3N99A

Crystal structure of tm1086
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
282
structure length
282
Chain Sequence
GHMRTNKDRLVRISVVGEIAPAKMRSPYSVTTEGTVRVIPVLGGITYNVKVGDSAYGWAGDHVEPGVSVMARRKEEEIPLMTLSCIGNEVIVMSGDAKGSRGFVTGKHGGVNHVLVHFEEEVLGKLMVGDKILIKAWGQGLKLLDHPDVKVMNIDPDLFEKLGIQEKNGKIHVPVVAKIPAHMMGSGIGASSSASTDYDIMASNPEDLGVADLKLGDIVAIQDHDNSYGVGKYRKGAVSIGVVVHSACVSAGHGPGVVVIMTGDESKILPEEVERANISDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein TM1086
publication title Crystal structure of TM1086
rcsb
source organism Thermotoga maritima
total genus 82
structure length 282
sequence length 282
chains with identical sequence B, C, D, E, G, H, I, J, K, L, M, N, O, P, S, T, U, V, X, a, b, c, d, e, g, h, i, j, k
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14505 DUF4438 Domain of unknown function (DUF4438)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.170 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3n99A02
2.102.30.10 Mainly Beta 3-layer Sandwich tm1086 (SG structure) fold tm1086 (SG structure) domain 3n99A01
4.10.1180.10 Few Secondary Structures Irregular tm1086 fold tm1086 domain 3n99A03
1EFRD 1SKYE 1W0KD 2W6ID 4XD7D 1H8HD 5FL7D 5HKKD 1COWD 3OEED 1OHHD 4TSFD 2WSSD 1W0JD 5CDFE 2CK3D 4Q4LA 3N99A 5IK2D 4ASUD 1NBMD 3OEHD 2F43B 3OFND 2WPDD 1E1QD 2JDID 2HLDD 2JIZD 2W6JD 2V7QD 3OE7D 1KMHB 4Z1MD 2JJ2D 1MABB 3ZIAD 3FKSD 1E1RD 1H8ED 1NBME 3OAAD 1FX0B 2XNDD 3DCLA 4TT3D 5DN6D 1BMFD 2JJ1D 2QE7D 4YXWD 1E79D 2XOKD
chains in the Genus database with same CATH superfamily
2GZ9A 5C20A 1TNKA 3SU0A 1O2RA 2W3IA 4NIXA 1BTHH 2QCYA 2FOHA 4THNH 1V2WT 3QTOH 3ZVAA 1TX8A 2F43B 2VVVA 1SGTA 2ZO3H 2D2DA 2OQ5A 1GJ9B 1IQMA 3GY6A 3QLPH 4FU8A 2J92A 4ABJA 5AHGH 1XXDA 1W11U 3U98H 1GL0E 2ZQ1A 2HNTF 1ZHPA 1MKXH 4BTIB 5T6FA 1BRCE 4K8YA 2AYWA 4B2CA 3QN7A 1A4WH 1EXFA 4HG6A 3SZNA 3ESTA 2XRCA 3N7OA 5LPEA 3MO3A 3VXEH 1K0HA 4XFQA 2Y80A 2ZDNA 4JYVH 1O39A 1WU1A 1C2EA 4TPIZ 4CBOA 3A8CA 4ZROA 1C5SA 3EA8A 4GCHF 3ZZ4A 4X8VH 2XXLA 1FN6A 2F83A 2PSYA 1Z71A 5HGGA 1UCYE 4MTBA 1HJAC 1J15A 1Q31A 1QJ6B 1ANCA 1COWD 3QGJA 1FXYA 1EAUA 1A61H 1MUEB 2ZTYA 3JZ1B 4I8JA 1P06A 1ESAA 1GI3A 3PLPA 3GY2A 1LHEH 4DY7B 4YT6H 1VKYA 3MYWA 3O8DA 4CRFA 3SV6A 1TBZH 2A32A 1UJ1A 3ATKA 2AMPA 1N8OC 2P8OB 3F68H 2F9PA 2IPHA 3S0NA 1C2DA 3T25A 1T8NA 2FOGA 1BTPA 2JH0D 1S83A 1N1LA 1K22H 1NU9A 2QF0A 3A89A 4Y0ZE 1GL1A 4ISIH 5ESTE 2QN5T 3UOPA 3OYPA 5EXMA 3UUZA 4AC9A 1ZHMA 2GZ8A 2WPJS 4JZEH 1GMCG 3CENA 2G5VA 1O5FH 1RD3B 3ZZ9A 2XYAA 1EPTB 1GVLA 1AFQC 1GJ7B 1GBCA 1UTLM 1K9OE 4ZKNU 1H4WA 4ZXXH 1Z1IA 2H9TH 4IW4E 2O8TA 3BTGE 2BDBA 2ZCHP 2C4FH 4ABEA 4KTSA 1SGRE 1OPHB 4ZKSU 1C5VA 2WHXA 1A2CH 1QCPA 2A5KA 4DURA 2QXGA 3QZQA 3SNBA 3QGNB 4KTUA 2V3OH 4X2XA 1O37A 4NWKA 2AEIH 2PHBA 1ZJKA 3LH1A 3FAOA 3T27A 1Y59T 1LQDB 2IJD1 5JYIA 4IBLH 1A5GH 3ZYEA 1A0LA 1D4PB 3KYFA 4JK5A 2ZDLA 4LXBH 1UTMA 1XUGA 3BG8A 1HRTH 1KXEA 2OC0A 2OP9A 1TNLA 2VWNA 2PGQB 2UWPA 1HJ8A 3WWBA 2ZGBH 2PR3A 2OBQA 5ABWA 1PPHE 2YMSD 1O30A 1ESBA 2W7SA 2EC9H 3GCHC 4Q7YA 2BOHB 1LHFH 3FOAA 1SKYE 4WH6A 3SHCH 5CHAB 2H5DA 3LGYA 2BD5A 1PYTC 2XTTB 3ODDA 3V0XA 5A0CA 1F0SA 1J8AA 2QAAA 2ZKSA 5EG4A 3M7TA 2H5CA 2FEQH 4Q7XA 1XMNB 2UUFB 2Y7XA 1TGBA 1LVMA 1FDPA 1ANDA 3V13A 1EB1H 3BF6H 4I32A 3I29A 1GDUA 1GGDC 1ELTA 1FONA 1DICA 1UTOA 2ZFTA 3NUMA 5EJ1A 3U8OH 1OP0A 2PGBB 1LVOA 3PMJA 1UVOA 1DLKB 1TNIA 2J2UA 2OXSA 2R2MB 1TRMA 4JMYA 4A1XA 1M9UA 1MTUA 3RXAA 1MTWA 2G52A 1SR5C 1C2HA 2ZPQA 2KCPA 1E34B 3ITIA 5LH8A 1T7CA 4JCNA 2GDDA 1C1QA 3SW2B 2ZTXA 3FKSD 1Z1JA 1CHGA 4X1SU 5A8XA 4CR5A 1AD8H 1GMCF 3PYHA 1UW7A 4YO9A 2FX6A 1GBEA 4NFEA 4NA7A 3SQEE 2ZI2H 1TQ0B 2Y5HA 1ABIH 2PTNA 1LPZB 1HXFH 3A8BA 2BLVA 7GCHG 2ZEBA 1P2MA 2GJGA 4AFUA 4X6MA 1G36A 4Y0YE 1W8BH 4NCYA 3LGWA 2FX4A 1FY3A 3S7KB 4BXSA 1GHAG 3SORA 2IOTA 1HAVA 3TJNA 3M61U 2UWLA 3SV8A 5AF9H 1O2HA 2Z3DA 1NS3A 1BTYA 3EE0B 4LK4A 3PWBA 2QA9E 2ZPRA 2EI7A 2XW9A 1SHYA 1UK4A 1TMBH 3RXPA 4DG4A 1CT2E 4Y8XA 5E0GA 2WPHS 4D7GA 2VIOA 1BHXB 1AO5A 2A7CA 2OC1A 2JIZD 6LPRA 4MDSA 2C8ZB 2ODYB 3A88A 1ZSLA 1FUJA 1FQ3A 1AHTH 1P2IA 5F8XA 2PKSB 2ZU2A 3GDVA 1ZRBA 5E2OA 1IQFA 3A7ZA 3DCLA 3BV9B 1YBWA 3BIUH 3MHWU 1KLJH 3FP8E 5CHBA 2KCYA 3AVZA 2GX4A 3LGTA 3F9HA 1GI1A 2EA3A 3DSOA 1NBMD 3ZVCA 4UFGH 4E7RG 5BRRE 4FUIA 1SGQE 2FMJA 3PV2A 1ELCA 1E35B 2BLOA 4BANB 3DD2H 3PLKA 1DWCH 2O9QA 4X1NU 4YESB 3V3MA 2BDYA 1V2TT 1GBTA 4JYUH 2ESTE 2UUKB 1ELFA 2GD4B 2JETB 5JBBS 1NZQH 3FO8D 2L74A 3TVJB 1J17T 4ABBA 2AIQA 3UPEA 3L3TA 4AYVB 5T3HA 1W10U 1YY3A 2V6NA 3U1JB 2YNAA 1V3XA 3ZIAD 2CN0H 2FDAA 1E1RD 1UO6A 2BD2A 2FYRA 4B74A 3PTBA 2BOKA 5KEDA 4X6OA 4DVAU 1KXAA 2NU4E 3RC5A 2GT7A 1BQYA 3DUXH 2XCNA 1EQ9A 3VFEA 1EX3A 1K1IA 2CV3A 1TRYA 5A0BA 5EPNA 2Q6DA 1NFXA 2A1DB 3BTFE 3IITA 4SGAE 1IQGA 1UCYH 2XBYA 1EJMA 5DP7A 2ZGXH 7GCHF 5JDUB 3E6PH 2HALA 4X6NA 2I6QA 4MPWA 3RDZA 2P3UB 3UIRA 1VITG 2FS8A 2VH0A 4NSVA 1GHAF 3SBKA 1FY5A 4H4FA 4K60A 4JZIA 2BVRH 2O8WA 2C93B 4Q80A 4TSFD 4X2WA 4AORA 3GDSA 1H9IE 4TWYA 1ELEE 1GI4A 3N7EA 1MU8B 3E90B 3AW1A 1C5UA 2XWBI 2BY8X 3OFND 1LMWB 1GCTB 1CO7E 1XVOA 2KR7A 4WWYA 5E0JA 1INCA 1G3CA 1OWEA 1C5TA 1BT7A 4Y8YA 4RI0A 4Y79A 1Y3WA 3VXFH 2Y81A 3H5CB 1TX6A 1CA0C 2B8OH 2Z9LA 2BLWA 3RU4T 4MG3A 1YLDA 3BTHE 3DFLA 1F5RA 4K69A 4R8TB 1HJAB 5GNDA 1KTTB 2ZGJA 3RP2A 4AGKA 5JBCS 3SI3H 1E1QD 1K1NA 1YP9A 2W26A 4M7GA 4NIVA 2HRVA 1SOTA 1P2JA 3LONA 5E2PA 4WF8A 2OCVB 2BDAA 5DG6A 1EAXA 1G3BA 5DP5A 1D3QB 1H9HE 1MZAA 2RG3A 2W6ID 2WINI 1TX7A 3PM3A 1RTLA 2DE8A 3ATLA 2BVSH 1OS8A 4YLUA 2I6SA 2V35A 4I8GA 6CHAC 1UVPA 1H8DH 2H6MA 1CE5A 1LHDH 5A8ZA 5GPIB 4F48B 2G00A 3BTME 2OQUA 5EW2H 1ETRH 1HCGA 4FOUC 5EODA 4YTAA 3BTDE 9LPRA 5HMAA 4U01A 1OWJA 4GVUA 3GY7A 3A84A 1C5NH 4BXWA 3TU7H 1C4Y2 4WMFA 4ACAA 1HLTH 1NM6A 2NU2E 4CRGA 1EFRD 4UFDH 1DM4B 1GI0A 2BZ6H 2XC5A 2VJ1A 4J1YA 3RXDA 2PSXA 2TRMA 4D7FA 1LHGH 2A4QA 1QGFA 1EOJA 1MKXK 2UUJB 3OX7U 3SN8A 4ZUHA 1KXCA 2Y6TA 1F0TA 4B6EA 1MQ6A 1W7XH 2YNBA 1A3BH 2A7HA 1TLDA 2ZTZA 1EZSC 3EE7A 1MH0A 2QC2A 