4IN1A

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
174
Chain Sequence
SAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGEINFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like protease
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
total genus 37
structure length 174
sequence length 182
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4in1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4in1A01
2J4IA 1SLUB 5HXFA 2VIPA 1N8OB 1G30B 2G52A 4ABEA 2ZGBH 3BF6H 1IQHA 1GHXH 1JBUH 4IMZA 4ZKSU 1YM0A 1KDQB 4Z6AH 1O2PA 3SNDA 2GDEH 4LZ1H 1EOLA 1YLDA 2H5CA 2H9HA 2HRVA 2WYGA 3PWBA 3RMNH 3HGNA 5EXMA 3MU8A 1S0QA 5FCKA 1C2GA 4BAOB 1WBGB 1ESBA 1K9OE 3M36A 5C5NA 1BQYA 1CGHA 4ABAA 1EZXC 3QZQA 1C4Y2 2PUQH 3LOXA 1GMDF 3EQ0H 1LHCH 1V2MT 1VGCC 3EA7A 3UOPA 4X6NA 1N1LA 3ZZAA 2FX4A 3LGVA 1ELAA 2GZ8A 2KAIB 1SLVB 3I77A 1GJ8B 1P2KA 5J4SA 1MAYA 2WPIS 1QURH 1WTHD 1UJ1A 3RXGA 2QC2A 2ESTE 1HRTH 2VU8E 1RIWC 3CS7A 1NESE 2R0LA 4RN6A 1ANDA 1C5XB 2OTVA 4B71A 1SC8U 2G4UA 1E35B 2D26C 5GDSH 5FX5A 1EASA 3EYDA 3W95A 2I6QA 3UNSA 2Q1JA 1EB1H 1K28D 2IN2A 5EQQA 3DA9B 1AY6H 3PWCA 1HLTH 2VH0A 1IQIA 1A5GH 1E36B 5T6FA 3RXSA 3SJOA 1H8DH 2V0BA 4X2VA 3SU3A 5C1YA 1MTNC 5AF9H 4KELA 1BTPA 1HDTH 1GI6A 1P10A 3DHKH 1V2TT 6CHAB 1SGPE 1P09A 4Z0KA 1NRNH 1TB6H 2HNTF 4ABBA 3MYWA 1FJSA 5CHAB 3M5LA 1YPHE 1ZTLA 3OY6U 4ZKRU 4K1TA 2RCEA 4X1NU 1PPGE 1AB9C 2NU2E 1GG6C 3E0PB 1S6FA 1EX3A 3SN8A 2Y5HA 3FFGA 2D8WA 1UHBB 1ZPCA 1XVOA 2GZ7A 3QTVH 1S83A 1PPHE 1K1NA 1BTWA 4B76A 1AI8H 3R3GB 1MD7A 1K1MA 1P2JA 2FS8A 4ZMAH 3LGIA 2CV3A 1SGIB 3SW2B 1KTTB 3BTHE 1W13U 2VVVA 2M5TA 4B1TA 5TJXA 1IAUA 4JYTA 5AFYH 2EI7A 4CRGA 3BTTE 1SGDE 1T8LA 2QN5T 4HTCH 2GCHG 3VFEA 2W3KA 5L30H 1BRBE 1GJ7B 3B8JA 1YPKH 3LJJA 3RXEA 2PFEA 1S82A 1CVWH 1AD8H 1FY4A 4FXGH 1HJAC 4O3UA 2Z94A 2XYAA 1RTKA 1V2ST 3RLWH 3Q3XA 1BDAA 1UK3A 5EU8A 2VIVA 1DWCH 4KTCA 1C1PA 2SGPE 2XRCA 3GY3A 1VITH 3TK9A 1UTNA 1XM1A 3U8RH 1AZZA 2ZDLA 1W7GH 1AUTC 1V2JT 1C2MA 1NTPA 3Q00A 4DW2U 1GBFA 1HV7A 4YT7H 3VPKA 2ODYB 1SFQB 1GCTC 3SQHE 1EAXA 3ODDA 4FUFA 4ESTE 4DIIH 4GPGA 1BT7A 5FPSA 2AGGX 1TBRH 3P8GA 1GJDB 3M3VA 1AKSA 1YCPM 2G5NA 1CQQA 3M35A 3SQEE 1GVLA 1AVWA 5HM2A 4NIWA 4D76A 1D3TB 3BTQE 4I32A 2PUXB 4IS5A 5IDKA 1EZUC 2A5IA 2FMJA 1AZ8A 1L4DA 1CT2E 1K1IA 2Y7ZA 1ELCA 3TGKE 4CRBA 2HOBA 4NG9H 4JZIA 4RKOB 2BDIA 1TPAE 4GCHG 3MI4A 3ATLA 4Y76A 1PPFE 1S85A 1SQAA 4AGKA 5DP3A 2CXVA 4H6SB 2ZU2A 2BQ6B 2ILNA 5DJ7A 3RXLA 3TVJB 3Q76A 1G2MA 3MNCA 3VXFH 1FDPA 3TU7H 3S7HB 4E05H 3QX5H 7KMEH 1HXFH 2ZWLH 1FN6A 1SGRE 5C67A 1RIWB 1TQ7B 3ZZ8A 4X6PA 1NROH 4UE7H 5C2ZA 1P57B 3RXCA 4KKDA 3SHCH 1IQJA 1QA0A 3GCTF 3GCNA 3RM2H 2ZI2H 1O5FH 1O36A 5C20A 1EXFA 4ZKNU 1GI4A 1RRKA 4MDSA 1OXGA 4MNYA 2JH5D 1O5GH 1C5UA 3P95A 5L2YH 1MTNB 3A89A 3BN9A 5EW1H 2FM2A 3RXDA 1V2RT 2FPZA 1PQ5A 4I8HA 4AGJA 2A4GA 3HPTB 1N6XA 1VJ9U 1NFXA 4XDEA 3MU5A 3NXPA 1GG6B 1O3GA 3S9AA 2ANMH 2STAE 3SUEA 2W26A 1ZSKA 2BDYA 1FONA 4NGAH 2V6NA 1IQEA 2BQ7B 2PSYA 3P6ZB 4O9VA 2QXIA 4Y11E 3SU6A 2FTLE 4K1SA 1ZMLA 2C8WB 2JH0D 1WU1A 1UTMA 3Q3YA 1JRSA 1Q31A 1DM4B 3AAUA 2GCTB 5T6GA 5J4QA 3MNXA 1DT2A 5ESTE 2FX6A 1G3EA 2AYWA 1O2XA 1TNHA 1BTHH 1DICA 3PV4A 4TY6A 2XCFA 1LVYA 1ELVA 3GOVB 1O39A 1SOTA 4GHQA 4Q7ZA 4XOJA 3ZV8A 1EPTA 1HNEE 4CR5A 2BMGB 3K6ZA 1B0FA 1TGNA 1G36A 1GBIA 1QBVH 3RXVA 1JXPA 1V2WT 2ANKH 2BD3A 1G2LA 1GJBB 1SGFA 1AFQC 2FEQH 5LPRA 4Q2KA 1Z7KA 1LTOA 5JB9S 4RSPA 3A87A 1HJAB 2BD2A 2EI8A 2ZO3H 4AX9H 1C5WB 1ZSLA 1SB1H 1O2UA 1YPMH 2C8XB 1A5IA 2OQUA 4LZ4B 2ZZUH 1LKBA 2R0KA 3QWCH 2GMTC 1ZTKA 3A8BA 3L6PA 1EPTC 3P92A 2ZGCA 2ZDNA 1QCPA 1SBWA 3E6PH 3SO3A 1OKXA 2ZTYA 1A3EH 2ODQA 2ZQ1A 3ZVAA 3TJUA 5EPYA 4J1YA 3MNSA 1UCYE 1Q3XA 5A8XA 1TIOA 1OWDA 1UTQA 4UDWH 2BZAA 3U1JB 1FPCH 4JK6A 3BEFB 1T4VH 2TGDA 3SU0A 1HAPH 2CGAA 4BANB 5FCRA 4Q80A 3MO9A 5L2ZH 1IQNA 3MOCA 4ZKOU 1GVZA 1W2KH 4X6OA 5GPIB 1LQEA 2W3IA 2FXRA 4D7GA 3RXAA 1FZZA 1HBTH 2QA9E 1TNJA 3E91A 5FAHA 1A4WH 2VGCC 1SGEE 2K1QA 1MCTA 1PPBH 1MBQA 2HALA 3L3TA 4FVDA 1ETSH 3FZZA 3GY4A 4NZQA 2ZECA 1A61H 1FI8A 4E7RG 3URDA 1MU8B 2WV4A 1IHSH 2ZFQH 4IC6A 3SJ9A 4A1VA 3LONA 1GBHA 3NCLA 1O3CA 5DP4A 3M5MA 3K65B 1Y5UT 1ZLRA 1UVSH 1CE5A 5F6MA 1AIXH 1TGTA 1CBWC 2BLOA 2SGFE 1L1NA 2G4TA 4X1RU 5DP9A 1KXAA 4DT7B 1O2WA 1ETTH 1P2IA 1YF4A 1MD8A 1B5GH 1THPB 3MU0A 3Q77A 1SGYE 3KL6A 2Q6GA 1TBZH 1DY9A 1O34A 2CF9H 3SI4H 1O5EH 2EI6A 1GMHG 4OS2A 1THRH 3GISB 1SQTA 4CH2B 1BITA 3ZYDA 1VJAU 1BBRK 1C2KA 1G9IE 2GGVB 2ZCLP 3PMAB 2FOBA 2O8LA 3D62A 2G8TA 1O3PB 3ZV9A 2VIWA 1RTFB 1UTKA 3OTJE 4JYUH 1GDQA 2BDCA 4FUCA 4ZXXH 1SR5C 1GHYH 4JMYA 3A7VA 