3N99A

Crystal structure of tm1086
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
282
Chain Sequence
GHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRKEEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNIDPDLFEKLGIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYRKGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TM1086
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein TM1086
total genus 82
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, G, H, I, J, K, L, M, N, O, P, S, T, U, V, X, a, b, c, d, e, g, h, i, j, k
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14505 DUF4438 Domain of unknown function (DUF4438)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.170 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3n99A02
2.102.30.10 Mainly Beta 3-layer Sandwich tm1086 (SG structure) fold tm1086 (SG structure) domain 3n99A01
4.10.1180.10 Few Secondary Structures Irregular tm1086 fold tm1086 domain 3n99A03
1EFRD 5DN6D 5CDFE 2QE7D 1MABB 1H8HD 3OAAD 3OE7D 5HKKD 1H8ED 1NBME 3N99A 2W6ID 3DCLA 3OEED 3OEHD 4Q4LA 2JJ2D 1E1QD 1E79D 2WPDD 5FL7D 1BMFD 1W0JD 4YXWD 1NBMD 1FX0B 1COWD 1KMHB 2CK3D 4TT3D 2F43B 4XD7D 2HLDD 3ZIAD 2JJ1D 1W0KD 4ASUD 2XOKD 4TSFD 4Z1MD 2V7QD 2W6JD 2JIZD 3FKSD 2JDID 1SKYE 1OHHD 2XNDD 3OFND 5IK2D 1E1RD 2WSSD
chains in the Genus database with same CATH superfamily
3QGJA 2W26A 2XXLA 1KXFA 3L33A 3D23A 1QQUA 1S81A 1BTPA 1BZXE 3A8CA 3RU4E 1VR1H 1C5LH 1O37A 1RRKA 1Y3XA 1OWKA 2HVXA 2QXHA 2DUCA 4ABFA 1FY4A 2ZI2H 3P8OA 4DVAU 3PMAB 2F9UA 1O31A 5EJ1A 1EPTC 3TJOA 3FKSD 5EW2H 3RLWH 1C5XB 2G52A 1C2GA 4GVUA 1GGDB 3QK1A 3BG4C 1IQKA 1XUFA 5CMXH 1IQNA 1C1TA 2JH0D 4ZH8A 5EPNA 1QHRB 5EGMA 5SGAE 1L1GA 5E0HA 1MZAA 4AZ2B 1F5RA 5DP7A 3A86A 1T8NA 2BY5X 1UTLM 1BHXF 1GI3A 1SGTA 1VGCC 2FO9A 1EZSC 1UMAH 1VITF 1UK2A 3GY4A 1TWXB 4ISOA 1ZZZA 3A7YA 3V0XA 4I7YH 3ZVGA 3A82A 1O5CB 4AYYB 1CBWC 3SUDA 2O8TA 2AH4X 1NROH 1EQ9A 3SNCA 3ATIA 3BG4B 1C5UA 1Z71A 4BAHB 2OK5A 1TBRH 1O3JA 4K69A 1FAXA 2ZIQH 3MH7A 5L2YH 1IQGA 1S84A 4Y10E 2OQ5A 3SV2H 4INKA 3F9FA 3ZZAA 1LVMA 2QF0A 3ATMA 1V2KT 3SNDA 2GKVE 1O2XA 1OS8A 5DP6A 3MOCA 1G37A 2QCYA 2XWAA 6CHAB 1O2ZA 2FOAA 1NFWA 4Y8ZA 1HXFH 2OC8A 1SMFE 1GHBG 1NPMA 4ZKOU 1HGTH 3ENSB 5HKKD 1JWTA 4B2AA 4D76A 2RG3A 3O8CA 1NC6A 1HPGA 2ZQ2A 1DS2E 2BD3A 3ZVAA 2CV3A 3IWMA 3EGKH 4YOJA 4DW2U 1CA8B 4CR9A 1NFYA 4RT0A 1AWFH 1N1LA 4YM9A 1EP5A 2VGCC 1W11U 3ESTA 1DPOA 2ZHDA 5PTPA 1EAXA 1BRBE 2WPIS 1A0JA 1VJAU 4FUDA 5FBIA 1J15A 1EFRD 1AFQB 2PLXA 3E90B 4GLYA 1VITG 3RXJA 2OTVA 1YPEH 1GMDF 3BTTE 1UHBA 2A2QH 1G32B 4WH8A 8GCHG 3SJIA 1ORFA 2BZ6H 3M61U 1IQHA 2BYAX 2A7CA 3ZZBA 1A0HB 2P3TB 1P2KA 2SGPE 5EXNA 1XX9A 3TK5A 3BTKE 1XM1A 4AB9A 3OAAD 4JCNA 5GCHG 2KAIB 1OYQA 3D62A 2FTMA 2GZ9A 4MDSA 2GJGA 4P02A 4FUBA 2BQ6B 4D8NA 2GDEH 1C2KA 1P11E 1C2LA 3MU5A 1FZZA 3GCHC 3HK6B 3M5OA 1TPOA 1TNKA 2NU0E 5K7RA 1K0HA 1O3DA 2ZDVH 3SV7A 1V6DA 4JYVH 1O2VA 4X2WA 1H9IE 1JOUB 1MZDA 1FAKH 4INHA 2HWLB 1HAZB 1LVYA 3ODDA 1EJNA 1UTOA 2J98B 1EOJA 1PQ5A 1O3KA 2FM2A 1C1UH 3DCLA 7GCHG 7ESTE 3PMJA 1QL7A 5HIYA 1GBIA 3RMNH 1BTUA 1FLEE 3DUXH 1C5SA 4D7GA 3RXIA 3UWIA 1AI8H 1SOTA 4K2YA 2V35A 1C5ZB 5T6DA 3SORA 1GBTA 2UUJB 1V2VT 1BRCE 3PWCA 3PLKA 4F48B 2WYJA 2QGRA 3KQDA 1MU8B 2ZNKH 3NZIA 1TPPA 2VU8E 4ZHAA 3H09A 1F92A 4H42U 2FOHA 3SNAA 4FUHA 4OS5A 4E7NA 3BSQA 3U8TH 1V2OT 1S5SA 1ZPBA 3FVFB 1J8AA 3DSPA 2A31A 1JRSA 1YPGH 4YLUA 1G3CA 1DWDH 2BB4A 1XUIA 3A83A 2G00A 2KCPA 3MNBA 4MPXA 4ABEA 4XDEA 1PPGE 4FU8A 1GJ8B 5K0HA 2Z9LA 1FNIA 4IW4E 3LDXH 2V3OH 5FX5A 5FCRA 4K1EA 1CT4E 3T26A 5LH8A 4B71A 5FAHA 3VXFH 2K1QA 1NS3A 4TT3D 2O8MA 4AFQA 2EY4C 1ZGIA 2HPQH 1AD8H 3OTJE 1TGNA 3SU4A 1L0ZA 4KTCA 1W8BH 5FCKA 2AMQA 2XRCA 2A45B 1TX8A 3SUFA 1FIWA 1AIXH 1O39A 3FP8E 1SQRA 4O97A 3T2NA 1N8OC 2Q6FA 1TOMH 4MNYA 4ABIA 1LQEA 1VJ9U 1UCYK 2C3SA 5DO4H 2AIPA 1SGCA 3UREA 4R8TB 1GMCG 2GCTC 4Y71A 4I86A 3M5MA 2XTTB 4XBDA 1UCYE 2SFAA 1QIXB 4Y7AA 3RXFA 3ZZ6A 1ANCA 4X6PA 1SGYE 4GAWA 4RSPA 3M7UA 4F55A 3F0OA 5G4BA 4RKJB 1Z8IB 1EB2A 4RT1A 2BQWB 3JZ1B 4K1TA 2RFKC 3TH4H 2VH6A 1LVOA 2B8OH 2KR7A 1BMFD 1ESAA 1RFNA 4M9FA 4CBNA 2JETC 2ODPA 1RXPA 4XBBA 1P2OA 3K9XB 1P57B 2AMDA 5ESBA 1A3EH 1Z8JB 4X8TH 5EQRA 3UQVA 5DN6D 5CDFE 1H8HD 2ANYA 3LU9B 1O33A 4IMZA 3LPRA 1SGNE 4JZEH 2PR3A 1TNHA 1YLDA 2UWPA 3K65B 3MFJA 1MKXK 4O03A 1F0SA 4TPYA 2GX4A 3E16B 1O3FA 3S9AA 3BTFE 3E0PB 4CRCA 1PYTD 4IBLH 1HIAB 1GHAG 2SGFE 1SGEE 2GD4B 1YGCH 2HVYB 1IQJA 3G01A 2P8OC 3PM3A 1GMCF 2B0FA 4NZQA 5B6LA 4ZKRU 4ABHA 2BX3A 3AASA 2GV7A 1V2WT 2W3KA 1QRWA 3GDSA 3RC5A 1Y5UT 5JBTA 1P10A 2NU2E 4IMQA 1CQQA 1F7ZA 1UHBB 1NO9H 2A1DB 2BD8A 4X8VH 4CHAB 1CE5A 2Z3EA 2OP9A 3VB5A 2R2MB 3TLOA 4HFPB 1Z7KA 1HUTH 2A4GA 1HAVB 4AGJA 3FP6E 1QJ7B 1VKYA 1QA0A 3PTBA 1DUEA 4GHTA 3S7HB 1GJAB 1FMGA 1NRSH 3SI3H 2FEQH 3SU5A 1TABE 1TGTA 2BY6X 5GIBA 2UWLA 4GUXA 1ZLRA 4IN2A 3BTQE 1GBKA 1L1NA 3D49H 1BDAA 2OD3B 5C67A 2FIRH 1OXGA 2SNVA 1JXPA 3SJ8A 1QL9A 2JKHA 1HJ9A 4ZXYH 2ZGCA 3GY8A 1O2KA 3ZZ8A 4QT8C 1ELVA 3EDXB 1WQVH 2QY0B 2ANKH 1N6YA 2VWOA 4FVBA 3NXPA 1PPHE 1XXFA 2Y7ZA 3UOPA 1UVOA 3A89A 1GI7B 3ZYDA 1VCQA 5DP3A 1A2CH 4WH6A 2Y7XA 1QBNA 1KXDA 1ZHMA 2GP9B 3E8LA 5CHAB 5A8ZA 4J1YA 1T31A 3I77A 1GI1A 4HZHA 1ACBE 1UJ1A 1TPSA 1EPTB 2Y82A 3E1XB 2STAE 3O8RA 1BB0B 2XNDD 1CHOG 2FYQA 1ABIH 2ZFFH 4E7RG 2GCHF 1ESTA 2PUXB 2Y5GA 1O5BB 1KXBA 1Y3YA 2ZGHA 4H6SB 2ZU4A 1O2TA 3SO3A 2M5TA 3A81A 1BOQA 2CHAC 2DE9A 2ZECA 4YT6H 1ARBA 4TY6A 1NFXA 1BRAA 5GNDA 1ZGVA 1HIAA 4I8LA 1TFXA 1C4Y2 2ZCKP 3TU7H 1LHGH 2BD9A 3KGPA 3UWJH 4ISHH 1GI5A 3SW2B 4FU9A 1THPB 3SN8A 4B76A 1TIOA 1C4U2 1FY8E 3PV4A 3RXTA 2J95A 3LGYA 1AE8H 2B7DH 1DT2A 2HPPH 3TPIZ 4AORA 4UEHH 5HM2A 4LOYH 5FHTA 2FOGA 1YPJH 2XC4A 4AGKA 1UVSH 1BCUH 4JZ1A 4BAQB 3BN9A 2PKAB 2UUYA 3M3TA 4WWYA 3SHCH 3TIUA 3QZRA 2FYRA 5C5NA 2QA9E 2WPKS 2Z9JA 1W7GH 1GJCB 1BTHH 4NIWA 1ZJKA 1A4WH 2V7QD 3GISB 1SL3A 4B6EA 1ZHRA 4FUIA 2P93A 1GI4A 5A0CA 1WSSH 5GJ4B 2L74A 4A1VA 2ZFRH 1HJAC 1LO6A 3MO9A 