4UFFH 2WV5A 1MU6B 2DE9A 2HVXA 4ASHA 1CU1A 1VITF 3T62A 1IOEA 3BEIB 1S6HA 2GZ7A 2SGFE 1KIGH 5A09A 4IN1A 2YMSB 1J16A 1O2LA 3GY5A 5E0HA 1CBWB 2HWLB 3M3TA 1SBWA 3RLWH 1W2KH 4FUBA 3LKWA 3V7TA 2KAIA 3QK1A 4X6PA 2O8MA 1V2KT 2Z9JA 3FP6E 1PFXC 4WMDA 3UQVA 7LPRA 1ELDE 3A83A 1FV9A 3KQBA 1MAYA 3SQHE 1QY6A 2PUQH 3SUDA 4WY3A 3LH3A 1JRTA 1ID5H 1BJVA 4CHAC 1MAXA 2GV7A 1DY9A 1A0JA 3HKJB 3RXEA 2BD7A 5DP3A 3U69H 5ETXA 1SSXA 1MTNC 5FCRA 2JH6D 1NBME 5EOKA 4MQAA 1BB0B 4I7YH 2C8WB 3OY5U 1UK2A 2XBWA 4OS2A 4UE7H 2RA3A 2PWXA 2A5AA 4ISHH 3SO3A 3GY4A 1BUIA 3KCGH 4ABIA 3FP7E 1IQIA 2WSSD 2LNCA 1BRBE 1GHYH 2BMGB 3RMMH 3RXFA 1TPOA 1ETTH 3KHVA 1FY4A 3F0OA 2Z9KA 2ASUB 3SZEA 3MTYA 3F9FA 3NPSA 1DWEH 3LOXA 2Y5GA 3DSPA 1EJAA 1V2LT 2KM0A 3GYMA 3OTJE 1P57B 4DIHH 3SHAH 1OKXA 2BQ7B 4TY7A 5DK1A 3BSQA 4XBCA 1TGNA 2F4LA 3MOCA 3W95A 2QIQA 1JXPA 6GCHG 1FPHH 1SLXB 3ATIA 2K1QA 1DITH 1RIWC 5EGMA 5DP4A 3HKIB 1GHWH 1HBTH 3LGUA 5C1XA 1BTWA 4K1TA 2ANMH 2STAE 3AASA 5F53A 2ANKH 3O8RA 4OGYA 1GHXH 1TALA 3QO6A 3SI4H 1ZYOA 2SNWA 1Z8RA 1GVKB 3ZVFA 4ABDA 3TNSA 1B5GH 4ACBA 1PQ7A 1YPHC 3BG4B 4AG1A 4CRDA 5L2ZH 2AH4X 1MCVA 4AFQA 3OU0A 4KKDA 1HAPH 2VH6A 1VJAU 1RJXB 1X7AC 1IHSH 2ALVA 3ZZ6A 1O3CA 2Z9IA 2Q1JA 4ZHLU 2ZDAH 1O5AB 1WBGB 4KELA 3SGQE 3A85A 4IMQA 2A4OA 3RMNH 4X1QU 1AFEH 5CMXH 3GY8A 1QRWA 1MABB 1TQ7B 4H6TA 5FPTA 3P8NA 1F0RA 1V2OT 2LELA 4TT3D 3FZZA 2J95A 1CGIE 1ZR0A 2A5IA 1A5IA 2EI8A 4TYDA 5DP9A 1HAOH 4CRCA 1W0KD 2L6OA 2BQWB 3UNRA 1YPGH 2A0QB 3RXIA 2CJIA 4AG2A 1UTPA 3MU4A 3MNSA 2VVUA 4ZH8A 1UHBB 1EUFA 1V2RT 2ZFSA 2VWMA 1EASA 4GHTA 1W13U 1FLEE 1YYY1 1QBVH 3GS9A 2ZNKH 2C90B 2Z9GA 1DXWA 3RC4A 1Z8JB 1IQJA 4FETA 2V3HH 1NT1A 3GICB 3KL6A 2A31A 5PTPA 1O2VA 2GCHG 4NGAH 5CDFE 5AFYH 3PO1B 3MMGA 3EA9A 1L1JA 4WVPE 4B1TA 5EQSA 1D3DB 1NESE 1W14U 2CF8H 2WYGA 1THPB 1GJ4H 2ZF0H 3HK3B 2TPIZ 1Z8GA 1BMAA 3MH6A 1SG8B 1GMDG 2G55A 4I8LA 1K28D 3PLBA 3OY6U 1GI7B 1TABE 2FXRA 3ZVEA 1P02A 1ZRKA 2WPIS 4I8HA 4FU7A 3LT3A 1O2GH 5HIZA 1VCPA 4CBNA 4MLFB 3KQCA 3URDA 3A8AA 1Y3UA 1TOCB 4FU9A 1GJCB 2VIDA 1ZGIA 1C1MA 3QDZB 1SGYE 3LPRA 2D8WA 3U8RH 3M3VA 1UMAH 3UTUH 1D6RA 4R0IA 1SC8U 5FBIA 2GKVE 4I31A 3M3SA 3RXRA 1HAVB 2AGEX 4ISLA 2CF9H 1O2JA 1W7GH 1P0SH 3GCTG 1Y5AT 5EXNA 1O3PB 1KXBA 3AAVA 4OS4A 3UNQA 5C0UA 1DWDH 1T8OA 1FPCH 5L30H 1ORFA 1HAYB 3F2GA 1AB9C 1WXRA 1NPMA 2ZFFH 2OK5A 2JKHA 3V12A 1G9IE 2XCFA 2XOKD 1YPKH 5J4SA 3WWFA 1V2MT 2BQ6B 4IGDA 1ZTKA 2AMQA 1AUJA 1CA0B 1PPFE 4MNVA 1EJNA 4CRAA 1KSNA 2TIOA 1XUHA 3A7VA 3PMHB 1GHBG 1T4UH 1NFUA 3S9CA 4NZLA 3SU1A 2ZZUH 5DP8A 2Z3EA 3QWCH 1AGJA 3SNEA 2W6JD 1DANH 3OE7D 1S0RA 3FN8A 4BAHB 1EP6A 1HAHH 3ZV8A 3ZZAA 1C1VH 1XXFA 1IQHA 2GGVB 2NU0E 3CP7A 2CHAC 1T8LA 3DSGA 4AOQA 1UHBA 2CMYA 3MU5A 3QX5H 1DVAH 2ZFQH 1XM1A 1QTFA 2CK3D 1EOLA 1E36B 1DWBH 1LO6A 1A5HA 3MU1A 2W3KA 5C67A 3VPKA 1HGTH 4RT1A 2JDID 1NC6A 2GCHF 2KCAA 2GCTC 1GVZA 3GOVB 1ESTA 5FX5A 4K1EA 1CHOG 1C9TA 1PPEE 4Y71A 1GBIA 1O2MA 1PYTD 1PQ5A 2JJ1D 1QURH 1O5EH 1UCYK 4XD7D 2ZHWH 1GMDF 2SGEE 3U1IB 1JWTA 1V2NT 2H2ZA 3F2FA 4UFEH 3TK6A 4AN7A 4UONA 1GG6B 2GMTC 3RXJA 4NG9H 1KMHB 2HNTE 2FTLE 3TITA 1LKAA 1Z8IB 5TCAA 3SJKA 4ESTE 1AIXH 3STJA 4INHA 1BMMH 5L6NH 1UVSH 3Q76A 2IN2A 1QRXA 3B9FH 3AK5A 5FL7D 1EKBB 1BTUA 1O0DH 2GT8A 2ZG0H 1P3EA 1OWHA 1CGHA 1SGCA 2OLGA 3E91A 1TRNA 1GHVH 1C1OA 4FUJA 1UVTH 1C5OH 3RUOA 2ZU4A 5K0HA 1S84A 3GCNA 1HAZB 3OTPA 4VGCC 5AVDA 3GCTF 3HGPA 1G32B 1Y3VA 1ZTJA 5GJ4B 2PW8H 3DHKH 3D62A 1QA7A 3ZZ8A 4CH2B 4O3UA 4TPYA 1DXPA 4X8UH 3RXSA 1D6WA 1OSSA 1QIXB 5CE1A 3N99A 5FCKA 2WUCA 4ASUD 2B5TB 2BVXH 2QXIA 2FI4E 5FPSA 3H7OA 1SGPE 2NWNA 3QZRA 1GHBF 3L6PA 4CHAB 2BD9A 3IWMA 3UFAA 1QHRB 2J9NA 2B7DH 1XKAC 3F9GA 1L1NA 2OC8A 1UK3A 2WV4A 2RA0A 1C5QA 1AE8H 4ABHA 2FODA 1F7ZA 3RXQA 2J34A 1K1LA 4XE4A 3MNXA 5JBAS 1C5PA 2HVYB 1DUAA 8GCHG 1AVWA 1F5LA 4A1VA 1GBBA 2A4RA 1QJ7B 5EJZA 1YLNA 2FESH 1A7SA 1P01A 5GXPA 1FAXA 1HNEE 1ZSKA 2V3MA 3TH2H 1WUNH 1V2ST 1ANEA 2J94A 1Z7KA 2LPRA 1DT2A 1O3AA 1KLIH 3SV9A 3QTVH 2PLXA 1P8VC 2ZDVH 3GDUA 1W0YH 2TBSA 1QQUA 3SJIA 3UNSA 1CT4E 1AY6H 1THRH 2FLBH 2FOAA 2CXVA 3Q00A 3SJOA 1O2ZA 1SB1H 1RIWB 2R3YA 2YOLA 1ZZZA 5A2MH 4BNRA 5BPEA 4D9QA 3TJOA 1P9UA 1P2NA 2A2QH 2C8YB 3BTQE 2B9LA 2HOBA 2M5TA 1TAWA 5FPYA 3SJ8A 1NU7B 1V6DA 1UTJA 2FI3E 2XNDD 4YM9A 2PP6A 1DUEA 1LPKB 1QB1A 1HPGA 3RC6A 3SUEA 1TPPA 1O3NA 4ZHAA 1TPAE 3A81A 2IPQX 3FFGA 4GUXA 1RXPA 1MBQA 1LQEA 1O3MA 2F91A 4I33A 3UWJH 2ILNA 2W5EA 4OGXA 5FXLA 2AGIX 5T1VA 3TK9A 3S7HB 1KLTA 1GMHG 1TYNA 2HPQH 2ZU3A 1MTSA 1UTNA 4CR9A 1JMOH 2BY6X 3VGCC 2RDLA 1S6FA 4ZKRU 4MPXA 2ZU1A 1NRQH 5GDSH 2ODPA 5A8YA 3ZVDA 2KAIB 4DT7B 1TB6H 2F9UA 1Y8TA 1S82A 3OSYA 4LZ1H 1EPTC 2XWAA 4IN2A 1ELAA 1L4ZA 5B6OA 2ZHQH 4KTCA 3KQ5A 3SNAA 1SLWB 1IAUA 3FVFB 1G30B 1A3EH 1KDQB 2ZU5A 5C1YA 2ZCKP 3IG6B 1E79D 2BDHA 3M35A 2A4GA 1QB6A 5IYTA 1TNJA 1GJBB 1HUTH 3RXKA 4HI3A 5FX6A 4RSPA 1O2XA 1VCQA 1MTVA 5EJLA 1O5BB 2XBVA 1Y3YA 1XX9A 4ZAEA 2ZECA 4WMEA 4F55A 1C2LA 3ZZ7A 3K9XB 3WY8A 1N6YA 3SU4A 1SQOA 2F9OA 2ZC9H 1HFDA 2J98A 5T6GA 1O32A 4B6FA 1G2LA 2C8XB 3BIVH 2EEKA 1FNIA 3C27B 3KN2A 3GY3A 3S9BA 3TGJE 3C1KA 1FY1A 1N8OB 5LPFA 5GIBA 1DOJA 1QA0A 1EB2A 1SGFG 1FY8E 1YPLH 3OEHD 5F8TA 1RGQA 1MMJN 4XSKU 4A5TS 2RDEA 1KTSB 2F9VA 4BTTB 2V7QD 1C1NA 2AERH 5DKMA 3FANA 3MWIU 4FUCA 5EXLA 2SGDE 1C5YB 5CHAC 4NIYA 2P16A 4B2BA 1AFQB 2OINA 4ISOA 3SNCA 3RXHA 3NXPA 4B2AA 2AIPA 1WDIA 1TONA 1U6QA 1XUIA 4TWWA 1AU8A 4UEHH 4DT4A 1VR1H 1A46H 4XOJA 1O34A 3MFJA 1NROH 4JZFH 1OYQA 1KYNA 4Y7AA 1TA2A 1HXEH 4YT7H 3SYJA 1C2KA 5EW1H 1GBAA 1BRAA 3SGAE 3P95A 2P93A 1L2EA 1P04A 4K3JA 1C1RA 2WV9A 3U28C 2WYJA 3HPTB 3SU2A 2ZCLP 4A6LA 2Y7ZA 1ZLRA 2P59A 4RKJB 3PB1E 2PKAA 3K65B 1GBLA 1YC0A 1OOKB 1RTFB 1EATA 5KECA 3MH5A 1BDAA 1IQNA 4Z6AH 3SU5A 4FVBA 4ZXYH 4BAMB 3F2HA 1G3EA 1LPGB 3EDXB 1L1GA 3A8DA 2P94A 2BDIA 2ZP0H 5HKKD 2STBE 4INKA 1ARCA 3RXLA 1HAIH 1ZGVA 1S5SA 5C17A 1B0EA 3GCHB 3TIUA 1LVYA 4E7NA 1YWUA 3ZZCA 3TGIE 1ZOMA 3RXGA 1O5GH 2FP7B 2LP6A 4Q2KA 4ZHMU 3NKKA 8LPRA 1KDQA 1EZQA 1MZDA 4Q7ZA 3A80A 4IMZA 3MO9A 1MCTA 2NU1E 2VIWA 