4NIVA 4OS1A 5F8XA 4DG4A 3FANA 3P70B 2OCVB 1Y3WA 1CU1A 1D3PB 4BOHA 4LOYH 1O3MA 3A8AA 2VWLA 3ZVBA 2FI4E 2GTBA 3AASA 3UNQA 1QQ4A 1FY1A 1P9SA 1KSNA 1GCDA 2P16A 3UREA 1MQ6A 3BTWE 1TPPA 2DE9A 3BV9B 4H4FA 5GCHG 1BMNH 2B0FA 1DOJA 4MVNA 5DPAA 5DP5A 3TPIZ 3A84A 1DITH 1AE8H 1LVOA 3UTUH 1UK4A 3M5NA 4A5TS 1P05A 3T5FH 3BG4C 1CHOF 4JZ1A 1AU8A 1UVPA 6CHAC 4IGDA 1C5MD 3AVZA 5JBAS 3U9AH 2VVUA 1P06A 1K2I1 3NUMA 4GVUA 5CHAC 3EA8A 4TWWA 1DVAH 3D65E 1YGCH 3ZZ7A 2R3YA 1MQ5A 3MO3A 2OBOA 4Y10E 1BBRH 2WYJA 1WTGH 1UVOA 4TY7A 4WMFA 3ZVCA 1MTVA 1EPTB 2VB0A 2Y82A 4K69A 4UONA 2NU3E 1KYNA 3JZ2B 7LPRA 1KTSB 2YNBA 4UFFH 5DKMA 1SFIA 1W0YH 1WQVH 2ZPSA 5I46H 3RP2A 2OC7A 2O8TA 3B9FH 5LGOA 2QV1A 3LGWA 1S81A 2ZHWH 4UFGH 4CHAC 1O3BA 3U1IB 1TWXB 4YOIA 4ZAEA 4X1SU 4Q7YA 1ZHPA 3KQBA 5JDUB 1J8AA 3K9XB 3C1KA 2WUBA 1DLKB 1SGQE 3LT3A 2ZGJA 3UWIA 2ZFTA 1QL8A 2ALPA 1IQLA 2VGCB 4ZHMU 1YPGH 1AHTH 4INLA 5HYOA 1P8VC 3BTDE 2C8YB 1LVMA 4TWYA 5E2OA 2AGEX 4QT8C 3ZZ9A 2BOHB 2JETB 1T7CA 1H9IE 4ISOA 2R3UA 3H5CB 4MQAA 3A7WA 2GX4A 4NFFA 5E0JA 1DSTA 1NRRH 1NU7B 1OOKB 1DY8A 3F68H 3F6UH 1A46H 1OS8A 1BTZA 3SBKA 2GDDA 2WPMS 1ZGIA 1GBMA 1TMBH 1EATA 1EP5A 4WVPE 3TNTA 6GCHF 1KY9A 2UWLA 3KGPA 1NFYA 2GCHF 4WJG2 2BYAX 1MZDA 1A7SA 1AVXA 3QO6A 2XWAA 4D9QA 1O3IA 3SV8A 4SGBE 3SGQE 1GL0E 1WOFA 1L1JA 2SGAA 1PQ7A 1O2TA 2AMDA 4FUIA 2TBSA 1PJPA 3ZZ5A 2AH4X 1CA8B 2ZCHP 3KN2A 3U98H 1F0UA 1BTYA 1SI5H 2ZPRA 1Q2WA 4CBNA 2XNIA 3GY8A 1C4U2 4D9RA 1V2PT 1DWBH 2AMPA 5HMAA 3GCHC 4Y79A 2QGRA 1NC6A 4INHA 2RG3A 2OC1A 2FOMB 3ZZCA 1GPZA 1C1SA 5C3NA 4IN1A 2RA0A 4A1XA 3IITA 1LQDB 2Y80A 3SOSA 1O3EA 3TJVA 3DFJA 1S6HA 1ZZZA 4ZH8A 2BDAA 2SGDE 2Z9LA 1AE5A 1PFXC 1O2LA 2O8WA 1FUJA 3BEIB 1AUJA 3VEQB 1CGIE 3V3MA 1A3BH 4HZHA 3V13A 2GZ9A 2OQ5A 1ARBA 2FS9A 2FLRH 1UTPA 2ODPA 4GCHF 1SL3A 1TA2A 2GP9B 2J94A 2ZHQH 1ZTJA 1GVKB 3VB4A 1JRTA 1ACBE 2A4QA 2ZDMA 3BG4B 3BSQA 2OC8A 2FO9A 2XBYA 3UUZA 3RXJA 2SNWA 4FVBA 3ITIA 3EGKH 1YPHC 3F9FA 3PTBA 2IJOB 1TOCB 3FZDA 1XUIA 3MH7A 2A5KA 3FP8E 4SGAE 2Z3EA 1MU6B 1IQGA 1NFUA 1IHTH 1T8OA 4XBBA 3MH4A 2ZCKP 4ISIH 1O35A 3ZZ4A 4DGJA 2BXUH 1WAYB 3KIDU 5GXPA 5ESBA 3BIUH 4AG2A 1DUAA 3RMLH 3LGYA 4YLQH 1ANCA 2ULLA 2BLQA 4A6LA 2DE8A 1HYLA 3SJIA 1RGQA 2GCTC 1O3HA 1NRSH 2ZDAH 3VXEH 1TMUH 3PYHA 2D2DA 4CH8B 5K7RA 4CHAB 2JKHA 1J9CH 4K3JA 3SUDA 3VGCC 1V2KT 1W0ZU 1DUEA 4CR9A 1Z8IB 1L4ZA 5A0BA 2A31A 3FVFB 4X8SH 4WH8A 3RDZA 5LPFA 2XW9A 1C5LH 3ZVDA 2WPHS 4NA8A 2SFAA 1UVTH 1YPEH 1EQ9A 1FQ3A 4MLFB 2B7DH 1O2HA 1GWAA 1BA8B 1W11U 2HWLB 2J38A 3SJ8A 1ZYOA 4BNRA 3QK1A 3EAJA 1ZMJA 1L1GA 2BVXH 1C2LA 1XKAC 1C1MA 2WPJS 5IYTA 4F4OC 4I8GA 2ZU1A 1O5BB 3SU2A 1LHFH 1ABIH 2G00A 3T62A 5FPTA 3PLPA 4GUXA 1OP0A 2OBQA 1WCZA 4X0WU 2ZQ2A 4JCNA 1P03A 3K2UA 1FAKH 3SV9A 2BVSH 1YPJH 2TRMA 1VITG 1E38B 3PLKA 3M5OA 1FXYA 3MMGA 3GY2A 1KLTA 5SGAE 4I33A 5AVDA 3CP7A 5FXLA 1LO6A 4UEHH 2ZG0H 5E2PA 1EUFA 1SGNE 1GI2A 4U01A 2RDLA 4AORA 2ZFFH 1L2EA 1EAWA 1DS2E 3N7OA 5EXNA 2O8UA 3K6YA 1QL7A 3QGNB 5EPNA 1P9UA 5EW2H 1G37A 1GMCG 3TK5A 5DP6A 3PROA 4AFSA 1MBMA 1P3EA 3LGUA 1XKBC 1UK2A 1BTUA 3GCHB 3IWMA 1NY22 1K22H 5EODA 1TX6A 3VB6A 4ZUHA 1NN6A 4DVAU 2PR3A 4FUBA 4RKJB 2ZKSA 4PROA 2ZPQA 3RC4A 1C2EA 4DIHH 3M7QA 1WSSH 5JBBS 2ZP0H 3HKJB 1AN1E 3BIVH 2PGQB 3TH2H 4Y8XA 4BAKB 1K21H 3P8FA 3RM0H 4GHTA 1D6RA 3HATH 2R2MB 1C5RA 1UCYK 2FODA 2A7JA 3D23A 1PQAA 4Y8ZA 4MG3A 1Z8RA 3PO1B 4OS7A 1ZPBA 4DY7B 1QFKH 2HNTC 1T32A 1GJ9B 2NWNA 4X1PU 1XXFA 2QCYA 1GBKA 2F3CE 1P2NA 2TIOA 4GLYA 4U2WA 3E0NB 4OGXA 1G3CA 1F5KU 3ODFA 4BAMB 1P01A 4X2WA 2AMQA 3LH1A 1GHVH 4FU9A 1GJ6A 1BJVA 3UQOA 1G32B 1D9IA 2PKAA 3ATKA 3BTEE 1UMAH 1TNLA 1DSUA 1O31A 4TYDA 3RXPA 1GMHF 1PPZA 4R0IA 4B2AA 2ZGXH 1Y3YA 3T29A 2FOAA 5F8TA 2GKVE 1JIRA 8ESTE 1CGJE 1BRUP 1CHGA 2P93A 1FN8A 2ZDVH 1Y5AT 1RJXB 3ZVFA 3VGCB 1V2UT 1C2FA 3MU1A 1BMLA 3URCA 2A1DB 2QIQA 1EJAA 3OY5U 2FI3E 3HGPA 1HXEH 2PWXA 3C27B 2ZDKA 1WYKA 1CT4E 1TAWA 1GHAG 1IQMA 1V2VT 1V3XA 3F9GA 1D3DB 3TH4H 3EDXB 5A09A 2CN0H 5GWZA 1UCYH 4JZDH 3RMOH 5EOKA 3U8TH 1TX7A 5A8ZA 4WH6A 1L0ZA 2Z9KA 1W12U 1PYTD 1SGFG 3RU4E 3S69A 1LHGH 1HAHH 1P2OA 5GCHF 3UQVA 3BTKE 1ELEE 1C1RA 2V3OH 1J16A 2H2ZA 1QJ7B 5EQSA 4FUEA 1AGJA 2C4FH 4JK5A 3LDXH 4JYVH 4AB9A 3GY7A 1O5AB 4A1TA 1V6DA 1XUGA 7GCHG 4X6MA 1A0HB 1MKXK 3T27A 1VR1H 5C5OA 1TRYA 3NWUA 1GI9B 1C5VA 1XMNB 1TPSA 4WF8A 1C1QA 1YKTA 1F2SE 3KQEA 3VB3A 2NU1E 1T4UH 5GJ4B 1NPMA 1NFWA 1YPLH 3O8RA 1ELGA 2ZC9H 2C93B 2FOFA 1O2VA 3MO6A 3MU4A 3RXOA 1WV7H 4R8TB 5L6NH 1OYTH 3QGJA 2JETC 2PTNA 4FUGA 6LPRA 2Y81A 3F1SB 2Q6FA 4K2YA 2BB4A 4OS5A 2R2WU 2Z3DA 1C4V2 2Z3CA 1S0RA 3PM3A 1QB6A 4IW4E 3SI3H 2J34A 