3N99A

Crystal structure of tm1086
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
282
Chain Sequence
GHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRKEEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNIDPDLFEKLGIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYRKGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein TM1086
publication title Crystal structure of TM1086
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 82
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, G, H, I, J, K, L, M, N, O, P, S, T, U, V, X, a, b, c, d, e, g, h, i, j, k
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14505 DUF4438 Domain of unknown function (DUF4438)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.170 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3n99A02
2.102.30.10 Mainly Beta 3-layer Sandwich tm1086 (SG structure) fold tm1086 (SG structure) domain 3n99A01
4.10.1180.10 Few Secondary Structures Irregular tm1086 fold tm1086 domain 3n99A03
2JJ1D 2WSSD 2XNDD 3OFND 4ASUD 1NBME 1BMFD 5IK2D 1FX0B 5CDFE 1NBMD 1W0JD 3OEHD 2V7QD 1COWD 2QE7D 4TSFD 4Z1MD 3OEED 2JIZD 4YXWD 2F43B 5DN6D 2JJ2D 5FL7D 2HLDD 2JDID 2XOKD 3ZIAD 1OHHD 1KMHB 4Q4LA 4XD7D 1H8ED 1H8HD 3OE7D 3DCLA 3OAAD 1E1RD 1E1QD 1E79D 2CK3D 1MABB 3FKSD 4TT3D 2WPDD 2W6JD 5HKKD 1W0KD 1SKYE 3N99A 1EFRD 2W6ID
chains in the Genus database with same CATH superfamily
2H9EH 3KYGA 1F5RA 2K1QA 1CE5A 3AASA 1EP6A 1D3TB 1O2QA 2WV5A 2ZGBH 2ZG0H 2J2UA 1SFQB 2R3UA 5BPEA 1KXAA 3TH4H 3BIVH 3RU4T 3UB0A 1LVBA 3SNDA 3LIWA 2Q1JA 4WMDA 2PGBB 1LVMA 1OWHA 5E8EH 1GDNA 4VGCC 1WCZA 1WBGB 4BAKB 2D2DA 1C1QA 1O5CB 2NU1E 2A7JA 2FOBA 2KAIA 3FAOA 4ZXYH 3F2GA 8KME2 1QA0A 1J14A 2HWLB 2VWNA 3L3TA 1GWAA 1SC8U 1SPJA 1HJAB 2ZCKP 1DT2A 1A5IA 1C5NH 3SZNA 3FFGA 1NC6A 3TH2H 1GHZA 1A5GH 4AC9A 2F9VA 1MTWA 2UUKB 3E1XB 2QF3A 1N6YA 5EXLA 1TWXB 1NFUA 3BTQE 1PQ8A 4AX9H 4Z0KA 5DP7A 1MD7A 4A6LA 1HAXB 4KELA 2I6SA 1GBFA 4MPXA 2KCYA 5DJ7A 3EA8A 1BDAA 3KQBA 2V3HH 1YF4A 3TK9A 2Z9LA 1XMNB 3F3BA 5EXMA 3QGNB 1TE0A 1FY8E 1EX3A 5KGOA 4CRAA 1EPTA 1AHTH 4YO9A 2D1JA 5A8ZA 1ABJH 1SGDE 1NBME 5HYOA 4I86A 5FHTA 1AVXA 2O8TA 3GY7A 5A0AE 1G3DA 4ZHMU 2JH0D 1C1VH 2ZWLH 1P9UA 2FOMB 3SNBA 1AN1E 2B8OH 2JJ2D 1W12U 3SHCH 2QA9E 2FIRH 1XX9A 3T5FH 2ZZUH 1QQUA 1TIOA 2LELA 2OTVA 3VB4A 2OQ5A 1Y59T 1QBNA 1FIWA 2CK3D 3PM3A 1O2JA 3SUGA 5CHAB 1VCQA 1GJCB 3T27A 1JWTA 4JK6A 1GJBB 5EJZA 3MNCA 3UWJH 3PTBA 3PV4A 3U69H 4BAQB 1AZZA 1F0TA 4JCNA 3SZEA 1PYTD 1ELEE 1NU9A 1QRZA 1W13U 2O8UA 2ZDVH 3F9EA 2TPIZ 3IG6B 4Y6DA 3GS9A 2SGFE 3GY2A 5JBCS 1XXFA 1V2NT 2ZPRA 4D9QA 4YLUA 1O5GH 1Y3XA 2BOHB 1C4Y2 2FYRA 1C1WH 2PV9B 4DG4A 4DOQA 1PPCE 2XBXA 2Y80A 8LPRA 1D6RA 2VWOA 2D26C 2VVCA 3S7KB 2WV9A 4OS2A 1IHSH 2V0BA 1GI0A 1EAWA 1ZRKA 1GBMA 4KTSA 1CHOF 1TONA 4E06H 2STAE 2GT7A 2XRCA 2JKHA 2PP6A 3SU0A 1BITA 5L2YH 4GSOA 1LHDH 3PMHB 1GBDA 2FM2A 2IN2A 5G4BA 5AF9H 3CS0A 2UUJB 4FUGA 1EKBB 1C5PA 1V2WT 5E2PA 4ZHAA 1QL9A 1FUJA 3PLBA 1FMGA 3RXUA 3MTYA 3D62A 2XCFA 2J94A 1YY3A 1GL0E 3UAIC 1P9SA 1LMWB 1FZZA 4CR5A 1K21H 2P8OC 3TLOA 1L4ZA 1GVLA 1N8OC 2BB4A 2GCHF 1GI2A 2ZGXH 1ELDE 3ATLA 3UUZA 1O2PA 3KF2A 4DT4A 5IDKA 2ZIQH 1EZQA 4MTBA 1PFXC 1OP2A 4AG1A 3I77A 4I31A 1OWDA 3W95A 4B1TA 1SFIA 1HFDA 1ETSH 2JDID 4Q7XA 2CGAA 2G55A 1AU8A 3OAAD 1AQ7A 1TRNA 1YKTA 2GDDA 5E0GA 3R3GB 1ELVA 3E0NB 2WSSD 3MH6A 2EQNA 5BRRE 1JBUH 2FS8A 1BJVA 3PMBB 3TGIE 1AZ8A 4JZIA 3RMMH 3STIA 2KX4A 1QJ1B 1Z8JB 1SGEE 1ZGIA 5EW2H 3O8CA 2GZ9A 1FPHH 1AFQB 4H42U 1L1NA 1CO7E 1H1BA 3P8OA 3LC3A 3PMAB 5CHBA 3VPKA 2FEQH 2BY9X 1HAYB 2BDIA 2W3IA 4Y11E 1DWDH 2ZF0H 1B0FA 3V7TA 3MQKC 3HATH 4K2YA 4MPUA 3UREA 1GBJA 3KYFA 4IMZA 3M7QA 2ZDMA 3RXCA 2GCTC 3AVZA 2EEKA 1C2KA 4DVAU 3DA9B 4ASHA 2TGDA 3TK5A 3RXSA 3U28C 4XOJA 2A4GA 1C2GA 2VVVA 2KR7A 3D49H 3GCTG 1GI6A 2F9OA 3MMGA 1C2HA 2FMJA 2K0QA 1C2DA 3R0FA 5L6NH 4ZAEA 2TGAA 3SJIA 4OGXA 3S9CA 1AY6H 4JYVH 3H5CB 5C1UA 3PROA 1TAWA 3V13A 2BDGA 2W6JD 1ZSKA 2PTNA 3GY5A 3URCA 5H4IB 1FIZA 3ATIA 1VGCB 2GZ8A 2OP9A 3FP8E 4X0WU 1ZZZA 1P2KA 3NXPA 3MU1A 2B7DH 2WV4A 2ZGCA 1EPTC 1RJXB 3QWCH 2WPLS 5FBIA 3ZIAD 2OD3B 5F8ZA 3ZZ7A 2GJGA 1HB0B 1T4UH 4P00A 3TGKE 2JETC 4WMEA 2OC0A 2TIOA 1HAVA 4NFFA 2ZPSA 1O2XA 1EZXC 2EA3A 2PW8H 3SGBE 4AYVB 3SGQE 1GDUA 2BY7X 2BXTH 4FUHA 5HIZA 1QURH 4AZ2B 4D7FA 3T2NA 1ESAA 3LGWA 4FUJA 2V7QD 7GCHG 1K1MA 1RXPA 1C1TA 2BD3A 5E2OA 4BTTB 1UHBB 2FWWA 2R2MB 3HKIB 2PGQB 2ZP0H 1IQIA 3F0OA 3GCHC 1H8ED 1H8HD 3FO8D 3DD2H 1SGIB 1TA6A 3JZ1B 2XC0A 3MI4A 3U9AH 2W6ID 6LPRA 4VGCB 3QLPH 2QGRA 3RXEA 3P95A 2G52A 2Y6TA 1HAOH 2LPRA 2OCVB 3RXBA 3OEHD 1SGFA 3TVJB 4NFEA 3SJKA 1GJ4H 1BUIA 2HLDD 3A89A 5DP6A 1MUEB 4CRFA 3PRDA 2XC5A 1RRKA 3QZRA 4D76A 3MFJA 4RN6A 3AW0A 4CH8B 1YGCH 7LPRA 1GBLA 1PPFE 4ISLA 4JZDH 4A7IB 3VG8A 2LP6A 5T1VA 1S6FA 3SU3A 2FI4E 4JZFH 1P12E 2BY8X 1MBQA 4KGAA 1TPOA 3LH3A 4BXSA 3P6ZB 4IC5A 1QRXA 3VGCC 3PO1C 3LJOA 2FOGA 3A7WA 1Q3XA 1ANDA 3DCLA 1F5LA 4IMQA 3EE0B 1JMOH 5JPMH 2VGCC 2BVSH 1RTKA 3GY6A 2FO9A 1ZOMA 2WPHS 4K60A 4A92A 3SV9A 2RDLA 1VKYA 4MNYA 1LKBA 2OINA 4DURA 4CBOA 1OP8A 1IQEA 1SGNE 5KEDA 2VIDA 2QXGA 5AFZH 3SGAE 1SVPA 2QE7D 1YWUA 2ALVA 2BDYA 3ZVAA 3Q3XA 2J5UA 2J4IA 1EAIA 5DP3A 3ZZ3A 3KIDU 3PYHA 1L0ZA 5LPEA 3VB5A 1C5QA 5AVDA 1PPGE 1Y8TA 2G4UA 2YMSC 3FZZA 4JK5A 3UNRA 1QRWA 1BMLA 3UFAA 1WTGH 4GPGA 3TU7H 4ABEA 3JZ2B 1ELFA 2D8WA 3U1JB 1BJUA 3U8TH 4TWYA 2WUCA 2PFEA 2FOEA 1WU1A 1NPMA 1AUTC 1XUHA 1UVUH 3OU0A 2VINA 3K9XB 1AWFH 1P10A 4LK4A 4AB9A 5J4SA 1E36B 4H6TA 4MPWA 2HNTF 4B2BA 2BDBA 1DM4B 4UFGH 1O3JA 1KSNA 1OXGA 2BX4A 3GCTF 1GHBG 1KXCA 1YPLH 2C93B 3T62A 5HM9A 1TRYA 5C5NA 4IS5A 3SV8A 3WY8A 2HPPH 2FX4A 9ESTA 3A87A 1BBRK 2Q6GA 3BG8A 4UE7H 4AOQA 1AIXH 2PUQH 3LGUA 5EGMA 1O2NA 1G3EA 1O3MA 1LHEH 1O3PB 3EAJA 1Z8RA 2ZQ2A 2FPZA 1L1GA 2HALA 3FP6E 5DGJA 3LU9B 1MTUA 1V2UT 3ZVEA 4WWYA 4Y7AA 1TMUH 4ESTE 2Y5HA 3QTVH 3VB7A 4CRCA 5C17A 4YZUA 4RI0A 3UWIA 1P11E 1MTNC 2ZFRH 1T8MA 1NBMD 4UONA 2G00A 1W8BH 5JB9S 1DX5M 3RXIA 2BLWA 5ESBA 