2BYAX 4FUEA 1P2QA 1SGDE 1SI5H 2GCTB 3RM0H 3E3TA 1P9SA 3D23A 1GGDB 4FUFA 1T32A 4LZ4B 2Z94A 1O3EA 1EZUC 3CNRA 1UTKA 1MD8A 3E0NB 3RXUA 4Q4LA 3D65E 5JBTA 3UY9A 1TA6A 3NK8A 1O3GA 1AUTC 4Z1MD 2XC4A 1TMTH 3NRLA 4O3TA 1W0ZU 3UWIA 1FMGA 1QL9A 1CVWH 4Z0KA 2ULLA 4JZ1A 1ZMNA 3EGKH 3BTWE 1O36A 2PTCE 3RU4D 4INLA 5DO4H 1EAWA 1UVUH 1BMNH 1NN6A 1W0JD 1V2UT 3M5MA 4X8SH 1C2IA 1CA8B 8ESTE 5TCCA 3UR6A 2G4TA 2BB4A 1Z6JH 3P8FA 3DA9B 4AFSA 1ELGA 3GYLB 4I86A 4Y7BA 4HTCH 1LCYA 1QFKH 2UUYA 3RM2H 4A7IB 2TGAA 1C5ZB 2OBOA 2FOBA 1O3JA 2G4UA 4VGCB 1DX5M 1S0QA 4WXVA 4FUHA 3TJVA 3ATWA 3ZVBA 4F4OC 1K1OA 4NFFA 4Y76A 3RMLH 2TGTA 2KCOA 1QR3E 2OUAA 3T26A 5IK2D 1SVPA 5F03A 1NRSH 1RS0A 2A2XH 2FWWA 1TPSA 1VJ9U 3KF2A 2Q6GA 1QZ8A 3M7QA 3PMBB 2KX4A 2NU3E 1T8MA 2J4IA 1WCZA 4LOYH 2PV9B 1GI2A 3N7DA 1S85A 1C4V2 1YF4A 2FO9A 1DSTA 3DFJA 4KP0A 5EQRA 2V0BA 3VG8A 2QGRA 3TGKE 1OYTH 5G4BA 3TNTA 1O3KA 4Q63A 3SUFA 2Z3CA 2G5NA 3M5OA 1BBRE 1PQ8A 1SOZA 2ZA5A 2QF3A 4X2VA 2K8IA 2ZDKA 2HGTH 2VINA 2BD4A 4BOHA 4NA8A 5I25A 1YPEH 3UOUA 2OC7A 3S69A 1O2WA 2QE7D 1K2I1 7KMEH 3I77A 1GCTC 2M2AA 3RXMA 5A0AE 4OM9A 1TIOA 2O8UA 5ESBA 1HJ9A 3PWCA 2GV6A 3RXVA 3K6ZA 2TGPZ 4XBBA 2SFAA 1AI8H 1BJUA 1OWDA 1SFIA 3ZVGA 2QV1A 5EIYA 2D1JA 2P95A 2VVCA 4M9FA 4AB9A 3ZZ5A 4XDEA 3BEUA 2AGGX 4D8NA 1YCPH 1TOMH 4ZKOU 1CGJE 1GI8B 1LKBA 3KYGA 2QXJA 3URCA 2RFKC 1FN8A 1ZSJA 2VNTA 2P3FH 1Q3XA 2GVFA 4OS5A 3UB0A 5IDKA 3T28A 5GCHG 6GCHF 1D3PB 3ENSB 3MNBA 4Y10E 1GJ5H 3PV4A 2G8TA 2EI6A 3T29A 1O2NA 4DCDA 3M7UA 4KGAA 3G01A 4AX9H 4UD9H 1G3DA 3CS7A 1HYLA 3SU3A 1B7XB 2AS9A 1BMLA 1C1SA 2KFWA 4IC6A 4X2YA 3WW7A 1EAIA 2AFQB 3MH7A 1O3HA 3P8OA 3LIWA 4D9RA 3VGCB 1FAKH 1XVMA 1TGCA 4JK6A 4K1SA 1AQ7A 2WPDD 3PRDA 2ANYA 1P09A 2QY0B 2Y82A 1SFQB 4FVDA 4AFZA 4AB8A 3U9AH 2GTBA 3RXBA 1AWHB 1C2GA 4FXGH 4CH8B 3P8GA 2C3SA 1AKSA 1C5RA 2PUXB 3BTEE 3A87A 5DGJA 1QJ1B 4B76A 2WZQA 1D9IA 1DE7H 1BCUH 2FI5E 1C9PA 1PPZA 1GWAA 2BX3A 2HPPH 2VIQA 1QNJA 1SGEE 1TWXB 2J97A 1GBMA 1TBRH 3BEFB 1JRSA 4P00A 1O2YA 5C3NA 1SHHB 1YLCA 4FUGA 3Q3YA 5DP6A 2CGAA 5L2YH 1L4DA 2QF4A 2BM2A 2VIPA 1WOFA 2ANWA 2D26C 1FIZA 9ESTA 1F5KU 3MU8A 1GJDB 1J14A 1O3LA 1VCWA 2ZFPH 4RT0A 1NFWA 1AZ8A 1OX1A 4DJZB 5J4QA 2G81E 4IS5A 4OS7A 1MKWH 2YMSC 3SGBE 1D3TB 2G51A 3LGIA 4DIIH 3FZDA 1HB0B 5HM9A 1CBWC 5C0TA 1FI8A 1SQRA 4BAQB 1K1MA 4X1RU 2ZIQH 1MD7A 4HZHA 3UQOA 1Y3XA 1IQLA 1HDTH 5FHTA 2WPKS 5GWZA 1BBRK 1QQ4A 2DUCA 1F2SE 2R3UA 3ZZDA 1OP2A 2ALPA 3ZV9A 6CHAB 5HYOA 2ZWLH 1ARBA 3W1EA 1VGCC 4PROA 2FLRH 1EP5A 1AE5A 1GDQA 1RFNA 1C1UH 1TNGA 3SOSA 1YPMH 1ZHRA 2QXHA 3T5FH 3LC5A 1C5MD 4K5ZA 2BLQA 5DJ7A 3S9AA 4GLYA 3TH3H 1JBUH 4BAKB 1DDJA 3VEQB 3HGNA 1ZPCA 2RCEA 1P05A 3RU4E 5GCHF 3RLYH 4MPUA 2H9EH 3E16B 3M36A 3OAAD 1GI6A 1EZXC 4O9VA 2R0LA 1E37B 1SPJA 1WQSA 2R9PA 2WPMS 1C2JA 1ANBA 3TLOA 4YXWD 1ZJDA 3NCLA 3Q77A 1TMUH 2H1UA 4E06H 3MI4A 4MNWA 1XKBC 1P2OA 2FS9A 3KQEA 5FAHA 4O97A 3EA7A 5LGOA 1DY8A 1O38A 1YKTA 2A7JA 3EQ0H 5DSFA 1O2SA 5I46H 4B73A 1O2IA 1A1RA 1ZPZA 5F8ZA 2A45B 2XNIA 1O3FA 1YPHE 2BY9X 2HLCA 1SGNE 1BOQA 1P12E 1S6LA 5C5NA 1O3DA 3SV7A 3SJ9A 4Y6DA 3TK5A 1C1PA 1BIOA 5EQQA 2K0QA 3ZZBA 3PV5A 1JOUB 2TGDA 1TGTA 3A7YA 4U32A 2VGCC 3AAUA 4FUDA 4ABGA 3BG4C 1EPTA 2BD8A 4Y11E 5C1UA 1BRUP 1L0ZA 3TH4H 1O2TA 1LHCH 1C1TA 4P02A 3M37A 2SGQE 2XC0A 1NFYA 2BX4A 3P92A 3STIA 4B71A 3F3BA 1LTOA 4GHQA 1V2QT 2ZQ2A 3B23B 3KEEA 4MVNA 1MTNB 1V2PT 1Y5UT 2QYIA 1C4U2 2SGAA 2FTMA 1W12U 1UTQA 2PFEA 2J98B 4JYTA 5C94A 4K8BA 1BITA 2P3TB 4QT8C 1CQQA 3LU9B 3TPIZ 1PPBH 1W3CA 3KNXA 1Z6EA 1GI5A 4NSYA 1Q2WA 3A7XA 2XBXA 3HK6B 5TJXA 5JPMH 1ABJH 2FPZA 3RXOA 1CHOF 3MQKC 1HAGE 4J2YB 1H8HD 2KZ4A 4WH8A 3M5NA 1QL8A 2BZAA 2OTVA 1ZTLA 1AWFH 1P11E 1HV7A 4CRBA 3SNDA 5SGAE 1C1WH 2GP9B 1ELBA 3D49H 3KIDU 2JJ2D 3R3GB 3KQDA 3A7TA 1YCPM 1FJSA 1DLEA 1KY9A 4X0WU 2FM2A 1SLUB 3B8JA 1JIRA 1NO9H 3PO1C 7ESTE 1CSOE 1J9CH 2W7UA 1C2FA 1AMHA 1BBRH 2ZDMA 1O35A 3UAIC 1BTXA 3K2UA 4DW2U 2BDGA 3E0PB 2AMDA 2VIVA 4X1PU 3E8LA 1K21H 1QRZA 1WTHD 5LPRA 3H09A 1WTGH 1K1PA 1PJPA 2EY4C 2P8OC 2BDCA 4O03A 4A92A 4DOQA 2PKAB 3R0FA 2R0KA 1OP8A 1TE0A 5DN6D 2VWOA 4E05H 1NTPA 4H6SB 3EAJA 3ATMA 3GISB 3A86A 5JB8S 4WJG2 1QL7A 2WPLS 1YGCH 2Q6FA 1DS2E 1GJAB 1SGFA 2VU8E 4RN6A 1O33A 1HAXB 3P70B 1E38B 5DPAA 4ZCNA 1C5XB 1VITH 3A7WA 3L33A 5E8EH 4MNYA 5HIYA 3UR9A 2BXTH 3VB6A 4GAWA 3A82A 1SGIB 1O2QA 3Q3XA 2SNVA 4DGJA 1WYKA 1SLVB 2GDEH 2QF5A 1C5WB 5B6LA 1GPZA 1KXDA 1HIAB 3P6ZB 3LJOA 1KXFA 1K1JA 2VB0A 3MH4A 8GCHF 1YPJH 3SV2H 1GBKA 3AW0A 1THSH 1ELVA 3U8TH 1IHTH 2BTCE 1ACBE 1NRNH 5H4IB 1G37A 1F92A 5EPYA 1NRRH 3O8CA 3F1SB 4ZMAH 1P3CA 1RTKA 1BZXE 2F9NA 1O2KA 4YLQH 3LJJA 3RXTA 1GDNA 4HFPB 3NZIA 1AVXA 2Z7FE 3NWUA 2ZGCA 4IC5A 2J5UA 4F49A 1PQAA 3EYDA 3VB5A 3SUGA 1MBMA 2F9BH 4Y8ZA 1V2JT 2ZPSA 1TBQH 5HXFA 4XRNA 1O2PA 3PMAB 3TJUA 4MPVA 1CT0E 1Y5BT 2FOCA 2AHME 4NWLA 1OHHD 1OWKA 1T31A 5C5OA 4TY6A 3GCOA 4H42U 1YM0A 5C2ZA 2JH5D 2THFB 1PPGE 3Q3KA 3VB7A 1ETSH 1GBDA 2EQNA 2OD3B 1GBJA 4AZ2B 3LGVA 1A0HB 4NIWA 1TNHA 1LVBA 1FIWA 1GBHA 3F9EA 3K6YA 1ZMLA 4I8KA 1C5LH 2Y5FA 1QBNA 1WV7H 1GMHF 1GG6C 4AGJA 1AVGH 1DFPA 1AB9B 1F0UA 1O2OA 1QBOA 2J38A 3I78A 3RXCA 1S81A 3PROA 6ESTA 4K2YA 1O5CB 1XUJA 2BY7X 1BTZA 4YZUA 3CS0A 1O3OA 3H7TA 1GHZA 1OWIA 1P2KA 3F6UH 1IQEA 2BHGA 2IJOB 3ELAH 4YOJA 1QB9A 1V2VT 1H8ED 3BTKE 1XUKA 2ODQA 4WXIA 4BTUB 1WAYB 1PPCE 4UDWH 4YOIA 2FZZA 1BMFD 1C2MA 2BXUH 3W94A 1B0FA 1SMFE 4U2WA 1P10A 2Z6BD 2CHAB 2VBCA 3PRBA 1AN1E 1DPOA 1SQAA 1YCPK 1N6XA 2R2WU 2ZHDA 1T4VH 3LDXH 1MQ5A 1O31A 3LC3A 1FZZA 2ZHEH 1ZMJA 4XBDA 3JZ2B 2VWLA 1E0FD 4X8TH 3HATH 1GI9B 2FOFA 3ZZ3A 3VB3A 4CREA 1DSUA 3ZYDA 2B0FA 3M5LA 5JB9S 1HIAA 1VGCB 1NRPH 3BTTE 1O2UA 4BAOB 1TFXA 3UREA 3MO6A 2ZGHA 3MNCA 4YOGA 5HM2A 1O3IA 4GCHG 1WSSH 2PKSC 2H9HA 4A1TA 1GJ6A 5KGOA 1SL3A 2ZFRH 8KME2 1O5DH 3KGPA 2GMTB 1VZQH 4MNXA 1FX0B 1ZPBA 2O8LA 2BY5X 3BN9A 1AZZA 1GJ8B 4JZDH 2FOEA 1XUFA 1IQKA 3T2NA 4NZQA 3O8BA 5F6MA 3OEED 2UWOA 5AFZH 4OS1A 4GPGA 2F3CE 3F0PA 1NY22 5FBEA 5EU8A 3RMOH 1LDTT 1GBFA 4NA9H 1BA8B 3E1XB 1TGSZ 2HNTC 4RKOB 3PTNA 4AYYB 3DT0H 2FIRH 2JETC 4HGCA 1GCDA 3VB4A 3P17H 4SGBE 1P03A 1SQTA 1WQVH 1H9LB 4ABAA 1AKSB 1G2MA 3QUMP 4GSOA 2BD3A 4ABFA 3SU6A 3MU0A 4B75A 1BHXF 1JIMA 1H1BA 2WUBA 5K7RA 2HLDD 4U30A 2VGCB 1MKWK 4ISNA 2FOMB 3ODFA 5T6DA 2FYQA 2SGPE 4OS6A 2ZHFH 4D76A 1RRKA 1O3BA 1H8IH 1OXGA