1S5SA 1QIXB 4IN2A 5A8YA 2A0QB 2B9LA 2G51A 3T26A 4B74A 1O3DA 3TITA 1TX8A 4FU7A 1PYTC 4YOJA 2ZGHA 4AYYB 2J92A 1MTSA 2PHBA 1GL1A 3L33A 1Y3VA 3GCOA 1QJ1B 1Y5BT 1K1PA 4AFUA 1C1UH 3H7TA 1SHHB 3BG8A 4AG1A 1Z1IA 2BX4A 3SUFA 5FPYA 1O2QA 3RXIA 3KQDA 1H8IH 3TJOA 2NU4E 1MKXH 1QL9A 3ZZ3A 3TNSA 4KTSA 1O3NA 3ZZ6A 1ZOMA 2XC5A 2QYIA 1F92A 1XUFA 4Y6DA 2XWBI 1NRQH 2B5TB 4K60A 3UY9A 2F9BH 2ZFPH 4K1EA 3DFLA 2P3FH 3SV2H 3F9HA 2JH6D 3SNAA 1ANEA 4MNXA 8GCHG 1NU9A 3A8DA 4ISHH 1B7XB 3NPSA 2FIRH 1O2KA 1THSH 4NA9H 4CRFA 1HAIH 3GDSA 1GDUA 1W10U 2FP7B 1W14U 1GBLA 3G01A 1T31A 1SSXA 2VWOA 2PKSB 4DURA 1MAXA 3S7KB 2PKAB 3MH5A 2OD3B 1XXDA 1GJAB 4VGCC 2EEKA 1GBJA 1Z6JH 1GJCB 1HCGA 1O2MA 2OXSA 2ZFSA 1D3QB 2A4OA 1Z8JB 3O8DA 1HJ9A 4I7YH 3RU4T 1ABJH 1GHBG 2UWOA 1ARCA 4GAWA 2FDAA 1O2RA 1LPGB 5DP8A 2Y5FA 9LPRA 1TGCA 3OSYA 2OP9A 1ELBA 1NO9H 2BD9A 1C5YB 4BXSA 4DJZB 1W7XH 3M37A 1X7AC 1HAVA 2HPQH 1FLEE 1PPEE 5C1UA 3GYMA 4NSYA 4UD9H 4BTIB 1F7ZA 1E34B 1KXBA 4MPVA 1O3AA 2R9PA 3M7TA 1GI1A 4HI3A 4WXVA 3M7UA 3E3TA 3U69H 3OU0A 4Y0ZE 2P3UB 3V12A 2I6SA 2VIQA 1P2MA 2A4RA 4Y8YA 4K8BA 1DX5M 2VIOA 4U30A 1BMAA 1H4WA 1GHWH 3EA9A 1BHXF 3SNBA 1YC0A 1ZGVA 1J15A 5BPEA 5AHGH 2F91A 3RXKA 2CMYA 1W3CA 1O2OA 5E0GA 3U8OH 1GHZA 4YM9A 2AGIX 4ABDA 5FBEA 5ABWA 1FNIA 1SLXB 2FI5E 2NU0E 1DE7H 1QRZA 1H9HE 1DDJA 1TMTH 3TGJE 4UFDH 3RXBA 7ESTE 2ZFRH 1GI8B 2W7SA 3M3SA 4ZXYH 1CT0E 4YESB 1NT1A 1AVGH 2AS9A 4BAQB 1LHDH 3UPEA 2VIDA 2A32A 3ATIA 4INKA 3HK6B 1C5SA 3A88A 4AZ2B 1C5PA 1Y3XA 4WMEA 1KIGH 3TIUA 9ESTA 3B23B 4KTUA 1C2JA 2VWNA 1BCUH 2Z9IA 2Y7XA 1HPGA 2UUYA 3A86A 1ID5H 1DLEA 1DANH 2XCNA 4WY3A 1SQOA 4O97A 1J17T 3OYPA 1C1TA 1BB0B 1QBNA 1LKAA 1P02A 3AW1A 3KF2A 2THFB 2XBVA 4X8VH 1BIOA 2AFQB 2BDGA 2YNAA 4AOQA 1O2ZA 2ZIQH 3QDZB 1HUTH 1O3OA 3R0FA 3SU5A 3GICB 2FLBH 1GBAA 3LC3A 1EAIA 1LDTT 1SGCA 5HGGA 1VITF 1KXCA 4MPWA 1QB9A 1ZJDA 2RA3A 2HPPH 3NZIA 1O3KA 1JMOH 2UUJB 1C1WH 2V35A 2OUAA 3FP6E 5C1XA 2BTCE 1YBWA 3I78A 3V7TA 4YLUA 1O2SA 5EGMA 1EOJA 2BDHA 1CHOG 3M3TA 1ELTA 1BUIA 2AIQA 3TJNA 3MWIU 2AIPA 1O2YA 3OX7U 1OSSA 3SV7A 2O9QA 2FOHA 1HGTH 1UVUH 1OPHB 1FY5A 1E37B 3A80A 2ZU4A 4YOGA 5F8ZA 1OWIA 1HAXB 1HB0B 3PO1C 2H9TH 3MFJA 1GMCF 5G4BA 4VGCB 4YZUA 4ABHA 3JZ1B 3PB1E 2GD4B 5A2MH 2ZTXA 3GY5A 8LPRA 1C5TA 3SJKA 3MH6A 2P94A 2VWMA 1O2GH 1V2OT 3GYLB 5PTPA 1NS3A 1OWEA 2HVXA 4BTUB 1P0SH 4LXBH 3W94A 1AWHB 1WUNH 3FP7E 4IMQA 3LKWA 1TFXA 3PMBB 1XUJA 2TGPZ 2BY7X 2H1UA 2C3SA 1SPJA 1GGDB 1OX1A 3PLBA 1ZJKA 3LGTA 2D1JA 4THNH 2ZHFH 1GJ5H 4JZEH 1K1OA 2C8ZB 2XC4A 3VB7A 2AERH 1ZR0A 1O2NA 2TGAA 4XBDA 3SHAH 2CJIA 4YO9A 3CENA 2BD8A 1C5ZB 2OLGA 1MH0A 1KXFA 2P59A 3LC5A 3MTYA 1ELDE 1QBOA 1AFEH 3SNCA 1SG8B 1GBDA 1HAVB 4K8YA 3ZZBA 1HAZB 1EKBB 1Y3UA 5B6OA 1ELFA 4TPYA 1MCVA 1A1RA 1AMHA 5T3HA 1FIWA 1TA6A 1YP9A 1WQSA 5FX6A 1AQ7A 1LVBA 2FESH 2ZTZA 1C9PA 3NK8A 1HAYB 2WUCA 6GCHG 2Q6DA 1QNJA 2F9VA 2H6MA 2DUCA 2PTCE 1C5QA 1C5NH 4U32A 1S84A 4I31A 3LH3A 2FYQA 2ZA5A 1C2HA 1QRXA 1MUEB 1TGBA 4BXWA 1KXDA 2P8OC 3KHVA 4MPUA 1HAOH 4WWYA 1SVPA 3RXQA 1ESAA 4UFEH 1A5HA 2BD4A 2BY6X 3BEUA 4KGAA 4B75A 4XE4A 2FOEA 4HFPB 4OS4A 3RUOA 4CRAA 3RLYH 5E8EH 1GHAF 1GBBA 2PLXA 4A7IB 3PTNA 1XUHA 1XVMA 4LK4A 1NM6A 1GMDG 4JZFH 2GT8A 2A45B 3LIWA 4DCDA 1DFPA 2XC0A 1F0RA 2VVCA 2VNTA 1JOUB 3S9BA 5EQRA 1C2IA 5F03A 1O2IA 1DWDH 3LPRA 2SGQE 3BTGE 1LPZB 4HGCA 1XUKA 1P2QA 2A7HA 1V2QT 1NZQH 1YCPK 2GVFA 2ALVA 1LPKB 1UTJA 3ZZDA 3WY8A 1E0FD 3SU4A 2FYRA 3DT0H 4NZLA 5ETXA 2OINA 3GDVA 4OGYA 1EB2A 4MNVA 2ZU5A 2BXTH 4XSKU 3A7XA 2BY9X 7GCHF 1OWJA 1V2LT 2Y5GA 1P3CA 3M61U 1ESTA 3RMMH 3ZYEA 4DOQA 2A2QH 2STBE 1VGCB 2VH6A 4NWKA 2F9UA 2O8MA 3AW0A 4Q7XA 3ENSB 2PW8H 2UWPA 1O32A 1DWEH 1ORFA 2BQWB 1QA7A 4MTBA 2SNVA 1TYNA 3RU4D 1ETRH 3SV6A 2BY8X 2QXHA 1HIAA 2WV5A 3T25A 1QQUA 2ZU3A 1TRMA 4ISLA 2J2UA 3QTOH 4X8UH 2SGEE 1FY3A 1G3BA 4XBCA 1TE0A 2CHAC 2YOLA 1IOEA 1M9UA 1Z71A 3IG6B 2WINI 1Z1JA 3DUXH 5T6DA 1BOQA 1LHEH 1YYY1 5I25A 1ZRKA 2HNTE 1H9LB 4X8TH 4WXIA 2BVRH 3FAOA 4NWLA 4X1QU 1YCPH 3E1XB 1P04A 1O5CB 1V2NT 2F9NA 4OS6A 1G3DA 2H5DA 2IPHA 4ABIA 3UR9A 3ATWA 4AB8A 1GBEA 4KP0A 2QY0B 3QLPH 2AEIH 3ZVEA 1BRAA 1AB9B 3P8NA 3E16B 5JPMH 1GI3A 1U6QA 4Y7AA 4ASHA 1C1OA 1MTWA 1D4PB 2PKSC 1GBCA 2ZHDA 1GBTA 2F83A 1BHXB 4BTTB 3ATMA 4D8NA 2WPKS 3A81A 1EJNA 1QY6A 2XTTB 1FMGA 1CSOE 1GI0A 1QRWA 1JIMA 3KNXA 2XBWA 3SNEA 1QGFA 4AYVB 1QHRB 1ANBA 4B73A 2G55A 1O33A 4ZROA 1SGTA 4NIYA 1MTUA 1TGSZ 4H6TA 8GCHF 4Y0YE 1PQ8A 4X2YA 3PMHB 3RC5A 5CE1A 1ZSJA 4CREA 1HJ8A 3UFAA 1CA0C 4E7NA 1HFDA 5JBCS 2PGBB 1C2DA 1ZHMA 2P8OB 1EP6A 4WMDA 3RXFA 5DP7A 4NIXA 4I8JA 3UWJH 3TGIE 1MMJN 2QXGA 4ABJA 4B2CA 