1XKBC 2I6QA 1UCYH 1JRTA 1DXWA 2IPHA 2ZU5A 2OQUA 5KEDA 2YMSB 1OPHB 4BANB 1RIWB 2ZFPH 1D3TB 4TPIZ 2HGTH 2QF3A 2LPRA 5FX6A 6GCHG 2R9PA 1IHSH 1Z6JH 1KTTB 3C1KA 1PPBH 3GYLB 1IQLA 4MPWA 2ZKSA 2O8LA 3RU4T 3UOUA 1AFEH 4AYVB 1GJ9B 3RXQA 1K1MA 1BITA 1AO5A 2PFEA 4Y76A 2GTBA 3LIWA 4JK6A 4NA7A 1QTFA 3ZZ5A 1MKWH 1KLTA 2OLGA 2WPMS 4A1TA 2QAAA 3RM2H 1YCPH 2GZ8A 4CBOA 2BDIA 1EASA 2SNWA 1LPZB 1V2QT 2HRVA 3ATWA 4YO9A 2A0QB 4BNRA 4I31A 4K5ZA 4DT7B 2EQNA 1UTKA 3AAUA 4CR5A 2ZU3A 2OCVB 3ZVEA 3DA9B 2NU4E 4IS5A 3M36A 5A0BA 1PJPA 5HM9A 1H8IH 2VB0A 3Q3KA 3RXEA 1KDQB 1AVXA 1BMAA 9ESTA 2A32A 2ZFQH 3KYGA 1C5NH 1LCYA 1GL0E 1L4DA 1SGPE 1EX3A 2QE7D 3M3SA 1KXCA 4ABBA 2CJIA 4ZAEA 2ZDKA 4BAKB 1WV7H 1SR5C 5BPEA 1GJ7B 1S82A 1CGIE 1TMTH 1C5WB 4CREA 1BTZA 3BTME 4UFEH 1FXYA 1GG6B 4A6LA 3B8JA 2BXUH 3ZVFA 1YLNA 1C2JA 2VIVA 2BZAA 1F5LA 2FLBH 2G81E 5B6OA 2PSXA 5E8EH 2RCEA 3E91A 2HNTF 4WVPE 4ASHA 3O8DA 1GHVH 1DWBH 3I29A 3ODFA 1C2IA 2RA3A 2ZU2A 3SUGA 2R3UA 4FOUC 3DFLA 3GCNA 1F2SE 2XCFA 3KQ5A 1V2MT 2QN5T 3LGVA 1GCTB 2VNTA 3SGQE 1WTHD 3GDVA 4F4OC 1QURH 4Z0KA 5L2ZH 1N8OB 1FX0B 4JYUH 4NIYA 3ZVDA 1YPHE 1OP0A 4MPVA 1O5GH 1ZPCA 5A09A 1YF4A 3A8AA 1LQDB 1TB6H 2XYAA 4FUEA 3RMMH 1GPZA 2J5UA 1BBRE 2BXTH 1HAXB 2J34A 2L6OA 1E34B 2HNTE 1H4WA 1EOLA 1CHOF 1DLKB 4TWWA 3MMGA 1HAYB 1BRUP 3ZZ7A 1P06A 1UO6A 2WHXA 4XE4A 3URDA 2P95A 1E0FD 3A7VA 1Y8TA 1OWHA 2R0KA 1KXEA 3PB1E 1MMJN 2BLVA 3Q3YA 2AGIX 3PROA 4A7IB 5HYOA 1EZUC 2HLCA 2QXJA 4I33A 1P04A 4X8UH 1KLJH 1MKXH 4LK4A 1DSUA 1UVTH 3P17H 5EG4A 2K0QA 4ABAA 1VZQH 7LPRA 1C2HA 2QYIA 5DSFA 1BHXB 1E35B 1SGFG 3MU4A 5LPFA 3FOAA 1P12E 3KQEA 1F0RA 3SUEA 4XD7D 2PHBA 1LHEH 1C5OH 2ZU1A 4IN1A 1EJMA 1VITH 2FX4A 1V2PT 2F91A 4UONA 4E06H 2YNBA 4ZHMU 1TMUH 4AOQA 2OINA 1Y3VA 4UD9H 4AFZA 3GOVB 3ZZCA 2H5CA 1TBQH 3BTGE 1DY8A 1GMDG 2XWBI 4I8JA 1ZSLA 5EJZA 2O8UA 4NA9H 8GCHF 2NWNA 2OC1A 4BXWA 3UR6A 1AU8A 3F9HA 1W10U 4O9VA 1K22H 1YYY1 3HKIB 1GHZA 5EPYA 2AFQB 1GJ4H 1YPHC 4JZDH 1C5MD 3F68H 2CF8H 4ABJA 1GI2A 4K8YA 3KNXA 3WY8A 2ZG0H 3FP7E 1C1PA 4JZIA 4X6MA 1HJAB 4Y6DA 1D9IA 2FI3E 1HFDA 1AGJA 4NZLA 3F0PA 1ELBA 3BEFB 1GBAA 3KQBA 2FS9A 4AFUA 1V2NT 4HTCH 1TGBA 1QY6A 2BX4A 4DG4A 1B7XB 1DOJA 1QR3E 2LP6A 1DSTA 1JMOH 2PUQH 3MU8A 3OYPA 1SGFA 1TPAE 5CE1A 1GHWH 2VGCB 1EZQA 3R0FA 1ELDE 3O8BA 3RXVA 4Y7BA 1HXEH 1CA0C 2GMTC 5FBEA 2F3CE 3PLBA 3QWCH 4OGXA 8LPRA 1E38B 1AVWA 3RXGA 3RXSA 1C1WH 4BTIB 1K1NA 4SGBE 3S0NA 3SU6A 2AGGX 3URCA 1HB0B 1GCDA 1MTNB 4KP0A 3DFJA 1C1OA 2AIQA 2JDID 4FUFA 1P2MA 2VIWA 2ZP0H 1O32A 1BUIA 3F2HA 3SJKA 5DG6A 3IITA 3RMLH 4A5TS 1EUFA 1OWJA 3W1EA 2JH6D 1NBME 1O3NA 4NA8A 2W6ID 3RXDA 3U69H 1Z6EA 4CH8B 1WDIA 2A7JA 1IAUA 1QZ8A 1SLWB 5E2PA 5F8TA 4YXWD 2FOMB 1NBMD 1OSSA 3UY9A 4GCHG 3KL6A 1PYTC 2PP6A 3U9AH 2H5DA 2KCAA 3NKKA 1GBFA 1KDQA 4B2CA 2PTCE 3LKWA 1YM0A 2ZTXA 6LPRA 1BT7A 2VIPA 3ZZ9A 2JJ2D 4KELA 2THFB 3M35A 3MH5A 4X1RU 5E0GA 2NU3E 3VPKA 2RDEA 3KCGH 2WYGA 2HLDD 1C2DA 1RD3B 1WCZA 4NWKA 1H1BA 2OBQA 2ZEBA 1TGCA 1AQ7A 3NCLA 2TGAA 1DLEA 1QBOA 1DX5M 1FV9A 1SFQB 2H9EH 2WINI 4E05H 2KFWA 2ZCLP 3FO8D 3BV9B 2GV6A 1QB9A 1G3EA 2C8WB 3SV8A 5DGJA 1L2EA 1VGCB 2UUKB 1CT0E 4K1SA 2Z3DA 1AE5A 1O3BA 3EYDA 1E79D 2G5NA 3SV9A 1K1PA 1O3LA 1LDTT 2FOFA 1MBQA 5C94A 4XSKU 1XUJA 1HAIH 2C93B 2FXRA 2WPLS 5T6GA 1ZMNA 4Y8YA 1W12U 5TCAA 1GBEA 1M9UA 3F6UH 3PRBA 4Y8XA 2C8XB 1TE0A 1BQYA 1ZJDA 3MI4A 3H7TA 3A84A 4NFEA 3P6ZB 2YMSD 3PYHA 2ALVA 1SPJA 2OBOA 3R3GB 5TCCA 1KIGH 4CRFA 1GBJA 1HJ8A 5EU8A 4ABDA 5FXLA 2PW8H 2CN0H 1TA2A 1C5RA 4MVNA 5DPAA 2SGEE 2Z3CA 1E36B 2J98A 1C1RA 1WOFA 3DSGA 3F2GA 3MNXA 4ZMAH 5EJLA 1ELGA 1LPGB 1GDQA 1P0SH 5EQSA 1GHXH 1ZSKA 4IGDA 2BLWA 4BOHA 3A80A 1MQ6A 2VJ1A 2O9QA 5LGOA 1AB9B 3QN7A 3GCOA 3MHWU 1J16A 1UK4A 2AGEX 3P70B 5T1VA 3RC6A 3PWBA 1E37B 1NT1A 1D3DB 1SVPA 4A1XA 2PGQB 1YPMH 1NRQH 2BVXH 3KYFA 4B74A 3F2FA 3PV5A 4X1QU 1O3EA 1O2HA 1MABB 1O3HA 1P09A 3K2UA 1P01A 3CP7A 4YT7H 1S83A 1UTPA 2VIDA 4INLA 3QLPH 4CH2B 2JETB 2J92A 3HK3B 3OY6U 2WZQA 3V12A 1MD7A 4MQAA 3U28C 3L3TA 4WMEA 1DANH 3EE0B 3GICB 2CGAA 1ZR0A 2V3HH 1ESBA 3RXUA 2JJ1D 1UVPA 7KMEH 3UNRA 1T8OA 4Z1MD 4K8BA 1C1VH 1S6LA 3F1SB 3BTEE 1W7XH 1C5TA 4NIXA 3RXRA 5DP9A 1WYKA 2GZ7A 2Z94A 3ATLA 2I6SA 2BQ7B 1K9OE 1J9CH 1O2GH 2FP7B 1NFUA 4U2WA 4ISLA 1C5YB 3WW7A 2FMJA 1TYNA 3MNCA 2ZHQH 5FPYA 1XMNB 2R0LA 2W3IA 3MWIU 1W0ZU 1TRMA 4KTUA 1LHFH 1TAWA 1MBMA 2FI4E 1D6RA 1O5FH 2C4FH 1A0LA 2BDAA 5JBAS 1W0YH 4X0WU 2ZHWH 4X2YA 3BF6H 3V3MA 3UNSA 3Q00A 1NTPA 2PTNA 2R2WU 4UFGH 3GCTG 1ZMJA 1WXRA 2SGDE 2CXVA 4H6TA 5IDKA 1K1JA 3F9EA 4THNH 4ZKNU 5C17A 3F3BA 3PRDA 2IJOB 2TGTA 4B73A 2Q1JA 3TVJB 3T62A 2TIOA 1TRNA 1YC0A 2GT8A 4OGYA 1TRYA 1SGIB 4YOGA 2TPIZ 4XBCA 2B5TB 4P00A 3OTPA 4UE7H 4RN6A 1DY9A 3VFEA 5ESTE 4ZUHA 4OS6A 3KIDU 1WBGB 1ETSH 3A88A 5F8ZA 1UTNA 1W0JD 4FXGH 1MQ5A 1NY22 1LKAA 4TYDA 4GPGA 1IQFA 1HAGE 5AFZH 4ZXXH 2FI5E 1N6XA 1DWCH 1ETTH 3HKJB 3MQKC 1P2IA 1O35A 2A2XH 5F03A 4ESTE 3M3VA 2BDCA 4NWLA 5TJXA 1O34A 2R3YA 2DE8A 1C2FA 3PO1B 2EA3A 1PQAA 1AZ8A 1GI9B 4UFFH 2VVUA 3U8RH 1F0UA 1XXDA 2G51A 2XBXA 5DKMA 5T6FA 1ELFA 2H9HA 1A5IA 1BBRK 3L6PA 1GHYH 1PQ8A 3A7TA 2Q6GA 4GCHF 1B5GH 4DURA 3SJ9A 1L1JA 1W3CA 2SGQE 2EC9H 2WUCA 2ZHEH 1C9PA 4K60A 1O5DH 1GDNA 1GL1A 4TWYA 1BBRH 1O2WA 3P8GA 2SGAA 3RXCA 1OOKB 2TGDA 4KGAA 1P2NA 1FPCH 5LPRA 2ZGJA 3MYWA 3TJNA 1ZPZA 4JYTA 2XNIA 3ATKA 3AAVA 3GS9A 5E2OA 1KTSB 1OWIA 2ZFTA 3ELAH 3JZ2B 3NWUA 1P03A 5EIYA 3LGWA 2Y5FA 5J4SA 4WY3A 5EXMA 3SU0A 3FAOA 1MTSA 4WJG2 1BMNH 1A46H 3T27A 5LPEA 3LC5A 4LZ4B 1C5QA 1W14U 4YOIA 4YESB 3P8FA 1UVUH 2ZWLH 4JZFH 1O5AB 1P3CA 1FY3A 4DT4A 3GCTF 4ABGA 4NIVA 1XKAC 1VCWA 1P3EA 1C4V2 2AS9A 1MKWK 1W0KD 3QX5H 5GWZA 3UFAA 1ZSJA 2JIZD 2A5KA 3TNSA 4F49A 5DP5A 2P59A 4YTAA 3W95A 4ZCNA 3A87A 5DJ7A 3ITIA 3QUMP 3K6ZA 1FN6A 9LPRA 1QRXA 4HGCA 1NN6A 3EA9A 4Q4LA 3ZZ4A 1ZTKA 3VB7A 1LVBA 1YPKH 3P95A 1G9IE 1GBLA 2CHAB 2ZDNA 1FN8A 3CNRA 3NK8A 2V6NA 1NU9A 2CK3D 3UPEA 4I8HA 1Q31A 2WV4A 4ASUD 1T8LA 4B2BA 1SKYE 2H6MA 1MTWA 1RTKA 3DT0H 2NU1E 2W7UA 3M5NA 1GBBA 1SGQE 1YY3A 