1MMJN

Porcine pancreatic elastase complexed with a potent peptidyl inhibitor, fr136706
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords elastase 1
publication title True interaction mode of porcine pancreatic elastase with FR136706, a potent peptidyl inhibitor
pubmed doi rcsb
molecule tags Hydrolase
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2002-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mmjN02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mmjN01
3GY2A 1DY9A 1HJ8A 1K22H 3P95A 5PTPA 1V2KT 6CHAC 3UOPA 1SGYE 4WWYA 5C5NA 1ZYOA 2CF8H 4OGYA 4LZ1H 3RM0H 1ELVA 2VNTA 3RXEA 1CA0C 1ANBA 1O2NA 4IN1A 3RMNH 4FU9A 1ZPCA 3O8CA 5HGGA 3E1XB 1YLCA 4ABIA 1HAPH 1WOFA 3RXSA 1TGTA 1CT4E 2WYJA 2NWNA 3S9CA 1BTHH 1HBTH 4XBDA 2ZHFH 1DSUA 1O5CB 2BQ7B 2H5DA 4JYUH 3M3SA 3RXGA 1K1PA 5T6FA 3GY3A 2BD5A 4INKA 1CGHA 1P11E 2ZCLP 1S85A 4CH8B 2JETC 1E36B 1ID5H 1SVPA 1C5PA 1ELBA 1GMCF 3UR6A 5EOKA 1GJ8B 1T32A 5E2OA 1XVMA 3PMJA 1F2SE 1J17T 1AN1E 1TNIA 1ZHMA 3EE0B 1ELDE 1MH0A 5C5OA 1XUKA 3TJVA 1C1OA 3Q00A 4H6SB 1TOMH 3BEFB 1QJ7B 3UIRA 1CT2E 3RUOA 1AKSA 3A87A 1TGNA 1ZZZA 3D23A 2B5TB 1TAWA 4NGAH 2PKAB 3U1IB 1RTFB 1A0LA 4MLFB 1KSNA 4XE4A 1WU1A 5FCKA 3VPKA 1G3BA 1SL3A 1ZJKA 1V2WT 1U6QA 3ESTA 2F9VA 1LPKB 1HYLA 5E0GA 2NU4E 1AB9C 1NC6A 1BCUH 5ABWA 1P2QA 1WAYB 2FI5E 2ZP0H 1CQQA 1GBFA 2QIQA 1TALA 3UREA 1KIGH 1Q31A 1W7XH 3E90B 1P0SH 1NZQH 2ZHDA 3U8RH 2GKVE 5DP5A 5F6MA 3BG8A 3RXIA 3L33A 1AQ7A 2ZFQH 1WSSH 3UNSA 4FUHA 1FJSA 1O3BA 3TLOA 2XC0A 2THFB 3U98H 2GP9B 1GI5A 4FVDA 1L2EA 4UE7H 2FOEA 1A5HA 2BLQA 2D2DA 1GDQA 5DP4A 2Y5GA 2ULLA 2VWLA 3P6ZB 4BAQB 3E0PB 3MO3A 3RMOH 3RXDA 1RIWB 4AFZA 5T3HA 2ODYB 2BY5X 1ARBA 2M5TA 1YCPK 2A4RA 2A5AA 5HXFA 1QL8A 3LKWA 3MNCA 1Z1IA 1AFQB 2PGBB 1NY22 1THPB 2TGDA 1OYTH 1O2MA 5C1UA 3CP7A 3M7UA 1ELFA 3RP2A 4KGAA 3GICB 2FLBH 3QO6A 1XX9A 2Z9LA 1XXFA 1UTOA 1KLTA 1GBCA 2ANMH 1L1GA 3A81A 4Y79A 5AFYH 5LH8A 2GDDA 2BTCE 1GMHG 4I8KA 1MBMA 2AS9A 2A7HA 2BY7X 1THRH 1FPCH 1LCYA 1O2RA 1TRMA 2VIPA 1WV7H 1LPZB 4JZEH 1LHEH 3SJ8A 2AIPA 3M3VA 5EXMA 5HM2A 1O2KA 3SBKA 1C9PA 1L4ZA 4Y76A 4ABBA 3R3GB 1TNGA 5DP8A 3Q77A 3HK6B 1FN6A 4X1NU 3TH4H 4YLUA 2Y5FA 3A7XA 4Y11E 2Y80A 1YGCH 3E16B 4CREA 1EB2A 1ETRH 2WUBA 3FP8E 5FCRA 3URCA 3GY5A 3LC3A 4AYYB 3M37A 3SU6A 1O32A 4D9RA 2C3SA 5GDSH 1O3CA 4AORA 4GPGA 1UTLM 1OWEA 1HRTH 1F5RA 1P9UA 2AH4X 1GI0A 1TPAE 1O5BB 4B75A 2HLCA 1PQ8A 2ZHEH 3UWJH 1OSSA 2VJ1A 2W5EA 3A7VA 3ZVEA 1UHBB 3EA8A 1IQFA 2J9NA 1FY8E 4RN6A 1O5AB 1V2TT 1J15A 2BDCA 1PPGE 2C8ZB 1O2TA 3ZZ5A 4ABEA 4JYTA 3MWIU 3I78A 2VIVA 1AD8H 1TOCB 1SB1H 2BD8A 2QF0A 1OWKA 3ZZ3A 1P8VC 1O2SA 1O2UA 1YM0A 3RDZA 1GBEA 3F68H 1BRAA 4B73A 1V2LT 4M7GA 2FI4E 1J16A 1E38B 4NZQA 5FAHA 1EJMA 1GG6B 5K0HA 3RXBA 4ZHLU 3SUDA 1G3EA 1O5GH 2O8UA 1AVWA 2P95A 2A5KA 3MO6A 3RU4E 1O3EA 4X2WA 3LU9B 2PKSB 1MAXA 2G52A 2P59A 1M9UA 1P2OA 1VGCB 4Y8YA 1S84A 2J4IA 1H1BA 3RXFA 3KL6A 1ZSKA 1QRXA 1V2PT 3ZVDA 2ZU5A 2BXTH 4A1VA 4BAHB 5L2YH 5IYTA 1BMMH 3IWMA 1SBWA 4SGBE 3BTEE 1B5GH 1GVZA 1KDQA 1BTXA 5FPSA 1FY1A 2P3UB 4X2XA 2AERH 2XYAA 2KAIB 5F8TA 3F9GA 1EASA 4TWWA 1OPHB 1BHXF 3A8AA 2XBXA 1Z8IB 4Y7AA 3PO1C 2AIQA 4IW4E 2ALPA 3SORA 3QK1A 2QXHA 1Z71A 3BF6H 1EAWA 2ZFFH 4XSKU 1TGSZ 1O39A 3PB1E 2OCVB 3OTJE 1A7SA 3RU4T 1IQEA 3ZZ6A 1XXDA 4Y71A 2JKHA 1MU8B 1AUJA 1QL9A 2W3KA 1C1NA 3QX5H 2GCHG 2VIDA 1SOZA 1P09A 2G81E 1WQSA 4DT7B 5EQRA 1LQDB 2PSYA 1XMNB 4KTUA 1JXPA 3ZV8A 1O3DA 1HXEH 1H8DH 1T4UH 1YPLH 1ZJDA 4BAMB 2OC1A 2B8OH 4HFPB 2ESTE 4NWKA 4JK5A 1PJPA 1NPMA 3GYLB 3NK8A 3A8BA 1BIOA 1O2GH 1P02A 1SG8B 2JH6D 1HUTH 1PYTC 1Y5AT 4UONA 3F9HA 3BEIB 1XVOA 4NFFA 4ZHMU 1F7ZA 1LO6A 1OP8A 3ZVBA 1QHRB 4ABGA 1AWFH 2ZGHA 3A89A 1E37B 3BTHE 1T4VH 1O2ZA 1S5SA 1W3CA 1RD3B 5A0CA 3ODFA 3CS7A 2PV9B 4K1EA 1GI4A 3TK9A 3Q3YA 2ZCKP 3PLBA 1GJ5H 1Y3XA 2AGEX 6CHAB 3E91A 1IAUA 4I7YH 2FOFA 1QA0A 1FIWA 1DITH 4D9QA 2VINA 3FVFB 1UVOA 3E6PH 2QGRA 3T62A 3ZZ7A 1CA0B 4BOHA 1NU7B 2RG3A 2BDYA 3TK5A 1GBKA 4HI3A 1UCYK 2Q6DA 3Q76A 1TWXB 4ISNA 4MQAA 2FESH 2FXRA 2FOGA 2IOTA 2NU2E 3MFJA 1GGDC 2Z9JA 3E8LA 2W7SA 4TWYA 5EW2H 1GCTB 2FOBA 1Y3YA 4YO9A 1ELCA 1V2NT 4MVNA 2BDIA 3TPIZ 1A4WH 1MKWK 2JETB 3PYHA 1HLTH 4MPWA 5H4IB 4WH8A 1FAXA 6LPRA 1ESBA 3VXEH 1EZUC 2BHGA 1S0RA 2GT8A 4ZUHA 3IG6B 4XFQA 4A6LA 4WXIA 2OC7A 1EP6A 4Y0YE 4NIVA 1DX5M 3M5OA 4IBLH 1A0HB 1A2CH 1AIXH 1CT0E 2SGFE 1SHHB 1UO6A 5L2ZH 1AVXA 3NUMA 2JH0D 2ZIQH 2A5IA 4NA9H 1WQVH 2DE8A 4FUBA 1HIAB 2RA0A 2PUXB 1CO7E 3FP7E 3QTVH 3TJNA 1PPZA 5DP3A 4D7GA 1GVKB 2TGPZ 1GBLA 4AN7A 1DLKB 4X8TH 2BDBA 1QQUA 1C2IA 3A7ZA 5I25A 1EPTA 4AFSA 2OLGA 2WYGA 1DM4B 1OP2A 2BM2A 2I6QA 4IN2A 4FUDA 2BYAX 1JRTA 1VCWA 2FTLE 1A3EH 2H6MA 2VIWA 3CENA 1QTFA 1BMAA 4OS1A 5JBBS 2QF3A 3EYDA 1XM1A 4XOJA 4K3JA 5TJXA 1GI9B 5K7RA 1LQEA 1N8OC 3SV6A 1QBVH 1IQIA 1BRCE 1ORFA 4MNXA 2F9BH 4ZKOU 3URDA 3UY9A 1HFDA 3VGCC 1CGIE 5DG6A 3UR9A 1QNJA 1O3GA 1JOUB 1TPPA 1VCPA 1Y3VA 1DICA 3HK3B 4ZROA 1Y5UT 2F9UA 1D4PB 1EX3A 1P9SA 3A88A 2RCEA 4LOYH 4WXVA 4DW2U 4K1SA 4Z0KA 2C4FH 3B23B 1PQAA 3SV2H 1VJAU 1TBRH 5LPFA 1SGIB 3F6UH 3BTTE 1NU9A 4AG1A 1QB6A 1K28D 2FPZA 3B8JA 