4GSOA 4I8LA 2BD7A 2HLCA 3MNBA 4Y7BA 2Y6TA 1TOMH 1VCWA 1OWKA 1TONA 1RTLA 1F0SA 3LJOA 2QAAA 1GI7B 1GHBF 1EAUA 1BZXE 2P95A 2FOCA 2ZF0H 2ANWA 3TK6A 1A2CH 2V3HH 4NSVA 2BHGA 1GCTB 1B0EA 3T28A 2BLWA 4FU8A 5EXLA 4NA7A 1PPCE 1Z6EA 2Z7FE 1TRNA 1TNIA 1EZSC 1INCA 1UTOA 1VCQA 4FUJA 5A0CA 3ZVGA 2EC9H 1A0LA 3P17H 3O8CA 2B8OH 1GI5A 1VZQH 2A2XH 3GCTG 3SU1A 1XX9A 4CBOA 1C1VH 2LPRA 3SGAE 1ZMNA 6ESTA 4BAHB 1HAGE 2EA3A 1BJUA 3E90B 2BOKA 2BX3A 1AKSB 4XFQA 3STJA 3AAVA 4I8KA 1OP8A 1OWHA 2XBXA 1TQ0B 3TLOA 5H4IB 1DXPA 2WPLS 3DD2H 5DG6A 3RXHA 5DO4H 1KDQA 2QF0A 2W5EA 3F9EA 3UNRA 4ABGA 1F5RA 3MHWU 3TH3H 2OC0A 1A0JA 3UR6A 2GT7A 1C1NA 3QUMP 4J2YB 4CRCA 3T2NA 1GJ4H 1ZPZA 3KEEA 3P8OA 2UUFB 3RXUA 1N8OC 2TPIZ 3RXMA 5AFZH 2ZEBA 2F9OA 5LPEA 5FBIA 2G81E 4YTAA 5JBTA 3A7YA 2CHAB 2Z6BD 5E0HA 2PV9B 4A92A 1T8MA 4ABFA 1VCPA 2KAIA 1N6YA 1DXWA 2BDBA 4X2XA 1SHYA 1O3LA 1ZRBA 4TPIZ 3RXRA 2TGTA 1ZHRA 3Q3KA 3BTFE 3HK3B 1HIAB 2G5VA 1OP2A 1EJMA 2P3TB 5DK1A 1FY8E 4K5ZA 1H1BA 4FUDA 2C90B 5FHTA 3CS0A 4CRDA 1O2JA 1AWFH 3S9CA 1Z8GA 2BD5A 3PMJA 2Z9JA 5GIBA 1CO7E 1YLCA 2BY5X 2ZNKH 1OYQA 2IOTA 1BMMH 3BTME 1TALA 3KCGH 1RS0A 3A83A 2PSXA 1QB1A 2HGTH 4IBLH 1Y8TA 3S0NA 1O30A 1DPOA 1O38A 1J14A 3RXTA 2ASUB 1O3JA 2FTMA 5LH8A 1O5DH 3V0XA 3KQCA 1O3FA 3H7OA 5HM9A 1NRPH 1KLIH 1FPHH 3NKKA 4Y71A 1T8NA 1RFNA 1K1JA 1UHBA 1O37A 2QF3A 4ISNA 2F9PA 1TLDA 1IQFA 1UTLM 1MKWK 1GGDC 1CA0B 1FIZA 3A7ZA 4O3TA 1AFQB 2BLVA 1TBQH 5K0HA 2LNCA 1JWTA 3SZNA 2FOGA 1KLJH 2FZZA 5TCAA 1AO5A 1FV9A 1QTFA 5JB8S 3ELAH 1LMWB 1W8BH 3VB5A 1QR3E 2A5AA 3ESTA 3E8LA 5JYIA 2J9NA 3I29A 1QJ6B 4MPXA 4NFEA 2GMTB 4ZHAA 4ZHLU 3LU9B 5DGJA 2BZ6H 4F49A 1BTXA 2FWWA 3RC6A 2ZHEH 3SGBE 3A85A 4M7GA 5A0AE 4AN7A 2UUKB 4IC5A 1LCYA 3GY6A 1SMFE 1P12E 3STIA 2GV6A 2GV7A 2Z9GA 2VINA 1F5LA 2XXLA 4H42U 4B2BA 2W7UA 3A7TA 5CMXH 1SOZA 1BBRE 5TCCA 3A82A 3O8BA 4AFZA 1O0DH 4FUHA 3SUGA 2J95A 3QZRA 1KXEA 1P11E 4AFQA 1Y59T 1EZQA 3D49H 1TPOA 3QN7A 4E06H 4YT6H 1TNKA 4NCYA 1C9TA 2ANYA 4O03A 1BRCE 2QXJA 3UIRA 1SLWB 1RD3B 1K1LA 1FAXA 1TNGA 2VJ1A 1GDNA 3GDUA 3EE0B 1IQKA 4MNWA 2A7CA 3UOUA 8KME2 3HKIB 5BRRE 1MKWH 3SORA 2CF8H 1F0TA 5EG4A 1TABE 1D6WA 1CBWB 4D7FA 3A8CA 1MZAA 1C5OH 2H9EH 1UO6A 2BM2A 1RXPA
chains in the Genus database with same CATH superfamily
1W0JD 2J4IA 1SLUB 5HXFA 2VIPA 1N8OB 1G30B 2G52A 3UAIC 4ABEA 2ZGBH 3BF6H 1IQHA 1GHXH 1JBUH 4IMZA 5C0UA 4ZKSU 1YM0A 1KDQB 4Z6AH 5T1VA 1O2PA 3SNDA 2GDEH 4LZ1H 1EOLA 1YLDA 2H5CA 2H9HA 2HRVA 2WYGA 3PWBA 1VKYA 3RMNH 3HGNA 5EXMA 3MU8A 1S0QA 5FCKA 1C2GA 4BAOB 1WBGB 1ESBA 1K9OE 3M36A 5C5NA 1BQYA 1CGHA 4ABAA 1EZXC 4FOUC 3QZQA 1C4Y2 2PUQH 3LOXA 1GMDF 2XNDD 3EQ0H 1LHCH 1V2MT 1VGCC 3EA7A 3UOPA 4X6NA 1N1LA 3ZZAA 2FX4A 3LGVA 1ELAA 2GZ8A 2KAIB 1SLVB 3I77A 1GJ8B 1P2KA 5J4SA 1MAYA 2WPIS 1QURH 1WTHD 1UJ1A 3RXGA 2QC2A 2ESTE 3VG8A 1HRTH 2VU8E 1RIWC 3CS7A 1NESE 2R0LA 4RN6A 1ANDA 1C5XB 2OTVA 4B71A 1SC8U 2G4UA 1E35B 2D26C 5GDSH 5FX5A 1EASA 3EYDA 3W95A 2I6QA 3UNSA 1EFRD 1EB1H 1K28D 2IN2A 2Q1JA 5EQQA 3DA9B 1AY6H 3PWCA 1HLTH 1YLNA 2VH0A 1IQIA 1A5GH 1E36B 5T6FA 3RXSA 3SJOA 1H8DH 2V0BA 4X2VA 3SU3A 5C1YA 1MTNC 5AF9H 4KELA 1BTPA 1HDTH 1GI6A 1P10A 3DHKH 1V2TT 6CHAB 1SGPE 1P09A 4Z0KA 1NRNH 1COWD 1TB6H 2HNTF 4ABBA 3MYWA 1FJSA 5CHAB 3M5LA 1YPHE 1ZTLA 3OY6U 4ZKRU 4K1TA 2RCEA 4Q63A 4X1NU 5GNDA 1PPGE 1AB9C 2NU2E 1GG6C 3E0PB 1S6FA 1EX3A 3SN8A 2Y5HA 3FFGA 2D8WA 1UHBB 1KMHB 1ZPCA 1XVOA 2GZ7A 3QTVH 1S83A 1PPHE 1K1NA 1BTWA 4B76A 1AI8H 3R3GB 1MD7A 1K1MA 1BMFD 1P2JA 2FS8A 4ZMAH 3LGIA 2CV3A 1SGIB 3SW2B 1KTTB 3BTHE 1W13U 2VVVA 2M5TA 4B1TA 5TJXA 1IAUA 4JYTA 5AFYH 4RT0A 2EI7A 4CRGA 3BTTE 1SGDE 1T8LA 2QN5T 4HTCH 2GCHG 3VFEA 2W3KA 5L30H 1BRBE 1GJ7B 3B8JA 1YPKH 3LJJA 3RXEA 2PFEA 1S82A 1CVWH 1AD8H 1FY4A 4FXGH 1HJAC 4O3UA 2Z94A 2XYAA 1RTKA 1V2ST 3RLWH 3Q3XA 1BDAA 1UK3A 5EU8A 2VIVA 1DWCH 4KTCA 1C1PA 2SGPE 2XRCA 3GY3A 1VITH 3TK9A 1UTNA 1XM1A 3U8RH 2J98A 3DSGA 1AZZA 2ZDLA 1W7GH 1AUTC 1V2JT 1C2MA 1NTPA 3Q00A 4DW2U 1GBFA 1HV7A 4YT7H 2EQNA 3VPKA 2ODYB 1SFQB 1GCTC 3SQHE 1EAXA 3ODDA 4FUFA 4ESTE 2YMSD 4DIIH 4GPGA 2JDID 1BT7A 5FPSA 2AGGX 1TBRH 3P8GA 1GJDB 3M3VA 1AKSA 1YCPM 2G5NA 1CQQA 3M35A 3SQEE 1GVLA 1AVWA 5HM2A 4NIWA 4D76A 1D3TB 3BTQE 4I32A 2PUXB 4IS5A 5IDKA 1EZUC 2A5IA 2FMJA 1AZ8A 1L4DA 3ZIAD 1CT2E 1K1IA 2Y7ZA 1ELCA 3TGKE 4CRBA 2HOBA 4NG9H 4JZIA 4RKOB 2BDIA 1TPAE 4GCHG 1SQRA 3MI4A 3ATLA 4Y76A 1PPFE 1S85A 1SQAA 4AGKA 5DP3A 2CXVA 4H6SB 2ZU2A 5KGOA 2BQ6B 2ILNA 5DJ7A 3RXLA 3TVJB 3Q76A 1G2MA 3MNCA 3VXFH 1FDPA 3TU7H 3S7HB 4E05H 3QX5H 7KMEH 1HXFH 2ZWLH 1FN6A 1SGRE 5C67A 1RIWB 1TQ7B 3ZZ8A 4X6PA 1NROH 4P00A 4UE7H 5C2ZA 