3N99A

Crystal structure of tm1086
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
282
Chain Sequence
b'GHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRKEEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNIDPDLFEKLGIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYRKGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein TM1086
publication title Crystal structure of TM1086
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 82
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, G, H, I, J, K, L, M, N, O, P, S, T, U, V, X, a, b, c, d, e, g, h, i, j, k
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14505 DUF4438 Domain of unknown function (DUF4438)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.170 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3n99A02
2.102.30.10 Mainly Beta 3-layer Sandwich tm1086 (SG structure) fold tm1086 (SG structure) domain 3n99A01
4.10.1180.10 Few Secondary Structures Irregular tm1086 fold tm1086 domain 3n99A03
3DCLA 5FL7D 2W6JD 5CDFE 1COWD 1EFRD 1E1QD 2CK3D 2HLDD 3FKSD 4Z1MD 3N99A 1NBME 1H8HD 4YXWD 4TSFD 2JJ2D 2JJ1D 1OHHD 2XOKD 2XNDD 1W0JD 4Q4LA 1E1RD 1H8ED 2W6ID 1KMHB 4TT3D 1SKYE 2JDID 3OEED 5DN6D 4ASUD 1E79D 4XD7D 3ZIAD 5IK2D 1FX0B 2JIZD 1NBMD 2QE7D 2WPDD 2WSSD 5HKKD 1W0KD 2V7QD 3OE7D 3OAAD 1MABB 3OFND 3OEHD 2F43B 1BMFD
chains in the Genus database with same CATH superfamily
1CA0C 3RM2H 4K1SA 3T29A 1O2LA 5EXMA 2WHXA 5LPRA 3M3SA 2YMSB 2K0QA 5C1UA 2PP6A 1QFKH 3KEEA 1PPHE 4WMDA 5A8ZA 3GYLB 1P01A 1K1JA 1KXCA 1C5QA 3RXGA 3SBKA 1DWDH 1LDTT 1LKAA 1V2LT 2NU1E 2XBVA 3UB0A 4ABBA 1D3DB 5A0CA 3F6UH 1LPKB 2PSXA 2OQ5A 1PJPA 3EQ0H 3SV6A 2GGVB 5JBBS 1HBTH 2KCYA 3GDSA 2UWPA 3Q76A 4Q7ZA 2OCVB 3ELAH 1GBHA 5A8XA 1PYTD 3L33A 2P3FH 1BRUP 3IWMA 2FX6A 1IQIA 3ZYEA 2QA9E 4ABDA 4RKJB 1T8NA 4X0WU 1W8BH 2TGTA 4AX9H 1OKXA 3GCHC 3KHVA 1W0YH 1OP0A 2FMJA 2SNVA 3OTPA 4XD7D 5DK1A 6GCHF 5GXPA 1HUTH 1E0FD 2QCYA 3SJOA 2ESTE 3GICB 3E16B 1GJ5H 5C0TA 4U30A 1YLDA 1Y59T 1BTHH 1ZGVA 2FI4E 2AGEX 3ATWA 3FP6E 1OP8A 4KKDA 2Q6DA 1ZPZA 4XBBA 5F8ZA 2CF8H 3UREA 1G36A 4IMZA 1UTPA 4LZ4B 1VITH 2RG3A 6CHAC 1GBCA 1QIXB 3T2NA 3RXSA 1ESBA 2VWOA 3RXRA 2CHAC 4Y8YA 1BDAA 1ZPCA 3TK5A 3SOSA 4CH8B 3UNSA 1F5RA 4AOQA 1O38A 1ZTLA 3NK8A 4OS4A 4D9QA 1NFYA 4FU7A 4ABJA 1Z8RA 2XOKD 1P2NA 1C5SA 4GHTA 1C1MA 5HIZA 4RT1A 1LVOA 5CMXH 4J2YB 3LIWA 2J2UA 4AORA 5E0JA 4YT7H 3MWIU 4MLFB 1UHBA 4IS5A 4A6LA 3AASA 7GCHG 1ELDE 1SQAA 1DS2E 1OWHA 2R2WU 3M5NA 3MTYA 4DG4A 3LONA 1KSNA 2CK3D 1K1MA 5TCCA 1MKXH 1TPPA 3KIDU 3GY3A 3A8DA 5DPAA 2SGFE 1JIRA 5DJ7A 1QJ6B 2KCOA 3MH6A 3RXJA 2C8ZB 3UTUH 4NIVA 3QN7A 4HZHA 3AK5A 1O2KA 2ZHQH 1OWKA 1GMHG 1DY8A 1VGCB 1C5WB 2OINA 1BIOA 1Y3WA 2A5KA 2OXSA 2J9NA 1G3DA 1MTNC 2UUJB 3SNDA 2GD4B 1SGEE 4YOGA 1TNJA 1GJCB 7KMEH 2ZHFH 5FXLA 1E1QD 3S9CA 1W2KH 1BQYA 4CR5A 3QUMP 1GBBA 3LJJA 3RDZA 1TE0A 3RXKA 1Z71A 2V3OH 1NFWA 1F5LA 1P2IA 1U6QA 1G9IE 1EB1H 1SOTA 3P8FA 1UVTH 1N8OB 2FOHA 1WCZA 3RXBA 3UUZA 1TPOA 1GHXH 1S84A 2J34A 1DOJA 5F8TA 1KLJH 3KQDA 3H7TA 1GI5A 1O3LA 4NFEA 1Q3XA 2G4UA 2BX3A 1ARCA 1P09A 1MZDA 1Z8GA 3F9GA 1O3NA 2BD5A 3A7WA 3ESTA 1N6XA 5LPFA 3I78A 1H8DH 1Q2WA 1SKYE 1O33A 5GJ4B 3PMAB 1C2EA 5F6MA 2FOEA 4JZ1A 1BB0B 3KYGA 1GJDB 2D8WA 4IC6A 4B2CA 1HAOH 3TVJB 1MBMA 1MAYA 1AWFH 1PYTC 2ZFQH 1UK3A 3RXEA 5L6NH 5EU8A 3TH4H 3BIUH 2YOLA 1HPGA 2G55A 4DJZB 1K21H 3EAJA 5J4QA 1K1IA 4BTTB 2JKHA 2LELA 3A80A 3LT3A 4AG1A 1SL3A 2RA0A 1TA2A 1MD7A 4X2YA 1EPTC 1TABE 4Y6DA 3SJ8A 1YGCH 1V2WT 5GWZA 1ETSH 5EJ1A 4AG2A 1ANCA 5ETXA 3U8OH 4IN2A 1Y5BT 2PUQH 2ZIQH 3F2HA 1VITF 3RM0H 1YPMH 1J9CH 1RXPA 2AERH 1FV9A 2V35A 1QJ1B 2A2QH 5CDFE 1UHBB 1AQ7A 3O8RA 4HI3A 1IQGA 4Y0YE 2BQ7B 4GUXA 2WPIS 5DSFA 1SFIA 2IJD1 1XKAC 3RC4A 6ESTA 1GI2A 3KQBA 4MNWA 3Q00A 3P95A 1A3EH 2GCTC 3NZIA 3ZVEA 2A45B 3PB1E 2HLCA 1AGJA 1V2ST 2ZA5A 4U01A 2FI3E 1NROH 1QBOA 1TFXA 3BTQE 4I86A 1C2LA 1ESTA 1G30B 1MCVA 2BDCA 2F83A 1L2EA 1EFRD 4NZLA 1BTUA 1YP9A 2GZ8A 2PW8H 1GVKB 2G8TA 2BZAA 1DFPA 4B71A 2XNDD 5DO4H 5KEDA 2J98A 4BXWA 3QK1A 3SNCA 2GDEH 2DUCA 3PTNA 1C1PA 1O3AA 3RLYH 2A0QB 4K69A 3VB4A 1S82A 1O2NA 3GISB 4CH2B 2RA3A 3TK9A 2BX4A 2VWNA 4FOUC 3A7ZA 2BY7X 2R3YA 2Z3CA 1GI1A 2G52A 1V6DA 1W14U 2C8YB 2WPKS 5K0HA 2ZO3H 4Z1MD 4MPVA 2M2AA 3GCNA 1ZJDA 1HAIH 2WPMS 4AGKA 4BANB 1SLVB 4X1SU 4CRBA 1KTSB 1C2IA 1FLEE 4IN1A 4FUGA 1KXEA 3BF6H 3CP7A 4FU9A 1FAXA 2JETC 1HJAB 2BD7A 2F43B 1YPJH 1HAVA 1TRNA 1Y3VA 2EQNA 1LHGH 1W12U 2V0BA 4ISOA 3V12A 4A1VA 1O2RA 2IPHA 3T25A 4ISIH 1C4V2 1QY6A 1O5CB 3UNRA 1CQQA 2AGIX 2XC0A 2XNIA 1LVMA 1SG8B 3E8LA 3KL6A 3ZZ5A 2Z3EA 1ARBA 5EOKA 8ESTE 4OM9A 4DIIH 4ZHAA 1GGDC 2G5VA 1GBIA 2WINI 3P8GA 1GMDF 1FMGA 1PPZA 2CJIA 3MU0A 4IC5A 4H6SB 1D3TB 1NBME 2WV5A 3GY4A 1EQ9A 1FY1A 1O3EA 4OS1A 2LP6A 3QTVH 1Y3UA 5CHBA 1GG6C 3HPTB 3H09A 2FWWA 1UK4A 2Y5GA 4M9FA 1C5PA 7GCHF 2Q1JA 3BTME 2BZ6H 1C2KA 3IITA 1A5IA 1HAHH 2ZFRH 1UVPA 2EI7A 2F9BH 3T5FH 1YCPH 2BD4A 3FKSD 1YPEH 4BOHA 1QA7A 5ESTE 1J15A 2J94A 4PROA 2DE9A 5F8XA 3A8BA 3TJVA 1GJBB 1SB1H 1IQFA 1EOLA 1KY9A 2BLVA 3G01A 3GCOA 2ZCHP 1AFQC 2GP9B 3VB7A 4SGAE 2J98B 3CS7A 1GBJA 2PFEA 4JMYA 2P94A 3NUMA 5C5OA 2P8OC 2ILNA 3KN2A 1GI3A 5TJXA 2RCEA 4WF8A 1B0FA 4UFEH 1XXDA 4INLA 3M36A 3KQ5A 3C27B 3TGKE 2VVVA 1A0HB 3SHAH 2XBYA 1S6FA 2A4RA 2LNCA 1O3BA 1CHOG 1O2OA 1MKXK 2Y80A 3ITIA 3LU9B 1GI4A 3LGUA 1C5XB 5G4BA 3RUOA 1CSOE 3K9XB 1SHYA 1C1NA 1B0EA 3GY2A 1QL7A 4VGCC 2IOTA 1V2KT 5H4IB 1V2PT 1WSSH 3QZRA 1UCYK 2JJ2D 2WV9A 1TAWA 2WV4A 2G81E 1WOFA 2A1DB 1TBRH 1FDPA 2Q6GA 1O34A 5EW1H 1TMUH 3HKJB 3DFJA 3SNAA 1RD3B 2ZGCA 1JMOH 3BG4B 3W1EA 2FDAA 3MHWU 1GJ7B 2BY9X 5EG4A 2CF9H 3PO1B 4F4OC 1O5AB 4X1QU 2FX4A 4LK4A 2VIWA 2ZU4A 2K8IA 2AHME 5DP9A 1MH0A 2V3MA 3R3GB 3VXEH 1C2MA 1C5OH 1SGNE 2GMTB 2C8XB 1VKYA 1ELTA 1EKBB 1UTNA 4AFZA 5LPEA 4GSOA 3P17H 2KCAA 5DG6A 1WDIA 4MTBA 5CHAC 1QHRB 2KZ4A 3RXTA 1WBGB 2UUFB 2SGPE 1P2JA 1OOKB 1BBRH 1C5MD 2FI5E 1AVXA 2O9QA 2XRCA 4WVPE 3RXUA 4ABHA 1GJ8B 4Q4LA 5B6OA 1WU1A 2CN0H 