4NWLA 1HAHH 2B0FA 1Z7KA 3LJOA 2XW9A 2Z94A 1YPJH 1O38A 1SGTA 2UWOA 3KNXA 1S6FA 1DDJA 3CS0A 1DY8A 4CR9A 1WCZA 1LDTT 1J9CH 2VH0A 3PM3A 4ASHA 3MHWU 2FX4A 1GL1A 3PLKA 3QN7A 1HAVA 4OS5A 1BRBE 1TMTH 2A1DB 3SU5A 3SUEA 1T8LA 1V2QT 2BD7A 5JPMH 1GPZA 1TGBA 2V35A 1MTUA 1P05A 1YP9A 4UFDH 2ZZUH 1KTSB 1RGQA 3U8OH 1SHYA 1DFPA 3GCNA 1SLUB 2C8XB 2IN2A 3FANA 3VB6A 3ATLA 3VB5A 4NIYA 2FM2A 5FPTA 3C27B 1BJVA 3DT0H 1QQ4A 1KXCA 1S83A 3HGNA 1YPHE 4PROA 3ZZBA 2P93A 3S7KB 2ZU2A 4DG4A 5EGMA 3B9FH 4E06H 3UNQA 3UFAA 5A8YA 1MCVA 4GCHF 3RLYH 1QJ6B 3RXVA 2H5CA 1C2LA 4AGJA 2FYQA 1HAOH 1ELAA 1SGFA 1SI5H 4GCHG 4O9VA 1GHBG 4WMDA 1NFUA 3SGAE 1V2JT 2O8WA 4BTUB 1O35A 3BTDE 3ZVFA 2XBVA 1MZAA 3MU8A 3AASA 1XUIA 4U32A 4XBCA 1ZPBA 3GCOA 2FTMA 3LGYA 4DURA 2G8TA 3N7OA 1O3AA 1O3KA 2STBE 4ABJA 1B7XB 2FOMB 2TGAA 1O2VA 1BITA 2A45B 4Z6AH 2A7CA 1PPBH 4VGCC 4AB9A 1O2JA 1IQJA 1PPHE 4ZMAH 3U9AH 3AW0A 2ZPRA 1GBDA 2QXJA 3A86A 1TRNA 5CHAC 1ZSLA 3JZ2B 5EQSA 4X8UH 5EW1H 3H7TA 2ZU1A 1WTGH 2A4OA 1V2OT 4ISLA 1TX7A 1NRRH 3RXTA 2BDHA 2HNTF 1W2KH 4A1TA 1FI8A 3OY6U 5GWZA 4NA8A 5DO4H 1MTNC 1D3PB 2O9QA 3D62A 2Z7FE 2OD3B 1RFNA 2CHAC 2ZFPH 3DUXH 1ELGA 3BV9B 1SGEE 4JZFH 2UWPA 1HAZB 1C1TA 7ESTE 3SI4H 4YZUA 4X1QU 1AFEH 1GBIA 3TH3H 2ZGBH 1FIZA 1A5GH 1V2VT 3PV4A 2O8TA 2P8OB 3PO1B 6ESTA 1HAXB 5A2MH 1AWHB 2CJIA 5EXNA 1C1VH 1GHYH 1ZTJA 1TLDA 1P04A 1RJXB 4BXSA 5A8XA 3TGIE 5FHTA 1CE5A 3U1JB 1TQ0B 1BBRK 1LTOA 1AZZA 5IDKA 3KQCA 4U30A 1F0SA 1BA8B 1O3IA 1SGDE 2TRMA 2VGCC 1X7AC 4AOQA 1V3XA 2ZHQH 2ZKSA 3GCHC 1EOJA 3SNDA 3OYPA 5LPEA 3BTWE 1C5OH 1C1QA 4J1YA 2ZTXA 4A7IB 3K6ZA 1O0DH 3S7HB 1Q2WA 4ZAEA 1IQHA 5DK1A 2ALVA 1GI2A 1TABE 4O97A 1C5UA 3RXMA 4BTTB 2GD4B 4ABFA 4GHQA 4FUCA 2D26C 3RXAA 1Z6JH 1H9HE 1UVUH 2WV5A 5JBCS 2R2WU 2Q1JA 1O2WA 1KTTB 3Q3KA 3RXJA 2P3FH 4ABHA 1ZGVA 2AGGX 2BVXH 4O3UA 5GCHG 1FY4A 7LPRA 4E7NA 1GMHF 1OX1A 1TONA 1GHAG 4BAKB 1BTPA 4KP0A 4B1TA 2DE9A 1RTKA 1YCPH 2A4QA 1T8MA 3TGJE 1AU8A 1LHGH 5C1YA 2BD4A 1DPOA 1HV7A 3RXCA 2XCFA 2UUJB 1XUGA 1ZMJA 3EAJA 4OS2A 4CRGA 5F8XA 3ATMA 1GMDG 1JMOH 4YOJA 1MKXH 1QBNA 2FOHA 1AE8H 3KN2A 1Y3UA 3OU0A 4AG2A 1EAUA 4TYDA 2BY9X 1FZZA 4Y8XA 4SGAE 4DIHH 4B76A 3QWCH 1MD8A 3SI3H 1HAIH 7GCHG 1SPJA 1ZMLA 1S6HA 1UK2A 3SJIA 2ZWLH 4ISHH 4ISOA 2QYIA 1N6XA 5CMXH 2Z9IA 1L0ZA 2ZTZA 2FDAA 1IQGA 5EU8A 4CHAC 1GHWH 2GZ8A 4ISIH 1W10U 1C5LH 3QZRA 4UFEH 1SGRE 1Z8GA 2BMGB 3ENSB 3BEUA 2PHBA 3I29A 5AF9H 1C1PA 1LKAA 1C5WB 4HZHA 2A2QH 3GY4A 3T26A 3NZIA 4AFQA 3WY8A 2C8WB 3NCLA 1QB9A 5A09A 1QBOA 3BTGE 2BOKA 2SGAA 3MH4A 2V3HH 2GZ9A 2YNBA 2ZFTA 1Y3WA 1K1MA 3ATKA 3PMBB 3LONA 1UMAH 3MH6A 3EQ0H 1EJNA 3TGKE 1DWDH 2PWXA 1T31A 3P70B 2BX4A 1AUTC 3V7TA 2VIQA 2VVCA 2FOAA 3MU0A 5J4SA 3OX7U 1O5DH 1FY3A 2Q6FA 1YKTA 4BTIB 1T8NA 2CGAA 1O2OA 5JDUB 3VB3A 2ODPA 4D76A 3A7YA 4Y0ZE 1O2YA 5FBIA 2VVVA 3BIUH 2VIOA 3P8GA 2GMTC 4H4FA 3EA9A 4IMQA 1O3PB 5SGAE 1TA2A 3D49H 2AGIX 2F9PA 2Z3DA 4GHTA 2ZFRH 2V3OH 4IS5A 4X6PA 2Y7ZA 2Z3CA 3C1KA 5HM9A 5A0AE 1G37A 1GBHA 1MU6B 2F91A 2HPQH 3S9AA 2UUYA 4NCYA 1K1JA 2VU8E 1DLEA 1BMLA 1HJ9A 5ESBA 1TPSA 2PKAA 2TBSA 5BRRE 2EEKA 1QL7A 4WVPE 3DHKH 4DGJA 2OUAA 4IGDA 2LPRA 4R0IA 5E2PA 1MZDA 2GGVB 3GY6A 1KXAA 4X2VA 1ETSH 1C1UH 1MTSA 3SU1A 1G3CA 4ZH8A 1UJ1A 2GCHF 3MNXA 1HXFH 1ZMNA 1LHDH 2ZDVH 2PR3A 4F4OC 3SUGA 1H9LB 2G5NA 5HYOA 1V2MT 1PPEE 1XUHA 2H9HA 9LPRA 2AMQA 1RXPA 1F0UA 1FPHH 4CRDA 1P2NA 3KIDU 4RKOB 1IOEA 1NESE 1P3CA 3DA9B 3ZV9A 1BDAA 5C20A 2GCTB 5FBEA 3BG4C 1EAXA 2P3TB 1GHXH 1GI7B 1UK4A 2R3UA 4K69A 4YOIA 4JZ1A 1GJ7B 3M7TA 1G36A 2ZG0H 1FMGA 4DVAU 2H9TH 1DUEA 1J8AA 1VZQH 1SFQB 3UQOA 2HALA 3K2UA 1FY5A 1KYNA 2HGTH 3AAUA 3E3TA 5ESTE 1ZTLA 3UPEA 1TIOA 4ZHAA 2UWLA 5L6NH 2J38A 1GJ4H 3A80A 3QGNB 4H42U 5GXPA 3LGTA 1P01A 3SHAH 4KTCA 2ZDLA 3SOSA 1O2PA 4AX9H 3TJOA 4BNRA 1K1NA 1ZSJA 3HPTB 1UVPA 1C2HA 3T29A 1GI3A 2A32A 2AFQB 3GDVA 4U2WA 3UQVA 3G01A 1WTHD 2ZPSA 1HB0B 5DJ7A 1Y8TA 1ZTKA 1NROH 4FXGH 1QY6A 1AO5A 1YBWA 2VWMA 3RXPA 3O8BA 2FOCA 2XCNA 1MQ6A 3MNBA 1TX8A 2ANWA 5ETXA 3T27A 2GTBA 3A84A 2BDAA 3MOCA 2QCYA 1F92A 1NO9H 1FXYA 3UNRA 3SNCA 2HNTC 4WF8A 3HKIB 3A8CA 4JZIA 1RS0A 1IQKA 4INLA 1O3FA 2XNIA 1A0JA 1F0RA 3SGBE 1C5TA 1G9IE 4VGCB 1LMWB 3NXPA 2FX6A 1A5IA 2EI8A 1L1JA 3PWBA 1CBWC 5CHAB 4OS6A 3P8FA 1THSH 1AKSB 1EJAA 1KLJH 3RXOA 3V12A 1ZHPA 2GV7A 1NM6A 2TPIZ 2QN5T 5LPRA 1C1MA 2ZI2H 1ZLRA 4D8NA 3D65E 2JH5D 1EP5A 2OC0A 1MTNB 2W3IA 2ZFSA 1DVAH 1QB1A 1HAGE 1JIMA 1SLVB 1W0ZU 3ELAH 2CHAB 3TU7H 1UHBA 2OQUA 2UUFB 3TJUA 1QRWA 8GCHG 2A31A 1Z8JB 3MYWA 1K21H 1TBQH 2UUKB 1EPTC 2C93B 1AB9B 1FQ3A 2AYWA 4KELA 4NSYA 2BD9A 4UEHH 4MPXA 1P2KA 3MNSA 3UWIA 1D3DB 1BOQA 1BUIA 1BTZA 1TB6H 4MNYA 3RXKA 1TE0A 2WPLS 1C2DA 2CV3A 4B71A 3SJOA 1CHOG 3HKJB 4B2AA 1ESTA 2G00A 2BY8X 2BZAA 1YLDA 4K8BA 1ZRKA 1UTJA 4JYVH 3E0NB 1CHGA 2BX3A 2O8MA 2CMYA 2TGTA 1ACBE 2PKSC 1ZOMA 4GSOA 3KEEA 4NZLA 4DJZB 1DUAA 4WMFA 4I8LA 4F49A 2FS8A 1VGCC 1CA8B 3A7WA 1NN6A 2SFAA 2VGCB 4NA7A 3PMAB 2EI6A 4ZKNU 2PW8H 2I6SA 2B9LA 3NPSA 3RXLA 3PLPA 1D3TB 5JB9S 5E0JA 1C4V2 1UTMA 2WPKS 1A1RA 4ZKRU 1MCTA 3QLPH 5J4QA 1W8BH 1C2FA 2KAIA 3FFGA 4THNH 1SGPE 4AYVB 5DGJA 2XBYA 4MPVA 1DWEH 2EC9H 