1MMJN

Porcine pancreatic elastase complexed with a potent peptidyl inhibitor, fr136706
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title True interaction mode of porcine pancreatic elastase with FR136706, a potent peptidyl inhibitor
pubmed doi rcsb
molecule keywords elastase 1
molecule tags Hydrolase
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mmjN02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mmjN01
4KTUA 4AN7A 2VIQA 3MO3A 3BV9B 3RXCA 4D9QA 3Q3XA 2GT7A 3TH4H 1GI6A 4YO9A 3RUOA 1P01A 4DJZB 1CU1A 3SGQE 1P2MA 3UWJH 3SU2A 1OPHB 3T25A 2ZFRH 2PUXB 1BTYA 2BDCA 4Y11E 2FOGA 3A80A 3PV4A 2NWNA 1V2ST 3BTHE 3Q3YA 4E05H 2ZTYA 1YCPM 2ZFQH 3V12A 1C5XB 1ZZZA 1TBRH 6GCHF 1ELAA 3Q76A 8LPRA 4WXIA 1GMCF 6CHAC 1P12E 3KQDA 3WY8A 1XUGA 2UWLA 3HKJB 4Y8XA 2OC1A 1QJ6B 4GCHG 1QBOA 1LHEH 2WPMS 1BIOA 2FEQH 1ZTJA 1JBUH 3TVJB 3QZRA 3HGNA 5FBIA 1HXEH 3KGPA 4ABFA 2ZQ1A 1EATA 3O8RA 3UREA 1FI8A 1EB1H 4AOQA 2AIPA 1O38A 3IWMA 1C1NA 1P06A 2ZGCA 3QK1A 1RIWC 4TY6A 1GMDG 3NKKA 2GKVE 5LPRA 2SNVA 2NU4E 1GVKB 1XX9A 2ZPRA 1MQ5A 4QT8C 1Q2WA 1NESE 3ZZ9A 1TLDA 4WY3A 3URCA 3TK6A 3TLOA 1W7GH 4MNWA 3ODFA 4CRCA 1QJ1B 3S7HB 3E16B 3LGUA 1X7AC 2AMPA 5DP3A 1NFUA 4ZXYH 1WQSA 1C5QA 4JYTA 1P04A 1O5EH 1HB0B 1FMGA 4LK4A 1UTJA 3SV6A 1AO5A 1INCA 2B5TB 1YPEH 1HAPH 1YF4A 4D7GA 2OD3B 3VB6A 1V2WT 4BTIB 1D9IA 4A1VA 4ZKOU 1ZPBA 1BMMH 1S85A 4K2YA 3KQCA 1WAYB 4I32A 4ZAEA 2QIQA 3E6PH 1D3DB 1C5SA 1UCYE 3B23B 1P2OA 1LQDB 2PSXA 1MU8B 5EGMA 5EPNA 3M7TA 1LHCH 2PKAA 1GG6B 5FX5A 3W95A 5GPIB 1V2QT 1T8NA 3SI4H 4B73A 1BTXA 2QF0A 3QGNB 1VR1H 3GY2A 1C4U2 4BAKB 3K65B 1QIXB 1EAWA 1UHBA 3ZZ4A 1C2FA 3SQEE 4ZXXH 5J4SA 1NTPA 5LPEA 4AORA 1GCTB 1NRSH 3ATWA 3RXTA 1GBKA 3FZZA 2BQ6B 1C5VA 1VJ9U 1NZQH 2WV4A 3G01A 2FI4E 2F83A 2GT8A 3TJNA 5DP8A 1ABIH 1XKBC 4O03A 1QB9A 3RU4E 1ELCA 2PTNA 2Z3CA 4DW2U 8ESTE 4YM9A 2BY7X 4HZHA 5FPSA 3ZZAA 3MU0A 3VXEH 1UTNA 1V2VT 3GY6A 1NROH 2QYIA 3PWCA 6GCHG 2FIRH 2VVVA 1LVBA 1Y5BT 5FPTA 2BDGA 5AFZH 1EPTA 2IJOB 3ODDA 3W94A 1UVOA 1A46H 1GMCG 1C2JA 1CGHA 3T27A 3ZZ6A 4D76A 1O2QA 1XXFA 1CT4E 1F0UA 1AB9C 1IQLA 2PTCE 2VINA 3F9HA 5CHAC 5FHTA 1VITH 4NZQA 1O3AA 3QUMP 3SUDA 2B7DH 2H2ZA 1YPLH 2EC9H 2FLBH 1V6DA 2FODA 3AW0A 1L2EA 3HPTB 1BUIA 1KXDA 1ZMLA 2OC7A 4IW4E 1RGQA 1UO6A 1NFXA 2C93B 4DIHH 1HAGE 1EP6A 2WPIS 4Z0KA 1P10A 3B8JA 1SHHB 4YOGA 1C5OH 4XOJA 4IMZA 3BEIB 2WYJA 1XKAC 3AASA 3LDXH 5E2PA 1D3QB 5F6MA 2BB4A 1SSXA 1C5LH 4CRGA 1XVOA 5F8ZA 1AKSA 5B6OA 1GBBA 1VGCC 1ARCA 4HFPB 4AZ2B 2I6SA 2J34A 1JMOH 1QRXA 5EQQA 5A0AE 4XBBA 3GCHB 3PLBA 2A2QH 1BBRH 2QA9E 1C1SA 3PYHA 1Z8IB 2VH0A 4AG2A 2J95A 4HGCA 4K1SA 1C1RA 2STBE 1QBNA 1AMHA 1DLKB 4OS1A 1FN8A 2GMTB 4PROA 2P94A 4DY7B 2RA0A 1KLTA 4J2YB 3NUMA 4UONA 4K8YA 2Z9KA 1FV9A 1HJAB 4H4FA 3PO1C 1KXCA 1P2JA 2ZU4A 3RXHA 2GCTB 2A4QA 1EZSC 3KF2A 1QL9A 4VGCB 1MKXK 2VH6A 2QCYA 2FP7B 5C67A 1BTWA 1C5NH 2H6MA 2VWOA 4F49A 2AERH 1SOTA 3UOPA 3EYDA 3S0NA 3V0XA 1K21H 1GCDA 6LPRA 4X6MA 1C5WB 1TONA 4X6NA 3URDA 1LDTT 1EAXA 3GY7A 1BJUA 3QWCH 3RXAA 2TIOA 3M5LA 1HAZB 1J14A 1JIMA 1SFQB 1WUNH 5JDUB 1D3PB 1YYY1 2GTBA 1MTUA 4X8TH 3I29A 1K22H 1Z8GA 3TNTA 3KIDU 1WQVH 2O8WA 4B76A 1FONA 1GBEA 3GY5A 4BANB 2WPKS 2ZKSA 1DWBH 1TNGA 3OU0A 1NFWA 1F5LA 2FX4A 4KGAA 1FNIA 1W11U 1C1PA 1TNLA 3GCNA 1A0LA 1GI7B 4X8VH 2A32A 3H7OA 3STJA 1VCPA 2XTTB 4YTAA 3GY4A 4AFQA 3BTEE 1EPTC 1TFXA 2LNCA 2QXHA 3PLKA 4FUDA 4NIVA 1BMNH 1WTHD 4B2AA 1OYQA 2AYWA 1CHGA 2STAE 3MNSA 2GZ7A 1GI3A 2R3UA 5GIBA 1MKXH 2QN5T 3SORA 4ISNA 1FIWA 3U8RH 1O5CB 2ZCKP 3OTJE 3D23A 1HNEE 1CHOG 1GBLA 1PPBH 2FZZA 1TWXB 1NRNH 5GXPA 5DGJA 1TGBA 2BOHB 3E0PB 3QZQA 4WVPE 1BHXF 3A87A 1THPB 1ZSLA 5IDKA 2IPHA 3LT3A 4I8KA 1TBQH 4X1QU 2ZIQH 3RXBA 3LONA 2ILNA 5LGOA 2C4FH 3OX7U 1AE5A 3TIUA 1P0SH 1SVPA 1A61H 1AY6H 1BRBE 1CA0C 3EA9A 3SUEA 2G52A 3MH5A 4K3JA 4CR9A 2AGIX 1AQ7A 4CH2B 5PTPA 1Z7KA 1G2MA 3PMAB 1A3EH 1P03A 2HNTE 2ZEBA 4D7FA 7KMEH 1SOZA 1YPKH 3T29A 1OXGA 1P05A 2V3HH 2Y7ZA 1L1GA 2ASUB 1O5DH 2PW8H 2JETB 2FXRA 1P2KA 2Y80A 4O9VA 2BY5X 4BAQB 1MAYA 1TGTA 1BBRE 1GBTA 4I8JA 3A88A 1O3KA 1AVGH 3V3MA 3RXVA 1F0SA 3ZZ5A 2VGCB 3BN9A 1AU8A 1GJ9B 2RG3A 1KTTB 2PKSC 1PPCE 4ESTE 1BRAA 1BJVA 3SNBA 4Y7AA 1MTVA 1SQTA 1C4V2 1AUTC 1O2JA 1T4UH 2P3TB 3RMNH 1BHXB 2YNAA 3I78A 1MTNC 4CRFA 1J8AA 3SJ9A 2BQWB 1EQ9A 4OS6A 1F0TA 1G37A 2VIWA 4WF8A 2G51A 1GL0E 5TJXA 3ZZBA 3O8CA 2CHAC 4Q7ZA 1S6FA 1V2MT 1O0DH 4GUXA 3GY3A 1ZJKA 1O32A 1EZUC 3EQ0H 4X0WU 1ELEE 2BVXH 4ZHAA 3CS7A 3MYWA 1FPCH 3M5NA 5EPYA 5DP6A 2J92A 1UMAH 1GJBB 4KP0A 5DJ7A 4HI3A 1H8DH 5LH8A 1O37A 4X6PA 3MH7A 3SU1A 5JBTA 5GDSH 1DSUA 1GPZA 2G81E 3EGKH 4Y79A 5C1YA 1TRNA 3MNBA 1DM4B 1TQ7B 3V7TA 2F3CE 2Z6BD 3ZVCA 1TX7A 5H4IB 3UNQA 3GYLB 3BIUH 4M7GA 1ZPZA 5GJ4B 2FS8A 1C2KA 1AGJA 1VITF 1G3BA 1EJNA 4YESB 1D6WA 5AHGH 2QAAA 3SGAE 1ESTA 3AVZA 1C1WH 1XM1A 4UE7H 4X1SU 1S83A 3B9FH 4ABHA 3RLYH 1OOKB 1F5KU 1XVMA 2WYGA 3Q3KA 1A4WH 2D1JA 1QA7A 1SGRE 4FUHA 4X2VA 5L6NH 3P8GA 1O2SA 2ZU5A 2GV7A 2G4TA 1NRQH 1TMBH 2Y5HA 3K9XB 2Z9IA 3TJUA 1N6YA 4BTTB 1S84A 4R0IA 1SGQE 1OWDA 2HNTF 3Q77A 4H6SB 2O9QA 2XYAA 2PGQB 1EJMA 1ELGA 1JIRA 4K1TA 