3EQ0H 4D9QA 1V2UT 3UIRA 5J4QA 2Q6DA 1O2YA 2JH5D 1AZZA 2XBYA 1O2UA 2ZGXH 5AFYH 1HCGA 3LONA 1YBWA 2EI7A 5EOKA 2BHGA 1YP9A 1QA7A 1MTNC 4JMYA 3AW1A 5C1YA 7GCHF 1G36A 3B9FH 2F4LA 3BTDE 1AVGH 5T3HA 2OC7A 4VGCB 2GGVB 1YKTA 2M2AA 1GJ5H 4ISNA 4Q63A 3ZVCA 1ZHPA 1YCPK 1FJSA 1TQ0B 3DHKH 1O2RA 4CRBA 3UNQA 4I32A 1GGDC 1EB1H 5C0UA 1TX7A 3K6YA 2BY7X 4YLQH 3TGIE 1GJBB 1O2OA 1OKXA 1C2MA 2GT7A 2ANWA 2BOHB 1T4UH 5DP4A 4WMFA 1AKSA 3UQOA 2BDBA 2QXIA 1TOCB 1GVLA 3FFGA 4DY7B 3LJOA 1OWDA 3M5LA 3TITA 2WPDD 5FL7D 2Z7FE 1KSNA 1O3GA 2Y5HA 1C5VA 4Y0YE 2ZA5A 3ZIAD 2F83A 3V13A 3UUZA 3E6PH 4CHAC 4I8KA 1P2JA 3MTYA 4U32A 1QBVH 1SG8B 3MU0A 2YNAA 1IHTH 2BVRH 1RJXB 1O3CA 1GBCA 1Z1IA 1A5HA 1HBTH 3SU2A 3UAIC 2FOEA 1OP8A 1CT2E 3BEIB 3LGTA 1Q2WA 4OS4A 1SLUB 3EE7A 1TONA 3ZZDA 3OU0A 4ACAA 2V3MA 1IOEA 1NRPH 3T25A 2ILNA 4K3JA 1O5EH 1KLIH 5EW1H 2RDLA 1GI6A 2AERH 4Q80A 2AMPA 1Y5AT 1Q3XA 3PMHB 3SGBE 3VEQB 5L6NH 4DIHH 1DITH 2ZPRA 2ZPSA 3QTOH 2BD7A 4LXBH 5GXPA 1BMLA 2B9LA 2YOLA 3GY7A 1O2JA 2WV9A 2VINA 5DP8A 1T8MA 2G4TA 4X1PU 3RXKA 3OY5U 1AHTH 1G3DA 3Q3XA 2VH0A 3ZV9A 1C1SA 1DE7H 2FPZA 4X1NU 3HGPA 5F6MA 2J97A 2KZ4A 1HAHH 1C9TA 2VVVA 3T29A 1ZRKA 5C2ZA 1YPLH 4DOQA 1UTQA 1U6QA 3SNEA 3GY6A 3GYMA 1DICA 2FDAA 3MH6A 4GSOA 1PPZA 1AMHA 1O30A 1ARCA 5A8YA 2ASUB 1INCA 3MO3A 4O3TA 2BM2A 2HALA 2F9PA 1O3OA 1GBMA 2ZPQA 1S85A 3PO1C 2LNCA 3T28A 2P8OB 1O3IA 3W94A 1MD8A 3OX7U 1EXFA 2WSSD 1ELAA 1RGQA 5A8XA 4NCYA 1HDTH 3KF2A 1NZQH 4OS2A 1T4VH 3SBKA 4A92A 1Z8RA 8KME2 5JDUB 4SGAE 5KECA 3ZZ3A 4XRNA 1BIOA 2QXGA 2ZDMA 2FS8A 3ZVBA 4ZHLU 3RXMA 4ISIH 3RM0H 3TGKE 3ZYEA 4TSFD 1SFIA 4BTUB 1VCPA 2V0BA 2PKSB 2K8IA 5HGGA 1EJAA 3RP2A 1OHHD 1GMHG 2EI6A 2ZQ1A 1BMMH 3LH1A 3OE7D 2C90B 3WWFA 2J9NA 1FY5A 1D6WA 1QQ4A 3M7TA 2BY8X 3RDZA 3CS0A 4D7FA 1GBDA 2IJD1 3MNSA 3T5FH 1PPFE 1KY9A 1MAXA 4I8GA 4FUCA 1EAWA 2VVCA 4IC5A 1W2KH 1B0EA 1ELEE 2BOKA 3CS7A 5BRRE 2PKSC 3RC4A 2ZHFH 2BMGB 3N99A 1QRZA 1CHGA 5CHBA 1K1OA 2ZO3H 2GCTB 2Z9GA 1CGHA 1K2I1 3BIUH 2BVSH 2FODA 1P05A 4KTSA 1D3QB 2RA0A 1SQTA 3SJOA 8ESTE 1D3PB 2LELA 2ZGBH 1BJVA 2W5EA 1SC8U 3QTVH 1GJ6A 3H5CB 3H7OA 1FQ3A 3TJUA 1QJ6B 2A7HA 4BXSA 6GCHF 2BD5A 3LH3A 1KYNA 1GBHA 3V7TA 1SQAA 1G2MA 1D4PB 1G2LA 1CVWH 1L4ZA 3GCHB 1A1RA 3PV2A 1PPCE 2J2UA 1HAOH 2GDDA 5JBBS 1TNJA 3QO6A 3SQHE 2VWNA 5E0JA 1TLDA 2UUFB 2XC5A 1ZRBA 3AW0A 4B6FA 3A7ZA 2GVFA 4U01A 2YMSC 4LZ1H 2A5AA 4NFFA 3SNBA 3SYJA 5GPIB 5JB8S 1X7AC 1ANBA 2PSYA 1V2RT 5JYIA 4OM9A 1EAUA 2Y6TA 2TRMA 1T7CA 4GHQA 3BIVH 1MAYA 3LJJA 2BLOA 2ODQA 2BD2A 4JK5A 2P16A 3S9CA 2FOBA 5HIZA 1OP2A 1JIMA 2CF9H 3N7OA 1ZTLA 2EI8A 2H2ZA 1ID5H 1UW7A 2HOBA 1GHAF 4FVDA 4AG2A 2Y80A 3NUMA 4NG9H 1H8ED 1OYTH 1Y3WA 1SI5H 1OWEA 3RXOA 5EQQA 2FX6A 3Q77A 3FN8A 1IQEA 3B23B 1HYLA 3KN2A 3RXBA 1S0RA 5C20A 5I25A 1UTMA 1SLVB 1K28D 3HPTB 3BTWE 1CO7E 1NM6A 2XBWA 2P3UB 5AF9H 1SHHB 4MLFB 1O38A 2VBCA 1KXAA 1QCPA 2QC2A 2VWMA 3LGIA 4TY7A 4ZROA 1TA6A 1V3XA 4FUJA 3P92A 1HAPH 4FETA 4R0IA 1AKSB 1IQMA 1TMBH 2FZZA 2H1UA 1GJDB 1NRNH 3NRLA 3U98H 2AYWA 1RIWC 1XUKA 2STBE 1AY6H 1RTFB 2FWWA 1XUHA 2D1JA 2G5VA 1BA8B 1O2QA 3KEEA 5I46H 1BTWA 3DSOA 1RTLA 1ETRH 1Y59T 1FPHH 1EP6A 2GCHG 3EA8A 3KQCA 4NSVA 2ZDAH 4UDWH 2IOTA 3RXLA 1TX6A 1HV7A 4OS7A 2AEIH 3AVZA 2G8TA 5JPMH 3GY5A 4RI0A 1QB1A 4Y79A 3U1IB 5H4IB 1CA0B 2GMTB 3LT3A 4NGAH 1C1QA 2PKAA 1T32A 2Y81A 1TNLA 1S6FA 4AC9A 3A8BA 1PQ7A 1KMHB 3OSYA 1SSXA 2AHME 4VGCC 2OXSA 1ZMLA 2KM0A 1EZXC 3PLPA 4WXVA 5HXFA 1EAIA 4U30A 3LGUA 1CBWB 1W13U 1LTOA 2VWLA 2Z9IA 5EODA 5FPSA 4AX9H 3SV6A 1EPTA 2ZDLA 4ZKSU 1G30B 2J4IA 4X1SU 2W7SA 1MU6B 3STIA 1QFKH 3TK6A 4FU7A 1GWAA 1FDPA 5GCHF 2KAIA 4CRAA 4DIIH 1GMHF 4XFQA 1QB6A 1SGDE 5EXLA 1O2PA 1SB1H 5GDSH 1V2ST 4X6OA 3S7KB 2BLQA 3MU1A 1NESE 3TK9A 1DWEH 1FI8A 1Z1JA 2KX4A 3VB6A 3SZEA 2F43B 1H9LB 1F0TA 1DXPA 3ZV8A 1LPKB 1NU7B 3SQEE 5DK1A 3RUOA 2W6JD 2KCOA 4Q7XA 5ABWA 1JIRA 4H4FA 5C0TA 1G3BA 6CHAC 1A3BH 4FUGA 3VG8A 3PMBB 1DM4B 1WUNH 3MH4A 4DCDA 1TQ7B 3VB3A 5A0AE 2XC0A 4AG1A 4BTTB 2A4OA 5CHAC 3VGCC 3M7QA 1ELTA 5C1XA 2WUBA 5ETXA 4AFSA 3EA7A 4MNWA 3S69A 1O2SA 4Z6AH 4Q7YA 3SZNA 1B0FA 3U8OH 5F8XA 1MTUA 4XOJA 4ACBA 2Z9KA 1IQIA 1O2LA 3I78A 1K1LA 1BTYA 3FZDA 3UR9A 1K21H 4PROA 2VIOA 1DUAA 2BDHA 2D26C 1C1NA 3PTNA 1H8DH 4IC6A 1YWUA 2BD4A 2WV5A 4BAOB 1COWD 3E0NB 1CU1A 1WQSA 2PGBB 1QNJA 1EATA 1AWHB 2XOKD 4MG3A 5A2MH 1LKBA 1RS0A 3FANA 2XBVA 5C1UA 4DJZB 2OC0A 4HI3A 1C1MA 3F9GA 2D8WA 3S9BA 1NRRH 5KGOA 4UFDH 2J94A 2VIQA 3KHVA 2IPQX 3FZZA 3SHAH 3UB0A 2BTCE 1QJ1B 1ANEA 2XCNA 1E1QD 1THSH 3BG8A 3A7XA 2ODYB 3SU1A 3TNTA 3GDUA 3UTUH 3AK5A 1LMWB 4BAMB 4WMDA 1O36A 1BJUA 3NPSA 1SOZA 3E3TA 2F9OA 3STJA 2ESTE 4HG6A 1K1IA 1P9SA 1GCTC 1O3PB 1GVKB 1YCPM 1BTXA 1TGSZ 1PPEE 2FOCA 1OX1A 1HLTH 2F9BH 4YZUA 2H9TH 4M7GA 2J38A 1O2MA 1FY1A 1JBUH 1O3MA 1UTJA 1MCVA 2QF5A 5IYTA 2BY9X 2OUAA 2TBSA 1S6HA 3SGAE 2D2DA 4Y11E 3WWBA 4D9RA 1ZTJA 1HAVA 1LHDH 1V2TT 4WXIA 1WAYB 1Y3UA 3RXAA 1ZYOA 2PWXA 1GI8B 2EEKA 3EAJA 1Y5BT 4CRGA 1V2LT 5JBCS 2G55A 1F5KU 1CSOE 3OEED 3A85A 2ALPA 3M37A 2QF4A 2ANMH 1SGRE 3P8NA 1GDUA 1O2IA 4CRDA 3DD2H 1ANDA 1HNEE 4MNXA 5AHGH 2WPHS 1FUJA 2F9NA 2QV1A 3RXPA 3SU3A 1QL8A 3MO6A 3LOXA 2O8WA 5IK2D 5L30H 3TJVA 4MPUA 3HATH 4B1TA 1LHCH 1AN1E 3OEHD 1WTGH 3CENA 2P94A 4Y0ZE 1O3AA 3N7DA 6ESTA 2C8YB 5AVDA 1P02A 4WF8A 1SHYA 3SOSA 3GY3A 1O2NA 1J14A 1E1RD 2ZC9H 1DVAH 2A5IA 1ELCA 1TNGA 2BDGA 1CGJE 3TH2H 1XVMA 1DDJA 1HRTH 4OS1A 2TGPZ 1A7SA 2XW9A 4RKOB 1SLXB 1TNIA 2IN2A 3C27B 1XVOA 1GG6C 2G4UA 1GHBF 5FPTA 1ZOMA 3IG6B 2FTLE 1A5GH 3SI4H 3LC3A 1P8VC 1MTVA 2FESH 2WPJS 1MUEB 2ZF0H 2ZTZA 4DGJA 4AB8A 3HGNA 1AUJA 3A8DA 1TALA 2ZCHP 2C8ZB 3D65E 1GI0A 1XUGA 2FLRH 1P2QA 1P9UA 2F9VA 5F53A 3A7WA 4Q2KA 4X2XA 3BEUA 2ZZUH 3TH3H 3QGNB 4B75A 5C3NA 4NSYA 1SBWA 3GY2A 5HMAA 1H9HE 2ZFSA 5C5OA 1YLCA 2PV9B 3Q76A 1MH0A 4J2YB 2P3FH 1FIZA 2ULLA 4X6NA 3VXEH 4X8SH 2CMYA 1AFQC 3QDZB 1MCTA 1Z8GA 2A4QA 3OFND 4MNVA 1EKBB 1SQOA 3RXHA 1UK3A 3TGJE 1A61H 4X2VA 1C5PA 4O3UA 1AB9C 1J17T 3RMOH 3N7EA 2ZTYA 3VGCB 4KKDA 1S0QA 3VB4A 4AN7A 1GVZA 1FONA 1PFXC 1DFPA 2A4RA 4Q7ZA 2HNTC 5JB9S 2Z6BD 1AUTC 1WU1A 2UWOA 1QGFA 1O0DH 1C2EA 1ABJH 1THRH 3RLYH 2BDYA 3BTHE 3U1JB 3RU4D 2KCYA 4MTBA 1TBZH 3QZQA 2QIQA 1V2JT
