1MMJN

Porcine pancreatic elastase complexed with a potent peptidyl inhibitor, fr136706
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase 1
publication title True interaction mode of porcine pancreatic elastase with FR136706, a potent peptidyl inhibitor
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mmjN02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mmjN01
1Z8IB 2G4TA 2ZFTA 1FIZA 5AFZH 2V35A 3SU6A 1SQOA 1E34B 3S69A 1WU1A 1IQMA 1YPLH 1FMGA 3MU0A 4FU9A 4NFEA 2A1DB 3V0XA 4B73A 1ANEA 1ABJH 1C2FA 3BF6H 2NU4E 4XOJA 3MO3A 5EOKA 1C1WH 1XUHA 3JZ2B 1YGCH 1L0ZA 2SGDE 1LCYA 2Q6DA 1G9IE 4WJG2 4J2YB 4Y7AA 1TGBA 4D7FA 2OC7A 4XSKU 1CGHA 3D62A 2ZTZA 4INHA 1P2NA 1P3EA 1ACBE 4YT7H 4GCHG 8GCHG 4K1TA 4YO9A 1TA6A 1D3QB 1A2CH 1TRYA 5DP4A 1UVUH 2XWBI 2ZFSA 4MLFB 2KAIA 4AGKA 2J9NA 2OD3B 1F92A 1ZHPA 1GBIA 4IC6A 2ZGBH 1C1SA 1W10U 2UWLA 1O2VA 3GICB 2Q6GA 1A0HB 3TNSA 3A87A 1O37A 2WYJA 1SGIB 1KYNA 3VXEH 2B5TB 3MU1A 4H6TA 3A88A 1S5SA 1ELTA 1RTLA 2R3YA 3RXJA 2CHAC 1YCPH 2VH6A 2QIQA 2QYIA 2BD4A 2M5TA 1EZXC 4XFQA 2UUYA 4TYDA 1PQAA 3BV9B 1AB9B 2FPZA 4NA7A 3M7TA 4H6SB 4U32A 1VITH 3V12A 5C1XA 2G8TA 1J8AA 1K1NA 1EPTC 5EQRA 1BRCE 1TA2A 3UR9A 1KY9A 1C1UH 1O3FA 3NCLA 2ZTXA 1V2JT 4ZHAA 5B6OA 2I6SA 4NA9H 1OXGA 3VB7A 4ZH8A 3T5FH 2H9EH 4O9VA 4D8NA 3SV2H 1PPZA 1LTOA 4OGYA 3TJVA 3U9AH 1A0JA 4ISIH 5CHAB 1XUJA 4AG1A 3GY2A 1MZAA 4MPUA 2BQWB 1XMNB 1O3KA 2Z9GA 4A1XA 1O3GA 4UONA 1DY9A 2Y6TA 2H2ZA 1C9TA 2A2QH 1J9CH 1GBTA 1GI9B 1Z1IA 3GCHC 1MTSA 2FOMB 4WXIA 2GV7A 3Q76A 1GBKA 6LPRA 2GKVE 1E35B 2AERH 1OX1A 2TGTA 4B71A 1K1JA 1KLTA 4IN2A 1GBCA 2XNIA 3TITA 1ELGA 3AASA 2AMPA 2LNCA 1H8DH 3P70B 3SZNA 1ANCA 3T62A 1K21H 2WPJS 4X8VH 1BZXE 1WBGB 1Z6JH 4HFPB 3UQVA 2ZGXH 2HLCA 1C1NA 1O39A 1CT0E 5JDUB 3SJKA 2SGFE 3OYPA 2P3TB 1C5UA 2P3UB 1Z8RA 1O2ZA 3LGUA 3LGTA 4ABFA 5LPRA 1ARCA 2Y5FA 5L30H 4F49A 1GBEA 1M9UA 3ZYDA 1MCTA 1PPEE 1D3DB 4ZMAH 4ZAEA 3FZZA 1BBRK 2XCFA 2HALA 2AFQB 1BBRH 2CV3A 4D7GA 2GZ8A 1SLXB 1PPBH 5C5NA 1THSH 2WPKS 1O34A 2ZHWH 1P2JA 2WPMS 1IHSH 2ZQ1A 1TPSA 1Y5AT 1C5MD 3VB6A 5JBTA 1A5GH 4R0IA 1LPKB 3RXAA 1FY1A 3KIDU 2UUFB 4WWYA 1GHAF 2ZKSA 1MAXA 2ZQ2A 1IQJA 4KTSA 5GDSH 5A8ZA 2A0QB 2FDAA 2VJ1A 5EXMA 3BEIB 4I32A 1FJSA 4LZ1H 2J94A 1HAIH 2ODQA 2V3HH 2ZGCA 4I8HA 1G3DA 4HI3A 1SGQE 3BTTE 1SQAA 1ELBA 1GI3A 2FOFA 3FFGA 4TWYA 3OSYA 1DS2E 4Y8YA 1S83A 1DWBH 3NUMA 3P17H 4D76A 2TRMA 4Y10E 1C2LA 3SU2A 4I8LA 2ZG0H 3UWIA 5E0HA 1BA8B 1FN8A 5H4IB 1C2MA 3BG8A 2EC9H 4BAHB 2P59A 2ZHEH 4ZHMU 4B2AA 3M7UA 1F7ZA 3SGBE 1OOKB 4GLYA 3UQOA 3RP2A 4X0WU 1QL7A 2VWNA 2VINA 2WPIS 2Z9IA 2BD8A 2HRVA 2TBSA 1DLKB 1RGQA 3K65B 4ABAA 2A4OA 1UVPA 2TGDA 2ZFQH 1DICA 1ELFA 5T3HA 2PUXB 3GCOA 3VB3A 2BLVA 2EEKA 1AQ7A 4IC5A 1C5PA 1SBWA 1AUTC 1BRBE 2VGCB 3A82A 4D9QA 1C5OH 2FZZA 4DCDA 1BJVA 1VJ9U 1ANBA 1EUFA 4NIXA 2QXGA 1H1BA 2ZFPH 4ABHA 4J1YA 1LHDH 1MKWK 4MG3A 4I33A 4E06H 2WUCA 3P8GA 3F1SB 1O5CB 3TNTA 2C8WB 2P3FH 2OQUA 2QXJA 3GY3A 2GCTC 1O3BA 3BTKE 4I8GA 1MD8A 1LHEH 2AGGX 1AIXH 4K2YA 1C5SA 4CHAC 5JB9S 2PW8H 2RCEA 1IAUA 2ZU3A 1HLTH 4MNWA 2BVXH 1SOZA 5E8EH 1MTWA 2PGQB 5DP3A 1XVMA 3A7YA 2PTNA 3M5LA 4RKOB 3LJJA 1GJBB 2FMJA 3PO1B 3P92A 1FDPA 3PMBB 3LC5A 2OXSA 2BVSH 3MU8A 1CA8B 2VIVA 2YNBA 1P10A 3SV6A 4FU8A 2QAAA 5IYTA 1O2SA 1NU7B 4KTCA 6ESTA 2C3SA 1FAKH 1HJ9A 2BOHB 3L3TA 1O2WA 3QTOH 3ITIA 1SPJA 5JBAS 1O2IA 4JK6A 1EOLA 1OWIA 4NZQA 1PQ7A 2GGVB 2HPQH 1VZQH 4FUFA 3VB5A 2VWMA 3R3GB 3TK9A 4BAQB 1GBAA 1Y3XA 2G00A 3EDXB 1TGSZ 2BYAX 1BTWA 2Z9JA 4Y6DA 1SC8U 1HDTH 1O5EH 1XXFA 3ZVEA 2XW9A 2BDAA 4GHTA 4MNYA 5E2PA 5EPNA 4B74A 1TMTH 2OLGA 3IITA 2FYQA 1BMAA 5JBCS 1O38A 3QGJA 2O8LA 1P09A 3E91A 3UIRA 3F6UH 1MBQA 1F0TA 4BNRA 3OY6U 5F6MA 3S9AA 1GCTC 2FX6A 4YZUA 5DK1A 2VVCA 3PMAB 4O03A 4BOHA 2QF0A 3LGIA 1O2OA 4BXWA 3RXBA 1HJAB 5DO4H 1EX3A 1XKBC 3RXOA 1P2QA 1B0EA 1K1PA 1O2MA 3P6ZB 5DPAA 4BAKB 3M5OA 1W2KH 2XBWA 1GI7B 4YT6H 1IQKA 2FX4A 4NCYA 3P8FA 1WSSH 1AKSB 2BDYA 1ZRKA 2Y7ZA 2VVVA 1NO9H 2PFEA 1O3HA 1K9OE 2QN5T 2A7CA 1O3IA 1A46H 4A92A 8LPRA 1QRXA 5CMXH 1O3PB 4U01A 1AZ8A 1TMBH 1C2GA 5ESTE 2ZEBA 1SB1H 3Q3KA 1GHXH 2G51A 2ZF0H 4ZXXH 1T31A 3M61U 1YPKH 2F9VA 4BAOB 1TALA 2RA0A 1ZOMA 2G5VA 4NSYA 1QL8A 8KME2 3RXIA 3BG4C 3QWCH 4Z6AH 2BD5A 1CBWB 1DWDH 4GAWA 5E0GA 2R2WU 2ZDVH 2AIPA 1O5DH 1CA0C 2GD4B 1QURH 4IS5A 3ZZ7A 1V2TT 2QCYA 3DT0H 4ZKSU 1ESBA 1O5AB 2K1QA 3F9EA 3S9BA 1GMHF 1P57B 4JZFH 2GZ7A 1FY3A 1D3PB 4NWLA 1GJ7B 1QRZA 6CHAB 3N7OA 2H5DA 2A5KA 2Z3EA 1VGCB 2ZP0H 3UFAA 1A0LA 2NU2E 1C5ZB 1EZSC 2Y80A 4AX9H 4KKDA 2TPIZ 3RXRA 3FP8E 4IBLH 3SBKA 4Y0ZE 1TBZH 4Y79A 1DE7H 1Z7KA 4A1VA 1AWHB 4AFUA 1TB6H 4DVAU 1P02A 2A7JA 2ODYB 3EYDA 3LU9B 1B0FA 3A8BA 1ELEE 1GBHA 2G55A 4X1QU 1Y5UT 2FM2A 1UHBB 2F9BH 4VGCB 2PGBB 1NS3A 4NZLA 1NPMA 4WY3A 5T6DA 2CF9H 1O3NA 1C5YB 1ZPZA 4X1NU 1DUEA 2OUAA 3SI4H 4BTIB 2ILNA 2O8UA 1XM1A 4B2CA 4ABIA 1YBWA 3AW1A 4MNXA 2Y5HA 1DWCH 1SFIA 2XCNA 2FIRH 3FANA 1QJ6B 7GCHF 5E2OA 5HXFA 2OC1A 1P2IA 1ZRBA 4X8UH 1PJPA 2ZDNA 3KQCA 1N8OC 1D3TB 2ZU4A 3E1XB 2BZ6H 3MU5A 3A7WA 4QT8C 5HM2A 1C1QA 1DM4B 3MH7A 2A4GA 2A4QA 1VCQA 1O2JA 2CHAB 2SNVA 1RD3B 