PA 3TVJB 1J16A 4B1TA 2OTVA 1BB0B 2F91A 4H6TA 1E0FD 3NK8A 3URCA 1RIWB 2BD3A 1T31A 2C8YB 2ZHWH 1A46H 1OHHD 5FBEA 2RCEA 4TPIZ 1RGQA 3VB7A 2G4TA 3U1JB 4HZHA 3BIUH 2G52A 5GPIB 2Z9IA 3QZQA 2XBYA 1ZHRA 2HOBA 2GT7A 1LMWB 1EJAA 9ESTA 2NU0E 2LPRA 1TMUH 1QCPA 4J1YA 3OX7U 4BXSA 1YLDA 1P02A 1C1PA 1LHEH 1V2PT 1S5SA 1O2MA 1S84A 2BDIA 2BOHB 1V2MT 4KTSA 4K8YA 1FN6A 3LKWA 3F6UH 5LPEA 3PB1E 1YP9A 3RXBA 5IK2D 2KAIA 3K2UA 2TGAA 3P8GA 3QK1A 3S9CA 4JYVH 4CRBA 2G8TA 3VGCB 2XC5A 2A31A 4OS7A 1EUFA 1G37A 1JBUH 5F8XA 2VH0A 3RMNH 4B75A 1AWHB 1OWHA 2ZECA 1XVMA 2GCTC 3FKSD 3TNTA 4KELA 4E06H 1TGCA 3L33A 3I78A 4E7NA 1ELBA 4B2BA 4BTTB 4WH8A 1C2JA 1K1OA 1GBCA 1GJ8B 2AS9A 3TNSA 2FOBA 1FUJA 5DPAA 4Y76A 1B7XB 1P06A 4MG3A 2EEKA 4K60A 3VB3A 1VR1H 3KQ5A 5C94A 5CHAB 4F55A 1E36B 5C1UA 1AVGH 1O2WA 4MTBA 1D3QB 2KZ4A 4B2CA 3LIWA 3BSQA 2BDYA 2XBXA 2VBCA 3GDSA 1SLXB 3DUXH 1GBIA 3M5MA 1L1GA 2A4QA 2SGPE 3STJA 2ZWLH 1YYY1 1SGCA 2LELA 2BXTH 3EE0B 1BUIA 3F1SB 4H6SB 2H1UA 2WINI 1TNJA 1SGDE 2VIPA 2DUCA 1EZUC 5EPNA 4ZKOU 3E6PH 3B8JA 3SW2B 1WQSA 3PO1B 1EPTA 4FUJA 2OINA 1GBJA 2SGQE 5FX5A 5KGOA 4D8NA 3AASA 1PFXC 4K1TA 4LXBH 3C27B 7GCHG 2KR7A 4ESTE 1O36A 1P11E 4B74A 1C4U2 1L4ZA 1TABE 1O2NA 2AGGX 3BTHE 3P8NA 2A1DB 1QIXB 2C8XB 1ESBA 1BT7A 1O2LA 1VJAU 3IITA 2VU8E 3BEUA 1C5ZB 2WPKS 1NFYA 1EJMA 4PROA 1IHTH 1SFIA 1V2QT 5ESTE 2SFAA 2I6SA 1UCYK 3QZRA 1C5YB 4OS4A 3E3TA 3A7XA 3A7WA 5FL7D 3F2HA 2Z3EA 4X1NU 4X6MA 2A4GA 4XBDA 5F6MA 1ZTJA 2KAIB 1E35B 4FU7A 3EQ0H 4ABAA 5EODA 2EA3A 3PM3A 3RXJA 1LQEA 5DP6A 3QDZB 4I33A 1TX6A 1BTZA 4DJZB 5HYOA 1EAXA 3RXHA 5A0CA 4BAHB 3F9GA 2JH5D 1SOTA 3ZV9A 1P9UA 4NZLA 4YM9A 4JZDH 2BB4A 5HIYA 1V2KT 4AFZA 1HLTH 1MZAA 1YY3A 2Q6GA 1O3BA 2J34A 1QJ6B 2ANWA 4QT8C 3UPEA 1TALA 1LVBA 4CBOA 3SU1A 3EAJA 1DUAA 1W0YH 3F9EA 4IN2A 1J14A 2V7QD 4Q7YA 4IN1A 1ELTA 4OS2A 1UW7A 3RU4T 3OE7D 2BVSH 1OWEA 3ATMA 1SLWB 3M5NA 1O3FA 4WWYA 4ISOA 4ABBA 4IC6A 3URDA 1Z6JH 4AC9A 1TX7A 1BJVA 2ALVA 2XNIA 3ODDA 4RKOB 5JYIA 1O2VA 4CHAB 4AFQA 2BOKA 2XWBI 1O30A 5HIZA 1HRTH 2YMSC 4A7IB 2HGTH 5C17A 2Z3DA 1K1NA 4JZ1A 3IWMA 4AN7A 2IOTA 3RXMA 1KLTA 1O39A 4Y7AA 2BY5X 1KXAA 1EPTB 1O31A 5E8EH 1UTNA 1CBWC 1K1IA 2PLXA 2Z9KA 4UFGH 3VB5A 1CO7E 2BY6X 1NT1A 1KDQA 4KP0A 1P2KA 3S9BA 1NO9H 4CRCA 3VXEH 3D49H 1LDTT 2FOGA 1SFQB 2JH6D 1P01A 2ZDVH 1JXPA 1WSSH 4DT4A 3QWCH 