1TX6A 5EXMA 5C3NA 1ZTKA 2AH4X 3M3SA 2FOBA 4A1TA 1XUHA 4CHAB 3NWUA 1ZMJA 1A0JA 4O97A 4LOYH 1NC6A 2A4GA 3A86A 1SI5H 4X2XA 3SI3H 4DURA 1CVWH 1YPGH 1Z6JH 1ARBA 1OWHA 4YT6H 1TA2A 3F68H 4JK6A 1KDQB 2V3OH 3SU3A 3UY9A 2FM2A 1BTPA 5DP7A 1HDTH 1SGDE 4YZUA 2C3SA 1EUFA 1PPFE 1QR3E 3SQHE 1ETRH 4NA8A 4GAWA 4JZDH 1F92A 1C1UH 3U69H 1LVOA 3DFJA 1ZSJA 3VGCB 3D49H 3MOCA 4XE4A 1K1IA 1HAXB 1TOCB 1P3CA 5I25A 2P93A 5DP5A 2J9NA 2AMDA 1HRTH 1TGCA 1E0FD 2FYQA 2GV6A 2LPRA 2ZA5A 1GJ8B 1O2GH 2AGEX 3AAVA 2XBXA 1C1TA 3ZVGA 2RA3A 2QV1A 2BD3A 4Q80A 1ELBA 1K1PA 2FWWA 3SNDA 1DXPA 3QTOH 1SGCA 2OTVA 1QURH 1SLUB 3VB4A 2CV3A 3TH3H 4BAOB 1MTWA 3A7VA 4B2CA 3I77A 1BCUH 2WUCA 1GI1A 1GL1A 3ZYDA 2BVSH 5C1XA 1J16A 1ZJDA 4CR5A 4JCNA 1BTHH 2ZFFH 3TH2H 4FUJA 3FANA 1O3DA 2XCNA 1ELFA 3R3GB 2KAIB 4Q7YA 1RXPA 2A45B 2K1QA 1IAUA 2G00A 3M3TA 1JRTA 2OC0A 2ZTXA 4WMEA 1FAXA 1Z8JB 4E7RG 1BTUA 1SB1H 4TWYA 3PROA 3ZZ3A 1IQJA 4AFUA 1AWHB 1IQMA 2G4UA 3BIVH 5A0BA 1GJ7B 4SGBE 1OP8A 2EI7A 4ZROA 3U8OH 2H1UA 1GHVH 1MTSA 1MU6B 4FVBA 3FP8E 4B71A 2JH0D 1HJ9A 2F9BH 1EOLA 1GGDC 1WSSH 1MD8A 1ELTA 5F8XA 2W5EA 3RDZA 5FAHA 3PTNA 1EZQA 3TNSA 2ODYB 1LTOA 4ABJA 1ID5H 3JZ1B 3MU5A 3LJJA 5L2ZH 1ORFA 4IS5A 1SGFG 1KIGH 3T62A 2ULLA 3SZNA 1FXYA 1TX8A 2GDEH 4TPYA 1KSNA 4X2WA 2UUKB 4JZIA 1O5GH 4Y8ZA 2Z9JA 2BHGA 4IC5A 2DE8A 2GD4B 4JMYA 5EXLA 3PMJA 5HM9A 1T32A 3MO9A 1UJ1A 2SGDE 1TIOA 3NXPA 2J38A 2ZDNA 2QF3A 3GOVB 1DITH 1O3CA 3TK9A 3BF6H 4FUFA 3H7TA 3BG8A 4NIXA 4FUIA 4RKOB 2I6QA 2OCVB 2D8WA 1P2QA 4Y6DA 1IQEA 2F91A 5E0JA 3STIA 1GHZA 1E37B 2HWLB 1TPAE 4KTSA 4NCYA 1IOEA 1GJ6A 1O2HA 1A3BH 1BZXE 2G8TA 2ZF0H 4WMDA 2VWLA 3U9AH 4ZH8A 2P3UB 3F9FA 1TPSA 3JZ2B 3O8DA 2Z9GA 2FO9A 1V2JT 4OS5A 4ABEA 4ABDA 5AVDA 1G2LA 2ZDKA 3SU0A 4JYUH 1O5AB 2EA3A 5EG4A 1PPZA 1XUIA 2PGBB 1FY8E 4CRDA 1C2EA 1OSSA 3SUGA 3RMLH 4MPWA 3ZV8A 3F9GA 1GJ5H 2OP9A 4GHQA 5L2YH 1ZRKA 5FBEA 1SMFE 6CHAB 5EODA 5DK1A 1W3CA 1E38B 2R2MB 2UUFB 3F1SB 4AX9H 2FPZA 2UWPA 1E34B 1GHYH 1ZPCA 1NY22 2A7JA 2M5TA 4ZMAH 2BY6X 1MBMA 3FFGA 3GYMA 1VCQA 3SHAH 1QB1A 4Y8YA 5FCKA 2ZHEH 1P9SA 2XWAA 3UTUH 1F7ZA 4CRBA 1HAVB 1WV7H 3SOSA 3ATIA 4Z6AH 1C1OA 2ZGHA 3UOUA 2Q6DA 1DE7H 3QN7A 1O2UA 2FOMB 2PLXA 3RXKA 1UVPA 3TGJE 1W8BH 4ABGA 3KQEA 3UQVA 2FI3E 5DP4A 3FZDA 4JK5A 3A8BA 4TPIZ 3VPKA 3S9CA 3RXUA 3KEEA 1DY8A 1O2IA 1O2WA 1YCPK 1C1MA 1UK4A 4INKA 4NA9H 1K9OE 2HPPH 4FU8A 1O3BA 3UIRA 1CO7E 1SGNE 2F9PA 5A8XA 2OQUA 4BNRA 5JBCS 1N8OB 1SPJA 1Q31A 2ZP0H 2FS9A 3AW1A 1EXFA 1H4WA 1PJPA 3RLWH 4FU7A 1K28D 5JBBS 1THSH 3VFEA 2ZO3H 1GJCB 2Z7FE 1BTZA 1GHAF 2B8OH 1B0EA 1IQIA 1YC0A 3ZVFA 1QHRB 1ZHRA 5JYIA 1UTOA 1ZRBA 2AGGX 1HFDA 1BQYA 1H1BA 1FN6A 1O2ZA 2UWOA 2OC8A 3SU6A 4Y0YE 4X6OA 1DANH 4B75A 1DFPA 1K1LA 1NU7B 1THRH 2ZCHP 3VEQB 5A2MH 2BM2A 2PSYA 4UFEH 4GPGA 3U8TH 2PV9B 3S9AA 1G9IE 2OBOA 3M7QA 1GI9B 3SUFA 3A7YA 1O2OA 1KLJH 1ZYOA 1P02A 3LC5A 5ETXA 3R0FA 1Q3XA 1G30B 2XCFA 4NA7A 4OS4A 2A0QB 2OQ5A 4FU9A 2UUYA 1CGJE 5GCHF 1KDQA 3S9BA 2XC5A 3M61U 7LPRA 3A7ZA 1IQHA 1HAHH 4XBCA 1QL7A 3RMMH 1YCPH 2ZZUH 1G32B 1WCZA 1K1MA 1FY3A 4A7IB 4NWKA 2O8TA 2ZDLA 2ZECA 1MAXA 5BRRE 5E2OA 1W2KH 3SV2H 1BT7A 2XBYA 3A7TA 4H42U 1Z8RA 2ZFPH 8GCHF 1TRYA 1OP0A 2CXVA 3FVFB 2FTLE 1SGFA 4B74A 1TQ0B 2A1DB 4CH8B 1DLEA 1AB9B 5CHAB 1AIXH 2BXUH 2GCHF 4I8LA 1TALA 1KY9A 3A89A 3ZVEA 1GDNA 2P8OC 1NFYA 1OWEA 4I8HA 4YLQH 3RXMA 3LPRA 3SV8A 5SGAE 1VZQH 2NU0E 4LZ4B 4XFQA 4INHA 1Z71A 1W13U 3L6PA 6ESTA 2IOTA 1GJ4H 3BG4C 2ZU1A 1SHYA 5HYOA 3OY6U 1V2OT 1KXBA 5K7RA 1ACBE 4IMQA 3F9EA 1MKWK 2WUBA 1Y59T 1YBWA 3P6ZB 4GSOA 1AFQC 1Y5AT 2ALVA 2C8XB 2H9HA 3QDZB 3RXDA 4F4OC 5FPYA 3GDUA 5TCAA 5A09A 4MDSA 1MBQA 1ZSKA 4OS7A 1B7XB 2KAIA 1QY6A 4WXVA 2ZCLP 4A1XA 2Q6GA 3SBKA 1FQ3A 1MUEB 1C1QA 4ZKRU 1L1JA 1VGCB 1O3IA 1SG8B 1PQ8A 1OWJA 4RN6A 1Y3VA 1AN1E 4ZKSU 1EX3A 1XXDA 1HAYB 3BEUA 3RM2H 1SLXB 2D26C 1ZR0A 1C2MA 1LHFH 2PHBA 3TITA 2BX3A 2CGAA 3RXIA 1GJAB 2BLVA 2RDLA 1UVTH 2GX4A 1QB6A 3E1XB 1GHAG 2ZFTA 2O8LA 1O2TA 4KKDA 4YT7H 3A8CA 1TB6H 1ANCA 2ZC9H 3A7XA 4B2BA 4OGYA 3EA8A 3HATH 1E36B 1G36A 2VVCA 3P17H 5I46H 4U2WA 4MNYA 3PO1B 3RXJA 1O3MA 1S0QA 1C5MD 1HV7A 4ABBA 1PFXC 4DT7B 1A1RA 1W7XH 3RXEA 3GDSA 1CBWC 1MQ6A 2BD7A 3RMOH 5T6GA 1OWIA 2CF8H 1NRRH 3DT0H 1YPMH 3L33A 4X1RU 2TGTA 4O3UA 1SBWA 1MKWH 3BTQE 5GCHG 3OYPA 1RS0A 3SHCH 1VJAU 5CMXH 1MMJN 2ZWLH 1WU1A 1EP5A 1FLEE 4ZHLU 1OP2A 1IQKA 2ZPSA 2XBWA 3ZZDA 3ENSB 3LJOA 2SNWA 1GI4A 5TCCA 4FVDA 3KL6A 1B0FA 2F9OA 3PM3A 1S82A 2BY8X 4Q7XA 1TGSZ 2VIOA 1C5ZB 8GCHG 4GVUA 1O31A 5DKMA 1OS8A 1OWKA 2R9PA 2DE9A 1MH0A 1JOUB 1GBDA 2THFB 4AFZA 1C9PA 1GHBF 1GJDB 4DIIH 3RC5A 3M7UA 5DP9A 2GCHG 3KHVA 1SL3A 1WYKA 1FPHH 3A81A 1C5YB 4FUCA 1C2IA 2AMQA 1S0RA 3BTDE 4K1EA 1EPTB 1TRMA 2ZHDA 4UEHH 1SLWB 3ATMA 2J2UA 5J4QA 2GVFA 1UCYK 2P59A 2ZTZA 1Y3WA 4FUGA 3VB7A 1RTKA 1V2UT 1GBMA 3QX5H 1H8IH 2HVXA 1ZMNA 3P8NA 3EA7A 1GHXH 2JKHA 4Y7BA 5HXFA 2ZU3A 5G4BA 1ELVA 1CT2E 5T3HA 1O3JA 3LGTA 3SV9A 4IN2A 1EASA 1DS2E 2B0FA 1HIAB 1P9UA 2BLWA 1HAVA 4OGXA 1GBIA 2WV5A 1XMNB 3BEFB 2FESH 2SGPE 3LIWA 3RM0H 3GY8A 5EW2H 1SR5C 1CA0B 2G55A 3MFJA 5EU8A 1UVUH 1QCPA 2R0LA 2Y5FA 2ZHFH 2VU8E 3S7KB 