2Z9LA 3RXGA 3A7ZA 1NESE 3VFEA 3MWIU 4LOYH 4Z0KA 1G32B 2Q1JA 2W3IA 3M5NA 1OYQA 1Z6EA 1OWDA 1TMUH 1NRRH 1BRAA 1C1MA 1UTJA 3ZVDA 3M36A 3RXTA 1HPGA 3MNXA 1EPTB 1LVMA 2GDDA 3SNBA 3MYWA 1ORFA 1F5RA 1GVKB 1SQTA 2PR3A 4GHQA 3UOPA 4AFZA 4AZ2B 2FESH 2O8TA 5EODA 3DD2H 3GY8A 3HPTB 4WXVA 3F9GA 4FUCA 4AG2A 1DWEH 4U2WA 2TGPZ 1H9IE 2A32A 1NRNH 4CH2B 1F0UA 1TE0A 1GBBA 4MPVA 4AFSA 1WQVH 3SV9A 1F2SE 3BSQA 1O5GH 2ZCHP 2GP9B 4Y8ZA 3SGQE 4E7RG 4FUDA 4ZKOU 2VIDA 1GMHG 3GCHB 4IN1A 3QUMP 3RXQA 1ELCA 1HRTH 5I25A 3GY4A 1GHWH 2XC0A 3VGCC 2F83A 1NFUA 4AB9A 5GCHF 1RXPA 5IDKA 1YPHC 1S82A 1AE5A 1V2NT 1P03A 1G30B 4FUIA 1O30A 1MTUA 4Y7BA 1C5RA 2OC8A 2XC5A 3M5MA 4NA8A 1SGTA 2BY8X 2P94A 1N1LA 1YYY1 5FXLA 1B7XB 3RXSA 2AMDA 1BTPA 2ASUB 3SU4A 2ZDLA 2CN0H 5TJXA 4NGAH 1GJ4H 2D2DA 3ZYEA 1GJ6A 1FONA 3GISB 3O8RA 4UFFH 1BUIA 1E37B 1GBDA 1O3LA 1SGRE 1UVOA 2C8YB 1GVZA 2DE9A 3SJIA 5A2MH 1SHYA 2B8OH 3B8JA 5HMAA 1MU6B 4WH6A 1QBOA 3KQBA 5DP8A 3T25A 7GCHG 4M7GA 2BD2A 3FP6E 4OS7A 4CREA 1C5VA 2OINA 5K0HA 3PTBA 2IPHA 3ZVCA 5F8XA 1O3DA 3MTYA 1YCPK 3KN2A 1FY4A 1DSTA 1YCPM 2OBOA 3UNRA 2C93B 1HAVB 1PPCE 3SV8A 2ODPA 1LHGH 1SL3A 2FOGA 2WV4A 1NRPH 1GI0A 5EQSA 3ATMA 2BQ6B 1AO5A 2ZCLP 1D9IA 4MQAA 1PPGE 1TNHA 1GBJA 3RXFA 1Q31A 3R0FA 4X2YA 1TABE 3FZDA 1DFPA 1O3AA 2AIQA 4F4OC 3ATIA 2OTVA 2A45B 1FNIA 1LO6A 1BT7A 3OU0A 3SJOA 4A5TS 2H5CA 2IJOB 1O3EA 1CHOF 5ETXA 1DVAH 1XUKA 2ZDKA 5DP5A 1K1LA 3CP7A 1PYTC 2JH6D 2C8XB 2IN2A 1GI2A 2CF8H 2A5IA 3SNCA 4CR5A 3BTME 1P04A 2FXRA 1AE8H 2ANMH 4DIHH 1CGJE 1AKSA 1P9SA 1GG6C 1GBFA 4X8TH 5GCHG 1F5LA 1O2TA 3SV7A 2Z3DA 1C2JA 1GHZA 4JYTA 1C1PA 3RXVA 5LH8A 1C2IA 4BXSA 4WMFA 3EAJA 1EB2A 2JETC 1EAXA 1C5WB 5FPTA 2PWXA 3MNBA 2BDHA 5DJ7A 4CHAB 1AUJA 1LQEA 3GY5A 1YP9A 5FPYA 1QB9A 1TOMH 5C1YA 1E38B 3DUXH 4CRGA 1N6YA 1S0QA 4Q7ZA 3RC5A 1F5KU 1QGFA 1ZHRA 3ZZCA 3URCA 1YPJH 2QGRA 4TWWA 1J16A 5FCRA 3VEQB 1G37A 1JBUH 2UWOA 4UDWH 1T8MA 4X2VA 1C2EA 1VCPA 3M3TA 3QX5H 5FCKA 1ZLRA 2PUQH 2ZFFH 5EW1H 1P3CA 2J2UA 3Q00A 2P8OB 1G3BA 1GI1A 4NWKA 4X6MA 2G5NA 5C3NA 1QR3E 1BBRE 1MCVA 2BDBA 3O8DA 1EP5A 3GY7A 1ARBA 1ZHMA 1KLJH 3S0NA 1V2ST 3DHKH 1ESAA 1UHBA 5PTPA 2VU8E 4THNH 3BTHE 1PPFE 5EU8A 1EAUA 2QXHA 3ZVGA 1DSUA 3A89A 3E3TA 2ZO3H 2JKHA 4X6NA 3UY9A 2F9OA 3UWJH 5I46H 4A1TA 2WV5A 3SO3A 4YTAA 5JB8S 4NIWA 3BN9A 1Z1JA 1S81A 3CS7A 5DP7A 1DLEA 2AGEX 1IQLA 1TBRH 3RU4T 1Y3WA 5EW2H 4K5ZA 1CHOG 3BTGE 3E0PB 4I7YH 4XDEA 4ZXYH 1FPHH 1GCTB 3GCNA 1QFKH 3S9CA 1C1TA 1BB0B 5C20A 4IMQA 1WUNH 3ODDA 1HJ8A 1H4WA 3RU4E 3HGNA 1O0DH 3MH5A 1QIXB 1GMDF 1O32A 2HNTC 4YOGA 4X1RU 3KNXA 5CHAC 4INLA 5TCAA 1ETRH 2P16A 5E0JA 1EJNA 4CBNA 2PV9B 3BTQE 3UNQA 1EPTA 1YPMH 1V2VT 1NRSH 3M3SA 2UUJB 3LDXH 1QA7A 1ZJKA 5CE1A 4LZ4B 3SW2B 1A4WH 3RM0H 1O33A 1QRWA 1G36A 3LPRA 3SI3H 4DURA 3E90B 1EKBB 4HTCH 3TVJB 4RSPA 2D1JA 1UCYH 3H7TA 3SJ9A 1C1OA 4DIIH 4B75A 3ATWA 3RMLH 3RXPA 1BHXB 2C8ZB 2FEQH 3KL6A 1ZSLA 3BG4B 1HV7A 2BDIA 3HK3B 2PKSC 1SGFG 2ZI2H 2VVUA 3PYHA 1GPZA 1LVBA 1CA0B 1OS8A 3A7XA 1C5NH 3QGNB 7LPRA 1H8IH 1HIAB 4HZHA 1UTOA 1ZMJA 1HUTH 1TONA 3SGAE 1D4PB 2FWWA 2XBYA 2W5EA 2BZAA 1W14U 1N6XA 2VIWA 3TLOA 2FP7B 3RC4A 4X6OA 1GDUA 4Q7YA 4DGJA 2BD7A 1AFQC 1NU9A 3ZZDA 5EG4A 2F9PA 1V2UT 4FUBA 2J4IA 1C2HA 3MH6A 1T32A 2P95A 4X6PA 4YLUA 5F03A 4TY7A 1P2KA 1BJUA 1BTUA 2BLWA 3MO6A 1KXEA 5A09A 4JCNA 2J92A 2WYGA 2OQ5A 2FLBH 1OWJA 3TK6A 2J38A 1O3MA 3GDSA 2FO9A 1DPOA 1Z8GA 1VJAU 4KP0A 1TNJA 4WMEA 2SGQE 4DW2U 1Q2WA 3A7TA 4MVNA 3PLKA 3SUEA 2H9HA 4MDSA 3SUDA 2GX4A 1O35A 1UK4A 2H1UA 4X2WA 1WAYB 1L1JA 1H9LB 1HFDA 2FLRH 5HM9A 2D26C 4Q2KA 1N8OB 1HAVA 4YM9A 1NFWA 1UTQA 1MH0A 2QC2A 1NT1A 1GMDG 1DDJA 4GPGA 1O31A 1FV9A 1YC0A 1RFNA 1D6WA 2F91A 2GV6A 3LH3A 2HGTH 2BD3A 3T27A 1TNKA 1LQDB 4BTTB 3Q77A 4H42U 1DXWA 4X1PU 1EJAA 3A80A 3FAOA 2VGCC 1K1OA 3AAVA 2BD9A 3SHAH 1TOCB 4ABJA 4R8TB 1V2MT 1NY22 5T6GA 1TNGA 1ZGVA 3ZZ4A 2W3KA 1NFYA 1S0RA 1AY6H 1HAXB 1CSOE 1ZMNA 2EI7A 4AOQA 2FOAA 1YLDA 1IQHA 3F9HA 1ZPCA 1O2KA 3U8RH 1HXFH 4ISOA 4K1SA 1BITA 1V2PT 2OCVB 3JZ1B 3HKJB 1DY8A 3MO9A 3A7VA 3MI4A 1SGCA 1SI5H 1C4V2 5AVDA 3GOVB 2BDCA 1TBQH 2GCHF 2ZHQH 2Y81A 3PV4A 3U8TH 1ZMLA 1CGIE 1KSNA 1QNJA 1S6FA 4CRDA 2A5AA 1GVLA 4ABDA 3VGCB 4NFFA 5F8ZA 1ID5H 1MTVA 2BHGA 2STBE 1J15A 2ZWLH 3GDVA 2A4RA 2QV1A 3UREA 1INCA 1RIWC 5EXNA 3BIVH 2Z94A 3ZVBA 1GBMA 1RTFB 2SGEE 4CH8B 1UVSH 1MKXK 2J34A 4INKA 3V7TA 1MKXH 5A0BA 2GMTC 2O8WA 1S84A 1JRTA 3I78A 1YKTA 1HGTH 2QXIA 1YM0A 2AS9A 2NU0E 2RDLA 5A0AE 1BMLA 1WTGH 4LXBH 1GI4A 2BLOA 1GGDC 2STAE 3M3VA 3AAUA 5GWZA 1W0ZU 5BPEA 3SU3A 2Y7XA 4PROA 4FU7A 3UUZA 3K9XB 1SHHB 1QA0A 3E0NB 1L4DA 4MPWA 1SMFE 2PTCE 1RRKA 1UK3A 1OWHA 5C1UA 1HYLA 4K8BA 2LPRA 3MU4A 3PM3A 5FPSA 1PYTD 1WOFA 2ZPSA 3TH4H 3W95A 1MBMA 3G01A 1GHVH 4UFDH 4MTBA 3CS0A 4UE7H 3FVFB 1QHRB 4TY6A 2OP9A 3MNCA 2BY5X 3PB1E 2PKAB 3PLBA 2ANWA 3TU7H 1C4Y2 2Y82A 1FAXA 1ZGIA 1HAGE 1ZSKA 2TIOA 1OWEA 1X7AC 3UR6A 4FVBA 5A8YA 3DFLA 1F0SA 1RJXB 3STJA 4OS4A 1HJAC 1TX7A 1UK2A 5JBBS 2RA3A 1W11U 3MMGA 1IQFA 2THFB 5JYIA 1GJ9B 1SLWB 3TJUA 1VITF 3GY6A 4AYYB 1TGTA 3F68H 3STIA 1GJCB 1O3JA 3ZZBA 3RM2H 1SGPE 1FQ3A 3LOXA 5K7RA 3EGKH 