chains in the Genus database with same CATH topology
1EFRD 2QE7D 3E90B 1MABB 2YOLA 4FETA 3M5NA 3LKWA 3N99A 2WV9A 5B6LA 5CHBA 3NRLA 1DY8A 1BT7A 3OEHD 4WH8A 2JJ2D 2WZQA 3N7DA 3RC5A 2OC1A 3KEEA 4B71A 2K1QA 3DSOA 1NS3A 4TT3D 1COWD 2O8MA 4WF8A 1CU1A 3P8OA 1RTLA 2HLDD 3LONA 2F9UA 2JJ1D 2LELA 2OBQA 3L6PA 4NWKA 2KZ4A 5EPYA 2XOKD 3SU4A 4KTCA 4Z1MD 2V7QD 3FKSD 4K8BA 1S6LA 4JMYA 1W3CA 4B6EA 3SUFA 2A4GA 2KFWA 2OC0A 1E1RD 2F4LA 3FO8D 3OAAD 3O8DA 5EPNA 4RI0A 5GJ4B 1DXWA 3KNXA 3SUGA 2FP7B 3SV8A 4A1VA 2OC7A 5H4IB 3U1IB 3SU5A 2GGVB 3UB0A 2M2AA 3RC4A 2XCFA 1A1RA 2XCNA 1E1QD 3EYDA 1E79D 3PV2A 4Q63A 4R8TB 3SV9A 5FPTA 3WW7A 2XNIA 3M5OA 3SU1A 1FX0B 1KMHB 5FPYA 2YMSB 3F0PA 2AHME 3GS9A 3SV7A 3M5MA 4I32A 2KM0A 3AK5A 3SUDA 5C0UA 3SV6A 5FPSA 1JXPA 4B6FA 3PRBA 2GVFA 2J5UA 4U01A 2YMSC 2OK5A 3OYPA 2WSSD 4F55A 3F0OA 1RGQA 3SU0A 3SYJA 5GPIB 2L6OA 3KF2A 2FM2A 3DCLA 2F9VA 3O8BA 4A92A 4OM9A 5F53A 4B75A 2YMSD 2OBOA 1WXRA 2WHXA 3M5LA 5IDKA 2WPDD 5FL7D 2KR7A 5C17A 4WH6A 1BMFD 3F3BA 4DT4A 3PRDA 4M9FA 2IJOB 3SZEA 2F43B 2QF5A 4B73A 3ZIAD 1DXPA 3SU6A 3WWBA 1W0KD 4A1TA 4TSFD 2W6JD 2JIZD 2KCOA 2JDID 5ESBA 3OTPA 3F2GA 2K8IA 1OHHD 2A4QA 2XNDD 3OFND 3O8RA 4ZCNA 3F2HA 2P59A 4I33A 2OC8A 5EQRA 5C0TA 5DN6D 5CDFE 1DY9A 1H8HD 5EQSA 3VG8A 3W1EA 3OE7D 5HKKD 1H8ED 1NBME 3N7EA 4I31A 2W6ID 3OEED 3SU2A 3WWFA 2K0QA 5EQQA 3O8CA 4Q4LA 3H09A 5DSFA 3FN8A 2QF4A 3KN2A 2IJD1 1W0JD 3P8NA 4YXWD 3FOAA 5GNDA 2FOMB 1NBMD 2A4RA 2CK3D 3SUEA 1N1LA 4XD7D 5ETXA 4TYDA 3DSPA 4ASUD 5T1VA 3RC6A 4B76A 4A1XA 2KCAA 2QV1A 1SKYE 2VBCA 3SU3A 2KCYA 2KCPA 3U1JB 3LOXA 4B74A 5IK2D 2OINA 3F2FA 4NWLA 3PV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFR D;  5DN6 D;  5CDF E;  2QE7 D;  1MAB B;  1H8H D;  3OAA D;  3OE7 D;  5HKK D;  1H8E D;  1NBM E;  3N99 A;  2W6I D;  3DCL A;  3OEE D;  3OEH D;  4Q4L A;  2JJ2 D;  1E1Q D;  1E79 D;  2WPD D;  5FL7 D;  1BMF D;  1W0J D;  4YXW D;  1NBM D;  1FX0 B;  1COW D;  1KMH B;  2CK3 D;  4TT3 D;  2F43 B;  4XD7 D;  2HLD D;  3ZIA D;  2JJ1 D;  1W0K D;  4ASU D;  2XOK D;  4TSF D;  4Z1M D;  2V7Q D;  2W6J D;  2JIZ D;  3FKS D;  2JDI D;  1SKY E;  1OHH D;  2XND D;  3OFN D;  5IK2 D;  1E1R D;  2WSS D; 
#chains in the Genus database with same CATH topology
 3QGJ A;  2W26 A;  2XXL A;  1KXF A;  3L33 A;  3D23 A;  1QQU A;  1S81 A;  1BTP A;  1BZX E;  3A8C A;  3RU4 E;  1VR1 H;  1C5L H;  1O37 A;  1RRK A;  1Y3X A;  1OWK A;  2HVX A;  2QXH A;  2DUC A;  4ABF A;  1FY4 A;  2ZI2 H;  3P8O A;  4DVA U;  3PMA B;  2F9U A;  1O31 A;  5EJ1 A;  1EPT C;  3TJO A;  3FKS D;  5EW2 H;  3RLW H;  1C5X B;  2G52 A;  1C2G A;  4GVU A;  1GGD B;  3QK1 A;  3BG4 C;  1IQK A;  1XUF A;  5CMX H;  1IQN A;  1C1T A;  2JH0 D;  4ZH8 A;  5EPN A;  1QHR B;  5EGM A;  5SGA E;  1L1G A;  5E0H A;  1MZA A;  4AZ2 B;  1F5R A;  5DP7 A;  3A86 A;  1T8N A;  2BY5 X;  1UTL M;  1BHX F;  1GI3 A;  1SGT A;  1VGC C;  2FO9 A;  1EZS C;  1UMA H;  1VIT F;  1UK2 A;  3GY4 A;  1TWX B;  4ISO A;  1ZZZ A;  3A7Y A;  3V0X A;  4I7Y H;  3ZVG A;  3A82 A;  1O5C B;  4AYY B;  1CBW C;  3SUD A;  2O8T A;  2AH4 X;  1NRO H;  1EQ9 A;  3SNC A;  3ATI A;  3BG4 B;  1C5U A;  1Z71 A;  4BAH B;  2OK5 A;  1TBR H;  1O3J A;  4K69 A;  1FAX A;  2ZIQ H;  3MH7 A;  5L2Y H;  1IQG A;  1S84 A;  4Y10 E;  2OQ5 A;  3SV2 H;  4INK A;  3F9F A;  3ZZA A;  1LVM A;  2QF0 A;  3ATM A;  1V2K T;  3SND A;  2GKV E;  1O2X A;  1OS8 A;  5DP6 A;  3MOC A;  1G37 A;  2QCY A;  2XWA A;  6CHA B;  1O2Z A;  2FOA A;  1NFW A;  4Y8Z A;  1HXF H;  2OC8 A;  1SMF E;  1GHB G;  1NPM A;  4ZKO U;  1HGT H;  3ENS B;  5HKK D;  1JWT A;  4B2A A;  4D76 A;  2RG3 A;  3O8C A;  1NC6 A;  1HPG A;  2ZQ2 A;  1DS2 E;  2BD3 A;  3ZVA A;  2CV3 A;  3IWM A;  3EGK H;  4YOJ A;  4DW2 U;  1CA8 B;  4CR9 A;  1NFY A;  4RT0 A;  1AWF H;  1N1L A;  4YM9 A;  1EP5 A;  2VGC C;  1W11 U;  3EST A;  1DPO A;  2ZHD A;  5PTP A;  1EAX A;  1BRB E;  2WPI S;  1A0J A;  1VJA U;  4FUD A;  5FBI A;  1J15 A;  1EFR D;  1AFQ B;  2PLX A;  3E90 B;  4GLY A;  1VIT G;  3RXJ A;  2OTV A;  1YPE H;  1GMD F;  3BTT E;  1UHB A;  2A2Q H;  1G32 B;  4WH8 A;  8GCH G;  3SJI A;  1ORF A;  2BZ6 H;  3M61 U;  1IQH A;  2BYA X;  2A7C A;  3ZZB A;  1A0H B;  2P3T B;  1P2K A;  2SGP E;  5EXN A;  1XX9 A;  3TK5 A;  3BTK E;  1XM1 A;  4AB9 A;  3OAA D;  4JCN A;  5GCH G;  2KAI B;  1OYQ A;  3D62 A;  2FTM A;  2GZ9 A;  4MDS A;  2GJG A;  4P02 A;  4FUB A;  2BQ6 B;  4D8N A;  2GDE H;  1C2K A;  1P11 E;  1C2L A;  3MU5 A;  1FZZ A;  3GCH C;  3HK6 B;  3M5O A;  1TPO A;  1TNK A;  2NU0 E;  5K7R A;  1K0H A;  1O3D A;  2ZDV H;  3SV7 A;  1V6D A;  4JYV H;  1O2V A;  4X2W A;  1H9I E;  1JOU B;  1MZD A;  1FAK H;  4INH A;  2HWL B;  1HAZ B;  1LVY A;  3ODD A;  1EJN A;  1UTO A;  2J98 B;  1EOJ A;  1PQ5 A;  1O3K A;  2FM2 A;  1C1U H;  3DCL A;  7GCH G;  7EST E;  3PMJ A;  1QL7 A;  5HIY A;  1GBI A;  3RMN H;  1BTU A;  1FLE E;  3DUX H;  1C5S A;  4D7G A;  3RXI A;  3UWI A;  1AI8 H;  1SOT A;  4K2Y A;  2V35 A;  1C5Z B;  5T6D A;  3SOR A;  1GBT A;  2UUJ B;  1V2V T;  1BRC E;  3PWC A;  3PLK A;  4F48 B;  2WYJ A;  2QGR A;  3KQD A;  1MU8 B;  2ZNK H;  3NZI A;  1TPP A;  2VU8 E;  4ZHA A;  3H09 A;  1F92 A;  4H42 U;  2FOH A;  3SNA A;  4FUH A;  4OS5 A;  4E7N A;  3BSQ A;  3U8T H;  1V2O T;  1S5S A;  1ZPB A;  3FVF B;  1J8A A;  3DSP A;  2A31 A;  1JRS A;  1YPG H;  4YLU A;  1G3C A;  1DWD H;  2BB4 A;  1XUI A;  3A83 A;  2G00 A;  2KCP A;  3MNB A;  4MPX A;  4ABE A;  4XDE A;  1PPG E;  4FU8 A;  1GJ8 B;  5K0H A;  2Z9L A;  1FNI A;  4IW4 E;  3LDX H;  2V3O H;  5FX5 A;  5FCR A;  4K1E A;  1CT4 E;  3T26 A;  5LH8 A;  4B71 A;  5FAH A;  3VXF H;  2K1Q A;  1NS3 A;  4TT3 D;  2O8M A;  4AFQ A;  2EY4 C;  1ZGI A;  2HPQ H;  1AD8 H;  3OTJ E;  1TGN A;  3SU4 A;  1L0Z A;  4KTC A;  1W8B H;  5FCK A;  2AMQ A;  2XRC A;  2A45 B;  1TX8 A;  3SUF A;  1FIW A;  1AIX H;  1O39 A;  3FP8 E;  1SQR A;  4O97 