1HYLA 4SGBE 1YPGH 1IQHA 4Y10E 2AIQA 2R3UA 5EJZA 1K1LA 4WMFA 2O8MA 4NGAH 1BITA 4CRGA 3ATIA 2JH5D 3SZEA 4E06H 2A7JA 1FAKH 1SQOA 1OSSA 1TNLA 2VGCB 2V6NA 2ZDMA 1TBQH 1HJ8A 4ZROA 3SJIA 1L1NA 1DE7H 1FIZA 1GBDA 2XWBI 4CRAA 3A89A 1XM1A 1F2SE 1UTKA 2QXHA 4ESTE 4K2YA 1ZTJA 4MNYA 2ZU3A 1RGQA 7ESTE 4B1TA 1E37B 4CHAB 5C67A 1PQ5A 3UY9A 2FOBA 2NU4E 2C90B 1HRTH 3EA8A 2OC1A 1EZQA 4FUIA 1HDTH 3LH1A 4F48B 2KFWA 2QYIA 5B6LA 5E2OA 5L2YH 1QA0A 1EAXA 4D8NA 4YOIA 2ZCLP 4D76A 1O2GH 3GY5A 1OXGA 3L6PA 2FM2A 3MFJA 5FPTA 3BSQA 4BAQB 1MQ6A 5HGGA 1JBUH 3F0PA 4YESB 1C5YB 1GBMA 3HGPA 2VJ1A 3SU6A 3M7QA 1BTPA 1VJAU 1GDQA 1BMNH 4Q7XA 3F2FA 1ZPBA 3ATKA 1O3MA 1TA6A 3QX5H 4YT6H 2H9TH 4IMQA 5EQRA 2ZDVH 5E2PA 2Z9IA 1BMMH 1E34B 3RU4E 2H1UA 3IG6B 3S7HB 1BRCE 1P03A 4HG6A 3LJOA 4ABEA 1TMBH 4KELA 2QC2A 4TSFD 3GS9A 3T26A 1ZSJA 3ZYDA 4U2WA 4D7GA 4THNH 2FLRH 1W11U 1SPJA 2THFB 5C1XA 1O37A 1EAUA 4NWLA 4Y7BA 2VIQA 4D9RA 2YNAA 2FYQA 3TPIZ 2A5AA 1HV7A 5FPSA 1P0SH 1XKBC 5FX6A 2BY5X 3ZZ7A 2BYAX 1X7AC 2A2XH 2WYGA 4KGAA 3M61U 1YKTA 2Z6BD 1TONA 2XW9A 2PWXA 2BD2A 1UJ1A 1BTZA 4CRDA 1AU8A 3SZNA 1GHBG 3ZVCA 3PMBB 2EA3A 2ZU5A 2ZHEH 1BJUA 1TB6H 2C8WB 3H7OA 4UD9H 3UFAA 4ASHA 3GY8A 2IN2A 2VWLA 4ABFA 2VWMA 3SI4H 2PUXB 1E35B 1D6WA 5DKMA 4AB9A 4JCNA 1NN6A 2BVSH 2B0FA 2TGPZ 2G5NA 3P92A 2WPHS 3UQVA 4UFGH 1TNIA 3M7TA 2ZQ2A 3PYHA 1C2DA 2GDDA 3PWBA 1MCTA 2OBQA 1OP2A 2W3KA 4RKOB 2FS8A 3R0FA 2BDAA 2EY4C 3UQOA 4NZQA 3FOAA 1JIMA 3PLBA 3JZ1B 2FYRA 1EAIA 5T1VA 3ENSB 2G00A 5FBEA 3DT0H 1K1NA 1K2I1 1SGPE 3WWFA 1GJ9B 3D23A 2XYAA 1T32A 1C1VH 5BPEA 5IK2D 4D7FA 1W13U 2XCNA 2F9UA 3ODFA 4AZ2B 1OS8A 1GI8B 3TJNA 2Z9JA 1SGTA 4B73A 1A46H 3HK6B 2R0KA 2AMDA 5JBTA 1T8OA 2VIOA 3ZZ9A 4A1TA 1YWUA 4X8SH 4CRCA 1DUEA 2XWAA 2NU0E 2PGBB 3M7UA 1O30A 3MMGA 4YXWD 1C1WH 3UOUA 4FVBA 3UPEA 3MU4A 1O39A 3QDZB 2A7HA 3AW0A 1CGIE 2PKAA 1HJ9A 1EZXC 1GBEA 1UO6A 2BOHB 1O5FH 1TGNA 4GCHG 1AZZA 4R8TB 3VPKA 1CBWB 5JBAS 3OAAD 3Q3XA 3BTEE 4NG9H 2TBSA 1XVOA 1AO5A 4GVUA 4ZKSU 1JOUB 4CBNA 2ZDKA 1C5VA 5HYOA 1RIWB 3ZZ4A 3PTBA 2P93A 1SVPA 1AE5A 3A8AA 4JK6A 3MNXA 1MZAA 1RTFB 2BDGA 3PRDA 4B2AA 1HNEE 3ZVDA 1HIAB 3ATMA 3SNEA 1EP5A 4XBCA 5KGOA 3ZVGA 1O2VA 1FY5A 3CNRA 5CE1A 1E79D 4DT4A 3MO6A 5DP3A 1ETTH 1KLTA 3UR6A 2BLOA 1DPOA 4O9VA 1F7ZA 1AMHA 2OP9A 2H9EH 1ZZZA 2F3CE 2PKSC 1V2TT 5A2MH 2WYJA 2HNTF 1GI7B 1B5GH 4TYDA 4AB8A 2OTVA 1C5NH 2F9NA 2A4OA 4K8YA 1A4WH 4O97A 1DM4B 1J14A 3PM3A 3QZQA 2JH0D 1O32A 1T7CA 1EX3A 1MTWA 3MNBA 5A0BA 1GCTB 4X1RU 3OE7D 2ZFTA 3BTDE 4NA7A 1IQJA 4M7GA 2OUAA 4Y0ZE 3SUDA 1W10U 3A82A 2R9PA 1ZHPA 3MU5A 4B75A 4WJG2 1LO6A 1CA0B 3ZZCA 2QV1A 5AF9H 1CT2E 2CGAA 3VGCC 2QE7D 2STAE 3ZVAA 1SQRA 5HMAA 2HALA 1Y3YA 1YBWA 1DITH 1GCDA 1SGFG 3FP7E 2OC0A 3KF2A 4MPXA 4HFPB 2ZP0H 3TH2H 2PSYA 1HB0B 2Y5HA 4I8LA 4WH8A 4BAHB 1ZJKA 2F91A 5GCHG 2JDID 1T4UH 3SV2H 3VB3A 1D3PB 1FNIA 1YC0A 3DFLA 5E0GA 4IGDA 2PKAB 1OYQA 3SU5A 1ZLRA 2BB4A 3F1SB 3RXHA 4CRFA 2Y82A 3GCHB 4FUCA 1HAPH 2B9LA 3LC3A 3OTJE 3P8OA 4MNVA 1LPGB 2A32A 1O2SA 4JYVH 5LH8A 3LOXA 2ZDNA 1A5GH 1OWJA 1LHDH 4A92A 3AVZA 1BBRE 4FUDA 2TIOA 5JBCS 1O2ZA 1A5HA 1UTMA 4KTSA 1LMWB 4X8VH 2CXVA 1QL8A 3LDXH 2H5DA 3ZV9A 1G2LA 1TQ7B 1NO9H 2CV3A 1E38B 3BG8A 3TGJE 4TY7A 1LVBA 1O3DA 3OU0A 1QJ7B 4NSYA 4DIHH 6CHAB 2O8LA 2OC8A 1P8VC 2CHAB 3GCTG 1GHBF 2W7UA 4BNRA 5EW2H 4ZUHA 2F4LA 1N1LA 3A8CA 1MTUA 4H42U 5JYIA 3SN8A 1TX8A 1O3CA 4DCDA 1TWXB 2ANKH 2OQUA 4OS2A 1LHEH 1WAYB 2BLWA 3VEQB 1BRBE 1K22H 1ZHMA 4X1NU 3TNTA 4GAWA 1GWAA 3GDVA 5DP8A 1SR5C 1BZXE 2Y5FA 1YLCA 1A1RA 2YMSD 4GHQA 1L1GA 2BDIA 3T62A 2HOBA 3RXFA 2AFQB 4MDSA 4LZ1H 1V2JT 3A7TA 2FP7B 1AKSA 1G37A 4BAOB 5T6FA 1E1RD 1ELGA 3H5CB 4JYTA 5C1YA 4X2XA 3QO6A 1NZQH 1C9TA 1Z6JH 2XXLA 3BTFE 3WY8A 2W3IA 1BJVA 3EA7A 1UMAH 1XVMA 4NCYA 1DICA 2O8UA 1IAUA 1W7XH 3LC5A 1DVAH 2ZU2A 1MQ5A 2FZZA 5E8EH 2Y6TA 3S7KB 1ZMNA 1GMCG 1G3CA 1QRXA 3EE0B 4TWWA 2Y7XA 1XUJA 5C3NA 1BMAA 3GDUA 2FPZA 1MTNB 1CHGA 1GBAA 2GJGA 3WWBA 5C5NA 5HM2A 3FO8D 2STBE 3OEED 1ORFA 1Z7KA 6LPRA 4ABAA 2ODPA 1INCA 1JRSA 2HRVA 2ZZUH 1FX0B 4TPIZ 1EATA 1K1OA 5HKKD 3E91A 4X8TH 3NPSA 2FIRH 1BMFD 4OS7A 1P2QA 2H6MA 1LVYA 5HXFA 1MKWH 4E7NA 3P6ZB 2SGQE 1QBNA 3O8BA 2FODA 1A2CH 1G32B 3RU4D 2HNTE 3FZZA 4F49A 4INHA 1Z8JB 4GCHF 1SSXA 1OWIA 5SGAE 4CBOA 4UEHH 1C4Y2 1GHYH 3BEUA 5L2ZH 4AN7A 1PPBH 4X1PU 3A85A 1TNHA 1P10A 5C17A 4WXVA 4ZHLU 1YPHC 2ZCKP 1W0KD 1ANEA 1QGFA 4NSVA 5IDKA 1ZR0A 4X6PA 3NKKA 1AUJA 5GIBA 1WYKA 2O8WA 3UWIA 3SHCH 1TQ0B 4K3JA 3U98H 1YYY1 1YF4A 1O2MA 2ZECA 2XBWA 1GMHF 2QY0B 2ZTZA 3M3VA 1ELVA 1JWTA 1RJXB 1EP6A 5FX5A 1DSTA 2FLBH 3TGIE 1AB9C 2AIPA 1EPTB 3HK3B 4NIWA 1EJNA 1NRNH 4X2VA 2OBOA 2KAIA 1GI9B 1A3BH 3UAIC 4DW2U 1GBKA 4YO9A 2Z3DA 4RI0A 3SORA 1QNJA 5ABWA 3SNBA 3EYDA 2BVXH 1AWHB 4U32A 1NM6A 1P2OA 3M35A 2P3TB 1SC8U 1AKSB 4Q80A 1C5RA 3F9FA 2GZ9A 1IOEA 2J92A 2Y81A 1V2VT 2PV9B 3A87A 3BTWE 2GCTB 4Z0KA 2QXIA 4HTCH 2EC9H 4JK5A 3VG8A 3P70B 1QQUA 1OX1A 1ABIH 3PMHB 1SLXB 2A5IA 2BDYA 1BUIA 5FHTA 3WW7A 1O3HA 1L0ZA 5DN6D 3W95A 1O2PA 5L30H 2BQWB 1WUNH 1S5SA 1W0ZU 4OGYA 1O3KA 5JB8S 2YMSC 3SI3H 1O3JA 3MOCA 1IHTH 3EGKH 3PLKA 3D49H 2Y7ZA 4X6MA 3K2UA 1NFXA 3FFGA 2SGEE 3KNXA 1GI6A 2EI6A 1S6LA 4XFQA 4KP0A 5ESBA 3RC5A 5GCHF 5HIYA 1TOCB 1ESAA 1VCPA 1W0JD 1O5BB 3M5LA 2ASUB 1NRQH 1MMJN 4KTUA 3LGIA 3RMNH 1KXAA 4B2BA 4R0IA 2ZHWH 1Y5UT 4I8HA 3LPRA 3LKWA 2ALVA 3TNSA 1WQSA 4X2WA 1BMLA 3B9FH 4ZKOU 3PLPA 2FOAA 1SGCA 3ZZBA 2ZGBH 1SBWA 1O3PB 2A31A 2TPIZ 3LGVA 2Z9KA 1HLTH 1PQ8A 1QL9A 3EE7A 2JETB 2HGTH 1KYNA 1N6YA 3AW1A 1IHSH 1S0RA 3MU8A 3QGJA 2C93B 3A83A 1VJ9U 5J4SA 1P02A 1TGBA 5DP7A 3PV4A 1WTHD 3UIRA 3SGBE 4NA9H 1ZTKA 2BXUH 1P04A 3P8NA 3DD2H 4Y79A 3SQEE 1ANDA 3GCTF 2HPPH 1DY9A 4ZXYH 5C94A 1IQLA 3CENA 1FN6A 3ZZ8A 1SLWB 1GGDB 3OX7U 3FANA 2KAIB 2ZFFH 2ZPQA 1NT1A 3BTTE 1FUJA 3JZ2B 3U69H 3V3MA 2PR3A 5BRRE 1SGIB 2C3SA 4ISHH 1QRWA 1QRZA 4I33A 4K5ZA 1C5TA 1PPEE 1ABJH 1S0QA 2PLXA 4JZDH 4ASUD 3A86A 4JZEH 3A7XA 2WSSD 4GPGA 1F0SA 1GG6B 2L74A 3DSPA 4FUBA 2BDBA 1Z8IB 5AFYH 2LPRA 2ZGJA 3TK6A 1GJ4H 2BHGA 3KYFA 