5GWZA 1V3XA 3H5CB 1TBZH 5FX6A 1SFIA 3PLPA 1C5TA 3SV7A 1FY1A 1K2I1 1TPPA 1H9HE 1SGYE 2V35A 1DUEA 1W12U 3M37A 3OY5U 3RXGA 2A4OA 1A0HB 3HGPA 2XRCA 1KYNA 1V2KT 5CE1A 1GWAA 2DUCA 1FUJA 2TBSA 1GBHA 1ESAA 2BD9A 2PKSB 3MU8A 1U6QA 1P8VC 1UCYH 2XWBI 1K1OA 3MWIU 3LOXA 2OLGA 4NG9H 3SO3A 1V2LT 1IQGA 4Q2KA 1KXFA 1MTNB 2RCEA 4ZHMU 4OS2A 4HTCH 1IHTH 1HYLA 1VCWA 2P16A 1SGIB 2H5DA 1YPHC 1BA8B 2YOLA 2GP9B 1Z1JA 4UFFH 1C9TA 1CE5A 1D6RA 1YP9A 1QJ7B 5FXLA 1T8MA 2GGVB 2HOBA 1C5PA 2WPJS 3UWIA 2A5AA 1AVWA 4X2YA 2J4IA 2EI8A 2GZ9A 3ZYEA 1CSOE 4MG3A 2VIVA 1GG6C 3SJIA 1T8LA 1V2NT 2OXSA 4MPXA 1UTPA 4DCDA 1GHBG 4NSYA 3BTME 3M35A 1QA0A 1GHWH 2B9LA 3UFAA 3O8BA 1OX1A 3LKWA 1F2SE 2BTCE 1GMHF 1K1JA 3TJVA 1GCTC 2ZHQH 3MH6A 2QXGA 2CJIA 2QXJA 1LQEA 1LPKB 3MNCA 3SJOA 1F0RA 1O3FA 1HXFH 1NRPH 1SGPE 1V2TT 2H9EH 3SNCA 1BMLA 4E06H 1H9LB 1JXPA 1OKXA 1RTFB 4SGAE 1HBTH 4D8NA 1VITG 1CT0E 3A8DA 3ZZ7A 1WTGH 1FAKH 1QFKH 1DX5M 4D9RA 2A5KA 2F9VA 1IQFA 5A8ZA 1NT1A 3SJ8A 2BDYA 2VWMA 1EOJA 5AFYH 3U1IB 4CBOA 1RJXB 4A6LA 1A5IA 2VWNA 5T6DA 2R3YA 2G5VA 1IHSH 2ZFSA 1YLCA 4Y0ZE 1O5BB 2SFAA 1TA6A 1JWTA 4I8GA 1LKAA 1N1LA 3T28A 4AGJA 1NS3A 2ESTE 2OUAA 1NO9H 2VVUA 3FP7E 1ANDA 3LH1A 1RTLA 1V2PT 4AYYB 1T31A 4IN1A 2P95A 2H9TH 5HGGA 3CS0A 3SW2B 3ZVDA 2PUQH 2SGEE 4B1TA 3LC3A 1O3PB 4BAHB 5A0CA 3NK8A 1NN6A 2A2XH 1ETTH 4XBDA 1RFNA 3M5MA 3RXOA 3E90B 1D4PB 4I7YH 2BY9X 3BTKE 3TPIZ 3PWBA 3UUZA 3KCGH 3F6UH 3LGVA 1Y5UT 5C2ZA 1HJ8A 3RU4T 2ZU2A 5EOKA 1TNHA 1DOJA 1TOMH 3ZV9A 1T8OA 2BQ7B 5A8YA 2EI6A 2C8WB 1PYTC 1N8OC 1QBVH 1QTFA 1GVZA 1EJAA 1SQAA 3SU4A 1CA8B 2PR3A 1LVYA 2XW9A 3FAOA 1GDQA 3QTVH 4ISOA 2R0KA 4AG1A 1BRCE 2W3KA 2ZQ2A 3FP6E 3PMBB 2CN0H 3GCHC 1DSTA 3D62A 1DPOA 3UQOA 4Y76A 2BD2A 1TMTH 1XUKA 5L30H 4BOHA 3A83A 2ANWA 2FDAA 1N6XA 2BD8A 2Q1JA 3AAUA 2PWXA 2VB0A 2GMTC 1O2KA 5DG6A 5E0HA 4YOIA 3QLPH 1LO6A 1EB2A 4TYDA 1L4DA 1MZDA 2BXTH 3SU5A 1HJAC 2SGFE 4DVAU 3LGIA 2TRMA 1O2NA 2GCTC 4VGCC 3MI4A 1O36A 4UFGH 5EQRA 2Y81A 2A4RA 4WWYA 2VJ1A 4UFDH 2HRVA 5C5NA 2QC2A 4U32A 1RRKA 1XUFA 1GMHG 1P11E 2BX4A 4GLYA 2OBQA 4INLA 2XBVA 1FDPA 4XDEA 4JZ1A 4IGDA 1YGCH 1SQOA 1BBRK 4ISLA 3RP2A 1A5GH 1TNKA 2TPIZ 2W7UA 1ESBA 3LGYA 2C8ZB 1G3CA 1S81A 2W7SA 2BDHA 4A92A 1RD3B 2ODQA 1RIWB 1SGEE 1TABE 5ESTE 1P2NA 4K69A 1SC8U 1GGDB 1DVAH 1DY9A 1O34A 5JB9S 1E35B 2BDAA 3A84A 2FLRH 3QO6A 4XSKU 2A31A 1AHTH 1ZOMA 4LXBH 4DG4A 2NU1E 2AS9A 4U01A 1GI0A 1W14U 2EEKA 1HIAA 2FTMA 4BAMB 1ANEA 1DWDH 2FX6A 1AD8H 1CHOF 1AUJA 3TJOA 2Z3EA 4KTCA 1G3DA 1LMWB 5LPFA 4BXSA 4O3TA 1PQAA 2YNBA 2ANKH 4X1PU 1AI8H 3RXQA 1QRWA 1AZZA 3OSYA 3DFLA 2P3FH 3SN8A 4DGJA 3DD2H 3KN2A 3BTTE 1C2HA 1LVMA 2FOFA 1QGFA 5E0GA 2W3IA 3UNRA 3MO6A 1TNIA 2ANYA 2VIDA 1KLIH 3BTWE 1M9UA 4JZEH 1LCYA 2QGRA 3GCTF 3DHKH 3MH4A 3M36A 1C2DA 3NCLA 1W0ZU 3MHWU 1O39A 2BVRH 4K5ZA 2ZG0H 4MVNA 3SGBE 5T6FA 1UK2A 2FYRA 1V2RT 5FCRA 3EDXB 2BLQA 1TPOA 7ESTE 3GCOA 1ZTLA 1Y3UA 4MNVA 1P2IA 2JETC 1O2VA 2TGPZ 2TGAA 2ZGJA 1FY5A 2GDDA 4JZFH 4AB8A 4ABIA 3IITA 1NPMA 2HALA 1B5GH 1SGTA 1WBGB 3E3TA 1AE8H 1DWEH 4MLFB 2XC0A 4MNXA 5E8EH 4CREA 5ESBA 2VGCC 1GBAA 4IC6A 3Q00A 2FOCA 2BZ6H 3A82A 1C4Y2 2G5NA 3BSQA 3HK6B 4KELA 5DO4H 2AIQA 2ZGXH 2A7CA 2ZNKH 1HAOH 1YLDA 1S6HA 4X8SH 1W10U 1UTKA 1QRZA 2HGTH 1A5HA 1EAUA 2IN2A 1LHGH 1Y3YA 3ATKA 1GBCA 1AVXA 3P70B 4WH6A 8KME2 4YOJA 3BTFE 2BMGB 3VB3A 2W26A 5C20A 4WJG2 3M3VA 4R8TB 2ZHWH 4NWLA 2FOEA 1DT2A 1TYNA 4AYVB 2CMYA 2FI5E 5HMAA 5EW1H 1GI8B 3DUXH 4NFEA 1F5RA 1EKBB 2Y5GA 4ASHA 3CENA 3U1JB 3UNSA 4CRAA 4X1NU 2H5CA 2F9UA 4E7NA 4JYVH 1YPJH 1EAIA 3M5OA 3PTBA 1AWFH 5HM2A 3ATLA 1D3TB 1KXAA 1G3EA 1Z1IA 3VB5A 1HUTH 2HLCA 3RC6A 2QY0B 2BLOA 3E0NB 1NM6A 4NIWA 1TGNA 5F03A 2ANMH 1NU9A 1O2MA 9ESTA 3DA9B 1GBJA 2Z9LA 1W0YH 5IYTA 2FOHA 9LPRA 1O2PA 2ZI2H 3RC4A 1HCGA 1O3HA 1O2XA 4DOQA 4NSVA 3GDVA 4UDWH 1MZAA 1C2GA 1O3OA 1PQ5A 3N7OA 1LKBA 3UR6A 2JH6D 1H9IE 1C2LA 3CP7A 1ABJH 3TGIE 2JH5D 4BXWA 2BZAA 1MCTA 4UD9H 2ZDMA 1AZ8A 3RXPA 4ABAA 1ZHPA 1KTSB 1DWCH 1PYTD 1AFEH 1L1NA 3ZVAA 2OINA 1JRSA 5JB8S 1O3NA 3BTGE 1LPGB 1O33A 1T7CA 3P8OA 3GCTG 3P92A 4RSPA 3PB1E 1MCVA 2PKAB 3ESTA 5DPAA 5K0HA 4J1YA 1P09A 3MMGA 3RXRA 1TE0A 3UPEA 3MTYA 3HKIB 3NPSA 1QL8A 1LHDH 3L3TA 2BD4A 1UHBB 2F9NA 7GCHF 1O2RA 1FJSA 3T5FH 4RKJB 4NIYA 1BRUP 4H6TA 1J15A 1UK3A 1L0ZA 1P3EA 2VNTA 2Y82A 3IG6B 2NU3E 4CHAC 1IQNA 1K1NA 1O3GA 1GI5A 2BOKA 4I31A 3TGKE 2AFQB 2O8UA 2R2WU 3P95A 3ZZ8A 1TMUH 5AF9H 1O3LA 1UTLM 2SGQE 3ELAH 3K6YA 1S5SA 4IBLH 3RXSA 2AEIH 1CQQA 4TWWA 1GDUA 3MU1A 1O35A 3ITIA 2BYAX 1YM0A 2ODPA 2D2DA 3SNEA 2P8OB 3C1KA 2BD5A 1TAWA 3K6ZA 1L4ZA 4MPVA 1ZGIA 2NU2E 4NGAH 4MPUA 4GHTA 1PPEE 3P8FA 3TK5A 4NZLA 3UR9A 1O30A 3VGCC 3BG4B 2ZDAH 3MNXA 1SLVB 4FXGH 2VIPA 1BOQA 1UTMA 1CGIE 4AGKA 1HGTH 4ISHH 1C5UA 3SJKA 1UVSH 1O3EA 2XC4A 3T26A 1AFQB 2HNTC 3PMHB 4YLUA 4U30A 1FZZA 1HLTH 2Y7XA 2C90B 4THNH 1P57B 1WOFA 2SGAA 3U98H 1QQUA 1OYTH 2CF9H 1UTQA 1DDJA 1HAIH 3K2UA 3LU9B 3C27B 1PPGE 1QQ4A 3A85A 4CBNA 3E8LA 4LZ1H 4ZKNU 3T2NA 3RXFA 1YPHE 4WMFA 3A8AA 4GCHF 1GVLA 2V0BA 4K8BA 4AFSA 3GISB 2GZ8A 2HPQH 1BB0B 3VXFH 5ABWA 1KXEA 4I33A 1O2YA 2FOAA 5C5OA 3E91A 3TU7H 2QXIA 2Y6TA 4NFFA 1ETSH 2ZDVH 3LGWA 4FUBA 1AKSB 3RXLA 4BTUB 5EXNA 1DUAA 1GMDF 1LPZB 3A7WA 4AB9A 1ZGVA 2BDIA 1ZHMA 1ELDE 3GICB 1YKTA 2Z94A 3RU4D 5F8TA 1CBWB 1O2LA 2ZGBH 3D65E 3ZVBA 4FUEA 1A7SA 1J9CH 1ANBA 2XXLA 1GBFA 1HPGA 5EQSA 3HK3B 3MU4A 1T4VH 3ZZCA 3EE0B 3S69A 1EZXC 2UUJB 3KNXA 2TGDA 1TNJA 1PPHE 2A5IA 4ISIH 2XNIA 3V13A 2WPLS 4Y71A 2Q6FA 2WPHS 4Y10E 1BITA 7GCHG 1BDAA 3QGJA 4WH8A 3SNAA 2CHAB 1DXWA 3LH3A 4A5TS 1MD7A 1C1VH 2ALPA 1A2CH 2J94A 1QNJA 2ZPQA 1J17T 2Z3DA 3NZIA 4K60A 1BMAA 5JBAS 1FIZA 4MTBA 1Y8TA 1Y3XA 2WINI 2C8YB 2O8MA 2FMJA 2A7HA 1GI2A 1Z6EA 2V6NA 3EAJA 1ZLRA 5BPEA 1C5RA 4X8UH 1XUJA 3KQBA 2BDBA 5JPMH 1DICA 2PFEA 4TY7A 1O5FH 5C1UA 1PQ7A 1FY4A 4MQAA 4ZUHA