1P03A 3UOPA 2C93B 1UK2A 2A7HA 3QGJA 2BD8A 2GV6A 5CHBA 5CMXH 1S0RA 2W7SA 5EPYA 1XUGA 5JBTA 1T4VH 1V2LT 2A4OA 2GT8A 1P2NA 1DLEA 2YOLA 4X8UH 1RRKA 5TJXA 2VWLA 3SJKA 4BAOB 1QR3E 2PR3A 4P02A 2ZEBA 2G00A 1TNHA 1LKAA 2Z6BD 5BPEA 4Z6AH 3DA9B 3HPTB 2A5KA 3O8CA 3PV5A 5K7RA 4ZKRU 5T6GA 4JK5A 4U30A 2BD5A 5FCRA 4AYYB 2WPDD 1PJPA 2JETC 3ZVBA 2SGAA 2H9EH 3P17H 4NZQA 3A85A 2FTMA 3BTTE 4FXGH 2AH4X 4DG4A 2A2QH 3P8FA 1U6QA 2GGVB 3RMLH 1X7AC 1MTUA 2J97A 1NRRH 4JK6A 1HV7A 2GCTB 1GJ9B 3S0NA 3UNQA 4NIXA 3W95A 2Z9GA 1N6YA 1YPKH 5EQRA 7ESTE 1YPJH 2NU3E 2D1JA 4BTIB 1V2NT 2OC0A 1S83A 3PV4A 3PMHB 2B7DH 2VIOA 1B0EA 1PYTD 1SGQE 1VGCB 2ZDAH 2FOEA 3R3GB 2DE9A 1A1RA 2PKSB 4R0IA 1ZOMA 1YCPH 1IQJA 3RXDA 4GCHF 1O3EA 1YPHC 1OSSA 3A82A 1DWCH 4X1SU 1HUTH 3UB0A 1O2RA 1G3CA 4AYVB 4UFDH 1LO6A 5TCAA 4B2AA 4M9FA 1C1WH 1KMHB 3MNSA 1N1LA 1W2KH 1KDQB 3PRDA 4YESB 1C5OH 2QC2A 5DN6D 2VVCA 4BAMB 1IAUA 2BHGA 2ZDMA 1C5NH 1FZZA 2QXHA 4K3JA 5EQQA 1PQAA 4U01A 4AORA 1P9SA 1YBWA 1Q31A 2QGRA 3RU4D 2A0QB 2GJGA 2FX4A 1Y8TA 1AUTC 1RIWC 4TWYA 4CH2B 5AFZH 1PPHE 1E34B 5DKMA 1C9TA 1GHVH 4O3TA 1O3IA 3PWCA 1FN8A 2BM2A 2BLVA 4MQAA 1GHZA 1H8DH 5GDSH 4YOJA 2Y7ZA 5A8XA 2PWXA 2O8WA 1GHWH 3T27A 4INHA 3ZVGA 1FI8A 3U69H 3KCGH 1OPHB 3DT0H 2A5AA 2BD4A 1XM1A 1JRSA 1D4PB 2FLRH 3LC3A 3VGCC 2ODQA 1BIOA 1Y5UT 3A8AA 3MMGA 3TGKE 4MVNA 4TY6A 5C2ZA 2UUJB 1O5BB 3LOXA 1QQUA 2J9NA 5AFYH 1QFKH 1AKSA 1O5DH 4KTCA 1CQQA 2WPJS 1SGFA 2GCHG 3M7TA 3OFND 1O5FH 3ZZ9A 1BMMH 3WWBA 1BTPA 2RDLA 4D7GA 3RXTA 1C1UH 2XYAA 2BX4A 1BRCE 1ZSKA 1EZXC 1TRYA 1CA0C 3SQHE 1ZZZA 1W7GH 3QTVH 5CHAC 3ZVFA 3RDZA 1W8BH 1ELDE 4ABEA 8GCHG 1YPLH 1QHRB 1CU1A 2BD2A 1LPGB 2WPHS 9LPRA 5JB8S 1GI3A 1S81A 2BDAA 2H5CA 4GPGA 5F03A 4FUBA 3HK3B 3PV2A 2ZFFH 3MFJA 3ELAH 2J5UA 1W0KD 2JJ1D 8LPRA 1GJ5H 1QA0A 2V0BA 2QF5A 3T5FH 1EZSC 1XUIA 3A7TA 3O8BA 3GYLB 3RM2H 4X2XA 1NU7B 3MO3A 1QL7A 1UVOA 4MNVA 2ZPSA 1GWAA 3SZNA 3T25A 2QE7D 3ZZAA 1XKAC 3W1EA 1RD3B 4ISIH 1K1MA 5KEDA 1GI7B 1ANBA 2AMQA 2TGDA 4ISHH 1V2VT 1VCQA 1AD8H 1O38A 1FIWA 3E0NB 3EE7A 3SNEA 1ANCA 5HKKD 1MU8B 2ZTXA 1NRPH 1Y3WA 1VCPA 2TGPZ 2A7JA 2UUYA 1NRQH 4ABDA 4XBCA 3ITIA 2ZF0H 4ZH8A 1HAYB 2P59A 1EZQA 1A2CH 1FY4A 1TGBA 1GI9B 1GI6A 2P94A 1LCYA 1EP6A 3PLKA 1O2KA 1S85A 1N6XA 1THRH 2R2WU 2ZFRH 4E05H 5LPRA 3T62A 1G32B 1QA7A 1YPHE 2L74A 3M7QA 1IQMA 1RJXB 