4J1YA 3E91A 3OY5U 3ZYEA 3DT0H 2FLBH 1P8VC 1XVMA 2PSYA 3FZDA 3RMLH 4AB8A 1EOLA 2P8OB 3C27B 2QYIA 3SU1A 2BQ6B 1HDTH 3Q3KA 1YC0A 3A7TA 4CRBA 1N8OB 1MZDA 2QY0B 2AS9A 2CV3A 1A0LA 2BTCE 5C0UA 1NS3A 1G9IE 1P02A 2AIPA 2G5VA 5EQSA 3A7VA 4ABGA 4H4FA 2SGPE 4CRGA 2J98B 1A0HB 7GCHF 3T28A 2XW9A 3PLPA 1P3CA 1GI5A 1BRBE 3NCLA 4F55A 1ZPCA 4F4OC 2AGEX 1TOMH 1BMNH 3SHAH 2AEIH 3SYJA 4CHAC 4I32A 1BT7A 3BTME 5FAHA 3IITA 5C1XA 3WWFA 3BV9B 2C4FH 1ID5H 3KQEA 1ZPZA 1AI8H 1TPPA 3LT3A 2ZFSA 4FU7A 3RP2A 1YPHE 4GHQA 1HIAB 3ZZ5A 1TALA 3LPRA 5T3HA 1UCYK 1J16A 3U8OH 4X8VH 1KXFA 3LGIA 1DXWA 1W0JD 3S9BA 1CVWH 1E38B 1TB6H 1HXEH 2QAAA 1GCTC 1SMFE 5C3NA 1XUFA 1O5EH 1HIAA 1O38A 3MU8A 1H9HE 1G2LA 2BDCA 4M9FA 2ZEBA 2R0LA 2HLCA 3UNSA 3PTNA 2JH5D 3URDA 1TYNA 3BSQA 4WH6A 1AGJA 2IJOB 4NG9H 4F49A 1O2KA 4AORA 1OPHB 3N7OA 1V2OT 3E6PH 3VXEH 3M5NA 1UTKA 1HAZB 2Y7ZA 3SI3H 3A81A 4WJG2 4X8SH 2F9NA 5GIBA 1SGTA 4X6MA 1IAUA 1Z1JA 1KMHB 1OWKA 1RD3B 1ZPBA 1Y5UT 4ISOA 3RC4A 3LOXA 1GVKB 2KAIB 3FKSD 1E1QD 3GDUA 1C4U2 1UCYH 2GCTB 3QZQA 4ZXXH 4FUDA 1EOJA 2J34A 3ZYDA 3SQEE 1SQRA 4MDSA 5EIYA 3Q76A 4U32A 2BYAX 1CHGA 3MU5A 1SLWB 1SGCA 2GX4A 2JIZD 2WPJS 1P09A 3P92A 4JYUH 1D6WA 4ZKNU 2B9LA 2GZ7A 3ZVFA 2BD2A 3H7TA 2F9PA 1QY6A 1PJPA 4B6FA 4AG2A 2BLQA 4ACAA 1BRCE 1HJ9A 1TX7A 3S7HB 2OC8A 3V12A 1TNJA 3F2FA 1A61H 1GDQA 2ULLA 2Z3CA 2WHXA 2O8MA 2PKAB 2G5NA 1ANEA 1EPTB 3UY9A 4DIHH 5EXNA 3KL6A 1GJ9B 2OC1A 3NKKA 1MKXK 1ZHPA 3SU5A 2AYWA 2NWNA 1K1LA 1ELAA 1C5VA 1HAHH 3RXAA 2JETB 3GDVA 2STBE 1NRRH 2PKAA 1C1RA 5L30H 1L4DA 2ZECA 2IPQX 1GHBF 1F2SE 1O3KA 1O39A 5JDUB 5ABWA 3N7EA 4BOHA 1C1NA 1YPEH 2YNBA 1ELGA 1COWD 2F43B 3B8JA 1MZAA 4Q7YA 1S0RA 1OS8A 1O30A 4CH2B 1C5UA 3MHWU 3W94A 2BD7A 1MQ6A 3F9FA 3GCHB 1K2I1 1YM0A 2G51A 1FN6A 4I8LA 2GTBA 1O5FH 1THRH 1D3PB 1LHCH 1XKBC 2WYJA 5TCAA 4NA8A 3KQDA 3SQHE 2BLOA 1PQ5A 1A3BH 1MU6B 3GICB 4TPYA 1MKXH 1MKWK 5F8XA 1QJ6B 4UEHH 4Z1MD 1O2MA 3GOVB 3PRBA 1BB0B 1H4WA 1NU7B 5C1YA 5DKMA 1C5ZB 4ZH8A 1LHGH 4Y79A 4YOJA 1C9PA 2R2WU 1SGYE 2SGQE 4X1PU 2GVFA 1FAKH 3PB1E 1NFYA 1UCYE 1F92A 2BY5X 1CBWC 3QX5H 2GP9B 3AAVA 3ZZ6A 4FUFA 5FX5A 3GISB 3A8BA 4ZROA 1THSH 2AGGX 2J38A 1LHFH 1AUJA 3M3TA 4OS4A 2Y5GA 3M3VA 1LQEA 3SI4H 1RTLA 1PYTC 1INCA 1V2TT 4UFFH 1V2RT 2XXLA 3HGPA 4CBNA 1F0RA 3QO6A 2XYAA 4U01A 2FZZA 1FY5A 4F48B 3VGCB 3TJVA 1KTSB 3PO1B 4MVNA 2EI7A 1DVAH 2ZPQA 1OWEA 2SNVA 2VH0A 1C4V2 5IYTA 1K0HA 1O5DH 3RXHA 1SLVB 4INHA 1MAYA 1MKWH 5GNDA 5L2ZH 2VGCB 1UMAH 3H7OA 3PWCA 3LKWA 1QB9A 2H9TH 1O36A 4KTCA 4E05H 3EYDA 2EI6A 1ANCA 3B9FH 5EJ1A 2PLXA 2J95A 1ZJDA 4ISNA 4LOYH 3RLYH 3W1EA 2AFQB 2V3MA 2QCYA 3MWIU 3F0PA 3ELAH 2HNTE 3BTHE 1FDPA 1C5LH 2A7HA 3P8NA 2F3CE 1PQ7A 1TGTA 1W14U 3ZZAA 3LGTA 1B5GH 3RMOH 2QN5T 2ANWA 3TPIZ 1CT0E 2BHGA 4BAHB 4X8TH 1PQAA 1O3BA 4RT0A 1SLXB 2YMSB 1VR1H 4ABAA 1AB9C 1DDJA 5GJ4B 3ITIA 3M5MA 5F03A 2HVXA 4KP0A 4OS5A 1UTMA 2HPQH 2FP7B 1IQFA 3BTWE 1S84A 1OYQA 5DO4H 2HRVA 3K6ZA 1T8LA 3A7XA 2PWXA 1AE5A 1C2MA 1GHWH 2A4RA 4NA9H 3PLKA 3RXJA 1E37B 2QV1A 6CHAC 1ZTKA 4A1VA 3LGVA 5SGAE 5JB8S 3SV6A 2QIQA 1EXFA 2BD4A 3BTDE 4Z6AH 1QBOA 5LH8A 4ABFA 4FVDA 5FL7D 4O9VA 1O3GA 4IN2A 1Y3UA 3MO6A 1ZHMA 4NSYA 2J92A 3QGJA 1E34B 1LPKB 1JRTA 5F6MA 1SHHB 1OKXA 2KFWA 4WF8A 2J9NA 2ODYB 4DGJA 5HM2A 5GXPA 1MH0A 5K7RA 3LONA 1MTNB 2SNWA 1ZLRA 4LZ1H 1O3EA 1DY9A 4Q80A 2BD8A 4JZ1A 2GT8A 3RMNH 1ZMNA 1T31A 1GI7B 1IOEA 5DPAA 1O2WA 1SSXA 2FOCA 1DOJA 1BZXE 4GVUA 1V6DA 4UDWH 1ZMLA 1YLDA 4TY7A 3UR6A 2BDHA 2QXJA 1BQYA 3AAUA 1ARBA 1B7XB 1YCPK 1UTQA 3BTFE 2W26A 1O31A 1PPEE 1W3CA 1UTPA 2PHBA 3BN9A 2AERH 1KDQA 2VIPA 1KLJH 2JH6D 3PV2A 7KMEH 1ZGVA 2ZU2A 4XRNA 3KQ5A 1EATA 1MABB 5EOKA 4CHAB 2H2ZA 1T7CA 1KIGH 3MOCA 4I8GA 3RU4E 1P01A 3E3TA 4NIVA 5C0TA 1ACBE 1P05A 2VWMA 3OY6U 5ESTE 1YLCA 2WINI 1HAVB 2L74A 4I7YH 4XBCA 2XNIA 1GCTB 1MMJN 1GJ6A 1NESE 1BTHH 3RXRA 1BIOA 5GCHG 1O34A 1WTHD 4YOIA 4Y8XA 2ALPA 3G01A 2A4QA 2XWBI 1TQ0B 3E16B 1BTYA 1TLDA 2ILNA 3RUOA 5E0HA 1FY3A 1DS2E 3KGPA 1D9IA 1DWCH 2GDEH 1F0SA 3SNEA 3HKJB 2VIQA 2AMDA 3A83A 1O2UA 3PV5A 2V35A 2A31A 2ZU3A 1OX1A 3GY4A 1J9CH 1EZSC 1D4PB 4Q7ZA 3P8GA 1A3EH 4Q4LA 4Q2KA 3LGYA 4HZHA 3VB3A 3E8LA 3HGNA 3MU0A 2CXVA 2Z9KA 3MO3A 2CF9H 1C1SA 1UW7A 4NWLA 1O2GH 1UJ1A 4K8YA 1DWEH 4J2YB 4R0IA 2GGVB 2YOLA 5T6FA 2VU8E 1DE7H 1SOTA 3SU4A 2SGDE 2ZGJA 3V3MA 4FOUC 1NZQH 1O5AB 1RS0A 2M2AA 1WUNH 3SUEA 1O3HA 2M5TA 1SL3A 2VBCA 1J15A 1SR5C 1KTTB 2C8WB 1Z8IB 1BA8B 5PTPA 5GDSH 1GHAG 1JRSA 3K2UA 1PPHE 1BMAA 1QBVH 4B76A 6GCHG 3SJ8A 1JOUB 1QZ8A 1ETTH 4ACBA 5T6DA 3A8AA 1VCWA 4Y0ZE 1OSSA 4TYDA 1Q2WA 1S82A 2FOFA 1DPOA 3RLWH 5DN6D 3D23A 1DUEA 2QXHA 4ZCNA 2ZO3H 1UK2A 3MH5A 2HVYB 4BAOB 1WYKA 1A5HA 3P8FA 4XDEA 4Q63A 2ODPA 2OBQA 1O2VA 4B2CA 1FPCH 5KECA 2L6OA 1UVPA 1K28D 1HAGE 1F5KU 1ORFA 2ZFPH 3BEFB 3RXMA 1GHYH 3FANA 1TNGA 4Y7BA 2AMPA 5IK2D 1NRQH 3SNCA 4NCYA 2A1DB 1RIWC 4FUBA 2ZFTA 1DSUA 2ZHEH 4JMYA 4DY7B 1FXYA 3CP7A 3TITA 1EJNA 5JYIA 2H5DA 1W0YH 1GI8B 5K0HA 4WXIA 2OK5A 2ZTXA 3HK6B 1D3QB 1RTFB 1V2MT 4WVPE 3SUFA 2BD5A 3ZZDA 4X6NA 1C2EA 3RXFA 1BTXA 1GMHF 3L6PA 1F0UA 1DSTA 2F9BH 5C20A 2C8YB 2V3OH 1K1PA 2AGIX 1EAUA 1K22H 2V6NA 3TGJE 3LJJA 5T6GA 3T29A 3TJNA 3FP7E 2YNAA 1DFPA 1P2QA 9LPRA 3F9HA 3BG4B 1GG6B 2IOTA 3SOSA 2A4OA 4OS6A 1SQOA 3D65E 2XTTB 4AN7A 2H6MA 3HK3B 1C5SA 4I33A 3GY8A 1LVYA 3ZVDA 3AK5A 2ZU5A 1CBWB 1GBAA 1CA0C 3RDZA 4X2VA 5FX6A 3OX7U 4GAWA 3MU4A 1EP5A 1UVTH 2SFAA 2P3TB 4IBLH 2BM2A 1GCDA 1K1OA 3QUMP 1O32A 1C2JA 2HGTH 1O3DA 4ZMAH 2OXSA 2AMQA 2ZU4A 2ANYA 3ATMA 3U1IB 3WWBA 2KCAA 3PMJA 1HYLA 2FTMA 1K9OE 1B0EA 1O3CA 1EASA 4KKDA 5LPFA 1O2TA 1SG8B 2P94A 1P2OA 1V2KT 8GCHF 1WSSH 2FYQA 2PKSC 4SGAE 3M7UA 1C5XB 1TRMA 1ZYOA 3SJOA 1JIMA 1G3CA 2ZTZA 4NWKA 4BAMB 1VCPA 1AKSA 1MCTA 3RXKA 1H9IE 2DE8A 2ZI2H 2GMTC 1K1NA 4MNVA 5GCHF 1UK3A 2C8XB 1SQAA 2GV6A 4X1QU 4CR9A 1YLNA 2O8WA 5B6LA 5ETXA 1A0JA 3VB6A 1BTZA 4D9RA 2UUFB 3QDZB 3K6YA 1MAXA 2TGPZ 4X1NU 1AB9B 1S85A 4FXGH 1IQJA 1S6LA 1V2ST 1ELCA 2NU4E 2Q6FA 4ABDA 4DT7B 1BBRH 1MD8A 1YCPM 2ZDKA 1DUAA 1PPZA 1EAXA 1OYTH 1WDIA 