3GY8A 5EQQA 2G5VA 2BB4A 1P2MA 1GDUA 4J2YB 1SQOA 3QDZB 4X2YA 1BMNH 1DANH 1FN8A 1G32B 4CR5A 2ANYA 5EXLA 2G51A 3SZNA 2Z6BD 3T25A 1MBQA 2LNCA 4B2CA 1BZXE 2ZDNA 2Q6GA 3QUMP 1VITG 2XRCA 3GCTG 2R2MB 4X6NA 3EA7A 1MTWA 4ZXXH 1GBMA 2BXUH 5TCCA 3SU3A 4WMEA 2OQ5A 2SNVA 2YNAA 5HMAA 2FLRH 1MAYA 3SNAA 3P8NA 4UFGH 1O3MA 4YM9A 1YF4A 1O37A 1WYKA 2QAAA 3LGIA 3MU5A 3IITA 1JWTA 4FUEA 4GUXA 2J92A 2ZHWH 2F9NA 2G4TA 2PTCE 2G4UA 2R9PA 1YYY1 4WY3A 1EATA 1GVLA 2SNWA 3ZYDA 2OINA 2FEQH 1J14A 3LIWA 4CHAB 1VITH 1TNJA 1ZPZA 2OTVA 1GHBF 4YOGA 3U69H 1C2EA 1YPKH 1ABIH 1KXFA 1C1RA 5DKMA 4K8YA 2FI3E 2ZGCA 3BIVH 2W26A 1C9TA 2FS9A 3LH1A 4HGCA 1FUJA 1HGTH 5F03A 1A3BH 2ZO3H 3SV7A 1TBZH 4AZ2B 1W7GH 1OWHA 4U01A 3ZYEA 2WPJS 2NU0E 1ANCA 1VJ9U 3SN8A 4NSVA 3K65B 4XDEA 4CRBA 1BTWA 1C5QA 4JZDH 3SJ9A 1GCTC 2HOBA 1EAIA 3M35A 1G3DA 3VB4A 1SGNE 3LC5A 5AHGH 1DXWA 1SSXA 1MUEB 1D6WA 1S82A 3T28A 1SR5C 3M5NA 1CGJE 1N1LA 5AVDA 2HVXA 2GT7A 5L30H 4K60A 4CBNA 2FP7B 3EDXB 1O2LA 2ZC9H 3M5LA 1JBUH 3ATIA 1SC8U 5EODA 1K1LA 1NFXA 1GMCG 2GMTB 3W95A 1EZSC 2QV1A 3P8OA 3SHCH 1F5KU 1VR1H 3SQEE 1Y59T 4JCNA 1K1OA 1KDQB 2BOHB 2SGPE 2WINI 2SGEE 4B74A 1YPEH 2GZ7A 5GPIB 1BT7A 2QXGA 4I33A 1FAKH 3T5FH 1HIAA 1O36A 5FX5A 4AFUA 3TIUA 4FU7A 4E05H 5AFZH 1SOTA 3A8DA 1NFWA 1G30B 3RXHA 5JBAS 3R0FA 1QFKH 2BVSH 4JMYA 4UFFH 1ZHRA 2R0LA 2TIOA 1P57B 3ZZDA 5C1XA 2FMJA 1GBJA 2G55A 2OBOA 1AHTH 1GBAA 2Y6TA 1SQAA 3KQDA 4OS7A 1TQ7B 3PTBA 3PWCA 1O2IA 1KXEA 1EXFA 1P10A 3F9FA 1OWJA 1UCYE 4DCDA 3GDSA 1P03A 4X0WU 4LZ4B 4DOQA 1HPGA 3GYMA 2YOLA 4RKJB 2BZ6H 1QURH 4X8VH 5GIBA 5G4BA 3LOXA 2Y81A 3VXFH 4X6MA 4CH2B 5GJ4B 3QGJA 2VH6A 5DP6A 1MD7A 3ATWA 1ZRBA 2F3CE 3BG4B 1BBRH 5B6OA 2FODA 3T2NA 3RXUA 3BN9A 5GCHF 3ZVGA 1GBBA 3M61U 3L6PA 1GHAF 2Y82A 1C1WH 1EQ9A 1Q3XA 2A7JA 2XXLA 1PPCE 1O33A 1OKXA 2ZGXH 3LPRA 3MU4A 1GL0E 4FUJA 2A4GA 4MNVA 4X6OA 2A2XH 1P3EA 1P2JA 3TNTA 1IQLA 1GBTA 3LGWA 3STIA 1GMDF 5E8EH 2DUCA 1SLWB 3UTUH 3FZDA 3RM2H 1MKXK 4WJG2 4O3TA 4OGXA 1D9IA 2Y7XA 3SW2B 3HGPA 5BPEA 1NS3A 3GISB 1IHSH 2QC2A 2FWWA 3K9XB 1ELTA 1YCPM 1F0TA 1LVOA 7GCHF 1LHCH 1GWAA 1B0EA 1HJAC 3FP6E 3RLWH 1ELEE 3ZZ4A 1GGDB 3KCGH 2ASUB 3KGPA 1FNIA 3M36A 4K5ZA 3M5MA 1QRZA 3FZZA 2BD3A 3SNEA 1FONA 1LPGB 1A46H 2NU3E 2RA3A 3TK6A 4BAOB 4ABAA 5JB8S 1L4DA 2Z9GA 2J2UA 4X1RU 3RMLH 2XBWA 1O5EH 2SGDE 4YESB 3SO3A 1QJ1B 1O5FH 1UVTH 3RMMH 4D7FA 2ZPQA 4CRAA 1JIRA 3NKKA 3LH3A 1AY6H 1UTQA 6GCHF 1FV9A 1CBWB 3QTOH 5FXLA 1A61H 3GY7A 3RU4D 3VEQB 6GCHG 1K2I1 3MMGA 4WH6A 2XTTB 1NRQH 3ZVAA 3EGKH 2BLOA 1C1SA 1INCA 3KQBA 4MPUA 2P94A 2BDGA 1GI8B 1GJ6A 4CRCA 1LVBA 1G2MA 4YLQH 2FZZA 1BTYA 4R8TB 3SU2A 2SGQE 5E0HA 2ODQA 3I77A 3TNSA 1ESAA 1NRSH 1O3LA 1KY9A 3LDXH 1EPTB 5A8ZA 4YT7H 1UTKA 1TNHA 1QIXB 3UUZA 2GDEH 3KQEA 4I32A 2WPHS 1TYNA 1TNLA 2QXIA 1V2UT 3NWUA 2RDLA 1L1NA 1TMUH 5C2ZA 1QCPA 1TGCA 1RRKA 2ZEBA 1BQYA 4DY7B 1N8OB 2ZNKH 3M7QA 1D3QB 3A83A 2NU1E 3ZZAA 1TPOA 2H1UA 2ZECA 3DFJA 3AW1A 2C8YB 3VGCB 3LT3A 1SGFG 1V2RT 8ESTE 3M3TA 5A0BA 1GI6A 1AI8H 1WUNH 2C90B 4MTBA 1DWCH 2F83A 1W0YH 2PSXA 3MTYA 1C2KA 3MU1A 2VWNA 2AMDA 5EPNA 1GDNA 1EZQA 1AGJA 1C5NH 2XC5A 1O3HA 4TPIZ 3F1SB 3HATH 4AGKA 4INHA 2WUCA 1NFYA 1C2JA 4KKDA 1SMFE 4IC5A 1XUJA 1C4Y2 3V0XA 1C5SA 2GV6A 1O3JA 2HPPH 2VWOA 5EG4A 3A82A 4Y8ZA 3SV9A 1EKBB 2P8OC 4JK6A 2P16A 5JBTA 1TX6A 3MH5A 2BQWB 4YTAA 1FDPA 3H7OA 4FU8A 4OS4A 1RTLA 1P2IA 1DXPA 3SUFA 4LK4A 2PGQB 1YPMH 1CVWH 4HTCH 2PFEA 1K9OE 1GJDB 1EB1H 1IQMA 2AMPA 1HAVB 1QA7A 3SGQE 3TVJB 1D6RA 3A7TA 2R3YA 1N6YA 1PYTD 4FVBA 1EZXC 3TH2H 3UOUA 2O8LA 1C5RA 3GOVB 2ZU4A 2FIRH 1QGFA 3AAVA 4CRFA 2XC4A 3LGUA 1RIWC 4MNWA 1ANDA 2WV4A 4MDSA 4I8GA 4ZXYH 1B0FA 3RC6A 1AE5A 3MH7A 1UK3A 2EA3A 1UTPA 1AFQC 2BY6X 4B2BA 3BTKE 3VFEA 1SGCA 2ZDKA 2Y5HA 4Q7YA 4K2YA 2BLWA 1HDTH 1GI1A 1CU1A 2ZCHP 3S0NA 1T8OA 1GHVH 2PLXA 4LXBH 2CN0H 4IMZA 2H2ZA 2GVFA 1XKAC 4GAWA 3SU4A 3P92A 2B7DH 4X1SU 1HCGA 2BVRH 1MQ5A 3VB7A 1OOKB 4Q2KA 4E7RG 1ABJH 3OSYA 1O2HA 5FPYA 3DD2H 4Y10E 1DE7H 3MO9A 1W14U 2CF9H 3ITIA 1Z8RA 3L3TA 5JYIA 2XWAA 4BANB 1IHTH 1GCDA 1UCYH 1DOJA 1BRUP 2FYRA 2OBQA 1BTUA 1TNKA 2D1JA 1HNEE 1W12U 2BLVA 3S9BA 2J94A 1BHXB 1C5YB 2FO9A 2J95A 1IQNA 1C5XB 1VCQA 2HNTE 1BBRE 1LKBA 4I31A 4QT8C 4Y6DA 1O31A 2ZTYA 3V13A 1MKWH 1E34B 3TITA 1JRSA 1OYQA 4FUIA 1PQ7A 4ESTE 1NRPH 2ZDMA 3S69A 1GJCB 5DP9A 1C2GA 3ODDA 4CBOA 5DPAA 1S81A 8GCHF 1LHFH 3JZ1B 3PTNA 4GLYA 1XKBC 3BTFE 4A5TS 3KHVA 2OP9A 2VVUA 3DFLA 2R0KA 1E35B 4X1PU 1O2QA 4Q7ZA 1OS8A 2PTNA 1GJ9B 2K1QA 2ZA5A 1F5LA 4ABDA 1CHOF 1MMJN 1S0QA 4H6TA 4TY7A 1NT1A 4X8SH 1OWDA 1Z1JA 1C5VA 1SFIA 3V3MA 1YC0A 1O3NA 3RXRA 2QY0B 3K6YA 1P12E 1GG6C 2ZGJA 4K1TA 5EPYA 2OXSA 3FAOA 1UTNA 1O2XA 1SGQE 1AVGH 4AB8A 3KF2A 1TFXA 1YPGH 2W7UA 2ZDAH 1K1IA 4NIWA 2ZQ2A 2HWLB 2IPHA 4MG3A 1ZGIA 1AZ8A 5F8ZA 2OC8A 1Y5BT 1SLXB 3LJJA 2H9EH 2XWBI 1NRNH 2ZQ1A 2BQ6B 1OWIA 3GCHB 4NFEA 2V0BA 1GJBB 1SQTA 3OY5U 1G2LA 4ZKSU 1DSTA 4I8JA 3ZZ8A 1KXBA 3SJKA 2PUQH 5CE1A 1C4U2 1TA6A 2A0QB 1LVMA 1HAYB 1H9IE 8LPRA 3STJA 1ZR0A 2BD2A 5C3NA 4XBBA 1CSOE 3MI4A 3Q3XA 3BTME 2Z3EA 1AMHA 3U8TH 3W94A 1LVYA 2J34A 2CXVA 4Q80A 1C5ZB 1NTPA 4I8HA 2EI7A 2IJOB 2HRVA 1C5MD 2Z9KA 3GDUA 3P17H 4GVUA 1VITF 1P06A 3QZQA 3GCTF 1BJUA 2ZU3A 3F9EA 1W11U 4UD9H 2D8WA 5T6GA 1O3OA 4NG9H 1OXGA 1GJAB 2WPMS 4RSPA 1DWBH 1KLIH 2AEIH 2F9OA 1O30A 3LGVA 3ZVCA 4Q7XA 1V6DA 2QA9E 1BB0B 1OP0A 4DIIH 2WPIS 7KMEH 3PROA 2ANKH 3AVZA 1ANEA 4FUFA 3SV8A 5I46H 3SU0A 1H8IH 3ZZCA 3BSQA 5LGOA 1O34A 4TPYA 1ETTH 4Y7BA 2STAE 1H4WA 1WBGB 2V6NA 4A1XA 3BTQE 1DT2A 1Z6EA 1PQ5A 3PMHB 4IC6A 1HJAB 4A92A 4TY6A 1TMBH 5C67A 4UDWH 5DP7A 1GHZA 3RC5A 9ESTA 1C2MA 2GCTC 2GX4A 1KXDA 1YPHC 1PPFE 2ILNA 2VB0A 1FLEE 2ZF0H 1DS2E 4YT6H 5T6DA 1TRYA 1EUFA 1ARCA 4FUGA 3RC4A 8KME2 3O8RA 3SQHE 1QR3E 1W13U 5TCAA 4NIXA 3ZZ9A 1PFXC 4KTSA 3RXQA 1E0FD 3O8DA 1XUFA 3A85A 5FX6A 3H5CB 4O03A 1EOLA 3SNBA 4BXWA 1UVSH 1V2ST 1T7CA 1MTVA