2DE8A 3E16B 2JJ2D 1EQ9A 3QO6A 3AAVA 3EA7A 4ZXXH 5LH8A 4DOQA 4CREA 4LZ1H 3KF2A 4HTCH 4OGYA 1V3XA 2ZGBH 1VJ9U 1AKSB 4INLA 2PW8H 5E0JA 4FUFA 1ETSH 1JWTA 2ZU3A 2M2AA 3A84A 1LVOA 1UCYH 2QXIA 3RXQA 4JYTA 4XOJA 4UFEH 5C1YA 3OTJE 3OYPA 3DCLA 3SU6A 1QURH 1Y5BT 4FUIA 1H8IH 3BTKE 2G5VA 2W7UA 4AB8A 2ZZUH 3CS0A 1GBMA 3U8TH 2JETB 1Q3XA 1FAXA 1MQ5A 4UONA 1TGNA 2R0LA 2ZCLP 1ARCA 3QTOH 1VKYA 2ZPQA 3RXAA 3NWUA 3RXFA 1FX0B 3W94A 1DS2E 1K22H 2W3IA 2W5EA 1GJAB 1QB9A 1C5RA 2VIQA 1TFXA 5PTPA 1TA2A 1KYNA 1KSNA 4I32A 2P3TB 5EJLA 4CHAC 3B23B 1LPKB 2SGFE 1FJSA 4FVBA 1WYKA 4JYUH 4I7YH 2J95A 1EJNA 1EOJA 3MQKC 1P2MA 2WYGA 1G9IE 8KME2 2CMYA 3ODFA 1G2MA 2O9QA 4Y8YA 1YC0A 1EPTC 1V2TT 4FETA 1BTXA 1XVOA 1IQHA 2JH0D 3AAUA 1DWEH 3SV9A 1YPGH 2WHXA 4ACAA 4CR9A 3I77A 2F9PA 5DO4H 2Z94A 1HXFH 1O2YA 7GCHF 4B76A 1V2UT 1AHTH 2QF0A 1O5CB 2ZFQH 2Y81A 1HXEH 2D2DA 2O8UA 2VIDA 5EXNA 2W3KA 2H2ZA 1DY8A 3MU8A 1P2QA 2ZU5A 3PTBA 3LGVA 1Q2WA 3ZYDA 1F0UA 2O8MA 3RLYH 1GBBA 1MTVA 1QRWA 1VCWA 4YOIA 4GLYA 3RXLA 2R9PA 3ATWA 1KTTB 3RUOA 3F2GA 1AU8A 6GCHG 3RC5A 1UHBB 1BMLA 2QV1A 3M35A 1EXFA 1WUNH 2O8TA 1G30B 1AWFH 1GBFA 2HVXA 1XUHA 3A80A 4KGAA 1K9OE 1A7SA 3MWIU 1UTJA 1DM4B 4X2YA 2ZNKH 3GY5A 2ZP0H 2BZAA 5H4IB 2M5TA 4LZ4B 5FAHA 2I6QA 1GJBB 1O32A 3VB4A 1SGRE 2OC8A 3TJVA 2HVYB 5F8TA 1SQRA 2FESH 4XFQA 1G2LA 3I29A 3ZZ8A 1S6FA 1GDQA 5JBCS 2XBWA 3M36A 2PFEA 3K9XB 1GMCG 1SHHB 1C2GA 2OBOA 1HJ9A 3MHWU 2NU1E 1UJ1A 4X2WA 1P2IA 5A09A 1CHOG 3MH6A 2EI8A 4X1QU 2F43B 1AZZA 2FO9A 4IS5A 3MU0A 3ATIA 3SU3A 4NGAH 5EXMA 4CRFA 1SR5C 3S7HB 1K21H 1MQ6A 1GDNA 1MH0A 1ZGVA 4LK4A 4F49A 3VFEA 1GPZA 2FI3E 8ESTE 1F0SA 1GGDC 1VGCC 1CA0B 4SGAE 3OAAD 1XX9A 1C5QA 1V2WT 4ZHLU 1WXRA 1SMFE 3FP7E 4ZUHA 2PKSC 1Y3UA 1NFXA 1KLJH 1H9LB 2B8OH 1BMAA 1LPZB 5FHTA 1LHDH 1IHSH 4B73A 1DSUA 1O3NA 5C67A 2GTBA 1CT0E 2XXLA 1SLUB 1DPOA 2AGIX 5JDUB 1PQ5A 2ZCHP 1L0ZA 3SI4H 1FONA 1DANH 1O3PB 3GDVA 1AGJA 5EQSA 1Z71A 4NA8A 3SUDA 1CT4E 5T6DA 1PPGE 2OCVB 1MKXK 1BQYA 4WXIA 1OWJA 1AB9B 3M3TA 1P04A 2A4RA 1ZMLA 1A5IA 1TPSA 1IQGA 3A81A 4B71A 4F48B 1AFQB 2B9LA 2J92A 3UUZA 3BEIB 1DE7H 1ZTLA 2UUFB 1ABJH 4DW2U 3VEQB 1A0HB 5C0TA 2SGEE 3SNAA 4ZMAH 1GMDG 2ZG0H 4DT7B 1XUFA 1BRBE 5I25A 3F0OA 3MU1A 2FS9A 4AFSA 6ESTA 3D23A 1C2KA 4ABFA 1ANEA 1MCVA 4WVPE 1WCZA 1IOEA 3NPSA 3QX5H 5DP4A 5ETXA 2GP9B 3GICB 5HM2A 