A;  3T2N A;  1N8O C;  2Q6F A;  1TOM H;  4MNY A;  4ABI A;  1LQE A;  1VJ9 U;  1UCY K;  2C3S A;  5DO4 H;  2AIP A;  1SGC A;  3URE A;  4R8T B;  1GMC G;  2GCT C;  4Y71 A;  4I86 A;  3M5M A;  2XTT B;  4XBD A;  1UCY E;  2SFA A;  1QIX B;  4Y7A A;  3RXF A;  3ZZ6 A;  1ANC A;  4X6P A;  1SGY E;  4GAW A;  4RSP A;  3M7U A;  4F55 A;  3F0O A;  5G4B A;  4RKJ B;  1Z8I B;  1EB2 A;  4RT1 A;  2BQW B;  3JZ1 B;  4K1T A;  2RFK C;  3TH4 H;  2VH6 A;  1LVO A;  2B8O H;  2KR7 A;  1BMF D;  1ESA A;  1RFN A;  4M9F A;  4CBN A;  2JET C;  2ODP A;  1RXP A;  4XBB A;  1P2O A;  3K9X B;  1P57 B;  2AMD A;  5ESB A;  1A3E H;  1Z8J B;  4X8T H;  5EQR A;  3UQV A;  5DN6 D;  5CDF E;  1H8H D;  2ANY A;  3LU9 B;  1O33 A;  4IMZ A;  3LPR A;  1SGN E;  4JZE H;  2PR3 A;  1TNH A;  1YLD A;  2UWP A;  3K65 B;  3MFJ A;  1MKX K;  4O03 A;  1F0S A;  4TPY A;  2GX4 A;  3E16 B;  1O3F A;  3S9A A;  3BTF E;  3E0P B;  4CRC A;  1PYT D;  4IBL H;  1HIA B;  1GHA G;  2SGF E;  1SGE E;  2GD4 B;  1YGC H;  2HVY B;  1IQJ A;  3G01 A;  2P8O C;  3PM3 A;  1GMC F;  2B0F A;  4NZQ A;  5B6L A;  4ZKR U;  4ABH A;  2BX3 A;  3AAS A;  2GV7 A;  1V2W T;  2W3K A;  1QRW A;  3GDS A;  3RC5 A;  1Y5U T;  5JBT A;  1P10 A;  2NU2 E;  4IMQ A;  1CQQ A;  1F7Z A;  1UHB B;  1NO9 H;  2A1D B;  2BD8 A;  4X8V H;  4CHA B;  1CE5 A;  2Z3E A;  2OP9 A;  3VB5 A;  2R2M B;  3TLO A;  4HFP B;  1Z7K A;  1HUT H;  2A4G A;  1HAV B;  4AGJ A;  3FP6 E;  1QJ7 B;  1VKY A;  1QA0 A;  3PTB A;  1DUE A;  4GHT A;  3S7H B;  1GJA B;  1FMG A;  1NRS H;  3SI3 H;  2FEQ H;  3SU5 A;  1TAB E;  1TGT A;  2BY6 X;  5GIB A;  2UWL A;  4GUX A;  1ZLR A;  4IN2 A;  3BTQ E;  1GBK A;  1L1N A;  3D49 H;  1BDA A;  2OD3 B;  5C67 A;  2FIR H;  1OXG A;  2SNV A;  1JXP A;  3SJ8 A;  1QL9 A;  2JKH A;  1HJ9 A;  4ZXY H;  2ZGC A;  3GY8 A;  1O2K A;  3ZZ8 A;  4QT8 C;  1ELV A;  3EDX B;  1WQV H;  2QY0 B;  2ANK H;  1N6Y A;  2VWO A;  4FVB A;  3NXP A;  1PPH E;  1XXF A;  2Y7Z A;  3UOP A;  1UVO A;  3A89 A;  1GI7 B;  3ZYD A;  1VCQ A;  5DP3 A;  1A2C H;  4WH6 A;  2Y7X A;  1QBN A;  1KXD A;  1ZHM A;  2GP9 B;  3E8L A;  5CHA B;  5A8Z A;  4J1Y A;  1T31 A;  3I77 A;  1GI1 A;  4HZH A;  1ACB E;  1UJ1 A;  1TPS A;  1EPT B;  2Y82 A;  3E1X B;  2STA E;  3O8R A;  1BB0 B;  2XND D;  1CHO G;  2FYQ A;  1ABI H;  2ZFF H;  4E7R G;  2GCH F;  1EST A;  2PUX B;  2Y5G A;  1O5B B;  1KXB A;  1Y3Y A;  2ZGH A;  4H6S B;  2ZU4 A;  1O2T A;  3SO3 A;  2M5T A;  3A81 A;  1BOQ A;  2CHA C;  2DE9 A;  2ZEC A;  4YT6 H;  1ARB A;  4TY6 A;  1NFX A;  1BRA A;  5GND A;  1ZGV A;  1HIA A;  4I8L A;  1TFX A;  1C4Y 2;  2ZCK P;  3TU7 H;  1LHG H;  2BD9 A;  3KGP A;  3UWJ H;  4ISH H;  1GI5 A;  3SW2 B;  4FU9 A;  1THP B;  3SN8 A;  4B76 A;  1TIO A;  1C4U 2;  1FY8 E;  3PV4 A;  3RXT A;  2J95 A;  3LGY A;  1AE8 H;  2B7D H;  1DT2 A;  2HPP H;  3TPI Z;  4AOR A;  4UEH H;  5HM2 A;  4LOY H;  5FHT A;  2FOG A;  1YPJ H;  2XC4 A;  4AGK A;  1UVS H;  1BCU H;  4JZ1 A;  4BAQ B;  3BN9 A;  2PKA B;  2UUY A;  3M3T A;  4WWY A;  3SHC H;  3TIU A;  3QZR A;  2FYR A;  5C5N A;  2QA9 E;  2WPK S;  2Z9J A;  1W7G H;  1GJC B;  1BTH H;  4NIW A;  1ZJK A;  1A4W H;  2V7Q D;  3GIS B;  1SL3 A;  4B6E A;  1ZHR A;  4FUI A;  2P93 A;  1GI4 A;  5A0C A;  1WSS H;  5GJ4 B;  2L74 A;  4A1V A;  2ZFR H;  1HJA C;  1LO6 A;  3MO9 A;  1XKB C;  2I6Q A;  1UCY H;  1JRT A;  1DXW A;  2IPH A;  2ZU5 A;  2OQU A;  5KED A;  2YMS B;  1OPH B;  4BAN B;  1RIW B;  2ZFP H;  1D3T B;  4TPI Z;  2HGT H;  2QF3 A;  2LPR A;  5FX6 A;  6GCH G;  2R9P A;  1IHS H;  1Z6J H;  1KTT B;  3C1K A;  1PPB H;  3GYL B;  1IQL A;  4MPW A;  2ZKS A;  2O8L A;  3RU4 T;  3UOU A;  1AFE H;  4AYV B;  1GJ9 B;  3RXQ A;  1K1M A;  1BIT A;  1AO5 A;  2PFE A;  4Y76 A;  2GTB A;  3LIW A;  4JK6 A;  4NA7 A;  1QTF A;  3ZZ5 A;  1MKW H;  1KLT A;  2OLG A;  2WPM S;  4A1T A;  2QAA A;  3RM2 H;  1YCP H;  2GZ8 A;  4CBO A;  2BDI A;  1EAS A;  2SNW A;  1LPZ B;  1V2Q T;  2HRV A;  3ATW A;  4YO9 A;  2A0Q B;  4BNR A;  4I31 A;  4K5Z A;  4DT7 B;  2EQN A;  1UTK A;  3AAU A;  4CR5 A;  2ZU3 A;  2OCV B;  3ZVE A;  3DA9 B;  2NU4 E;  4IS5 A;  3M36 A;  5A0B A;  1PJP A;  5HM9 A;  1H8I H;  2VB0 A;  3Q3K A;  3RXE A;  1KDQ B;  1AVX A;  1BMA A;  9EST A;  2A32 A;  2ZFQ H;  3KYG A;  1C5N H;  1LCY A;  1GL0 E;  1L4D A;  1SGP E;  1EX3 A;  2QE7 D;  3M3S A;  1KXC A;  4ABB A;  2CJI A;  4ZAE A;  2ZDK A;  4BAK B;  1WV7 H;  1SR5 C;  5BPE A;  1GJ7 B;  1S82 A;  1CGI E;  1TMT H;  1C5W B;  4CRE A;  1BTZ A;  3BTM E;  4UFE H;  1FXY A;  1GG6 B;  4A6L A;  3B8J A;  2BXU H;  3ZVF A;  1YLN A;  1C2J A;  2VIV A;  2BZA A;  1F5L A;  2FLB H;  2G81 E;  5B6O A;  2PSX A;  5E8E H;  2RCE A;  3E91 A;  2HNT F;  4WVP E;  4ASH A;  3O8D A;  1GHV H;  1DWB H;  3I29 A;  3ODF A;  1C2I A;  2RA3 A;  2ZU2 A;  3SUG A;  2R3U A;  4FOU C;  3DFL A;  3GCN A;  1F2S E;  2XCF A;  3KQ5 A;  1V2M T;  2QN5 T;  3LGV A;  1GCT B;  2VNT A;  3SGQ E;  1WTH D;  3GDV A;  4F4O C;  1QUR H;  4Z0K A;  5L2Z H;  1N8O B;  1FX0 B;  4JYU H;  4NIY A;  3ZVD A;  1YPH E;  1OP0 A;  4MPV A;  1O5G H;  1ZPC A;  5A09 A;  1YF4 A;  3A8A A;  1LQD B;  1TB6 H;  2XYA A;  4FUE A;  3RMM H;  1GPZ A;  2J5U A;  1BBR E;  2BXT H;  1HAX B;  2J34 A;  2L6O A;  1E34 B;  2HNT E;  1H4W A;  1EOL A;  1CHO F;  1DLK B;  4TWW A;  3MMG A;  1HAY B;  1BRU P;  3ZZ7 A;  1P06 A;  1UO6 A;  2WHX A;  4XE4 A;  3URD A;  2P95 A;  1E0F D;  3A7V A;  1Y8T A;  1OWH A;  2R0K A;  1KXE A;  3PB1 E;  1MMJ N;  2BLV A;  3Q3Y A;  2AGI X;  3PRO A;  4A7I B;  5HYO A;  1EZU C;  2HLC A;  2QXJ A;  4I33 A;  1P04 A;  4X8U H;  1KLJ H;  1MKX H;  4LK4 A;  1DSU A;  1UVT H;  3P17 H;  5EG4 A;  2K0Q A;  4ABA A;  1VZQ H;  7LPR A;  1C2H A;  2QYI A;  5DSF A;  1BHX B;  1E35 B;  1SGF G;  3MU4 A;  5LPF A;  3FOA A;  1P12 E;  3KQE A;  1F0R A;  3SUE A;  4XD7 D;  2PHB A;  1LHE H;  1C5O H;  2ZU1 A;  4IN1 A;  1EJM A;  1VIT H;  2FX4 A;  1V2P T;  2F91 A;  4UON A;  4E06 H;  2YNB A;  4ZHM U;  1TMU H;  4AOQ A;  2OIN A;  1Y3V A;  4UD9 H;  4AFZ A;  3GOV B;  3ZZC A;  2H5C A;  1TBQ H;  3BTG E;  1DY8 A;  