1P0SH 1C2DA 2EI6A 6GCHF 1AHTH 1T8OA 1YPHE 4DOQA 1C5QA 1TRNA 1ZYOA 2HVXA 5DP6A 8ESTE 5AFYH 5EGMA 2BLQA 1SGFA 1PFXC 1XUGA 3VB4A 1BQYA 1SGYE 1CO7E 3V13A 1O2NA 2FYRA 5DKMA 4X8SH 1GMCF 4ISNA 7ESTE 1GDQA 4UFGH 2FOHA 1K28D 4FXGH 2GCHG 1H9HE 1HAHH 1HAZB 1MQ6A 3SU5A 3GDUA 4GSOA 3A86A 4RKJB 1IQIA 2BM2A 1HCGA 1GI8B 1TLDA 3RMOH 1GG6B 3RXUA 1QJ1B 1Y3UA 2VIQA 1OYTH 1DANH 1SG8B 4Q80A 3PLPA 1GI5A 1YPGH 1C5XB 2BY7X 3UNSA 4Q7XA 4OS5A 2VWLA 2Q6FA 4JK5A 3P8OA 4I31A 4ABBA 2FI5E 1NRQH 1GHBF 4HGCA 3EA8A 1NZQH 2JETB 5A0CA 5BRRE 3MHWU 2ZU1A 1T7CA 3PTNA 1GBLA 1JIRA 1UTMA 3KCGH 4AN7A 1ZTJA 2BDGA 2PHBA 1FPCH 3EE0B 2BOKA 4KELA 4NIVA 1LKAA 1W0YH 3RXCA 1QQ4A 4DT7B 4X2XA 2CXVA 2Z7FE 4H4FA 3QO6A 1FUJA 2AYWA 4B2BA 5GJ4B 4VGCC 3C1KA 1SOTA 2EA3A 1GJDB 1HIAA 1ZTKA 4K69A 9LPRA 1G2LA 2ANYA 1C2KA 2HNTF 5T6FA 1JIMA 1NTPA 1U6QA 1RTKA 2BQ7B 3QZRA 3QN7A 2ZU5A 3U1JB 4I8JA 4LK4A 3ZV8A 1ABIH 1EATA 3E6PH 4IGDA 1LHCH 2ZHFH 1O36A 3DFJA 1HAOH 1SGEE 2ZDAH 3U69H 1P2MA 3M37A 1TX6A 3BTWE 1TGCA 2V0BA 3LGYA 1O3CA 3W94A 1Y8TA 2B9LA 1VITG 1SVPA 3UTUH 3O8BA 1YLCA 2G4UA 2A31A 1GCDA 2H9TH 1EJMA 3LKWA 1SR5C 1MTNC 1KXFA 1XUFA 5AF9H 1C1RA 2XYAA 3RU4D 1W12U 1HB0B 3BEFB 4FUGA 3ZVAA 3SUGA 4CRCA 6GCHG 3BTFE 3PMHB 2QA9E 1CT4E 1O3OA 1HAYB 3P8NA 2CGAA 4JZEH 3RXHA 1EASA 2C90B 5C67A 5C5OA 2W7UA 1UMAH 4AGJA 1GMCG 3SUFA 1BMMH 1WQSA 3IG6B 4K3JA 5L2YH 4KGAA 3RDZA 3SU1A 1DX5M 1ETSH 3AVZA 2OBQA 1WYKA 1TYNA 1DT2A 3V3MA 1V2KT 2R3UA 2Y5GA 4A7IB 4FUEA 1O2YA 1ELAA 3KEEA 4U30A 1WTHD 1LPGB 3A85A 3D65E 1Y3VA 4ZKNU 1ZZZA 3L33A 2A2XH 1A7SA 4WF8A 1GJ8B 2ZA5A 5FX6A 1UVTH 2ZIQH 1KDQB 1L2EA 1KXAA 5LGOA 1ANDA 2ZZUH 2FS8A 2GCTB 1THRH 1MU8B 1QBVH 3M7QA 3SU0A 1GHBG 2RG3A 3MNSA 4FUJA 1HNEE 1D6RA 1SGDE 1TAWA 2QF3A 3ODFA 4UFEH 1O2PA 4DG4A 2NWNA 2AMQA 1L4ZA 3T2NA 5FBEA 1V2QT 1IQNA 2FOBA 1NROH 2GDEH 3GCTF 1KXDA 1T8NA 1BCUH 3T29A 2PKSB 1TQ0B 3I29A 1L1NA 3U1IB 1QBNA 1W8BH 1LVYA 5DGJA 2FOCA 1GJ5H 3HK6B 2XBVA 2AGIX 4OS1A 3LIWA 1ZJDA 1NFXA 1Q3XA 3ELAH 1W13U 1AU8A 1BTZA 2FTMA 3A8CA 4MPXA 1PQ5A 1QB1A 1AZZA 5SGAE 1YF4A 2TGAA 1BTHH 2GVFA 1AFQB 3BTDE 3URDA 3HKIB 3QLPH 2XC4A 1PQ8A 1O5FH 1UTKA 4B76A 1A5HA 3A8DA 4O3UA 3AW0A 2NU1E 4B1TA 1FXYA 1V2OT 1NC6A 4RN6A 1V2RT 2CJIA 3RXMA 2HNTE 1CHGA 1AVGH 2V6NA 3ENSB 4Y76A 1JMOH 1BHXF 1AB9C 4OS6A 1P8VC 3BTEE 1AFEH 1BMNH 4FUHA 4CR9A 5GPIB 4O3TA 1CQQA 4Y11E 2F9NA 4AB8A 1A1RA 3TJOA 2BMGB 3LJOA 3IWMA 2SGPE 4SGAE 3U8OH 2PLXA 3KGPA 4AORA 3L6PA 3M35A 3B9FH 1AVXA 2PKAA 1XUIA 2AEIH 4CRAA 1Z8JB 1VCWA 2R0KA 2GZ9A 1JXPA 1XX9A 2F9UA 4JZIA 1LDTT 1KXCA 2PSXA 5L2ZH 4CRBA 1A61H 2B0FA 3WY8A 1CVWH 1UO6A 2XWAA 1LHFH 1JRSA 3Q3XA 2HPPH 4GVUA 1TWXB 2AH4X 4JZ1A 4NIYA 3PWBA 4ISLA 3MFJA 3QDZB 4FVDA 3NZIA 3F9FA 1TPPA 4OS2A 2ZCKP 3TGIE 2R9PA 1LVOA 4K1EA 1FY5A 2B7DH 4ESTE 3TIUA 2ZGHA 5TCCA 1S6HA 4AYVB 3TH3H 1IQGA 2F3CE 1EQ9A 1Y5BT 1HXEH 3ESTA 1MKWH 2ZGJA 3LGWA 3RLYH 1UCYK 3SJ8A 3MH4A 1KLIH 7KMEH 5AHGH 2GT7A 1MAYA 1EZQA 4ABEA 4DJZB 2WPLS 1IQEA 2BXUH 3K6YA 3GCTG 2GT8A 4A6LA 3K2UA 5A8XA 5G4BA 3O8CA 1EB1H 3LC3A 2YNAA 1MD7A 3B23B 1O2QA 2G52A 2JH5D 2ZPQA 1C4U2 4E05H 1SSXA 2SNWA 1OPHB 1P01A 1FN6A 1ESTA 1DOJA 4XBBA 2VB0A 3ZVFA 3SN8A 4JYUH 2ZECA 1SFQB 3D23A 1FLEE 2ZTYA 3RMNH 1GJAB 3SQEE 1G3CA 3GYMA 1UCYE 3S7KB 1AD8H 2NU3E 3UPEA 1G2MA 1P05A 3PWCA 1WV7H 3H7OA 1KTTB 3GYLB 3QTVH 2KAIB 3NWUA 1V2LT 5FBIA 1RIWB 4K8YA 1AMHA 2O9QA 3I77A 1GHAG 3SQHE 1UTPA 5LPEA 1QCPA 2ULLA 2P8OC 3RXKA 4AFQA 2GMTB 2J95A 3HATH 3CENA 3A8AA 2DUCA 1EXFA 3LGVA 4ABGA 1AN1E 4NG9H 1ELVA 1O2UA 2FTLE 4ASHA 1A5IA 3ZZAA 3MOCA 2ZFRH 1GGDB 1TGNA 2FODA 1HAPH 3ZZ9A 1AI8H 1AVWA 1UTLM 3LT3A 2JH0D 1A3EH 4GUXA 1DXPA 1QQUA 3RUOA 4XBDA 4ZUHA 2A7HA 3D49H 1QB6A 1ZR0A 1OWKA 1Z71A 1EAIA 1EZUC 2ZC9H 2BTCE 2UUKB 1C1VH 1WCZA 1ELDE 2ZHDA 4YESB 2VNTA 1C5LH 5ESBA 1IHTH 1K2I1 1SGNE 3H5CB 1QL9A 2ALPA 5FHTA 3RC6A 2D8WA 2Z3CA 5JPMH 3PMJA 1B5GH 1OP8A 5GIBA 1BDAA 1LPZB 1Y59T 3Q3YA 1BOQA 1OP2A 3A81A 9ESTA 1BIOA 3QK1A 2FI3E 4YLQH 1AGJA 1O2GH 1AWFH 2VIPA 1O5BB 3NK8A 1HBTH 3RXEA 3C27B 1QTFA 4YOIA 3NXPA 1DITH 2PSYA 4IW4E 2FS9A 1NN6A 2BX4A 1LMWB 1VR1H 4XBCA 1PPHE 1FI8A 3KF2A 3TH2H 2ZU2A 5L6NH 1ZTLA 5LPFA 1FZZA 3ATKA 1CU1A 2ZDMA 2H6MA 3SORA 4BANB 4XE4A 4K60A 2ANKH 3T26A 2OC0A 1OKXA 3SNDA 1TX8A 2Z9KA 1Y3YA 3PO1C 2BVRH 3RMMH 1FY8E 3ZZ3A 3LH1A 1UTNA 1EP6A 2VWOA 2CMYA 4E7NA 2ALVA 2BX3A 1C9PA 3VXFH 1KDQA 2FI4E 1TPOA 5F8TA 1T4VH 3RLWH 1MQ5A 3ATLA 1TNIA 3P95A 5ABWA 1EOJA 2V3OH 2SGAA 1W7XH 3HGPA 1QJ7B 4NSVA 1GL1A 1P11E 3SOSA 1JWTA 1BTXA 5EXLA 4TPYA 3U98H 3NKKA 1P06A 1ZSJA 2XRCA 3TGJE 4TPIZ 1F0RA 1GDNA 1A3BH 1MMJN 1YPEH 2O8MA 3T28A 1OP0A 1T4UH 3OY5U 1KTSB 3A83A 2ZPRA 2GTBA 4JYVH 2WINI 1RS0A 1GHYH 3S7HB 3SNEA 2QY0B 3ZZ6A 2HOBA 3SNAA 4X1SU 4ZROA 2XXLA 3RXDA 1MUEB 5FAHA 1L1GA 3QZQA 3BIUH 4KTUA 1FIWA 4GCHF 8GCHF 5HGGA 1TQ7B 5C2ZA 5FX5A 4ZKRU 3ZV9A 3E8LA 4JMYA 4OGXA 1DUAA 4ZHLU 2W26A 4JZDH 2HWLB 2BY6X 5J4SA 4SGBE 5DG6A 2R2MB 1V2WT 2WPHS 1W7GH 4UD9H 1XXDA 2SFAA 3ZZ8A 1TFXA 2FOEA 1ETTH 3TK5A 1OSSA 3EQ0H 1J14A 3KQEA 2XTTB 2W7SA 1P9UA 2WUBA 4MNVA 1K22H 4Y0YE 1TRMA 2UWPA 5J4QA 4Y71A 4YOJA 5HYOA 3OX7U 1CT2E 1E36B 3KQDA 1S85A 1MZDA 1MTNB 1GL0E 3EA7A 3SHCH 1O2LA 2BY9X 2VH0A 1XKAC 3A84A 2Z6BD 4WVPE 4DY7B 3OTJE 1QY6A 4Y8XA 1P2OA 1ZPBA 1P12E 4ISHH 1C5TA 2EI8A 1K1MA 1J17T 4BAMB 3KHVA 3ZZ5A 2I6QA 3K6ZA 1O2XA 5EPYA 4IMZA 1TNLA 1BTYA 2XBXA 2BB4A 3DA9B 1KXBA 1UJ1A 2IOTA 3NPSA 1TPAE 1O2HA 1V3XA 1KIGH 4WH8A 2VIOA 2G81E 3LONA 4O97A 2R0LA 3TPIZ 1CBWC 1E0FD 5DP9A 3VPKA 1V6DA 2ESTE 3TGKE 1THPB 1K1IA 1LKBA 1G3EA 1NM6A 2BXTH 2DE8A 3UOUA 4CBOA 5EQQA 2P93A 5GXPA 1SLVB 1T8LA 2YOLA 2ZNKH 3PROA 3RXLA 1W3CA 1EAWA 1BRUP 1O2RA 1GI6A 3FP7E 3BEUA 2C4FH 6CHAC 1IOEA 1JOUB 3E16B 4BTUB 1CE5A 4CRFA 1VGCC 4UEHH 1XVOA 4WMDA 1SLUB 3TJNA 4I8KA 3EA9A 1TIOA 1GWAA 4D9RA