1Z1IA 3MNSA 1CT2E 1DWBH 1L2EA 2XWAA 4QT8C 4BTUB 1UTNA 4AYYB 2GKVE 5C94A 3M3SA 3OSYA 4I8JA 2A32A 1S5SA 1P2JA 1H8IH 1A7SA 1BRUP 5FBEA 1E79D 4HI3A 1A46H 1V3XA 1WQVH 1HUTH 2FI3E 2P16A 1Y3VA 2P93A 1C5YB 3M7TA 5AHGH 3MNXA 1O3NA 5JBTA 4E7RG 3V0XA 3RXGA 1IQNA 1NRNH 1GMDF 1LKAA 4K3JA 6CHAB 1GMCF 1GGDC 1J17T 3UQVA 3STJA 5DP9A 3SV7A 1TGSZ 2BY6X 2ZU1A 1C9TA 5GPIB 2EC9H 3QK1A 1O3LA 4H6SB 3Q3YA 3EE7A 3EQ0H 1GHAF 3NWUA 4X2YA 6GCHF 4ZUHA 3MH7A 1NTPA 1Y5AT 4DJZB 4DW2U 1HV7A 3TK6A 1HCGA 2EY4C 2P95A 1GBHA 1O5BB 3CENA 1KXBA 2ODQA 1BTWA 3BTTE 1KXDA 2RA0A 4I8KA 2F4LA 5FCKA 3SO3A 4X6PA 3FN8A 3PWBA 1V2JT 4TY6A 2FI5E 5FPSA 3BTGE 3M61U 2G81E 5DP5A 3BTKE 1SGRE 1LO6A 3RXTA 1Y3YA 1V2LT 1FY4A 2B0FA 1O2IA 3A84A 1GBCA 3DFLA 1QB1A 1O37A 1QFKH 1C1UH 4P02A 3ZZCA 1EJMA 1TBZH 2DE9A 4YESB 3RM2H 1W7GH 3CS7A 3N7DA 5DP8A 3UOPA 4FUEA 2O9QA 1A2CH 2HNTC 1LVOA 1NFXA 3UIRA 1TABE 1FAXA 2ZFFH 1TQ7B 1GBEA 2BZ6H 4UD9H 1C1MA 3M5OA 1ELBA 2VJ1A 2A2XH 2OLGA 3A82A 1MTVA 1NT1A 3B23B 3VEQB 1BBRE 1G3BA 1ZRBA 2CMYA 4LXBH 3UR9A 4E7NA 5JBAS 3E90B 4TSFD 1DXPA 1SBWA 2SGAA 4X1RU 3UPEA 1NY22 2R3YA 1CA8B 3RXDA 5I25A 1V2VT 2ZCLP 3ATKA 4BANB 4TWWA 2RG3A 1C2FA 1C5TA 1ZTLA 4WXVA 3AW1A 5E0JA 4FUIA 1TNLA 4RKOB 1ABIH 1O2HA 2OUAA 5J4QA 1EB1H 1V2PT 3Q77A 4O3UA 1TPAE 2BZAA 1SGQE 3FVFB 3QTOH 1GVZA 2CHAC 5DSFA 1UVSH 3ZZ8A 5CMXH 1H8DH 1J8AA 3RXVA 3M35A 1ETRH 4K1EA 1T4VH 4Y71A 1AVGH 3U98H 4B74A 1W0ZU 3OYPA 3SNAA 1YPMH 2W3KA 3HPTB 1AD8H 2BLVA 1AMHA 2J97A 2F91A 4XD7D 1MBMA 3T25A 2QC2A 3NZIA 3ZZ4A 1SB1H 2GD4B 2KCOA 3F2HA 2Z9GA 2FX6A 3F6UH 1C5MD 2BDAA 2Z9JA 6ESTA 2ZDNA 1IQLA 1WOFA 4ABIA 2QF0A 4YTAA 4THNH 1X7AC 1EUFA 1NN6A 3ZV8A 1XM1A 3MO9A 2CF8H 1P57B 2QF4A 1Q31A 3KQCA 5TJXA 1BHXB 1AO5A 4X6OA 1BTUA 3NRLA 2A5AA 1KYNA 3BG4C 1GG6C 1TGNA 4YLQH 2H5CA 4INKA 3CNRA 4Y8YA 1O3IA 3DHKH 2W7SA 3EA7A 3MYWA 4JYTA 2A5IA 5EODA 4IW4E 5JBBS 1RFNA 5DP4A 1E0FD 3RU4D 1FV9A 1SGPE 1P2MA 3DSPA 1LQDB 2XBVA 2BQ7B 5C2ZA 2THFB 5EPYA 1CGJE 1ELTA 1KY9A 2AIQA 2BMGB 3SBKA 3GDSA 1OHHD 3DFJA 1VITF 4NZQA 1IQKA 3SJ9A 4ZKRU 2KZ4A 2R0KA 3A7ZA 3NK8A 1QR3E 3UOUA 2RDEA 1EFRD 3TIUA 2WYGA 2ZKSA 4OS7A 1O2RA 2NU0E 1EJAA 3O8RA 4NA7A 2OQUA 2RFKC 4A1XA 2WPMS 5C5OA 8ESTE 3DUXH 2TBSA 2IJD1 1ESTA 3ZVCA 5A8YA 2VVUA 1BTPA 2UUYA 1RIWB 1CGIE 1Z6JH 2BD9A 1DICA 4JZEH 1CSOE 4D8NA 1EQ9A 1IQGA 1QCPA 1EZUC 2DUCA 4Y8ZA 2ZTYA 1OWIA 5HKKD 2ZC9H 4OS1A 3ESTA 4K69A 1W7XH 3BF6H 1T8NA 4XBBA 3UTUH 2OC7A 4ABBA 1FX0B 1P06A 1ZSJA 1BCUH 4X2WA 1W11U 3O8DA 1E35B 1C5WB 2BVXH 1FONA 2KCPA 2CN0H 2FTLE 2HOBA 2FOHA 1C1OA 4B6EA 3DSOA 1O2LA 2G8TA 3SW2B 1S81A 1CA0B 2P3UB 1ESBA 1IQMA 2GV7A 2F9UA 3A8CA 3H09A 1LCYA 1VJ9U 4PROA 3ZVBA 5HMAA 1C5OH 5FXLA 1BHXF 1DITH 4A1TA 2C8ZB 1UK4A 4R8TB 1RGQA 1UTLM 5GWZA 1QJ7B 2ZFQH 2XBWA 1QIXB 1SOZA 3IWMA 3KCGH 3GYMA 2BXUH 2Z3DA 2VIVA 4SGBE 3T26A 1TNHA 4ABJA 2FDAA 5HIYA 3VFEA 3ZVGA 1EB2A 1GMHG 3OFND 1UO6A 1XUJA 1YYY1 3MH4A 3F1SB 4D7GA 2PKSB 1TBQH 3OTPA 1JXPA 1UTOA 2Y82A 1CQQA 1GHXH 1P2NA 4UFDH 4Y0YE 1GJ5H 1GJ8B 1D3DB 3BIUH 3SN8A 1KLTA 1YPJH 2GMTB 1YPKH 1GBIA 3K65B 2Z3EA 1DY8A 1W0KD 3LDXH 2UWLA 1KDQB 5HXFA 3O8BA 2JJ1D 4CRDA 4DIIH 1T8OA 2NU2E 1SGFG 4AFUA 2VH6A 5F53A 4DCDA 1CGHA 4MQAA 2NU3E 4FVBA 1TNIA 1LPGB 1MU8B 2P59A 3A7YA 5EPNA 1MQ5A 5EQQA 1S83A 4AGKA 1HRTH 4Y10E 3P70B 2XC4A 3LH1A 1Z8GA 4XE4A 2OBOA 4AGJA 2BVRH 8GCHG 1GJDB 4YT6H 4FU8A 1KLIH 1QQ4A 2G4TA 4B75A 1GGDB 1UVOA 3SU6A 1QB6A 4NSVA 2O8LA 3ODDA 3BTEE 1HJAC 5LGOA 5HGGA 2ZCHP 1DLKB 1O35A 4AFSA 1YBWA 3MNBA 4XSKU 1O2OA 1XKAC 1YCPH 2FOAA 2Y5FA 5FPTA 4B73A 2QXIA 1TBRH 1YP9A 2XNDD 1S6HA 2K8IA 3GYLB 1GL1A 1P04A 5FPYA 4X8UH 1OWJA 3ATWA 1GPZA 3FOAA 1G32B 3EGKH 3RXLA 3SU2A 5LPRA 1VITH 4I8HA 2PUXB 1XUGA 1GBBA 2AHME 4RKJB 3S0NA 1P03A 1IQHA 4NIWA 1ANBA 3ZZBA 2I6QA 1XUIA 4XFQA 2Y81A 1BOQA 1CT4E 1QHRB 1C1PA 1LTOA 4GCHG 4TT3D 1VZQH 2Y7XA 3LC5A 2PTCE 5A0BA 3N99A 5EQRA 2Z94A 4ABHA 2KM0A 5DK1A 4WH8A 3RXPA 3ENSB 4WMFA 3ZZ9A 1HJ8A 4MG3A 1G30B 1GMDG 4TPIZ 2VWLA 1O0DH 1GMCG 3KEEA 3NPSA 1TFXA 2ANKH 3NUMA 2QF5A 2H9HA 4BTIB 1GBKA 1HAIH 1FY1A 2FLRH 1BMMH 1DLEA 4HTCH 4XBDA 1AWHB 5CHAC 3RXQA 3BEIB 2ZDAH 1TA2A 1SKYE 4ZKSU 4A5TS 7ESTE 4MPVA 1UHBA 4K1SA 3EA9A 2WUBA 4B2AA 1ZMJA 1LPZB 4K1TA 1G36A 2A45B 3VXFH 2FXRA 2Z7FE 3F9GA 5B6OA 1AE8H 2C3SA 2Z9IA 3A88A 5EJLA 1L1JA 4UFEH 3SORA 2ZA5A 1QL7A 4AFZA 1HLTH 4X2XA 2BOKA 1YPHC 4IN1A 1A4WH 1K1IA 3RM0H 1TMTH 2CHAB 2UWPA 1ZR0A 4OGYA 3QN7A 4YOGA 4MLFB 1TGBA 1AVWA 2ANMH 1Z71A 4ISIH 1M9UA 1QA7A 2BX3A 1WAYB 4M7GA 4MNXA 1U6QA 3C1KA 4INLA 2YMSD 3OTJE 4CREA 2TRMA 1THPB 3A80A 3L33A 2FESH 3SV2H 2ZHQH 1BMFD 3M37A 4K5ZA 1ZJKA 1FI8A 4O03A 1XXDA 1JIRA 1T32A 1HGTH 2XBYA 4AFQA 1GHVH 1QL8A 1MCVA 1SLUB 2A2QH 3U8RH 4BXWA 1TGCA 5EG4A 1DANH 4IC6A 3DSGA 2C90B 1N6XA 4NZLA 3S9AA 3RXOA 4KTUA 4FUCA 2W5EA 1P0SH 3RC5A 4HFPB 2A7CA 1G2MA 1GBTA 2ZHDA 2H1UA 2ESTE 3RC6A 1FLEE 4YXWD 1QTFA 5TCCA 4YT7H 3WW7A 1TNKA 4RT1A 3M36A 4O3TA 1KXEA 1YPGH 2LNCA 1O33A 1BRAA 2WZQA 2WPDD 1AKSB 4U2WA 4ISHH 2F83A 1ARCA 2P3FH 2EI8A 2ZDLA 4OM9A 1FN8A 2WPKS 2WPIS 2W7UA 2ZQ1A 3UNQA 4LZ4B 1GJAB 1O3AA 2TGTA 1O3FA 4U30A 2AH4X 1W10U 1HAPH 2ZNKH 1HXFH 1TPSA 2CJIA 4YM9A 3KNXA 1AFQC 1ZTJA 3UQOA 2ASUB 2VIWA 3F68H 1H9LB 4GLYA 5C67A 1GI1A 3ODFA 3TH3H 4FETA 4GHTA 1MTSA 3OE7D 3A85A 1AFEH 3TJOA 1W2KH 4ASUD 2SGEE 5A09A 4NGAH 5CDFE 1PPBH 1O2YA 2XCNA 1NRSH 5EU8A 1GI9B 3TNTA 5EW1H 4ZHLU 4FU9A 1SI5H 2FS9A 1N1LA 3P17H 3GCOA 5CE1A 2ZHWH 5A2MH 3GY3A 5A8XA 1A1RA 1QGFA 4O97A 1ZHRA 1VITG 1K1JA 3KHVA 2A0QB 4GCHF 4IGDA 4BNRA 1Y3WA 2ZGHA 1FNIA 1XVOA 1Z7KA 1NROH 1TX8A 3A86A 2A5KA 3E0PB 1VJAU 1WQSA 2B5TB 1FQ3A 4NIYA 1TX6A 3GCNA 2FODA 1NFWA 3KN2A 3S69A 4HGCA 1HBTH 2VB0A 1TMBH 1P3EA 2VNTA 1CHOG 1C2LA 2XOKD 3EDXB 1O3OA 5FCRA 1ZSLA 2Q6DA 4ZKOU 1NO9H 1E1RD 4GUXA 1S0QA 1SHYA 2J98A 1OOKB 1UTJA 1Y5BT 4MNWA 1VGCC 1C2IA 1WV7H 4HG6A 5A0CA 1G37A 1F7ZA 2R9PA 3BEUA 3Q00A 1O2SA 3TNSA 4X1SU 1Z6EA 2PSXA 3ZV9A 1WXRA 1TOCB 1NRPH 3M5LA 2RA3A 1CU1A 4NIXA 1LDTT 1GJ7B 3I29A 2IPHA 3OEED 2VIOA 1FJSA 1GI3A 2PR3A 4WY3A 5I46H 1HNEE 1OP0A 2UWOA 5AFYH 1IHTH 1GI4A 1C5RA 1HPGA 3TJUA 2RCEA 2GCHG 4B71A 4K8BA 5DG6A 1SQTA 1XUKA 1O2ZA 3SUDA 2ZHFH 1P2IA 1NM6A 3A8DA 4RSPA 4Y76A 1V2QT 5F8TA 2BQWB 2Z6BD 1QNJA 3I78A