1E1QD 1P57B 3RXCA 4KKDA 3SHCH 1IQJA 1QA0A 3GCTF 3GCNA 3RM2H 2ZI2H 1O5FH 1O36A 5C20A 1EXFA 4ZKNU 1GI4A 1RRKA 4MDSA 1OXGA 4MNYA 2JH5D 1O5GH 1E1RD 1C5UA 3P95A 2OK5A 5L2YH 1MTNB 3A89A 3BN9A 5EW1H 2FM2A 1K0HA 3RXDA 2YMSC 1V2RT 3KYFA 2FPZA 1PQ5A 4I8HA 4AGJA 2A4GA 3HPTB 1N6XA 1VJ9U 1NFXA 4XDEA 3MU5A 3NXPA 1GG6B 1O3GA 3S9AA 2ANMH 2STAE 3F3BA 3SUEA 2W26A 1ZSKA 2BDYA 1FONA 4NGAH 2V6NA 1IQEA 4XD7D 2BQ7B 2PSYA 3P6ZB 4O9VA 2QXIA 4Y11E 3SU6A 3PV5A 2FTLE 4K1SA 1ZMLA 2C8WB 2JH0D 1WU1A 1UTMA 3Q3YA 1JRSA 1Q31A 1DM4B 3AAUA 4AC9A 2GCTB 5T6GA 5J4QA 3MNXA 1DT2A 5ESTE 2FX6A 1G3EA 2AYWA 1O2XA 1TNHA 1BTHH 1DICA 3PV4A 4TY6A 2XCFA 1LVYA 1ELVA 3GOVB 1O39A 1SOTA 4GHQA 4Q7ZA 4XOJA 3F2FA 3ZV8A 1EPTA 1HNEE 4CR5A 2BMGB 3K6ZA 1B0FA 1TGNA 1G36A 1GBIA 1QBVH 3RXVA 1JXPA 1V2WT 2ANKH 2BD3A 1G2LA 1GJBB 1SGFA 1AFQC 2FEQH 5LPRA 4Q2KA 1Z7KA 1LTOA 5JB9S 4RSPA 3A87A 1HJAB 2BD2A 2EI8A 2ZO3H 4AX9H 1C5WB 2KM0A 1ZSLA 2KFWA 1SB1H 1O2UA 1YPMH 2C8XB 1A5IA 2OQUA 4LZ4B 2ZZUH 1LKBA 5HIYA 2R0KA 3QWCH 2GMTC 1ZTKA 3A8BA 3L6PA 1EPTC 3P92A 2ZGCA 2ZDNA 1QCPA 1SBWA 3E6PH 2WSSD 3SO3A 1OKXA 2ZTYA 1A3EH 2ODQA 2ZQ1A 3ZVAA 2AHME 3TJUA 2KCPA 3OEHD 5EPYA 4J1YA 3MNSA 1UCYE 1Q3XA 5A8XA 1TIOA 1OWDA 1UTQA 4UDWH 2BZAA 3U1JB 1FPCH 4JK6A 3BEFB 1T4VH 2TGDA 3SU0A 1HAPH 2CGAA 4BANB 5FCRA 4Q80A 3MO9A 5L2ZH 1IQNA 3MOCA 2J98B 4ZKOU 1GVZA 2LELA 3F2HA 1W2KH 4X6OA 5GPIB 1LQEA 2W3IA 2FXRA 4D7GA 3RXAA 1FZZA 1HBTH 2QA9E 1TNJA 3E91A 5FAHA 1A4WH 2VGCC 1SGEE 2K1QA 1MCTA 1PPBH 1MBQA 2HALA 3L3TA 4FVDA 1ETSH 3FZZA 3GY4A 4NZQA 2ZECA 1A61H 1FI8A 4E7RG 3URDA 3OAAD 1MU8B 2WV4A 1IHSH 2ZFQH 4IC6A 3SJ9A 4A1VA 3LONA 1GBHA 3NCLA 1O3CA 5DP4A 3M5MA 3K65B 1Y5UT 1ZLRA 1UVSH 1CE5A 5F6MA 2M2AA 1AIXH 1TGTA 1CBWC 2BLOA 2SGFE 1L1NA 2G4TA 4X1RU 5DP9A 1KXAA 4DT7B 1O2WA 1ETTH 1P2IA 1YF4A 1MD8A 1B5GH 1THPB 3MU0A 3Q77A 1SGYE 3KL6A 2Q6GA 1TBZH 1DY9A 1O34A 2CF9H 3SI4H 1O5EH 2EI6A 1GMHG 4OS2A 1THRH 3GISB 1SQTA 4CH2B 1BITA 3ZYDA 1VJAU 1BBRK 1C2KA 1G9IE 2GGVB 2ZCLP 3PMAB 2FOBA 2O8LA 3D62A 2G8TA 1O3PB 3ZV9A 2VIWA 1RTFB 1UTKA 3OTJE 4JYUH 1GDQA 2BDCA 4FUCA 4ZXXH 1SR5C 1GHYH 4JMYA 3A7VA 4NIVA 4OS1A 5F8XA 4DG4A 3FANA 3P70B 2OCVB 1Y3WA 1CU1A 1NBME 1D3PB 4BOHA 4LOYH 1O3MA 3A8AA 5KECA 2VWLA 3ZVBA 2FI4E 2GTBA 3AASA 2HLDD 3UNQA 1QQ4A 1FY1A 1P9SA 1KSNA 1GCDA 2P16A 3UREA 1MQ6A 3BTWE 1TPPA 2DE9A 3BV9B 4H4FA 2LP6A 5GCHG 1BMNH 2B0FA 1DOJA 4MVNA 5DPAA 5DP5A 3TPIZ 3A84A 1DITH 1AE8H 1LVOA 3UTUH 1UK4A 3M5NA 4A5TS 1P05A 3T5FH 3BG4C 1CHOF 4JZ1A 1AU8A 1UVPA 6CHAC 4IGDA 1C5MD 3AVZA 5JBAS 3U9AH 2VVUA 1P06A 1K2I1 3NUMA 4GVUA 5CHAC 3EA8A 4TWWA 1DVAH 3D65E 1YGCH 3ZZ7A 2F4LA 2R3YA 1MQ5A 3MO3A 3OEED 2OBOA 4Y10E 1BBRH 2WYJA 2PP6A 1WTGH 1UVOA 4TY7A 4WMFA 3ZVCA 1MTVA 5HIZA 1EPTB 2VB0A 2Y82A 4K69A 4UONA 2NU3E 1KYNA 3JZ2B 7LPRA 1KTSB 2YNBA 4UFFH 5DKMA 1H8ED 4F55A 1SFIA 1W0YH 1WQVH 2ZPSA 5I46H 3RP2A 2OC7A 2O8TA 3B9FH 5LGOA 2QV1A 3LGWA 1S81A 2GJGA 2ZHWH 4UFGH 4CHAC 1O3BA 2QF4A 2KCAA 3U1IB 1TWXB 4YOIA 4ZAEA 4X1SU 4Q7YA 2JIZD 1ZHPA 3KQBA 5JDUB 1J8AA 3K9XB 3C1KA 2WUBA 1DLKB 1SGQE 3LT3A 2ZGJA 3UWIA 2ZFTA 1QL8A 2ALPA 1IQLA 2VGCB 5FL7D 4ZHMU 1YPGH 1AHTH 4INLA 5HYOA 1P8VC 3BTDE 2C8YB 1LVMA 4TWYA 5E2OA 2AGEX 4QT8C 3UB0A 3ZZ9A 2BOHB 2JETB 1T7CA 1H9IE 4ISOA 5CDFE 2R3UA 3H5CB 4MQAA 3A7WA 2GX4A 4NFFA 5E0JA 1DSTA 5EJZA 1NRRH 1NU7B 1OOKB 1DY8A 5C94A 3F68H 3F6UH 1A46H 1OS8A 1BTZA 3SBKA 2GDDA 2WPMS 1ZGIA 2J97A 1GBMA 1TMBH 1EATA 1EP5A 4WVPE 3TNTA 6GCHF 1KY9A 2UWLA 3KGPA 1NFYA 2GCHF 4WJG2 2BYAX 1MZDA 1A7SA 1AVXA 3QO6A 4I86A 2XWAA 4D9QA 1O3IA 3SV8A 4SGBE 3SGQE 1GL0E 1WOFA 1L1JA 2SGAA 1PQ7A 3FO8D 4B6EA 1O2TA 2AMDA 4FUIA 2TBSA 1PJPA 3ZZ5A 2AH4X 1CA8B 2ZCHP 3NRLA 3KN2A 3U98H 1F0UA 1BTYA 1SI5H 2ZPRA 1Q2WA 4CBNA 2XNIA 3GY8A 1C4U2 4D9RA 1V2PT 1DWBH 2AMPA 5HMAA 3GCHC 4Y79A 2QGRA 1NC6A 4INHA 2RG3A 2OC1A 2FOMB 3ZZCA 1GPZA 3DCLA 1C1SA 5C3NA 4IN1A 2RA0A 4A1XA 3IITA 1LQDB 2Y80A 3SOSA 1O3EA 3TJVA 3DFJA 1S6HA 1ZZZA 4ZH8A 2BDAA 2SGDE 2Z9LA 1AE5A 1PFXC 1O2LA 2O8WA 1FUJA 3BEIB 1AUJA 3VEQB 1CGIE 3V3MA 1A3BH 4HZHA 3V13A 2GZ9A 2OQ5A 1ARBA 2FS9A 2FLRH 1UTPA 2ODPA 4GCHF 1SL3A 1TA2A 2GP9B 2J94A 2ZHQH 1ZTJA 1GVKB 3VB4A 1JRTA 1ACBE 2A4QA 2ZDMA 3BG4B 3BSQA 2OC8A 2JJ1D 2FO9A 2XBYA 2WZQA 3UUZA 3AK5A 3RXJA 2L6OA 2SNWA 4FVBA 3ITIA 3EGKH 1YPHC 3F9FA 3PTBA 2IJOB 1TOCB 3FZDA 1XUIA 3MH7A 2A5KA 3FP8E 4SGAE 2Z3EA 1MU6B 1IQGA 1NFUA 1IHTH 1T8OA 4XBBA 3MH4A 2ZCKP 4ISIH 1O35A 3ZZ4A 4DGJA 2BXUH 1WAYB 3F0PA 3KIDU 5GXPA 5ESBA 3BIUH 4AG2A 1DUAA 3RMLH 3LGYA 4YLQH 1ANCA 2ULLA 2BLQA 4A6LA 2DE8A 1HYLA 2K0QA 3SJIA 1RGQA 2GCTC 1O3HA 1NRSH 2ZDAH 3VXEH 1TMUH 3PYHA 2D2DA 4CH8B 