chains in the Genus database with same CATH superfamily
1Z8IB 2G4TA 2ZFTA 1FIZA 5AFZH 2V35A 3SU6A 1SQOA 1E34B 3S69A 1WU1A 1IQMA 1YPLH 1FMGA 3MU0A 4FU9A 4NFEA 2A1DB 3V0XA 4B73A 1ANEA 1ABJH 1C2FA 3BF6H 2NU4E 4XOJA 3MO3A 5EOKA 1C1WH 5IK2D 1XUHA 3JZ2B 1YGCH 1L0ZA 2SGDE 1LCYA 2Q6DA 1G9IE 4P02A 4WJG2 4J2YB 4Y7AA 1TGBA 4D7FA 2OC7A 4XSKU 1CGHA 3D62A 2ZTZA 4INHA 1P2NA 1P3EA 1ACBE 4YT7H 4GCHG 8GCHG 4K1TA 4YO9A 1TA6A 1D3QB 1A2CH 1TRYA 5DP4A 1UVUH 2XWBI 3UAIC 2ZFSA 4MLFB 2QF5A 2KAIA 4AGKA 2J9NA 2OD3B 1F92A 1ZHPA 1GBIA 4IC6A 2ZGBH 1C1SA 1W10U 2UWLA 1O2VA 3GICB 2Q6GA 1A0HB 3TNSA 3A87A 1O37A 2WYJA 1SGIB 3SYJA 1KYNA 3VXEH 2B5TB 3MU1A 4H6TA 3A88A 1S5SA 1ELTA 1RTLA 2R3YA 3RXJA 2CHAC 1YCPH 2VH6A 2QIQA 2QYIA 3OFND 2BD4A 2M5TA 1EZXC 4XFQA 2UUYA 4TYDA 1PQAA 3BV9B 4I86A 1AB9B 2FPZA 4NA7A 3M7TA 4H6SB 4U32A 1VITH 3V12A 2WV9A 5C1XA 2G8TA 1J8AA 1K1NA 1EPTC 5EQRA 1BRCE 1TA2A 3UR9A 5EIYA 1KY9A 1C1UH 5KECA 1O3FA 3NCLA 2ZTXA 1V2JT 4ZHAA 5B6OA 2I6SA 4NA9H 1FX0B 1OXGA 3VB7A 4ZH8A 3T5FH 2H9EH 4O9VA 4D8NA 3SV2H 1PPZA 1LTOA 4OGYA 3TJVA 1MABB 3U9AH 1A0JA 3SZEA 4ISIH 5CHAB 1XUJA 4AG1A 3GY2A 1MZAA 4MPUA 2BQWB 1XMNB 1O3KA 2Z9GA 4A1XA 1O3GA 4UONA 1DY9A 2Y6TA 2H2ZA 1C9TA 2A2QH 1J9CH 1GBTA 1GI9B 1Z1IA 3GCHC 1MTSA 2FOMB 4WXIA 2GV7A 3Q76A 1UW7A 1GBKA 4AC9A 6LPRA 2GKVE 1E35B 2AERH 1OX1A 2TGTA 4B71A 1K1JA 1KLTA 4IN2A 1GBCA 2XNIA 3PV5A 3TITA 1ELGA 3AASA 2AMPA 2LNCA 1H8DH 3P70B 3SZNA 1ANCA 3T62A 1K21H 2WPJS 4X8VH 1BZXE 1WBGB 1Z6JH 4HFPB 3UQVA 2ZGXH 2HLCA 1C1NA 1O39A 1CT0E 5JDUB 3SJKA 2J5UA 2SGFE 3OYPA 2P3TB 1C5UA 2P3UB 1COWD 1Z8RA 5EJLA 1O2ZA 3LGUA 3LGTA 4ABFA 3MQKC 5LPRA 1ARCA 2Y5FA 5L30H 2L6OA 4F49A 1GBEA 1M9UA 3ZYDA 5C0TA 3VG8A 1MCTA 1PPEE 1D3DB 4ZMAH 4ZAEA 3FZZA 1BBRK 2XCFA 2HALA 2AFQB 1BBRH 2CV3A 4D7GA 2GZ8A 1SLXB 1PPBH 5C5NA 1THSH 2WPKS 1O34A 2ZHWH 1P2JA 2WPMS 1IHSH 2ZQ1A 1TPSA 1Y5AT 1C5MD 3VB6A 5JBTA 1A5GH 4R0IA 1LPKB 2YMSD 3RXAA 1FY1A 3KIDU 2UUFB 4WWYA 1GHAF 2ZKSA 1MAXA 2ZQ2A 1IQJA 4KTSA 2QE7D 3CNRA 5GDSH 5A8ZA 2KCOA 4TT3D 2A0QB 2FDAA 2VJ1A 5EXMA 3BEIB 2V7QD 4RI0A 4I32A 1FJSA 4LZ1H 4F55A 1W0JD 2J94A 1HAIH 2ODQA 2V3HH 2V3MA 2ZGCA 4I8HA 1G3DA 4HI3A 1SGQE 3H09A 3BTTE 1SQAA 1ELBA 1GI3A 2FOFA 3FFGA 4TWYA 5CDFE 3OSYA 1DS2E 4Y8YA 3F3BA 1S83A 1DWBH 3NUMA 3P17H 4D76A 2TRMA 4Y10E 1C2LA 3SU2A 4I8LA 2ZG0H 3UWIA 5E0HA 1BA8B 1FN8A 5H4IB 1C2MA 3BG8A 2EC9H 4BAHB 2LELA 2P59A 2RFKC 2ZHEH 4ZHMU 4B2AA 3M7UA 1F7ZA 3SGBE 2GJGA 1OOKB 4GLYA 3UQOA 3RP2A 4X0WU 1QL7A 2VWNA 2VINA 2WPIS 2Z9IA 2BD8A 2HRVA 5C0UA 2TBSA 1DLKB 1RGQA 3K65B 4ABAA 2A4OA 1UVPA 2TGDA 2ZFQH 2WPDD 1DICA 1ELFA 5T3HA 2PUXB 3GS9A 3GCOA 5HIYA 2BLVA 2EEKA 3VB3A 1AQ7A 4IC5A 1C5PA 1SBWA 1AUTC 5DN6D 1BRBE 2VGCB 3A82A 4D9QA 1C5OH 2FZZA 1BMFD 4DCDA 1BJVA 2KR7A 1VJ9U 1ANBA 1EUFA 1S6LA 4NIXA 2QXGA 1H1BA 2ZFPH 4ABHA 4J1YA 1LHDH 1MKWK 4MG3A 4I33A 4E06H 2WUCA 3P8GA 3F1SB 1O5CB 3TNTA 2C8WB 2P3FH 2OQUA 5B6LA 2QXJA 3GY3A 2GCTC 1O3BA 3BTKE 4I8GA 1MD8A 1LHEH 2AGGX 1AIXH 4K2YA 1C5SA 4CHAC 5JB9S 2PW8H 2RCEA 1IAUA 2ZU3A 1HLTH 4MNWA 2BVXH 1SOZA 5E8EH 1MTWA 2PGQB 5DP3A 1XVMA 3A7YA 2PTNA 3M5LA 4RKOB 3LJJA 1GJBB 2FMJA 3PO1B 3P92A 1FDPA 3PMBB 3LC5A 2OXSA 2BVSH 3MU8A 1CA8B 2VIVA 2YNBA 1P10A 3SV6A 4FU8A 2QAAA 5IYTA 1O2SA 1NU7B 4KTCA 6ESTA 2C3SA 1FAKH 1HJ9A 2BOHB 2PP6A 3L3TA 1O2WA 3QTOH 3ITIA 4F48B 1SPJA 5JBAS 1O2IA 4JK6A 1EOLA 1OWIA 4NZQA 1PQ7A 2GGVB 2HPQH 1VZQH 4FUFA 3VB5A 2VWMA 3R3GB 3TK9A 4BAQB 1GBAA 1Y3XA 3FO8D 2G00A 3EDXB 1TGSZ 2BYAX 1BTWA 3WWFA 2Z9JA 4Y6DA 1SC8U 1HDTH 1O5EH 1XXFA 3ZVEA 2XW9A 2BDAA 4GHTA 4MNYA 5E2PA 5EPNA 4B74A 1TMTH 2OLGA 3IITA 2FYQA 2J97A 1BMAA 5JBCS 2AHME 1O38A 3QGJA 2O8LA 1P09A 3E91A 3UIRA 3F6UH 1MBQA 1F0TA 4BNRA 3OY6U 5F6MA 3OEED 3S9AA 1GCTC 2FX6A 4YZUA 3PRDA 5DK1A 2VVCA 3PMAB 4O03A 4BOHA 2QF0A 3FOAA 3LGIA 1O2OA 4BXWA 3RXBA 1HJAB 5DO4H 1EX3A 1XKBC 3RXOA 1P2QA 1B0EA 1K1PA 1O2MA 3P6ZB 5DPAA 4BAKB 3M5OA 1W2KH 2XBWA 1GI7B 4YT6H 1IQKA 2FX4A 4NCYA 3P8FA 1WSSH 1AKSB 2BDYA 1ZRKA 2Y7ZA 2VVVA 1NO9H 2PFEA 1O3HA 1K9OE 2QN5T 2A7CA 1O3IA 1A46H 4A92A 8LPRA 1QRXA 5CMXH 1O3PB 4U01A 1AZ8A 1TMBH 1C2GA 5ESTE 2ZEBA 1SB1H 3Q3KA 1GHXH 2G51A 2ZF0H 4ZXXH 1YLNA 1T31A 3M61U 1YPKH 2F9VA 4BAOB 1TALA 2RA0A 1ZOMA 2G5VA 4NSYA 1QL8A 8KME2 3RXIA 3BG4C 3QWCH 3U28C 4Z6AH 2BD5A 1CBWB 1DWDH 4GAWA 5E0GA 2R2WU 2ZDVH 2AIPA 1O5DH 1CA0C 2GD4B 1QURH 4IS5A 3ZZ7A 1V2TT 2QCYA 3DT0H 4ZKSU 1ESBA 1O5AB 2K1QA 3F9EA 3S9BA 1GMHF 1P57B 2K8IA 4JZFH 