chains in the Genus database with same CATH topology
2JJ1D 2YMSB 2WSSD 5GJ4B 2K1QA 4OM9A 3O8RA 3M5MA 4A1XA 5IK2D 1S6LA 5F53A 1DXWA 1W0JD 3N7EA 3U1JB 2IJD1 3SZEA 2V7QD 1COWD 3E90B 4TSFD 2FP7B 1DXPA 2F43B 4JMYA 3GS9A 2XNIA 3O8CA 3KNXA 3UB0A 3F0OA 2P59A 5EPNA 1H8ED 5EQQA 1H8HD 4M9FA 2OK5A 2A4QA 3FO8D 1E79D 4WH6A 3SUFA 2IJOB 3P8OA 4FETA 5CHBA 5HKKD 2A4RA 3L6PA 2W6ID 3OE7D 4ASUD 2OBOA 2QV1A 2OC7A 4A1VA 5DSFA 3PV5A 1FX0B 5CDFE 3M5NA 3SV6A 2XCNA 2WV9A 3F2GA 3O8DA 3OEHD 3SV7A 4B75A 4Z1MD 3SU6A 3SV8A 3PRBA 5GPIB 3OYPA 5FL7D 2HLDD 4B74A 1N1LA 3PRDA 1KMHB 4Q4LA 3SU0A 1A1RA 2GVFA 2KCPA 4XD7D 3LOXA 3RC4A 3FKSD 1E1QD 2KCOA 3F2HA 3DSOA 4I33A 4B6EA 2FM2A 3AK5A 2KFWA 4WF8A 2A4GA 2F9VA 4NWLA 5FPTA 4B73A 2YMSD 3VG8A 5T1VA 2XNDD 2GGVB 4RI0A 2YOLA 5C17A 2KR7A 3SU3A 2K8IA 1BMFD 5FPYA 2QF4A 1NBMD 1RTLA 2F9UA 2XCFA 3H09A 3KN2A 2K0QA 3LONA 3FOAA 3SU4A 3SU2A 5ESBA 2AHME 2JIZD 3NRLA 2M2AA 2KCYA 2F4LA 3SUEA 2XOKD 2KCAA 1DY9A 4U01A 3U1IB 3WWBA 3SU1A 2VBCA 4A1TA 3FN8A 4R8TB 1RGQA 3F3BA 3DCLA 1E1RD 5FPSA 4TT3D 2W6JD 5C0UA 4B76A 5GNDA 1NS3A 5H4IB 4B6FA 3N99A 5EQRA 4A92A 3KF2A 3LKWA 3SV9A 2KM0A 3OFND 3DSPA 4WH8A 5EQSA 1NBME 4DT4A 2OINA 2OC8A 5EPYA 3RC5A 5IDKA 1WXRA 3F2FA 3M5LA 4KTCA 3OTPA 4TYDA 3EYDA 1JXPA 1W3CA 4I31A 1CU1A 2WHXA 3KEEA 4NWKA 2QE7D 2FOMB 2O8MA 3OEED 3RC6A 4YXWD 5DN6D 2QF5A 2JJ2D 3N7DA 3PV2A 3W1EA 4F55A 2JDID 3F0PA 3WW7A 4ZCNA 3ZIAD 1OHHD 2OC1A 3SU5A 2LELA 3P8NA 2J5UA 4B71A 1BT7A 3SYJA 4I32A 3OAAD 4K8BA 4Q63A 1MABB 2CK3D 2KZ4A 2OBQA 2OC0A 2WZQA 2WPDD 3WWFA 3SUGA 5B6LA 5ETXA 3SUDA 1DY8A 1W0KD 1SKYE 3M5OA 2YMSC 2L6OA 5C0TA 1EFRD 3O8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJ1 D;  2WSS D;  2XND D;  3OFN D;  4ASU D;  1NBM E;  1BMF D;  5IK2 D;  1FX0 B;  5CDF E;  1NBM D;  1W0J D;  3OEH D;  2V7Q D;  1COW D;  2QE7 D;  4TSF D;  4Z1M D;  3OEE D;  2JIZ D;  4YXW D;  2F43 B;  5DN6 D;  2JJ2 D;  5FL7 D;  2HLD D;  2JDI D;  2XOK D;  3ZIA D;  1OHH D;  1KMH B;  4Q4L A;  4XD7 D;  1H8E D;  1H8H D;  3OE7 D;  3DCL A;  3OAA D;  1E1R D;  1E1Q D;  1E79 D;  2CK3 D;  1MAB B;  3FKS D;  4TT3 D;  2WPD D;  2W6J D;  5HKK D;  1W0K D;  1SKY E;  3N99 A;  1EFR D;  2W6I D; 
#chains in the Genus database with same CATH topology
 2H9E H;  3KYG A;  1F5R A;  2K1Q A;  1CE5 A;  3AAS A;  1EP6 A;  1D3T B;  1O2Q A;  2WV5 A;  2ZGB H;  2ZG0 H;  2J2U A;  1SFQ B;  2R3U A;  5BPE A;  1KXA A;  3TH4 H;  3BIV H;  3RU4 T;  3UB0 A;  1LVB A;  3SND A;  3LIW A;  2Q1J A;  4WMD A;  2PGB B;  1LVM A;  1OWH A;  5E8E H;  1GDN A;  4VGC C;  1WCZ A;  1WBG B;  4BAK B;  2D2D A;  1C1Q A;  1O5C B;  2NU1 E;  2A7J A;  2FOB A;  2KAI A;  3FAO A;  4ZXY H;  3F2G A;  8KME 2;  1QA0 A;  1J14 A;  2HWL B;  2VWN A;  3L3T A;  1GWA A;  1SC8 U;  1SPJ A;  1HJA B;  2ZCK P;  1DT2 A;  1A5I A;  1C5N H;  3SZN A;  3FFG A;  1NC6 A;  3TH2 H;  1GHZ A;  1A5G H;  4AC9 A;  2F9V A;  1MTW A;  2UUK B;  3E1X B;  2QF3 A;  1N6Y A;  5EXL A;  1TWX B;  1NFU A;  3BTQ E;  1PQ8 A;  4AX9 H;  4Z0K A;  5DP7 A;  1MD7 A;  4A6L A;  1HAX B;  4KEL A;  2I6S A;  1GBF A;  4MPX A;  2KCY A;  5DJ7 A;  3EA8 A;  1BDA A;  3KQB A;  2V3H H;  1YF4 A;  3TK9 A;  2Z9L A;  1XMN B;  3F3B A;  5EXM A;  3QGN B;  1TE0 A;  1FY8 E;  1EX3 A;  5KGO A;  4CRA A;  1EPT A;  1AHT H;  4YO9 A;  2D1J A;  5A8Z A;  1ABJ H;  1SGD E;  1NBM E;  5HYO A;  4I86 A;  5FHT A;  1AVX A;  2O8T A;  3GY7 A;  5A0A E;  1G3D A;  4ZHM U;  2JH0 D;  1C1V H;  2ZWL H;  1P9U A;  2FOM B;  3SNB A;  1AN1 E;  2B8O H;  2JJ2 D;  1W12 U;  3SHC H;  2QA9 E;  2FIR H;  1XX9 A;  3T5F H;  2ZZU H;  1QQU A;  1TIO A;  2LEL A;  2OTV A;  3VB4 A;  2OQ5 A;  1Y59 T;  1QBN A;  1FIW A;  2CK3 D;  3PM3 A;  1O2J A;  3SUG A;  5CHA B;  1VCQ A;  1GJC B;  3T27 A;  1JWT A;  4JK6 A;  1GJB B;  5EJZ A;  3MNC A;  3UWJ H;  3PTB A;  3PV4 A;  3U69 H;  4BAQ B;  1AZZ A;  1F0T A;  4JCN A;  3SZE A;  1PYT D;  1ELE E;  1NU9 A;  1QRZ A;  1W13 U;  2O8U A;  2ZDV H;  3F9E A;  2TPI Z;  3IG6 B;  4Y6D A;  3GS9 A;  2SGF E;  3GY2 A;  5JBC S;  1XXF A;  1V2N T;  2ZPR A;  4D9Q A;  4YLU A;  1O5G H;  1Y3X A;  2BOH B;  1C4Y 2;  2FYR A;  1C1W H;  2PV9 B;  4DG4 A;  4DOQ A;  1PPC E;  2XBX A;  2Y80 A;  8LPR A;  1D6R A;  2VWO A;  2D26 C;  2VVC A;  3S7K B;  2WV9 A;  4OS2 A;  1IHS H;  2V0B A;  1GI0 A;  1EAW A;  1ZRK A;  1GBM A;  4KTS A;  1CHO F;  1TON A;  4E06 H;  2STA E;  2GT7 A;  2XRC A;  2JKH A;  2PP6 A;  3SU0 A;  1BIT A;  5L2Y H;  4GSO A;  1LHD H;  3PMH B;  1GBD A;  2FM2 A;  2IN2 A;  5G4B A;  5AF9 H;  3CS0 A;  2UUJ B;  4FUG A;  1EKB B;  1C5P A;  1V2W T;  5E2P A;  4ZHA A;  1QL9 A;  1FUJ A;  3PLB A;  1FMG A;  3RXU A;  3MTY A;  3D62 A;  2XCF A;  2J94 A;  1YY3 A;  1GL0 E;  3UAI C;  1P9S A;  1LMW B;  1FZZ A;  4CR5 A;  1K21 H;  2P8O C;  3TLO A;  1L4Z A;  1GVL A;  1N8O C;  2BB4 A;  2GCH F;  1GI2 A;  2ZGX H;  1ELD E;  3ATL A;  3UUZ A;  1O2P A;  3KF2 A;  4DT4 A;  5IDK A;  2ZIQ H;  1EZQ A;  4MTB A;  1PFX C;  1OP2 A;  4AG1 A;  3I77 A;  4I31 A;  1OWD A;  3W95 A;  4B1T A;  1SFI A;  1HFD A;  1ETS H;  2JDI D;  4Q7X A;  2CGA A;  2G55 A;  1AU8 A;  3OAA D;  1AQ7 A;  1TRN A;  1YKT A;  2GDD A;  5E0G A;  3R3G B;  1ELV A;  3E0N B;  2WSS D;  3MH6 A;  2EQN A;  5BRR E;  1JBU H;  2FS8 A;  1BJV A;  3PMB B;  3TGI E;  1AZ8 A;  4JZI A;  3RMM H;  3STI A;  2KX4 A;  1QJ1 B;  1Z8J B;  1SGE E;  1ZGI A;  5EW2 H;  3O8C A;  2GZ9 A;  1FPH H;  1AFQ B;  4H42 U;  1L1N A;  1CO7 E;  1H1B A;  3P8O A;  3LC3 A;  3PMA B;  5CHB A;  3VPK A;  2FEQ H;  2BY9 X;  1HAY B;  2BDI A;  2W3I A;  4Y11 E;  1DWD H;  2ZF0 H;  1B0F A;  3V7T A;  3MQK C;  3HAT H;  4K2Y A;  4MPU A;  3URE A;  1GBJ A;  3KYF A;  4IMZ A;  3M7Q A;  2ZDM A;  3RXC A;  2GCT C;  3AVZ A;  2EEK A;  1C2K A;  4DVA U;  3DA9 B;  4ASH A;  2TGD A;  3TK5 A;  3RXS A;  3U28 C;  4XOJ A;  2A4G A;  1C2G A;  2VVV A;  2KR7 A;  3D49 H;  