1RTKA 3VFEA 5EQSA 4OS6A 3URDA 1C1SA 1AI8H 2AS9A 4UONA 3LGTA 5KECA 3VB5A 2AH4X 2FOFA 2PTNA 1UTJA 3OSYA 4YLQH 3K65B 3OYPA 1AHTH 1O3OA 2YNBA 1GBFA 2G51A 1NU7B 1SGRE 1AZ8A 1H9LB 3O8DA 4H6TA 2ZPSA 3SU4A 2ODQA 1AFQB 3F9HA 1HAXB 5EPYA 1VR1H 2I6SA 2ZHDA 2QGRA 4Q2KA 4TPYA 3A7VA 1VGCC 4BAMB 1DUAA 3BEIB 1UW7A 1F0RA 2KR7A 1SGDE 2WPJS 2O8TA 2P8OB 1UTQA 3ZZDA 1THRH 1YCPM 1C2HA 2I6QA 4Y76A 3RXLA 3O8CA 2AMQA 5LGOA 4I7YH 3QWCH 3K6ZA 2R0LA 5C2ZA 3Q77A 3E6PH 3MO9A 2HLDD 1LPZB 3RXQA 2ZKSA 1HIAA 2BMGB 4UDWH 4TWYA 1N8OC 1NRRH 5I46H 2UWOA 3MH7A 3M37A 3AAUA 4VGCB 3T28A 1ZMJA 2ZU1A 1GPZA 4AYYB 1UVUH 2QXJA 2ZFPH 1P2MA 1GJ6A 2WUBA 5DGJA 1GI0A 4I8GA 5C0UA 3UOPA 2H5CA 1IQMA 2UWLA 1CT0E 1C1TA 1K1PA 1XXFA 2FO9A 1ZGIA 1SGFA 3BTKE 2QF3A 3A84A 3A81A 3E1XB 3RU4T 1MKWK 1O5EH 2ZQ1A 4FUEA 3S9AA 5DP5A 2BXTH 1NTPA 1VCWA 2OC7A 1O0DH 1DXWA 2UUYA 4XOJA 4AGJA 1QB6A 1BA8B 1COWD 3F68H 2A7CA 5CHAB 4MVNA 2JJ1D 3DUXH 5C20A 1CHOF 1O2XA 1V2QT 1GDNA 1TGCA 3ZZAA 4ABIA 5A0AE 1UTOA 4I31A 8GCHG 3Q3YA 1G2MA 1CE5A 1K0HA 1L4ZA 1YCPK 1C2FA 4B76A 2GCHG 2H9HA 3RP2A 5JB9S 1LKBA 3E0NB 2TGDA 2FTLE 4I8JA 4P00A 3W94A 5GDSH 5T6DA 4ZHMU 1KXDA 4NFFA 4WXIA 1ELFA 3FN8A 1FPHH 3A7YA 1EZSC 5T3HA 8LPRA 1P06A 2JH6D 3SU1A 3ATLA 2RDEA 5HM9A 4JZFH 1Z1IA 1ZRKA 1DXPA 1ETRH 4MQAA 1O2JA 1H9HE 2NWNA 1CU1A 1XX9A 1TGSZ 1AFEH 3T27A 5A09A 1PQ7A 5FBIA 3RXAA 3RXCA 1P2KA 1FY8E 1OPHB 1TLDA 1LHCH 1GMDG 3MH5A 5A8YA 1QZ8A 3E0PB 4JYUH 3GY7A 3SJKA 1KLIH 1OYTH 4IBLH 2HWLB 4ZAEA 4K60A 4MPWA 2ZNKH 1TNKA 1ZHRA 1NESE 4UFFH 1NBMD 4Y7AA 4ZH8A 2VB0A 1FY4A 4A7IB 2J97A 1GL0E 2EI8A 1HCGA 5GPIB 1NPMA 5FL7D 1BHXB 4DVAU 2GT7A 1TRYA 4DURA 1FQ3A 3QLPH 1CVWH 2ZGHA 5JDUB 2VIDA 4AC9A 4ZMAH 3FVFB 5E0HA 3V7TA 1P3CA 1TALA 2NU3E 4DT7B 1DWBH 9ESTA 2W5EA 1HJAC 4Y8XA 1DSUA 1A0LA 4YOJA 1WTGH 3OY6U 3FZDA 2ANWA 2ZG0H 1UCYH 1GBTA 1YLNA 2BY8X 3SV7A 2D1JA 2PGQB 4YLUA 1QB1A 3HATH 1JRTA 1EZUC 3HGNA 2ZWLH 1BT7A 3SU2A 2VBCA 3QGNB 5AVDA 3OY5U 2GX4A 1SGQE 2XBXA 1GHAG 3I29A 5PTPA 1AIXH 2ALPA 1H9IE 2Z94A 4DY7B 2QF0A 1O2TA 1S83A 2SFAA 1NRPH 3SUGA 1THSH 1C5LH 5EIYA 1Y3XA 2J4IA 1BBRK 1THPB 3RLWH 2Z7FE 4WWYA 1VZQH 4Y11E 1TIOA 1CT4E 4X6OA 2XC4A 2VIPA 1GHVH 3OFND 3F3BA 2ZDLA 2QN5T 1J8AA 3DSGA 5I25A 3L3TA 4ISNA 3MNSA 2SGAA 1AVGH 2SNWA 3SU3A 1EJMA 1O2UA 3I77A 2VU8E 3N7DA 4K8BA 2ZPRA 1O5GH 2BDHA 3MU1A 4A5TS 2PTCE 1BOQA 4YTAA 1DLKB 3SJ9A 9LPRA 1GDUA 2ANMH 1P11E 1O5DH 1C1RA 3MNCA 2QIQA 3B8JA 3ZZ6A 1S6HA 1ZYOA 3QTOH 4KTCA 1TNGA 1ZSLA 2VVUA 4O03A 1GL1A 3OEHD 3SW2B 1EOJA 1YPKH 2IJOB 2XC5A 1HFDA 1V2OT 2IPQX 4X6NA 4F55A 4AFUA 1FPCH 3M5MA 2TGAA 2ANYA 1FN8A 2BQ6B 2W6ID 3E90B 1ELAA 1SOZA 2Z9GA 3V13A 1XUIA 1UTLM 1KXBA 4HGCA 2WPDD 1M9UA 1NRSH 1YM0A 3VXFH 1PPFE 2GV7A 4XE4A 1DX5M 1KIGH 1V3XA 1BTWA 2VVCA 3BIVH 1WV7H 3SU0A 4Q63A 1SFQB 1C2GA 1D9IA 2AMPA 2F9OA 3RXDA 2Q6FA 3U9AH 3U1IB 3U8RH 2ZTXA 1CO7E 1A7SA 1GHWH 5EXNA 3S69A 1GVLA 1O2HA 2J38A 4ZKNU 3RMOH 2EEKA 1EPTA 1B7XB 3ZV8A 4P02A 1ID5H 1HAGE 1BTYA 1HGTH 2HVYB 2BY6X 1SHHB 5FCRA 5FCKA 1HAYB 1P05A 3RXPA 3SUEA 1KDQA 2P16A 3TH3H 1PQAA 3SQHE 1UVOA 4NIYA 5DP6A 3RXOA 1D3QB 2ZI2H 4H4FA 1H8IH 3ZVFA 2D26C 3SV8A 1K9OE 2VNTA 3BG4C 3LGYA 5GNDA 1MTSA 1HXEH 1NC6A 1QURH 4ZCNA 1SQTA 3PO1C 4BAKB 1SGYE 4MG3A 4FXGH 5FAHA 4O3TA 4FVDA 5DP4A 1QB9A 1TBZH 2HNTC 1ELEE 3BTGE 4FUFA 4ACAA 3RMLH 3SGQE 1H1BA 1XUKA 4RN6A 4WMEA 3ZVBA 2GMTC 2QF5A 4BXSA 1TX6A 2OD3B 1FONA 1PFXC 1FXYA 3LH3A 3PV5A 1S85A 4B6FA 3AAVA 2H2ZA 1Y5AT 2W6JD 4E05H 3PRBA 1AN1E 8GCHF 1GVZA 2WZQA 2K1QA 2R2MB 1OHHD 3GY6A 3HKIB 5F03A 1WQVH 2P95A 4YZUA 2GCHF 1CA8B 5F53A 2PKSB 1FI8A 1FJSA 2P59A 1EJAA 2ULLA 5EQQA 1MU6B 4TY6A 4AFQA 5EXLA 2FTMA 4MPUA 3K6YA 1PPGE 2SGDE 3MQKC 5AHGH 1RFNA 1V2RT 2AYWA 3BTHE 3Q3KA 3U8TH 3U28C 1T31A 1HXFH 2BD3A 7LPRA 1KTTB 5EGMA 1SMFE 1NU9A 1C5ZB 3RXIA 3URCA 2VGCC 4BTUB 3SUFA 1H4WA 1UK2A 3A88A 1Z1JA 1TOMH 4BTIB 1ZSKA 1MU8B 2RFKC 2ZDAH 1ELBA 3TITA 2BLQA 2F9VA 8KME2 1C1OA 1MTVA 3UR9A 2FXRA 4AFSA 3NWUA 1BTXA 3VGCB 4CHAC 2B5TB 1H8HD 1WXRA 1LQDB 1ZOMA 3SV9A 1D4PB 2ZFSA 2KM0A 1C1QA 1S81A 2ZEBA 2BTCE 3M3TA 3ZIAD 1J17T 3ODDA 1O2IA 1AY6H 1EASA 1P57B 1EXFA 4NIXA 2WPLS 2KCPA 3KGPA 1W7GH 1EUFA 1V2UT 1O31A 3D65E 3MH4A 1KDQB 4FETA 1AVWA 2BOKA 1C2JA 2C4FH 2GVFA 5FPYA 2DE8A 2BD9A 1EAWA 4ACBA 1XMNB 1H8ED 1KMHB 3F0OA 3RMMH 4XDEA 2AGGX 2FEQH 3EDXB 1L1JA 2W26A 1A61H 3M5OA 2A4QA 4Q7YA 2JIZD 4UE7H 1TYNA 3FP8E 4LXBH 1GHAF 1NY22 4WH6A 4K1EA 4RT0A 6GCHG 1T8LA 4LOYH 3KQCA 1E36B 4RSPA 4DOQA 1TMTH 2ODYB 1BHXF 1RS0A 1GJAB 1V2MT 1PPCE 4MNXA 1BCUH 4CR9A 3MI4A 1TGTA 1O2QA 2B7DH 2BVRH 1ZRBA 2Z9LA 3RXVA 1YPHE 3F2GA 1AUTC 3STJA 1C4U2 4ABGA 1FY3A 2FOMB 1IQNA 1OWDA 3GOVB 3TJOA 1MD8A 2L6OA 1Q31A 3FAOA 1DT2A 2UUKB 4QT8C 2B8OH 2V3HH 4UFDH 1FZZA 1IQEA 4Y71A 2GZ7A 1LCYA 3PROA 4NA8A 4CREA 1LTOA 2G4TA 1HAVB 4K1TA 3BEFB 5K7RA 2ZTYA 1QBVH 1QTFA 1F0UA 1XUHA 1CGJE 3NXPA 3TLOA 5T6GA 1O3FA 1V2NT 2V7QD 1TPAE 3SGAE 3DA9B 4X8UH 2VH0A 4ZXXH 1P9SA 2FESH 2BD8A 4GLYA 2OLGA 1F5KU 3U1JB 3PWCA 1CGHA 2AEIH 3PV2A 5JPMH 1RRKA 1UVSH 2FOCA 5EPNA 2FOGA 1YPLH 3RXMA 1GHZA 2GV6A 3S0NA 1J16A 3D62A 1BRAA 1XUFA 1NFUA 1NS3A 4O3UA 2VH6A 4B6EA 4J1YA 3STIA 4Y8ZA 4A1XA 1SI5H 3CS0A 3N7OA 1W3CA 4NWKA 1IQKA 4FUHA 1MBQA 4XRNA 4DGJA 1AE8H 1DWCH 2PHBA 1UCYE 1AD8H 3V0XA 2HVXA 4E7RG 1ACBE 1F0TA 2ZF0H 1XUGA 4OS5A 3F9EA 2J95A 3KCGH 1Z6EA 1HAZB 4TT3D 1RTLA 2VIVA 3UNQA 2F9PA 3LGWA 3KQEA 1G3EA 1FIWA 2ZGXH 3RC6A 2J5UA 3UWJH 2OK5A 2GKVE 1TRMA 3BN9A 1MABB 1O2WA 1LHFH 1P3EA 2GT8A 4INKA 3E3TA 1DDJA 3DCLA 4WY3A 3N7EA 1F92A 4ZKRU 2QF4A 3ZZ3A 1TX7A 1L4DA 1VCQA 1C1UH 1A0JA 1QR3E 3C1KA 1CBWC 1DLEA 1DWEH 3BV9B 3MYWA 4ISLA 1QCPA 2A4GA 5EJLA 1O2YA 4IW4E 3S9BA 3MO3A 5AFZH 2QAAA 1ANBA 4B74A 4YM9A 3EA9A 4OGXA 3NCLA 3SYJA 1RIWC 1OWEA 1GMCF 2XCFA 1JXPA 3SO3A 1D6RA 1DANH 4AYVB 3TJUA 1KXFA 2GTBA 1AB9B 1T4VH 2KX4A 3N99A 1YY3A 1O3IA 2QXGA 2CMYA 2WUCA 1QQ4A 1TPSA 2VINA 4FUJA 4XSKU 3NRLA 2D2DA 2HPQH 1ELCA 2BM2A 2FS9A 2TRMA 1C5UA 3DSOA 2W7SA 1C9PA 5EODA 1O35A 1O36A 3GYMA 4I8KA 4FU8A 2XTTB 5IYTA 5TCAA 3B23B 4JZIA 2M5TA 1MUEB 1MAXA 1G3BA 2RDLA 1VITG 1EB2A 1LQEA 3PMJA 1GBLA 1O3GA 1P9UA 4XBDA 2P3UB 2NU2E 1GCTC 3VB6A 1SLUB 4I32A 3DHKH 1ZMLA 3TIUA 1K28D 1Y8TA 2ZC9H 1T8MA 4Z6AH 3TU7H 1P12E