2GZ7A 1FY3A 1D3PB 4NWLA 1GJ7B 1QRZA 6CHAB 3N7OA 2H5DA 2A5KA 2Z3EA 1VGCB 2ZP0H 3UFAA 1A0LA 2NU2E 1C5ZB 1EZSC 2Y80A 4AX9H 4KKDA 2TPIZ 3RXRA 3FP8E 4IBLH 3SBKA 4Y0ZE 1TBZH 4Y79A 1DE7H 1Z7KA 4A1VA 1AWHB 4AFUA 1TB6H 4DVAU 1P02A 2A7JA 3DSPA 2ODYB 3EYDA 3LU9B 1B0FA 3A8BA 1ELEE 1GBHA 2G55A 4X1QU 1Y5UT 2FM2A 1UHBB 2F9BH 4VGCB 2PGBB 1NS3A 4NZLA 1NPMA 4WY3A 5T6DA 2CF9H 1O3NA 1C5YB 1ZPZA 4X1NU 1DUEA 2OUAA 3SI4H 4BTIB 2ILNA 2O8UA 1XM1A 4B2CA 4ABIA 1YBWA 3AW1A 4MNXA 5EJZA 2Y5HA 1DWCH 1SFIA 2XCNA 2FIRH 3FANA 1QJ6B 7GCHF 5E2OA 5HXFA 2OC1A 1P2IA 1ZRBA 4X8UH 1PJPA 1YY3A 2ZDNA 3KQCA 1N8OC 1VKYA 1D3TB 2ZU4A 3E1XB 2BZ6H 3MU5A 3A7WA 4QT8C 5HM2A 1C1QA 1DM4B 3WWBA 3MH7A 2A4GA 2A4QA 1VCQA 1O2JA 2CHAB 2SNVA 1RD3B 2Z9LA 3RXGA 4ASUD 3A7ZA 1NESE 3VFEA 3MWIU 4LOYH 5KEDA 4Z0KA 1G32B 2Q1JA 2W3IA 3M5NA 1OYQA 1Z6EA 1OWDA 1TMUH 1NRRH 1BRAA 1C1MA 1UTJA 3ZVDA 3M36A 3RXTA 1HPGA 3MNXA 1EPTB 1LVMA 2GDDA 3SNBA 3DSGA 3MYWA 1ORFA 1F5RA 1GVKB 1SQTA 2PR3A 4GHQA 3UOPA 4AFZA 4AZ2B 2FESH 2O8TA 3F2GA 3N7DA 5EODA 3DD2H 3GY8A 3HPTB 4WXVA 3F9GA 4FUCA 4AG2A 1DWEH 4U2WA 2TGPZ 1H9IE 2A32A 1NRNH 4CH2B 1F0UA 1TE0A 3WW7A 1GBBA 4MPVA 4AFSA 1WQVH 3SV9A 1F2SE 3BSQA 1O5GH 2ZCHP 2GP9B 4Y8ZA 3SGQE 4E7RG 4FUDA 4ZKOU 2VIDA 1GMHG 3GCHB 4IN1A 3QUMP 3RXQA 1ELCA 1HRTH 5I25A 3GY4A 1GHWH 2XC0A 3VGCC 2F83A 1NFUA 4AB9A 5GCHF 1RXPA 5IDKA 1YPHC 1S82A 1AE5A 1V2NT 1P03A 1G30B 4FUIA 1O30A 1MTUA 4Y7BA 1C5RA 2OC8A 2XC5A 3M5MA 4NA8A 1SGTA 2BY8X 2P94A 1N1LA 1YYY1 5FXLA 1B7XB 3RXSA 2AMDA 1BTPA 2ASUB 3SU4A 2ZDLA 2CN0H 5TJXA 4NGAH 1GJ4H 2D2DA 3ZYEA 1GJ6A 1FONA 3GISB 3O8RA 4UFFH 1BUIA 1E37B 1GBDA 1O3LA 1SGRE 1UVOA 2C8YB 1GVZA 2DE9A 3SJIA 1SQRA 5A2MH 1SHYA 2B8OH 3B8JA 5HMAA 1MU6B 4WH6A 1QBOA 3KQBA 5DP8A 5HIZA 3T25A 7GCHG 4M7GA 2BD2A 3FP6E 4OS7A 4CREA 1C5VA 2OINA 5K0HA 3FN8A 3PTBA 3DSOA 2IPHA 3ZVCA 5F8XA 5CHBA 1O3DA 3MTYA 1YCPK 3KN2A 1FY4A 1DSTA 1YCPM 2OBOA 3UNRA 2C93B 1HAVB 1PPCE 3SV8A 2ODPA 1LHGH 1SL3A 2FOGA 2WV4A 1NRPH 1GI0A 5EQSA 3ATMA 2BQ6B 1AO5A 2ZCLP 1D9IA 4MQAA 1PPGE 1TNHA 1GBJA 3RXFA 1Q31A 3R0FA 4X2YA 1TABE 3FZDA 1E79D 1DFPA 1O3AA 2AIQA 4F4OC 3ATIA 2OTVA 2A45B 1FNIA 1LO6A 1BT7A 3OU0A 3SJOA 4A5TS 2H5CA 2IJOB 1O3EA 3N99A 1CHOF 5ETXA 1DVAH 1XUKA 2ZDKA 5DP5A 1K1LA 3CP7A 1PYTC 2JH6D 2C8XB 2IN2A 1GI2A 2CF8H 2A5IA 3SNCA 4CR5A 3BTME 1P04A 2FXRA 2F4LA 1AE8H 4P00A 2ANMH 4DIHH 1CGJE 1AKSA 1P9SA 2QF4A 1GG6C 1GBFA 4X8TH 5GCHG 1F5LA 1O2TA 3SV7A 2Z3DA 1C2JA 3OE7D 1GHZA 4JYTA 1C1PA 3RXVA 5LH8A 1C2IA 4BXSA 4WMFA 3EAJA 1EB2A 2JETC 1EAXA 1C5WB 5FPTA 2PWXA 3MNBA 2BDHA 5DJ7A 4CHAB 1AUJA 1LQEA 3GY5A 1YP9A 5FPYA 2J98B 1H8ED 1QB9A 1TOMH 3N7EA 5C1YA 1E38B 3DUXH 4CRGA 1N6YA 1S0QA 4Q7ZA 1KMHB 3RC5A 1F5KU 1QGFA 1ZHRA 3ZZCA 3URCA 4DT4A 1YPJH 2QGRA 4TWWA 1J16A 5FCRA 1OHHD 1E1QD 3VEQB 1G37A 1JBUH 2UWOA 4UDWH 1T8MA 4X2VA 1C2EA 1VCPA 3M3TA 3QX5H 5FCKA 1ZLRA 2PUQH 2ZFFH 5EW1H 1P3CA 4YXWD 2J2UA 4XRNA 4B6FA 3Q00A 2P8OB 1G3BA 1GI1A 4NWKA 4X6MA 2G5NA 5C3NA 1QR3E 1BBRE 1MCVA 2BDBA 3O8DA 1EP5A 3GY7A 1ARBA 1ZHMA 1KLJH 3S0NA 1V2ST 3DHKH 1ESAA 1UHBA 5PTPA 2VU8E 4THNH 3BTHE 1PPFE 5EU8A 3NRLA 1EAUA 2QXHA 3ZVGA 1DSUA 3A89A 3E3TA 2ZO3H 2JKHA 4X6NA 3UY9A 2F9OA 3UWJH 5I46H 4A1TA 2WV5A 3SO3A 4YTAA 5JB8S 4NIWA 3BN9A 1Z1JA 1S81A 3CS7A 5DP7A 1DLEA 2AGEX 1IQLA 1TBRH 3RU4T 1Y3WA 5EW2H 4K5ZA 1CHOG 1WDIA 3BTGE 3E0PB 4I7YH 4XDEA 4ZXYH 5DSFA 1FPHH 1GCTB 3GCNA 1QFKH 3S9CA 1C1TA 1BB0B 2KX4A 5C20A 4IMQA 1WUNH 3ODDA 1HJ8A 1H4WA 3RU4E 3HGNA 1O0DH 3MH5A 1QIXB 1GMDF 1O32A 2HNTC 4YOGA 4X1RU 3KNXA 5CHAC 4INLA 5TCAA 2EQNA 1ETRH 2P16A 5E0JA 1EJNA 4CBNA 2PV9B 3BTQE 3UNQA 1EPTA 1YPMH 1V2VT 1NRSH 3M3SA 2UUJB 3LDXH 1QA7A 2W6ID 1ZJKA 5CE1A 4LZ4B 3SW2B 1A4WH 3RM0H 1O33A 1QRWA 1G36A 3LPRA 3SI3H 4DURA 3E90B 1EKBB 4HTCH 3TVJB 4RSPA 2D1JA 1UCYH 3H7TA 3SJ9A 1C1OA 4DIIH 4B75A 3ATWA 3RMLH 3RXPA 1BHXB 2C8ZB 2FEQH 3KL6A 1ZSLA 3BG4B 1HV7A 2BDIA 3HK3B 2PKSC 1SGFG 5C94A 2ZI2H 2VVUA 3PYHA 1GPZA 1LVBA 4RT0A 2HVYB 1CA0B 1OS8A 3A7XA 1C5NH 3QGNB 7LPRA 1H8IH 1HIAB 2KFWA 4HZHA 1UTOA 1ZMJA 1HUTH 1TONA 4Q63A 3SGAE 1D4PB 2FWWA 2XBYA 2W5EA 2BZAA 1W14U 1N6XA 2VIWA 4HG6A 2FP7B 3TLOA 3RC4A 4X6OA 1GDUA 4Q7YA 4DGJA 2BD7A 1AFQC 1NU9A 3ZZDA 5EG4A 2F9PA 1V2UT 4FUBA 2J4IA 5C17A 1C2HA 3MH6A 1T32A 2P95A 4X6PA 4YLUA 5F03A 4TY7A 1P2KA 1BJUA 1BTUA 2BLWA 3MO6A 1KXEA 5A09A 4JCNA 2J92A 2WYGA 2OQ5A 2FLBH 3DCLA 1OWJA 3TK6A 2J38A 1O3MA 3GDSA 2FO9A 1DPOA 1Z8GA 1VJAU 4KP0A 1TNJA 4WMEA 2SGQE 4DW2U 1Q2WA 3A7TA 4MVNA 3PLKA 3SUEA 2H9HA 4MDSA 3SUDA 2GX4A 1O35A 1UK4A 2H1UA 4X2WA 1WAYB 1L1JA 1H9LB 1HFDA 2FLRH 5HM9A 2D26C 4Q2KA 1N8OB 1HAVA 4YM9A 1NFWA 1UTQA 1MH0A 2QC2A 1NT1A 1GMDG 1DDJA 4GPGA 1O31A 1FV9A 1YC0A 1RFNA 1D6WA 2F91A 2GV6A 2YMSC 2HLDD 3LH3A 2HGTH 2BD3A 3T27A 1TNKA 4FOUC 1LQDB 5FL7D 4BTTB 3Q77A 4H42U 4ACAA 1DXWA 4X1PU 2JIZD 1EJAA 3A80A 3FAOA 2VGCC 1K1OA 3AAVA 2BD9A 3SHAH 1TOCB 4ABJA 4R8TB 3KYFA 1V2MT 1NY22 5T6GA 1TNGA 1ZGVA 3ZZ4A 2W3KA 1NFYA 1S0RA 1AY6H 1HAXB 1CSOE 1ZMNA 2EI7A 4AOQA 2FOAA 1YLDA 1IQHA 3F9HA 1ZPCA 1O2KA 3U8RH 1HXFH 4ISOA 4K1SA 1BITA 1V2PT 2OCVB 3JZ1B 3HKJB 1DY8A 3MO9A 3A7VA 3MI4A 1SGCA 1SI5H 1C4V2 