chains in the Genus database with same CATH superfamily
4KTUA 4AN7A 2VIQA 3MO3A 3BV9B 3RXCA 4D9QA 3Q3XA 2GT7A 3TH4H 1GI6A 4YO9A 3RUOA 1P01A 4DJZB 1CU1A 3SGQE 1P2MA 3UWJH 3SU2A 1OPHB 3T25A 2ZFRH 2PUXB 4Q4LA 1BTYA 2BDCA 4Y11E 2FOGA 3A80A 3PV4A 2NWNA 1V2ST 3BTHE 3Q3YA 4E05H 2ZTYA 1YCPM 2ZFQH 3V12A 1C5XB 1ZZZA 1TBRH 6GCHF 1ELAA 3Q76A 8LPRA 4WXIA 4RI0A 1GMCF 6CHAC 1P12E 3KQDA 2J98A 3WY8A 1XUGA 2UWLA 3HKJB 4Y8XA 2OC1A 1QJ6B 4GCHG 1QBOA 1LHEH 2WPMS 1BIOA 2FEQH 1ZTJA 1JBUH 3TVJB 3QZRA 3HGNA 5FBIA 1HXEH 3KGPA 4ABFA 2ZQ1A 1EATA 3O8RA 3UREA 1FI8A 1EB1H 4AOQA 2AIPA 1O38A 3IWMA 1C1NA 1P06A 2ZGCA 3QK1A 1RIWC 4TY6A 1GMDG 3NKKA 2GKVE 5LPRA 2SNVA 2NU4E 1GVKB 1XX9A 2IPQX 2ZPRA 1MQ5A 4QT8C 1Q2WA 1NESE 3ZZ9A 1TLDA 4WY3A 3URCA 3EE7A 3TK6A 3TLOA 1W7GH 4MNWA 3ODFA 4CRCA 1QJ1B 3S7HB 3E16B 3LGUA 1X7AC 2AMPA 5DP3A 1NFUA 4ZXYH 1WQSA 1C5QA 4JYTA 1P04A 1O5EH 1HB0B 1FMGA 4LK4A 1UTJA 3SV6A 1AO5A 1INCA 2B5TB 1YPEH 1HAPH 1YF4A 4D7GA 1K0HA 2OD3B 3VB6A 1V2WT 4BTIB 1D9IA 4A1VA 4ZKOU 1ZPBA 1BMMH 1S85A 4K2YA 3KQCA 1WAYB 4I32A 4ZAEA 2QIQA 3E6PH 1D3DB 1C5SA 1EFRD 1UCYE 3B23B 1KMHB 1P2OA 1LQDB 2PSXA 1MU8B 5EGMA 5EPNA 3M7TA 1LHCH 2PKAA 1GG6B 5FX5A 3W95A 2RDEA 5GPIB 1V2QT 1T8NA 3SI4H 4B73A 1BTXA 2QF0A 3QGNB 1VR1H 3GY2A 1C4U2 4BAKB 3K65B 1QIXB 1EAWA 3DCLA 1UHBA 3ZZ4A 1C2FA 3SQEE 4ZXXH 5J4SA 1NTPA 5LPEA 4AORA 1GCTB 1NRSH 3ATWA 3RXTA 1GBKA 3FZZA 2BQ6B 1C5VA 1VJ9U 1NZQH 2WV4A 3CNRA 3G01A 2FI4E 4ACBA 2F83A 2GT8A 3TJNA 5DP8A 1ABIH 1XKBC 4O03A 1QB9A 3RU4E 4RT0A 1ELCA 2PTNA 2Z3CA 3F3BA 4DW2U 8ESTE 4YM9A 3F2FA 2BY7X 4HZHA 5FPSA 3ZZAA 3MU0A 3VXEH 3UB0A 1UTNA 1V2VT 3GY6A 1NROH 2QYIA 3PWCA 6GCHG 2FIRH 2VVVA 1LVBA 1Y5BT 5FPTA 2BDGA 5AFZH 1EPTA 2IJOB 3ODDA 3W94A 1UVOA 1A46H 1GMCG 1C2JA 1CGHA 3T27A 3ZZ6A 4D76A 1O2QA 1XXFA 1CT4E 1F0UA 1AB9C 1IQLA 2PTCE 2VINA 3F9HA 5CHAC 5FHTA 1VITH 4NZQA 1O3AA 3QUMP 3SUDA 2B7DH 2H2ZA 1YPLH 2EC9H 2FLBH 1V6DA 2FODA 3AW0A 1L2EA 3HPTB 1BUIA 1KXDA 1ZMLA 2OC7A 4IW4E 1RGQA 1UO6A 1NFXA 2C93B 4DIHH 1HAGE 3GS9A 1EP6A 2WPIS 4Z0KA 1P10A 3B8JA 1SHHB 4YOGA 5IK2D 1C5OH 4XOJA 4F48B 4IMZA 3BEIB 3H09A 2WYJA 1XKAC 3AASA 3LDXH 5E2PA 2V3MA 1D3QB 5F6MA 2BB4A 1SSXA 1C5LH 4CRGA 1XVOA 5F8ZA 1AKSA 5B6OA 1GBBA 1VGCC 1ARCA 4HFPB 4AZ2B 2I6SA 2J34A 1JMOH 1QRXA 5EQQA 5A0AE 4XBBA 3GCHB 3PLBA 2A2QH 1BBRH 2QA9E 1C1SA 3PYHA 1Z8IB 2VH0A 4AG2A 2J95A 4HGCA 4K1SA 1C1RA 2STBE 1QBNA 1AMHA 1DLKB 4OS1A 1FN8A 5EJ1A 2GMTB 4PROA 2P94A 4DY7B 2RA0A 1KLTA 4J2YB 3NUMA 4UONA 4K8YA 2Z9KA 1FV9A 1HJAB 4H4FA 3PO1C 3FN8A 1KXCA 1P2JA 2ZU4A 3RXHA 2GCTB 2A4QA 1EZSC 3KF2A 1QL9A 4VGCB 1MKXK 2VH6A 2QCYA 2FP7B 5C67A 1BTWA 1C5NH 2H6MA 2VWOA 4F49A 2AERH 3FO8D 5C17A 1SOTA 3UOPA 3EYDA 3S0NA 3V0XA 1K21H 1GCDA 3OE7D 6LPRA 4X6MA 1C5WB 1TONA 4X6NA 3URDA 1LDTT 1EAXA 3GY7A 1BJUA 3QWCH 3RXAA 2TIOA 3M5LA 1HAZB 1J14A 1JIMA 1SFQB 1WUNH 5JDUB 1D3PB 1YYY1 2GTBA 1MTUA 4X8TH 3I29A 1K22H 3WWFA 1Z8GA 3TNTA 3KIDU 1WQVH 2EY4C 2O8WA 4B76A 1FONA 1GBEA 3GY5A 4BANB 2WPKS 2ZKSA 3UAIC 1DWBH 1TNGA 3OU0A 1NFWA 1F5LA 2FX4A 4KGAA 1FNIA 1W11U 1C1PA 1TNLA 3GCNA 1A0LA 1GI7B 4X8VH 2A32A 3H7OA 3STJA 1VCPA 2XTTB 4YTAA 3GY4A 4AFQA 1H8ED 3BTEE 1EPTC 1TFXA 2LNCA 2QXHA 3PLKA 4FUDA 4NIVA 1BMNH 1WTHD 4B2AA 1OYQA 2AYWA 1CHGA 2STAE 3MNSA 2GZ7A 1GI3A 2R3UA 4P00A 1MKXH 5GIBA 2QN5T 3SORA 4ISNA 1FIWA 3U8RH 1O5CB 1QZ8A 2ZCKP 3D23A 1HNEE 1CHOG 3OTJE 1GBLA 1PPBH 2FZZA 1TWXB 1W0KD 1NRNH 5GXPA 5DGJA 1TGBA 2BOHB 3E0PB 3QZQA 4WVPE 1BHXF 3A87A 1THPB 4HG6A 1ZSLA 3N7DA 5IDKA 2IPHA 3LT3A 4I8KA 1TBQH 4X1QU 2ZIQH 3RXBA 3F0PA 2ILNA 3LONA 5LGOA 2C4FH 3OX7U 1AE5A 3TIUA 1P0SH 1SVPA 4XRNA 1A61H 1AY6H 1BRBE 1CA0C 3EA9A 3SUEA 2G52A 3MH5A 4K3JA 4CR9A 2AGIX 2LELA 1AQ7A 4CH2B 3NRLA 5PTPA 1Z7KA 1G2MA 3PMAB 1A3EH 1P03A 2HNTE 2ZEBA 4D7FA 7KMEH 1SOZA 1YPKH 3T29A 1OXGA 1P05A 2V3HH 2Y7ZA 1L1GA 5FL7D 2ASUB 1O5DH 2PW8H 2JETB 2FXRA 1P2KA 2Y80A 4O9VA 2BY5X 4BAQB 1MAYA 1TGTA 5EIYA 1BBRE 1GBTA 2CK3D 4I8JA 3A88A 1O3KA 1AVGH 3V3MA 3RXVA 1F0SA 3ZZ5A 2VGCB 3BN9A 1AU8A 1GJ9B 1YY3A 2J97A 2RG3A 1KTTB 2PKSC 1PPCE 4ESTE 1BRAA 1BJVA 3SNBA 4Y7AA 1MTVA 1SQTA 5EJLA 1C4V2 1AUTC 1O2JA 1T4UH 2P3TB 3RMNH 1BHXB 2YNAA 3I78A 4AC9A 1MTNC 4CRFA 1J8AA 3SJ9A 2BQWB 1EQ9A 4OS6A 1F0TA 1G37A 2VIWA 4WF8A 2G51A 1GL0E 5TJXA 3ZZBA 3O8CA 2CHAC 4Q7ZA 1S6FA 1V2MT 1O0DH 4GUXA 3GY3A 1ZJKA 1O32A 1EZUC 3EQ0H 4X0WU 1ELEE 2BVXH 4ZHAA 3CS7A 2QF5A 5GNDA 3MYWA 1FPCH 3M5NA 5EPYA 5DP6A 