chains in the Genus database with same CATH topology
1EFRD 4XD7D 2K1QA 3KN2A 2M2AA 3SU0A 2YMSC 3U1IB 3F2FA 4OM9A 5F53A 4K8BA 5ESBA 2VBCA 4Q4LA 5C0TA 2QF5A 3PRBA 5EPNA 3O8RA 2YOLA 3OEHD 5B6LA 2A4QA 2F43B 1RGQA 1W3CA 2WHXA 3KNXA 2F9VA 2QV1A 2V7QD 4Z1MD 1KMHB 4M9FA 5FPYA 3NRLA 4NWKA 4B6EA 2XNDD 3W1EA 5H4IB 3SV8A 5EPYA 2IJD1 3O8CA 3RC6A 1NS3A 3AK5A 3M5LA 3SUEA 1H8HD 5FL7D 2KZ4A 2GVFA 2OINA 4I31A 1CU1A 4TSFD 3M5NA 1W0JD 4WH8A 3UB0A 5IDKA 3M5MA 4I33A 3N7EA 3E90B 2OC0A 3OFND 4DT4A 2YMSB 4A1TA 2KR7A 5C0UA 2OC1A 3OTPA 3WWBA 2JIZD 5T1VA 2J5UA 3EYDA 3SUGA 2JJ2D 1MABB 1BT7A 2OBQA 2OBOA 3OAAD 5FPTA 3LKWA 4RI0A 3SYJA 2YMSD 3P8NA 3F2GA 2LELA 1FX0B 4TT3D 3DCLA 2FM2A 5GJ4B 2OK5A 3SU3A 1WXRA 4TYDA 2KFWA 4YXWD 3WW7A 2O8MA 2WV9A 5CHBA 2XCFA 2XOKD 1W0KD 1SKYE 2KCYA 2L6OA 3FOAA 3O8BA 4WH6A 3WWFA 1COWD 2AHME 3OEED 4NWLA 3SU2A 1DXPA 1OHHD 2KCOA 3P8OA 4R8TB 1DY8A 2F9UA 3DSOA 3F0PA 3N99A 5GNDA 3SUDA 1NBMD 4ASUD 5IK2D 2P59A 5DSFA 5FPSA 3SU1A 2WPDD 1E1QD 3PRDA 3H09A 3O8DA 4B73A 4KTCA 1DY9A 3KF2A 1A1RA 3PV2A 2W6JD 3L6PA 3LONA 3OE7D 4WF8A 4I32A 5ETXA 3SV6A 2XNIA 4A92A 3FN8A 1NBME 3GS9A 3SU5A 1DXWA 3N7DA 5DN6D 2GGVB 2OC8A 1S6LA 3RC4A 3F2HA 4B76A 2WZQA 1E79D 5EQRA 4FETA 3SV7A 3VG8A 2A4GA 2W6ID 3FO8D 5HKKD 1N1LA 5EQQA 2K0QA 1RTLA 3PV5A 2WSSD 4JMYA 4A1XA 5C17A 5CDFE 3SU6A 2CK3D 4A1VA 3F0OA 4B75A 2A4RA 3OYPA 3SZEA 4Q63A 3SUFA 5EQSA 2JDID 5GPIB 3LOXA 2FP7B 2KCAA 2HLDD 2QF4A 2KCPA 3M5OA 3U1JB 4ZCNA 3DSPA 2KM0A 4F55A 2IJOB 2FOMB 3ZIAD 3FKSD 1E1RD 1H8ED 2K8IA 4B74A 4U01A 3SU4A 4B71A 3F3BA 2F4LA 3RC5A 4B6FA 1BMFD 2OC7A 3SV9A 2JJ1D 2QE7D 1JXPA 3KEEA 2XCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFR D;  1SKY E;  1W0K D;  2W6I D;  4XD7 D;  1H8H D;  5FL7 D;  5HKK D;  1COW D;  3OEE D;  1OHH D;  4TSF D;  2WSS D;  1W0J D;  5CDF E;  2CK3 D;  4Q4L A;  3N99 A;  5IK2 D;  4ASU D;  1NBM D;  3OEH D;  2F43 B;  3OFN D;  2WPD D;  1E1Q D;  2JDI D;  2HLD D;  2JIZ D;  2W6J D;  2V7Q D;  3OE7 D;  1KMH B;  4Z1M D;  2JJ2 D;  1MAB B;  3ZIA D;  3FKS D;  1E1R D;  1H8E D;  1NBM E;  3OAA D;  1FX0 B;  2XND D;  3DCL A;  4TT3 D;  5DN6 D;  1BMF D;  2JJ1 D;  2QE7 D;  4YXW D;  1E79 D;  2XOK D; 
#chains in the Genus database with same CATH topology
 2GZ9 A;  5C20 A;  1TNK A;  3SU0 A;  1O2R A;  2W3I A;  4NIX A;  1BTH H;  2QCY A;  2FOH A;  4THN H;  1V2W T;  3QTO H;  3ZVA A;  1TX8 A;  2F43 B;  2VVV A;  1SGT A;  2ZO3 H;  2D2D A;  2OQ5 A;  1GJ9 B;  1IQM A;  3GY6 A;  3QLP H;  4FU8 A;  2J92 A;  4ABJ A;  5AHG H;  1XXD A;  1W11 U;  3U98 H;  1GL0 E;  2ZQ1 A;  2HNT F;  1ZHP A;  1MKX H;  4BTI B;  5T6F A;  1BRC E;  4K8Y A;  2AYW A;  4B2C A;  3QN7 A;  1A4W H;  1EXF A;  4HG6 A;  3SZN A;  3EST A;  2XRC A;  3N7O A;  5LPE A;  3MO3 A;  3VXE H;  1K0H A;  4XFQ A;  2Y80 A;  2ZDN A;  4JYV H;  1O39 A;  1WU1 A;  1C2E A;  4TPI Z;  4CBO A;  3A8C A;  4ZRO A;  1C5S A;  3EA8 A;  4GCH F;  3ZZ4 A;  4X8V H;  2XXL A;  1FN6 A;  2F83 A;  2PSY A;  1Z71 A;  5HGG A;  1UCY E;  4MTB A;  1HJA C;  1J15 A;  1Q31 A;  1QJ6 B;  1ANC A;  1COW D;  3QGJ A;  1FXY A;  1EAU A;  1A61 H;  1MUE B;  2ZTY A;  3JZ1 B;  4I8J A;  1P06 A;  1ESA A;  1GI3 A;  3PLP A;  3GY2 A;  1LHE H;  4DY7 B;  4YT6 H;  1VKY A;  3MYW A;  3O8D A;  4CRF A;  3SV6 A;  1TBZ H;  2A32 A;  1UJ1 A;  3ATK A;  2AMP A;  1N8O C;  2P8O B;  3F68 H;  2F9P A;  2IPH A;  3S0N A;  1C2D A;  3T25 A;  1T8N A;  2FOG A;  1BTP A;  2JH0 D;  1S83 A;  1N1L A;  1K22 H;  1NU9 A;  2QF0 A;  3A89 A;  4Y0Z E;  1GL1 A;  4ISI H;  5EST E;  2QN5 T;  3UOP A;  3OYP A;  5EXM A;  3UUZ A;  4AC9 A;  1ZHM A;  2GZ8 A;  2WPJ S;  4JZE H;  1GMC G;  3CEN A;  2G5V A;  1O5F H;  1RD3 B;  3ZZ9 A;  2XYA A;  1EPT B;  1GVL A;  1AFQ C;  1GJ7 B;  1GBC A;  1UTL M;  1K9O E;  4ZKN U;  1H4W A;  4ZXX H;  1Z1I A;  2H9T H;  4IW4 E;  2O8T A;  3BTG E;  2BDB A;  2ZCH P;  2C4F H;  4ABE A;  4KTS A;  1SGR E;  1OPH B;  4ZKS U;  1C5V A;  2WHX A;  1A2C H;  1QCP A;  2A5K A;  4DUR A;  2QXG A;  3QZQ A;  3SNB A;  3QGN B;  4KTU A;  2V3O H;  4X2X A;  1O37 A;  4NWK A;  2AEI H;  2PHB A;  1ZJK A;  3LH1 A;  3FAO A;  3T27 A;  1Y59 T;  1LQD B;  2IJD 1;  5JYI A;  4IBL H;  1A5G H;  3ZYE A;  1A0L A;  1D4P B;  3KYF A;  4JK5 A;  2ZDL A;  4LXB H;  1UTM A;  1XUG A;  3BG8 A;  1HRT H;  1KXE A;  2OC0 A;  2OP9 A;  1TNL A;  2VWN A;  2PGQ B;  2UWP A;  1HJ8 A;  3WWB A;  2ZGB H;  2PR3 A;  2OBQ A;  5ABW A;  1PPH E;  2YMS D;  1O30 A;  1ESB A;  2W7S A;  2EC9 H;  3GCH C;  4Q7Y A;  2BOH B;  1LHF H;  3FOA A;  1SKY E;  4WH6 A;  3SHC H;  5CHA B;  2H5D A;  3LGY A;  2BD5 A;  1PYT C;  2XTT B;  3ODD A;  3V0X A;  5A0C A;  1F0S A;  1J8A A;  2QAA A;  2ZKS A;  5EG4 A;  3M7T A;  2H5C A;  2FEQ H;  4Q7X A;  1XMN B;  2UUF B;  2Y7X A;  1TGB A;  1LVM A;  1FDP A;  1AND A;  3V13 A;  1EB1 H;  3BF6 H;  4I32 A;  3I29 A;  1GDU A;  1GGD C;  1ELT A;  1FON A;  1DIC A;  1UTO A;  2ZFT A;  3NUM A;  5EJ1 A;  3U8O H;  1OP0 A;  2PGB B;  1LVO A;  3PMJ A;  1UVO A;  1DLK B;  1TNI A;  2J2U A;  2OXS A;  2R2M B;  1TRM A;  4JMY A;  4A1X A;  1M9U A;  1MTU A;  3RXA A;  1MTW A;  2G52 A;  1SR5 C;  1C2H A;  2ZPQ A;  2KCP A;  1E34 B;  3ITI A;  5LH8 A;  1T7C A;  4JCN A;  2GDD A;  1C1Q A;  3SW2 B;  2ZTX A;  3FKS D;  1Z1J A;  1CHG A;  4X1S U;  5A8X A;  4CR5 A;  1AD8 H;  1GMC F;  3PYH A;  1UW7 A;  4YO9 A;  2FX6 A;  1GBE A;  4NFE A;  4NA7 A;  3SQE E;  2ZI2 H;  1TQ0 B;  2Y5H A;  1ABI H;  2PTN A;  1LPZ B;  1HXF H;  3A8B A;  2BLV A;  7GCH G;  2ZEB A;  1P2M A;  2GJG A;  4AFU A;  4X6M A;  1G36 A;  4Y0Y E;  1W8B H;  4NCY A;  3LGW A;  2FX4 A;  1FY3 A;  3S7K B;  4BXS A;  1GHA G;  3SOR A;  2IOT A;  1HAV A;  3TJN A;  3M61 U;  2UWL A;  3SV8 A;  5AF9 H;  1O2H A;  2Z3D A;  1NS3 A;  1BTY A;  3EE0 B;  4LK4 A;  3PWB A;  2QA9 E;  