5AVDA 3GOVB 3F2HA 2BDCA 1TBQH 2GCHF 2ZHQH 2Y81A 3PV4A 3U8TH 1ZMLA 1CGIE 1KSNA 1QNJA 1S6FA 4CRDA 2A5AA 1GVLA 4ABDA 3VGCB 2KCAA 4NFFA 5F8ZA 1ID5H 1MTVA 2BHGA 2IJD1 2M2AA 2STBE 1J15A 2ZWLH 3GDVA 2A4RA 3EE7A 2QV1A 3UREA 1INCA 1RIWC 5EXNA 3BIVH 2Z94A 3ZVBA 1GBMA 1RTFB 2SGEE 5HKKD 4CH8B 1UVSH 1MKXK 2J34A 4INKA 3V7TA 1MKXH 5A0BA 2GMTC 2J98A 1S84A 2O8WA 1JRTA 3I78A 1YKTA 1HGTH 2QXIA 1YM0A 2AS9A 2NU0E 2RDLA 5A0AE 1BMLA 1WTGH 4LXBH 1GI4A 2BLOA 1GGDC 2STAE 3M3VA 3AAUA 5GWZA 1W0ZU 3W1EA 5BPEA 3SU3A 2Y7XA 4PROA 4FU7A 3UUZA 2L74A 3K9XB 1SHHB 2RDEA 1QA0A 3E0NB 1L4DA 4MPWA 1SMFE 2PTCE 1RRKA 1UK3A 1OWHA 5C1UA 1HYLA 4K8BA 2LPRA 3MU4A 3PM3A 2OK5A 5FPSA 1PYTD 1WOFA 2ZPSA 3TH4H 3W95A 1MBMA 3G01A 1GHVH 4UFDH 4MTBA 3CS0A 4UE7H 3FVFB 1QHRB 4TY6A 2OP9A 3MNCA 2BY5X 3PB1E 2PKAB 3PLBA 2ANWA 3TU7H 1C4Y2 2Y82A 1FAXA 1ZGIA 1HAGE 1ZSKA 2TIOA 1OWEA 1X7AC 3UR6A 4FVBA 5A8YA 3DFLA 1F0SA 1RJXB 3STJA 4OS4A 1HJAC 1TX7A 1UK2A 5JBBS 2RA3A 1W11U 3MMGA 1IQFA 2THFB 5JYIA 1GJ9B 1SLWB 3TJUA 1VITF 3GY6A 4AYYB 1TGTA 3F68H 3STIA 1GJCB 2VBCA 1O3JA 3ZZBA 3RM2H 1SGPE 1FQ3A 3LOXA 5K7RA 3EGKH 1P0SH 1C2DA 2EI6A 6GCHF 1AHTH 1T8OA 1YPHE 4DOQA 1C5QA 1TRNA 1ZYOA 2HVXA 5DP6A 8ESTE 4XD7D 5AFYH 5EGMA 2BLQA 1SGFA 1PFXC 1XUGA 3VB4A 1BQYA 1SGYE 4M9FA 1CO7E 3V13A 1O2NA 2FYRA 5DKMA 4X8SH 3UB0A 1GMCF 4ISNA 7ESTE 1GDQA 4UFGH 2FOHA 1K28D 4FXGH 2GCHG 1H9HE 1HAHH 2CK3D 1HAZB 1MQ6A 3SU5A 3GDUA 4GSOA 3A86A 4RKJB 1IQIA 2BM2A 1HCGA 1GI8B 1TLDA 3RMOH 1GG6B 3RXUA 1QJ1B 1Y3UA 2VIQA 1OYTH 1DANH 1SG8B 4Q80A 3PLPA 1GI5A 1YPGH 1C5XB 2BY7X 4Q4LA 3UNSA 4Q7XA 4OS5A 2VWLA 2Q6FA 4JK5A 3P8OA 4I31A 4ABBA 2FI5E 1NRQH 1GHBF 4HGCA 3EA8A 1NZQH 2JETB 5A0CA 5BRRE 3MHWU 2ZU1A 1T7CA 3PTNA 1GBLA 1JIRA 5GNDA 1UTMA 3KCGH 2WHXA 4AN7A 1ZTJA 2BDGA 2PHBA 1FPCH 3EE0B 2BOKA 4KELA 4NIVA 1LKAA 1W0YH 3RXCA 1QQ4A 4DT7B 4X2XA 2CXVA 2Z7FE 4H4FA 3QO6A 1FUJA 2AYWA 4B2BA 5GJ4B 4VGCC 3C1KA 1SOTA 2EA3A 1GJDB 1HIAA 1ZTKA 4K69A 9LPRA 1G2LA 2ANYA 2K0QA 3F2FA 1C2KA 2HNTF 5T6FA 1JIMA 1NTPA 1U6QA 1RTKA 2BQ7B 3QZRA 2XNDD 4Z1MD 3QN7A 2ZU5A 3U1JB 4I8JA 4LK4A 3ZV8A 1ABIH 1EATA 3E6PH 4IGDA 1LHCH 2ZHFH 1O36A 3DFJA 1HAOH 1SGEE 2ZDAH 3U69H 1P2MA 3M37A 1TX6A 3BTWE 1TGCA 2V0BA 3ZIAD 4OM9A 4TSFD 3LGYA 1O3CA 3W94A 1Y8TA 2B9LA 1VITG 1SVPA 3UTUH 3O8BA 1YLCA 2G4UA 2A31A 1GCDA 2H9TH 1EJMA 3LKWA 1SR5C 1MTNC 1KXFA 1XUFA 5AF9H 1C1RA 2JJ2D 2XYAA 3RU4D 1W12U 1HB0B 3BEFB 4FUGA 3ZVAA 3SUGA 4CRCA 6GCHG 3BTFE 3PMHB 2WSSD 2QA9E 1CT4E 1O3OA 1HAYB 3P8NA 2CGAA 4JZEH 3RXHA 1EASA 2C90B 5C67A 5C5OA 2W7UA 1UMAH 4AGJA 1GMCG 3SUFA 1BMMH 1WQSA 3IG6B 4K3JA 5L2YH 4KGAA 1K0HA 3RDZA 1H8HD 3SU1A 1DX5M 1ETSH 3AVZA 2OBQA 1WYKA 1TYNA 1DT2A 3V3MA 1V2KT 2R3UA 2Y5GA 4A7IB 4FUEA 1O2YA 1ELAA 3KEEA 4U30A 1WTHD 1LPGB 3A85A 3D65E 1Y3VA 4ZKNU 1ZZZA 3L33A 2A2XH 1A7SA 4WF8A 1GJ8B 2ZA5A 5FX6A 1UVTH 2ZIQH 1KDQB 1L2EA 1KXAA 5LGOA 1ANDA 2ZZUH 2FS8A 2GCTB 1THRH 1MU8B 1QBVH 3M7QA 3SU0A 1GHBG 2RG3A 3MNSA 4FUJA 1HNEE 1D6RA 1SGDE 1TAWA 1W0KD 2QF3A 3ODFA 1O2PA 4UFEH 4DG4A 2NWNA 2AMQA 1L4ZA 3T2NA 5FBEA 1V2QT 1IQNA 2FOBA 1NROH 2GDEH 3OEHD 3GCTF 1KXDA 1T8NA 1BCUH 3T29A 2PKSB 1TQ0B 3I29A 1L1NA 3U1IB 1QBNA 1W8BH 1LVYA 5DGJA 2FOCA 1GJ5H 3HK6B 2XBVA 2AGIX 4OS1A 3LIWA 1ZJDA 1NFXA 1Q3XA 3ELAH 1W13U 1AU8A 5T1VA 4B6EA 1BTZA 2FTMA 3A8CA 2XOKD 1PQ5A 1QB1A 4MPXA 1AZZA 5SGAE 1YF4A 2TGAA 1BTHH 2GVFA 1AFQB 3BTDE 3URDA 3HKIB 3QLPH 2XC4A 1PQ8A 1O5FH 1UTKA 4B76A 5KGOA 1A5HA 3A8DA 4O3UA 3AW0A 2NU1E 4B1TA 1FXYA 1V2OT 1NC6A 1QZ8A 4RN6A 1V2RT 2CJIA 3RXMA 2HNTE 2KZ4A 1CHGA 3PRBA 1AVGH 2V6NA 3ENSB 4Y76A 1JMOH 1BHXF 1AB9C 4OS6A 1P8VC 3BTEE 1AFEH 1BMNH 4FUHA 4CR9A 5GPIB 4O3TA 4ZCNA 1CQQA 4Y11E 2F9NA 4AB8A 1A1RA 3TJOA 2BMGB 3LJOA 3IWMA 2SGPE 4SGAE 3U8OH 2PLXA 3KGPA 4AORA 3L6PA 3M35A 3B9FH 1AVXA 2PKAA 1XUIA 2AEIH 4CRAA 1Z8JB 1VCWA 2R0KA 3OAAD 2GZ9A 1JXPA 1XX9A 2F9UA 4JZIA 1LDTT 1KXCA 2PSXA 5L2ZH 4CRBA 1SKYE 1A61H 3KQ5A 2B0FA 3WY8A 1CVWH 1UO6A 2XWAA 1LHFH 1JRSA 3Q3XA 2HPPH 4GVUA 1TWXB 2AH4X 2LP6A 4JZ1A 4NIYA 3PWBA 4ISLA 3MFJA 3QDZB 4FVDA 2YMSB 3NZIA 3F9FA 1TPPA 4OS2A 2ZCKP 3TGIE 2R9PA 1LVOA 4K1EA 1FY5A 2B7DH 4ESTE 3TIUA 2ZGHA 5TCCA 1S6HA 2KCPA 4RT1A 4AYVB 2WZQA 3TH3H 1IQGA 2F3CE 1EQ9A 1Y5BT 1HXEH 3ESTA 1MKWH 2ZGJA 3LGWA 3RLYH 1UCYK 3SJ8A 3MH4A 1KLIH 7KMEH 5AHGH 2GT7A 1MAYA 1EZQA 4ABEA 4DJZB 2WPLS 1IQEA 2BXUH 3K6YA 3GCTG 2GT8A 4A6LA 3K2UA 5A8XA 5G4BA 3O8CA 1EB1H 3LC3A 2YNAA 1MD7A 3B23B 1O2QA 2G52A 2JH5D 2ZPQA 1C4U2 4E05H 1SSXA 2SNWA 1OPHB 1P01A 1FN6A 1ESTA 1DOJA 4XBBA 2VB0A 3ZVFA 3SN8A 4JYUH 2ZECA 1SFQB 3D23A 1FLEE 2ZTYA 3RMNH 1GJAB 3SQEE 1G3CA 3GYMA 1UCYE 3S7KB 1AD8H 3PV2A 2NU3E 3UPEA 1G2MA 1P05A 3PWCA 1WV7H 3H7OA 1KTTB 3GYLB 3QTVH 2KAIB 3NWUA 4FETA 1V2LT 5FBIA 1RIWB 4K8YA 1AMHA 2O9QA 3I77A 1GHAG 3SQHE 1UTPA 5LPEA 1QCPA 2ULLA 2P8OC 3RXKA 4AFQA 3AK5A 2GMTB 2J95A 3HATH 3CENA 3A8AA 2DUCA 1EXFA 3LGVA 4ABGA 1AN1E 4NG9H 1ELVA 1O2UA 2FTLE 4ASHA 1A5IA 3ZZAA 3MOCA 2ZFRH 1GGDB 1TGNA 1E1RD 2FODA 1HAPH 3ZZ9A 1AI8H 1AVWA 1UTLM 3LT3A 2JH0D 1A3EH 4GUXA 1DXPA 1QQUA 3RUOA 4XBDA 4ZUHA 2A7HA 3D49H 1QB6A 1ZR0A 1OWKA 1Z71A 1EAIA 1EZUC 2ZC9H 2BTCE 2UUKB 