chains in the Genus database with same CATH topology
2AHME 1BT7A 3SU2A 5EQSA 2VBCA 3M5NA 3VG8A 2OC0A 3KF2A 4A1TA 1COWD 5CDFE 3LONA 2CK3D 3O8RA 1NBME 2WHXA 4FETA 3SV8A 2YMSB 4YXWD 4TSFD 2JJ1D 2K0QA 3GS9A 2GVFA 5FPYA 5GNDA 5DSFA 3RC4A 2IJD1 5CHBA 3KEEA 4WH8A 3H09A 4I31A 3WWBA 4ZCNA 1H8ED 2KCOA 4M9FA 3WW7A 1KMHB 3FO8D 1RTLA 3F0OA 4TT3D 3SUGA 2JDID 2KCAA 3OEED 5DN6D 3AK5A 4B76A 3UB0A 3M5OA 4NWLA 1DY8A 2A4QA 3OYPA 1FX0B 2JIZD 4R8TB 2OINA 3RC6A 2J5UA 5HKKD 2OK5A 4U01A 2QF5A 2YMSC 3OAAD 3SU5A 1MABB 3OFND 3F3BA 2KZ4A 2GGVB 3O8DA 3PV5A 1BMFD 4WH6A 4B6FA 3SV6A 2KCYA 3DCLA 5FPSA 3SU4A 3FN8A 2W6JD 3PRBA 1EFRD 3N7EA 3P8OA 1E1QD 3KNXA 3FKSD 5EPYA 3SU1A 1S6LA 2QF4A 2WZQA 3SU3A 2K1QA 3LOXA 5ESBA 3N7DA 1OHHD 4K8BA 3RC5A 4B71A 3O8BA 2XNDD 1W0JD 4Q4LA 3PRDA 2KR7A 3M5LA 4A92A 1DXPA 5F53A 2A4GA 2P59A 1E79D 5EQQA 3LKWA 3F2GA 4XD7D 4B74A 4DT4A 3OTPA 3O8CA 1CU1A 3SYJA 2FOMB 4KTCA 2O8MA 5C17A 2XCFA 1JXPA 3SZEA 2L6OA 1W0KD 3OEHD 2HLDD 4JMYA 5IDKA 2IJOB 5C0TA 4F55A 3KN2A 4Z1MD 3N99A 4WF8A 4TYDA 2OC8A 2M2AA 3M5MA 2F4LA 1N1LA 3NRLA 2A4RA 2W6ID 4B73A 1SKYE 3E90B 5GJ4B 1RGQA 3DSOA 2OBQA 3SUFA 2WPDD 1NBMD 2V7QD 3OE7D 2OC1A 2KFWA 2OBOA 3P8NA 2F43B 5B6LA 2F9VA 5C0UA 5GPIB 3FOAA 3SU0A 5FL7D 4Q63A 2YMSD 1A1RA 1DY9A 3U1JB 2YOLA 3L6PA 5H4IB 2FM2A 3SUDA 1H8HD 4RI0A 5FPTA 1WXRA 1DXWA 2JJ2D 3U1IB 4A1VA 2WV9A 2LELA 2FP7B 2XOKD 3PV2A 4B75A 1E1RD 3EYDA 5T1VA 3SV9A 3F0PA 2KM0A 4I32A 5EPNA 3SU6A 3WWFA 4I33A 2XNIA 2QV1A 1NS3A 4ASUD 3F2FA 3W1EA 3ZIAD 5ETXA 5IK2D 2WSSD 2QE7D 4B6EA 4OM9A 2XCNA 2F9UA 3SUEA 3DSPA 5EQRA 3SV7A 4A1XA 3F2HA 2OC7A 1W3CA 4NWKA 2K8IA 2KCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCL A;  5FL7 D;  2W6J D;  5CDF E;  1COW D;  1EFR D;  1E1Q D;  2CK3 D;  2HLD D;  3FKS D;  4Z1M D;  3N99 A;  1NBM E;  1H8H D;  4YXW D;  4TSF D;  2JJ2 D;  2JJ1 D;  1OHH D;  2XOK D;  2XND D;  1W0J D;  4Q4L A;  1E1R D;  1H8E D;  2W6I D;  1KMH B;  4TT3 D;  1SKY E;  2JDI D;  3OEE D;  5DN6 D;  4ASU D;  1E79 D;  4XD7 D;  3ZIA D;  5IK2 D;  1FX0 B;  2JIZ D;  1NBM D;  2QE7 D;  2WPD D;  2WSS D;  5HKK D;  1W0K D;  2V7Q D;  3OE7 D;  3OAA D;  1MAB B;  3OFN D;  3OEH D;  2F43 B;  1BMF D; 
#chains in the Genus database with same CATH topology
 1CA0 C;  3RM2 H;  4K1S A;  3T29 A;  1O2L A;  5EXM A;  2WHX A;  5LPR A;  3M3S A;  2YMS B;  2K0Q A;  5C1U A;  2PP6 A;  1QFK H;  3KEE A;  1PPH E;  4WMD A;  5A8Z A;  3GYL B;  1P01 A;  1K1J A;  1KXC A;  1C5Q A;  3RXG A;  3SBK A;  1DWD H;  1LDT T;  1LKA A;  1V2L T;  2NU1 E;  2XBV A;  3UB0 A;  4ABB A;  1D3D B;  5A0C A;  3F6U H;  1LPK B;  2PSX A;  2OQ5 A;  1PJP A;  3EQ0 H;  3SV6 A;  2GGV B;  5JBB S;  1HBT H;  2KCY A;  3GDS A;  2UWP A;  3Q76 A;  4Q7Z A;  2OCV B;  3ELA H;  1GBH A;  5A8X A;  1PYT D;  3L33 A;  2P3F H;  1BRU P;  3IWM A;  2FX6 A;  1IQI A;  3ZYE A;  2QA9 E;  4ABD A;  4RKJ B;  1T8N A;  4X0W U;  1W8B H;  2TGT A;  4AX9 H;  1OKX A;  3GCH C;  3KHV A;  1W0Y H;  1OP0 A;  2FMJ A;  2SNV A;  3OTP A;  4XD7 D;  5DK1 A;  6GCH F;  5GXP A;  1HUT H;  1E0F D;  2QCY A;  3SJO A;  2EST E;  3GIC B;  3E16 B;  1GJ5 H;  5C0T A;  4U30 A;  1YLD A;  1Y59 T;  1BTH H;  1ZGV A;  2FI4 E;  2AGE X;  3ATW A;  3FP6 E;  1OP8 A;  4KKD A;  2Q6D A;  1ZPZ A;  4XBB A;  5F8Z A;  2CF8 H;  3URE A;  1G36 A;  4IMZ A;  1UTP A;  4LZ4 B;  1VIT H;  2RG3 A;  6CHA C;  1GBC A;  1QIX B;  3T2N A;  3RXS A;  1ESB A;  2VWO A;  3RXR A;  2CHA C;  4Y8Y A;  1BDA A;  1ZPC A;  3TK5 A;  3SOS A;  4CH8 B;  3UNS A;  1F5R A;  4AOQ A;  1O38 A;  1ZTL A;  3NK8 A;  4OS4 A;  4D9Q A;  1NFY A;  4FU7 A;  4ABJ A;  1Z8R A;  2XOK D;  1P2N A;  1C5S A;  4GHT A;  1C1M A;  5HIZ A;  4RT1 A;  1LVO A;  5CMX H;  4J2Y B;  3LIW A;  2J2U A;  4AOR A;  5E0J A;  4YT7 H;  3MWI U;  4MLF B;  1UHB A;  4IS5 A;  4A6L A;  3AAS A;  7GCH G;  1ELD E;  1SQA A;  1DS2 E;  1OWH A;  2R2W U;  3M5N A;  3MTY A;  4DG4 A;  3LON A;  1KSN A;  2CK3 D;  1K1M A;  5TCC A;  1MKX H;  1TPP A;  3KID U;  3GY3 A;  3A8D A;  5DPA A;  2SGF E;  1JIR A;  5DJ7 A;  1QJ6 B;  2KCO A;  3MH6 A;  3RXJ A;  2C8Z B;  3UTU H;  4NIV A;  3QN7 A;  4HZH A;  3AK5 A;  1O2K A;  2ZHQ H;  1OWK A;  1GMH G;  1DY8 A;  1VGC B;  1C5W B;  2OIN A;  1BIO A;  1Y3W A;  2A5K A;  2OXS A;  2J9N A;  1G3D A;  1MTN C;  2UUJ B;  3SND A;  2GD4 B;  1SGE E;  4YOG A;  1TNJ A;  1GJC B;  7KME H;  2ZHF H;  5FXL A;  1E1Q D;  3S9C A;  1W2K H;  1BQY A;  4CR5 A;  3QUM P;  1GBB A;  3LJJ A;  3RDZ A;  1TE0 A;  3RXK A;  1Z71 A;  2V3O H;  1NFW A;  1F5L A;  1P2I A;  1U6Q A;  1G9I E;  1EB1 H;  1SOT A;  3P8F A;  1UVT H;  1N8O B;  2FOH A;  1WCZ A;  3RXB A;  3UUZ A;  1TPO A;  1GHX H;  1S84 A;  2J34 A;  1DOJ A;  5F8T A;  1KLJ H;  3KQD A;  3H7T A;  1GI5 A;  1O3L A;  4NFE A;  1Q3X A;  2G4U A;  2BX3 A;  1ARC A;  1P09 A;  1MZD A;  1Z8G A;  3F9G A;  1O3N A;  2BD5 A;  3A7W A;  3EST A;  1N6X A;  5LPF A;  3I78 A;  1H8D H;  1Q2W A;  1SKY E;  1O33 A;  5GJ4 B;  3PMA B;  1C2E A;  5F6M A;  2FOE A;  4JZ1 A;  1BB0 B;  3KYG A;  1GJD B;  2D8W A;  4IC6 A;  4B2C A;  1HAO H;  3TVJ B;  1MBM A;  1MAY A;  1AWF H;  1PYT C;  2ZFQ H;  1UK3 A;  3RXE A;  5L6N H;  5EU8 A;  3TH4 H;  3BIU H;  2YOL A;  1HPG A;  2G55 A;  4DJZ B;  1K21 H;  3EAJ A;  5J4Q A;  1K1I A;  4BTT B;  2JKH A;  2LEL A;  3A80 A;  3LT3 A;  4AG1 A;  1SL3 A;  2RA0 A;  1TA2 A;  1MD7 A;  4X2Y A;  1EPT C;  1TAB E;  4Y6D A;  3SJ8 A;  1YGC H;  1V2W T;  5GWZ A;  1ETS H;  5EJ1 A;  4AG2 A;  1ANC A;  5ETX A;  3U8O H;  4IN2 A;  1Y5B T;  2PUQ H;  2ZIQ H;  3F2H A;  1VIT F;  3RM0 H;  1YPM H;  1J9C H;  1RXP A;  2AER H;  1FV9 A;  2V35 A;  1QJ1 B;  2A2Q H;  5CDF E;  1UHB B;  1AQ7 A;  3O8R A;  4HI3 A;  1IQG A;  4Y0Y E;  2BQ7 B;  4GUX A;  2WPI S;  5DSF A;  1SFI A;  2IJD 1;  1XKA C;  3RC4 A;  6EST A;  1GI2 A;  3KQB A;  4MNW A;  3Q00 A;  3P95 A;  1A3E H;  2GCT C;  3NZI A;  