2ZPR A;  2EI7 A;  2XW9 A;  1SHY A;  1UK4 A;  1TMB H;  3RXP A;  4DG4 A;  1CT2 E;  4Y8X A;  5E0G A;  2WPH S;  4D7G A;  2VIO A;  1BHX B;  1AO5 A;  2A7C A;  2OC1 A;  2JIZ D;  6LPR A;  4MDS A;  2C8Z B;  2ODY B;  3A88 A;  1ZSL A;  1FUJ A;  1FQ3 A;  1AHT H;  1P2I A;  5F8X A;  2PKS B;  2ZU2 A;  3GDV A;  1ZRB A;  5E2O A;  1IQF A;  3A7Z A;  3DCL A;  3BV9 B;  1YBW A;  3BIU H;  3MHW U;  1KLJ H;  3FP8 E;  5CHB A;  2KCY A;  3AVZ A;  2GX4 A;  3LGT A;  3F9H A;  1GI1 A;  2EA3 A;  3DSO A;  1NBM D;  3ZVC A;  4UFG H;  4E7R G;  5BRR E;  4FUI A;  1SGQ E;  2FMJ A;  3PV2 A;  1ELC A;  1E35 B;  2BLO A;  4BAN B;  3DD2 H;  3PLK A;  1DWC H;  2O9Q A;  4X1N U;  4YES B;  3V3M A;  2BDY A;  1V2T T;  1GBT A;  4JYU H;  2EST E;  2UUK B;  1ELF A;  2GD4 B;  2JET B;  5JBB S;  1NZQ H;  3FO8 D;  2L74 A;  3TVJ B;  1J17 T;  4ABB A;  2AIQ A;  3UPE A;  3L3T A;  4AYV B;  5T3H A;  1W10 U;  1YY3 A;  2V6N A;  3U1J B;  2YNA A;  1V3X A;  3ZIA D;  2CN0 H;  2FDA A;  1E1R D;  1UO6 A;  2BD2 A;  2FYR A;  4B74 A;  3PTB A;  2BOK A;  5KED A;  4X6O A;  4DVA U;  1KXA A;  2NU4 E;  3RC5 A;  2GT7 A;  1BQY A;  3DUX H;  2XCN A;  1EQ9 A;  3VFE A;  1EX3 A;  1K1I A;  2CV3 A;  1TRY A;  5A0B A;  5EPN A;  2Q6D A;  1NFX A;  2A1D B;  3BTF E;  3IIT A;  4SGA E;  1IQG A;  1UCY H;  2XBY A;  1EJM A;  5DP7 A;  2ZGX H;  7GCH F;  5JDU B;  3E6P H;  2HAL A;  4X6N A;  2I6Q A;  4MPW A;  3RDZ A;  2P3U B;  3UIR A;  1VIT G;  2FS8 A;  2VH0 A;  4NSV A;  1GHA F;  3SBK A;  1FY5 A;  4H4F A;  4K60 A;  4JZI A;  2BVR H;  2O8W A;  2C93 B;  4Q80 A;  4TSF D;  4X2W A;  4AOR A;  3GDS A;  1H9I E;  4TWY A;  1ELE E;  1GI4 A;  3N7E A;  1MU8 B;  3E90 B;  3AW1 A;  1C5U A;  2XWB I;  2BY8 X;  3OFN D;  1LMW B;  1GCT B;  1CO7 E;  1XVO A;  2KR7 A;  4WWY A;  5E0J A;  1INC A;  1G3C A;  1OWE A;  1C5T A;  1BT7 A;  4Y8Y A;  4RI0 A;  4Y79 A;  1Y3W A;  3VXF H;  2Y81 A;  3H5C B;  1TX6 A;  1CA0 C;  2B8O H;  2Z9L A;  2BLW A;  3RU4 T;  4MG3 A;  1YLD A;  3BTH E;  3DFL A;  1F5R A;  4K69 A;  4R8T B;  1HJA B;  5GND A;  1KTT B;  2ZGJ A;  3RP2 A;  4AGK A;  5JBC S;  3SI3 H;  1E1Q D;  1K1N A;  1YP9 A;  2W26 A;  4M7G A;  4NIV A;  2HRV A;  1SOT A;  1P2J A;  3LON A;  5E2P A;  4WF8 A;  2OCV B;  2BDA A;  5DG6 A;  1EAX A;  1G3B A;  5DP5 A;  1D3Q B;  1H9H E;  1MZA A;  2RG3 A;  2W6I D;  2WIN I;  1TX7 A;  3PM3 A;  1RTL A;  2DE8 A;  3ATL A;  2BVS H;  1OS8 A;  4YLU A;  2I6S A;  2V35 A;  4I8G A;  6CHA C;  1UVP A;  1H8D H;  2H6M A;  1CE5 A;  1LHD H;  5A8Z A;  5GPI B;  4F48 B;  2G00 A;  3BTM E;  2OQU A;  5EW2 H;  1ETR H;  1HCG A;  4FOU C;  5EOD A;  4YTA A;  3BTD E;  9LPR A;  5HMA A;  4U01 A;  1OWJ A;  4GVU A;  3GY7 A;  3A84 A;  1C5N H;  4BXW A;  3TU7 H;  1C4Y 2;  4WMF A;  4ACA A;  1HLT H;  1NM6 A;  2NU2 E;  4CRG A;  1EFR D;  4UFD H;  1DM4 B;  1GI0 A;  2BZ6 H;  2XC5 A;  2VJ1 A;  4J1Y A;  3RXD A;  2PSX A;  2TRM A;  4D7F A;  1LHG H;  2A4Q A;  1QGF A;  1EOJ A;  1MKX K;  2UUJ B;  3OX7 U;  3SN8 A;  4ZUH A;  1KXC A;  2Y6T A;  1F0T A;  4B6E A;  1MQ6 A;  1W7X H;  2YNB A;  1A3B H;  2A7H A;  1TLD A;  2ZTZ A;  1EZS C;  3EE7 A;  1MH0 A;  2QC2 A;  4UFF H;  2WV5 A;  1MU6 B;  2DE9 A;  2HVX A;  4ASH A;  1CU1 A;  1VIT F;  3T62 A;  1IOE A;  3BEI B;  1S6H A;  2GZ7 A;  2SGF E;  1KIG H;  5A09 A;  4IN1 A;  2YMS B;  1J16 A;  1O2L A;  3GY5 A;  5E0H A;  1CBW B;  2HWL B;  3M3T A;  1SBW A;  3RLW H;  1W2K H;  4FUB A;  3LKW A;  3V7T A;  2KAI A;  3QK1 A;  4X6P A;  2O8M A;  1V2K T;  2Z9J A;  3FP6 E;  1PFX C;  4WMD A;  3UQV A;  7LPR A;  1ELD E;  3A83 A;  1FV9 A;  3KQB A;  1MAY A;  3SQH E;  1QY6 A;  2PUQ H;  3SUD A;  4WY3 A;  3LH3 A;  1JRT A;  1ID5 H;  1BJV A;  4CHA C;  1MAX A;  2GV7 A;  1DY9 A;  1A0J A;  3HKJ B;  3RXE A;  2BD7 A;  5DP3 A;  3U69 H;  5ETX A;  1SSX A;  1MTN C;  5FCR A;  2JH6 D;  1NBM E;  5EOK A;  4MQA A;  1BB0 B;  4I7Y H;  2C8W B;  3OY5 U;  1UK2 A;  2XBW A;  4OS2 A;  4UE7 H;  2RA3 A;  2PWX A;  2A5A A;  4ISH H;  3SO3 A;  3GY4 A;  1BUI A;  3KCG H;  4ABI A;  3FP7 E;  1IQI A;  2WSS D;  2LNC A;  1BRB E;  1GHY H;  2BMG B;  3RMM H;  3RXF A;  1TPO A;  1ETT H;  3KHV A;  1FY4 A;  3F0O A;  2Z9K A;  2ASU B;  3SZE A;  3MTY A;  3F9F A;  3NPS A;  1DWE H;  3LOX A;  2Y5G A;  3DSP A;  1EJA A;  1V2L T;  2KM0 A;  3GYM A;  3OTJ E;  1P57 B;  4DIH H;  3SHA H;  1OKX A;  2BQ7 B;  4TY7 A;  5DK1 A;  3BSQ A;  4XBC A;  1TGN A;  2F4L A;  3MOC A;  3W95 A;  2QIQ A;  1JXP A;  6GCH G;  1FPH H;  1SLX B;  3ATI A;  2K1Q A;  1DIT H;  1RIW C;  5EGM A;  5DP4 A;  3HKI B;  1GHW H;  1HBT H;  3LGU A;  5C1X A;  1BTW A;  4K1T A;  2ANM H;  2STA E;  3AAS A;  5F53 A;  2ANK H;  3O8R A;  4OGY A;  1GHX H;  1TAL A;  3QO6 A;  3SI4 H;  1ZYO A;  2SNW A;  1Z8R A;  1GVK B;  3ZVF A;  4ABD A;  3TNS A;  1B5G H;  4ACB A;  1PQ7 A;  1YPH C;  3BG4 B;  4AG1 A;  4CRD A;  5L2Z H;  2AH4 X;  1MCV A;  4AFQ A;  3OU0 A;  4KKD A;  1HAP H;  2VH6 A;  1VJA U;  1RJX B;  1X7A C;  1IHS H;  2ALV A;  3ZZ6 A;  1O3C A;  2Z9I A;  2Q1J A;  4ZHL U;  2ZDA H;  1O5A B;  1WBG B;  4KEL A;  3SGQ E;  3A85 A;  4IMQ A;  2A4O A;  3RMN H;  4X1Q U;  1AFE H;  5CMX H;  3GY8 A;  1QRW A;  1MAB B;  1TQ7 B;  4H6T A;  5FPT A;  3P8N A;  1F0R A;  1V2O T;  2LEL A;  4TT3 D;  3FZZ A;  2J95 A;  1CGI E;  1ZR0 A;  2A5I A;  1A5I A;  2EI8 A;  4TYD A;  5DP9 A;  1HAO H;  4CRC A;  1W0K D;  2L6O A;  2BQW B;  3UNR A;  1YPG H;  2A0Q B;  3RXI A;  2CJI A;  4AG2 A;  1UTP A;  3MU4 A;  3MNS A;  2VVU A;  4ZH8 A;  1UHB B;  1EUF A;  1V2R T;  2ZFS A;  2VWM A;  1EAS A;  4GHT A;  1W13 U;  1FLE E;  1YYY 1;  1QBV H;  3GS9 A;  2ZNK H;  2C90 B;  2Z9G A;  1DXW A;  3RC4 A;  1Z8J B;  1IQJ A;  4FET A;  2V3H H;  1NT1 A;  3GIC B;  3KL6 A;  2A31 A;  5PTP A;  1O2V A;  2GCH G;  4NGA H;  5CDF E;  5AFY H;  3PO1 B;  3MMG A;  3EA9 A;  1L1J A;  4WVP E;  4B1T A;  5EQS A;  1D3D B;  1NES E;  1W14 U;  2CF8 H;  2WYG A;  1THP B;  1GJ4 H;  2ZF0 H;  3HK3 B;  2TPI Z;  1Z8G A;  1BMA A;  3MH6 A;  1SG8 B;  1GMD G;  2G55 A;  4I8L A;  1K28 D;  3PLB A;  3OY6 U;  1GI7 B;  1TAB E;  2FXR A;  3ZVE