chains in the Genus database with same CATH superfamily
3GY2A 1DY9A 1HJ8A 1K22H 3P95A 5PTPA 1NBME 1V2KT 6CHAC 3UOPA 1SGYE 4FOUC 4WWYA 5C5NA 1ZYOA 2CF8H 4OGYA 4LZ1H 3RM0H 1ELVA 2VNTA 3RXEA 1CA0C 1ANBA 1O2NA 4IN1A 3RMNH 1E1RD 4FU9A 1ZPCA 3O8CA 5HGGA 3E1XB 1YLCA 2J97A 4ABIA 1HAPH 1WOFA 3RXSA 1TGTA 1CT4E 2WYJA 4AC9A 2NWNA 3S9CA 1BTHH 1HBTH 4XBDA 2ZHFH 1DSUA 1O5CB 2BQ7B 2H5DA 4JYUH 3M3SA 3RXGA 1K1PA 5T6FA 3GY3A 2BD5A 4INKA 1CGHA 1P11E 2ZCLP 1S85A 3EE7A 4CH8B 2JETC 1E36B 1ID5H 1SVPA 1C5PA 1ELBA 3UAIC 1GMCF 3UR6A 5EOKA 1GJ8B 1T32A 5E2OA 1XVMA 3PMJA 1F2SE 1J17T 1AN1E 1TNIA 1ZHMA 3EE0B 1ELDE 1MH0A 5C5OA 1XUKA 3TJVA 1C1OA 2XNDD 3Q00A 4H6SB 1TOMH 3BEFB 1QJ7B 3UIRA 1CT2E 3RUOA 1AKSA 3A87A 1TGNA 1ZZZA 3D23A 2B5TB 1TAWA 4NGAH 2PKAB 3U1IB 1RTFB 1A0LA 4MLFB 3KQ5A 1KSNA 4XE4A 1WU1A 5FCKA 3VPKA 1G3BA 1SL3A 1ZJKA 1V2WT 1U6QA 3ESTA 2F9VA 1LPKB 1HYLA 5E0GA 2NU4E 1AB9C 1NC6A 1BCUH 5ABWA 1P2QA 1WAYB 2FI5E 2ZP0H 2YMSD 1CQQA 1GBFA 2QIQA 1TALA 3UREA 1KIGH 1Q31A 1W7XH 3E90B 2JJ1D 1P0SH 1NZQH 2ZHDA 3U8RH 2GKVE 5DP5A 5F6MA 3BG8A 3RXIA 3L33A 1AQ7A 2ZFQH 1WSSH 3UNSA 4FUHA 1FJSA 1O3BA 3TLOA 2XC0A 2THFB 3U98H 2GP9B 1SKYE 1GI5A 4FVDA 1L2EA 1OHHD 2YMSC 4UE7H 2FOEA 1A5HA 2BLQA 2D2DA 1GDQA 5DP4A 2Y5GA 3WWFA 2ULLA 2VWLA 3P6ZB 4BAQB 3E0PB 3MO3A 3RMOH 3RXDA 1RIWB 4AFZA 5T3HA 2ODYB 3UB0A 2BY5X 1ARBA 2M5TA 1YCPK 2A4RA 2A5AA 5HXFA 2PP6A 2KCPA 1QL8A 3LKWA 3MNCA 1Z1IA 1AFQB 1NY22 1THPB 2PGBB 2TGDA 1OYTH 1O2MA 2XOKD 3CP7A 5C1UA 3M7UA 1ELFA 3RP2A 4KGAA 3GICB 2FLBH 3QO6A 1XX9A 2Z9LA 1XXFA 1UTOA 1KLTA 1GBCA 2ANMH 1L1GA 3A81A 4Y79A 5AFYH 3FN8A 2GDDA 5LH8A 2BTCE 1GMHG 4I8KA 1MBMA 2AS9A 2A7HA 2BY7X 1THRH 1FPCH 1LCYA 1O2RA 1TRMA 2VIPA 2QF5A 1WV7H 1LPZB 4JZEH 1LHEH 3SJ8A 2AIPA 3M3VA 5EXMA 5HM2A 1O2KA 3SBKA 1C9PA 1L4ZA 4Y76A 4ABBA 3R3GB 1TNGA 5DP8A 3Q77A 1W0JD 3HK6B 1FN6A 2QE7D 4X1NU 3TH4H 2RDEA 4YLUA 2Y5FA 3A7XA 4Y11E 2Y80A 1YGCH 3E16B 4CREA 1EB2A 1ETRH 2WUBA 3FP8E 5FCRA 3URCA 3GY5A 3LC3A 4AYYB 3M37A 3SU6A 1O32A 4D9RA 2C3SA 5GDSH 3OE7D 1O3CA 4AORA 4GPGA 1UTLM 1OWEA 1HRTH 1F5RA 1P9UA 2AH4X 1GI0A 1TPAE 1O5BB 4B75A 2L6OA 2HLCA 1PQ8A 2ZHEH 3DSPA 3UWJH 1OSSA 2VJ1A 2W5EA 3A7VA 3ZVEA 1UHBB 3EA8A 1IQFA 2J9NA 1FY8E 4RN6A 1O5AB 1V2TT 1J15A 2BDCA 1PPGE 2C8ZB 1O2TA 3ZZ5A 4ABEA 4JYTA 3MWIU 3I78A 2VIVA 1AD8H 1TOCB 1SB1H 2BD8A 2QF0A 1OWKA 3ZZ3A 1P8VC 1O2SA 1O2UA 3F3BA 1YM0A 3RDZA 1GBEA 3F68H 1BRAA 4B73A 1V2LT 4M7GA 2FI4E 1J16A 1E38B 4NZQA 5FAHA 1EJMA 1GG6B 5K0HA 3RXBA 4ZHLU 2W6ID 3SUDA 1G3EA 1O5GH 2O8UA 1AVWA 2P95A 2A5KA 3MO6A 3RU4E 1O3EA 4X2WA 3LU9B 2PKSB 1MAXA 2G52A 2P59A 1M9UA 1P2OA 1VGCB 4Y8YA 1S84A 2J4IA 1H1BA 3RXFA 3KL6A 1ZSKA 1QRXA 1V2PT 3ZVDA 2ZU5A 2BXTH 4A1VA 4BAHB 5L2YH 5IYTA 1BMMH 3IWMA 1SBWA 4SGBE 3BTEE 1B5GH 1GVZA 1KDQA 1BTXA 5FPSA 1FY1A 2P3UB 4X2XA 2AERH 2XYAA 3U28C 2KAIB 5F8TA 2J98B 3F9GA 1EASA 4TWWA 1OPHB 1BHXF 3A8AA 2XBXA 1Z8IB 4Y7AA 3PO1C 2AIQA 4IW4E 2ALPA 3SORA 3QK1A 2QXHA 1Z71A 3BF6H 1EAWA 2ZFFH 4XSKU 1TGSZ 1O39A 3PB1E 2OCVB 3OTJE 1A7SA 3RU4T 1IQEA 3ZZ6A 1XXDA 4Y71A 2JKHA 1MU8B 1AUJA 4F48B 1QL9A 2W3KA 1C1NA 3QX5H 2GCHG 4Q63A 2VIDA 1SOZA 1P09A 2G81E 1WQSA 4DT7B 5EQRA 1LQDB 2PSYA 1XMNB 4KTUA 1JXPA 3ZV8A 1O3DA 1HXEH 1H8DH 1T4UH 1YPLH 1ZJDA 5F53A 4BAMB 2OC1A 2B8OH 4HFPB 2ESTE 4NWKA 4JK5A 1PJPA 1NPMA 4RT0A 3OEED 3GYLB 3NK8A 3A8BA 1BIOA 1O2GH 1P02A 1SG8B 2JH6D 1HUTH 1PYTC 1Y5AT 4UONA 3F9HA 3BEIB 1XVOA 4NFFA 4ZHMU 1F7ZA 1LO6A 1OP8A 3ZVBA 3DSGA 1QHRB 4ABGA 1AWFH 2ZGHA 3A89A 5GNDA 1E37B 3BTHE 1T4VH 1O2ZA 1S5SA 1W3CA 1RD3B 5A0CA 3ODFA 3CS7A 2PV9B 4K1EA 1GI4A 3TK9A 3Q3YA 2ZCKP 3PLBA 1GJ5H 1Y3XA 2AGEX 6CHAB 3E91A 1IAUA 4I7YH 2FOFA 1QA0A 1FIWA 1DITH 4D9QA 2VINA 3FVFB 1UVOA 3E6PH 2QGRA 3T62A 3ZZ7A 1CA0B 4BOHA 1NU7B 2RG3A 2BDYA 3TK5A 1GBKA 4HI3A 1UCYK 2Q6DA 3Q76A 3WWBA 1TWXB 4ISNA 4MQAA 2FESH 2FXRA 2FOGA 2IOTA 2NU2E 3MFJA 1GGDC 2Z9JA 3E8LA 2W7SA 4TWYA 5EW2H 1Y3YA 2FOBA 1GCTB 4YO9A 1ELCA 1V2NT 4MVNA 2BDIA 3TPIZ 2W6JD 1A4WH 1MKWK 2JETB 3PYHA 1HLTH 4MPWA 5H4IB 4WH8A 1FAXA 6LPRA 1ESBA 3VXEH 1EZUC 2BHGA 4P00A 3WW7A 1S0RA 2GT8A 4ZUHA 3IG6B 4XFQA 4A6LA 1YY3A 4WXIA 2OC7A 1EP6A 4Y0YE 4NIVA 1DX5M 3M5OA 4IBLH 1BMFD 1A0HB 1A2CH 1AIXH 1CT0E 2SGFE 1SHHB 1UO6A 5L2ZH 1AVXA 2IJD1 3NUMA 2JH0D 2ZIQH 2A5IA 4NA9H 1WQVH 2DE8A 4FUBA 1HIAB 2RA0A 2PUXB 1CO7E 3FP7E 3QTVH 3TJNA 1PPZA 5DP3A 4D7GA 1GVKB 2TGPZ 1GBLA 4AN7A 1DLKB 4X8TH 