3ZVE A;  2A45 B;  3PB1 E;  2HLC A;  1AGJ A;  1V2S T;  2ZA5 A;  4U01 A;  2FI3 E;  1NRO H;  1QBO A;  1TFX A;  3BTQ E;  4I86 A;  1C2L A;  1EST A;  1G30 B;  1MCV A;  2BDC A;  2F83 A;  1L2E A;  1EFR D;  4NZL A;  1BTU A;  1YP9 A;  2GZ8 A;  2PW8 H;  1GVK B;  2G8T A;  2BZA A;  1DFP A;  4B71 A;  2XND D;  5DO4 H;  5KED A;  2J98 A;  4BXW A;  3QK1 A;  3SNC A;  2GDE H;  2DUC A;  3PTN A;  1C1P A;  1O3A A;  3RLY H;  2A0Q B;  4K69 A;  3VB4 A;  1S82 A;  1O2N A;  3GIS B;  4CH2 B;  2RA3 A;  3TK9 A;  2BX4 A;  2VWN A;  4FOU C;  3A7Z A;  2BY7 X;  2R3Y A;  2Z3C A;  1GI1 A;  2G52 A;  1V6D A;  1W14 U;  2C8Y B;  2WPK S;  5K0H A;  2ZO3 H;  4Z1M D;  4MPV A;  2M2A A;  3GCN A;  1ZJD A;  1HAI H;  2WPM S;  4AGK A;  4BAN B;  1SLV B;  4X1S U;  4CRB A;  1KTS B;  1C2I A;  1FLE E;  4IN1 A;  4FUG A;  1KXE A;  3BF6 H;  3CP7 A;  4FU9 A;  1FAX A;  2JET C;  1HJA B;  2BD7 A;  2F43 B;  1YPJ H;  1HAV A;  1TRN A;  1Y3V A;  2EQN A;  1LHG H;  1W12 U;  2V0B A;  4ISO A;  3V12 A;  4A1V A;  1O2R A;  2IPH A;  3T25 A;  4ISI H;  1C4V 2;  1QY6 A;  1O5C B;  3UNR A;  1CQQ A;  2AGI X;  2XC0 A;  2XNI A;  1LVM A;  1SG8 B;  3E8L A;  3KL6 A;  3ZZ5 A;  2Z3E A;  1ARB A;  5EOK A;  8EST E;  4OM9 A;  4DII H;  4ZHA A;  1GGD C;  2G5V A;  1GBI A;  2WIN I;  3P8G A;  1GMD F;  1FMG A;  1PPZ A;  2CJI A;  3MU0 A;  4IC5 A;  4H6S B;  1D3T B;  1NBM E;  2WV5 A;  3GY4 A;  1EQ9 A;  1FY1 A;  1O3E A;  4OS1 A;  2LP6 A;  3QTV H;  1Y3U A;  5CHB A;  1GG6 C;  3HPT B;  3H09 A;  2FWW A;  1UK4 A;  2Y5G A;  4M9F A;  1C5P A;  7GCH F;  2Q1J A;  3BTM E;  2BZ6 H;  1C2K A;  3IIT A;  1A5I A;  1HAH H;  2ZFR H;  1UVP A;  2EI7 A;  2F9B H;  3T5F H;  1YCP H;  2BD4 A;  3FKS D;  1YPE H;  4BOH A;  1QA7 A;  5EST E;  1J15 A;  2J94 A;  4PRO A;  2DE9 A;  5F8X A;  3A8B A;  3TJV A;  1GJB B;  1SB1 H;  1IQF A;  1EOL A;  1KY9 A;  2BLV A;  3G01 A;  3GCO A;  2ZCH P;  1AFQ C;  2GP9 B;  3VB7 A;  4SGA E;  2J98 B;  3CS7 A;  1GBJ A;  2PFE A;  4JMY A;  2P94 A;  3NUM A;  5C5O A;  2P8O C;  2ILN A;  3KN2 A;  1GI3 A;  5TJX A;  2RCE A;  4WF8 A;  1B0F A;  4UFE H;  1XXD A;  4INL A;  3M36 A;  3KQ5 A;  3C27 B;  3TGK E;  2VVV A;  1A0H B;  3SHA H;  2XBY A;  1S6F A;  2A4R A;  2LNC A;  1O3B A;  1CHO G;  1O2O A;  1MKX K;  2Y80 A;  3ITI A;  3LU9 B;  1GI4 A;  3LGU A;  1C5X B;  5G4B A;  3RUO A;  1CSO E;  3K9X B;  1SHY A;  1C1N A;  1B0E A;  3GY2 A;  1QL7 A;  4VGC C;  2IOT A;  1V2K T;  5H4I B;  1V2P T;  1WSS H;  3QZR A;  1UCY K;  2JJ2 D;  2WV9 A;  1TAW A;  2WV4 A;  2G81 E;  1WOF A;  2A1D B;  1TBR H;  1FDP A;  2Q6G A;  1O34 A;  5EW1 H;  1TMU H;  3HKJ B;  3DFJ A;  3SNA A;  1RD3 B;  2ZGC A;  1JMO H;  3BG4 B;  3W1E A;  2FDA A;  3MHW U;  1GJ7 B;  2BY9 X;  5EG4 A;  2CF9 H;  3PO1 B;  4F4O C;  1O5A B;  4X1Q U;  2FX4 A;  4LK4 A;  2VIW A;  2ZU4 A;  2K8I A;  2AHM E;  5DP9 A;  1MH0 A;  2V3M A;  3R3G B;  3VXE H;  1C2M A;  1C5O H;  1SGN E;  2GMT B;  2C8X B;  1VKY A;  1ELT A;  1EKB B;  1UTN A;  4AFZ A;  5LPE A;  4GSO A;  3P17 H;  2KCA A;  5DG6 A;  1WDI A;  4MTB A;  5CHA C;  1QHR B;  2KZ4 A;  3RXT A;  1WBG B;  2UUF B;  2SGP E;  1P2J A;  1OOK B;  1BBR H;  1C5M D;  2FI5 E;  1AVX A;  2O9Q A;  2XRC A;  4WVP E;  3RXU A;  4ABH A;  1GJ8 B;  4Q4L A;  5B6O A;  1WU1 A;  2CN0 H;  1HYL A;  4SGB E;  1YPG H;  1IQH A;  4Y10 E;  2AIQ A;  2R3U A;  5EJZ A;  1K1L A;  4WMF A;  2O8M A;  4NGA H;  1BIT A;  4CRG A;  3ATI A;  2JH5 D;  3SZE A;  4E06 H;  2A7J A;  1FAK H;  1SQO A;  1OSS A;  1TNL A;  2VGC B;  2V6N A;  2ZDM A;  1TBQ H;  1HJ8 A;  4ZRO A;  3SJI A;  1L1N A;  1DE7 H;  1FIZ A;  1GBD A;  2XWB I;  4CRA A;  3A89 A;  1XM1 A;  1F2S E;  1UTK A;  2QXH A;  4EST E;  4K2Y A;  1ZTJ A;  4MNY A;  2ZU3 A;  1RGQ A;  7EST E;  4B1T A;  1E37 B;  4CHA B;  5C67 A;  1PQ5 A;  3UY9 A;  2FOB A;  2NU4 E;  2C90 B;  1HRT H;  3EA8 A;  2OC1 A;  1EZQ A;  4FUI A;  1HDT H;  3LH1 A;  4F48 B;  2KFW A;  2QYI A;  5B6L A;  5E2O A;  5L2Y H;  1QA0 A;  1EAX A;  4D8N A;  4YOI A;  2ZCL P;  4D76 A;  1O2G H;  3GY5 A;  1OXG A;  3L6P A;  2FM2 A;  3MFJ A;  5FPT A;  3BSQ A;  4BAQ B;  1MQ6 A;  5HGG A;  1JBU H;  3F0P A;  4YES B;  1C5Y B;  1GBM A;  3HGP A;  2VJ1 A;  3SU6 A;  3M7Q A;  1BTP A;  1VJA U;  1GDQ A;  1BMN H;  4Q7X A;  3F2F A;  1ZPB A;  3ATK A;  1O3M A;  1TA6 A;  3QX5 H;  4YT6 H;  2H9T H;  4IMQ A;  5EQR A;  2ZDV H;  5E2P A;  2Z9I A;  1BMM H;  1E34 B;  3RU4 E;  2H1U A;  3IG6 B;  3S7H B;  1BRC E;  1P03 A;  4HG6 A;  3LJO A;  4ABE A;  1TMB H;  4KEL A;  2QC2 A;  4TSF D;  3GS9 A;  3T26 A;  1ZSJ A;  3ZYD A;  4U2W A;  4D7G A;  4THN H;  2FLR H;  1W11 U;  1SPJ A;  2THF B;  5C1X A;  1O37 A;  1EAU A;  4NWL A;  4Y7B A;  2VIQ A;  4D9R A;  2YNA A;  2FYQ A;  3TPI Z;  2A5A A;  1HV7 A;  5FPS A;  1P0S H;  1XKB C;  5FX6 A;  2BY5 X;  3ZZ7 A;  2BYA X;  1X7A C;  2A2X H;  2WYG A;  4KGA A;  3M61 U;  1YKT A;  2Z6B D;  1TON A;  2XW9 A;  2PWX A;  2BD2 A;  1UJ1 A;  1BTZ A;  4CRD A;  1AU8 A;  3SZN A;  1GHB G;  3ZVC A;  3PMB B;  2EA3 A;  2ZU5 A;  2ZHE H;  1BJU A;  1TB6 H;  2C8W B;  3H7O A;  4UD9 H;  3UFA A;  4ASH A;  3GY8 A;  2IN2 A;  2VWL A;  4ABF A;  2VWM A;  3SI4 H;  2PUX B;  1E35 B;  1D6W A;  5DKM A;  4AB9 A;  4JCN A;  1NN6 A;  2BVS H;  2B0F A;  2TGP Z;  2G5N A;  3P92 A;  2WPH S;  3UQV A;  4UFG H;  1TNI A;  3M7T A;  2ZQ2 A;  3PYH A;  1C2D A;  2GDD A;  3PWB A;  1MCT A;  2OBQ A;  1OP2 A;  2W3K A;  4RKO B;  2FS8 A;  3R0F A;  2BDA A;  2EY4 C;  3UQO A;  4NZQ A;  3FOA A;  1JIM A;  3PLB A;  3JZ1 B;  2FYR A;  1EAI A;  5T1V A;  3ENS B;  2G00 A;  5FBE A;  3DT0 H;  1K1N A;  1K2I 1;  1SGP E;  3WWF A;  1GJ9 B;  3D23 A;  2XYA A;  1T32 A;  1C1V H;  5BPE A;  5IK2 D;  4D7F A;  1W13 U;  2XCN A;  2F9U A;  3ODF A;  4AZ2 B;  1OS8 A;  1GI8 B;  3TJN A;  2Z9J A;  1SGT A;  4B73 A;  1A46 H;  3HK6 B;  2R0K A;  2AMD A;  5JBT A;  1T8O A;  2VIO A;  3ZZ9 A;  4A1T A;  1YWU A;  4X8S H;  4CRC A;  1DUE A;  2XWA A;  2NU0 E;  2PGB B;  3M7U A;  1O30 A;  3MMG A;  4YXW D;  1C1W H;  3UOU A;  4FVB A;  3UPE A;  3MU4 A;  1O39 A;  3QDZ B;  2A7H A;  3AW0 A;  1CGI E;  2PKA A;  1HJ9 A;  1EZX C;  1GBE A;  1UO6 A;  2BOH B;  1O5F H;  1TGN A;  4GCH G;  1AZZ A;  4R8T B;  3VPK A;  1CBW B;  5JBA S;  3OAA D;  3Q3X A;  3BTE E;  4NG9 H;  2TBS A;  1XVO A;  1AO5 A;  4GVU A;  4ZKS U;  1JOU B;  4CBN A;  2ZDK A;  1C5V A;  5HYO A;  1RIW B;  3ZZ4 A;  3PTB A;  2P93 A;  1SVP A;  1AE5 A;  3A8A A;  4JK6 A;  3MNX A;  1MZA A;  1RTF B;  2BDG A;  3PRD A;  4B2A A;  1HNE E;  3ZVD A;  1HIA B;  3ATM A;  3SNE A;  1EP5 A;  4XBC A;  5KGO A;  3ZVG A;  1O2V A;  1FY5 A;  3CNR A;  5CE1 A;  1E79 D;  4DT4 A;  3MO6 A;  5DP3 A;  1ETT H;  1KLT A;  3UR6 A;  2BLO A;  1DPO A;  4O9V A;  1F7Z A;  1AMH A;  2OP9 A;  2H9E H;  1ZZZ A;  2F3C E;  2PKS C;  1V2T T;  5A2M H;  2WYJ A;  2HNT F;  1GI7 B;  1B5G H;  4TYD A;  4AB8 A;  2OTV A;  1C5N H;  2F9N A;  2A4O A;  4K8Y A;  1A4W H;  4O97 A;  1DM4 B;  1J14 A;  3PM3 A;  3QZQ A;  2JH0 D;  1O32 A;  1T7C A;  1EX3 A;  1MTW A;  3MNB A;  5A0B A;  1GCT B;  4X1R U;  3OE7 D;  2ZFT A;  3BTD E;  4NA7 A;  1IQJ A;  4M7G A;  2OUA A;  4Y0Z E;  3SUD A;  1W10 U;  3A82 A;  2R9P A;  1ZHP A;  3MU5 A;  4B75 A;  4WJG 2;  1LO6 A;  1CA0 B;  3ZZC A;  2QV1 A;  5AF9 H;  1CT2 E;  2CGA A;  3VGC C;  2QE7 D;  2STA E;  3ZVA A;  1SQR A;  5HMA A;  2HAL A;  1Y3Y A;  1YBW A;  1DIT H;  1GCD A;  1SGF G;  3FP7 E;  2OC0 A;  3KF2 A;  4MPX A;  4HFP B;  2ZP0 H;  3TH2 H;  2PSY A;  1HB0 B;  2Y5H A;  4I8L A;  4WH8 A;  4BAH B;  1ZJK A;  2F91 A;  5GCH G;  2JDI D;  1T4U H;  3SV2 H;  3VB3 A;  1D3P B;  1FNI A;  1YC0 A;  3DFL A;  5E0G A;  4IGD A;  2PKA B;  1OYQ A;  3SU5 A;  1ZLR A;  2BB4 A;  3F1S B;  3RXH A;  4CRF A;  2Y82 A;  3GCH B;  4FUC A;  1HAP H;  2B9L A;  3LC3 A;  3OTJ E;  3P8O A;  4MNV A;  1LPG B;  2A32 A;  1O2S A;  4JYV H;  5LH8 A;  3LOX A;  2ZDN A;  1A5G H;  1OWJ A;  1LHD H;  4A92 A;  3AVZ A;  1BBR E;  4FUD A;  2TIO A;  5JBC S;  1O2Z A;  1A5H A;  1UTM A;  4KTS A;  1LMW B;  4X8V H;  2CXV A;  1QL8 A;  3LDX H;  2H5D A;  3ZV9 A;  1G2L A;  1TQ7 B;  1NO9 H;  2CV3 A;  1E38 B;  3BG8 A;  3TGJ E;  4TY7 A;  1LVB A;  1O3D A;  3OU0 A;  1QJ7 B;  4NSY A;  4DIH H;  6CHA B;  2O8L A;  2OC8 A;  1P8V C;  2CHA B;  3GCT G;  1GHB F;  2W7U A;  4BNR A;  5EW2 H;  4ZUH A;  2F4L A;  1N1L A;  3A8C A;  1MTU A;  4H42 U;  5JYI A;  3SN8 A;  1TX8 A;  1O3C A;  4DCD A;  1TWX B;  2ANK H;  2OQU A;  4OS2 A;  1LHE H;  1WAY B;  2BLW A;  3VEQ B;  1BRB E;  1K22 H;  1ZHM A;  4X1N U;  3TNT A;  4GAW A;  1GWA A;  3GDV A;  5DP8 A;  1SR5 C;  1BZX E;  2Y5F A;  1YLC A;  1A1R A;  2YMS D;  4GHQ A;  1L1G A;  2BDI A;  3T62 A;  2HOB A;  3RXF A;  2AFQ B;  4MDS A;  4LZ1 H;  1V2J T;  3A7T A;  2FP7 B;  1AKS A;  1G37 A;  4BAO B;  5T6F A;  1E1R D;  1ELG A;  3H5C B;  4JYT A;  5C1Y A;  4X2X A;  3QO6 A;  1NZQ H;  1C9T A;  1Z6J H;  2XXL A;  3BTF E;  3WY8 A;  2W3I A;  1BJV A;  3EA7 A;  1UMA H;  1XVM A;  4NCY A;  1DIC A;  2O8U A;  1IAU A;  1W7X H;  3LC5 A;  1DVA H;  2ZU2 A;  1MQ5 A;  2FZZ A;  5E8E H;  2Y6T A;  3S7K B;  1ZMN A;  1GMC G;  1G3C A;  1QRX A;  3EE0 B;  4TWW A;  2Y7X A;  1XUJ A;  5C3N A;  1BMA A;  3GDU A;  2FPZ A;  1MTN B;  1CHG A;  1GBA A;  2GJG A;  3WWB A;  5C5N A;  5HM2 A;  3FO8 D;  2STB E;  3OEE D;  1ORF A;  1Z7K A;  6LPR A;  4ABA A;  2ODP A;  1INC A;  1JRS A;  2HRV A;  2ZZU H;  1FX0 B;  4TPI Z;  1EAT A;  1K1O A;  5HKK D;  3E91 A;  4X8T H;  3NPS A;  2FIR H;  1BMF D;  4OS7 A;  1P2Q A;  2H6M A;  1LVY A;  5HXF A;  1MKW H;  4E7N A;  3P6Z B;  2SGQ E;  1QBN A;  3O8B A;  2FOD A;  1A2C H;  1G32 B;  3RU4 D;  2HNT E;  3FZZ A;  4F49 A;  4INH A;  1Z8J B;  4GCH F;  1SSX A;  1OWI A;  5SGA E;  4CBO A;  4UEH H;  1C4Y 2;  1GHY H;  3BEU A;  5L2Z H;  4AN7 A;  1PPB H;  4X1P U;  3A85 A;  1TNH A;  1P10 A;  5C17 A;  4WXV A;  4ZHL U;  1YPH C;  2ZCK P;  1W0K D;  1ANE A;  1QGF A;  4NSV A;  5IDK A;  1ZR0 A;  4X6P A;  3NKK A;  1AUJ A;  5GIB A;  1WYK A;  2O8W A;  3UWI A;  3SHC H;  1TQ0 B;  4K3J A;  3U98 H;  1YYY 1;  1YF4 A;  1O2M A;  2ZEC A;  2XBW A;  1GMH F;  2QY0 B;  2ZTZ A;  3M3V A;  1ELV A;  1JWT A;  1RJX B;  1EP6 A;  5FX5 A;  1DST A;  2FLB H;  3TGI E;  1AB9 C;  2AIP A;  1EPT B;  3HK3 B;  4NIW A;  1EJN A;  1NRN H;  4X2V A;  2OBO A;  2KAI A;  1GI9 B;  1A3B H;  3UAI C;  4DW2 U;  1GBK A;  4YO9 A;  2Z3D A;  4RI0 A;  3SOR A;  1QNJ A;  5ABW A;  3SNB A;  3EYD A;  2BVX H;  1AWH B;  4U32 A;  1NM6 A;  1P2O A;  3M35 A;  2P3T B;  1SC8 U;  1AKS B;  4Q80 A;  1C5R A;  3F9F A;  2GZ9 A;  1IOE A;  2J92 A;  2Y81 A;  1V2V T;  2PV9 B;  3A87 A;  3BTW E;  2GCT B;  4Z0K A;  2QXI A;  4HTC H;  2EC9 H;  4JK5 A;  3VG8 A;  3P70 B;  1QQU A;  1OX1 A;  1ABI H;  3PMH B;  1SLX B;  2A5I A;  2BDY A;  1BUI A;  5FHT A;  3WW7 A;  1O3H A;  1L0Z A;  5DN6 D;  3W95 A;  1O2P A;  5L30 H;  2BQW B;  1WUN H;  1S5S A;  1W0Z U;  4OGY A;  1O3K A;  5JB8 S;  2YMS C;  3SI3 H;  1O3J A;  3MOC A;  1IHT H;  3EGK H;  3PLK A;  3D49 H;  2Y7Z A;  4X6M A;  3K2U A;  1NFX A;  3FFG A;  2SGE E;  3KNX A;  1GI6 A;  2EI6 A;  1S6L A;  4XFQ A;  4KP0 A;  5ESB A;  3RC5 A;  5GCH F;  5HIY A;  1TOC B;  1ESA A;  1VCP A;  1W0J D;  1O5B B;  3M5L A;  2ASU B;  1NRQ H;  1MMJ N;  4KTU A;  3LGI A;  3RMN H;  1KXA A;  4B2B A;  4R0I A;  2ZHW H;  1Y5U T;  4I8H A;  3LPR A;  3LKW A;  2ALV A;  3TNS A;  1WQS A;  4X2W A;  1BML A;  3B9F H;  4ZKO U;  3PLP A;  2FOA A;  1SGC A;  3ZZB A;  2ZGB H;  1SBW A;  1O3P B;  2A31 A;  2TPI Z;  3LGV A;  2Z9K A;  1HLT H;  1PQ8 A;  1QL9 A;  3EE7 A;  2JET B;  2HGT H;  1KYN A;  1N6Y A;  3AW1 A;  1IHS H;  1S0R A;  3MU8 A;  3QGJ A;  2C93 B;  3A83 A;  1VJ9 U;  5J4S A;  1P02 A;  1TGB A;  5DP7 A;  3PV4 A;  1WTH D;  3UIR A;  3SGB E;  4NA9 H;  1ZTK A;  2BXU H;  1P04 A;  3P8N A;  3DD2 H;  4Y79 A;  3SQE E;  1AND A;  3GCT F;  2HPP H;  1DY9 A;  4ZXY H;  5C94 A;  1IQL A;  3CEN A;  1FN6 A;  3ZZ8 A;  1SLW B;  1GGD B;  3OX7 U;  3FAN A;  2KAI B;  2ZFF H;  2ZPQ A;  1NT1 A;  3BTT E;  1FUJ A;  3JZ2 B;  3U69 H;  3V3M A;  2PR3 A;  5BRR E;  1SGI B;  2C3S A;  4ISH H;  1QRW A;  1QRZ A;  4I33 A;  4K5Z