5K7RA 4CHAB 2JKHA 1J9CH 4K3JA 3SUDA 3VGCC 1V2KT 1W0ZU 1DUEA 4CR9A 1Z8IB 1L4ZA 5A0BA 2A31A 3FVFB 4X8SH 4WH8A 3RDZA 5LPFA 2XW9A 1C5LH 3ZVDA 2WPHS 4NA8A 2SFAA 1UVTH 1YPEH 1EQ9A 1FQ3A 4MLFB 2B7DH 1O2HA 1GWAA 1BA8B 4TSFD 1W11U 2HWLB 2J38A 3SJ8A 1ZYOA 4BNRA 3QK1A 3EAJA 1ZMJA 1L1GA 2BVXH 1C2LA 1XKAC 1C1MA 2WPJS 5IYTA 4F4OC 4I8GA 2ZU1A 1O5BB 3SU2A 1LHFH 1ABIH 2G00A 3T62A 5FPTA 3PLPA 4GUXA 1OP0A 2OBQA 1WCZA 4X0WU 2ZQ2A 4JCNA 1P03A 3K2UA 1FAKH 3SV9A 2BVSH 1YPJH 2TRMA 1VITG 1E38B 3PLKA 3M5OA 1FXYA 3MMGA 3GY2A 1KLTA 1W0KD 5SGAE 4I33A 5AVDA 3CP7A 5FXLA 1LO6A 4UEHH 2ZG0H 5E2PA 1EUFA 1SGNE 1GI2A 4U01A 2RDLA 4AORA 2ZFFH 1L2EA 1EAWA 1DS2E 3N7OA 5EXNA 2O8UA 3K6YA 1QL7A 3QGNB 5EPNA 1P9UA 5EW2H 1G37A 1GMCG 3TK5A 1E79D 5DP6A 3PROA 4AFSA 1MBMA 1P3EA 3LGUA 1XKBC 1UK2A 1BTUA 3GCHB 3IWMA 1NY22 1K22H 5EODA 3EE7A 1TX6A 3VB6A 4ZUHA 1NN6A 4DVAU 2PR3A 4FUBA 4RKJB 4HG6A 2ZKSA 4PROA 2ZPQA 3RC4A 3DSPA 3U28C 1C2EA 4DIHH 3M7QA 1WSSH 5JBBS 2ZP0H 3HKJB 1AN1E 3BIVH 2PGQB 3TH2H 4Y8XA 2RFKC 4BAKB 1K21H 3P8FA 3RM0H 4GHTA 1D6RA 3HATH 2R2MB 1C5RA 1UCYK 2FODA 2A7JA 3D23A 3PRDA 1PQAA 4Y8ZA 4MG3A 1YY3A 1Z8RA 3PO1B 4OS7A 1ZPBA 4DY7B 1QFKH 2HNTC 1T32A 1GJ9B 2NWNA 4X1PU 1XXFA 2QCYA 1GBKA 2F3CE 1P2NA 2TIOA 4GLYA 4U2WA 3E0NB 4OGXA 1G3CA 1F5KU 3ODFA 4BAMB 1P01A 4X2WA 2F43B 2AMQA 3LH1A 1GHVH 4FU9A 1GJ6A 1BJVA 3UQOA 1G32B 1D9IA 2PKAA 3ATKA 3BTEE 1UMAH 1TNLA 1DSUA 1O31A 4TYDA 3RXPA 1GMHF 2IPQX 1PPZA 4R0IA 4B2AA 2ZGXH 1Y3YA 3T29A 2FOAA 5F8TA 2GKVE 1JIRA 8ESTE 1S6LA 1CGJE 1BRUP 1CHGA 2P93A 1FN8A 2ZDVH 1Y5AT 1RJXB 3ZVFA 3VGCB 1V2UT 1C2FA 3MU1A 1BMLA 3URCA 2A1DB 2QIQA 4ASUD 1EJAA 3OY5U 2FI3E 3HGPA 1HXEH 2PWXA 3C27B 2ZDKA 1WYKA 1CT4E 1TAWA 1GHAG 1IQMA 1V2VT 1V3XA 3F9GA 1D3DB 3TH4H 5B6LA 3EDXB 5C17A 4Q4LA 5A09A 2CN0H 5GWZA 1UCYH 4JZDH 3RMOH 5EOKA 3U8TH 1TX7A 5A8ZA 4WH6A 1L0ZA 2Z9KA 1W12U 1PYTD 1SGFG 3RU4E 3SZEA 3S69A 1LHGH 4TT3D 1HAHH 1P2OA 5GCHF 3UQVA 3BTKE 1ELEE 1C1RA 2V3OH 1J16A 2H2ZA 1QJ7B 5EQSA 4FUEA 1AGJA 2C4FH 4JK5A 2CK3D 1OHHD 3LDXH 4JYVH 4AB9A 3GY7A 1O5AB 4A1TA 1V6DA 1XUGA 7GCHG 4X6MA 1A0HB 1YWUA 1MKXK 3T27A 4DT4A 1VR1H 5C5OA 1TRYA 3NWUA 1GI9B 1C5VA 1NBMD 1XMNB 3OE7D 1TPSA 4WF8A 1C1QA 1YKTA 1F2SE 3KQEA 3VB3A 2NU1E 1T4UH 5GJ4B 1NPMA 1NFWA 1YPLH 3O8RA 1ELGA 2ZC9H 2C93B 2FOFA 1O2VA 3MO6A 3MU4A 3RXOA 1WV7H 4R8TB 5L6NH 1OYTH 3QGJA 2JETC 2PTNA 4FUGA 6LPRA 2Y81A 3F1SB 2Q6FA 4K2YA 2BB4A 4OS5A 2R2WU 2XOKD 2Z3DA 1C4V2 2Z3CA 1S0RA 3PM3A 1QB6A 4IW4E 3SI3H 2J34A 1S5SA 1QIXB 4IN2A 4B6FA 5A8YA 2A0QB 2B9LA 2G51A 3T26A 4B74A 1O3DA 3TITA 1TX8A 4FU7A 1PYTC 4YOJA 2ZGHA 4AYYB 2J92A 5HKKD 1MTSA 2PHBA 1GL1A 3L33A 1Y3VA 3GCOA 1QJ1B 1Y5BT 1K1PA 4AFUA 1C1UH 3FOAA 3H7TA 1SHHB 3BG8A 4AG1A 1Z1IA 2BX4A 3SUFA 5FPYA 1O2QA 3RXIA 3KQDA 1H8IH 3TJOA 2NU4E 1MKXH 1QL9A 3ZZ3A 3TNSA 4KTSA 1O3NA 3ZZ6A 1ZOMA 2XC5A 2QYIA 1F92A 1H8HD 1XUFA 4Y6DA 2XWBI 1NRQH 2B5TB 4K60A 3UY9A 2F9BH 2ZFPH 4K1EA 3DFLA 2P3FH 3SV2H 3F9HA 3N99A 2JH6D 5F53A 3SNAA 1ANEA 4MNXA 2K8IA 8GCHG 1NU9A 3A8DA 2KCYA 4ISHH 1B7XB 3NPSA 2FIRH 1O2KA 5C0TA 1THSH 4NA9H 4CRFA 1HAIH 3GDSA 1GDUA 1W10U 2FP7B 1W14U 1GBLA 3G01A 2HVYB 1T31A 1SSXA 2VWOA 2PKSB 4DURA 1MAXA 3S7KB 4ACBA 2PKAB 3MH5A 2OD3B 1XXDA 1GJAB 4VGCC 2EEKA 1GBJA 5EJ1A 1Z6JH 1GJCB 1HCGA 1O2MA 2OXSA 2ZFSA 1D3QB 2A4OA 1Z8JB 3O8DA 1HJ9A 3SYJA 4I7YH 3RU4T 1ABJH 1GHBG 2UWOA 1ARCA 4GAWA 4ZCNA 2FDAA 1O2RA 1LPGB 5DP8A 2Y5FA 9LPRA 1TGCA 3OSYA 2OP9A 1ELBA 1NO9H 2WPDD 2BD9A 1C5YB 4BXSA 4DJZB 1W7XH 3M37A 1X7AC 1HAVA 2HPQH 3OFND 1FLEE 1PPEE 5C1UA 3GYMA 4NSYA 4UD9H 4BTIB 1F7ZA 1E34B 1KXBA 4MPVA 1O3AA 3H09A 2R9PA 3M7TA 1GI1A 4HI3A 4WXVA 3M7UA 3E3TA 3U69H 3OU0A 4Y0ZE 2P3UB 3V12A 2I6SA 2VIQA 1P2MA 2A4RA 4Y8YA 4K8BA 1DX5M 2VIOA 4U30A 1BMAA 1H4WA 1GHWH 3EA9A 1BHXF 3SNBA 1YC0A 1ZGVA 1J15A 5BPEA 5AHGH 2F91A 3RXKA 2CMYA 3MQKC 1W3CA 1O2OA 5E0GA 3U8OH 1GHZA 4YM9A 2AGIX 4ABDA 5FBEA 5ABWA 1FNIA 1SLXB 2FI5E 2NU0E 1DE7H 2QF5A 1QRZA 1H9HE 2W6ID 1DDJA 1TMTH 3TGJE 4UFDH 3RXBA 7ESTE 2ZFRH 1GI8B 2W7SA 3M3SA 4ZXYH 1CT0E 4YESB 1NT1A 1AVGH 3OTPA 2AS9A 4BAQB 1LHDH 2JJ2D 3UPEA 2VIDA 2A32A 3ATIA 4INKA 3HK6B 1C5SA 3A88A 4AZ2B 1C5PA 1Y3XA 4WMEA 1KIGH 3TIUA 9ESTA 3B23B 4KTUA 1C2JA 2VWNA 1BCUH 2Z9IA 2Y7XA 1HPGA 2UUYA 3A86A 1ID5H 1DLEA 1DANH 3W1EA 2XCNA 4WY3A 1SQOA 4O97A 1J17T 3OYPA 1C1TA 1BB0B 1QBNA 1LKAA 1P02A 3AW1A 3KF2A 2THFB 2XBVA 4X8VH 1BIOA 2AFQB 2BDGA 2YNAA 4AOQA 1O2ZA 2ZIQH 3QDZB 1HUTH 1O3OA 4YXWD 3R0FA 3SU5A 3GICB 2FLBH 1GBAA 3LC3A 1EAIA 1LDTT 1SGCA 5HGGA 1VITF 1KXCA 4MPWA 1QB9A 1ZJDA 2RA3A 2HPPH 3NZIA 1O3KA 1JMOH 2UUJB 1C1WH 2V35A 2OUAA 2W6JD 3FP6E 3PV2A 3N7EA 5C1XA 