3GCT G;  1GI6 A;  2F9O A;  3MMG A;  1C2H A;  2FMJ A;  2K0Q A;  1C2D A;  3R0F A;  5L6N H;  4ZAE A;  2TGA A;  3SJI A;  4OGX A;  3S9C A;  1AY6 H;  4JYV H;  3H5C B;  5C1U A;  3PRO A;  1TAW A;  3V13 A;  2BDG A;  2W6J D;  1ZSK A;  2PTN A;  3GY5 A;  3URC A;  5H4I B;  1FIZ A;  3ATI A;  1VGC B;  2GZ8 A;  2OP9 A;  3FP8 E;  4X0W U;  1ZZZ A;  1P2K A;  3NXP A;  3MU1 A;  2B7D H;  2WV4 A;  2ZGC A;  1EPT C;  1RJX B;  3QWC H;  2WPL S;  5FBI A;  3ZIA D;  2OD3 B;  5F8Z A;  3ZZ7 A;  2GJG A;  1HB0 B;  1T4U H;  4P00 A;  3TGK E;  2JET C;  4WME A;  2OC0 A;  2TIO A;  1HAV A;  4NFF A;  2ZPS A;  1O2X A;  1EZX C;  2EA3 A;  2PW8 H;  3SGB E;  4AYV B;  3SGQ E;  1GDU A;  2BY7 X;  2BXT H;  4FUH A;  5HIZ A;  1QUR H;  4AZ2 B;  4D7F A;  3T2N A;  1ESA A;  3LGW A;  4FUJ A;  2V7Q D;  7GCH G;  1K1M A;  1RXP A;  1C1T A;  2BD3 A;  5E2O A;  4BTT B;  1UHB B;  2FWW A;  2R2M B;  3HKI B;  2PGQ B;  2ZP0 H;  1IQI A;  3F0O A;  3GCH C;  1H8E D;  1H8H D;  3FO8 D;  3DD2 H;  1SGI B;  1TA6 A;  3JZ1 B;  2XC0 A;  3MI4 A;  3U9A H;  2W6I D;  6LPR A;  4VGC B;  3QLP H;  2QGR A;  3RXE A;  3P95 A;  2G52 A;  2Y6T A;  1HAO H;  2LPR A;  2OCV B;  3RXB A;  3OEH D;  1SGF A;  3TVJ B;  4NFE A;  3SJK A;  1GJ4 H;  1BUI A;  2HLD D;  3A89 A;  5DP6 A;  1MUE B;  4CRF A;  3PRD A;  2XC5 A;  1RRK A;  3QZR A;  4D76 A;  3MFJ A;  4RN6 A;  3AW0 A;  4CH8 B;  1YGC H;  7LPR A;  1GBL A;  1PPF E;  4ISL A;  4JZD H;  4A7I B;  3VG8 A;  2LP6 A;  5T1V A;  1S6F A;  3SU3 A;  2FI4 E;  4JZF H;  1P12 E;  2BY8 X;  1MBQ A;  4KGA A;  1TPO A;  3LH3 A;  4BXS A;  3P6Z B;  4IC5 A;  1QRX A;  3VGC C;  3PO1 C;  3LJO A;  2FOG A;  3A7W A;  1Q3X A;  1AND A;  3DCL A;  1F5L A;  4IMQ A;  3EE0 B;  1JMO H;  5JPM H;  2VGC C;  2BVS H;  1RTK A;  3GY6 A;  2FO9 A;  1ZOM A;  2WPH S;  4K60 A;  4A92 A;  3SV9 A;  2RDL A;  1VKY A;  4MNY A;  1LKB A;  2OIN A;  4DUR A;  4CBO A;  1OP8 A;  1IQE A;  1SGN E;  5KED A;  2VID A;  2QXG A;  5AFZ H;  3SGA E;  1SVP A;  2QE7 D;  1YWU A;  2ALV A;  2BDY A;  3ZVA A;  3Q3X A;  2J5U A;  2J4I A;  1EAI A;  5DP3 A;  3ZZ3 A;  3KID U;  3PYH A;  1L0Z A;  5LPE A;  3VB5 A;  1C5Q A;  5AVD A;  1PPG E;  1Y8T A;  2G4U A;  2YMS C;  3FZZ A;  4JK5 A;  3UNR A;  1QRW A;  1BML A;  3UFA A;  1WTG H;  4GPG A;  3TU7 H;  4ABE A;  3JZ2 B;  1ELF A;  2D8W A;  3U1J B;  1BJU A;  3U8T H;  4TWY A;  2WUC A;  2PFE A;  2FOE A;  1WU1 A;  1NPM A;  1AUT C;  1XUH A;  1UVU H;  3OU0 A;  2VIN A;  3K9X B;  1AWF H;  1P10 A;  4LK4 A;  4AB9 A;  5J4S A;  1E36 B;  4H6T A;  4MPW A;  2HNT F;  4B2B A;  2BDB A;  1DM4 B;  4UFG H;  1O3J A;  1KSN A;  1OXG A;  2BX4 A;  3GCT F;  1GHB G;  1KXC A;  1YPL H;  2C93 B;  3T62 A;  5HM9 A;  1TRY A;  5C5N A;  4IS5 A;  3SV8 A;  3WY8 A;  2HPP H;  2FX4 A;  9EST A;  3A87 A;  1BBR K;  2Q6G A;  3BG8 A;  4UE7 H;  4AOQ A;  1AIX H;  2PUQ H;  3LGU A;  5EGM A;  1O2N A;  1G3E A;  1O3M A;  1LHE H;  1O3P B;  3EAJ A;  1Z8R A;  2ZQ2 A;  2FPZ A;  1L1G A;  2HAL A;  3FP6 E;  5DGJ A;  3LU9 B;  1MTU A;  1V2U T;  3ZVE A;  4WWY A;  4Y7A A;  1TMU H;  4EST E;  2Y5H A;  3QTV H;  3VB7 A;  4CRC A;  5C17 A;  4YZU A;  4RI0 A;  3UWI A;  1P11 E;  1MTN C;  2ZFR H;  1T8M A;  1NBM D;  4UON A;  2G00 A;  1W8B H;  5JB9 S;  1DX5 M;  3RXI A;  2BLW A;  5ESB A;  4J1Y A;  3E91 A;  3OY5 U;  3ZYE A;  3DT0 H;  2FLB H;  1P8V C;  1XVM A;  2PSY A;  3FZD A;  3RML H;  4AB8 A;  1EOL A;  2P8O B;  3C27 B;  2QYI A;  3SU1 A;  2BQ6 B;  1HDT H;  3Q3K A;  1YC0 A;  3A7T A;  4CRB A;  1N8O B;  1MZD A;  2QY0 B;  2AS9 A;  2CV3 A;  1A0L A;  2BTC E;  5C0U A;  1NS3 A;  1G9I E;  1P02 A;  2AIP A;  2G5V A;  5EQS A;  3A7V A;  4ABG A;  4H4F A;  2SGP E;  4CRG A;  2J98 B;  1A0H B;  7GCH F;  3T28 A;  2XW9 A;  3PLP A;  1P3C A;  1GI5 A;  1BRB E;  3NCL A;  4F55 A;  1ZPC A;  4F4O C;  2AGE X;  1TOM H;  1BMN H;  3SHA H;  2AEI H;  3SYJ A;  4CHA C;  4I32 A;  1BT7 A;  3BTM E;  5FAH A;  3IIT A;  5C1X A;  3WWF A;  3BV9 B;  2C4F H;  1ID5 H;  3KQE A;  1ZPZ A;  1AI8 H;  1TPP A;  3LT3 A;  2ZFS A;  4FU7 A;  3RP2 A;  1YPH E;  4GHQ A;  1HIA B;  3ZZ5 A;  1TAL A;  3LPR A;  5T3H A;  1UCY K;  1J16 A;  3U8O H;  4X8V H;  1KXF A;  3LGI A;  1DXW A;  1W0J D;  3S9B A;  1CVW H;  1E38 B;  1TB6 H;  1HXE H;  2QAA A;  1GCT C;  1SMF E;  5C3N A;  1XUF A;  1O5E H;  1HIA A;  1O38 A;  3MU8 A;  1H9H E;  1G2L A;  2BDC A;  4M9F A;  2ZEB A;  2R0L A;  2HLC A;  3UNS A;  3PTN A;  2JH5 D;  3URD A;  1TYN A;  3BSQ A;  4WH6 A;  1AGJ A;  2IJO B;  4NG9 H;  4F49 A;  1O2K A;  4AOR A;  1OPH B;  3N7O A;  1V2O T;  3E6P H;  3VXE H;  3M5N A;  1UTK A;  1HAZ B;  2Y7Z A;  3SI3 H;  3A81 A;  4WJG 2;  4X8S H;  2F9N A;  5GIB A;  1SGT A;  4X6M A;  1IAU A;  1Z1J A;  1KMH B;  1OWK A;  1RD3 B;  1ZPB A;  1Y5U T;  4ISO A;  3RC4 A;  3LOX A;  1GVK B;  2KAI B;  3FKS D;  1E1Q D;  3GDU A;  1C4U 2;  1UCY H;  2GCT B;  3QZQ A;  4ZXX H;  4FUD A;  1EOJ A;  2J34 A;  3ZYD A;  3SQE E;  1SQR A;  4MDS A;  5EIY A;  3Q76 A;  4U32 A;  2BYA X;  1CHG A;  3MU5 A;  1SLW B;  1SGC A;  2GX4 A;  2JIZ D;  2WPJ S;  1P09 A;  3P92 A;  4JYU H;  1D6W A;  4ZKN U;  2B9L A;  2GZ7 A;  3ZVF A;  2BD2 A;  3H7T A;  2F9P A;  1QY6 A;  1PJP A;  4B6F A;  4AG2 A;  2BLQ A;  4ACA A;  1BRC E;  1HJ9 A;  1TX7 A;  3S7H B;  2OC8 A;  3V12 A;  1TNJ A;  3F2F A;  1A61 H;  1GDQ A;  2ULL A;  2Z3C A;  2WHX A;  2O8M A;  2PKA B;  2G5N A;  1ANE A;  1EPT B;  3UY9 A;  4DIH H;  5EXN A;  3KL6 A;  1GJ9 B;  2OC1 A;  3NKK A;  1MKX K;  1ZHP A;  3SU5 A;  2AYW A;  2NWN A;  1K1L A;  1ELA A;  1C5V A;  1HAH H;  3RXA A;  2JET B;  3GDV A;  2STB E;  1NRR H;  2PKA A;  1C1R A;  5L30 H;  1L4D A;  2ZEC A;  2IPQ X;  1GHB F;  1F2S E;  1O3K A;  1O39 A;  5JDU B;  5ABW A;  3N7E A;  4BOH A;  1C1N A;  1YPE H;  2YNB A;  1ELG A;  1COW D;  2F43 B;  3B8J A;  1MZA A;  4Q7Y A;  1S0R A;  1OS8 A;  1O30 A;  4CH2 B;  1C5U A;  3MHW U;  3W94 A;  2BD7 A;  1MQ6 A;  3F9F A;  3GCH B;  1K2I 1;  1YM0 A;  2G51 A;  1FN6 A;  4I8L A;  2GTB A;  1O5F H;  1THR H;  1D3P B;  1LHC H;  1XKB C;  2WYJ A;  5TCA A;  4NA8 A;  