2BDBA 1QQUA 1C2IA 3A7ZA 5I25A 1EPTA 4AFSA 2OLGA 2WYGA 1DM4B 1OP2A 2BM2A 2I6QA 4IN2A 4FUDA 2BYAX 1JRTA 1VCWA 2FTLE 1A3EH 2H6MA 2L74A 2VIWA 3FOAA 3CENA 1QTFA 1BMAA 4OS1A 5JBBS 2QF3A 3H09A 3EYDA 1XM1A 4XOJA 4K3JA 5TJXA 1GI9B 5K7RA 1LQEA 1N8OC 4P02A 3SV6A 1QBVH 1IQIA 1BRCE 1ORFA 4MNXA 2F9BH 4ZKOU 3URDA 3UY9A 1HFDA 3VGCC 1CGIE 5DG6A 3UR9A 1QNJA 1O3GA 1JOUB 2YMSB 2M2AA 1TPPA 5C0UA 1VCPA 1Y3VA 4DT4A 1DICA 3HK3B 4ZROA 1Y5UT 2F9UA 1D4PB 1EX3A 4ASUD 1P9SA 3A88A 2RCEA 4LOYH 4WXVA 4DW2U 4K1SA 4Z0KA 2C4FH 3B23B 1PQAA 3SV2H 2VBCA 1VJAU 1TBRH 5LPFA 1SGIB 3F6UH 4I86A 3BTTE 1NU9A 4AG1A 1QB6A 1K28D 2FPZA 3B8JA 4NWLA 1YWUA 1HAHH 2AHME 2B0FA 1Z7KA 3LJOA 2XW9A 2Z94A 1YPJH 1O38A 1SGTA 2UWOA 3KNXA 1S6FA 1DDJA 3CS0A 1DY8A 4CR9A 1WCZA 1LDTT 1J9CH 2VH0A 3PM3A 4ASHA 3MHWU 2FX4A 1NBMD 1GL1A 3PLKA 3QN7A 1HAVA 4OS5A 1BRBE 1TMTH 2A1DB 3SU5A 3SUEA 1T8LA 1V2QT 2BD7A 5JPMH 1GPZA 1TGBA 2V35A 1MTUA 1P05A 1YP9A 2JJ2D 4UFDH 2ZZUH 1KTSB 1RGQA 3U8OH 1SHYA 1DFPA 3GCNA 1SLUB 2C8XB 2IN2A 3FANA 3VB6A 3ATLA 3VB5A 4NIYA 2FM2A 5FPTA 3C27B 2WZQA 1BJVA 3DT0H 1QQ4A 1KXCA 1S83A 3HGNA 1YPHE 4PROA 3ZZBA 2P93A 3S7KB 2ZU2A 4DG4A 5EGMA 3B9FH 4E06H 3PRDA 3UNQA 1UW7A 3UFAA 5A8YA 1MCVA 3KYGA 2QF4A 4GCHF 3RLYH 1QJ6B 3RXVA 2H5CA 1C2LA 4AGJA 2FYQA 1HAOH 1ELAA 3PV2A 1SGFA 3N99A 1SI5H 4GCHG 4O9VA 1GHBG 4WMDA 3OEHD 1NFUA 3ZIAD 3SGAE 1V2JT 2O8WA 4BTUB 1O35A 3BTDE 3ZVFA 2XBVA 1MZAA 3MU8A 3AASA 1XUIA 4U32A 4XBCA 2K0QA 1QZ8A 1ZPBA 3GCOA 2FTMA 3LGYA 4DURA 2G8TA 3N7OA 1O3AA 1O3KA 2STBE 4ABJA 1B7XB 2FOMB 3SZEA 2TGAA 1O2VA 1BITA 2A45B 4Z6AH 2A7CA 1PPBH 4Q4LA 4VGCC 4AB9A 1O2JA 1IQJA 1PPHE 4ZMAH 3U9AH 3AW0A 2ZPRA 1GBDA 2QXJA 3A86A 1TRNA 5CHAC 1ZSLA 3JZ2B 5EQSA 4X8UH 1WXRA 2F43B 5EW1H 3H7TA 2ZU1A 1WTGH 2A4OA 1V2OT 4ISLA 1TX7A 1NRRH 3RXTA 2BDHA 2HNTF 1W2KH 4A1TA 1FI8A 3OY6U 5GWZA 4NA8A 5DO4H 1MTNC 2J5UA 1D3PB 2O9QA 3D62A 2Z7FE 2OD3B 1RFNA 2CHAC 2ZFPH 3DUXH 1ELGA 3BV9B 5DN6D 1SGEE 4JZFH 2UWPA 2WHXA 1HAZB 1C1TA 7ESTE 3SI4H 2KR7A 4YZUA 4X1QU 1AFEH 1GBIA 3TH3H 2ZGBH 1FIZA 1A5GH 1V2VT 3PV4A 2O8TA 2P8OB 3PO1B 6ESTA 1HAXB 5A2MH 1AWHB 2CJIA 5EXNA 1C1VH 1GHYH 1ZTJA 1TLDA 1P04A 1RJXB 4BXSA 5A8XA 3TGIE 5FHTA 1CE5A 3U1JB 1TQ0B 1BBRK 1LTOA 1AZZA 5IDKA 3KQCA 4U30A 1F0SA 1BA8B 1O3IA 1SGDE 2TRMA 2VGCC 1X7AC 4AOQA 1V3XA 2ZHQH 2ZKSA 3GCHC 1EOJA 3SNDA 3OYPA 5LPEA 3BTWE 5KGOA 1C5OH 1C1QA 4J1YA 2ZTXA 4A7IB 3K6ZA 1O0DH 3PV5A 1Q2WA 3S7HB 4ZAEA 1IQHA 5DK1A 2ALVA 1GI2A 1TABE 4O97A 1C5UA 3RXMA 4BTTB 2GD4B 4ABFA 4GHQA 1MABB 4FUCA 2D26C 4ACBA 3RXAA 1Z6JH 1H9HE 1UVUH 2WV5A 5JBCS 2R2WU 2Q1JA 1O2WA 1KTTB 3Q3KA 3RXJA 2P3FH 4ABHA 1ZGVA 2AGGX 2BVXH 4O3UA 5GCHG 1FY4A 7LPRA 4E7NA 1GMHF 1OX1A 1TONA 3DSOA 1GHAG 4BAKB 1BTPA 4KP0A 4B1TA 2DE9A 1RTKA 1YCPH 2A4QA 1T8MA 3TGJE 1AU8A 1LHGH 4Z1MD 5C1YA 2BD4A 1DPOA 1HV7A 3RXCA 2XCFA 2UUJB 1XUGA 1ZMJA 3EAJA 4OS2A 3W1EA 4CRGA 1COWD 5F8XA 4B6EA 3ATMA 1GMDG 1JMOH 4YOJA 1MKXH 1QBNA 2FOHA 1AE8H 3KN2A 1Y3UA 3OU0A 4AG2A 1EAUA 4TYDA 2BY9X 1FZZA 4Y8XA 4SGAE 4DIHH 4B76A 3QWCH 1MD8A 3SI3H 1HAIH 7GCHG 1SPJA 1ZMLA 1S6HA 1UK2A 3SJIA 2ZWLH 4ISHH 4ISOA 2QYIA 1N6XA 5CMXH 2Z9IA 5FL7D 1L0ZA 4F55A 2ZTZA 2FDAA 3OTPA 1IQGA 5EU8A 5C17A 4CHAC 1GHWH 2HVYB 2GZ8A 4ISIH 1W10U 1C5LH 3QZRA 4UFEH 1SGRE 1Z8GA 2BMGB 3ENSB 3BEUA 2PHBA 3I29A 5AF9H 1C1PA 1LKAA 1C5WB 4HZHA 2A2QH 3GY4A 3T26A 3NZIA 4AFQA 3WY8A 2C8WB 3NCLA 1QB9A 5A09A 1QBOA 3BTGE 1KMHB 2BOKA 2SGAA 3MH4A 2V3HH 2GZ9A 2YNBA 2ZFTA 1Y3WA 1K1MA 3ATKA 3PMBB 3LONA 1UMAH 3MH6A 3EQ0H 1EJNA 3TGKE 1DWDH 2PWXA 1T31A 3P70B 2BX4A 1AUTC 3V7TA 2VIQA 2VVCA 2FOAA 3MU0A 5J4SA 3OX7U 1S6LA 2WSSD 1O5DH 1FY3A 2Q6FA 1YKTA 4BTIB 1T8NA 2CGAA 1O2OA 5JDUB 3VB3A 2ODPA 4D76A 3A7YA 4Y0ZE 1O2YA 5FBIA 2VVVA 3BIUH 2VIOA 3P8GA 2GMTC 4H4FA 3EA9A 4IMQA 1O3PB 5SGAE 1TA2A 3D49H 2AGIX 2F9PA 2Z3DA 4GHTA 2ZFRH 2V3OH 4IS5A 4X6PA 2Y7ZA 2Z3CA 3C1KA 5HM9A 5A0AE 1G37A 1GBHA 4TT3D 1MU6B 2F91A 2HPQH 3S9AA 2UUYA 4NCYA 1K1JA 2VU8E 1DLEA 5C94A 1BMLA 1HJ9A 1SQRA 1TPSA 5ESBA 2PKAA 2TBSA 5BRRE 2EEKA 1QL7A 4WVPE 3DHKH 4DGJA 2OUAA 4IGDA 2LPRA 4R0IA 5E2PA 1MZDA 2GGVB 3GY6A 1KXAA 4X2VA 1ETSH 1C1UH 1MTSA 3SU1A 1G3CA 4ZH8A 1UJ1A 2GCHF 3MNXA 1HXFH 1ZMNA 1LHDH 2ZDVH 2PR3A 4F4OC 3SUGA 1H9LB 2G5NA 5HYOA 1V2MT 1PPEE 1XUHA 2H9HA 9LPRA 2AMQA 1RXPA 1F0UA 1FPHH 4CRDA 1P2NA 3KIDU 4RKOB 1IOEA 1NESE 1P3CA 3DA9B 5EJZA 1BDAA 3ZV9A 5C20A 2GCTB 5FBEA 3BG4C 1EAXA 2P3TB 1GHXH 1GI7B 1UK4A 2R3UA 4K69A 4YOIA 2KCAA 4JZ1A 1GJ7B 3M7TA 1G36A 2ZG0H 1FMGA 4DVAU 2H9TH 1DUEA 1J8AA 1VZQH 1SFQB 3UQOA 2HALA 3K2UA 1FY5A 1KYNA 2HGTH 3AAUA 3F2FA 3E3TA 5ESTE 1ZTLA 3UPEA 1TIOA 4ZHAA 2UWLA 5L6NH 2J38A 3KYFA 1GJ4H 3A80A 3QGNB 4H42U 5GXPA 3LGTA 1P01A 3SHAH 4KTCA 2WPDD 2ZDLA 3SOSA 1O2PA 4ZCNA 4AX9H 3TJOA 4BNRA 1K1NA 1ZSJA 3HPTB 1UVPA 1C2HA 3T29A 1GI3A 2A32A 2AFQB 3GDVA 4U2WA 3UQVA 3G01A 1WTHD 2ZPSA 1HB0B 5DJ7A 1Y8TA 1ZTKA 1NROH 4FXGH 1QY6A 1AO5A 1YBWA 2VWMA 3RXPA 3O8BA 2FOCA 2XCNA 1MQ6A 3MNBA 1TX8A 2ANWA 5ETXA 3T27A 2GTBA 3A84A 2BDAA 3MOCA 2QCYA 1F92A 1NO9H 1FXYA 3UNRA 3SNCA 2HNTC 4WF8A 3HKIB 3A8CA 4JZIA 1RS0A 1IQKA 4INLA 1O3FA 2XNIA 1A0JA 1F0RA 3SGBE 1C5TA 1G9IE 4VGCB 1LMWB 