2BTCE 1YBWA 3I78A 3V7TA 4YLUA 1O2SA 5EGMA 1EOJA 2BDHA 1CHOG 3M3TA 1ELTA 1BUIA 2AIQA 3TJNA 3MWIU 2AIPA 1O2YA 3OX7U 1OSSA 3SV7A 2O9QA 2FOHA 1HGTH 1UVUH 1OPHB 1FY5A 1E37B 3A80A 2ZU4A 4YOGA 5F8ZA 1OWIA 1HAXB 1HB0B 3PO1C 2H9TH 3MFJA 1GMCF 5G4BA 4VGCB 4YZUA 4ABHA 3JZ1B 3PB1E 2GD4B 5A2MH 2ZTXA 3GY5A 8LPRA 1C5TA 3SJKA 3MH6A 4F48B 2P94A 2VWMA 1O2GH 1V2OT 3GYLB 5PTPA 1NS3A 1OWEA 2HVXA 4BTUB 1P0SH 4LXBH 3W94A 1AWHB 1WUNH 3FP7E 2KX4A 4IMQA 3LKWA 1TFXA 3PMBB 1XUJA 2TGPZ 2BY7X 2H1UA 2C3SA 1SPJA 1GGDB 1OX1A 3PLBA 1ZJKA 3LGTA 2D1JA 4THNH 2ZHFH 1GJ5H 4JZEH 1K1OA 2C8ZB 2XC4A 3VB7A 2AERH 1ZR0A 1O2NA 2TGAA 2J5UA 4XBDA 3SHAH 2CJIA 4YO9A 3CENA 2BD8A 2EY4C 1C5ZB 2OLGA 1MH0A 1KXFA 2P59A 3LC5A 3MTYA 1ELDE 1QBOA 1AFEH 3SNCA 4M9FA 4RT1A 1SG8B 1GBDA 1HAVB 4K8YA 3ZZBA 1HAZB 1EKBB 1Y3UA 5B6OA 1ELFA 4TPYA 1MCVA 1MABB 1A1RA 1AMHA 5T3HA 1FIWA 1TA6A 1YP9A 1WQSA 5FX6A 1AQ7A 1LVBA 2FESH 2ZTZA 1C9PA 3NK8A 1HAYB 2WUCA 6GCHG 2Q6DA 1QNJA 2F9VA 2H6MA 2DUCA 2PTCE 1C5QA 1C5NH 4U32A 1S84A 4I31A 3LH3A 2FYQA 2ZA5A 1C2HA 1QRXA 1MUEB 1TGBA 4BXWA 1KXDA 2P8OC 3KHVA 4MPUA 1HAOH 4WWYA 1SVPA 3RXQA 1ESAA 4UFEH 1A5HA 2BD4A 2BY6X 3BEUA 4KGAA 2QE7D 4B75A 4XE4A 2FOEA 4HFPB 3CNRA 4OS4A 3RUOA 4CRAA 3RLYH 5E8EH 1GHAF 1GBBA 2PLXA 4A7IB 3PTNA 1XUHA 1XVMA 2V7QD 4LK4A 1NM6A 1GMDG 4JZFH 2GT8A 2A45B 3LIWA 4DCDA 1DFPA 2XC0A 1F0RA 2VVCA 2VNTA 1JOUB 3S9BA 5EQRA 1C2IA 5F03A 1O2IA 1DWDH 3LPRA 2SGQE 2RDEA 3BTGE 1LPZB 4HGCA 1XUKA 1P2QA 2A7HA 1V2QT 1NZQH 1YCPK 2GVFA 2ALVA 1LPKB 1UTJA 3ZZDA 3WY8A 1E0FD 3SU4A 2FYRA 3DT0H 4NZLA 5ETXA 2OINA 3GDVA 4OGYA 1EB2A 4MNVA 2ZU5A 2BXTH 4XSKU 5EIYA 3A7XA 2BY9X 7GCHF 1OWJA 4OM9A 1V2LT 2Y5GA 1P3CA 3M61U 1ESTA 3RMMH 3ZYEA 4DOQA 2A2QH 2STBE 1VGCB 2VH6A 4NWKA 2F9UA 2O8MA 3AW0A 4Q7XA 3ENSB 2PW8H 2UWPA 1O32A 2L74A 1DWEH 1ORFA 2BQWB 1QA7A 1WDIA 4MTBA 2SNVA 1TYNA 3RU4D 1ETRH 3SV6A 2BY8X 2QXHA 1HIAA 2WV5A 3T25A 1QQUA 2ZU3A 1TRMA 4ISLA 2J2UA 3QTOH 4X8UH 2SGEE 1FY3A 1G3BA 4XBCA 1TE0A 2CHAC 2YOLA 1IOEA 1M9UA 1Z71A 3IG6B 2WINI 1Z1JA 3DUXH 5T6DA 1BOQA 1LHEH 1YYY1 5I25A 2KR7A 1ZRKA 2HNTE 1H9LB 3GS9A 4X8TH 4WXIA 2BVRH 3FAOA 4NWLA 2KCOA 4X1QU 1YCPH 3E1XB 1P04A 1O5CB 1V2NT 2F9NA 4OS6A 1G3DA 2H5DA 2IPHA 4ABIA 3UR9A 3ATWA 4AB8A 1GBEA 4KP0A 2QY0B 3QLPH 2AEIH 3ZVEA 1BRAA 1AB9B 3P8NA 3E16B 5JPMH 1GI3A 1U6QA 4Y7AA 4ASHA 1C1OA 1MTWA 1D4PB 2PKSC 1GBCA 3F2GA 2ZHDA 1GBTA 2F83A 1BHXB 4BTTB 3ATMA 4D8NA 2WPKS 3A81A 1EJNA 1QY6A 2XTTB 1FMGA 1CSOE 1GI0A 1QRWA 1JIMA 3KNXA 2XBWA 3SNEA 1QGFA 4AYVB 3WWFA 3WWBA 1QHRB 1ANBA 4B73A 2G55A 1O33A 4ZROA 1SGTA 4RI0A 4NIYA 1MTUA 1TGSZ 4H6TA 8GCHF 4Y0YE 1PQ8A 4X2YA 3PMHB 3RC5A 5CE1A 1ZSJA 4CREA 1HJ8A 3UFAA 1CA0C 4E7NA 1HFDA 3FN8A 5JBCS 2PGBB 1C2DA 1ZHMA 2P8OB 1EP6A 4WMDA 3RXFA 5DP7A 4NIXA 4I8JA 3UWJH 3TGIE 1MMJN 2QXGA 4ABJA 4B2CA 4GSOA 4I8LA 2BD7A 2HLCA 3MNBA 4Y7BA 2Y6TA 1TOMH 1VCWA 1OWKA 1TONA 1RTLA 1F0SA 3LJOA 2QAAA 1GI7B 1GHBF 1EAUA 1BZXE 2P95A 2FOCA 2ZF0H 2ANWA 3TK6A 1A2CH 2V3HH 4NSVA 2BHGA 1GCTB 1B0EA 3T28A 5CHBA 2BLWA 4FU8A 5EXLA 4NA7A 1PPCE 1Z6EA 2V3MA 2Z7FE 1TRNA 1TNIA 1EZSC 1INCA 1UTOA 1VCQA 4FUJA 5A0CA 3ZVGA 3WW7A 2EC9H 1A0LA 3P17H 3O8CA 2B8OH 1GI5A 1VZQH 2A2XH 3GCTG 3SU1A 1XX9A 4CBOA 1C1VH 2LPRA 3SGAE 1SKYE 1ZMNA 6ESTA 4BAHB 1HAGE 2EA3A 1BJUA 3E90B 2BOKA 2BX3A 1AKSB 4XFQA 3STJA 3AAVA 4I8KA 1OP8A 1OWHA 2XBXA 1TQ0B 3TLOA 5H4IB 1DXPA 2WPLS 3DD2H 5DG6A 3RXHA 5DO4H 3F0OA 1KDQA 2QF0A 2W5EA 3F9EA 3UNRA 3FKSD 5KEDA 4ABGA 1F5RA 3MHWU 3TH3H 2OC0A 1A0JA 3UR6A 2GT7A 1C1NA 3QUMP 4J2YB 4CRCA 3T2NA 1GJ4H 1ZPZA 3KEEA 3KYGA 3P8OA 2UUFB 3RXUA 1N8OC 2TPIZ 3RXMA 5AFZH 2ZEBA 2F9OA 5LPEA 5FBIA 2G81E 4YTAA 5JBTA 3A7YA 2CHAB 2Z6BD 5E0HA 2PV9B 4A92A 1T8MA 4ABFA 1VCPA 2KAIA 1N6YA 1DXWA 2BDBA 4X2XA 1SHYA 3DSOA 1O3LA 1QZ8A 1ZRBA 4TPIZ 3RXRA 2TGTA 1ZHRA 3Q3KA 3BTFE 3HK3B 1HIAB 2G5VA 1OP2A 1EJMA 2P3TB 5DK1A 5EJLA 1FY8E 4K5ZA 5IK2D 1H1BA 2YMSB 4FUDA 2C90B 5FHTA 3CS0A 4CRDA 1O2JA 1AWFH 3S9CA 1Z8GA 2BD5A 3PMJA 2Z9JA 5GIBA 1CO7E 1YLCA 2BY5X 2ZNKH 1OYQA 2IOTA 1BMMH 3BTME 4ACAA 2VBCA 1TALA 3KCGH 1RS0A 3A83A 2PSXA 1QB1A 2HGTH 1WXRA 4IBLH 1Y8TA 3S0NA 1O30A 1DPOA 1O38A 1J14A 3RXTA 2IJD1 2ASUB 2WV9A 1O3JA 2FTMA 5DN6D 5LH8A 1O5DH 3V0XA 3KQCA 1O3FA 3H7OA 5HM9A 1NRPH 1KLIH 1FPHH 3NKKA 4Y71A 1T8NA 1RFNA 4Z1MD 1K1JA 1UHBA 1O37A 2QF3A 4ISNA 2F9PA 1UW7A 1TLDA 1IQFA 1UTLM 1MKWK 1GGDC 1CA0B 1FIZA 3A7ZA 4O3TA 1AFQB 2BLVA 1TBQH 5K0HA 2LNCA 1JWTA 2WHXA 3SZNA 2FOGA 1KLJH 2FZZA 5TCAA 1AO5A 1FV9A 1QTFA 5JB8S 3ELAH 1LMWB 1W8BH 3VB5A 1QR3E 2A5AA 3ESTA 3E8LA 5JYIA 2J9NA 3I29A 1QJ6B 4MPXA 4NFEA 2GMTB 4ZHAA 4ZHLU 3LU9B 5DGJA 2BZ6H 2KZ4A 4F49A 1BTXA 2FWWA 3RC6A 2ZHEH 3SGBE 3A85A 4M7GA 5A0AE 3N7DA 4AN7A 2UUKB 4IC5A 1LCYA 3GY6A 1SMFE 1P12E 3STIA 2GV6A 2GV7A 2Z9GA 2VINA 1F5LA 2XXLA 4H42U 4B2BA 2W7UA 3A7TA 5CMXH 1SOZA 1BBRE 5TCCA 3A82A 3O8BA 4AFZA 1O0DH 4FUHA 3SUGA 2J95A 3QZRA 1KXEA 1P11E 4AFQA 1Y59T 1EZQA 3D49H 1TPOA 3QN7A 4E06H 4YT6H 1TNKA 4NCYA 1C9TA 2ANYA 4O03A 1BRCE 2QXJA 3UIRA 1SLWB 1RD3B 1K1LA 1FAXA 4XRNA 1TNGA 2VJ1A 1GDNA 3GDUA 3EE0B 4P02A 3PRBA 1IQKA 1FX0B 4MNWA 2A7CA 3UOUA 8KME2 3HKIB 4FETA 5BRRE 1MKWH 3SORA 2CF8H 1F0TA 5EG4A 5DSFA 1TABE 1D6WA 1CBWB 4D7FA 3A8CA 3KQ5A 1MZAA 1C5OH 2H9EH 1UO6A 2BM2A 1RXPA