A;  1C5T A;  1PPE E;  1ABJ H;  1S0Q A;  2PLX A;  4JZD H;  4ASU D;  3A86 A;  4JZE H;  3A7X A;  2WSS D;  4GPG A;  1F0S A;  1GG6 B;  2L74 A;  3DSP A;  4FUB A;  2BDB A;  1Z8I B;  5AFY H;  2LPR A;  2ZGJ A;  3TK6 A;  1GJ4 H;  2BHG A;  3KYF A;  1RTK A;  3VFE A;  5EQS A;  4OS6 A;  3URD A;  1C1S A;  1AI8 H;  2AS9 A;  4UON A;  3LGT A;  5KEC A;  3VB5 A;  2AH4 X;  2FOF A;  2PTN A;  1UTJ A;  3OSY A;  4YLQ H;  3K65 B;  3OYP A;  1AHT H;  1O3O A;  2YNB A;  1GBF A;  2G51 A;  1NU7 B;  1SGR E;  1AZ8 A;  1H9L B;  3O8D A;  4H6T A;  2ZPS A;  3SU4 A;  2ODQ A;  1AFQ B;  3F9H A;  1HAX B;  5EPY A;  1VR1 H;  2I6S A;  2ZHD A;  2QGR A;  4Q2K A;  4TPY A;  3A7V A;  1VGC C;  4BAM B;  1DUA A;  3BEI B;  1UW7 A;  1F0R A;  2KR7 A;  1SGD E;  2WPJ S;  2O8T A;  2P8O B;  1UTQ A;  3ZZD A;  1THR H;  1YCP M;  1C2H A;  2I6Q A;  4Y76 A;  3RXL A;  3O8C A;  2AMQ A;  5LGO A;  4I7Y H;  3QWC H;  3K6Z A;  2R0L A;  5C2Z A;  3Q77 A;  3E6P H;  3MO9 A;  2HLD D;  1LPZ B;  3RXQ A;  2ZKS A;  1HIA A;  2BMG B;  4UDW H;  4TWY A;  1N8O C;  1NRR H;  5I46 H;  2UWO A;  3MH7 A;  3M37 A;  3AAU A;  4VGC B;  3T28 A;  1ZMJ A;  2ZU1 A;  1GPZ A;  4AYY B;  1UVU H;  2QXJ A;  2ZFP H;  1P2M A;  1GJ6 A;  2WUB A;  5DGJ A;  1GI0 A;  4I8G A;  5C0U A;  3UOP A;  2H5C A;  1IQM A;  2UWL A;  1CT0 E;  1C1T A;  1K1P A;  1XXF A;  2FO9 A;  1ZGI A;  1SGF A;  3BTK E;  2QF3 A;  3A84 A;  3A81 A;  3E1X B;  3RU4 T;  1MKW K;  1O5E H;  2ZQ1 A;  4FUE A;  3S9A A;  5DP5 A;  2BXT H;  1NTP A;  1VCW A;  2OC7 A;  1O0D H;  1DXW A;  2UUY A;  4XOJ A;  4AGJ A;  1QB6 A;  1BA8 B;  1COW D;  3F68 H;  2A7C A;  5CHA B;  4MVN A;  2JJ1 D;  3DUX H;  5C20 A;  1CHO F;  1O2X A;  1V2Q T;  1GDN A;  1TGC A;  3ZZA A;  4ABI A;  5A0A E;  1UTO A;  4I31 A;  8GCH G;  3Q3Y A;  1G2M A;  1CE5 A;  1K0H A;  1L4Z A;  1YCP K;  1C2F A;  4B76 A;  2GCH G;  2H9H A;  3RP2 A;  5JB9 S;  1LKB A;  3E0N B;  2TGD A;  2FTL E;  4I8J A;  4P00 A;  3W94 A;  5GDS H;  5T6D A;  4ZHM U;  1KXD A;  4NFF A;  4WXI A;  1ELF A;  3FN8 A;  1FPH H;  3A7Y A;  1EZS C;  5T3H A;  8LPR A;  1P06 A;  2JH6 D;  3SU1 A;  3ATL A;  2RDE A;  5HM9 A;  4JZF H;  1Z1I A;  1ZRK A;  1DXP A;  1ETR H;  4MQA A;  1O2J A;  1H9H E;  2NWN A;  1CU1 A;  1XX9 A;  1TGS Z;  1AFE H;  3T27 A;  5A09 A;  1PQ7 A;  5FBI A;  3RXA A;  3RXC A;  1P2K A;  1FY8 E;  1OPH B;  1TLD A;  1LHC H;  1GMD G;  3MH5 A;  5A8Y A;  1QZ8 A;  3E0P B;  4JYU H;  3GY7 A;  3SJK A;  1KLI H;  1OYT H;  4IBL H;  2HWL B;  4ZAE A;  4K60 A;  4MPW A;  2ZNK H;  1TNK A;  1ZHR A;  1NES E;  4UFF H;  1NBM D;  4Y7A A;  4ZH8 A;  2VB0 A;  1FY4 A;  4A7I B;  2J97 A;  1GL0 E;  2EI8 A;  1HCG A;  5GPI B;  1NPM A;  5FL7 D;  1BHX B;  4DVA U;  2GT7 A;  1TRY A;  4DUR A;  1FQ3 A;  3QLP H;  1CVW H;  2ZGH A;  5JDU B;  2VID A;  4AC9 A;  4ZMA H;  3FVF B;  5E0H A;  3V7T A;  1P3C A;  1TAL A;  2NU3 E;  4DT7 B;  1DWB H;  9EST A;  2W5E A;  1HJA C;  4Y8X A;  1DSU A;  1A0L A;  4YOJ A;  1WTG H;  3OY6 U;  3FZD A;  2ANW A;  2ZG0 H;  1UCY H;  1GBT A;  1YLN A;  2BY8 X;  3SV7 A;  2D1J A;  2PGQ B;  4YLU A;  1QB1 A;  3HAT H;  1JRT A;  1EZU C;  3HGN A;  2ZWL H;  1BT7 A;  3SU2 A;  2VBC A;  3QGN B;  5AVD A;  3OY5 U;  2GX4 A;  1SGQ E;  2XBX A;  1GHA G;  3I29 A;  5PTP A;  1AIX H;  2ALP A;  1H9I E;  2Z94 A;  4DY7 B;  2QF0 A;  1O2T A;  1S83 A;  2SFA A;  1NRP H;  3SUG A;  1THS H;  1C5L H;  5EIY A;  1Y3X A;  2J4I A;  1BBR K;  1THP B;  3RLW H;  2Z7F E;  4WWY A;  1VZQ H;  4Y11 E;  1TIO A;  1CT4 E;  4X6O A;  2XC4 A;  2VIP A;  1GHV H;  3OFN D;  3F3B A;  2ZDL A;  2QN5 T;  1J8A A;  3DSG A;  5I25 A;  3L3T A;  4ISN A;  3MNS A;  2SGA A;  1AVG H;  2SNW A;  3SU3 A;  1EJM A;  1O2U A;  3I77 A;  2VU8 E;  3N7D A;  4K8B A;  2ZPR A;  1O5G H;  2BDH A;  3MU1 A;  4A5T S;  2PTC E;  1BOQ A;  4YTA A;  1DLK B;  3SJ9 A;  9LPR A;  1GDU A;  2ANM H;  1P11 E;  1O5D H;  1C1R A;  3MNC A;  2QIQ A;  3B8J A;  3ZZ6 A;  1S6H A;  1ZYO A;  3QTO H;  4KTC A;  1TNG A;  1ZSL A;  2VVU A;  4O03 A;  1GL1 A;  3OEH D;  3SW2 B;  1EOJ A;  1YPK H;  2IJO B;  2XC5 A;  1HFD A;  1V2O T;  2IPQ X;  4X6N A;  4F55 A;  4AFU A;  1FPC H;  3M5M A;  2TGA A;  2ANY A;  1FN8 A;  2BQ6 B;  2W6I D;  3E90 B;  1ELA A;  1SOZ A;  2Z9G A;  3V13 A;  1XUI A;  1UTL M;  1KXB A;  4HGC A;  2WPD D;  1M9U A;  1NRS H;  1YM0 A;  3VXF H;  1PPF E;  2GV7 A;  4XE4 A;  1DX5 M;  1KIG H;  1V3X A;  1BTW A;  2VVC A;  3BIV H;  1WV7 H;  3SU0 A;  4Q63 A;  1SFQ B;  1C2G A;  1D9I A;  2AMP A;  2F9O A;  3RXD A;  2Q6F A;  3U9A H;  3U1I B;  3U8R H;  2ZTX A;  1CO7 E;  1A7S A;  1GHW H;  5EXN A;  3S69 A;  1GVL A;  1O2H A;  2J38 A;  4ZKN U;  3RMO H;  2EEK A;  1EPT A;  1B7X B;  3ZV8 A;  4P02 A;  1ID5 H;  1HAG E;  1BTY A;  1HGT H;  2HVY B;  2BY6 X;  1SHH B;  5FCR A;  5FCK A;  1HAY B;  1P05 A;  3RXP A;  3SUE A;  1KDQ A;  2P16 A;  3TH3 H;  1PQA A;  3SQH E;  1UVO A;  4NIY A;  5DP6 A;  3RXO A;  1D3Q B;  2ZI2 H;  4H4F A;  1H8I H;  3ZVF A;  2D26 C;  3SV8 A;  1K9O E;  2VNT A;  3BG4 C;  3LGY A;  5GND A;  1MTS A;  1HXE H;  1NC6 A;  1QUR H;  4ZCN A;  1SQT A;  3PO1 C;  4BAK B;  1SGY E;  4MG3 A;  4FXG H;  5FAH A;  4O3T A;  4FVD A;  5DP4 A;  1QB9 A;  1TBZ H;  2HNT C;  1ELE E;  3BTG E;  4FUF A;  4ACA A;  3RML H;  3SGQ E;  1H1B A;  1XUK A;  4RN6 A;  4WME A;  3ZVB A;  2GMT C;  2QF5 A;  4BXS A;  1TX6 A;  2OD3 B;  1FON A;  1PFX C;  1FXY A;  3LH3 A;  3PV5 A;  1S85 A;  4B6F A;  3AAV A;  2H2Z A;  1Y5A T;  2W6J D;  4E05 H;  3PRB A;  1AN1 E;  8GCH F;  1GVZ A;  2WZQ A;  2K1Q A;  2R2M B;  1OHH D;  3GY6 A;  3HKI B;  5F03 A;  1WQV H;  2P95 A;  4YZU A;  2GCH F;  1CA8 B;  5F53 A;  2PKS B;  1FI8 A;  1FJS A;  2P59 A;  1EJA A;  2ULL A;  5EQQ A;  1MU6 B;  4TY6 A;  4AFQ A;  5EXL A;  2FTM A;  4MPU A;  3K6Y A;  1PPG E;  2SGD E;  3MQK C;  5AHG H;  1RFN A;  1V2R T;  2AYW A;  3BTH E;  3Q3K A;  3U8T H;  3U28 C;  1T31 A;  1HXF H;  2BD3 A;  7LPR A;  1KTT B;  5EGM A;  1SMF E;  1NU9 A;  1C5Z B;  3RXI A;  3URC A;  2VGC C;  4BTU B;  3SUF A;  1H4W A;  1UK2 A;  3A88 A;  1Z1J A;  