1GMD G;  2XWB I;  4I8J A;  1ZSL A;  5EJZ A;  2O8U A;  4NA9 H;  8GCH F;  2NWN A;  2OC1 A;  4BXW A;  3UR6 A;  1AU8 A;  3F9H A;  1W10 U;  4O9V A;  1K22 H;  1YYY 1;  3HKI B;  1GHZ A;  5EPY A;  2AFQ B;  1GJ4 H;  1YPH C;  4JZD H;  1C5M D;  3F68 H;  2CF8 H;  4ABJ A;  1GI2 A;  4K8Y A;  3KNX A;  3WY8 A;  2ZG0 H;  3FP7 E;  1C1P A;  4JZI A;  4X6M A;  1HJA B;  4Y6D A;  1D9I A;  2FI3 E;  1HFD A;  1AGJ A;  4NZL A;  3F0P A;  1ELB A;  3BEF B;  1GBA A;  3KQB A;  2FS9 A;  4AFU A;  1V2N T;  4HTC H;  1TGB A;  1QY6 A;  2BX4 A;  4DG4 A;  1B7X B;  1DOJ A;  1QR3 E;  2LP6 A;  1DST A;  1JMO H;  2PUQ H;  3MU8 A;  3OYP A;  1SGF A;  1TPA E;  5CE1 A;  1GHW H;  2VGC B;  1EZQ A;  3R0F A;  1ELD E;  3O8B A;  3RXV A;  4Y7B A;  1HXE H;  1CA0 C;  2GMT C;  5FBE A;  2F3C E;  3PLB A;  3QWC H;  4OGX A;  8LPR A;  1E38 B;  1AVW A;  3RXG A;  3RXS A;  1C1W H;  4BTI B;  1K1N A;  4SGB E;  3S0N A;  3SU6 A;  2AGG X;  3URC A;  1HB0 B;  1GCD A;  1MTN B;  4KP0 A;  3DFJ A;  1C1O A;  2AIQ A;  2JDI D;  4FUF A;  1P2M A;  2VIW A;  2ZP0 H;  1O32 A;  1BUI A;  3F2H A;  3SJK A;  5DG6 A;  3IIT A;  3RML H;  4A5T S;  1EUF A;  1OWJ A;  3W1E A;  2JH6 D;  1NBM E;  1O3N A;  4NA8 A;  2W6I D;  3RXD A;  3U69 H;  1Z6E A;  4CH8 B;  1WDI A;  2A7J A;  1IAU A;  1QZ8 A;  1SLW B;  5E2P A;  5F8T A;  4YXW D;  2FOM B;  1NBM D;  1OSS A;  3UY9 A;  4GCH G;  3KL6 A;  1PYT C;  2PP6 A;  3U9A H;  2H5D A;  2KCA A;  3NKK A;  1GBF A;  1KDQ A;  4B2C A;  2PTC E;  3LKW A;  1YM0 A;  2ZTX A;  6LPR A;  1BT7 A;  2VIP A;  3ZZ9 A;  2JJ2 D;  4KEL A;  2THF B;  3M35 A;  3MH5 A;  4X1R U;  5E0G A;  2NU3 E;  3VPK A;  2RDE A;  3KCG H;  2WYG A;  2HLD D;  1C2D A;  1RD3 B;  1WCZ A;  4NWK A;  1H1B A;  2OBQ A;  2ZEB A;  1TGC A;  1AQ7 A;  3NCL A;  2TGA A;  1DLE A;  1QBO A;  1DX5 M;  1FV9 A;  1SFQ B;  2H9E H;  2WIN I;  4E05 H;  2KFW A;  2ZCL P;  3FO8 D;  3BV9 B;  2GV6 A;  1QB9 A;  1G3E A;  2C8W B;  3SV8 A;  5DGJ A;  1L2E A;  1VGC B;  2UUK B;  1CT0 E;  4K1S A;  2Z3D A;  1AE5 A;  1O3B A;  3EYD A;  1E79 D;  2G5N A;  3SV9 A;  1K1P A;  1O3L A;  1LDT T;  2FOF A;  1MBQ A;  5C94 A;  4XSK U;  1XUJ A;  1HAI H;  2C93 B;  2FXR A;  2WPL S;  5T6G A;  1ZMN A;  4Y8Y A;  1W12 U;  5TCA A;  1GBE A;  1M9U A;  3F6U H;  3PRB A;  4Y8X A;  2C8X B;  1TE0 A;  1BQY A;  1ZJD A;  3MI4 A;  3H7T A;  3A84 A;  4NFE A;  3P6Z B;  2YMS D;  3PYH A;  2ALV A;  1SPJ A;  2OBO A;  3R3G B;  5TCC A;  1KIG H;  4CRF A;  1GBJ A;  1HJ8 A;  5EU8 A;  4ABD A;  5FXL A;  2PW8 H;  2CN0 H;  1TA2 A;  1C5R A;  4MVN A;  5DPA A;  2SGE E;  2Z3C A;  1E36 B;  2J98 A;  1C1R A;  1WOF A;  3DSG A;  3F2G A;  3MNX A;  4ZMA H;  5EJL A;  1ELG A;  1LPG B;  1GDQ A;  1P0S H;  5EQS A;  1GHX H;  1ZSK A;  4IGD A;  2BLW A;  4BOH A;  3A80 A;  1MQ6 A;  2VJ1 A;  2O9Q A;  5LGO A;  1AB9 B;  3QN7 A;  3GCO A;  3MHW U;  1J16 A;  1UK4 A;  2AGE X;  3P70 B;  5T1V A;  3RC6 A;  3PWB A;  1E37 B;  1NT1 A;  1D3D B;  1SVP A;  4A1X A;  2PGQ B;  1YPM H;  1NRQ H;  2BVX H;  3KYF A;  4B74 A;  3F2F A;  3PV5 A;  4X1Q U;  1O3E A;  1O2H A;  1MAB B;  1O3H A;  1P09 A;  3K2U A;  1P01 A;  3CP7 A;  4YT7 H;  1S83 A;  1UTP A;  2VID A;  4INL A;  3QLP H;  4CH2 B;  2JET B;  2J92 A;  3HK3 B;  3OY6 U;  2WZQ A;  3V12 A;  1MD7 A;  4MQA A;  3U28 C;  3L3T A;  4WME A;  1DAN H;  3EE0 B;  3GIC B;  2CGA A;  1ZR0 A;  2V3H H;  1ESB A;  3RXU A;  2JJ1 D;  1UVP A;  7KME H;  3UNR A;  1T8O A;  4Z1M D;  4K8B A;  1C1V H;  1S6L A;  3F1S B;  3BTE E;  1W7X H;  1C5T A;  4NIX A;  3RXR A;  5DP9 A;  1WYK A;  2GZ7 A;  2Z94 A;  3ATL A;  2I6S A;  2BQ7 B;  1K9O E;  1J9C H;  1O2G H;  2FP7 B;  1NFU A;  4U2W A;  4ISL A;  1C5Y B;  3WW7 A;  2FMJ A;  1TYN A;  3MNC A;  2ZHQ H;  5FPY A;  1XMN B;  2R0L A;  2W3I A;  3MWI U;  1W0Z U;  1TRM A;  4KTU A;  1LHF H;  1TAW A;  1MBM A;  2FI4 E;  1D6R A;  1O5F H;  2C4F H;  1A0L A;  2BDA A;  5JBA S;  1W0Y H;  4X0W U;  2ZHW H;  4X2Y A;  3BF6 H;  3V3M A;  3UNS A;  3Q00 A;  1NTP A;  2PTN A;  2R2W U;  4UFG H;  3GCT G;  1ZMJ A;  1WXR A;  2SGD E;  2CXV A;  4H6T A;  5IDK A;  1K1J A;  3F9E A;  4THN H;  4ZKN U;  5C17 A;  3F3B A;  3PRD A;  2IJO B;  2TGT A;  4B73 A;  2Q1J A;  3TVJ B;  3T62 A;  2TIO A;  1TRN A;  1YC0 A;  2GT8 A;  4OGY A;  1TRY A;  1SGI B;  4YOG A;  2TPI Z;  4XBC A;  2B5T B;  4P00 A;  3OTP A;  4UE7 H;  4RN6 A;  1DY9 A;  3VFE A;  5EST E;  4ZUH A;  4OS6 A;  3KID U;  1WBG B;  1ETS H;  3A88 A;  5F8Z A;  1UTN A;  1W0J D;  4FXG H;  1MQ5 A;  1NY2 2;  1LKA A;  4TYD A;  4GPG A;  1IQF A;  1HAG E;  5AFZ H;  4ZXX H;  2FI5 E;  1N6X A;  1DWC H;  1ETT H;  3HKJ B;  3MQK C;  1P2I A;  1O35 A;  2A2X H;  5F03 A;  4EST E;  3M3V A;  2BDC A;  4NWL A;  5TJX A;  1O34 A;  2R3Y A;  2DE8 A;  1C2F A;  3PO1 B;  2EA3 A;  1PQA A;  1AZ8 A;  1GI9 B;  4UFF H;  2VVU A;  3U8R H;  1F0U A;  1XXD A;  2G51 A;  2XBX A;  5DKM A;  5T6F A;  1ELF A;  2H9H A;  1A5I A;  1BBR K;  3L6P A;  1GHY H;  1PQ8 A;  3A7T A;  2Q6G A;  4GCH F;  1B5G H;  4DUR A;  3SJ9 A;  1L1J A;  1W3C A;  2SGQ E;  2EC9 H;  2WUC A;  2ZHE H;  1C9P A;  4K60 A;  1O5D H;  1GDN A;  1GL1 A;  4TWY A;  1BBR H;  1O2W A;  3P8G A;  2SGA A;  3RXC A;  1OOK B;  2TGD A;  4KGA A;  1P2N A;  1FPC H;  5LPR A;  2ZGJ A;  3MYW A;  3TJN A;  1ZPZ A;  4JYT A;  2XNI A;  3ATK A;  3AAV A;  3GS9 A;  5E2O A;  1KTS B;  1OWI A;  2ZFT A;  3ELA H;  3JZ2 B;  3NWU A;  1P03 A;  5EIY A;  3LGW A;  2Y5F A;  5J4S A;  4WY3 A;  5EXM A;  3SU0 A;  3FAO A;  1MTS A;  4WJG 2;  1BMN H;  1A46 H;  3T27 A;  5LPE A;  3LC5 A;  4LZ4 B;  1C5Q A;  1W14 U;  4YOI A;  4YES B;  3P8F A;  1UVU H;  2ZWL H;  4JZF H;  1O5A B;  1P3C A;  1FY3 A;  4DT4 A;  3GCT F;  4ABG A;  4NIV A;  1XKA C;  1VCW A;  1P3E A;  1C4V 2;  2AS9 A;  1MKW K;  1W0K D;  3QX5 H;  5GWZ A;  3UFA A;  1ZSJ A;  2JIZ D;  2A5K A;  3TNS A;  4F49 A;  5DP5 A;  2P59 A;  4YTA A;  3W95 A;  4ZCN A;  3A87 A;  5DJ7 A;  3ITI A;  3QUM P;  3K6Z A;  1FN6 A;  9LPR A;  1QRX A;  4HGC A;  1NN6 A;  3EA9 A;  4Q4L A;  3ZZ4 A;  1ZTK A;  3VB7 A;  1LVB A;  1YPK H;  