2J92A 1UMAH 1GJBB 4KP0A 5DJ7A 4HI3A 1H8DH 5LH8A 1O37A 4TSFD 4X6PA 3MH7A 3SU1A 5JBTA 5GDSH 1DSUA 1GPZA 2G81E 3EGKH 4Y79A 5C1YA 1TRNA 3MNBA 1DM4B 1TQ7B 3V7TA 2F3CE 2GJGA 2Z6BD 3ZVCA 1TX7A 5H4IB 3UNQA 3GYLB 3BIUH 4M7GA 1ZPZA 3PV2A 5GJ4B 2FS8A 1C2KA 1AGJA 1VITF 1G3BA 1EJNA 4YESB 1D6WA 3OEED 5AHGH 2QAAA 3SGAE 1ESTA 3AVZA 1C1WH 1XM1A 3OTPA 4UE7H 4X1SU 1S83A 3B9FH 4ABHA 3RLYH 1OOKB 3N7EA 1F5KU 1XVMA 2WYGA 3Q3KA 1A4WH 2D1JA 1QA7A 1SGRE 4FUHA 4X2VA 5L6NH 3P8GA 5HKKD 1O2SA 2ZU5A 2GV7A 2G4TA 1NRQH 1TMBH 2Y5HA 3K9XB 2Z9IA 3TJUA 1N6YA 4BTTB 1S84A 4R0IA 1SGQE 1OWDA 2HNTF 3Q77A 4H6SB 2O9QA 2XYAA 2PGQB 1EJMA 1ELGA 1JIRA 4K1TA 1TX6A 5EXMA 5C3NA 1ZTKA 2AH4X 2EQNA 3M3SA 2FOBA 4A1TA 1XUHA 4CHAB 3NWUA 1ZMJA 1A0JA 4O97A 4LOYH 1NC6A 2A4GA 3A86A 1SI5H 4X2XA 3SI3H 4DURA 1CVWH 1YPGH 1Z6JH 1ARBA 1OWHA 4YT6H 1TA2A 3F68H 4JK6A 1KDQB 2V3OH 3SU3A 3UY9A 2FM2A 1BTPA 5DP7A 1HDTH 1SGDE 4YZUA 2C3SA 1EUFA 1PPFE 1QR3E 3SQHE 1ETRH 4NA8A 4GAWA 4JZDH 1F92A 1C1UH 3U69H 1LVOA 3DFJA 1ZSJA 3FKSD 3VGCB 3D49H 3MOCA 4XE4A 1K1IA 1HAXB 1TOCB 1P3CA 5I25A 2P93A 5DP5A 2J9NA 2AMDA 1HRTH 1TGCA 1E0FD 2FYQA 5B6LA 2GV6A 2LPRA 2ZA5A 2J5UA 1GJ8B 1O2GH 2AGEX 3AAVA 2XBXA 1C1TA 3ZVGA 2RA3A 2QV1A 2AHME 2BD3A 4Q80A 4TT3D 5CHBA 1ELBA 1K1PA 2FWWA 3SNDA 1DXPA 3QTOH 1SGCA 2KCAA 2V7QD 2OTVA 1QURH 1SLUB 3F0OA 3VB4A 2CV3A 3TH3H 4BAOB 1MTWA 3A7VA 4B2CA 3I77A 1NBMD 1BCUH 2WUCA 1GI1A 1GL1A 3ZYDA 2BVSH 5C1XA 1J16A 1ZJDA 4CR5A 4JCNA 1BTHH 2ZFFH 3TH2H 4FUJA 3FANA 1O3DA 2XCNA 1ELFA 3R3GB 2KAIB 4Q7YA 1RXPA 2A45B 2K1QA 1IAUA 2G00A 3M3TA 1JRTA 2OC0A 2ZTXA 4WMEA 1FAXA 1Z8JB 4E7RG 1BTUA 1SB1H 4TWYA 3PROA 3ZZ3A 1IQJA 4AFUA 1AWHB 1IQMA 2G4UA 3BIVH 5A0BA 1GJ7B 4SGBE 1OP8A 2EI7A 4ZROA 3U8OH 2H1UA 1GHVH 1MTSA 1MU6B 4FVBA 3FP8E 4B71A 2KX4A 2JH0D 4DT4A 1HJ9A 2F9BH 1EOLA 1GGDC 1WSSH 1MD8A 1ELTA 5F8XA 2W5EA 3RDZA 5FAHA 3PTNA 1EZQA 3TNSA 2ODYB 1LTOA 4ABJA 1ID5H 3JZ1B 3MU5A 3LJJA 5L2ZH 1ORFA 2QF4A 4IS5A 1SGFG 1KIGH 3T62A 2ULLA 3SZNA 1FXYA 1TX8A 2GDEH 4TPYA 1KSNA 4X2WA 2UUKB 4JZIA 1O5GH 4Y8ZA 2Z9JA 2BHGA 4IC5A 2DE8A 2GD4B 4JMYA 5EXLA 3PMJA 5HM9A 1T32A 3MO9A 1UJ1A 2SGDE 1TIOA 3NXPA 2J38A 2ZDNA 2QF3A 3GOVB 3WWBA 2K8IA 1DITH 1O3CA 3TK9A 3BF6H 4FUFA 3H7TA 3BG8A 4NIXA 4FUIA 4RKOB 2I6QA 2OCVB 2D8WA 1P2QA 4Y6DA 1IQEA 2F91A 5E0JA 3STIA 1GHZA 1E37B 2HWLB 2WZQA 1TPAE 4KTSA 4NCYA 1IOEA 1GJ6A 1O2HA 1A3BH 1BZXE 2L6OA 2G8TA 2ZF0H 4WMDA 2VWLA 3U9AH 4ZH8A 2P3UB 3F9FA 1TPSA 3JZ2B 3O8DA 2Z9GA 2FO9A 1V2JT 4OS5A 4ABEA 4ABDA 5AVDA 1G2LA 2ZDKA 3SU0A 4JYUH 1O5AB 2EA3A 5EG4A 1PPZA 1BMFD 1XUIA 2PGBB 1FY8E 4CRDA 1C2EA 1OSSA 3SUGA 3RMLH 2F43B 4MPWA 3ZV8A 3F9GA 1GJ5H 2OP9A 2W6ID 4GHQA 5L2YH 1ZRKA 5FBEA 1SMFE 6CHAB 5EODA 5DK1A 1W3CA 1E38B 2R2MB 5EJZA 2UUFB 3F1SB 4AX9H 2FPZA 2UWPA 3DSOA 1E34B 1GHYH 1ZPCA 1NY22 2A7JA 2M5TA 4ZMAH 2BY6X 1MBMA 3FFGA 3GYMA 1VCQA 3SHAH 1QB1A 4Y8YA 5FCKA 2ZHEH 1P9SA 2XWAA 3UTUH 1F7ZA 1S6LA 4CRBA 1HAVB 1WV7H 3SOSA 3ATIA 4Z6AH 1C1OA 2ZGHA 3UOUA 2Q6DA 1DE7H 1WDIA 1O2UA 2FOMB 2PLXA 3QN7A 3RXKA 1UVPA 3TGJE 1W8BH 4ABGA 3KQEA 3UQVA 2FI3E 5DP4A 3FZDA 4JK5A 3U28C 3A8BA 4TPIZ 3VPKA 3S9CA 3RXUA 3KEEA 1DY8A 2XNDD 1O2IA 1O2WA 1YCPK 1C1MA 1UK4A 4INKA 4NA9H 1K9OE 2HPPH 4FU8A 4I86A 1O3BA 2JJ2D 3UIRA 1CO7E 1SGNE 2F9PA 5A8XA 2OQUA 4BNRA 5JBCS 1N8OB 1SPJA 1Q31A 2ZP0H 2FS9A 2VBCA 3AW1A 1EXFA 1H4WA 1PJPA 3RLWH 4FU7A 1K28D 5JBBS 1THSH 3VFEA 2ZO3H 1GJCB 3WW7A 2Z7FE 1BTZA 1GHAF 2B8OH 1B0EA 1IQIA 1YC0A 3ZVFA 1QHRB 1ZHRA 5JYIA 1UTOA 1ZRBA 2AGGX 2KCYA 1HFDA 1NBME 1BQYA 1H1BA 1FN6A 1O2ZA 2UWOA 2OC8A 3SU6A 4Y0YE 4X6OA 1DANH 4B75A 1DFPA 1K1LA 1NU7B 1THRH 2ZCHP 3VEQB 5A2MH 2BM2A 2PSYA 4UFEH 4GPGA 3U8TH 2PV9B 3S9AA 1G9IE 2OBOA 3M7QA 1GI9B 3SUFA 3A7YA 1O2OA 1KLJH 1ZYOA 1P02A 3LC5A 5ETXA 3R0FA 1Q3XA 1G30B 2XCFA 4NA7A 4OS4A 2A0QB 2OQ5A 4FU9A 2UUYA 1CGJE 5GCHF 1KDQA 3S9BA 2XC5A 3M61U 7LPRA 3A7ZA 1IQHA 1HAHH 4XBCA 1QL7A 3RMMH 1YCPH 2ZZUH 1G32B 1WCZA 1K1MA 1FY3A 4A7IB 4NWKA 2O8TA 2ZDLA 2ZECA 1MAXA 5BRRE 5E2OA 1W2KH 3SV2H 1BT7A 2XBYA 3A7TA 3KQ5A 4H42U 1Z8RA 2ZFPH 8GCHF 1TRYA 1OP0A 2CXVA 3FVFB 2FTLE 1SGFA 4B74A 1TQ0B 2A1DB 4CH8B 1DLEA 1AB9B 5CHAB 1AIXH 2BXUH 2GCHF 4I8LA 2HLDD 1TALA 1KY9A 3A89A 3ZVEA 1GDNA 2P8OC 1NFYA 1OWEA 4I8HA 4YLQH 3RXMA 3LPRA 3SV8A 5SGAE 1VZQH 2NU0E 4LZ4B 4XFQA 4INHA 1Z71A 1W13U 3L6PA 6ESTA 2IOTA 1GJ4H 3BG4C 2ZU1A 1SHYA 4ACAA 5HYOA 5C0UA 3OY6U 1V2OT 1KXBA 5K7RA 1ACBE 4IMQA 3F9EA 1MKWK 2WUBA 3W1EA 1E79D 1Y59T 1YBWA 3P6ZB 4GSOA 1AFQC 1Y5AT 2ALVA 2C8XB 2H9HA 3QDZB 3RXDA 4F4OC 5FPYA 3GDUA 5TCAA 5A09A 4MDSA 1MBQA 1ZSKA 4OS7A 1SKYE 1B7XB 2KAIA 1QY6A 4WXVA 2ZCLP 4A1XA 2Q6GA 3SBKA 1FQ3A 1MUEB 1C1QA 4ZKRU 5C94A 1L1JA 1VGCB 1O3IA 1SG8B 1PQ8A 1OWJA 4RN6A 1Y3VA 1AN1E 3ZIAD 4ZKSU 1EX3A 1XXDA 1HAYB 3BEUA 3RM2H 1SLXB 2D26C 1ZR0A 1C2MA 1LHFH 3OEHD 2PHBA 3TITA 2BX3A 2CGAA 3RXIA 1GJAB 2BLVA 2RDLA 1UVTH 2GX4A 2L74A 1QB6A 3E1XB 1GHAG 2ZFTA 2O8LA 1O2TA 4KKDA 4YT7H 3A8CA 1TB6H 1ANCA 2ZC9H 3A7XA 4B2BA 4OGYA 3EA8A 3HATH 1E36B 1G36A 2VVCA 3P17H 5I46H 4U2WA 4MNYA 3PO1B 2KM0A 3RXJA 1O3MA 1S0QA 1C5MD 1HV7A 4ABBA 1PFXC 4DT7B 1A1RA 1W7XH 3RXEA 3GDSA 1CBWC 1MQ6A 2BD7A 