A;  1P02 A;  1ZRK A;  2WPI S;  4I8H A;  4FU7 A;  3LT3 A;  1O2G H;  5HIZ A;  1VCP A;  4CBN A;  4MLF B;  3KQC A;  3URD A;  3A8A A;  1Y3U A;  1TOC B;  4FU9 A;  1GJC B;  2VID A;  1ZGI A;  1C1M A;  3QDZ B;  1SGY E;  3LPR A;  2D8W A;  3U8R H;  3M3V A;  1UMA H;  3UTU H;  1D6R A;  4R0I A;  1SC8 U;  5FBI A;  2GKV E;  4I31 A;  3M3S A;  3RXR A;  1HAV B;  2AGE X;  4ISL A;  2CF9 H;  1O2J A;  1W7G H;  1P0S H;  3GCT G;  1Y5A T;  5EXN A;  1O3P B;  1KXB A;  3AAV A;  4OS4 A;  3UNQ A;  5C0U A;  1DWD H;  1T8O A;  1FPC H;  5L30 H;  1ORF A;  1HAY B;  3F2G A;  1AB9 C;  1WXR A;  1NPM A;  2ZFF H;  2OK5 A;  2JKH A;  3V12 A;  1G9I E;  2XCF A;  2XOK D;  1YPK H;  5J4S A;  3WWF A;  1V2M T;  2BQ6 B;  4IGD A;  1ZTK A;  2AMQ A;  1AUJ A;  1CA0 B;  1PPF E;  4MNV A;  1EJN A;  4CRA A;  1KSN A;  2TIO A;  1XUH A;  3A7V A;  3PMH B;  1GHB G;  1T4U H;  1NFU A;  3S9C A;  4NZL A;  3SU1 A;  2ZZU H;  5DP8 A;  2Z3E A;  3QWC H;  1AGJ A;  3SNE A;  2W6J D;  1DAN H;  3OE7 D;  1S0R A;  3FN8 A;  4BAH B;  1EP6 A;  1HAH H;  3ZV8 A;  3ZZA A;  1C1V H;  1XXF A;  1IQH A;  2GGV B;  2NU0 E;  3CP7 A;  2CHA C;  1T8L A;  3DSG A;  4AOQ A;  1UHB A;  2CMY A;  3MU5 A;  3QX5 H;  1DVA H;  2ZFQ H;  1XM1 A;  1QTF A;  2CK3 D;  1EOL A;  1E36 B;  1DWB H;  1LO6 A;  1A5H A;  3MU1 A;  2W3K A;  5C67 A;  3VPK A;  1HGT H;  4RT1 A;  2JDI D;  1NC6 A;  2GCH F;  2KCA A;  2GCT C;  1GVZ A;  3GOV B;  1EST A;  5FX5 A;  4K1E A;  1CHO G;  1C9T A;  1PPE E;  4Y71 A;  1GBI A;  1O2M A;  1PYT D;  1PQ5 A;  2JJ1 D;  1QUR H;  1O5E H;  1UCY K;  4XD7 D;  2ZHW H;  1GMD F;  2SGE E;  3U1I B;  1JWT A;  1V2N T;  2H2Z A;  3F2F A;  4UFE H;  3TK6 A;  4AN7 A;  4UON A;  1GG6 B;  2GMT C;  3RXJ A;  4NG9 H;  1KMH B;  2HNT E;  2FTL E;  3TIT A;  1LKA A;  1Z8I B;  5TCA A;  3SJK A;  4EST E;  1AIX H;  3STJ A;  4INH A;  1BMM H;  5L6N H;  1UVS H;  3Q76 A;  2IN2 A;  1QRX A;  3B9F H;  3AK5 A;  5FL7 D;  1EKB B;  1BTU A;  1O0D H;  2GT8 A;  2ZG0 H;  1P3E A;  1OWH A;  1CGH A;  1SGC A;  2OLG A;  3E91 A;  1TRN A;  1GHV H;  1C1O A;  4FUJ A;  1UVT H;  1C5O H;  3RUO A;  2ZU4 A;  5K0H A;  1S84 A;  3GCN A;  1HAZ B;  3OTP A;  4VGC C;  5AVD A;  3GCT F;  3HGP A;  1G32 B;  1Y3V A;  1ZTJ A;  5GJ4 B;  2PW8 H;  3DHK H;  3D62 A;  1QA7 A;  3ZZ8 A;  4CH2 B;  4O3U A;  4TPY A;  1DXP A;  4X8U H;  3RXS A;  1D6W A;  1OSS A;  1QIX B;  5CE1 A;  3N99 A;  5FCK A;  2WUC A;  4ASU D;  2B5T B;  2BVX H;  2QXI A;  2FI4 E;  5FPS A;  3H7O A;  1SGP E;  2NWN A;  3QZR A;  1GHB F;  3L6P A;  4CHA B;  2BD9 A;  3IWM A;  3UFA A;  1QHR B;  2J9N A;  2B7D H;  1XKA C;  3F9G A;  1L1N A;  2OC8 A;  1UK3 A;  2WV4 A;  2RA0 A;  1C5Q A;  1AE8 H;  4ABH A;  2FOD A;  1F7Z A;  3RXQ A;  2J34 A;  1K1L A;  4XE4 A;  3MNX A;  5JBA S;  1C5P A;  2HVY B;  1DUA A;  8GCH G;  1AVW A;  1F5L A;  4A1V A;  1GBB A;  2A4R A;  1QJ7 B;  5EJZ A;  1YLN A;  2FES H;  1A7S A;  1P01 A;  5GXP A;  1FAX A;  1HNE E;  1ZSK A;  2V3M A;  3TH2 H;  1WUN H;  1V2S T;  1ANE A;  2J94 A;  1Z7K A;  2LPR A;  1DT2 A;  1O3A A;  1KLI H;  3SV9 A;  3QTV H;  2PLX A;  1P8V C;  2ZDV H;  3GDU A;  1W0Y H;  2TBS A;  1QQU A;  3SJI A;  3UNS A;  1CT4 E;  1AY6 H;  1THR H;  2FLB H;  2FOA A;  2CXV A;  3Q00 A;  3SJO A;  1O2Z A;  1SB1 H;  1RIW B;  2R3Y A;  2YOL A;  1ZZZ A;  5A2M H;  4BNR A;  5BPE A;  4D9Q A;  3TJO A;  1P9U A;  1P2N A;  2A2Q H;  2C8Y B;  3BTQ E;  2B9L A;  2HOB A;  2M5T A;  1TAW A;  5FPY A;  3SJ8 A;  1NU7 B;  1V6D A;  1UTJ A;  2FI3 E;  2XND D;  4YM9 A;  2PP6 A;  1DUE A;  1LPK B;  1QB1 A;  1HPG A;  3RC6 A;  3SUE A;  1TPP A;  1O3N A;  4ZHA A;  1TPA E;  3A81 A;  2IPQ X;  3FFG A;  4GUX A;  1RXP A;  1MBQ A;  1LQE A;  1O3M A;  2F91 A;  4I33 A;  3UWJ H;  2ILN A;  2W5E A;  4OGX A;  5FXL A;  2AGI X;  5T1V A;  3TK9 A;  3S7H B;  1KLT A;  1GMH G;  1TYN A;  2HPQ H;  2ZU3 A;  1MTS A;  1UTN A;  4CR9 A;  1JMO H;  2BY6 X;  3VGC C;  2RDL A;  1S6F A;  4ZKR U;  4MPX A;  2ZU1 A;  1NRQ H;  5GDS H;  2ODP A;  5A8Y A;  3ZVD A;  2KAI B;  4DT7 B;  1TB6 H;  2F9U A;  1Y8T A;  1S82 A;  3OSY A;  4LZ1 H;  1EPT C;  2XWA A;  4IN2 A;  1ELA A;  1L4Z A;  5B6O A;  2ZHQ H;  4KTC A;  3KQ5 A;  3SNA A;  1SLW B;  1IAU A;  3FVF B;  1G30 B;  1A3E H;  1KDQ B;  2ZU5 A;  5C1Y A;  2ZCK P;  3IG6 B;  1E79 D;  2BDH A;  3M35 A;  2A4G A;  1QB6 A;  5IYT A;  1TNJ A;  1GJB B;  1HUT H;  3RXK A;  4HI3 A;  5FX6 A;  4RSP A;  1O2X A;  1VCQ A;  1MTV A;  5EJL A;  1O5B B;  2XBV A;  1Y3Y A;  1XX9 A;  4ZAE A;  2ZEC A;  4WME A;  4F55 A;  1C2L A;  3ZZ7 A;  3K9X B;  3WY8 A;  1N6Y A;  3SU4 A;  1SQO A;  2F9O A;  2ZC9 H;  1HFD A;  2J98 A;  5T6G A;  1O32 A;  4B6F A;  1G2L A;  2C8X B;  3BIV H;  2EEK A;  1FNI A;  3C27 B;  3KN2 A;  3GY3 A;  3S9B A;  3TGJ E;  3C1K A;  1FY1 A;  1N8O B;  5LPF A;  5GIB A;  1DOJ A;  1QA0 A;  1EB2 A;  1SGF G;  1FY8 E;  1YPL H;  3OEH D;  5F8T A;  1RGQ A;  1MMJ N;  4XSK U;  4A5T S;  2RDE A;  1KTS B;  2F9V A;  4BTT B;  2V7Q D;  1C1N A;  2AER H;  5DKM A;  3FAN A;  3MWI U;  4FUC A;  5EXL A;  2SGD E;  1C5Y B;  5CHA C;  4NIY A;  2P16 A;  4B2B A;  1AFQ B;  2OIN A;  4ISO A;  3SNC A;  3RXH A;  3NXP A;  4B2A A;  2AIP A;  1WDI A;  1TON A;  1U6Q A;  1XUI A;  4TWW A;  1AU8 A;  4UEH H;  4DT4 A;  1VR1 H;  1A46 H;  4XOJ A;  1O34 A;  3MFJ A;  1NRO H;  4JZF H;  1OYQ A;  1KYN A;  4Y7A A;  1TA2 A;  1HXE H;  4YT7 H;  3SYJ A;  1C2K A;  5EW1 H;  1GBA A;  1BRA A;  3SGA E;  3P95 A;  2P93 A;  1L2E A;  1P04 A;  4K3J A;  1C1R A;  2WV9 A;  3U28 C;  2WYJ A;  3HPT B;  3SU2 A;  2ZCL P;  4A6L A;  2Y7Z A;  1ZLR A;  2P59 A;  4RKJ B;  3PB1 E;  2PKA A;  3K65 B;  1GBL A;  1YC0 A;  1OOK B;  1RTF B;  1EAT A;  5KEC A;  3MH5 A;  1BDA A;  1IQN A;  4Z6A H;  3SU5 A;  4FVB A;  4ZXY H;  4BAM B;  3F2H A;  1G3E A;  1LPG B;  3EDX B;  1L1G A;  3A8D A;  2P94 A;  2BDI A;  2ZP0 H;  5HKK D;  2STB E;  4INK A;  1ARC A;  3RXL A;  1HAI H;  1ZGV A;  1S5S A;  5C17 A;  1B0E A;  3GCH B;  3TIU A;  1LVY A;  4E7N A;  1YWU A;  3ZZC A;  3TGI E;  1ZOM A;  3RXG A;  1O5G H;  2FP7 B;  2LP6 A;  4Q2K A;  4ZHM U;  3NKK