5C0TA 3NXPA 2FX6A 1A5IA 2EI8A 1L1JA 3PWBA 1CBWC 5CHAB 4OS6A 3P8FA 1THSH 2KCOA 1AKSB 1EJAA 1KLJH 3RXOA 3V12A 1ZHPA 2GV7A 1NM6A 2TPIZ 2QN5T 5LPRA 1C1MA 2ZI2H 1ZLRA 4D8NA 3D65E 2JH5D 1EP5A 2OC0A 1MTNB 2W3IA 2ZFSA 1DVAH 1QB1A 1HAGE 1JIMA 1SLVB 1W0ZU 3ELAH 2CHAB 3TU7H 1UHBA 2OQUA 2UUFB 3TJUA 1QRWA 8GCHG 2A31A 1Z8JB 3MYWA 1K21H 1TBQH 2UUKB 1E79D 1EPTC 2C93B 1AB9B 1FQ3A 2AYWA 4KELA 4NSYA 2BD9A 4UEHH 4MPXA 1P2KA 3MNSA 3UWIA 1D3DB 1BOQA 1BUIA 3OAAD 1BTZA 3SYJA 1TB6H 4MNYA 3RXKA 1TE0A 2WPLS 1C2DA 2CV3A 4B71A 3SJOA 1CHOG 3HKJB 4B2AA 1ESTA 2G00A 2BY8X 2BZAA 1YLDA 4K8BA 1ZRKA 1UTJA 4JYVH 3E0NB 4YXWD 1CHGA 2BX3A 2O8MA 2CMYA 2TGTA 1ACBE 2PKSC 1ZOMA 4GSOA 3KEEA 4NZLA 4ACAA 4DJZB 1DUAA 4WMFA 4I8LA 4F49A 2FS8A 1VGCC 1CA8B 3A7WA 5KEDA 1NN6A 2SFAA 2VGCB 4NA7A 3PMAB 2EI6A 4ZKNU 2PW8H 2I6SA 2B9LA 3NPSA 3RXLA 3PLPA 1D3TB 5JB9S 5E0JA 1C4V2 1UTMA 2WPKS 1A1RA 4ZKRU 1MCTA 3QLPH 5J4QA 1W8BH 1C2FA 2KAIA 2J98A 3FFGA 4THNH 1SGPE 4AYVB 5DGJA 2XBYA 4MPVA 1DWEH 2EC9H 3GY8A 5EQQA 2G5VA 2BB4A 1P2MA 1GDUA 4J2YB 1SQOA 3QDZB 4X2YA 1BMNH 1DANH 1FN8A 1G32B 5CHBA 4CR5A 2ANYA 5EXLA 2G51A 3SZNA 2Z6BD 3T25A 1MBQA 2LNCA 4B2CA 1BZXE 2ZDNA 2Q6GA 3QUMP 1VITG 2XRCA 3GCTG 2R2MB 4X6NA 3EA7A 1MTWA 4ZXXH 1GBMA 2BXUH 5TCCA 3SU3A 4WMEA 2OQ5A 2SNVA 2YNAA 5HMAA 2JIZD 2FLRH 1MAYA 3SNAA 3P8NA 4UFGH 5HIZA 1O3MA 4YM9A 1YF4A 1O37A 1WYKA 2QAAA 3LGIA 3MU5A 5T1VA 3IITA 1JWTA 4FUEA 4GUXA 2J92A 2ZHWH 2F9NA 2G4TA 2PTCE 2G4UA 2R9PA 1YYY1 4WY3A 1EATA 1GVLA 2SNWA 3ZYDA 4FETA 2OINA 2FEQH 1J14A 3LIWA 4CHAB 1VITH 1TNJA 1ZPZA 2OTVA 1GHBF 4YOGA 3U69H 1C2EA 1YPKH 1ABIH 1KXFA 1C1RA 2WV9A 5DKMA 4K8YA 2FI3E 2ZGCA 3BIVH 2W26A 1C9TA 2FS9A 3LH1A 2V7QD 4HGCA 1FUJA 3MQKC 1HGTH 5F03A 1A3BH 2ZO3H 3SV7A 1TBZH 4AZ2B 1W7GH 1OWHA 4U01A 3ZYEA 2WPJS 2NU0E 1ANCA 1VJ9U 3SN8A 4NSVA 3K65B 4XDEA 4CRBA 1BTWA 1C5QA 4JZDH 3SJ9A 1GCTC 1H8HD 2HOBA 1EAIA 4B6FA 3M35A 1G3DA 3VB4A 1SGNE 3LC5A 5AHGH 1DXWA 1SSXA 1MUEB 1D6WA 1S82A 3T28A 1SR5C 3M5NA 1CGJE 1N1LA 5AVDA 2HVXA 2GT7A 5L30H 4K60A 1VKYA 4CBNA 2FP7B 3EDXB 1O2LA 2ZC9H 3M5LA 1JBUH 3ATIA 1SC8U 5EODA 1K1LA 1NFXA 1GMCG 2GMTB 3W95A 1EZSC 2QV1A 3P8OA 3SHCH 1F5KU 1VR1H 3SQEE 1Y59T 4JCNA 1K1OA 1KDQB 2BOHB 2SGPE 2WINI 2SGEE 4B74A 1YPEH 4XRNA 2GZ7A 5GPIB 1BT7A 2EY4C 2QXGA 4I33A 1FAKH 3T5FH 1HIAA 1O36A 5FX5A 4AFUA 3TIUA 4FU7A 4E05H 5AFZH 1SOTA 3A8DA 1NFWA 1G30B 3RXHA 5JBAS 3R0FA 1QFKH 2BVSH 4JMYA 3PRBA 4UFFH 1ZHRA 2R0LA 2TIOA 1P57B 3ZZDA 5C1XA 2FMJA 1GBJA 2G55A 2OBOA 1AHTH 1GBAA 2Y6TA 1SQAA 3KQDA 4OS7A 1TQ7B 3PTBA 3PWCA 1O2IA 1KXEA 1EXFA 1P10A 3F9FA 1OWJA 1UCYE 4DCDA 1K0HA 3GDSA 2OK5A 4M9FA 1P03A 4X0WU 4LZ4B 4DOQA 1HPGA 3GYMA 2YOLA 4RKJB 2BZ6H 1QURH 4X8VH 5HIYA 5GIBA 5G4BA 3LOXA 2Y81A 2KCYA 3VXFH 4X6MA 4CH2B 5GJ4B 3QGJA 2VH6A 5DP6A 1MD7A 3ATWA 1ZRBA 2F3CE 1W0KD 3BG4B 1BBRH 5B6OA 2FODA 3T2NA 3RXUA 3BN9A 5GCHF 3ZVGA 1GBBA 3M61U 3L6PA 1GHAF 2Y82A 1C1WH 1EQ9A 1Q3XA 2A7JA 2XXLA 1PPCE 1O33A 1OKXA 2ZGXH 3LPRA 3MU4A 1GL0E 4FUJA 2A4GA 4MNVA 4X6OA 2A2XH 1P3EA 1P2JA 3TNTA 1IQLA 1GBTA 3LGWA 3STIA 1GMDF 5E8EH 2DUCA 1SLWB 3UTUH 3FZDA 3RM2H 1MKXK 4WJG2 4O3TA 4OGXA 1D9IA 2Y7XA 3SW2B 3HGPA 5BPEA 1NS3A 3GISB 4HG6A 1IHSH 2F4LA 2QC2A 2FWWA 3K9XB 1ELTA 1YCPM 1F0TA 1LVOA 7GCHF 1LHCH 2IPQX 1GWAA 1B0EA 1HJAC 3FP6E 3RLWH 1ELEE 3ZZ4A 1GGDB 3KCGH 2ASUB 3KGPA 1FNIA 3M36A 4K5ZA 3M5MA 1QRZA 3FZZA 2BD3A 3SNEA 1FONA 1LPGB 1A46H 2NU3E 2RA3A 3TK6A 4BAOB 4ABAA 5JB8S 1L4DA 2Z9GA 2J2UA 4X1RU 3RMLH 2XBWA 1O5EH 2SGDE 4YESB 3SO3A 1QJ1B 1O5FH 1UVTH 3RMMH 4D7FA 2ZPQA 4CRAA 1JIRA 3NKKA 3LH3A 1AY6H 1UTQA 6GCHF 1FV9A 1CBWB 3QTOH 5FXLA 2KX4A 1A61H 3GY7A 3RU4D 3VEQB 1H8ED 6GCHG 1K2I1 3MMGA 4WH6A 2XTTB 1NRQH 3ZVAA 3EGKH 2BLOA 1C1SA 1INCA 3KQBA 4MPUA 2P94A 2BDGA 1GI8B 1GJ6A 4CRCA 1LVBA 1G2MA 4YLQH 2FZZA 1BTYA 4R8TB 3SU2A 2SGQE 4OM9A 5E0HA 2ODQA 3I77A 3TNSA 1ESAA 1EFRD 1NRSH 1O3LA 1KY9A 3LDXH 1EPTB 5A8ZA 4YT7H 2LELA 1UTKA 1TNHA 1QIXB 3UUZA 2GDEH 3KQEA 4I32A 2WPHS 2HLDD 1TYNA 1TNLA 2QXIA 3CNRA 1V2UT 3NWUA 3N7DA 2RDLA 1L1NA 1TMUH 5C2ZA 1QCPA 1TGCA 1RRKA 2ZEBA 1BQYA 4DY7B 1N8OB 2ZNKH 3M7QA 4XD7D 1D3QB 3A83A 2NU1E 3ZZAA 1TPOA 2H1UA 2ZECA 3DFJA 3AW1A 2C8YB 3VGCB 1YLNA 3LT3A 1SGFG 1V2RT 3F2GA 3M3TA 8ESTE 5A0BA 4RI0A 1GI6A 1AI8H 1WUNH 2C90B 4MTBA 1DWCH 2F83A 1W0YH 2PSXA 3MTYA 1C2KA 3MU1A 2VWNA 2AMDA 5EPNA 1GDNA 1EZQA 2KM0A 1AGJA 1C5NH 5B6LA 2XC5A 1O3HA 4TPIZ 3F1SB 3HATH 4AGKA 4INHA 2WUCA 1NFYA 1C2JA 4KKDA 4TSFD 1SMFE 4IC5A 1XUJA 1C4Y2 3V0XA 1C5SA 2GV6A 1O3JA 2HPPH 2VWOA 3AK5A 5EG4A 3A82A 4Y8ZA 3SV9A 5EIYA 1EKBB 2P8OC 4JK6A 2P16A 3F0PA 5JBTA 1TX6A 3MH5A 2GJGA 2BQWB 4YTAA 3VG8A 1FDPA 3H7OA 4FU8A 4OS4A 1RTLA 2CK3D 1P2IA 1DXPA 3SUFA 4LK4A 2PGQB 1YPMH 1CVWH 4HTCH 2PFEA 5CDFE 1K9OE 1GJDB 1EB1H 1IQMA 2AMPA 2RFKC 1HAVB 1QA7A 3SGQE 3TVJB 1D6RA 3A7TA 2R3YA 1N6YA 1PYTD 4FVBA 1EZXC 3TH2H 3UOUA 2O8LA 1C5RA 3GOVB 2ZU4A 2FIRH 1QGFA 5EJLA 3AAVA 4CRFA 2XC4A 3LGUA 1RIWC 1E1QD 4MNWA 1ANDA 5EJ1A 2WV4A 3DCLA 4MDSA 4I8GA 4ZXYH 1B0FA 3RC6A 1AE5A 3MH7A 1UK3A 2EA3A 1UTPA 2LP6A 1AFQC 2BY6X 4B2BA 3BTKE 3VFEA 1SGCA 2ZDKA 2Y5HA 4Q7YA 4K2YA 2BLWA 1HDTH 1GI1A 1CU1A 2ZCHP 3S0NA 