3RMOH 5T6GA 2YMSC 1OWIA 2CF8H 1NRRH 3DT0H 1YPMH 3L33A 4X1RU 2TGTA 4O3UA 1SBWA 1MKWH 3BTQE 5GCHG 3OYPA 1RS0A 3SHCH 1VJAU 5CMXH 5DN6D 1MMJN 2ZWLH 1WU1A 1EP5A 1FLEE 4ZHLU 1OP2A 1IQKA 2ZPSA 2XBWA 3ZZDA 3ENSB 3LJOA 2SNWA 1GI4A 5TCCA 4FVDA 3KL6A 1B0FA 2F9OA 3PM3A 1S82A 2BY8X 4Q7XA 1TGSZ 2VIOA 1C5ZB 8GCHG 4GVUA 1O31A 5DKMA 1OS8A 1OWKA 2R9PA 2DE9A 1MH0A 2KCOA 1JOUB 1GBDA 2THFB 4AFZA 4B6EA 1C9PA 1GHBF 1GJDB 4DIIH 3RC5A 3M7UA 5DP9A 2GCHG 3KHVA 1SL3A 1WYKA 1FPHH 3A81A 1C5YB 4FUCA 1C2IA 3PRDA 2AMQA 1S0RA 3BTDE 4K1EA 1EPTB 1TRMA 2ZHDA 4UEHH 1SLWB 3ATMA 3AK5A 2J2UA 5J4QA 2GVFA 1UCYK 2P59A 2ZTZA 1Y3WA 4FUGA 3VB7A 1RTKA 1V2UT 1GBMA 3QX5H 1H8IH 2HVXA 1ZMNA 3P8NA 3EA7A 1GHXH 2JKHA 4Y7BA 5HXFA 4RT1A 2ZU3A 5G4BA 1ELVA 1CT2E 5T3HA 4F55A 1O3JA 3LGTA 3SV9A 1OHHD 1FX0B 1EASA 1DS2E 2B0FA 1HIAB 4IN2A 1P9UA 2BLWA 1HAVA 4OGXA 1GBIA 2WV5A 1XMNB 3BEFB 2FESH 2SGPE 3LIWA 3RM0H 3GY8A 5EW2H 1SR5C 1CA0B 2G55A 3MFJA 5EU8A 1UVUH 1QCPA 2R0LA 2Y5FA 2ZHFH 2VU8E 3S7KB 5GWZA 1V3XA 3H5CB 1TBZH 5FX6A 1SFIA 3PLPA 1C5TA 3SV7A 1FY1A 1K2I1 1TPPA 1H9HE 1SGYE 2V35A 1DUEA 1W12U 3M37A 2JIZD 2F4LA 3OY5U 3RXGA 2A4OA 1A0HB 3DSGA 3HGPA 2XRCA 1KYNA 1V2KT 5CE1A 1GWAA 2DUCA 1FUJA 2TBSA 1GBHA 1ESAA 2BD9A 2PKSB 3MU8A 4P02A 1U6QA 1P8VC 1UCYH 2XWBI 1K1OA 3MWIU 3LOXA 2OLGA 4NG9H 3SO3A 1V2LT 1IQGA 2JJ1D 4Q2KA 2PP6A 1KXFA 1MTNB 2RCEA 4ZHMU 4OS2A 3F2GA 4HTCH 1IHTH 1HYLA 1VCWA 2P16A 1SGIB 3MQKC 2H5DA 1YPHC 1BA8B 3F2HA 2YOLA 2GP9B 1Z1JA 4UFFH 2HVYB 1COWD 1C9TA 1CE5A 1D6RA 1YP9A 1QJ7B 5FXLA 1T8MA 2GGVB 2HOBA 1C5PA 2WPJS 3UWIA 2A5AA 1AVWA 4X2YA 2J4IA 2EI8A 2GZ9A 3ZYEA 1CSOE 4MG3A 2VIVA 1GG6C 3SJIA 1T8LA 1V2NT 2OXSA 3KYGA 4ZCNA 5KGOA 4MPXA 1UTPA 4DCDA 1GHBG 4NSYA 3BTME 3M35A 1QA0A 1GHWH 2B9LA 3UFAA 3O8BA 1OX1A 3LKWA 1F2SE 2BTCE 1GMHF 1K1JA 3TJVA 1GCTC 2ZHQH 3MH6A 2QXGA 2CJIA 2QXJA 1LQEA 1LPKB 3MNCA 3SJOA 1F0RA 1O3FA 1HXFH 1NRPH 1SGPE 5KECA 1V2TT 2H9EH 3PRBA 3SNCA 1BMLA 4E06H 1UW7A 1H9LB 1JXPA 1OKXA 1RTFB 4SGAE 1HBTH 4D8NA 1VITG 1CT0E 3A8DA 3ZZ7A 1WTGH 1FAKH 1QFKH 1DX5M 4D9RA 2A5KA 2F9VA 1IQFA 5A8ZA 1NT1A 3SJ8A 2BDYA 2VWMA 1EOJA 5AFYH 3U1IB 4CBOA 1RJXB 4A6LA 1A5IA 2VWNA 5T6DA 2R3YA 2G5VA 1IHSH 2ZFSA 1YLCA 4Y0ZE 5HIZA 1O5BB 2SFAA 1TA6A 1JWTA 4I8GA 1LKAA 1N1LA 3T28A 4AGJA 1NS3A 2ESTE 2OUAA 1NO9H 2VVUA 3FP7E 1ANDA 3LH1A 4M9FA 1RTLA 1V2PT 4AYYB 1T31A 4IN1A 2P95A 2H9TH 5HGGA 3CS0A 3SW2B 3ZVDA 2PUQH 2SGEE 4B1TA 3LC3A 1O3PB 2OK5A 4BAHB 5A0CA 3NK8A 1NN6A 1YLNA 2A2XH 1ETTH 4XBDA 5T1VA 1RFNA 3M5MA 3RXOA 3E90B 1D4PB 4I7YH 2BY9X 3BTKE 3TPIZ 3PWBA 3UUZA 3KCGH 3F6UH 3LGVA 1Y5UT 5C2ZA 1HJ8A 3RU4T 2ZU2A 5EOKA 1TNHA 1DOJA 1TOMH 3ZV9A 1T8OA 2BQ7B 2WHXA 5A8YA 2EI6A 2C8WB 1PYTC 1N8OC 1QBVH 1QTFA 2YMSD 1GVZA 1EJAA 1SQAA 3SU4A 1CA8B 2PR3A 1LVYA 2XW9A 1YWUA 3FAOA 1GDQA 3QTVH 4ISOA 2R0KA 4AG1A 1BRCE 2W3KA 2ZQ2A 3FP6E 3PMBB 2CN0H 3GCHC 1DSTA 3D62A 1E1RD 1DPOA 5HIYA 3UQOA 4Y76A 2BD2A 1TMTH 1XUKA 5L30H 4BOHA 3A83A 2ANWA 2FDAA 1N6XA 2BD8A 2Q1JA 3AAUA 2PWXA 2VB0A 2GMTC 1O2KA 5DG6A 1W0JD 5E0HA 4YOIA 3QLPH 2K0QA 1LO6A 1EB2A 4TYDA 1L4DA 1MZDA 2BXTH 3SU5A 1HJAC 2SGFE 4DVAU 3LGIA 2TRMA 1O2NA 2GCTC 4VGCC 3MI4A 1O36A 4UFGH 5EQRA 3KYFA 2Y81A 2A4RA 4WWYA 5CDFE 2VJ1A 4UFDH 2HRVA 2RFKC 5C5NA 2QC2A 4U32A 1RRKA 1XUFA 1GMHG 1P11E 1VKYA 4Q63A 2BX4A 4GLYA 2OBQA 4INLA 2XBVA 1FDPA 4XDEA 4JZ1A 4IGDA 1YGCH 1SQOA 1BBRK 4ISLA 3RP2A 4YXWD 1A5GH 1TNKA 2TPIZ 2W7UA 3FOAA 1ESBA 3LGYA 2C8ZB 1G3CA 1S81A 2W7SA 2BDHA 4A92A 1RD3B 2ODQA 1RIWB 1SGEE 1TABE 5ESTE 1P2NA 2WV9A 4K69A 1SC8U 1GGDB 1DVAH 1DY9A 1O34A 5JB9S 1E35B 2BDAA 3A84A 2FLRH 3QO6A 4XSKU 4Z1MD 2A31A 1AHTH 4FOUC 1ZOMA 4LXBH 4DG4A 2NU1E 2AS9A 3OAAD 4U01A 1GI0A 1W14U 2EEKA 1HIAA 2FTMA 2JDID 4BAMB 1ANEA 1DWDH 2FX6A 1AD8H 1CHOF 1AUJA 3TJOA 2Z3EA 4KTCA 1G3DA 1LMWB 5LPFA 4BXSA 4O3TA 1PQAA 2YNBA 2ANKH 4X1PU 1AI8H 2KCPA 3RXQA 1QRWA 1AZZA 3OSYA 3DFLA 2XOKD 2P3FH 3SN8A 4DGJA 3DD2H 3KN2A 3BTTE 1C2HA 1LVMA 2FOFA 1QGFA 5E0GA 2W3IA 3UNRA 3MO6A 1TNIA 2ANYA 2VIDA 1KLIH 1SQRA 1M9UA 3BTWE 4JZEH 1LCYA 3SYJA 2QGRA 3GCTF 3DHKH 3MH4A 3M36A 1WXRA 1C2DA 3NCLA 1W0ZU 3MHWU 1O39A 2BVRH 4K5ZA 2ZG0H 4MVNA 3SGBE 5T6FA 1UK2A 2FYRA 1V2RT 5FCRA 3EDXB 2BLQA 1TPOA 7ESTE 3GCOA 1ZTLA 1Y3UA 4MNVA 1P2IA 2JETC 1O2VA 2TGPZ 2TGAA 2ZGJA 1FY5A 2GDDA 4JZFH 4AB8A 4ABIA 3IITA 1NPMA 2HALA 1B5GH 1SGTA 1WBGB 3E3TA 1AE8H 1DWEH 4MLFB 2XC0A 4MNXA 5E8EH 3PV5A 3DSPA 4CREA 5ESBA 2VGCC 1GBAA 4IC6A 2KZ4A 3Q00A 2FOCA 2BZ6H 3A82A 1C4Y2 2G5NA 3BSQA 3HK6B 4KELA 5DO4H 2AIQA 2ZGXH 2A7CA 2ZNKH 5C0TA 4FETA 1HAOH 1YLDA 1S6HA 4X8SH 1W10U 1UTKA 1QRZA 2HGTH 1A5HA 1EAUA 2IN2A 1LHGH 1Y3YA 3ATKA 1GBCA 1AVXA 3P70B 4WH6A 8KME2 1E1QD 3BTFE 4YOJA 2BMGB 3VB3A 2W26A 5C20A 4WJG2 3M3VA 2J98B 4R8TB 2ZHWH 4NWLA 2FOEA 1DT2A 1TYNA 4AYVB 2CMYA 2FI5E 5HMAA 5EW1H 1GI8B 4OM9A 3DUXH 4NFEA 1F5RA 1EKBB 2Y5GA 2W6JD 4ASHA 3CENA 3U1JB 3UNSA 4XD7D 4CRAA 4X1NU 2H5CA 2F9UA 4E7NA 4JYVH 1YPJH 1EAIA 3M5OA 3PTBA 1AWFH 5HM2A 3ATLA 1D3TB 1KXAA 1G3EA 1Z1IA 3VB5A 1HUTH 2HLCA 3RC6A 2QY0B 2BLOA 3E0NB 1NM6A 4NIWA 1TGNA 5F03A 2ANMH 1NU9A 1O2MA 9ESTA 3DA9B 1GBJA 2Z9LA 1W0YH 5IYTA 3N99A 2FOHA 9LPRA 