A;  8LPR A;  1KDQ A;  1EZQ A;  1MZD A;  4Q7Z A;  3A80 A;  4IMZ A;  3MO9 A;  1MCT A;  2NU1 E;  2VIW A;  2BYA X;  4FUE A;  1P2Q A;  1SGD E;  1SI5 H;  2GCT B;  3RM0 H;  3E3T A;  1P9S A;  3D23 A;  1GGD B;  4FUF A;  1T32 A;  4LZ4 B;  2Z94 A;  1O3E A;  1EZU C;  3CNR A;  1UTK A;  1MD8 A;  3E0N B;  3RXU A;  4Q4L A;  3D65 E;  5JBT A;  3UY9 A;  1TA6 A;  3NK8 A;  1O3G A;  1AUT C;  4Z1M D;  2XC4 A;  1TMT H;  3NRL A;  4O3T A;  1W0Z U;  3UWI A;  1FMG A;  1QL9 A;  1CVW H;  4Z0K A;  2ULL A;  4JZ1 A;  1ZMN A;  3EGK H;  3BTW E;  1O36 A;  2PTC E;  3RU4 D;  4INL A;  5DO4 H;  1EAW A;  1UVU H;  1BMN H;  1NN6 A;  1W0J D;  1V2U T;  3M5M A;  4X8S H;  1C2I A;  1CA8 B;  8EST E;  5TCC A;  3UR6 A;  2G4T A;  2BB4 A;  1Z6J H;  3P8F A;  3DA9 B;  4AFS A;  1ELG A;  3GYL B;  4I86 A;  4Y7B A;  4HTC H;  1LCY A;  1QFK H;  2UUY A;  3RM2 H;  4A7I B;  2TGA A;  1C5Z B;  2OBO A;  2FOB A;  1O3J A;  2G4U A;  4VGC B;  1DX5 M;  1S0Q A;  4WXV A;  4FUH A;  3TJV A;  3ATW A;  3ZVB A;  4F4O C;  1K1O A;  4NFF A;  4Y76 A;  3RML H;  2TGT A;  2KCO A;  1QR3 E;  2OUA A;  3T26 A;  5IK2 D;  1SVP A;  5F03 A;  1NRS H;  1RS0 A;  2A2X H;  2FWW A;  1TPS A;  1VJ9 U;  3KF2 A;  2Q6G A;  1QZ8 A;  3M7Q A;  3PMB B;  2KX4 A;  2NU3 E;  1T8M A;  2J4I A;  1WCZ A;  4LOY H;  2PV9 B;  1GI2 A;  3N7D A;  1S85 A;  1C4V 2;  1YF4 A;  2FO9 A;  1DST A;  3DFJ A;  4KP0 A;  5EQR A;  2V0B A;  3VG8 A;  2QGR A;  3TGK E;  1OYT H;  5G4B A;  3TNT A;  1O3K A;  4Q63 A;  3SUF A;  2Z3C A;  2G5N A;  3M5O A;  1BBR E;  1PQ8 A;  1SOZ A;  2ZA5 A;  2QF3 A;  4X2V A;  2K8I A;  2ZDK A;  2HGT H;  2VIN A;  2BD4 A;  4BOH A;  4NA8 A;  5I25 A;  1YPE H;  3UOU A;  2OC7 A;  3S69 A;  1O2W A;  2QE7 D;  1K2I 1;  7KME H;  3I77 A;  1GCT C;  2M2A A;  3RXM A;  5A0A E;  4OM9 A;  1TIO A;  2O8U A;  5ESB A;  1HJ9 A;  3PWC A;  2GV6 A;  3RXV A;  3K6Z A;  2TGP Z;  4XBB A;  2SFA A;  1AI8 H;  1BJU A;  1OWD A;  1SFI A;  3ZVG A;  2QV1 A;  5EIY A;  2D1J A;  2P95 A;  2VVC A;  4M9F A;  4AB9 A;  3ZZ5 A;  4XDE A;  3BEU A;  2AGG X;  4D8N A;  1YCP H;  1TOM H;  4ZKO U;  1CGJ E;  1GI8 B;  1LKB A;  3KYG A;  2QXJ A;  3URC A;  2RFK C;  1FN8 A;  1ZSJ A;  2VNT A;  2P3F H;  1Q3X A;  2GVF A;  4OS5 A;  3UB0 A;  5IDK A;  3T28 A;  5GCH G;  6GCH F;  1D3P B;  3ENS B;  3MNB A;  4Y10 E;  1GJ5 H;  3PV4 A;  2G8T A;  2EI6 A;  3T29 A;  1O2N A;  4DCD A;  3M7U A;  4KGA A;  3G01 A;  4AX9 H;  4UD9 H;  1G3D A;  3CS7 A;  1HYL A;  3SU3 A;  1B7X B;  2AS9 A;  1BML A;  1C1S A;  2KFW A;  4IC6 A;  4X2Y A;  3WW7 A;  1EAI A;  2AFQ B;  3MH7 A;  1O3H A;  3P8O A;  3LIW A;  4D9R A;  3VGC B;  1FAK H;  1XVM A;  1TGC A;  4JK6 A;  4K1S A;  1AQ7 A;  2WPD D;  3PRD A;  2ANY A;  1P09 A;  2QY0 B;  2Y82 A;  1SFQ B;  4FVD A;  4AFZ A;  4AB8 A;  3U9A H;  2GTB A;  3RXB A;  1AWH B;  1C2G A;  4FXG H;  4CH8 B;  3P8G A;  2C3S A;  1AKS A;  1C5R A;  2PUX B;  3BTE E;  3A87 A;  5DGJ A;  1QJ1 B;  4B76 A;  2WZQ A;  1D9I A;  1DE7 H;  1BCU H;  2FI5 E;  1C9P A;  1PPZ A;  1GWA A;  2BX3 A;  2HPP H;  2VIQ A;  1QNJ A;  1SGE E;  1TWX B;  2J97 A;  1GBM A;  1TBR H;  3BEF B;  1JRS A;  4P00 A;  1O2Y A;  5C3N A;  1SHH B;  1YLC A;  4FUG A;  3Q3Y A;  5DP6 A;  2CGA A;  5L2Y H;  1L4D A;  2QF4 A;  2BM2 A;  2VIP A;  1WOF A;  2ANW A;  2D26 C;  1FIZ A;  9EST A;  1F5K U;  3MU8 A;  1GJD B;  1J14 A;  1O3L A;  1VCW A;  2ZFP H;  4RT0 A;  1NFW A;  1AZ8 A;  1OX1 A;  4DJZ B;  5J4Q A;  2G81 E;  4IS5 A;  4OS7 A;  1MKW H;  2YMS C;  3SGB E;  1D3T B;  2G51 A;  3LGI A;  4DII H;  3FZD A;  1HB0 B;  5HM9 A;  1CBW C;  5C0T A;  1FI8 A;  1SQR A;  4BAQ B;  1K1M A;  4X1R U;  2ZIQ H;  1MD7 A;  4HZH A;  3UQO A;  1Y3X A;  1IQL A;  1HDT H;  5FHT A;  2WPK S;  5GWZ A;  1BBR K;  1QQ4 A;  2DUC A;  1F2S E;  2R3U A;  3ZZD A;  1OP2 A;  2ALP A;  3ZV9 A;  6CHA B;  5HYO A;  2ZWL H;  1ARB A;  3W1E A;  1VGC C;  4PRO A;  2FLR H;  1EP5 A;  1AE5 A;  1GDQ A;  1RFN A;  1C1U H;  1TNG A;  3SOS A;  1YPM H;  1ZHR A;  2QXH A;  3T5F H;  3LC5 A;  1C5M D;  4K5Z A;  2BLQ A;  5DJ7 A;  3S9A A;  4GLY A;  3TH3 H;  1JBU H;  4BAK B;  1DDJ A;  3VEQ B;  3HGN A;  1ZPC A;  2RCE A;  1P05 A;  3RU4 E;  5GCH F;  3RLY H;  4MPU A;  2H9E H;  3E16 B;  3M36 A;  3OAA D;  1GI6 A;  1EZX C;  4O9V A;  2R0L A;  1E37 B;  1SPJ A;  1WQS A;  2R9P A;  2WPM S;  1C2J A;  1ANB A;  3TLO A;  4YXW D;  1ZJD A;  3NCL A;  3Q77 A;  1TMU H;  2H1U A;  4E06 H;  3MI4 A;  4MNW A;  1XKB C;  1P2O A;  2FS9 A;  3KQE A;  5FAH A;  4O97 A;  3EA7 A;  5LGO A;  1DY8 A;  1O38 A;  1YKT A;  2A7J A;  3EQ0 H;  5DSF A;  1O2S A;  5I46 H;  4B73 A;  1O2I A;  1A1R A;  1ZPZ A;  5F8Z A;  2A45 B;  2XNI A;  1O3F A;  1YPH E;  2BY9 X;  2HLC A;  1SGN E;  1BOQ A;  1P12 E;  1S6L A;  5C5N A;  1O3D A;  3SV7 A;  3SJ9 A;  4Y6D A;  3TK5 A;  1C1P A;  1BIO A;  5EQQ A;  2K0Q A;  3ZZB A;  3PV5 A;  1JOU B;  2TGD A;  1TGT A;  3A7Y A;  4U32 A;  2VGC C;  3AAU A;  4FUD A;  4ABG A;  3BG4 C;  1EPT A;  2BD8 A;  4Y11 E;  5C1U A;  1BRU P;  1L0Z A;  3TH4 H;  1O2T A;  1LHC H;  1C1T A;  4P02 A;  3M37 A;  2SGQ E;  2XC0 A;  1NFY A;  2BX4 A;  3P92 A;  3STI A;  4B71 A;  3F3B A;  1LTO A;  4GHQ A;  1V2Q T;  2ZQ2 A;  3B23 B;  3KEE A;  4MVN A;  1MTN B;  1V2P T;  1Y5U T;  2QYI A;  1C4U 2;  2SGA A;  2FTM A;  1W12 U;  1UTQ A;  2PFE A;  2J98 B;  4JYT A;  5C94 A;  4K8B A;  1BIT A;  2P3T B;  4QT8 C;  1CQQ A;  3LU9 B;  3TPI Z;  1PPB H;  1W3C A;  3KNX A;  1Z6E A;  1GI5 A;  4NSY A;  1Q2W A;  3A7X A;  2XBX A;  3HK6 B;  5TJX A;  5JPM H;  1ABJ H;  2FPZ A;  3RXO A;  1CHO F;  3MQK C;  1HAG E;  4J2Y B;  1H8H D;  2KZ4 A;  4WH8 A;  3M5N A;  1QL8 A;  2BZA A;  2OTV A;  1ZTL A;  1AWF H;  1P11 E;  1HV7 A;  4CRB A;  3SND A;  5SGA E;  1C1W H;  2GP9 B;  1ELB A;  3D49 H;  3KID U;  2JJ2 D;  3R3G B;  3KQD A;  3A7T A;  1YCP M;  1FJS A;  1DLE A;  1KY9 A;  4X0W U;  2FM2 A;  1SLU B;  3B8J A;  1JIR A;  1NO9 H;  3PO1 C;  7EST E;  1CSO E;  1J9C H;  2W7U A;  1C2F A;  1AMH A;  1BBR H;  2ZDM A;  1O35 A;  3UAI C;  1BTX A;  3K2U A;  4DW2 U;  2BDG A;  3E0P B;  2AMD A;  2VIV A;  