2ZQ1A 5T1VA 3HGNA 4ABJA 1G3EA 1OXGA 2FS8A 4CR5A 3MI4A 1MBQA 1C2MA 3SJ9A 2PSXA 3FP8E 1TBZH 1ZMNA 1BDAA 1NC6A 2ZGJA 3SO3A 2H5DA 1FIZA 3OY6U 1KIGH 5E2OA 1CVWH 1JIRA 1H9HE 3FO8D 1SKYE 1O3MA 1O2SA 1WBGB 1HJ8A 1ZPZA 2PUXB 3GCTG 5FX6A 1AI8H 1YPMH 1MAYA 3UTUH 2PHBA 3DSGA 2BYAX 3SORA 3BF6H 1UVPA 2A2XH 4JZFH 3ESTA 2VIWA 1AE5A 4Y10E 1ETRH 1HAIH 1ZHMA 2CK3D 3LT3A 1OWKA 4Y79A 5C1XA 2HPQH 1O5GH 1NBMD 1KXEA 2Q1JA 4ZHMU 1Z8IB 3TK6A 4I86A 2QN5T 1ETTH 3N7EA 1P57B 1TQ7B 1IQNA 2EC9H 3MH5A 3M37A 1BZXE 4ZHAA 4A1TA 3U8OH 2PGQB 2VIVA 3LJOA 2AYWA 7KMEH 5L6NH 3GOVB 1WOFA 1P3EA 5C20A 3PWBA 1EKBB 4AX9H 4ISLA 1LVMA 1QJ7B 1C2IA 2ZU1A 1INCA 1C5VA 1ARBA 1FNIA 2VH6A 1C5XB 2FOAA 5K0HA 1WTGH 2ZFTA 1W13U 1VZQH 1MKWK 2ZDNA 5BRRE 4GHTA 1GBTA 1BHXF 1EAWA 1G3DA 2Y5HA 2OK5A 2SNVA 2STAE 2ZO3H 3KQEA 4A6LA 1L4DA 1C4Y2 3ZIAD 3F9HA 4KKDA 3NKKA 1TAWA 1QL8A 5FPTA 2EQNA 4VGCC 2FI4E 1ANDA 1TOMH 1RTKA 5IYTA 5FXLA 1A5HA 1W0JD 1MTWA 1C5UA 3HK6B 4OS1A 2GDDA 3GY8A 1CGJE 3SV7A 5A0BA 1GHAG 1MZDA 3NUMA 3UFAA 4X6OA 1GG6C 3TU7H 2OUAA 3SJ8A 2PV9B 3ZZ7A 3BEFB 1FY3A 1IQFA 4Q63A 2TRMA 2RDEA 2GCHF 3A8DA 4Q4LA 4UEHH 3TK9A 4Y7BA 1TNIA 4K5ZA 1P8VC 4ZAEA 3BTWE 1HDTH 1SOZA 4ZCNA 1TRNA 5EW1H 4Y0ZE 4BOHA 1O2QA 2NU4E 3FZDA 3MNXA 1TWXB 1QB1A 2ESTE 4OM9A 3F0PA 1BTWA 1WV7H 8GCHF 5CE1A 1FMGA 1QQ4A 4WY3A 1MABB 2P3FH 2P93A 4I31A 1F0TA 2VWMA 4NWLA 1KY9A 2QXJA 3H7OA 4Q80A 2CXVA 3VPKA 1F5LA 1SB1H 3OU0A 2CHAB 3FZZA 1RXPA 3OY5U 1ACBE 2FM2A 3TH2H 1C1MA 1NPMA 2O8LA 3LGYA 4IW4E 3SGAE 2PTCE 2BVRH 3RLWH 3SNBA 3BTFE 1GGDB 1A0LA 1J15A 4CRGA 1BRUP 3SU4A 4Y8XA 3FAOA 3VB6A 4AOQA 1UTLM 3UWIA 5G4BA 2ZU2A 2R2MB 3GCOA 2HNTF 2W26A 3H09A 3GCHB 2H9TH 1TA6A 2QYIA 4RT1A 3LGUA 4M7GA 1GL1A 1QY6A 1OX1A 1OP8A 4DY7B 5EXLA 1K1LA 2ZGCA 4MPUA 5B6OA 2BY9X 4H4FA 1JOUB 2WUCA 4RSPA 5ABWA 1O3DA 3BTEE 3QGNB 4BXWA 3MH4A 2ZFPH 3OTPA 2F4LA 3DSOA 3RXVA 1NU9A 1O5AB 1TNLA 3F3BA 1LHGH 3K6YA 3PLPA 5L30H 5EIYA 4O9VA 2A45B 1BMNH 1OYTH 2BDBA 2OBQA 2IN2A 2WV9A 4HGCA 1DDJA 5GIBA 1C2HA 1O2OA 1EB1H 2ANYA 4I8KA 1MTNB 4Y0YE 1PQ7A 3OEHD 3ZZDA 1W12U 4O3UA 1GJ6A 1TLDA 1F2SE 1H4WA 3P8OA 4BANB 2ZFSA 1QTFA 1BMFD 2J98A 1EB2A 1O5EH 1P12E 3SV8A 3UY9A 2IJOB 4MNXA 1GHBG 3L6PA 5HGGA 1K1PA 1YM0A 1WAYB 2QF3A 2WPMS 1Y3YA 4XD7D 3RXOA 2CGAA 2C8ZB 5T3HA 2ZGXH 1C1TA 2F9NA 2QCYA 2SGDE 3SUEA 1GL0E 3N7OA 5E0HA 1ESAA 4MLFB 3UNRA 3FP6E 2G55A 4YT6H 3A7ZA 1O3KA 1H1BA 1W3CA 2ULLA 4DGJA 1PPCE 1GI1A 1ZGIA 2ALPA 1SHYA 3TLOA 4Q7XA 1KTSB 1SQOA 3UNSA 2FODA 5C5OA 1C5SA 1PPFE 1GDUA 4B6FA 2VINA 3MO9A 1UMAH 2ILNA 1DFPA 3FFGA 1L2EA 1NRSH 4NFEA 5EJ1A 1ORFA 2BQWB 1WTHD 3TGJE 3KYGA 1H9IE 3V7TA 3ZZ3A 3RXRA 1J8AA 1AO5A 1TBRH 1TMBH 2THFB 3GDUA 4D7FA 5E2PA 3LONA 2FYRA 2HPPH 4OS5A 1ELGA 1GVZA 4TY7A 2ZHFH 3TJUA 1AB9C 3UQVA 1T32A 2OQUA 1FDPA 2AHME 2EI6A 3MTYA 2Y5GA 1HYLA 2FPZA 3NXPA 2V6NA 6GCHF 5L2YH 1AFQC 4SGBE 3SNDA 4FUGA 1ELCA 5JBAS 1KXBA 1AMHA 3CP7A 1TX8A 2OQ5A 1BRAA 2GDEH 1MBMA 1TBQH 1FY8E 3DFLA 4DCDA 3V3MA 2QAAA 1Y59T 2XNDD 3E0PB 2ZPRA 1MKXH 2KCPA 2B5TB 3PTNA 1AUJA 4TSFD 4VGCB 2AERH 2PTNA 3RU4E 1TOCB 1Y3XA 3KEEA 1GMCF 3A86A 3HGPA 1GVLA 1UTKA 4ZKSU 3A88A 1F92A 2ASUB 3S9AA 5EU8A 4NFFA 1CHOF 1ELVA 2ANKH 3KL6A 3U9AH 1GG6B 1MMJN 4XRNA 1J9CH 1RFNA 1HFDA 3HATH 2H9HA 4X1PU 2WPLS 2ZGHA 1HPGA 4NWKA 5F53A 4NSVA 3GY4A 1QGFA 5DJ7A 2FI5E 4ASUD 1C1NA 1ZMJA 4INKA 3G01A 3SZEA 3A8CA 2LP6A 4CBNA 1P0SH 1C1QA 1C5MD 1HAZB 1TYNA 2UWLA 3Q77A 4B6EA 3KYFA 5EGMA 2HALA 3ZZ6A 4F4OC 2OC7A 2WSSD 1T8OA 1SGEE 2ZHQH 1O2TA 2BMGB 3BTME 5DP7A 4X8TH 3B9FH 1BTHH 1DUEA 1G36A 5DG6A 2XBVA 6CHAB 2HLDD 2KCAA 4X0WU 4RT0A 1TMTH 1FXYA 2BVXH 2IPQX 3JZ2B 5DP3A 1ZRBA 4FOUC 1MU6B 1Z8RA 1PPZA 3D62A 1FPHH 4FUCA 2EI7A 4ZKNU 1T8MA 5FBIA 1FY1A 1OP0A 1BA8B
chains in the Genus database with same CATH topology
2GZ8A 2XC0A 1BHXB 4MPVA 2K1QA 2ZU4A 1Z1JA 1D6RA 3M61U 3S7KB 3P92A 5A8YA 2BD7A 4UE7H 4CH8B 1UVUH 3MNCA 3SN8A 1ID5H 1OYQA 1QB6A 3ZZBA 1F0RA 4Y8ZA 1C5WB 1GMDF 3E91A 4RN6A 3RXPA 1OWDA 4A1VA 5AHGH 3BG4B 1GBEA 2FMJA 3QLPH 3T26A 1P3CA 1ZSLA 1IQLA 2WYJA 3SHAH 1NTPA 3RMOH 3QUMP 4JCNA 1EOLA 2FOHA 1MKWH 3PYHA 3UWJH 3LH3A 5A8ZA 3ATLA 1DITH 1HGTH 3BTDE 1NESE 1DT2A 2Z9JA 5DGJA 3RXSA 3PLBA 4JZEH 5EW2H 2ODYB 3GCTF 4I8JA 5L2ZH 4IC5A 4THNH 3T29A 1AVXA 5J4QA 4ABIA 2AIQA 3ZZ5A 1XXFA 4Y11E 1SI5H 1ZLRA 3ZV8A 1VITG 4DVAU 1SSXA 2ZI2H 3SU2A 1C1RA 2BDHA 1ZTKA 1A5GH 2UWPA 3BTQE 3ZVEA 1GI2A 1HAXB 1AZ8A 4NA9H 4HI3A 2FTLE 3V12A 1HBTH 1FLEE 3D65E 1HAOH 1PPEE 4FU9A 2AEIH 1GCTB 5HMAA 2BDCA 4XBBA 1NFUA 5AF9H 2CHAC 2PUQH 1EATA 4AFUA 2F9UA 2G5NA 1AN1E 3PROA 4UFFH 3EA8A 4Z0KA 3A89A 2CF8H 1DWBH 1KXDA 1TONA 1AE8H 2Z7FE 3PMJA 2V35A 2FP7B 2HRVA 5GCHG 1LHFH 3SOSA 4WJG2 1FV9A 4GAWA 3GCHC 1LQDB 