1O2PA 2ZI2H 3RC4A 1HCGA 1O3HA 1O2XA 4DOQA 1H8HD 4NSVA 3GDVA 4UDWH 1MZAA 1C2GA 1O3OA 1PQ5A 3N7OA 1LKBA 3UR6A 2JH6D 1H9IE 1C2LA 3CP7A 1ABJH 2WSSD 2JH5D 3TGIE 4BXWA 2BZAA 1MCTA 4UD9H 2ZDMA 1AZ8A 3RXPA 4ABAA 2IJD1 1ZHPA 1KTSB 1DWCH 1PYTD 1AFEH 1L1NA 3ZVAA 2OINA 1JRSA 5JB8S 1O3NA 3BTGE 1LPGB 1O33A 3SZEA 1T7CA 3P8OA 3GCTG 3P92A 4RSPA 3PB1E 1MCVA 2PKAB 3ESTA 5DPAA 5K0HA 4J1YA 1P09A 3MMGA 3RXRA 1TE0A 3UPEA 3MTYA 3HKIB 3NPSA 1QL8A 1LHDH 2KR7A 3L3TA 2BD4A 1UHBB 2F9NA 7GCHF 1O2RA 1FJSA 3T5FH 4RKJB 4NIYA 1BRUP 4H6TA 1J15A 1UK3A 1L0ZA 1P3EA 2VNTA 2Y82A 3IG6B 2NU3E 4CHAC 1IQNA 1K1NA 1O3GA 1GI5A 2BOKA 4I31A 3TGKE 2AFQB 2O8UA 2R2WU 3P95A 3ZZ8A 1TMUH 5AF9H 4B6FA 1O3LA 1UTLM 2SGQE 3ELAH 3K6YA 1S5SA 4IBLH 3RXSA 2AEIH 1CQQA 4TWWA 1GDUA 3MU1A 1O35A 2WPDD 2BYAX 1YM0A 2ODPA 3ITIA 2D2DA 3SNEA 2P8OB 3C1KA 2BD5A 1TAWA 3K6ZA 1L4ZA 4MPVA 1ZGIA 2NU2E 4NGAH 4MPUA 4GHTA 1PPEE 3P8FA 3TK5A 4NZLA 3UR9A 1O30A 3VGCC 3BG4B 2ZDAH 3MNXA 1SLVB 4FXGH 2VIPA 1BOQA 1UTMA 1CGIE 4AGKA 1HGTH 4ISHH 1C5UA 3SJKA 1UVSH 1O3EA 2XC4A 3T26A 1AFQB 2HNTC 3PMHB 4YLUA 4U30A 2LP6A 1FZZA 1HLTH 2Y7XA 2C90B 4THNH 1P57B 1WOFA 2SGAA 3U98H 1QQUA 1OYTH 2CF9H 1UTQA 1DDJA 5F53A 1HAIH 3K2UA 3VG8A 3LU9B 3C27B 1PPGE 1QQ4A 5DSFA 3A85A 4CBNA 3E8LA 4LZ1H 3OFND 2M2AA 4ZKNU 3RXFA 3T2NA 1YPHE 4WMFA 3A8AA 4GCHF 1GVLA 2V0BA 4K8BA 4AFSA 3GISB 2GZ8A 2HPQH 1BB0B 3VXFH 5ABWA 1KXEA 4I33A 1O2YA 2FOAA 5C5OA 3E91A 3TU7H 2QXIA 2Y6TA 4NFFA 1ETSH 2ZDVH 3LGWA 4FUBA 1AKSB 3RXLA 4BTUB 5EXNA 1DUAA 1GMDF 1LPZB 3A7WA 4AB9A 1ZGVA 2BDIA 1ZHMA 1ELDE 3GICB 1YKTA 2Z94A 3RU4D 5F8TA 1CBWB 1O2LA 2ZGBH 3D65E 3ZVBA 4FUEA 1A7SA 2YMSB 1J9CH 1ANBA 2XXLA 1GBFA 1HPGA 5EQSA 3HK3B 2QE7D 3MU4A 1T4VH 3ZZCA 3EE0B 3S69A 1EZXC 2UUJB 3KNXA 2TGDA 1TNJA 1PPHE 2A5IA 4ISIH 2XNIA 3V13A 2WPLS 4Y71A 2Q6FA 2WPHS 4ASUD 4Y10E 1MABB 1BITA 7GCHG 1BDAA 3QGJA 4WH8A 3SNAA 2CHAB 1DXWA 3LH3A 4A5TS 1MD7A 1C1VH 2ALPA 1A2CH 2J94A 1QNJA 2ZPQA 1J17T 2Z3DA 3NZIA 4K60A 2KFWA 1BMAA 5JBAS 1FIZA 4MTBA 1Y8TA 1Y3XA 2WINI 5KEDA 2C8YB 2O8MA 2FMJA 2A7HA 1GI2A 1Z6EA 2V6NA 3EAJA 1ZLRA 5BPEA 1C5RA 4X8UH 1XUJA 3KQBA 2BDBA 5JPMH 1DICA 2PFEA 4TY7A 1O5FH 5C1UA 1PQ7A 1FY4A 4MQAA 4ZUHA
chains in the Genus database with same CATH topology
4KTUA 4AN7A 2VIQA 3MO3A 3BV9B 3RXCA 4D9QA 3Q3XA 2GT7A 3TH4H 1GI6A 4YO9A 3RUOA 1P01A 4DJZB 1CU1A 3SGQE 1P2MA 3UWJH 3SU2A 1OPHB 3T25A 2ZFRH 2PUXB 1BTYA 2BDCA 4Y11E 2FOGA 3A80A 3PV4A 2NWNA 1V2ST 3BTHE 3Q3YA 4E05H 2ZTYA 1YCPM 2ZFQH 3V12A 1C5XB 1ZZZA 1TBRH 6GCHF 1ELAA 3Q76A 8LPRA 4WXIA 1GMCF 6CHAC 1P12E 3KQDA 3WY8A 1XUGA 2UWLA 3HKJB 4Y8XA 2OC1A 1QJ6B 4GCHG 1QBOA 1LHEH 2WPMS 1BIOA 2FEQH 1ZTJA 1JBUH 3TVJB 3QZRA 3HGNA 5FBIA 1HXEH 3KGPA 4ABFA 2ZQ1A 1EATA 3O8RA 3UREA 1FI8A 1EB1H 4AOQA 2AIPA 1O38A 3IWMA 1C1NA 1P06A 2ZGCA 3QK1A 1RIWC 4TY6A 1GMDG 3NKKA 2GKVE 5LPRA 2SNVA 2NU4E 1GVKB 1XX9A 2ZPRA 1MQ5A 4QT8C 1Q2WA 1NESE 3ZZ9A 1TLDA 4WY3A 3URCA 3TK6A 3TLOA 1W7GH 4MNWA 3ODFA 4CRCA 1QJ1B 3S7HB 3E16B 3LGUA 1X7AC 2AMPA 5DP3A 1NFUA 4ZXYH 1WQSA 1C5QA 4JYTA 1P04A 1O5EH 1HB0B 1FMGA 4LK4A 1UTJA 3SV6A 1AO5A 1INCA 2B5TB 1YPEH 1HAPH 1YF4A 4D7GA 2OD3B 3VB6A 1V2WT 4BTIB 1D9IA 4A1VA 4ZKOU 1ZPBA 1BMMH 1S85A 4K2YA 3KQCA 1WAYB 4I32A 4ZAEA 2QIQA 3E6PH 1D3DB 1C5SA 1UCYE 3B23B 1P2OA 1LQDB 2PSXA 1MU8B 5EGMA 5EPNA 3M7TA 1LHCH 2PKAA 1GG6B 5FX5A 3W95A 5GPIB 1V2QT 1T8NA 3SI4H 4B73A 1BTXA 2QF0A 3QGNB 1VR1H 3GY2A 1C4U2 4BAKB 3K65B 1QIXB 1EAWA 1UHBA 3ZZ4A 1C2FA 3SQEE 4ZXXH 5J4SA 1NTPA 5LPEA 4AORA 1GCTB 1NRSH 3ATWA 3RXTA 1GBKA 3FZZA 2BQ6B 1C5VA 1VJ9U 1NZQH 2WV4A 3G01A 2FI4E 2F83A 2GT8A 3TJNA 5DP8A 1ABIH 1XKBC 4O03A 1QB9A 3RU4E 1ELCA 2PTNA 2Z3CA 4DW2U 8ESTE 4YM9A 2BY7X 4HZHA 5FPSA 3ZZAA 3MU0A 3VXEH 1UTNA 1V2VT 3GY6A 1NROH 2QYIA 3PWCA 6GCHG 2FIRH 2VVVA 1LVBA 1Y5BT 5FPTA 2BDGA 5AFZH 1EPTA 2IJOB 3ODDA 3W94A 1UVOA 1A46H 1GMCG 1C2JA 1CGHA 3T27A 3ZZ6A 4D76A 1O2QA 1XXFA 1CT4E 1F0UA 1AB9C 1IQLA 2PTCE 2VINA 3F9HA 5CHAC 5FHTA 1VITH 4NZQA 1O3AA 3QUMP 3SUDA 2B7DH 2H2ZA 1YPLH 2EC9H 2FLBH 1V6DA 2FODA 3AW0A 1L2EA 3HPTB 1BUIA 1KXDA 1ZMLA 2OC7A 4IW4E 1RGQA 1UO6A 1NFXA 2C93B 4DIHH 1HAGE 1EP6A 2WPIS 4Z0KA 1P10A 3B8JA 1SHHB 4YOGA 1C5OH 4XOJA 4IMZA 3BEIB 2WYJA 1XKAC 3AASA 3LDXH 5E2PA 1D3QB 5F6MA 2BB4A 1SSXA 1C5LH 4CRGA 1XVOA 5F8ZA 1AKSA 5B6OA 1GBBA 1VGCC 1ARCA 4HFPB 4AZ2B 2I6SA 2J34A 1JMOH 1QRXA 5EQQA 5A0AE 4XBBA 3GCHB 3PLBA 2A2QH 1BBRH 2QA9E 1C1SA 3PYHA 1Z8IB 2VH0A 4AG2A 2J95A 4HGCA 4K1SA 1C1RA 2STBE 1QBNA 1AMHA 1DLKB 4OS1A 1FN8A 2GMTB 4PROA 2P94A 4DY7B 2RA0A 1KLTA 4J2YB 3NUMA 4UONA 4K8YA 2Z9KA 1FV9A 1HJAB 4H4FA 3PO1C 1KXCA 1P2JA 2ZU4A 3RXHA 2GCTB 2A4QA 1EZSC 3KF2A 1QL9A 4VGCB 1MKXK 2VH6A 2QCYA 2FP7B 5C67A 1BTWA 1C5NH 2H6MA 2VWOA 4F49A 2AERH 1SOTA 3UOPA 3EYDA 3S0NA 3V0XA 1K21H 1GCDA 6LPRA 4X6MA 1C5WB 1TONA 4X6NA 3URDA 1LDTT 1EAXA 3GY7A 1BJUA 3QWCH 3RXAA 2TIOA 3M5LA 1HAZB 1J14A 1JIMA 1SFQB 1WUNH 5JDUB 1D3PB 1YYY1 2GTBA 1MTUA 4X8TH 3I29A 1K22H 1Z8GA 3TNTA 3KIDU 1WQVH 2O8WA 4B76A 1FONA 1GBEA 3GY5A 4BANB 2WPKS 2ZKSA 1DWBH 1TNGA 3OU0A 1NFWA 1F5LA 2FX4A 4KGAA 1FNIA 1W11U 1C1PA 1TNLA 3GCNA 1A0LA 1GI7B 4X8VH 2A32A 3H7OA 