1C1VH 1WCZA 1ELDE 2ZHDA 4YESB 2VNTA 1C5LH 5ESBA 1IHTH 1K2I1 1SGNE 3H5CB 1QL9A 2ALPA 5FHTA 3RC6A 2D8WA 2Z3CA 5JPMH 3PMJA 1B5GH 1OP8A 5GIBA 1BDAA 1LPZB 1Y59T 3Q3YA 1BOQA 2JDID 2KM0A 1OP2A 2KCYA 3A81A 1BIOA 9ESTA 5EJ1A 3QK1A 2FI3E 4YLQH 1AGJA 1O2GH 1AWFH 2VIPA 1O5BB 3NK8A 1HBTH 3RXEA 3C27B 1QTFA 4YOIA 3NXPA 1DITH 2PSYA 4IW4E 2FS9A 1NN6A 2BX4A 4ACBA 1LMWB 1VR1H 4XBCA 1PPHE 1FI8A 3KF2A 2EY4C 3TH2H 2ZU2A 5L6NH 1ZTLA 5LPFA 1FZZA 3ATKA 1CU1A 2ZDMA 1NBMD 2H6MA 3SORA 4BANB 4XE4A 4K60A 2ANKH 3T26A 2OC0A 1OKXA 3SNDA 1TX8A 2Z9KA 1Y3YA 3PO1C 2BVRH 3RMMH 1FY8E 3ZZ3A 3F0PA 3LH1A 1UTNA 1EP6A 2VWOA 2CMYA 4E7NA 2ALVA 2BX3A 1C9PA 3VXFH 1KDQA 2FI4E 1TPOA 5F8TA 3KYGA 1T4VH 3RLWH 1MQ5A 3ATLA 1TNIA 3P95A 5ABWA 1EOJA 2V3OH 2SGAA 1W7XH 3HGPA 1QJ7B 4NSVA 1GL1A 5F53A 1P11E 3SOSA 1JWTA 1BTXA 5EXLA 4TPYA 3U98H 3NKKA 1P06A 1ZSJA 2XRCA 3TGJE 4TPIZ 1F0RA 1GDNA 3F0OA 1A3BH 2IPQX 1MMJN 1YPEH 2O8MA 3T28A 1OP0A 1T4UH 3OY5U 1KTSB 3A83A 2ZPRA 2GTBA 3OTPA 4JYVH 2WINI 1RS0A 1GHYH 3S7HB 3SNEA 2QY0B 3ZZ6A 2HOBA 3SNAA 4X1SU 4ZROA 2XXLA 3RXDA 1MUEB 5FAHA 1L1GA 3QZQA 3BIUH 2F43B 1FIWA 4GCHF 4KTUA 8GCHF 5HGGA 1TQ7B 5C2ZA 5FX5A 4ZKRU 3ZV9A 3E8LA 4JMYA 4OGXA 1DUAA 4ZHLU 2W26A 4JZDH 2HWLB 2BY6X 5J4SA 4SGBE 5DG6A 2R2MB 1V2WT 2WPHS 1W7GH 4UD9H 1XXDA 2SFAA 3ZZ8A 1TFXA 2FOEA 1ETTH 3TK5A 1OSSA 3EQ0H 1J14A 3KQEA 2XTTB 2W7SA 2JJ1D 1P9UA 2WUBA 4MNVA 1K22H 4Y0YE 1TRMA 2UWPA 5J4QA 4Y71A 4YOJA 5HYOA 3OX7U 1CT2E 1E36B 3KQDA 1S85A 1MZDA 1MTNB 1EFRD 1GL0E 3EA7A 3SHCH 1O2LA 2BY9X 2VH0A 1XKAC 3A84A 2Z6BD 4WVPE 4DY7B 3OTJE 1QY6A 4Y8XA 1P2OA 1ZPBA 1P12E 4ISHH 1C5TA 2W6JD 2EI8A 1K1MA 1J17T 4BAMB 3KHVA 3ZZ5A 2I6QA 3K6ZA 1O2XA 5EPYA 4IMZA 1TNLA 1BTYA 2XBXA 2BB4A 3DA9B 1KXBA 1UJ1A 2IOTA 1WXRA 3NPSA 1TPAE 1O2HA 1V3XA 1KIGH 4WH8A 2VIOA 2G81E 3FKSD 3LONA 4O97A 2R0LA 3TPIZ 1CBWC 1E0FD 5DP9A 3VPKA 1V6DA 2ESTE 3TGKE 1THPB 1K1IA 1LKBA 1G3EA 1NM6A 2BXTH 2DE8A 3UOUA 4CBOA 5EQQA 2P93A 5GXPA 1YWUA 1SLVB 1T8LA 2YOLA 2ZNKH 3PROA 3RXLA 1W3CA 1EAWA 1BRUP 1O2RA 1GI6A 3FP7E 3BEUA 2C4FH 6CHAC 1NBME 1IOEA 1JOUB 3E16B 4BTUB 1CE5A 4CRFA 1VGCC 4UEHH 1XVOA 4WMDA 1SLUB 3TJNA 4I8KA 3EA9A 1TIOA 1GWAA 4D9RA
chains in the Genus database with same CATH topology
1Z8IB 2G4TA 2ZFTA 1FIZA 5AFZH 2V35A 3SU6A 1SQOA 1E34B 3S69A 1WU1A 1IQMA 1YPLH 1FMGA 3MU0A 4FU9A 4NFEA 2A1DB 3V0XA 4B73A 1ANEA 1ABJH 1C2FA 3BF6H 2NU4E 4XOJA 3MO3A 5EOKA 1C1WH 1XUHA 3JZ2B 1YGCH 1L0ZA 2SGDE 1LCYA 2Q6DA 1G9IE 4WJG2 4J2YB 4Y7AA 1TGBA 4D7FA 2OC7A 4XSKU 1CGHA 3D62A 2ZTZA 4INHA 1P2NA 1P3EA 1ACBE 4YT7H 4GCHG 8GCHG 4K1TA 4YO9A 1TA6A 1D3QB 1A2CH 1TRYA 5DP4A 1UVUH 2XWBI 2ZFSA 4MLFB 2KAIA 4AGKA 2J9NA 2OD3B 1F92A 1ZHPA 1GBIA 4IC6A 2ZGBH 1C1SA 1W10U 2UWLA 1O2VA 3GICB 2Q6GA 1A0HB 3TNSA 3A87A 1O37A 2WYJA 1SGIB 1KYNA 3VXEH 2B5TB 3MU1A 4H6TA 3A88A 1S5SA 1ELTA 1RTLA 2R3YA 3RXJA 2CHAC 1YCPH 2VH6A 2QIQA 2QYIA 2BD4A 2M5TA 1EZXC 4XFQA 2UUYA 4TYDA 1PQAA 3BV9B 1AB9B 2FPZA 4NA7A 3M7TA 4H6SB 4U32A 1VITH 3V12A 5C1XA 2G8TA 1J8AA 1K1NA 1EPTC 5EQRA 1BRCE 1TA2A 3UR9A 1KY9A 1C1UH 1O3FA 3NCLA 2ZTXA 1V2JT 4ZHAA 5B6OA 2I6SA 4NA9H 1OXGA 3VB7A 4ZH8A 3T5FH 2H9EH 4O9VA 4D8NA 3SV2H 1PPZA 1LTOA 4OGYA 3TJVA 3U9AH 1A0JA 4ISIH 5CHAB 1XUJA 4AG1A 3GY2A 1MZAA 4MPUA 2BQWB 1XMNB 1O3KA 2Z9GA 4A1XA 1O3GA 4UONA 1DY9A 2Y6TA 2H2ZA 1C9TA 2A2QH 1J9CH 1GBTA 1GI9B 1Z1IA 3GCHC 1MTSA 2FOMB 4WXIA 2GV7A 3Q76A 1GBKA 6LPRA 2GKVE 1E35B 2AERH 1OX1A 2TGTA 4B71A 1K1JA 1KLTA 4IN2A 1GBCA 2XNIA 3TITA 1ELGA 3AASA 2AMPA 2LNCA 1H8DH 3P70B 3SZNA 1ANCA 3T62A 1K21H 2WPJS 4X8VH 1BZXE 1WBGB 1Z6JH 4HFPB 3UQVA 2ZGXH 2HLCA 1C1NA 1O39A 1CT0E 5JDUB 3SJKA 2SGFE 3OYPA 2P3TB 1C5UA 2P3UB 1Z8RA 1O2ZA 3LGUA 3LGTA 4ABFA 5LPRA 1ARCA 2Y5FA 5L30H 4F49A 1GBEA 1M9UA 3ZYDA 1MCTA 1PPEE 1D3DB 4ZMAH 4ZAEA 3FZZA 1BBRK 2XCFA 2HALA 2AFQB 1BBRH 2CV3A 4D7GA 2GZ8A 1SLXB 1PPBH 5C5NA 1THSH 2WPKS 1O34A 2ZHWH 1P2JA 2WPMS 1IHSH 2ZQ1A 1TPSA 1Y5AT 1C5MD 3VB6A 5JBTA 1A5GH 4R0IA 1LPKB 3RXAA 1FY1A 3KIDU 2UUFB 4WWYA 1GHAF 2ZKSA 1MAXA 2ZQ2A 1IQJA 4KTSA 5GDSH 5A8ZA 2A0QB 2FDAA 2VJ1A 5EXMA 3BEIB 4I32A 1FJSA 4LZ1H 2J94A 1HAIH 2ODQA 2V3HH 2ZGCA 4I8HA 1G3DA 4HI3A 1SGQE 3BTTE 1SQAA 1ELBA 1GI3A 2FOFA 3FFGA 4TWYA 3OSYA 1DS2E 4Y8YA 1S83A 1DWBH 3NUMA 3P17H 4D76A 2TRMA 4Y10E 1C2LA 3SU2A 4I8LA 2ZG0H 3UWIA 5E0HA 1BA8B 1FN8A 5H4IB 1C2MA 3BG8A 2EC9H 4BAHB 2P59A 2ZHEH 4ZHMU 4B2AA 3M7UA 1F7ZA 3SGBE 1OOKB 4GLYA 3UQOA 3RP2A 4X0WU 1QL7A 2VWNA 2VINA 2WPIS 2Z9IA 2BD8A 2HRVA 2TBSA 1DLKB 1RGQA 3K65B 4ABAA 2A4OA 1UVPA 2TGDA 2ZFQH 1DICA 1ELFA 5T3HA 2PUXB 3GCOA 3VB3A 2BLVA 2EEKA 1AQ7A 4IC5A 1C5PA 1SBWA 1AUTC 1BRBE 2VGCB 3A82A 4D9QA 1C5OH 2FZZA 4DCDA 1BJVA 1VJ9U 1ANBA 1EUFA 4NIXA 2QXGA 1H1BA 2ZFPH 4ABHA 4J1YA 1LHDH 1MKWK 4MG3A 4I33A 4E06H 2WUCA 3P8GA 3F1SB 1O5CB 3TNTA 2C8WB 2P3FH 2OQUA 2QXJA 3GY3A 2GCTC 1O3BA 3BTKE 4I8GA 1MD8A 1LHEH 2AGGX 1AIXH 4K2YA 1C5SA 4CHAC 5JB9S 2PW8H 2RCEA 1IAUA 2ZU3A 1HLTH 4MNWA 2BVXH 1SOZA 5E8EH 1MTWA 2PGQB 5DP3A 1XVMA 3A7YA 2PTNA 3M5LA 4RKOB 3LJJA 1GJBB 2FMJA 3PO1B 3P92A 1FDPA 3PMBB 3LC5A 2OXSA 2BVSH 3MU8A 1CA8B 2VIVA 2YNBA 1P10A 3SV6A 4FU8A 2QAAA 5IYTA 