3KQCA 3Q3XA 3P70B 1K28D 4RKJB 3SV2H 5C5NA 5JBBS 3MU5A 4X2VA 1ZSJA 2ZA5A 1XXDA 4GSOA 2C4FH 5J4SA 4BTUB 1D3TB 3GYMA 1O2HA 4JZIA 3LGTA 3M5OA 1DWDH 2Y7XA 3MH7A 2P8OC 4D76A 4FUHA 2ANMH 5EG4A 1O3AA 1C5LH 1TNKA 1YKTA 2GX4A 3KQDA 1C4V2 3LGIA 1HAVA 2D26C 2Y82A 1O34A 3U1IB 2TGTA 3SNCA 4A92A 1GHAF 1TNGA 1O2IA 2AMPA 2A5IA 1AFEH 1Z8GA 1SVPA 4IBLH 3RC4A 1MTNC 1O3CA 1QBNA 4ZXYH 1W11U 2FX6A 2JKHA 3A7VA 3ATKA 4J2YB 1O2ZA 1CHGA 1HIAA 1OP2A 1XUJA 1YGCH 1GMHG 1O3GA 3A87A 2PSYA 2ZIQH 3FANA 3BIVH 1OS8A 4NCYA 2HWLB 2TBSA 1F5KU 3CS7A 1XMNB 2ODPA 2A7CA 2GD4B 2F3CE 1WQVH 1C2DA 1O2XA 1THPB 3Q3KA 3C1KA 1BBRK 3CENA 1HCGA 3FVFB 3ZVCA 3KGPA 4CRAA 1Y5AT 1DOJA 1GBHA 2ZTYA 5A2MH 3MNBA 5TCCA 4I8LA 1BITA 1T4UH 4TWWA 1SC8U 1CSOE 1RTLA 1GVKB 2BDGA 2HLCA 1HAGE 3EYDA 3UOUA 2G4UA 3JZ1B 1FAKH 3GY7A 4MNYA 2NU2E 1MD8A 3E8LA 4K2YA 3MO6A 1SL3A 2P16A 4NSYA 1DICA 4IMQA 5IDKA 2GMTB 4WH6A 1AY6H 1DX5M 2XW9A 1GI5A 3SHCH 3LU9B 3KHVA 1GJ7B 3SJOA 4WMFA 4FUDA 1QRXA 4IGDA 1HAHH 1FY5A 3RXKA 1ZRKA 4YLQH 1MAXA 5EOKA 1UTOA 1QBVH 2BY8X 3U98H 3SV6A 3SJIA 2Z9LA 3PMBB 3K65B 1ZYOA 4U2WA 1QBOA 3RXCA 1F7ZA 4Q2KA 2RG3A 1ELEE 1P2JA 1TE0A 1S6HA 1RS0A 1O3JA 3NZIA 4AB9A 3GCNA 1HAVB 1QNJA 2J38A 1SLVB 3H5CB 1O2JA 5A0AE 1GBAA 1BBRE 1Z8JB 3O8DA 3VXFH 1IQIA 1DLKB 3TITA 2ZQ2A 2VB0A 2VGCC 3AVZA 3HKIB 1D3DB 1UCYE 3SQEE 4I8HA 2R0KA 4X6PA 2XWAA 1NZQH 1HIAB 1SGYE 4A5TS 2FOMB 4K8BA 1TQ0B 1ELFA 1L1JA 1RTFB 2C3SA 4Y6DA 1CT2E 4YLUA 3TJNA 4YZUA 3RXUA 2XCFA 1KLIH 4NIYA 4UDWH 4X1RU 2FDAA 4KTUA 1GHBF 1D3PB 1KXFA 2WUBA 1UO6A 5SGAE 1HJAB 1DY9A 3NCLA 3SBKA 3M3SA 1GBLA 2VJ1A 4AGKA 1PQ8A 1SG8B 3F9FA 1GBDA 4ABHA 3A8BA 1O2GH 2V3OH 1AQ7A 1GI0A 1CA8B 3RP2A 5GWZA 1NROH 1Z1IA 2G81E 2QIQA 2WV5A 2UUKB 2BX3A 1OKXA 5C3NA 5HM9A 1YPEH 5E0GA 1GJCB 2WPIS 2XRCA 1O3LA 6LPRA 4JMYA 1KXCA 1PYTC 4UD9H 2V3HH 1O35A 1A3BH 1O37A 2AFQB 2VVVA 2RA0A 1SQAA 1F5RA 1C1SA 1E37B 3KIDU 4BNRA 2Y5FA 2PGBB 6CHAC 1THSH 1A3EH 4K69A 1ZPCA 4K1SA 2BQ7B 2ZTZA 4YOGA 1C9PA 1DSTA 3BG8A 2AIPA 3R0FA 1GI4A 4YTAA 1YCPM 3LJJA 4LOYH 3SUGA 3P6ZB 1GJ4H 2OP9A 5F8ZA 1GHYH 1SGFG 2TPIZ 2F9OA 4AG1A 1A0JA 5FPYA 1BTYA 2R3UA 3UR9A 2ZDLA 1NS3A 3BG4C 4TYDA 1EAIA 3KQBA 1FQ3A 1WU1A 2BD9A 2XTTB 2P8OB 2F9BH 4BAQB 1MCTA 3S69A 2QY0B 3WY8A 3ZZ4A 5I46H 7LPRA 4Q7ZA 1Y3VA 1N8OC 4DURA 1O2PA 3UR6A 2FWWA 2J2UA 1C1VH 3GISB 4GUXA 1ZPBA 