3STJA 1VCPA 2XTTB 4YTAA 3GY4A 4AFQA 3BTEE 1EPTC 1TFXA 2LNCA 2QXHA 3PLKA 4FUDA 4NIVA 1BMNH 1WTHD 4B2AA 1OYQA 2AYWA 1CHGA 2STAE 3MNSA 2GZ7A 1GI3A 2R3UA 5GIBA 1MKXH 2QN5T 3SORA 4ISNA 1FIWA 3U8RH 1O5CB 2ZCKP 3OTJE 3D23A 1HNEE 1CHOG 1GBLA 1PPBH 2FZZA 1TWXB 1NRNH 5GXPA 5DGJA 1TGBA 2BOHB 3E0PB 3QZQA 4WVPE 1BHXF 3A87A 1THPB 1ZSLA 5IDKA 2IPHA 3LT3A 4I8KA 1TBQH 4X1QU 2ZIQH 3RXBA 3LONA 2ILNA 5LGOA 2C4FH 3OX7U 1AE5A 3TIUA 1P0SH 1SVPA 1A61H 1AY6H 1BRBE 1CA0C 3EA9A 3SUEA 2G52A 3MH5A 4K3JA 4CR9A 2AGIX 1AQ7A 4CH2B 5PTPA 1Z7KA 1G2MA 3PMAB 1A3EH 1P03A 2HNTE 2ZEBA 4D7FA 7KMEH 1SOZA 1YPKH 3T29A 1OXGA 1P05A 2V3HH 2Y7ZA 1L1GA 2ASUB 1O5DH 2PW8H 2JETB 2FXRA 1P2KA 2Y80A 4O9VA 2BY5X 4BAQB 1MAYA 1TGTA 1BBRE 1GBTA 4I8JA 3A88A 1O3KA 1AVGH 3V3MA 3RXVA 1F0SA 3ZZ5A 2VGCB 3BN9A 1AU8A 1GJ9B 2RG3A 1KTTB 2PKSC 1PPCE 4ESTE 1BRAA 1BJVA 3SNBA 4Y7AA 1MTVA 1SQTA 1C4V2 1AUTC 1O2JA 1T4UH 2P3TB 3RMNH 1BHXB 2YNAA 3I78A 1MTNC 4CRFA 1J8AA 3SJ9A 2BQWB 1EQ9A 4OS6A 1F0TA 1G37A 2VIWA 4WF8A 2G51A 1GL0E 5TJXA 3ZZBA 3O8CA 2CHAC 4Q7ZA 1S6FA 1V2MT 1O0DH 4GUXA 3GY3A 1ZJKA 1O32A 1EZUC 3EQ0H 4X0WU 1ELEE 2BVXH 4ZHAA 3CS7A 3MYWA 1FPCH 3M5NA 5EPYA 5DP6A 2J92A 1UMAH 1GJBB 4KP0A 5DJ7A 4HI3A 1H8DH 5LH8A 1O37A 4X6PA 3MH7A 3SU1A 5JBTA 5GDSH 1DSUA 1GPZA 2G81E 3EGKH 4Y79A 5C1YA 1TRNA 3MNBA 1DM4B 1TQ7B 3V7TA 2F3CE 2Z6BD 3ZVCA 1TX7A 5H4IB 3UNQA 3GYLB 3BIUH 4M7GA 1ZPZA 5GJ4B 2FS8A 1C2KA 1AGJA 1VITF 1G3BA 1EJNA 4YESB 1D6WA 5AHGH 2QAAA 3SGAE 1ESTA 3AVZA 1C1WH 1XM1A 4UE7H 4X1SU 1S83A 3B9FH 4ABHA 3RLYH 1OOKB 1F5KU 1XVMA 2WYGA 3Q3KA 1A4WH 2D1JA 1QA7A 1SGRE 4FUHA 4X2VA 5L6NH 3P8GA 1O2SA 2ZU5A 2GV7A 2G4TA 1NRQH 1TMBH 2Y5HA 3K9XB 2Z9IA 3TJUA 1N6YA 4BTTB 1S84A 4R0IA 1SGQE 1OWDA 2HNTF 3Q77A 4H6SB 2O9QA 2XYAA 2PGQB 1EJMA 1ELGA 1JIRA 4K1TA 1TX6A 5EXMA 5C3NA 1ZTKA 2AH4X 3M3SA 2FOBA 4A1TA 1XUHA 4CHAB 3NWUA 1ZMJA 1A0JA 4O97A 4LOYH 1NC6A 2A4GA 3A86A 1SI5H 4X2XA 3SI3H 4DURA 1CVWH 1YPGH 1Z6JH 1ARBA 1OWHA 4YT6H 1TA2A 3F68H 4JK6A 1KDQB 2V3OH 3SU3A 3UY9A 2FM2A 1BTPA 5DP7A 1HDTH 1SGDE 4YZUA 2C3SA 1EUFA 1PPFE 1QR3E 3SQHE 1ETRH 4NA8A 4GAWA 4JZDH 1F92A 1C1UH 3U69H 1LVOA 3DFJA 1ZSJA 3VGCB 3D49H 3MOCA 4XE4A 1K1IA 1HAXB 1TOCB 1P3CA 5I25A 2P93A 5DP5A 2J9NA 2AMDA 1HRTH 1TGCA 1E0FD 2FYQA 2GV6A 2LPRA 2ZA5A 1GJ8B 1O2GH 2AGEX 3AAVA 2XBXA 1C1TA 3ZVGA 2RA3A 2QV1A 2BD3A 4Q80A 1ELBA 1K1PA 2FWWA 3SNDA 1DXPA 3QTOH 1SGCA 2OTVA 1QURH 1SLUB 3VB4A 2CV3A 3TH3H 4BAOB 1MTWA 3A7VA 4B2CA 3I77A 1BCUH 2WUCA 1GI1A 1GL1A 3ZYDA 2BVSH 5C1XA 1J16A 1ZJDA 4CR5A 4JCNA 1BTHH 2ZFFH 3TH2H 4FUJA 3FANA 1O3DA 2XCNA 1ELFA 3R3GB 2KAIB 4Q7YA 1RXPA 2A45B 2K1QA 1IAUA 2G00A 3M3TA 1JRTA 2OC0A 2ZTXA 4WMEA 1FAXA 1Z8JB 4E7RG 1BTUA 1SB1H 4TWYA 3PROA 3ZZ3A 1IQJA 4AFUA 1AWHB 1IQMA 2G4UA 3BIVH 5A0BA 1GJ7B 4SGBE 1OP8A 2EI7A 4ZROA 3U8OH 2H1UA 1GHVH 1MTSA 1MU6B 4FVBA 3FP8E 4B71A 2JH0D 1HJ9A 2F9BH 1EOLA 1GGDC 1WSSH 1MD8A 1ELTA 5F8XA 2W5EA 3RDZA 5FAHA 3PTNA 1EZQA 3TNSA 2ODYB 1LTOA 4ABJA 1ID5H 3JZ1B 3MU5A 3LJJA 5L2ZH 1ORFA 4IS5A 1SGFG 1KIGH 3T62A 2ULLA 3SZNA 1FXYA 1TX8A 2GDEH 4TPYA 1KSNA 4X2WA 2UUKB 4JZIA 1O5GH 4Y8ZA 2Z9JA 2BHGA 4IC5A 2DE8A 2GD4B 4JMYA 5EXLA 3PMJA 5HM9A 1T32A 3MO9A 1UJ1A 2SGDE 1TIOA 3NXPA 2J38A 2ZDNA 2QF3A 3GOVB 1DITH 1O3CA 3TK9A 3BF6H 4FUFA 3H7TA 3BG8A 4NIXA 4FUIA 4RKOB 2I6QA 2OCVB 2D8WA 1P2QA 4Y6DA 1IQEA 2F91A 5E0JA 3STIA 1GHZA 1E37B 2HWLB 1TPAE 4KTSA 4NCYA 1IOEA 1GJ6A 1O2HA 1A3BH 1BZXE 2G8TA 2ZF0H 4WMDA 2VWLA 3U9AH 4ZH8A 2P3UB 3F9FA 1TPSA 3JZ2B 3O8DA 2Z9GA 2FO9A 1V2JT 4OS5A 4ABEA 4ABDA 5AVDA 1G2LA 2ZDKA 3SU0A 4JYUH 1O5AB 2EA3A 5EG4A 1PPZA 1XUIA 2PGBB 1FY8E 4CRDA 1C2EA 1OSSA 3SUGA 3RMLH 4MPWA 3ZV8A 3F9GA 1GJ5H 2OP9A 4GHQA 5L2YH 1ZRKA 5FBEA 1SMFE 6CHAB 5EODA 5DK1A 1W3CA 1E38B 2R2MB 2UUFB 3F1SB 4AX9H 2FPZA 2UWPA 1E34B 1GHYH 1ZPCA 1NY22 2A7JA 2M5TA 4ZMAH 2BY6X 1MBMA 3FFGA 3GYMA 1VCQA 3SHAH 1QB1A 4Y8YA 5FCKA 2ZHEH 1P9SA 2XWAA 3UTUH 1F7ZA 4CRBA 1HAVB 1WV7H 3SOSA 3ATIA 4Z6AH 1C1OA 2ZGHA 3UOUA 2Q6DA 1DE7H 3QN7A 1O2UA 2FOMB 2PLXA 3RXKA 1UVPA 3TGJE 1W8BH 4ABGA 3KQEA 3UQVA 2FI3E 5DP4A 3FZDA 4JK5A 3A8BA 4TPIZ 3VPKA 3S9CA 3RXUA 3KEEA 1DY8A 1O2IA 1O2WA 1YCPK 1C1MA 1UK4A 4INKA 4NA9H 1K9OE 2HPPH 4FU8A 1O3BA 3UIRA 1CO7E 1SGNE 2F9PA 5A8XA 2OQUA 4BNRA 5JBCS 1N8OB 1SPJA 1Q31A 2ZP0H 2FS9A 3AW1A 1EXFA 1H4WA 1PJPA 3RLWH 4FU7A 1K28D 5JBBS 1THSH 3VFEA 2ZO3H 1GJCB 2Z7FE 1BTZA 1GHAF 2B8OH 1B0EA 1IQIA 1YC0A 3ZVFA 1QHRB 1ZHRA 5JYIA 1UTOA 1ZRBA 2AGGX 1HFDA 1BQYA 1H1BA 1FN6A 1O2ZA 2UWOA 2OC8A 3SU6A 4Y0YE 4X6OA 1DANH 4B75A 1DFPA 1K1LA 1NU7B 1THRH 2ZCHP 3VEQB 5A2MH 2BM2A 2PSYA 4UFEH 4GPGA 3U8TH 2PV9B 3S9AA 1G9IE 2OBOA 3M7QA 1GI9B 3SUFA 3A7YA 1O2OA 1KLJH 1ZYOA 1P02A 3LC5A 5ETXA 3R0FA 1Q3XA 1G30B 2XCFA 4NA7A 4OS4A 2A0QB 2OQ5A 4FU9A 2UUYA 1CGJE 5GCHF 1KDQA 3S9BA 2XC5A 3M61U 7LPRA 3A7ZA 1IQHA 1HAHH 4XBCA 1QL7A 3RMMH 1YCPH 2ZZUH 1G32B 1WCZA 1K1MA 1FY3A 4A7IB 4NWKA 2O8TA 2ZDLA 2ZECA 1MAXA 5BRRE 5E2OA 1W2KH 3SV2H 1BT7A 2XBYA 3A7TA 4H42U 1Z8RA 2ZFPH 8GCHF 1TRYA 1OP0A 2CXVA 3FVFB 2FTLE 1SGFA 4B74A 1TQ0B 2A1DB 4CH8B 1DLEA 1AB9B 5CHAB 1AIXH 2BXUH 2GCHF 4I8LA 1TALA 1KY9A 3A89A 3ZVEA 1GDNA 2P8OC 1NFYA