3P95 A;  1G9I E;  1GBL A;  2CHA B;  2ZDN A;  1FN8 A;  3CNR A;  3NK8 A;  2V6N A;  1NU9 A;  2CK3 D;  3UPE A;  4I8H A;  1Q31 A;  2WV4 A;  4ASU D;  1T8L A;  4B2B A;  1SKY E;  2H6M A;  1MTW A;  1RTK A;  3DT0 H;  2NU1 E;  2W7U A;  3M5N A;  1GBB A;  1SGQ E;  1YY3 A;  3EQ0 H;  4D9Q A;  1V2U T;  3UIR A;  5J4Q A;  2Q6D A;  1O2Y A;  2JH5 D;  1AZZ A;  2XBY A;  1O2U A;  2ZGX H;  5AFY H;  1HCG A;  3LON A;  1YBW A;  2EI7 A;  5EOK A;  2BHG A;  1YP9 A;  1QA7 A;  1MTN C;  4JMY A;  3AW1 A;  5C1Y A;  7GCH F;  1G36 A;  3B9F H;  2F4L A;  3BTD E;  1AVG H;  5T3H A;  2OC7 A;  4VGC B;  2GGV B;  1YKT A;  2M2A A;  1GJ5 H;  4ISN A;  4Q63 A;  3ZVC A;  1ZHP A;  1YCP K;  1FJS A;  1TQ0 B;  3DHK H;  1O2R A;  4CRB A;  3UNQ A;  4I32 A;  1GGD C;  1EB1 H;  5C0U A;  1TX7 A;  3K6Y A;  2BY7 X;  4YLQ H;  3TGI E;  1GJB B;  1O2O A;  1OKX A;  1C2M A;  2GT7 A;  2ANW A;  2BOH B;  1T4U H;  5DP4 A;  4WMF A;  1AKS A;  3UQO A;  2BDB A;  2QXI A;  1TOC B;  1GVL A;  3FFG A;  4DY7 B;  3LJO A;  1OWD A;  3M5L A;  3TIT A;  2WPD D;  5FL7 D;  2Z7F E;  1KSN A;  1O3G A;  2Y5H A;  1C5V A;  4Y0Y E;  2ZA5 A;  3ZIA D;  2F83 A;  3V13 A;  3UUZ A;  3E6P H;  4CHA C;  4I8K A;  1P2J A;  3MTY A;  4U32 A;  1QBV H;  1SG8 B;  3MU0 A;  2YNA A;  1IHT H;  2BVR H;  1RJX B;  1O3C A;  1GBC A;  1Z1I A;  1A5H A;  1HBT H;  3SU2 A;  3UAI C;  2FOE A;  1OP8 A;  1CT2 E;  3BEI B;  3LGT A;  1Q2W A;  4OS4 A;  1SLU B;  3EE7 A;  1TON A;  3ZZD A;  3OU0 A;  4ACA A;  2V3M A;  1IOE A;  1NRP H;  3T25 A;  2ILN A;  4K3J A;  1O5E H;  1KLI H;  5EW1 H;  2RDL A;  1GI6 A;  2AER H;  4Q80 A;  2AMP A;  1Y5A T;  1Q3X A;  3PMH B;  3SGB E;  3VEQ B;  5L6N H;  4DIH H;  1DIT H;  2ZPR A;  2ZPS A;  3QTO H;  2BD7 A;  4LXB H;  5GXP A;  1BML A;  2B9L A;  2YOL A;  3GY7 A;  1O2J A;  2WV9 A;  2VIN A;  5DP8 A;  1T8M A;  2G4T A;  4X1P U;  3RXK A;  3OY5 U;  1AHT H;  1G3D A;  3Q3X A;  2VH0 A;  3ZV9 A;  1C1S A;  1DE7 H;  2FPZ A;  4X1N U;  3HGP A;  5F6M A;  2J97 A;  2KZ4 A;  1HAH H;  1C9T A;  2VVV A;  3T29 A;  1ZRK A;  5C2Z A;  1YPL H;  4DOQ A;  1UTQ A;  1U6Q A;  3SNE A;  3GY6 A;  3GYM A;  1DIC A;  2FDA A;  3MH6 A;  4GSO A;  1PPZ A;  1AMH A;  1O30 A;  1ARC A;  5A8Y A;  2ASU B;  1INC A;  3MO3 A;  4O3T A;  2BM2 A;  2HAL A;  2F9P A;  1O3O A;  1GBM A;  2ZPQ A;  1S85 A;  3PO1 C;  2LNC A;  3T28 A;  2P8O B;  1O3I A;  3W94 A;  1MD8 A;  3OX7 U;  1EXF A;  2WSS D;  1ELA A;  1RGQ A;  5A8X A;  4NCY A;  1HDT H;  3KF2 A;  1NZQ H;  4OS2 A;  1T4V H;  3SBK A;  4A92 A;  1Z8R A;  8KME 2;  5JDU B;  4SGA E;  5KEC A;  3ZZ3 A;  4XRN A;  1BIO A;  2QXG A;  2ZDM A;  2FS8 A;  3ZVB A;  4ZHL U;  3RXM A;  4ISI H;  3RM0 H;  3TGK E;  3ZYE A;  4TSF D;  1SFI A;  4BTU B;  1VCP A;  2V0B A;  2PKS B;  2K8I A;  5HGG A;  1EJA A;  3RP2 A;  1OHH D;  1GMH G;  2EI6 A;  2ZQ1 A;  1BMM H;  3LH1 A;  3OE7 D;  2C90 B;  3WWF A;  2J9N A;  1FY5 A;  1D6W A;  1QQ4 A;  3M7T A;  2BY8 X;  3RDZ A;  3CS0 A;  4D7F A;  1GBD A;  2IJD 1;  3MNS A;  3T5F H;  1PPF E;  1KY9 A;  1MAX A;  4I8G A;  4FUC A;  1EAW A;  2VVC A;  4IC5 A;  1W2K H;  1B0E A;  1ELE E;  2BOK A;  3CS7 A;  5BRR E;  2PKS C;  3RC4 A;  2ZHF H;  2BMG B;  3N99 A;  1QRZ A;  1CHG A;  5CHB A;  1K1O A;  2ZO3 H;  2GCT B;  2Z9G A;  1CGH A;  1K2I 1;  3BIU H;  2BVS H;  2FOD A;  1P05 A;  4KTS A;  1D3Q B;  2RA0 A;  1SQT A;  3SJO A;  8EST E;  1D3P B;  2LEL A;  2ZGB H;  1BJV A;  2W5E A;  1SC8 U;  3QTV H;  1GJ6 A;  3H5C B;  3H7O A;  1FQ3 A;  3TJU A;  1QJ6 B;  2A7H A;  4BXS A;  6GCH F;  2BD5 A;  3LH3 A;  1KYN A;  1GBH A;  3V7T A;  1SQA A;  1G2M A;  1D4P B;  1G2L A;  1CVW H;  1L4Z A;  3GCH B;  1A1R A;  3PV2 A;  1PPC E;  2J2U A;  1HAO H;  2GDD A;  5JBB S;  1TNJ A;  3QO6 A;  3SQH E;  2VWN A;  5E0J A;  1TLD A;  2UUF B;  2XC5 A;  1ZRB A;  3AW0 A;  4B6F A;  3A7Z A;  2GVF A;  4U01 A;  2YMS C;  4LZ1 H;  2A5A A;  4NFF A;  3SNB A;  3SYJ A;  5GPI B;  5JB8 S;  1X7A C;  1ANB A;  2PSY A;  1V2R T;  5JYI A;  4OM9 A;  1EAU A;  2Y6T A;  2TRM A;  1T7C A;  4GHQ A;  3BIV H;  1MAY A;  3LJJ A;  2BLO A;  2ODQ A;  2BD2 A;  4JK5 A;  2P16 A;  3S9C A;  2FOB A;  5HIZ A;  1OP2 A;  1JIM A;  2CF9 H;  3N7O A;  1ZTL A;  2EI8 A;  2H2Z A;  1ID5 H;  1UW7 A;  2HOB A;  1GHA F;  4FVD A;  4AG2 A;  2Y80 A;  3NUM A;  4NG9 H;  1H8E D;  1OYT H;  1Y3W A;  1SI5 H;  1OWE A;  3RXO A;  5EQQ A;  2FX6 A;  3Q77 A;  3FN8 A;  1IQE A;  3B23 B;  1HYL A;  3KN2 A;  3RXB A;  1S0R A;  5C20 A;  5I25 A;  1UTM A;  1SLV B;  1K28 D;  3HPT B;  3BTW E;  1CO7 E;  1NM6 A;  2XBW A;  2P3U B;  5AF9 H;  1SHH B;  4MLF B;  1O38 A;  2VBC A;  1KXA A;  1QCP A;  2QC2 A;  2VWM A;  3LGI A;  4TY7 A;  4ZRO A;  1TA6 A;  1V3X A;  4FUJ A;  3P92 A;  1HAP H;  4FET A;  4R0I A;  1AKS B;  1IQM A;  1TMB H;  2FZZ A;  2H1U A;  1GJD B;  1NRN H;  3NRL A;  3U98 H;  2AYW A;  1RIW C;  1XUK A;  2STB E;  1AY6 H;  1RTF B;  2FWW A;  1XUH A;  2D1J A;  2G5V A;  1BA8 B;  1O2Q A;  3KEE A;  5I46 H;  1BTW A;  3DSO A;  1RTL A;  1ETR H;  1Y59 T;  1FPH H;  1EP6 A;  2GCH G;  3EA8 A;  3KQC A;  4NSV A;  2ZDA H;  4UDW H;  2IOT A;  3RXL A;  1TX6 A;  1HV7 A;  4OS7 A;  2AEI H;  3AVZ A;  2G8T A;  5JPM H;  3GY5 A;  4RI0 A;  1QB1 A;  4Y79 A;  3U1I B;  5H4I B;  1CA0 B;  2GMT B;  3LT3 A;  4NGA H;  1C1Q A;  2PKA A;  1T32 A;  2Y81 A;  1TNL A;  1S6F A;  4AC9 A;  3A8B A;  1PQ7 A;  1KMH B;  3OSY A;  1SSX A;  2AHM E;  4VGC C;  2OXS A;  1ZML A;  2KM0 A;  1EZX C;  3PLP A;  4WXV A;  5HXF A;  1EAI A;  4U30 A;  3LGU A;  1CBW B;  1W13 U;  1LTO A;  2VWL A;  2Z9I A;  5EOD A;  5FPS A;  4AX9 H;  3SV6 A;  1EPT A;  2ZDL A;  4ZKS U;  1G30 B;  2J4I A;  4X1S U;  2W7S A;  1MU6 B;  3STI A;  1QFK H;  3TK6 A;  4FU7 A;  1GWA A;  1FDP A;  5GCH F;  2KAI A;  4CRA A;  4DII H;  1GMH F;  4XFQ A;  1QB6 A;  1SGD E;  5EXL A;  1O2P A;  1SB1 H;  5GDS H;  1V2S T;  4X6O A;  3S7K B;  2BLQ A;  3MU1 A;  1NES E;  3TK9 A;  1DWE H;  1FI8 A;  1Z1J A;  2KX4 A;  3VB6 A;  3SZE A;  2F43 B;  1H9L B;  1F0T A;  1DXP A;  3ZV8 A;  1LPK B;  1NU7 B;  3SQE E;  5DK1 A;  3RUO