3AW1A 3L3TA 1CGIE 4Y71A 4R8TB 1DXPA 2GVFA 1B0FA 2ZC9H 1QJ1B 1SGNE 3ZVDA 1ABIH 3UREA 1C2EA 1HB0B 3V0XA 4ISNA 1JMOH 4OS6A 3MYWA 2VWOA 5AVDA 4AZ2B 3GY3A 3SUFA 1W7XH 3EDXB 4MNWA 3V13A 1A4WH 3MU4A 4GHQA 3UIRA 4MPXA 1XUKA 1LKBA 1UK3A 1FPCH 5JPMH 1JRTA 2R3YA 1TB6H 1G3BA 4MDSA 2FZZA 1K1JA 3TH3H 1O3OA 1DVAH 2CJIA 1C5TA 1V2JT 4DIIH 4CRDA 1IQKA 3PMAB 3RXGA 3QN7A 1UVSH 3BN9A 1GCTC 1O2UA 4U32A 4IMZA 2CV3A 2G51A 3Q00A 2BLQA 2ZHEH 4D9RA 2FLBH 4K1EA 2UWOA 1MTSA 1NN6A 4GVUA 3Q76A 1UTQA 5DP9A 1V2RT 2IPHA 1SGTA 4D9QA 1SQTA 5DP5A 1ELAA 2BY7X 1DXWA 3MOCA 1LHCH 2TIOA 3ZVAA 3TIUA 1TGSZ 4YO9A 2HNTC 1EAUA 1NFWA 2BLOA 3F68H 3LC5A 1HNEE 3RMMH 1C2LA 1E38B 1O0DH 2FXRA 4O03A 2ZKSA 2P95A 3DD2H 2VVUA 3LPRA 1D9IA 3STIA 1C2FA 2Q6DA 1GCDA 2QA9E 1TRMA 1S82A 4XSKU 2PKAA 1V2OT 2AGEX 5LGOA 1V6DA 3ZZCA 2FIRH 1BOQA 1QL9A 2ZDKA 3OSYA 1CE5A 4WF8A 1VITH 3UQOA 1ZHPA 2STBE 1M9UA 4TPYA 1NM6A 1GBKA 3M7UA 1BTUA 3TGIE 1T8LA 1BJUA 3T2NA 3RXEA 2YNBA 2P3UB 1W10U 2Y6TA 5T6FA 2OD3B 1EASA 2D8WA 3M5LA 2Q6FA 2B0FA 3P95A 3A83A 3PO1C 5GXPA 2F83A 1J17T 3KNXA 2VGCB 1S0QA 2FOFA 3IG6B 4GCHG 2BTCE 1AVWA 4NG9H 3SGQE 3H7TA 4X8SH 1TGTA 4WMEA 2A32A 1CBWB 4OGXA 1HAPH 3T28A 4FVDA 2H6MA 1QRZA 1VITF 2FEQH 4NIVA 4NA7A 1UTPA 2LNCA 3Q3YA 1NRNH 2F9VA 1PPBH 4FU8A 3TPIZ 4I8GA 2J94A 2C8WB 5JB9S 1UHBA 1LVYA 4E7RG 1GJDB 3SU5A 1O33A 2FYQA 2AMDA 4H42U 3ENSB 2ZHDA 4X6NA 1UTMA 2FOCA 4AGJA 3A7YA 4NIWA 2BXUH 1W0ZU 3AW0A 2NWNA 2BZ6H 1EP5A 2YNAA 1Z7KA 1TPOA 4ZROA 2GMTC 1MUEB 1OWIA 1CGHA 3HKJB 4MPWA 1L1NA 3K6ZA 1BBRH 4ASHA 2VNTA 1C1OA 5ESBA 5FCKA 2Y80A 4FUEA 1LTOA 3GY2A 4HFPB 5GCHF 2OLGA 4DIHH 1K2I1 2CF9H 1O3HA 3LH1A 5LPFA 2PKAB 1ZR0A 3TK5A 3LDXH 5DP8A 1B5GH 1TPAE 1EX3A 1D6WA 5DK1A 1SGIB 1OOKB 1V2ST 3SU0A 1P05A 1NY22 1P09A 3E1XB 1YCPK 4O97A 2C90B 1SBWA 1YLCA 2GZ9A 2CN0H 1P2OA 3TH4H 3ZYEA 2WV4A 1AIXH 2OXSA 3RXIA 1BCUH 3SI3H 3TJOA 4XE4A 4AG2A 1T7CA 5FPSA 1TIOA 1GI8B 2GZ7A 5GJ4B 1T8NA 1TPPA 4WXVA 3M3VA 1A61H 3LGWA 3O8RA 3E90B 5HXFA 4YT7H 4A1XA 1GHXH 3EGKH 3EA9A 4X8VH 3BV9B 1SGPE 3U8RH 4ABGA 2HNTE 3DHKH 2XCNA 1Z6EA 2SNWA 2ZCKP 2Z3CA 1GMHF 1IQEA 2BQ6B 1JIMA 1W14U 2XC4A 2VWNA 1SPJA 1N8OB 3GY6A 3RC6A 1ZJKA 2OC1A 2GV7A 2QXGA 1ZJDA 4BAKB 1HJAC 2GKVE 1MD7A 1P10A 4XDEA 2BLWA 3BTGE 1UVTH 1ESTA 3RM0H 1UK4A 1XKBC 3DFJA 2RA3A 3SGBE 2J4IA 1YF4A 4WMDA 3KN2A 1C5PA 3TVJB 1J16A 