1TOM H;  4BTI B;  1ZSK A;  1MU8 B;  2RFK C;  2ZDA H;  1ELB A;  3TIT A;  2BLQ A;  2F9V A;  8KME 2;  1C1O A;  1MTV A;  3UR9 A;  2FXR A;  4AFS A;  3NWU A;  1BTX A;  3VGC B;  4CHA C;  2B5T B;  1H8H D;  1WXR A;  1LQD B;  1ZOM A;  3SV9 A;  1D4P B;  2ZFS A;  2KM0 A;  1C1Q A;  1S81 A;  2ZEB A;  2BTC E;  3M3T A;  3ZIA D;  1J17 T;  3ODD A;  1O2I A;  1AY6 H;  1EAS A;  1P57 B;  1EXF A;  4NIX A;  2WPL S;  2KCP A;  3KGP A;  1W7G H;  1EUF A;  1V2U T;  1O31 A;  3D65 E;  3MH4 A;  1KDQ B;  4FET A;  1AVW A;  2BOK A;  1C2J A;  2C4F H;  2GVF A;  5FPY A;  2DE8 A;  2BD9 A;  1EAW A;  4ACB A;  1XMN B;  1H8E D;  1KMH B;  3F0O A;  3RMM H;  4XDE A;  2AGG X;  2FEQ H;  3EDX B;  1L1J A;  2W26 A;  1A61 H;  3M5O A;  2A4Q A;  4Q7Y A;  2JIZ D;  4UE7 H;  1TYN A;  3FP8 E;  4LXB H;  1GHA F;  1NY2 2;  4WH6 A;  4K1E A;  4RT0 A;  6GCH G;  1T8L A;  4LOY H;  3KQC A;  1E36 B;  4RSP A;  4DOQ A;  1TMT H;  2ODY B;  1BHX F;  1RS0 A;  1GJA B;  1V2M T;  1PPC E;  4MNX A;  1BCU H;  4CR9 A;  3MI4 A;  1TGT A;  1O2Q A;  2B7D H;  2BVR H;  1ZRB A;  2Z9L A;  3RXV A;  1YPH E;  3F2G A;  1AUT C;  3STJ A;  1C4U 2;  4ABG A;  1FY3 A;  2FOM B;  1IQN A;  1OWD A;  3GOV B;  3TJO A;  1MD8 A;  2L6O A;  1Q31 A;  3FAO A;  1DT2 A;  2UUK B;  4QT8 C;  2B8O H;  2V3H H;  4UFD H;  1FZZ A;  1IQE A;  4Y71 A;  2GZ7 A;  1LCY A;  3PRO A;  4NA8 A;  4CRE A;  1LTO A;  2G4T A;  1HAV B;  4K1T A;  3BEF B;  5K7R A;  2ZTY A;  1QBV H;  1QTF A;  1F0U A;  1XUH A;  1CGJ E;  3NXP A;  3TLO A;  5T6G A;  1O3F A;  1V2N T;  2V7Q D;  1TPA E;  3SGA E;  3DA9 B;  4X8U H;  2VH0 A;  4ZXX H;  1P9S A;  2FES H;  2BD8 A;  4GLY A;  2OLG A;  1F5K U;  3U1J B;  3PWC A;  1CGH A;  2AEI H;  3PV2 A;  5JPM H;  1RRK A;  1UVS H;  2FOC A;  5EPN A;  2FOG A;  1YPL H;  3RXM A;  1GHZ A;  2GV6 A;  3S0N A;  1J16 A;  3D62 A;  1BRA A;  1XUF A;  1NFU A;  1NS3 A;  4O3U A;  2VH6 A;  4B6E A;  4J1Y A;  3STI A;  4Y8Z A;  4A1X A;  1SI5 H;  3CS0 A;  3N7O A;  1W3C A;  4NWK A;  1IQK A;  4FUH A;  1MBQ A;  4XRN A;  4DGJ A;  1AE8 H;  1DWC H;  2PHB A;  1UCY E;  1AD8 H;  3V0X A;  2HVX A;  4E7R G;  1ACB E;  1F0T A;  2ZF0 H;  1XUG A;  4OS5 A;  3F9E A;  2J95 A;  3KCG H;  1Z6E A;  1HAZ B;  4TT3 D;  1RTL A;  2VIV A;  3UNQ A;  2F9P A;  3LGW A;  3KQE A;  1G3E A;  1FIW A;  2ZGX H;  3RC6 A;  2J5U A;  3UWJ H;  2OK5 A;  2GKV E;  1TRM A;  3BN9 A;  1MAB B;  1O2W A;  1LHF H;  1P3E A;  2GT8 A;  4INK A;  3E3T A;  1DDJ A;  3DCL A;  4WY3 A;  3N7E A;  1F92 A;  4ZKR U;  2QF4 A;  3ZZ3 A;  1TX7 A;  1L4D A;  1VCQ A;  1C1U H;  1A0J A;  1QR3 E;  3C1K A;  1CBW C;  1DLE A;  1DWE H;  3BV9 B;  3MYW A;  4ISL A;  1QCP A;  2A4G A;  5EJL A;  1O2Y A;  4IW4 E;  3S9B A;  3MO3 A;  5AFZ H;  2QAA A;  1ANB A;  4B74 A;  4YM9 A;  3EA9 A;  4OGX A;  3NCL A;  3SYJ A;  1RIW C;  1OWE A;  1GMC F;  2XCF A;  1JXP A;  3SO3 A;  1D6R A;  1DAN H;  4AYV B;  3TJU A;  1KXF A;  2GTB A;  1AB9 B;  1T4V H;  2KX4 A;  3N99 A;  1YY3 A;  1O3I A;  2QXG A;  2CMY A;  2WUC A;  1QQ4 A;  1TPS A;  2VIN A;  4FUJ A;  4XSK U;  3NRL A;  2D2D A;  2HPQ H;  1ELC A;  2BM2 A;  2FS9 A;  2TRM A;  1C5U A;  3DSO A;  2W7S A;  1C9P A;  5EOD A;  1O35 A;  1O36 A;  3GYM A;  4I8K A;  4FU8 A;  2XTT B;  5IYT A;  5TCA A;  3B23 B;  4JZI A;  2M5T A;  1MUE B;  1MAX A;  1G3B A;  2RDL A;  1VIT G;  1EB2 A;  1LQE A;  3PMJ A;  1GBL A;  1O3G A;  1P9U A;  4XBD A;  2P3U B;  2NU2 E;  1GCT C;  3VB6 A;  1SLU B;  4I32 A;  3DHK H;  1ZML A;  3TIU A;  1K28 D;  1Y8T A;  2ZC9 H;  1T8M A;  4Z6A H;  3TU7 H;  1P12 E; 
#chains in the Genus database with same CATH homology
 2AHM E;  1BT7 A;  3SU2 A;  5EQS A;  2VBC A;  3M5N A;  3VG8 A;  2OC0 A;  3KF2 A;  4A1T A;  1COW D;  5CDF E;  3LON A;  2CK3 D;  3O8R A;  1NBM E;  2WHX A;  4FET A;  3SV8 A;  2YMS B;  4YXW D;  4TSF D;  2JJ1 D;  2K0Q A;  3GS9 A;  2GVF A;  5FPY A;  5GND A;  5DSF A;  3RC4 A;  2IJD 1;  5CHB A;  3KEE A;  4WH8 A;  3H09 A;  4I31 A;  3WWB A;  4ZCN A;  1H8E D;  2KCO A;  4M9F A;  3WW7 A;  1KMH B;  3FO8 D;  1RTL A;  3F0O A;  4TT3 D;  3SUG A;  2JDI D;  2KCA A;  3OEE D;  5DN6 D;  3AK5 A;  4B76 A;  3UB0 A;  3M5O A;  4NWL A;  1DY8 A;  2A4Q A;  3OYP A;  1FX0 B;  2JIZ D;  4R8T B;  2OIN A;  3RC6 A;  2J5U A;  5HKK D;  2OK5 A;  4U01 A;  2QF5 A;  2YMS C;  3OAA D;  3SU5 A;  1MAB B;  3OFN D;  3F3B A;  2KZ4 A;  2GGV B;  3O8D A;  3PV5 A;  1BMF D;  4WH6 A;  4B6F A;  3SV6 A;  2KCY A;  3DCL A;  5FPS A;  3SU4 A;  3FN8 A;  2W6J D;  3PRB A;  1EFR D;  3N7E A;  3P8O A;  1E1Q D;  3KNX A;  3FKS D;  5EPY A;  3SU1 A;  1S6L A;  2QF4 A;  2WZQ A;  3SU3 A;  2K1Q A;  3LOX A;  5ESB A;  3N7D A;  1OHH D;  4K8B A;  3RC5 A;  4B71 A;  3O8B A;  2XND D;  1W0J D;  4Q4L A;  3PRD A;  2KR7 A;  3M5L A;  4A92 A;  1DXP A;  5F53 A;  2A4G A;  2P59 A;  1E79 D;  5EQQ A;  3LKW A;  3F2G A;  4XD7 D;  4B74 A;  4DT4 A;  3OTP A;  3O8C A;  1CU1 A;  3SYJ A;  2FOM B;  4KTC A;  2O8M A;  5C17 A;  2XCF A;  1JXP A;  3SZE A;  2L6O A;  1W0K D;  3OEH D;  2HLD D;  4JMY A;  5IDK A;  2IJO B;  5C0T A;  4F55 A;  3KN2 A;  4Z1M D;  3N99 A;  4WF8 A;  4TYD A;  2OC8 A;  2M2A A;  3M5M A;  2F4L A;  1N1L A;  3NRL A;  2A4R A;  2W6I D;  4B73 A;  1SKY E;  3E90 B;  5GJ4 B;  1RGQ A;  3DSO A;  2OBQ A;  3SUF A;  2WPD D;  1NBM D;  2V7Q D;  3OE7 D;  2OC1 A;  2KFW A;  2OBO A;  3P8N A;  2F43 B;  5B6L A;  2F9V A;  5C0U A;  5GPI B;  3FOA A;  3SU0 A;  5FL7 D;  4Q63 A;  2YMS D;  1A1R A;  1DY9 A;  3U1J B;  2YOL A;  3L6P A;  5H4I B;  2FM2 A;  3SUD A;  1H8H D;  4RI0 A;  5FPT A;  1WXR A;  1DXW A;  2JJ2 D;  3U1I B;  4A1V A;  2WV9 A;  2LEL A;  2FP7 B;  2XOK D;  3PV2 A;  4B75 A;  1E1R D;  3EYD A;  5T1V A;  3SV9 A;  3F0P A;  2KM0 A;  4I32 A;  5EPN A;  3SU6 A;  3WWF A;  4I33 A;  2XNI A;  2QV1 A;  1NS3 A;  4ASU D;  3F2F A;  3W1E A;  3ZIA D;  5ETX A;  5IK2 D;  2WSS D;  2QE7 D;  4B6E A;  4OM9 A;  2XCN A;  2F9U A;  3SUE A;  3DSP A;  5EQR A;  3SV7 A;  4A1X A;  3F2H A;  2OC7 A;  1W3C A;  4NWK A;  2K8I A;  2KCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...