1O2SA 1NU7B 4KTCA 6ESTA 2C3SA 1FAKH 1HJ9A 2BOHB 3L3TA 1O2WA 3QTOH 3ITIA 1SPJA 5JBAS 1O2IA 4JK6A 1EOLA 1OWIA 4NZQA 1PQ7A 2GGVB 2HPQH 1VZQH 4FUFA 3VB5A 2VWMA 3R3GB 3TK9A 4BAQB 1GBAA 1Y3XA 2G00A 3EDXB 1TGSZ 2BYAX 1BTWA 2Z9JA 4Y6DA 1SC8U 1HDTH 1O5EH 1XXFA 3ZVEA 2XW9A 2BDAA 4GHTA 4MNYA 5E2PA 5EPNA 4B74A 1TMTH 2OLGA 3IITA 2FYQA 1BMAA 5JBCS 1O38A 3QGJA 2O8LA 1P09A 3E91A 3UIRA 3F6UH 1MBQA 1F0TA 4BNRA 3OY6U 5F6MA 3S9AA 1GCTC 2FX6A 4YZUA 5DK1A 2VVCA 3PMAB 4O03A 4BOHA 2QF0A 3LGIA 1O2OA 4BXWA 3RXBA 1HJAB 5DO4H 1EX3A 1XKBC 3RXOA 1P2QA 1B0EA 1K1PA 1O2MA 3P6ZB 5DPAA 4BAKB 3M5OA 1W2KH 2XBWA 1GI7B 4YT6H 1IQKA 2FX4A 4NCYA 3P8FA 1WSSH 1AKSB 2BDYA 1ZRKA 2Y7ZA 2VVVA 1NO9H 2PFEA 1O3HA 1K9OE 2QN5T 2A7CA 1O3IA 1A46H 4A92A 8LPRA 1QRXA 5CMXH 1O3PB 4U01A 1AZ8A 1TMBH 1C2GA 5ESTE 2ZEBA 1SB1H 3Q3KA 1GHXH 2G51A 2ZF0H 4ZXXH 1T31A 3M61U 1YPKH 2F9VA 4BAOB 1TALA 2RA0A 1ZOMA 2G5VA 4NSYA 1QL8A 8KME2 3RXIA 3BG4C 3QWCH 4Z6AH 2BD5A 1CBWB 1DWDH 4GAWA 5E0GA 2R2WU 2ZDVH 2AIPA 1O5DH 1CA0C 2GD4B 1QURH 4IS5A 3ZZ7A 1V2TT 2QCYA 3DT0H 4ZKSU 1ESBA 1O5AB 2K1QA 3F9EA 3S9BA 1GMHF 1P57B 4JZFH 2GZ7A 1FY3A 1D3PB 4NWLA 1GJ7B 1QRZA 6CHAB 3N7OA 2H5DA 2A5KA 2Z3EA 1VGCB 2ZP0H 3UFAA 1A0LA 2NU2E 1C5ZB 1EZSC 2Y80A 4AX9H 4KKDA 2TPIZ 3RXRA 3FP8E 4IBLH 3SBKA 4Y0ZE 1TBZH 4Y79A 1DE7H 1Z7KA 4A1VA 1AWHB 4AFUA 1TB6H 4DVAU 1P02A 2A7JA 2ODYB 3EYDA 3LU9B 1B0FA 3A8BA 1ELEE 1GBHA 2G55A 4X1QU 1Y5UT 2FM2A 1UHBB 2F9BH 4VGCB 2PGBB 1NS3A 4NZLA 1NPMA 4WY3A 5T6DA 2CF9H 1O3NA 1C5YB 1ZPZA 4X1NU 1DUEA 2OUAA 3SI4H 4BTIB 2ILNA 2O8UA 1XM1A 4B2CA 4ABIA 1YBWA 3AW1A 4MNXA 2Y5HA 1DWCH 1SFIA 2XCNA 2FIRH 3FANA 1QJ6B 7GCHF 5E2OA 5HXFA 2OC1A 1P2IA 1ZRBA 4X8UH 1PJPA 2ZDNA 3KQCA 1N8OC 1D3TB 2ZU4A 3E1XB 2BZ6H 3MU5A 3A7WA 4QT8C 5HM2A 1C1QA 1DM4B 3MH7A 2A4GA 2A4QA 1VCQA 1O2JA 2CHAB 2SNVA 1RD3B 2Z9LA 3RXGA 3A7ZA 1NESE 3VFEA 3MWIU 4LOYH 4Z0KA 1G32B 2Q1JA 2W3IA 3M5NA 1OYQA 1Z6EA 1OWDA 1TMUH 1NRRH 1BRAA 1C1MA 1UTJA 3ZVDA 3M36A 3RXTA 1HPGA 3MNXA 1EPTB 1LVMA 2GDDA 3SNBA 3MYWA 1ORFA 1F5RA 1GVKB 1SQTA 2PR3A 4GHQA 3UOPA 4AFZA 4AZ2B 2FESH 2O8TA 5EODA 3DD2H 3GY8A 3HPTB 4WXVA 3F9GA 4FUCA 4AG2A 1DWEH 4U2WA 2TGPZ 1H9IE 2A32A 1NRNH 4CH2B 1F0UA 1TE0A 1GBBA 4MPVA 4AFSA 1WQVH 3SV9A 1F2SE 3BSQA 1O5GH 2ZCHP 2GP9B 4Y8ZA 3SGQE 4E7RG 4FUDA 4ZKOU 2VIDA 1GMHG 3GCHB 4IN1A 3QUMP 3RXQA 1ELCA 1HRTH 5I25A 3GY4A 1GHWH 2XC0A 3VGCC 2F83A 1NFUA 4AB9A 5GCHF 1RXPA 5IDKA 1YPHC 1S82A 1AE5A 1V2NT 1P03A 1G30B 4FUIA 1O30A 1MTUA 4Y7BA 1C5RA 2OC8A 2XC5A 3M5MA 4NA8A 1SGTA 2BY8X 2P94A 1N1LA 1YYY1 5FXLA 1B7XB 3RXSA 2AMDA 1BTPA 2ASUB 3SU4A 2ZDLA 2CN0H 5TJXA 4NGAH 1GJ4H 2D2DA 3ZYEA 1GJ6A 1FONA 3GISB 3O8RA 4UFFH 1BUIA 1E37B 1GBDA 1O3LA 1SGRE 1UVOA 2C8YB 1GVZA 2DE9A 3SJIA 5A2MH 1SHYA 2B8OH 3B8JA 5HMAA 1MU6B 4WH6A 1QBOA 3KQBA 5DP8A 3T25A 7GCHG 4M7GA 2BD2A 3FP6E 4OS7A 4CREA 1C5VA 2OINA 5K0HA 3PTBA 2IPHA 3ZVCA 5F8XA 1O3DA 3MTYA 1YCPK 3KN2A 1FY4A 1DSTA 1YCPM 2OBOA 3UNRA 2C93B 1HAVB 1PPCE 3SV8A 2ODPA 1LHGH 1SL3A 2FOGA 2WV4A 1NRPH 1GI0A 5EQSA 3ATMA 2BQ6B 1AO5A 2ZCLP 1D9IA 4MQAA 1PPGE 1TNHA 1GBJA 3RXFA 1Q31A 3R0FA 4X2YA 1TABE 3FZDA 1DFPA 1O3AA 2AIQA 4F4OC 3ATIA 2OTVA 2A45B 1FNIA 1LO6A 1BT7A 3OU0A 3SJOA 4A5TS 2H5CA 2IJOB 1O3EA 1CHOF 5ETXA 1DVAH 1XUKA 2ZDKA 5DP5A 1K1LA 3CP7A 1PYTC 2JH6D 2C8XB 2IN2A 1GI2A 2CF8H 2A5IA 3SNCA 4CR5A 3BTME 1P04A 2FXRA 1AE8H 2ANMH 4DIHH 1CGJE 1AKSA 1P9SA 1GG6C 1GBFA 4X8TH 5GCHG 1F5LA 1O2TA 3SV7A 2Z3DA 1C2JA 1GHZA 4JYTA 1C1PA 3RXVA 5LH8A 1C2IA 4BXSA 4WMFA 3EAJA 1EB2A 2JETC 1EAXA 1C5WB 5FPTA 2PWXA 3MNBA 2BDHA 5DJ7A 4CHAB 1AUJA 1LQEA 3GY5A 1YP9A 5FPYA 1QB9A 1TOMH 5C1YA 1E38B 3DUXH 4CRGA 1N6YA 1S0QA 4Q7ZA 3RC5A 1F5KU 1QGFA 1ZHRA 3ZZCA 3URCA 1YPJH 2QGRA 4TWWA 1J16A 5FCRA 3VEQB 1G37A 1JBUH 2UWOA 4UDWH 1T8MA 4X2VA 1C2EA 1VCPA 3M3TA 3QX5H 5FCKA 1ZLRA 2PUQH 2ZFFH 5EW1H 1P3CA 2J2UA 3Q00A 2P8OB 1G3BA 1GI1A 4NWKA 4X6MA 2G5NA 5C3NA 1QR3E 1BBRE 1MCVA 2BDBA 3O8DA 1EP5A 3GY7A 1ARBA 1ZHMA 1KLJH 3S0NA 1V2ST 3DHKH 1ESAA 1UHBA 5PTPA 2VU8E 4THNH 3BTHE 1PPFE 5EU8A 1EAUA 2QXHA 3ZVGA 1DSUA 3A89A 3E3TA 2ZO3H 2JKHA 4X6NA 3UY9A 2F9OA 3UWJH 5I46H 4A1TA 2WV5A 3SO3A 4YTAA 5JB8S 4NIWA 3BN9A 1Z1JA 1S81A 3CS7A 5DP7A 1DLEA 2AGEX 1IQLA 1TBRH 3RU4T 1Y3WA 5EW2H 4K5ZA 1CHOG 3BTGE 3E0PB 4I7YH 4XDEA 4ZXYH 1FPHH 1GCTB 3GCNA 1QFKH 3S9CA 1C1TA 1BB0B 5C20A 4IMQA 1WUNH 3ODDA 1HJ8A 1H4WA 3RU4E 3HGNA 1O0DH 3MH5A 1QIXB 1GMDF 1O32A 2HNTC 4YOGA 4X1RU 3KNXA 5CHAC 4INLA 5TCAA 1ETRH 2P16A 5E0JA 1EJNA 4CBNA 2PV9B 3BTQE 3UNQA 1EPTA 1YPMH 1V2VT 1NRSH 3M3SA 2UUJB 3LDXH 1QA7A 1ZJKA 5CE1A 4LZ4B 3SW2B 1A4WH 3RM0H 1O33A 1QRWA 1G36A 3LPRA 3SI3H 4DURA 3E90B 1EKBB 4HTCH 3TVJB 4RSPA 2D1JA 1UCYH 3H7TA 3SJ9A 1C1OA 4DIIH 4B75A 3ATWA 3RMLH 3RXPA 1BHXB 2C8ZB 2FEQH 3KL6A 1ZSLA 3BG4B 1HV7A 2BDIA 3HK3B 2PKSC 1SGFG 2ZI2H 2VVUA 3PYHA 1GPZA 1LVBA 1CA0B 1OS8A 3A7XA 1C5NH 3QGNB 7LPRA 1H8IH 1HIAB 4HZHA 1UTOA 1ZMJA 1HUTH 1TONA 3SGAE 1D4PB 2FWWA 2XBYA 2W5EA 2BZAA 1W14U 1N6XA 2VIWA 3TLOA 2FP7B 3RC4A 4X6OA 1GDUA 4Q7YA 4DGJA 2BD7A 1AFQC 1NU9A 3ZZDA 5EG4A 2F9PA 1V2UT 4FUBA 2J4IA 1C2HA 3MH6A 1T32A 2P95A 4X6PA 4YLUA 5F03A 4TY7A 1P2KA