4B1TA 2OTVA 1BB0B 2F91A 4H6TA 1E0FD 3NK8A 3URCA 1RIWB 2BD3A 1T31A 2C8YB 2ZHWH 1A46H 5FBEA 2RCEA 4TPIZ 1RGQA 3VB7A 2G4TA 3U1JB 4HZHA 3BIUH 2G52A 5GPIB 2Z9IA 3QZQA 2XBYA 1ZHRA 2HOBA 2GT7A 1LMWB 1EJAA 9ESTA 2NU0E 2LPRA 1TMUH 1QCPA 4J1YA 3OX7U 4BXSA 1YLDA 1P02A 1C1PA 1LHEH 1V2PT 1S5SA 1O2MA 1S84A 2BDIA 2BOHB 1V2MT 4KTSA 4K8YA 1FN6A 3LKWA 3F6UH 5LPEA 3PB1E 1YP9A 3RXBA 2KAIA 3K2UA 2TGAA 3P8GA 3QK1A 3S9CA 4JYVH 4CRBA 2G8TA 3VGCB 2XC5A 2A31A 4OS7A 1EUFA 1G37A 1JBUH 5F8XA 2VH0A 3RMNH 4B75A 1AWHB 1OWHA 2ZECA 1XVMA 2GCTC 3TNTA 4KELA 4E06H 1TGCA 3L33A 3I78A 4E7NA 1ELBA 4B2BA 4BTTB 4WH8A 1C2JA 1K1OA 1GBCA 1GJ8B 2AS9A 3TNSA 2FOBA 1FUJA 5DPAA 4Y76A 1B7XB 1P06A 4MG3A 2EEKA 4K60A 3VB3A 1VR1H 5CHAB 1E36B 5C1UA 1AVGH 1O2WA 4MTBA 1D3QB 4B2CA 3LIWA 3BSQA 2BDYA 2XBXA 3GDSA 1SLXB 3DUXH 1GBIA 3M5MA 1L1GA 2A4QA 2SGPE 3STJA 2ZWLH 1YYY1 1SGCA 2BXTH 3EE0B 1BUIA 3F1SB 4H6SB 2H1UA 2WINI 1TNJA 1SGDE 2VIPA 2DUCA 1EZUC 5EPNA 4ZKOU 3E6PH 3B8JA 3SW2B 1WQSA 3PO1B 1EPTA 4FUJA 2OINA 1GBJA 2SGQE 5FX5A 4D8NA 3AASA 1PFXC 4K1TA 4LXBH 3C27B 7GCHG 4ESTE 1O36A 1P11E 4B74A 1C4U2 1L4ZA 1TABE 1O2NA 2AGGX 3BTHE 3P8NA 2A1DB 1QIXB 2C8XB 1ESBA 1BT7A 1O2LA 1VJAU 3IITA 2VU8E 3BEUA 1C5ZB 2WPKS 1NFYA 1EJMA 4PROA 1IHTH 1SFIA 1V2QT 5ESTE 2SFAA 2I6SA 1UCYK 3QZRA 1C5YB 4OS4A 3E3TA 3A7XA 3A7WA 2Z3EA 4X1NU 4X6MA 2A4GA 4XBDA 5F6MA 1ZTJA 2KAIB 1E35B 4FU7A 3EQ0H 4ABAA 5EODA 2EA3A 3PM3A 3RXJA 1LQEA 5DP6A 3QDZB 4I33A 1TX6A 1BTZA 4DJZB 5HYOA 1EAXA 3RXHA 5A0CA 4BAHB 3F9GA 2JH5D 1SOTA 3ZV9A 1P9UA 4NZLA 4YM9A 4JZDH 2BB4A 1V2KT 4AFZA 1HLTH 1MZAA 2Q6GA 1O3BA 2J34A 1QJ6B 2ANWA 4QT8C 3UPEA 1TALA 1LVBA 4CBOA 3SU1A 3EAJA 1DUAA 1W0YH 3F9EA 4IN2A 1J14A 4Q7YA 4IN1A 1ELTA 4OS2A 3RU4T 2BVSH 1OWEA 3ATMA 1SLWB 3M5NA 1O3FA 4WWYA 4ISOA 4ABBA 4IC6A 3URDA 1Z6JH 1TX7A 1BJVA 2ALVA 2XNIA 3ODDA 4RKOB 5JYIA 1O2VA 4CHAB 4AFQA 2BOKA 2XWBI 1O30A 1HRTH 4A7IB 2HGTH 2Z3DA 1K1NA 4JZ1A 3IWMA 4AN7A 2IOTA 3RXMA 1KLTA 1O39A 4Y7AA 2BY5X 1KXAA 1EPTB 1O31A 5E8EH 1UTNA 1CBWC 1K1IA 2PLXA 2Z9KA 4UFGH 3VB5A 1CO7E 2BY6X 1NT1A 1KDQA 4KP0A 1P2KA 3S9BA 1NO9H 4CRCA 3VXEH 3D49H 1LDTT 2FOGA 1SFQB 2JH6D 1P01A 2ZDVH 1JXPA 1WSSH 3QWCH 1P03A 3UOPA 2C93B 1UK2A 2A7HA 3QGJA 2BD8A 2GV6A 5CMXH 1S0RA 2W7SA 5EPYA 1XUGA 5JBTA 1T4VH 1V2LT 2A4OA 2GT8A 1P2NA 1DLEA 2YOLA 4X8UH 1RRKA 5TJXA 2VWLA