3KQD A;  3SQH E;  2BLO A;  1PQ5 A;  1A3B H;  1MU6 B;  3GIC B;  4TPY A;  1MKX H;  1MKW K;  5F8X A;  1QJ6 B;  4UEH H;  4Z1M D;  1O2M A;  3GOV B;  3PRB A;  1BB0 B;  1H4W A;  1NU7 B;  5C1Y A;  5DKM A;  1C5Z B;  4ZH8 A;  1LHG H;  4Y79 A;  4YOJ A;  1C9P A;  2R2W U;  1SGY E;  2SGQ E;  4X1P U;  2GVF A;  1FAK H;  3PB1 E;  1NFY A;  1UCY E;  1F92 A;  2BY5 X;  1CBW C;  3QX5 H;  2GP9 B;  3AAV A;  3ZZ6 A;  4FUF A;  5FX5 A;  3GIS B;  3A8B A;  4ZRO A;  1THS H;  2AGG X;  2J38 A;  1LHF H;  1AUJ A;  3M3T A;  4OS4 A;  2Y5G A;  3M3V A;  1LQE A;  3SI4 H;  1RTL A;  1PYT C;  1INC A;  1V2T T;  4UFF H;  1V2R T;  2XXL A;  3HGP A;  4CBN A;  1F0R A;  3QO6 A;  2XYA A;  4U01 A;  2FZZ A;  1FY5 A;  4F48 B;  3VGC B;  3TJV A;  1KTS B;  3PO1 B;  4MVN A;  2EI7 A;  1DVA H;  2ZPQ A;  1OWE A;  2SNV A;  2VH0 A;  1C4V 2;  5IYT A;  1K0H A;  1O5D H;  3RXH A;  1SLV B;  4INH A;  1MAY A;  1MKW H;  5GND A;  5L2Z H;  2VGC B;  1UMA H;  3H7O A;  3PWC A;  3LKW A;  1QB9 A;  2H9T H;  1O36 A;  4KTC A;  4E05 H;  3EYD A;  2EI6 A;  1ANC A;  3B9F H;  5EJ1 A;  2PLX A;  2J95 A;  1ZJD A;  4ISN A;  4LOY H;  3RLY H;  3W1E A;  2AFQ B;  2V3M A;  2QCY A;  3MWI U;  3F0P A;  3ELA H;  2HNT E;  3BTH E;  1FDP A;  1C5L H;  2A7H A;  3P8N A;  2F3C E;  1PQ7 A;  1TGT A;  1W14 U;  3ZZA A;  3LGT A;  1B5G H;  3RMO H;  2QN5 T;  2ANW A;  3TPI Z;  1CT0 E;  2BHG A;  4BAH B;  4X8T H;  1PQA A;  1O3B A;  4RT0 A;  1SLX B;  2YMS B;  1VR1 H;  4ABA A;  1AB9 C;  1DDJ A;  5GJ4 B;  3ITI A;  3M5M A;  5F03 A;  2HVX A;  4KP0 A;  4OS5 A;  1UTM A;  2HPQ H;  2FP7 B;  1IQF A;  3BTW E;  1S84 A;  1OYQ A;  5DO4 H;  2HRV A;  3K6Z A;  1T8L A;  3A7X A;  2PWX A;  1AE5 A;  1C2M A;  1GHW H;  2A4R A;  4NA9 H;  3PLK A;  3RXJ A;  1E37 B;  2QV1 A;  6CHA C;  1ZTK A;  4A1V A;  3LGV A;  5SGA E;  5JB8 S;  3SV6 A;  2QIQ A;  1EXF A;  2BD4 A;  3BTD E;  4Z6A H;  1QBO A;  5LH8 A;  4ABF A;  4FVD A;  5FL7 D;  4O9V A;  1O3G A;  4IN2 A;  1Y3U A;  3MO6 A;  1ZHM A;  4NSY A;  2J92 A;  3QGJ A;  1E34 B;  1LPK B;  1JRT A;  5F6M A;  1SHH B;  1OKX A;  2KFW A;  4WF8 A;  2J9N A;  2ODY B;  4DGJ A;  5HM2 A;  5GXP A;  1MH0 A;  5K7R A;  3LON A;  1MTN B;  2SNW A;  1ZLR A;  4LZ1 H;  1O3E A;  1DY9 A;  4Q80 A;  2BD8 A;  4JZ1 A;  2GT8 A;  3RMN H;  1ZMN A;  1T31 A;  1GI7 B;  1IOE A;  5DPA A;  1O2W A;  1SSX A;  2FOC A;  1DOJ A;  1BZX E;  4GVU A;  1V6D A;  4UDW H;  1ZML A;  1YLD A;  4TY7 A;  3UR6 A;  2BDH A;  2QXJ A;  1BQY A;  3AAU A;  1ARB A;  1B7X B;  1YCP K;  1UTQ A;  3BTF E;  2W26 A;  1O31 A;  1PPE E;  1W3C A;  1UTP A;  2PHB A;  3BN9 A;  2AER H;  1KDQ A;  2VIP A;  1KLJ H;  2JH6 D;  3PV2 A;  7KME H;  1ZGV A;  2ZU2 A;  4XRN A;  3KQ5 A;  1EAT A;  1MAB B;  5EOK A;  4CHA B;  2H2Z A;  1T7C A;  1KIG H;  3MOC A;  4I8G A;  3RU4 E;  1P01 A;  3E3T A;  4NIV A;  5C0T A;  1ACB E;  1P05 A;  2VWM A;  3OY6 U;  5EST E;  1YLC A;  2WIN I;  1HAV B;  2L74 A;  4I7Y H;  4XBC A;  2XNI A;  1GCT B;  1MMJ N;  1GJ6 A;  1NES E;  1BTH H;  3RXR A;  1BIO A;  5GCH G;  1O34 A;  1WTH D;  4YOI A;  4Y8X A;  2ALP A;  3G01 A;  2A4Q A;  2XWB I;  1TQ0 B;  3E16 B;  1BTY A;  1TLD A;  2ILN A;  3RUO A;  5E0H A;  1FY3 A;  1DS2 E;  3KGP A;  1D9I A;  1DWC H;  2GDE H;  1F0S A;  3SNE A;  3HKJ B;  2VIQ A;  2AMD A;  3A83 A;  1O2U A;  3PV5 A;  2V35 A;  2A31 A;  2ZU3 A;  1OX1 A;  3GY4 A;  1J9C H;  1EZS C;  1D4P B;  4Q7Z A;  3P8G A;  1A3E H;  4Q4L A;  4Q2K A;  3LGY A;  4HZH A;  3VB3 A;  3E8L A;  3HGN A;  3MU0 A;  2CXV A;  2Z9K A;  3MO3 A;  2CF9 H;  1C1S A;  1UW7 A;  4NWL A;  1O2G H;  1UJ1 A;  4K8Y A;  1DWE H;  4J2Y B;  4R0I A;  2GGV B;  2YOL A;  5T6F A;  2VU8 E;  1DE7 H;  1SOT A;  3SU4 A;  2SGD E;  2ZGJ A;  3V3M A;  4FOU C;  1NZQ H;  1O5A B;  1RS0 A;  2M2A A;  1WUN H;  3SUE A;  1O3H A;  2M5T A;  1SL3 A;  2VBC A;  1J15 A;  1SR5 C;  1KTT B;  2C8W B;  1Z8I B;  1BA8 B;  5PTP A;  5GDS H;  1GHA G;  1JRS A;  3K2U A;  1PPH E;  1BMA A;  1QBV H;  4B76 A;  6GCH G;  3SJ8 A;  1JOU B;  1QZ8 A;  1ETT H;  4ACB A;  5T6D A;  3A8A A;  1VCW A;  4Y0Z E;  1OSS A;  4TYD A;  1Q2W A;  1S82 A;  2FOF A;  1DPO A;  3RLW H;  5DN6 D;  3D23 A;  1DUE A;  2QXH A;  4ZCN A;  2ZO3 H;  1UK2 A;  3MH5 A;  2HVY B;  4BAO B;  1WYK A;  1A5H A;  3P8F A;  4XDE A;  4Q63 A;  2ODP A;  2OBQ A;  1O2V A;  4B2C A;  1FPC H;  5KEC A;  2L6O A;  1UVP A;  1K28 D;  1HAG E;  1F5K U;  1ORF A;  2ZFP H;  3BEF B;  3RXM A;  1GHY H;  3FAN A;  1TNG A;  4Y7B A;  2AMP A;  5IK2 D;  1NRQ H;  3SNC A;  4NCY A;  2A1D B;  1RIW C;  4FUB A;  2ZFT A;  1DSU A;  2ZHE H;  4JMY A;  4DY7 B;  1FXY A;  3CP7 A;  3TIT A;  1EJN A;  5JYI A;  2H5D A;  1W0Y H;  1GI8 B;  5K0H A;  4WXI A;  2OK5 A;  2ZTX A;  3HK6 B;  1D3Q B;  1RTF B;  1V2M T;  4WVP E;  3SUF A;  2BD5 A;  3ZZD A;  4X6N A;  1C2E A;  3RXF A;  1BTX A;  1GMH F;  3L6P A;  1F0U A;  1DST A;  2F9B H;  5C20 A;  2C8Y B;  2V3O H;  1K1P A;  2AGI X;  1EAU A;  1K22 H;  2V6N A;  3TGJ E;  3LJJ A;  5T6G A;  3T29 A;  3TJN A;  3FP7 E;  2YNA A;  1DFP A;  1P2Q A;  9LPR A;  3F9H A;  3BG4 B;  1GG6 B;  2IOT A;  3SOS A;  2A4O A;  4OS6 A;  1SQO A;  3D65 E;  2XTT B;  4AN7 A;  2H6M A;  3HK3 B;  1C5S A;  4I33 A;  3GY8 A;  1LVY A;  3ZVD A;  3AK5 A;  2ZU5 A;  1CBW B;  1GBA A;  1CA0 C;  3RDZ A;  4X2V A;  5FX6 A;  3OX7 U;  4GAW A;  3MU4 A;  1EP5 A;  1UVT H;  2SFA A;  2P3T B;  4IBL H;  2BM2 A;  1GCD A;  1K1O A;  3QUM P;  1O32 A;  1C2J A;  2HGT H;  1O3D A;  4ZMA H;  2OXS A;  2AMQ A;  2ZU4 A;  2ANY A;  3ATM A;  3U1I B;  3WWB A;  2KCA A;  3PMJ A;  1HYL A;  2FTM A;  1K9O E;  1B0E A;  1O3C A;  1EAS A;  4KKD A;  5LPF A;  1O2T A;  1SG8 B;  2P94 A;  1P2O A;  1V2K T;  8GCH F;  1WSS H;  2FYQ A;  2PKS C;  4SGA E;  3M7U A;  1C5X B;  1TRM A;  1ZYO A;  3SJO A;  1JIM A;  1G3C A;  2ZTZ A;  4NWK A;  4BAM B;  1VCP A;  1AKS A;  1MCT A;  3RXK A;  1H9I E;  2DE8 A;  2ZI2 H;  2GMT C;  1K1N A;  4MNV A;  5GCH F;  1UK3 A;  2C8X B;  1SQA A;  2GV6 A;  4X1Q U;  4CR9 A;  1YLN A;  2O8W A;  5B6L A;  5ETX A;  1A0J A;  3VB6 A;  1BTZ A;  4D9R