1T8OA 1GHVH 2PLXA 4LXBH 2CN0H 4IMZA 2H2ZA 2GVFA 1XKAC 4GAWA 3SU4A 3P92A 2B7DH 4X1SU 1HCGA 2BVRH 1MQ5A 3F0OA 1OOKB 3VB7A 4Q2KA 4E7RG 1ABJH 3OSYA 1O2HA 5FPYA 2K8IA 3DD2H 4Y10E 1DE7H 3MO9A 1W14U 2CF9H 1FX0B 2JDID 2EQNA 3ITIA 1Z8RA 3L3TA 5JYIA 2XWAA 4BANB 1IHTH 1GCDA 1UCYH 5HKKD 1DOJA 1BRUP 2FYRA 2OBQA 1BTUA 1TNKA 2D1JA 1HNEE 1W12U 2BLVA 3S9BA 2J94A 1BHXB 1C5YB 2FO9A 3GS9A 2J95A 1IQNA 1C5XB 1VCQA 2HNTE 1BBRE 1LKBA 4I31A 4QT8C 4Y6DA 1O31A 2ZTYA 3V13A 1MKWH 1E34B 3TITA 1JRSA 3N7EA 1OYQA 4FUIA 1PQ7A 4ESTE 1NRPH 2V3MA 2ZDMA 3F2HA 3S69A 1GJCB 5DP9A 1C2GA 3ODDA 4CBOA 5DPAA 1S81A 8GCHF 1LHFH 3JZ1B 3PTNA 5IK2D 4GLYA 1XKBC 3BTFE 4A5TS 3KHVA 2OP9A 2VVUA 3DFLA 2R0KA 1E35B 2KZ4A 4X1PU 1O2QA 4Q7ZA 1OS8A 2PTNA 1GJ9B 2K1QA 2ZA5A 1F5LA 4ABDA 1CHOF 1MMJN 1S0QA 4H6TA 4TY7A 1NT1A 4X8SH 1OWDA 1Z1JA 1C5VA 1SFIA 3V3MA 1YC0A 1O3NA 3RXRA 2QY0B 3K6YA 1P12E 1GG6C 2ZGJA 4K1TA 5EPYA 2OXSA 3FAOA 1UTNA 1O2XA 1SGQE 1AVGH 4AB8A 3KF2A 1TFXA 1YPGH 2W7UA 2ZDAH 1K1IA 4NIWA 2KFWA 2ZQ2A 2HWLB 2IPHA 4MG3A 1ZGIA 1AZ8A 5F8ZA 2OC8A 1Y5BT 1SLXB 3LJJA 2H9EH 2XWBI 1NRNH 2ZQ1A 2BQ6B 1OWIA 3GCHB 4NFEA 2V0BA 1GJBB 1SQTA 3OY5U 1G2LA 4ZKSU 1DSTA 4I8JA 3ZZ8A 1KXBA 3SJKA 2PUQH 5CE1A 1C4U2 1TA6A 3OFND 2A0QB 1LVMA 1HAYB 1H9IE 8LPRA 3STJA 1ZR0A 2BD2A 5C3NA 4XBBA 1CSOE 3MI4A 3Q3XA 3BTME 2Z3EA 1AMHA 3U8TH 3W94A 1LVYA 2J34A 2CXVA 4Q80A 1C5ZB 1NTPA 4I8HA 2EI7A 2IJOB 2HRVA 1C5MD 2Z9KA 3GDUA 3P17H 3FKSD 4GVUA 1VITF 1P06A 3QZQA 3GCTF 1BJUA 2ZU3A 3F9EA 1W11U 4UD9H 2D8WA 5T6GA 1O3OA 1WDIA 4NG9H 1OXGA 1GJAB 2WPMS 5DSFA 4RSPA 5KECA 1DWBH 4RT1A 1KLIH 2AEIH 2F9OA 1O30A 3LGVA 3ZVCA 4Q7XA 1V6DA 2QA9E 1BB0B 1OP0A 4DIIH 2WPIS 7KMEH 3PROA 2ANKH 3AVZA 1ANEA 4FUFA 3SV8A 5I46H 3SU0A 1H8IH 3ZZCA 3BSQA 5LGOA 1O34A 4TPYA 1ETTH 4Y7BA 2STAE 1H4WA 1WBGB 2V6NA 4A1XA 3BTQE 1DT2A 1Z6EA 1PQ5A 3PMHB 4IC6A 1HJAB 4A92A 4TY6A 1TMBH 5C67A 4UDWH 5DP7A 1GHZA 3RC5A 9ESTA 1C2MA 2GCTC 2GX4A 1KXDA 1YPHC 1PPFE 2ILNA 2VB0A 3FO8D 1FLEE 2ZF0H 1DS2E 4YT6H 5T6DA 1TRYA 1EUFA 1ARCA 4FUGA 3RC4A 8KME2 3O8RA 3SQHE 1QR3E 1W13U 5TCAA 3NRLA 4NIXA 1PFXC 3ZZ9A 4KTSA 3RXQA 1E0FD 3O8DA 1XUFA 3A85A 5FX6A 3H5CB 4O03A 1EOLA 3SNBA 4BXWA 1UVSH 1V2ST 1T7CA 1MTVA
chains in the Genus database with same CATH topology
3GY2A 1DY9A 1HJ8A 1K22H 3P95A 5PTPA 1V2KT 6CHAC 3UOPA 1SGYE 4WWYA 5C5NA 1ZYOA 2CF8H 4OGYA 4LZ1H 3RM0H 1ELVA 2VNTA 3RXEA 1CA0C 1ANBA 1O2NA 4IN1A 3RMNH 4FU9A 1ZPCA 3O8CA 5HGGA 3E1XB 1YLCA 4ABIA 1HAPH 1WOFA 3RXSA 1TGTA 1CT4E 2WYJA 2NWNA 3S9CA 1BTHH 1HBTH 4XBDA 2ZHFH 1DSUA 1O5CB 2BQ7B 2H5DA 4JYUH 3M3SA 3RXGA 1K1PA 5T6FA 3GY3A 2BD5A 4INKA 1CGHA 1P11E 2ZCLP 1S85A 4CH8B 2JETC 1E36B 1ID5H 1SVPA 1C5PA 1ELBA 1GMCF 3UR6A 5EOKA 1GJ8B 1T32A 5E2OA 1XVMA 3PMJA 1F2SE 1J17T 1AN1E 1TNIA 1ZHMA 3EE0B 1ELDE 1MH0A 5C5OA 1XUKA 3TJVA 1C1OA 3Q00A 4H6SB 1TOMH 3BEFB 1QJ7B 3UIRA 1CT2E 3RUOA 1AKSA 3A87A 1TGNA 1ZZZA 3D23A 2B5TB 1TAWA 4NGAH 2PKAB 3U1IB 1RTFB 1A0LA 4MLFB 1KSNA 4XE4A 1WU1A 5FCKA 3VPKA 1G3BA 1SL3A 1ZJKA 1V2WT 1U6QA 3ESTA 2F9VA 1LPKB 1HYLA 5E0GA 2NU4E 1AB9C 1NC6A 1BCUH 5ABWA 1P2QA 1WAYB 2FI5E 2ZP0H 1CQQA 1GBFA 2QIQA 1TALA 3UREA 1KIGH 1Q31A 1W7XH 3E90B 1P0SH 1NZQH 2ZHDA 3U8RH 2GKVE 5DP5A 5F6MA 3BG8A 3RXIA 3L33A 1AQ7A 2ZFQH 1WSSH 3UNSA 4FUHA 1FJSA 1O3BA 3TLOA 2XC0A 2THFB 3U98H 2GP9B 1GI5A 4FVDA 1L2EA 4UE7H 2FOEA 1A5HA 2BLQA 2D2DA 1GDQA 5DP4A 2Y5GA 2ULLA 2VWLA 3P6ZB 4BAQB 3E0PB 3MO3A 3RMOH 3RXDA 1RIWB 4AFZA 5T3HA 2ODYB 2BY5X 1ARBA 2M5TA 1YCPK 2A4RA 2A5AA 5HXFA 1QL8A 3LKWA 3MNCA 1Z1IA 1AFQB 2PGBB 1NY22 1THPB 2TGDA 1OYTH 1O2MA 5C1UA 3CP7A 3M7UA 1ELFA 3RP2A 4KGAA 3GICB 2FLBH 3QO6A 1XX9A 2Z9LA 1XXFA 1UTOA 1KLTA 1GBCA 2ANMH 1L1GA 3A81A 4Y79A 5AFYH 5LH8A 2GDDA 2BTCE 1GMHG 4I8KA 1MBMA 2AS9A 2A7HA 2BY7X 1THRH 1FPCH 1LCYA 1O2RA 1TRMA 2VIPA 1WV7H 1LPZB 4JZEH 1LHEH 3SJ8A 2AIPA 3M3VA 5EXMA 5HM2A 1O2KA 3SBKA 1C9PA 1L4ZA 4Y76A 4ABBA 3R3GB 1TNGA 5DP8A 3Q77A 3HK6B 1FN6A 4X1NU 3TH4H 4YLUA 2Y5FA 3A7XA 4Y11E 2Y80A 1YGCH 3E16B 4CREA 1EB2A 1ETRH 2WUBA 3FP8E 5FCRA 3URCA 3GY5A 3LC3A 4AYYB 3M37A 3SU6A 1O32A 4D9RA 2C3SA 5GDSH 1O3CA 4AORA 4GPGA 1UTLM 1OWEA 1HRTH 1F5RA 1P9UA 2AH4X 1GI0A 1TPAE 1O5BB 4B75A 2HLCA 1PQ8A 2ZHEH 3UWJH 1OSSA 2VJ1A 2W5EA 3A7VA 3ZVEA 1UHBB 3EA8A 1IQFA 2J9NA 1FY8E 4RN6A 1O5AB 1V2TT 1J15A 2BDCA 1PPGE 2C8ZB 1O2TA 3ZZ5A 4ABEA 4JYTA 3MWIU 3I78A 2VIVA 1AD8H 1TOCB 1SB1H 2BD8A 2QF0A 1OWKA 3ZZ3A 1P8VC 1O2SA 1O2UA 1YM0A 3RDZA 1GBEA 3F68H 1BRAA 4B73A 1V2LT 4M7GA 2FI4E 1J16A 1E38B 4NZQA 5FAHA 1EJMA 1GG6B 5K0HA 3RXBA 4ZHLU 3SUDA 1G3EA 1O5GH 2O8UA 1AVWA 2P95A 2A5KA 3MO6A 3RU4E 1O3EA 4X2WA 3LU9B 2PKSB 1MAXA 2G52A 2P59A 1M9UA 1P2OA 1VGCB 4Y8YA 1S84A 2J4IA 1H1BA 3RXFA 3KL6A 1ZSKA 1QRXA 1V2PT 3ZVDA 2ZU5A 2BXTH 4A1VA 4BAHB 5L2YH 5IYTA 1BMMH 3IWMA 1SBWA 4SGBE 3BTEE 1B5GH 1GVZA 1KDQA 1BTXA 5FPSA 1FY1A 2P3UB 4X2XA 2AERH 2XYAA 2KAIB 5F8TA 3F9GA 1EASA 4TWWA 1OPHB 1BHXF 3A8AA 2XBXA 1Z8IB 4Y7AA 3PO1C 2AIQA 4IW4E 2ALPA 3SORA 3QK1A 2QXHA 1Z71A 3BF6H 1EAWA 2ZFFH 4XSKU 1TGSZ 1O39A 3PB1E 2OCVB 3OTJE 1A7SA 3RU4T 1IQEA 3ZZ6A 1XXDA 4Y71A 2JKHA 1MU8B 1AUJA 1QL9A 2W3KA 1C1NA 3QX5H 2GCHG 2VIDA 1SOZA 