4X1P U;  3E8L A;  1K21 H;  1QRZ A;  1WTH D;  5LPR A;  3H09 A;  1WTG H;  1K1P A;  1PJP A;  2EY4 C;  2P8O C;  2BDC A;  4O03 A;  4A92 A;  4DOQ A;  2PKA B;  3R0F A;  2R0K A;  1OP8 A;  1TE0 A;  5DN6 D;  2VWO A;  4E05 H;  1NTP A;  4H6S B;  3EAJ A;  3ATM A;  3GIS B;  3A86 A;  5JB8 S;  4WJG 2;  1QL7 A;  2WPL S;  1YGC H;  2Q6F A;  1DS2 E;  1GJA B;  1SGF A;  2VU8 E;  4RN6 A;  1O33 A;  1HAX B;  3P70 B;  1E38 B;  5DPA A;  4ZCN A;  1C5X B;  1VIT H;  3A7W A;  3L33 A;  5E8E H;  4MNY A;  5HIY A;  3UR9 A;  2BXT H;  3VB6 A;  4GAW A;  3A82 A;  1SGI B;  1O2Q A;  3Q3X A;  2SNV A;  4DGJ A;  1WYK A;  1SLV B;  2GDE H;  2QF5 A;  1C5W B;  5B6L A;  1GPZ A;  1KXD A;  1HIA B;  3P6Z B;  3LJO A;  1KXF A;  1K1J A;  2VB0 A;  3MH4 A;  8GCH F;  1YPJ H;  3SV2 H;  1GBK A;  3AW0 A;  1THS H;  1ELV A;  3U8T H;  1IHT H;  2BTC E;  1ACB E;  1NRN H;  5H4I B;  1G37 A;  1F92 A;  5EPY A;  1NRR H;  3O8C A;  3F1S B;  4ZMA H;  1P3C A;  1RTK A;  1BZX E;  2F9N A;  1O2K A;  4YLQ H;  3LJJ A;  3RXT A;  1GDN A;  4HFP B;  3NZI A;  1AVX A;  2Z7F E;  3NWU A;  2ZGC A;  4IC5 A;  2J5U A;  4F49 A;  1PQA A;  3EYD A;  3VB5 A;  3SUG A;  1MBM A;  2F9B H;  4Y8Z A;  1V2J T;  2ZPS A;  1TBQ H;  5HXF A;  4XRN A;  1O2P A;  3PMA B;  3TJU A;  4MPV A;  1CT0 E;  1Y5B T;  2FOC A;  2AHM E;  4NWL A;  1OHH D;  1OWK A;  1T31 A;  5C5O A;  4TY6 A;  3GCO A;  4H42 U;  1YM0 A;  5C2Z A;  2JH5 D;  2THF B;  1PPG E;  3Q3K A;  3VB7 A;  1ETS H;  1GBD A;  2EQN A;  2OD3 B;  1GBJ A;  4AZ2 B;  3LGV A;  1A0H B;  4NIW A;  1TNH A;  1LVB A;  1FIW A;  1GBH A;  3F9E A;  3K6Y A;  1ZML A;  4I8K A;  1C5L H;  2Y5F A;  1QBN A;  1WV7 H;  1GMH F;  1GG6 C;  4AGJ A;  1AVG H;  1DFP A;  1AB9 B;  1F0U A;  1O2O A;  1QBO A;  2J38 A;  3I78 A;  3RXC A;  1S81 A;  3PRO A;  6EST A;  4K2Y A;  1O5C B;  1XUJ A;  2BY7 X;  1BTZ A;  4YZU A;  3CS0 A;  1O3O A;  3H7T A;  1GHZ A;  1OWI A;  1P2K A;  3F6U H;  1IQE A;  2BHG A;  2IJO B;  3ELA H;  4YOJ A;  1QB9 A;  1V2V T;  1H8E D;  3BTK E;  1XUK A;  2ODQ A;  4WXI A;  4BTU B;  1WAY B;  1PPC E;  4UDW H;  4YOI A;  2FZZ A;  1BMF D;  1C2M A;  2BXU H;  3W94 A;  1B0F A;  1SMF E;  4U2W A;  1P10 A;  2Z6B D;  2CHA B;  2VBC A;  3PRB A;  1AN1 E;  1DPO A;  1SQA A;  1YCP K;  1N6X A;  2R2W U;  2ZHD A;  1T4V H;  3LDX H;  1MQ5 A;  1O31 A;  3LC3 A;  1FZZ A;  2ZHE H;  1ZMJ A;  4XBD A;  3JZ2 B;  2VWL A;  1E0F D;  4X8T H;  3HAT H;  1GI9 B;  2FOF A;  3ZZ3 A;  3VB3 A;  4CRE A;  1DSU A;  3ZYD A;  2B0F A;  3M5L A;  5JB9 S;  1HIA A;  1VGC B;  1NRP H;  3BTT E;  1O2U A;  4BAO B;  1TFX A;  3URE A;  3MO6 A;  2ZGH A;  3MNC A;  4YOG A;  5HM2 A;  1O3I A;  4GCH G;  1WSS H;  2PKS C;  2H9H A;  4A1T A;  1GJ6 A;  5KGO A;  1SL3 A;  2ZFR H;  8KME 2;  1O5D H;  3KGP A;  2GMT B;  1VZQ H;  4MNX A;  1FX0 B;  1ZPB A;  2O8L A;  2BY5 X;  3BN9 A;  1AZZ A;  1GJ8 B;  4JZD H;  2FOE A;  1XUF A;  1IQK A;  3T2N A;  4NZQ A;  3O8B A;  5F6M A;  3OEE D;  2UWO A;  5AFZ H;  4OS1 A;  4GPG A;  2F3C E;  3F0P A;  1NY2 2;  5FBE A;  5EU8 A;  3RMO H;  1LDT T;  1GBF A;  4NA9 H;  1BA8 B;  3E1X B;  1TGS Z;  2HNT C;  4RKO B;  3PTN A;  4AYY B;  3DT0 H;  2FIR H;  2JET C;  4HGC A;  1GCD A;  3VB4 A;  3P17 H;  4SGB E;  1P03 A;  1SQT A;  1WQV H;  1H9L B;  4ABA A;  1AKS B;  1G2M A;  3QUM P;  4GSO A;  2BD3 A;  4ABF A;  3SU6 A;  3MU0 A;  4B75 A;  1BHX F;  1JIM A;  1H1B A;  2WUB A;  5K7R A;  2HLD D;  4U30 A;  2VGC B;  1MKW K;  4ISN A;  2FOM B;  3ODF A;  5T6D A;  2FYQ A;  2SGP E;  4OS6 A;  2ZHF H;  4D76 A;  1RRK A;  1O3B A;  1H8I H;  1OXG A; 
#chains in the Genus database with same CATH homology
 1EFR D;  4XD7 D;  2K1Q A;  3KN2 A;  2M2A A;  3SU0 A;  2YMS C;  3U1I B;  3F2F A;  4OM9 A;  5F53 A;  4K8B A;  5ESB A;  2VBC A;  4Q4L A;  5C0T A;  2QF5 A;  3PRB A;  5EPN A;  3O8R A;  2YOL A;  3OEH D;  5B6L A;  2A4Q A;  2F43 B;  1RGQ A;  1W3C A;  2WHX A;  3KNX A;  2F9V A;  2QV1 A;  2V7Q D;  4Z1M D;  1KMH B;  4M9F A;  5FPY A;  3NRL A;  4NWK A;  4B6E A;  2XND D;  3W1E A;  5H4I B;  3SV8 A;  5EPY A;  2IJD 1;  3O8C A;  3RC6 A;  1NS3 A;  3AK5 A;  3M5L A;  3SUE A;  1H8H D;  5FL7 D;  2KZ4 A;  2GVF A;  2OIN A;  4I31 A;  1CU1 A;  4TSF D;  3M5N A;  1W0J D;  4WH8 A;  3UB0 A;  5IDK A;  3M5M A;  4I33 A;  3N7E A;  3E90 B;  2OC0 A;  3OFN D;  4DT4 A;  2YMS B;  4A1T A;  2KR7 A;  5C0U A;  2OC1 A;  3OTP A;  3WWB A;  2JIZ D;  5T1V A;  2J5U A;  3EYD A;  3SUG A;  2JJ2 D;  1MAB B;  1BT7 A;  2OBQ A;  2OBO A;  3OAA D;  5FPT A;  3LKW A;  4RI0 A;  3SYJ A;  2YMS D;  3P8N A;  3F2G A;  2LEL A;  1FX0 B;  4TT3 D;  3DCL A;  2FM2 A;  5GJ4 B;  2OK5 A;  3SU3 A;  1WXR A;  4TYD A;  2KFW A;  4YXW D;  3WW7 A;  2O8M A;  2WV9 A;  5CHB A;  2XCF A;  2XOK D;  1W0K D;  1SKY E;  2KCY A;  2L6O A;  3FOA A;  3O8B A;  4WH6 A;  3WWF A;  1COW D;  2AHM E;  3OEE D;  4NWL A;  3SU2 A;  1DXP A;  1OHH D;  2KCO A;  3P8O A;  4R8T B;  1DY8 A;  2F9U A;  3DSO A;  3F0P A;  3N99 A;  5GND A;  3SUD A;  1NBM D;  4ASU D;  5IK2 D;  2P59 A;  5DSF A;  5FPS A;  3SU1 A;  2WPD D;  1E1Q D;  3PRD A;  3H09 A;  3O8D A;  4B73 A;  4KTC A;  1DY9 A;  3KF2 A;  1A1R A;  3PV2 A;  2W6J D;  3L6P A;  3LON A;  3OE7 D;  4WF8 A;  4I32 A;  5ETX A;  3SV6 A;  2XNI A;  4A92 A;  3FN8 A;  1NBM E;  3GS9 A;  3SU5 A;  1DXW A;  3N7D A;  5DN6 D;  2GGV B;  2OC8 A;  1S6L A;  3RC4 A;  3F2H A;  4B76 A;  2WZQ A;  1E79 D;  5EQR A;  4FET A;  3SV7 A;  3VG8 A;  2A4G A;  2W6I D;  3FO8 D;  5HKK D;  1N1L A;  5EQQ A;  2K0Q A;  1RTL A;  3PV5 A;  2WSS D;  4JMY A;  4A1X A;  5C17 A;  5CDF E;  3SU6 A;  2CK3 D;  4A1V A;  3F0O A;  4B75 A;  2A4R A;  3OYP A;  3SZE A;  4Q63 A;  3SUF A;  5EQS A;  2JDI D;  5GPI B;  3LOX A;  2FP7 B;  2KCA A;  2HLD D;  2QF4 A;  2KCP A;  3M5O A;  3U1J B;  4ZCN A;  3DSP A;  2KM0 A;  4F55 A;  2IJO B;  2FOM B;  3ZIA D;  3FKS D;  1E1R D;  1H8E D;  2K8I A;  4B74 A;  4U01 A;  3SU4 A;  4B71 A;  3F3B A;  2F4L A;  3RC5 A;  4B6F A;  1BMF D;  2OC7 A;  3SV9 A;  2JJ1 D;  2QE7 D;  1JXP A;  3KEE A;  2XCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...