A;  2UUF B;  3QDZ B;  3K6Y A;  1MAX A;  2TGP Z;  4X1N U;  1AB9 B;  1S85 A;  4FXG H;  1IQJ A;  1S6L A;  1V2S T;  1ELC A;  2NU4 E;  2Q6F A;  4ABD A;  4DT7 B;  1BBR H;  1MD8 A;  1YCP M;  2ZDK A;  1DUA A;  1PPZ A;  1EAX A;  1OYT H;  1WDI A;  1Z1I A;  3MNS A;  1CT2 E;  1DWB H;  1L2E A;  2XWA A;  4QT8 C;  4BTU B;  1UTN A;  4AYY B;  2GKV E;  5C94 A;  3M3S A;  3OSY A;  4I8J A;  2A32 A;  1S5S A;  1P2J A;  1H8I H;  1A7S A;  1BRU P;  5FBE A;  1E79 D;  4HI3 A;  1A46 H;  1V3X A;  1WQV H;  1HUT H;  2FI3 E;  2P16 A;  1Y3V A;  2P93 A;  1C5Y B;  3M7T A;  5AHG H;  3MNX A;  1O3N A;  5JBT A;  4E7R G;  3V0X A;  3RXG A;  1IQN A;  1NRN H;  1GMD F;  1LKA A;  4K3J A;  6CHA B;  1GMC F;  1GGD C;  1J17 T;  3UQV A;  3STJ A;  5DP9 A;  3SV7 A;  1TGS Z;  2BY6 X;  2ZU1 A;  1C9T A;  5GPI B;  2EC9 H;  3QK1 A;  1O3L A;  4H6S B;  3Q3Y A;  3EE7 A;  3EQ0 H;  1GHA F;  3NWU A;  4X2Y A;  6GCH F;  4ZUH A;  3MH7 A;  1NTP A;  1Y5A T;  4DJZ B;  4DW2 U;  1HV7 A;  3TK6 A;  1HCG A;  2EY4 C;  2P95 A;  1GBH A;  1O5B B;  3CEN A;  1KXB A;  2ODQ A;  1BTW A;  3BTT E;  1KXD A;  2RA0 A;  4I8K A;  2F4L A;  5FCK A;  3SO3 A;  4X6P A;  3FN8 A;  3PWB A;  1V2J T;  4TY6 A;  2FI5 E;  5FPS A;  3BTG E;  3M61 U;  2G81 E;  5DP5 A;  3BTK E;  1SGR E;  1LO6 A;  3RXT A;  1Y3Y A;  1V2L T;  1FY4 A;  2B0F A;  1O2I A;  3A84 A;  1GBC A;  3DFL A;  1QB1 A;  1O37 A;  1QFK H;  1C1U H;  4P02 A;  3ZZC A;  1EJM A;  1TBZ H;  2DE9 A;  4YES B;  3RM2 H;  1W7G H;  3CS7 A;  3N7D A;  5DP8 A;  3UOP A;  4FUE A;  2O9Q A;  1A2C H;  2HNT C;  1LVO A;  1NFX A;  3UIR A;  1TAB E;  1FAX A;  2ZFF H;  1TQ7 B;  1GBE A;  2BZ6 H;  4UD9 H;  1C1M A;  3M5O A;  1ELB A;  2VJ1 A;  2A2X H;  2OLG A;  3A82 A;  1MTV A;  1NT1 A;  3B23 B;  3VEQ B;  1BBR E;  1G3B A;  1ZRB A;  2CMY A;  4LXB H;  3UR9 A;  4E7N A;  5JBA S;  3E90 B;  4TSF D;  1DXP A;  1SBW A;  2SGA A;  4X1R U;  3UPE A;  1NY2 2;  2R3Y A;  1CA8 B;  3RXD A;  5I25 A;  1V2V T;  2ZCL P;  3ATK A;  4BAN B;  4TWW A;  2RG3 A;  1C2F A;  1C5T A;  1ZTL A;  4WXV A;  3AW1 A;  5E0J A;  4FUI A;  1TNL A;  4RKO B;  1ABI H;  1O2H A;  2OUA A;  5J4Q A;  1EB1 H;  1V2P T;  3Q77 A;  4O3U A;  1TPA E;  2BZA A;  1SGQ E;  3FVF B;  3QTO H;  1GVZ A;  2CHA C;  5DSF A;  1UVS H;  3ZZ8 A;  5CMX H;  1H8D H;  1J8A A;  3RXV A;  3M35 A;  1ETR H;  4K1E A;  1T4V H;  4Y71 A;  1AVG H;  3U98 H;  4B74 A;  1W0Z U;  3OYP A;  3SNA A;  1YPM H;  2W3K A;  3HPT B;  1AD8 H;  2BLV A;  1AMH A;  2J97 A;  2F91 A;  4XD7 D;  1MBM A;  3T25 A;  2QC2 A;  3NZI A;  3ZZ4 A;  1SB1 H;  2GD4 B;  2KCO A;  3F2H A;  2Z9G A;  2FX6 A;  3F6U H;  1C5M D;  2BDA A;  2Z9J A;  6EST A;  2ZDN A;  1IQL A;  1WOF A;  4ABI A;  2QF0 A;  4YTA A;  4THN H;  1X7A C;  1EUF A;  1NN6 A;  3ZV8 A;  1XM1 A;  3MO9 A;  2CF8 H;  1P57 B;  2QF4 A;  1Q31 A;  3KQC A;  5TJX A;  1BHX B;  1AO5 A;  4X6O A;  1BTU A;  3NRL A;  2A5A A;  1KYN A;  3BG4 C;  1GG6 C;  1TGN A;  4YLQ H;  2H5C A;  4INK A;  3CNR A;  4Y8Y A;  1O3I A;  3DHK H;  2W7S A;  3EA7 A;  3MYW A;  4JYT A;  2A5I A;  5EOD A;  4IW4 E;  5JBB S;  1RFN A;  5DP4 A;  1E0F D;  3RU4 D;  1FV9 A;  1SGP E;  1P2M A;  3DSP A;  1LQD B;  2XBV A;  2BQ7 B;  5C2Z A;  2THF B;  5EPY A;  1CGJ E;  1ELT A;  1KY9 A;  2AIQ A;  2BMG B;  3SBK A;  3GDS A;  1OHH D;  3DFJ A;  1VIT F;  4NZQ A;  1IQK A;  3SJ9 A;  4ZKR U;  2KZ4 A;  2R0K A;  3A7Z A;  3NK8 A;  1QR3 E;  3UOU A;  2RDE A;  1EFR D;  3TIU A;  2WYG A;  2ZKS A;  4OS7 A;  1O2R A;  2NU0 E;  1EJA A;  3O8R A;  4NA7 A;  2OQU A;  2RFK C;  4A1X A;  2WPM S;  5C5O A;  8EST E;  3DUX H;  2TBS A;  2IJD 1;  1EST A;  3ZVC A;  5A8Y A;  2VVU A;  1BTP A;  2UUY A;  1RIW B;  1CGI E;  1Z6J H;  2BD9 A;  1DIC A;  4JZE H;  1CSO E;  4D8N A;  1EQ9 A;  1IQG A;  1QCP A;  1EZU C;  2DUC A;  4Y8Z A;  2ZTY A;  1OWI A;  5HKK D;  2ZC9 H;  4OS1 A;  3EST A;  4K69 A;  1W7X H;  3BF6 H;  1T8N A;  4XBB A;  3UTU H;  2OC7 A;  4ABB A;  1FX0 B;  1P06 A;  1ZSJ A;  1BCU H;  4X2W A;  1W11 U;  3O8D A;  1E35 B;  1C5W B;  2BVX H;  1FON A;  2KCP A;  2CN0 H;  2FTL E;  2HOB A;  2FOH A;  1C1O A;  4B6E A;  3DSO A;  1O2L A;  2G8T A;  3SW2 B;  1S81 A;  1CA0 B;  2P3U B;  1ESB A;  1IQM A;  2GV7 A;  2F9U A;  3A8C A;  3H09 A;  1LCY A;  1VJ9 U;  4PRO A;  3ZVB A;  5HMA A;  1C5O H;  5FXL A;  1BHX F;  1DIT H;  4A1T A;  2C8Z B;  1UK4 A;  4R8T B;  1RGQ A;  1UTL M;  5GWZ A;  1QJ7 B;  2ZFQ H;  2XBW A;  1QIX B;  1SOZ A;  3IWM A;  3KCG H;  3GYM A;  2BXU H;  2Z3D A;  2VIV A;  4SGB E;  3T26 A;  1TNH A;  4ABJ A;  2FDA A;  5HIY A;  3VFE A;  3ZVG A;  1EB2 A;  1GMH G;  3OFN D;  1UO6 A;  1XUJ A;  1YYY 1;  3MH4 A;  3F1S B;  4D7G A;  2PKS B;  1TBQ H;  3OTP A;  1JXP A;  1UTO A;  2Y82 A;  1CQQ A;  1GHX H;  1P2N A;  4UFD H;  4Y0Y E;  1GJ5 H;  1GJ8 B;  1D3D B;  3BIU H;  3SN8 A;  1KLT A;  1YPJ H;  2GMT B;  1YPK H;  1GBI A;  3K65 B;  2Z3E A;  1DY8 A;  1W0K D;  3LDX H;  2UWL A;  1KDQ B;  5HXF A;  3O8B A;  2JJ1 D;  4CRD A;  4DII H;  1T8O A;  2NU2 E;  1SGF G;  4AFU A;  2VH6 A;  5F53 A;  4DCD A;  1CGH A;  4MQA A;  2NU3 E;  4FVB A;  1TNI A;  1LPG B;  1MU8 B;  2P59 A;  3A7Y A;  5EPN A;  1MQ5 A;  5EQQ A;  1S83 A;  4AGK A;  1HRT H;  4Y10 E;  3P70 B;  2XC4 A;  3LH1 A;  1Z8G A;  4XE4 A;  2OBO A;  4AGJ A;  2BVR H;  8GCH G;  1GJD B;  4YT6 H;  4FU8 A;  1KLI H;  1QQ4 A;  2G4T A;  4B75 A;  1GGD B;  1UVO A;  3SU6 A;  1QB6 A;  4NSV A;  2O8L A;  3ODD A;  3BTE E;  1HJA C;  5LGO A;  5HGG A;  2ZCH P;  1DLK B;  1O35 A;  4AFS A;  1YBW A;  3MNB A;  4XSK U;  1O2O A;  1XKA C;  1YCP H;  2FOA A;  2Y5F A;  5FPT A;  4B73 A;  2QXI A;  1TBR H;  1YP9 A;  2XND D;  1S6H A;  2K8I A;  3GYL B;  1GL1 A;  1P04 A;  5FPY A;  4X8U H;  1OWJ A;  3ATW A;  1GPZ A;  3FOA A;  1G32 B;  3EGK H;  3RXL A;  3SU2 A;  5LPR A;  1VIT H;  4I8H A;  2PUX B;  1XUG A;  1GBB A;  2AHM E;  4RKJ B;  3S0N A;  1P03 A;  1IQH A;  4NIW A;  1ANB A;  3ZZB A;  2I6Q A;  1XUI A;  4XFQ A;  2Y81 A;  1BOQ A;  1CT4 E;  1QHR B;  1C1P A;  1LTO A;  4GCH G;  4TT3 D;  1VZQ H;  2Y7X A;  3LC5 A;  