A;  2W6J D;  2KCO A;  4Q7X A;  5ABW A;  1JIR A;  4H4F A;  5C0T A;  1G3B A;  6CHA C;  1A3B H;  4FUG A;  3VG8 A;  3PMB B;  1DM4 B;  1WUN H;  3MH4 A;  4DCD A;  1TQ7 B;  3VB3 A;  5A0A E;  2XC0 A;  4AG1 A;  4BTT B;  2A4O A;  5CHA C;  3VGC C;  3M7Q A;  1ELT A;  5C1X A;  2WUB A;  5ETX A;  4AFS A;  3EA7 A;  4MNW A;  3S69 A;  1O2S A;  4Z6A H;  4Q7Y A;  3SZN A;  1B0F A;  3U8O H;  5F8X A;  1MTU A;  4XOJ A;  4ACB A;  2Z9K A;  1IQI A;  1O2L A;  3I78 A;  1K1L A;  1BTY A;  3FZD A;  3UR9 A;  1K21 H;  4PRO A;  2VIO A;  1DUA A;  2BDH A;  2D26 C;  1C1N A;  3PTN A;  1H8D H;  4IC6 A;  1YWU A;  2BD4 A;  2WV5 A;  4BAO B;  1COW D;  3E0N B;  1CU1 A;  1WQS A;  2PGB B;  1QNJ A;  1EAT A;  1AWH B;  2XOK D;  4MG3 A;  5A2M H;  1LKB A;  1RS0 A;  3FAN A;  2XBV A;  5C1U A;  4DJZ B;  2OC0 A;  4HI3 A;  1C1M A;  3F9G A;  2D8W A;  3S9B A;  1NRR H;  5KGO A;  4UFD H;  2J94 A;  2VIQ A;  3KHV A;  2IPQ X;  3FZZ A;  3SHA H;  3UB0 A;  2BTC E;  1QJ1 B;  1ANE A;  2XCN A;  1E1Q D;  1THS H;  3BG8 A;  3A7X A;  2ODY B;  3SU1 A;  3TNT A;  3GDU A;  3UTU H;  3AK5 A;  1LMW B;  4BAM B;  4WMD A;  1O36 A;  1BJU A;  3NPS A;  1SOZ A;  3E3T A;  2F9O A;  3STJ A;  2EST E;  4HG6 A;  1K1I A;  1P9S A;  1GCT C;  1O3P B;  1GVK B;  1YCP M;  1BTX A;  1TGS Z;  1PPE E;  2FOC A;  1OX1 A;  1HLT H;  2F9B H;  4YZU A;  2H9T H;  4M7G A;  2J38 A;  1O2M A;  1FY1 A;  1JBU H;  1O3M A;  1UTJ A;  1MCV A;  2QF5 A;  5IYT A;  2BY9 X;  2OUA A;  2TBS A;  1S6H A;  3SGA E;  2D2D A;  4Y11 E;  3WWB A;  4D9R A;  1ZTJ A;  1HAV A;  1LHD H;  1V2T T;  4WXI A;  1WAY B;  1Y3U A;  3RXA A;  1ZYO A;  2PWX A;  1GI8 B;  2EEK A;  3EAJ A;  1Y5B T;  4CRG A;  1V2L T;  5JBC S;  2G55 A;  1F5K U;  1CSO E;  3OEE D;  3A85 A;  2ALP A;  3M37 A;  2QF4 A;  2ANM H;  1SGR E;  3P8N A;  1GDU A;  1O2I A;  4CRD A;  3DD2 H;  1AND A;  1HNE E;  4MNX A;  5AHG H;  2WPH S;  1FUJ A;  2F9N A;  2QV1 A;  3RXP A;  3SU3 A;  1QL8 A;  3MO6 A;  3LOX A;  2O8W A;  5IK2 D;  5L30 H;  3TJV A;  4MPU A;  3HAT H;  4B1T A;  1LHC H;  1AN1 E;  3OEH D;  1WTG H;  3CEN A;  2P94 A;  4Y0Z E;  1O3A A;  3N7D A;  6EST A;  2C8Y B;  5AVD A;  1P02 A;  4WF8 A;  1SHY A;  3SOS A;  3GY3 A;  1O2N A;  1J14 A;  1E1R D;  2ZC9 H;  1DVA H;  2A5I A;  1ELC A;  1TNG A;  2BDG A;  1CGJ E;  3TH2 H;  1XVM A;  1DDJ A;  1HRT H;  4OS1 A;  2TGP Z;  1A7S A;  2XW9 A;  4RKO B;  1SLX B;  1TNI A;  2IN2 A;  3C27 B;  1XVO A;  1GG6 C;  2G4U A;  1GHB F;  5FPT A;  1ZOM A;  3IG6 B;  2FTL E;  1A5G H;  3SI4 H;  3LC3 A;  1P8V C;  1MTV A;  2FES H;  2WPJ S;  1MUE B;  2ZF0 H;  2ZTZ A;  4DGJ A;  4AB8 A;  3HGN A;  1AUJ A;  3A8D A;  1TAL A;  2ZCH P;  2C8Z B;  3D65 E;  1GI0 A;  1XUG A;  2FLR H;  1P2Q A;  1P9U A;  2F9V A;  5F53 A;  3A7W A;  4Q2K A;  4X2X A;  3BEU A;  2ZZU H;  3TH3 H;  3QGN B;  4B75 A;  5C3N A;  4NSY A;  1SBW A;  3GY2 A;  5HMA A;  1H9H E;  2ZFS A;  5C5O A;  1YLC A;  2PV9 B;  3Q76 A;  1MH0 A;  4J2Y B;  2P3F H;  1FIZ A;  2ULL A;  4X6N A;  3VXE H;  4X8S H;  2CMY A;  1AFQ C;  3QDZ B;  1MCT A;  1Z8G A;  2A4Q A;  3OFN D;  4MNV A;  1EKB B;  1SQO A;  3RXH A;  1UK3 A;  3TGJ E;  1A61 H;  4X2V A;  1C5P A;  4O3U A;  1AB9 C;  1J17 T;  3RMO H;  3N7E A;  2ZTY A;  3VGC B;  4KKD A;  1S0Q A;  3VB4 A;  4AN7 A;  1GVZ A;  1FON A;  1PFX C;  1DFP A;  2A4R A;  4Q7Z A;  2HNT C;  5JB9 S;  2Z6B D;  1AUT C;  1WU1 A;  2UWO A;  1QGF A;  1O0D H;  1C2E A;  1ABJ H;  1THR H;  3RLY H;  2BDY A;  3BTH E;  3U1J B;  3RU4 D;  2KCY A;  4MTB A;  1TBZ H;  3QZQ A;  2QIQ A;  1V2J T; 
#chains in the Genus database with same CATH homology
 1EFR D;  2QE7 D;  3E90 B;  1MAB B;  2YOL A;  4FET A;  3M5N A;  3LKW A;  3N99 A;  2WV9 A;  5B6L A;  5CHB A;  3NRL A;  1DY8 A;  1BT7 A;  3OEH D;  4WH8 A;  2JJ2 D;  2WZQ A;  3N7D A;  3RC5 A;  2OC1 A;  3KEE A;  4B71 A;  2K1Q A;  3DSO A;  1NS3 A;  4TT3 D;  1COW D;  2O8M A;  4WF8 A;  1CU1 A;  3P8O A;  1RTL A;  2HLD D;  3LON A;  2F9U A;  2JJ1 D;  2LEL A;  2OBQ A;  3L6P A;  4NWK A;  2KZ4 A;  5EPY A;  2XOK D;  3SU4 A;  4KTC A;  4Z1M D;  2V7Q D;  3FKS D;  4K8B A;  1S6L A;  4JMY A;  1W3C A;  4B6E A;  3SUF A;  2A4G A;  2KFW A;  2OC0 A;  1E1R D;  2F4L A;  3FO8 D;  3OAA D;  3O8D A;  5EPN A;  4RI0 A;  5GJ4 B;  1DXW A;  3KNX A;  3SUG A;  2FP7 B;  3SV8 A;  4A1V A;  2OC7 A;  5H4I B;  3U1I B;  3SU5 A;  2GGV B;  3UB0 A;  2M2A A;  3RC4 A;  2XCF A;  1A1R A;  2XCN A;  1E1Q D;  3EYD A;  1E79 D;  3PV2 A;  4Q63 A;  4R8T B;  3SV9 A;  5FPT A;  3WW7 A;  2XNI A;  3M5O A;  3SU1 A;  1FX0 B;  1KMH B;  5FPY A;  2YMS B;  3F0P A;  2AHM E;  3GS9 A;  3SV7 A;  3M5M A;  4I32 A;  2KM0 A;  3AK5 A;  3SUD A;  5C0U A;  3SV6 A;  5FPS A;  1JXP A;  4B6F A;  3PRB A;  2GVF A;  2J5U A;  4U01 A;  2YMS C;  2OK5 A;  3OYP A;  2WSS D;  4F55 A;  3F0O A;  1RGQ A;  3SU0 A;  3SYJ A;  5GPI B;  2L6O A;  3KF2 A;  2FM2 A;  3DCL A;  2F9V A;  3O8B A;  4A92 A;  4OM9 A;  5F53 A;  4B75 A;  2YMS D;  2OBO A;  1WXR A;  2WHX A;  3M5L A;  5IDK A;  2WPD D;  5FL7 D;  2KR7 A;  5C17 A;  4WH6 A;  1BMF D;  3F3B A;  4DT4 A;  3PRD A;  4M9F A;  2IJO B;  3SZE A;  2F43 B;  2QF5 A;  4B73 A;  3ZIA D;  1DXP A;  3SU6 A;  3WWB A;  1W0K D;  4A1T A;  4TSF D;  2W6J D;  2JIZ D;  2KCO A;  2JDI D;  5ESB A;  3OTP A;  3F2G A;  2K8I A;  1OHH D;  2A4Q A;  2XND D;  3OFN D;  3O8R A;  4ZCN A;  3F2H A;  2P59 A;  4I33 A;  2OC8 A;  5EQR A;  5C0T A;  5DN6 D;  5CDF E;  1DY9 A;  1H8H D;  5EQS A;  3VG8 A;  3W1E A;  3OE7 D;  5HKK D;  1H8E D;  1NBM E;  3N7E A;  4I31 A;  2W6I D;  3OEE D;  3SU2 A;  3WWF A;  2K0Q A;  5EQQ A;  3O8C A;  4Q4L A;  3H09 A;  5DSF A;  3FN8 A;  2QF4 A;  3KN2 A;  2IJD 1;  1W0J D;  3P8N A;  4YXW D;  3FOA A;  5GND A;  2FOM B;  1NBM D;  2A4R A;  2CK3 D;  3SUE A;  1N1L A;  4XD7 D;  5ETX A;  4TYD A;  3DSP A;  4ASU D;  5T1V A;  3RC6 A;  4B76 A;  4A1X A;  2KCA A;  2QV1 A;  1SKY E;  2VBC A;  3SU3 A;  2KCY A;  2KCP A;  3U1J B;  3LOX A;  4B74 A;  5IK2 D;  2OIN A;  3F2F A;  4NWL A;  3PV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...