1P09A 2G81E 1WQSA 4DT7B 5EQRA 1LQDB 2PSYA 1XMNB 4KTUA 1JXPA 3ZV8A 1O3DA 1HXEH 1H8DH 1T4UH 1YPLH 1ZJDA 4BAMB 2OC1A 2B8OH 4HFPB 2ESTE 4NWKA 4JK5A 1PJPA 1NPMA 3GYLB 3NK8A 3A8BA 1BIOA 1O2GH 1P02A 1SG8B 2JH6D 1HUTH 1PYTC 1Y5AT 4UONA 3F9HA 3BEIB 1XVOA 4NFFA 4ZHMU 1F7ZA 1LO6A 1OP8A 3ZVBA 1QHRB 4ABGA 1AWFH 2ZGHA 3A89A 1E37B 3BTHE 1T4VH 1O2ZA 1S5SA 1W3CA 1RD3B 5A0CA 3ODFA 3CS7A 2PV9B 4K1EA 1GI4A 3TK9A 3Q3YA 2ZCKP 3PLBA 1GJ5H 1Y3XA 2AGEX 6CHAB 3E91A 1IAUA 4I7YH 2FOFA 1QA0A 1FIWA 1DITH 4D9QA 2VINA 3FVFB 1UVOA 3E6PH 2QGRA 3T62A 3ZZ7A 1CA0B 4BOHA 1NU7B 2RG3A 2BDYA 3TK5A 1GBKA 4HI3A 1UCYK 2Q6DA 3Q76A 1TWXB 4ISNA 4MQAA 2FESH 2FXRA 2FOGA 2IOTA 2NU2E 3MFJA 1GGDC 2Z9JA 3E8LA 2W7SA 4TWYA 5EW2H 1GCTB 2FOBA 1Y3YA 4YO9A 1ELCA 1V2NT 4MVNA 2BDIA 3TPIZ 1A4WH 1MKWK 2JETB 3PYHA 1HLTH 4MPWA 5H4IB 4WH8A 1FAXA 6LPRA 1ESBA 3VXEH 1EZUC 2BHGA 1S0RA 2GT8A 4ZUHA 3IG6B 4XFQA 4A6LA 4WXIA 2OC7A 1EP6A 4Y0YE 4NIVA 1DX5M 3M5OA 4IBLH 1A0HB 1A2CH 1AIXH 1CT0E 2SGFE 1SHHB 1UO6A 5L2ZH 1AVXA 3NUMA 2JH0D 2ZIQH 2A5IA 4NA9H 1WQVH 2DE8A 4FUBA 1HIAB 2RA0A 2PUXB 1CO7E 3FP7E 3QTVH 3TJNA 1PPZA 5DP3A 4D7GA 1GVKB 2TGPZ 1GBLA 4AN7A 1DLKB 4X8TH 2BDBA 1QQUA 1C2IA 3A7ZA 5I25A 1EPTA 4AFSA 2OLGA 2WYGA 1DM4B 1OP2A 2BM2A 2I6QA 4IN2A 4FUDA 2BYAX 1JRTA 1VCWA 2FTLE 1A3EH 2H6MA 2VIWA 3CENA 1QTFA 1BMAA 4OS1A 5JBBS 2QF3A 3EYDA 1XM1A 4XOJA 4K3JA 5TJXA 1GI9B 5K7RA 1LQEA 1N8OC 3SV6A 1QBVH 1IQIA 1BRCE 1ORFA 4MNXA 2F9BH 4ZKOU 3URDA 3UY9A 1HFDA 3VGCC 1CGIE 5DG6A 3UR9A 1QNJA 1O3GA 1JOUB 1TPPA 1VCPA 1Y3VA 1DICA 3HK3B 4ZROA 1Y5UT 2F9UA 1D4PB 1EX3A 1P9SA 3A88A 2RCEA 4LOYH 4WXVA 4DW2U 4K1SA 4Z0KA 2C4FH 3B23B 1PQAA 3SV2H 1VJAU 1TBRH 5LPFA 1SGIB 3F6UH 3BTTE 1NU9A 4AG1A 1QB6A 1K28D 2FPZA 3B8JA 4NWLA 1HAHH 2B0FA 1Z7KA 3LJOA 2XW9A 2Z94A 1YPJH 1O38A 1SGTA 2UWOA 3KNXA 1S6FA 1DDJA 3CS0A 1DY8A 4CR9A 1WCZA 1LDTT 1J9CH 2VH0A 3PM3A 4ASHA 3MHWU 2FX4A 1GL1A 3PLKA 3QN7A 1HAVA 4OS5A 1BRBE 1TMTH 2A1DB 3SU5A 3SUEA 1T8LA 1V2QT 2BD7A 5JPMH 1GPZA 1TGBA 2V35A 1MTUA 1P05A 1YP9A 4UFDH 2ZZUH 1KTSB 1RGQA 3U8OH 1SHYA 1DFPA 3GCNA 1SLUB 2C8XB 2IN2A 3FANA 3VB6A 3ATLA 3VB5A 4NIYA 2FM2A 5FPTA 3C27B 1BJVA 3DT0H 1QQ4A 1KXCA 1S83A 3HGNA 1YPHE 4PROA 3ZZBA 2P93A 3S7KB 2ZU2A 4DG4A 5EGMA 3B9FH 4E06H 3UNQA 3UFAA 5A8YA 1MCVA 4GCHF 3RLYH 1QJ6B 3RXVA 2H5CA 1C2LA 4AGJA 2FYQA 1HAOH 1ELAA 1SGFA 1SI5H 4GCHG 4O9VA 1GHBG 4WMDA 1NFUA 3SGAE 1V2JT 2O8WA 4BTUB 1O35A 3BTDE 3ZVFA 2XBVA 1MZAA 3MU8A 3AASA 1XUIA 4U32A 4XBCA 1ZPBA 3GCOA 2FTMA 3LGYA 4DURA 2G8TA 3N7OA 1O3AA 1O3KA 2STBE 4ABJA 1B7XB 2FOMB 2TGAA 1O2VA 1BITA 2A45B 4Z6AH 2A7CA 1PPBH 4VGCC 4AB9A 1O2JA 1IQJA 1PPHE 4ZMAH 3U9AH 3AW0A 2ZPRA 1GBDA 2QXJA 3A86A 1TRNA 5CHAC 1ZSLA 3JZ2B 5EQSA 4X8UH 5EW1H 3H7TA 2ZU1A 1WTGH 2A4OA 1V2OT 4ISLA 1TX7A 1NRRH 3RXTA 2BDHA 2HNTF 1W2KH 4A1TA 1FI8A 3OY6U 5GWZA 4NA8A 5DO4H 1MTNC 1D3PB 2O9QA 3D62A 2Z7FE 2OD3B 1RFNA 2CHAC 2ZFPH 3DUXH 1ELGA 3BV9B 1SGEE 4JZFH 2UWPA 1HAZB 1C1TA 7ESTE 3SI4H 4YZUA 4X1QU 1AFEH 1GBIA 3TH3H 2ZGBH 1FIZA 1A5GH 1V2VT 3PV4A 2O8TA 2P8OB 3PO1B 6ESTA 1HAXB 5A2MH 1AWHB 2CJIA 5EXNA 1C1VH 1GHYH 1ZTJA 1TLDA 1P04A 1RJXB 4BXSA 5A8XA 3TGIE 5FHTA 1CE5A 3U1JB 1TQ0B 1BBRK 1LTOA 1AZZA 5IDKA 3KQCA 4U30A 1F0SA 1BA8B 1O3IA 1SGDE 2TRMA 2VGCC 1X7AC 4AOQA 1V3XA 2ZHQH 2ZKSA 3GCHC 1EOJA 3SNDA 3OYPA 5LPEA 3BTWE 1C5OH 1C1QA 4J1YA 2ZTXA 4A7IB 3K6ZA 1O0DH 3S7HB 1Q2WA 4ZAEA 1IQHA 5DK1A 2ALVA 1GI2A 1TABE 4O97A 1C5UA 3RXMA 4BTTB 2GD4B 4ABFA 4GHQA 4FUCA 2D26C 3RXAA 1Z6JH 1H9HE 1UVUH 2WV5A 5JBCS 2R2WU 2Q1JA 1O2WA 1KTTB 3Q3KA 3RXJA 2P3FH 4ABHA 1ZGVA 2AGGX 2BVXH 4O3UA 5GCHG 1FY4A 7LPRA 4E7NA 1GMHF 1OX1A 1TONA 1GHAG 4BAKB 1BTPA 4KP0A 4B1TA 2DE9A 1RTKA 1YCPH 2A4QA 1T8MA 3TGJE 1AU8A 1LHGH 5C1YA 2BD4A 1DPOA 1HV7A 3RXCA 2XCFA 2UUJB 1XUGA 1ZMJA 3EAJA 4OS2A 4CRGA 5F8XA 3ATMA 1GMDG 1JMOH 4YOJA 1MKXH 1QBNA 2FOHA 1AE8H 3KN2A 1Y3UA 3OU0A 4AG2A 1EAUA 4TYDA 2BY9X 1FZZA 4Y8XA 4SGAE 4DIHH 4B76A 3QWCH 1MD8A 3SI3H 1HAIH 7GCHG 1SPJA 1ZMLA 1S6HA 1UK2A 3SJIA 2ZWLH 4ISHH 4ISOA 2QYIA 1N6XA 5CMXH 2Z9IA 1L0ZA 2ZTZA 2FDAA 1IQGA 5EU8A 4CHAC 1GHWH 2GZ8A 4ISIH 1W10U 1C5LH 3QZRA 4UFEH 1SGRE 1Z8GA 2BMGB 3ENSB 3BEUA 2PHBA 3I29A 5AF9H 1C1PA 1LKAA 1C5WB 4HZHA 2A2QH 3GY4A 3T26A 3NZIA 4AFQA 3WY8A 2C8WB 3NCLA 1QB9A 5A09A 1QBOA 3BTGE 2BOKA 2SGAA 3MH4A 2V3HH 2GZ9A 2YNBA 2ZFTA 1Y3WA 1K1MA 3ATKA 3PMBB 3LONA 1UMAH 3MH6A 3EQ0H 1EJNA 3TGKE 1DWDH 2PWXA 1T31A 3P70B 2BX4A 1AUTC 3V7TA 2VIQA 2VVCA 2FOAA 3MU0A 5J4SA 3OX7U 1O5DH 1FY3A 2Q6FA 1YKTA 4BTIB 1T8NA 2CGAA 1O2OA 5JDUB 3VB3A 2ODPA 4D76A 3A7YA 4Y0ZE 1O2YA 5FBIA 2VVVA 3BIUH 2VIOA 3P8GA 2GMTC 4H4FA 3EA9A 4IMQA 1O3PB 5SGAE 1TA2A 3D49H 2AGIX 2F9PA 2Z3DA 4GHTA 2ZFRH 2V3OH 4IS5A 4X6PA 2Y7ZA 2Z3CA 3C1KA 5HM9A 5A0AE 1G37A 1GBHA 1MU6B 2F91A 2HPQH 3S9AA 2UUYA 4NCYA 1K1JA 2VU8E 1DLEA 1BMLA 1HJ9A 5ESBA 1TPSA 2PKAA 2TBSA 5BRRE 2EEKA 1QL7A 4WVPE 3DHKH 4DGJA 2OUAA 4IGDA 2LPRA 4R0IA 5E2PA 1MZDA 2GGVB 3GY6A 1KXAA 4X2VA 1ETSH 1C1UH 1MTSA 3SU1A 1G3CA 4ZH8A 1UJ1A 2GCHF 3MNXA 1HXFH 1ZMNA 1LHDH 2ZDVH 2PR3A 4F4OC 3SUGA 1H9LB 2G5NA 5HYOA 1V2MT 1PPEE 1XUHA 2H9HA 9LPRA 2AMQA 1RXPA 1F0UA 1FPHH 4CRDA 1P2NA 3KIDU