2PTC E;  5A0B A;  3N99 A;  5EQR A;  2Z94 A;  4ABH A;  2KM0 A;  5DK1 A;  4WH8 A;  3RXP A;  3ENS B;  4WMF A;  3ZZ9 A;  1HJ8 A;  4MG3 A;  1G30 B;  1GMD G;  4TPI Z;  2VWL A;  1O0D H;  1GMC G;  3KEE A;  3NPS A;  1TFX A;  2ANK H;  3NUM A;  2QF5 A;  2H9H A;  4BTI B;  1GBK A;  1HAI H;  1FY1 A;  2FLR H;  1BMM H;  1DLE A;  4HTC H;  4XBD A;  1AWH B;  5CHA C;  3RXQ A;  3BEI B;  2ZDA H;  1TA2 A;  1SKY E;  4ZKS U;  4A5T S;  7EST E;  4MPV A;  1UHB A;  4K1S A;  3EA9 A;  2WUB A;  4B2A A;  1ZMJ A;  1LPZ B;  4K1T A;  1G36 A;  2A45 B;  3VXF H;  2FXR A;  2Z7F E;  3F9G A;  5B6O A;  1AE8 H;  2C3S A;  2Z9I A;  3A88 A;  5EJL A;  1L1J A;  4UFE H;  3SOR A;  2ZA5 A;  1QL7 A;  4AFZ A;  1HLT H;  4X2X A;  2BOK A;  1YPH C;  4IN1 A;  1A4W H;  1K1I A;  3RM0 H;  1TMT H;  2CHA B;  2UWP A;  1ZR0 A;  4OGY A;  3QN7 A;  4YOG A;  4MLF B;  1TGB A;  1AVW A;  2ANM H;  1Z71 A;  4ISI H;  1M9U A;  1QA7 A;  2BX3 A;  1WAY B;  4M7G A;  4MNX A;  1U6Q A;  3C1K A;  4INL A;  2YMS D;  3OTJ E;  4CRE A;  2TRM A;  1THP B;  3A80 A;  3L33 A;  2FES H;  3SV2 H;  2ZHQ H;  1BMF D;  3M37 A;  4K5Z A;  1ZJK A;  1FI8 A;  4O03 A;  1XXD A;  1JIR A;  1T32 A;  1HGT H;  2XBY A;  4AFQ A;  1GHV H;  1QL8 A;  1MCV A;  1SLU B;  2A2Q H;  3U8R H;  4BXW A;  1TGC A;  5EG4 A;  1DAN H;  4IC6 A;  3DSG A;  2C90 B;  1N6X A;  4NZL A;  3S9A A;  3RXO A;  4KTU A;  4FUC A;  2W5E A;  1P0S H;  3RC5 A;  4HFP B;  2A7C A;  1G2M A;  1GBT A;  2ZHD A;  2H1U A;  2EST E;  3RC6 A;  1FLE E;  4YXW D;  1QTF A;  5TCC A;  4YT7 H;  3WW7 A;  1TNK A;  4RT1 A;  3M36 A;  4O3T A;  1KXE A;  1YPG H;  2LNC A;  1O33 A;  1BRA A;  2WZQ A;  2WPD D;  1AKS B;  4U2W A;  4ISH H;  2F83 A;  1ARC A;  2P3F H;  2EI8 A;  2ZDL A;  4OM9 A;  1FN8 A;  2WPK S;  2WPI S;  2W7U A;  2ZQ1 A;  3UNQ A;  4LZ4 B;  1GJA B;  1O3A A;  2TGT A;  1O3F A;  4U30 A;  2AH4 X;  1W10 U;  1HAP H;  2ZNK H;  1HXF H;  1TPS A;  2CJI A;  4YM9 A;  3KNX A;  1AFQ C;  1ZTJ A;  3UQO A;  2ASU B;  2VIW A;  3F68 H;  1H9L B;  4GLY A;  5C67 A;  1GI1 A;  3ODF A;  3TH3 H;  4FET A;  4GHT A;  1MTS A;  3OE7 D;  3A85 A;  1AFE H;  3TJO A;  1W2K H;  4ASU D;  2SGE E;  5A09 A;  4NGA H;  5CDF E;  1PPB H;  1O2Y A;  2XCN A;  1NRS H;  5EU8 A;  1GI9 B;  3TNT A;  5EW1 H;  4ZHL U;  4FU9 A;  1SI5 H;  2FS9 A;  1N1L A;  3P17 H;  3GCO A;  5CE1 A;  2ZHW H;  5A2M H;  3GY3 A;  5A8X A;  1A1R A;  1QGF A;  4O97 A;  1ZHR A;  1VIT G;  1K1J A;  3KHV A;  2A0Q B;  4GCH F;  4IGD A;  4BNR A;  1Y3W A;  2ZGH A;  1FNI A;  1XVO A;  1Z7K A;  1NRO H;  1TX8 A;  3A86 A;  2A5K A;  3E0P B;  1VJA U;  1WQS A;  2B5T B;  1FQ3 A;  4NIY A;  1TX6 A;  3GCN A;  2FOD A;  1NFW A;  3KN2 A;  3S69 A;  4HGC A;  1HBT H;  2VB0 A;  1TMB H;  1P3E A;  2VNT A;  1CHO G;  1C2L A;  2XOK D;  3EDX B;  1O3O A;  5FCR A;  1ZSL A;  2Q6D A;  4ZKO U;  1NO9 H;  1E1R D;  4GUX A;  1S0Q A;  1SHY A;  2J98 A;  1OOK B;  1UTJ A;  1Y5B T;  4MNW A;  1VGC C;  1C2I A;  1WV7 H;  4HG6 A;  5A0C A;  1G37 A;  1F7Z A;  2R9P A;  3BEU A;  3Q00 A;  1O2S A;  3TNS A;  4X1S U;  1Z6E A;  2PSX A;  3ZV9 A;  1WXR A;  1TOC B;  1NRP H;  3M5L A;  2RA3 A;  1CU1 A;  4NIX A;  1LDT T;  1GJ7 B;  3I29 A;  2IPH A;  3OEE D;  2VIO A;  1FJS A;  1GI3 A;  2PR3 A;  4WY3 A;  5I46 H;  1HNE E;  1OP0 A;  2UWO A;  5AFY H;  1IHT H;  1GI4 A;  1C5R A;  1HPG A;  3TJU A;  2RCE A;  2GCH G;  4B71 A;  4K8B A;  5DG6 A;  1SQT A;  1XUK A;  1O2Z A;  3SUD A;  2ZHF H;  1P2I A;  1NM6 A;  3A8D A;  4RSP A;  4Y76 A;  1V2Q T;  5F8T A;  2BQW B;  2Z6B D;  1QNJ A;  3I78 A; 
#chains in the Genus database with same CATH homology
 2JJ1 D;  2YMS B;  2WSS D;  5GJ4 B;  2K1Q A;  4OM9 A;  3O8R A;  3M5M A;  4A1X A;  5IK2 D;  1S6L A;  5F53 A;  1DXW A;  1W0J D;  3N7E A;  3U1J B;  2IJD 1;  3SZE A;  2V7Q D;  1COW D;  3E90 B;  4TSF D;  2FP7 B;  1DXP A;  2F43 B;  4JMY A;  3GS9 A;  2XNI A;  3O8C A;  3KNX A;  3UB0 A;  3F0O A;  2P59 A;  5EPN A;  1H8E D;  5EQQ A;  1H8H D;  4M9F A;  2OK5 A;  2A4Q A;  3FO8 D;  1E79 D;  4WH6 A;  3SUF A;  2IJO B;  3P8O A;  4FET A;  5CHB A;  5HKK D;  2A4R A;  3L6P A;  2W6I D;  3OE7 D;  4ASU D;  2OBO A;  2QV1 A;  2OC7 A;  4A1V A;  5DSF A;  3PV5 A;  1FX0 B;  5CDF E;  3M5N A;  3SV6 A;  2XCN A;  2WV9 A;  3F2G A;  3O8D A;  3OEH D;  3SV7 A;  4B75 A;  4Z1M D;  3SU6 A;  3SV8 A;  3PRB A;  5GPI B;  3OYP A;  5FL7 D;  2HLD D;  4B74 A;  1N1L A;  3PRD A;  1KMH B;  4Q4L A;  3SU0 A;  1A1R A;  2GVF A;  2KCP A;  4XD7 D;  3LOX A;  3RC4 A;  3FKS D;  1E1Q D;  2KCO A;  3F2H A;  3DSO A;  4I33 A;  4B6E A;  2FM2 A;  3AK5 A;  2KFW A;  4WF8 A;  2A4G A;  2F9V A;  4NWL A;  5FPT A;  4B73 A;  2YMS D;  3VG8 A;  5T1V A;  2XND D;  2GGV B;  4RI0 A;  2YOL A;  5C17 A;  2KR7 A;  3SU3 A;  2K8I A;  1BMF D;  5FPY A;  2QF4 A;  1NBM D;  1RTL A;  2F9U A;  2XCF A;  3H09 A;  3KN2 A;  2K0Q A;  3LON A;  3FOA A;  3SU4 A;  3SU2 A;  5ESB A;  2AHM E;  2JIZ D;  3NRL A;  2M2A A;  2KCY A;  2F4L A;  3SUE A;  2XOK D;  2KCA A;  1DY9 A;  4U01 A;  3U1I B;  3WWB A;  3SU1 A;  2VBC A;  4A1T A;  3FN8 A;  4R8T B;  1RGQ A;  3F3B A;  3DCL A;  1E1R D;  5FPS A;  4TT3 D;  2W6J D;  5C0U A;  4B76 A;  5GND A;  1NS3 A;  5H4I B;  4B6F A;  3N99 A;  5EQR A;  4A92 A;  3KF2 A;  3LKW A;  3SV9 A;  2KM0 A;  3OFN D;  3DSP A;  4WH8 A;  5EQS A;  1NBM E;  4DT4 A;  2OIN A;  2OC8 A;  5EPY A;  3RC5 A;  5IDK A;  1WXR A;  3F2F A;  3M5L A;  4KTC A;  3OTP A;  4TYD A;  3EYD A;  1JXP A;  1W3C A;  4I31 A;  1CU1 A;  2WHX A;  3KEE A;  4NWK A;  2QE7 D;  2FOM B;  2O8M A;  3OEE D;  3RC6 A;  4YXW D;  5DN6 D;  2QF5 A;  2JJ2 D;  3N7D A;  3PV2 A;  3W1E A;  4F55 A;  2JDI D;  3F0P A;  3WW7 A;  4ZCN A;  3ZIA D;  1OHH D;  2OC1 A;  3SU5 A;  2LEL A;  3P8N A;  2J5U A;  4B71 A;  1BT7 A;  3SYJ A;  4I32 A;  3OAA D;  4K8B A;  4Q63 A;  1MAB B;  2CK3 D;  2KZ4 A;  2OBQ A;  2OC0 A;  2WZQ A;  2WPD D;  3WWF A;  3SUG A;  5B6L A;  5ETX A;  3SUD A;  1DY8 A;  1W0K D;  1SKY E;  3M5O A;  2YMS C;  2L6O A;  5C0T A;  1EFR D;  3O8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...