chains in the Genus database with same CATH topology
2J4IA 1SLUB 5HXFA 2VIPA 1N8OB 1G30B 2G52A 4ABEA 2ZGBH 3BF6H 1IQHA 1GHXH 1JBUH 4IMZA 4ZKSU 1YM0A 1KDQB 4Z6AH 1O2PA 3SNDA 2GDEH 4LZ1H 1EOLA 1YLDA 2H5CA 2H9HA 2HRVA 2WYGA 3PWBA 3RMNH 3HGNA 5EXMA 3MU8A 1S0QA 5FCKA 1C2GA 4BAOB 1WBGB 1ESBA 1K9OE 3M36A 5C5NA 1BQYA 1CGHA 4ABAA 1EZXC 3QZQA 1C4Y2 2PUQH 3LOXA 1GMDF 3EQ0H 1LHCH 1V2MT 1VGCC 3EA7A 3UOPA 4X6NA 1N1LA 3ZZAA 2FX4A 3LGVA 1ELAA 2GZ8A 2KAIB 1SLVB 3I77A 1GJ8B 1P2KA 5J4SA 1MAYA 2WPIS 1QURH 1WTHD 1UJ1A 3RXGA 2QC2A 2ESTE 1HRTH 2VU8E 1RIWC 3CS7A 1NESE 2R0LA 4RN6A 1ANDA 1C5XB 2OTVA 4B71A 1SC8U 2G4UA 1E35B 2D26C 5GDSH 5FX5A 1EASA 3EYDA 3W95A 2I6QA 3UNSA 2Q1JA 1EB1H 1K28D 2IN2A 5EQQA 3DA9B 1AY6H 3PWCA 1HLTH 2VH0A 1IQIA 1A5GH 1E36B 5T6FA 3RXSA 3SJOA 1H8DH 2V0BA 4X2VA 3SU3A 5C1YA 1MTNC 5AF9H 4KELA 1BTPA 1HDTH 1GI6A 1P10A 3DHKH 1V2TT 6CHAB 1SGPE 1P09A 4Z0KA 1NRNH 1TB6H 2HNTF 4ABBA 3MYWA 1FJSA 5CHAB 3M5LA 1YPHE 1ZTLA 3OY6U 4ZKRU 4K1TA 2RCEA 4X1NU 1PPGE 1AB9C 2NU2E 1GG6C 3E0PB 1S6FA 1EX3A 3SN8A 2Y5HA 3FFGA 2D8WA 1UHBB 1ZPCA 1XVOA 2GZ7A 3QTVH 1S83A 1PPHE 1K1NA 1BTWA 4B76A 1AI8H 3R3GB 1MD7A 1K1MA 1P2JA 2FS8A 4ZMAH 3LGIA 2CV3A 1SGIB 3SW2B 1KTTB 3BTHE 1W13U 2VVVA 2M5TA 4B1TA 5TJXA 1IAUA 4JYTA 5AFYH 2EI7A 4CRGA 3BTTE 1SGDE 1T8LA 2QN5T 4HTCH 2GCHG 3VFEA 2W3KA 5L30H 1BRBE 1GJ7B 3B8JA 1YPKH 3LJJA 3RXEA 2PFEA 1S82A 1CVWH 1AD8H 1FY4A 4FXGH 1HJAC 4O3UA 2Z94A 2XYAA 1RTKA 1V2ST 3RLWH 3Q3XA 1BDAA 1UK3A 5EU8A 2VIVA 1DWCH 4KTCA 1C1PA 2SGPE 2XRCA 3GY3A 1VITH 3TK9A 1UTNA 1XM1A 3U8RH 1AZZA 2ZDLA 1W7GH 1AUTC 1V2JT 1C2MA 1NTPA 3Q00A 4DW2U 1GBFA 1HV7A 4YT7H 3VPKA 2ODYB 1SFQB 1GCTC 3SQHE 1EAXA 3ODDA 4FUFA 4ESTE 4DIIH 4GPGA 1BT7A 5FPSA 2AGGX 1TBRH 3P8GA 1GJDB 3M3VA 1AKSA 1YCPM 2G5NA 1CQQA 3M35A 3SQEE 1GVLA 1AVWA 5HM2A 4NIWA 4D76A 1D3TB 3BTQE 4I32A 2PUXB 4IS5A 5IDKA 1EZUC 2A5IA 2FMJA 1AZ8A 1L4DA 1CT2E 1K1IA 2Y7ZA 1ELCA 3TGKE 4CRBA 2HOBA 4NG9H 4JZIA 4RKOB 2BDIA 1TPAE 4GCHG 3MI4A 3ATLA 4Y76A 1PPFE 1S85A 1SQAA 4AGKA 5DP3A 2CXVA 4H6SB 2ZU2A 2BQ6B 2ILNA 5DJ7A 3RXLA 3TVJB 3Q76A 1G2MA 3MNCA 3VXFH 1FDPA 3TU7H 3S7HB 4E05H 3QX5H 7KMEH 1HXFH 2ZWLH 1FN6A 1SGRE 5C67A 1RIWB 1TQ7B 3ZZ8A 4X6PA 1NROH 4UE7H 5C2ZA 1P57B 3RXCA 4KKDA 3SHCH 1IQJA 1QA0A 3GCTF 3GCNA 3RM2H 2ZI2H 1O5FH 1O36A 5C20A 1EXFA 4ZKNU 1GI4A 1RRKA 4MDSA 1OXGA 4MNYA 2JH5D 1O5GH 1C5UA 3P95A 5L2YH 1MTNB 3A89A 3BN9A 5EW1H 2FM2A 3RXDA 1V2RT 2FPZA 1PQ5A 4I8HA 4AGJA 2A4GA 3HPTB 1N6XA 1VJ9U 1NFXA 4XDEA 3MU5A 3NXPA 1GG6B 1O3GA 3S9AA 2ANMH 2STAE 3SUEA 2W26A 1ZSKA 2BDYA 1FONA 4NGAH 2V6NA 1IQEA 2BQ7B 2PSYA 3P6ZB 4O9VA 2QXIA 4Y11E 3SU6A 2FTLE 4K1SA 1ZMLA 2C8WB 2JH0D 1WU1A 1UTMA 3Q3YA 1JRSA 1Q31A 1DM4B 3AAUA 2GCTB 5T6GA 5J4QA 3MNXA 1DT2A 5ESTE 2FX6A 1G3EA 2AYWA 1O2XA 1TNHA 1BTHH 1DICA 3PV4A 4TY6A 2XCFA 1LVYA 1ELVA 3GOVB 1O39A 1SOTA 4GHQA 4Q7ZA 4XOJA 3ZV8A 1EPTA 1HNEE 4CR5A 2BMGB 3K6ZA 1B0FA 1TGNA 1G36A 1GBIA 1QBVH 3RXVA 1JXPA 1V2WT 2ANKH 2BD3A 1G2LA 1GJBB 1SGFA 1AFQC 2FEQH 5LPRA 4Q2KA 1Z7KA 1LTOA 5JB9S 4RSPA 3A87A 1HJAB 2BD2A 2EI8A 2ZO3H 4AX9H 1C5WB 1ZSLA 1SB1H 1O2UA 1YPMH 2C8XB 1A5IA 2OQUA 4LZ4B 2ZZUH 1LKBA 2R0KA 3QWCH 2GMTC 1ZTKA 3A8BA 3L6PA 1EPTC 3P92A 2ZGCA 2ZDNA 1QCPA 1SBWA 3E6PH 3SO3A 1OKXA 2ZTYA 1A3EH 2ODQA 2ZQ1A 3ZVAA 3TJUA 5EPYA 4J1YA 3MNSA 1UCYE 1Q3XA 5A8XA 1TIOA 1OWDA 1UTQA 4UDWH 2BZAA 3U1JB 1FPCH 4JK6A 3BEFB 1T4VH 2TGDA 3SU0A 1HAPH 2CGAA 4BANB 5FCRA 4Q80A 3MO9A 5L2ZH 1IQNA 3MOCA 4ZKOU 1GVZA 1W2KH 4X6OA 5GPIB 1LQEA 2W3IA 2FXRA 4D7GA 3RXAA 1FZZA 1HBTH 2QA9E 1TNJA 3E91A 5FAHA 1A4WH 2VGCC 1SGEE 2K1QA 1MCTA 1PPBH 1MBQA 2HALA 3L3TA 4FVDA 1ETSH 3FZZA 3GY4A 4NZQA 2ZECA 1A61H 1FI8A 4E7RG 3URDA 1MU8B 2WV4A 1IHSH 2ZFQH 4IC6A 3SJ9A 4A1VA 3LONA 1GBHA 3NCLA 1O3CA 5DP4A 3M5MA 3K65B 1Y5UT 1ZLRA 1UVSH 1CE5A 5F6MA 1AIXH 1TGTA 1CBWC 2BLOA 2SGFE 1L1NA 2G4TA 4X1RU 5DP9A 1KXAA 4DT7B 1O2WA 1ETTH 1P2IA 1YF4A 1MD8A 1B5GH 1THPB 3MU0A 3Q77A 1SGYE 3KL6A 2Q6GA 1TBZH 1DY9A 1O34A 2CF9H 3SI4H 1O5EH 2EI6A 1GMHG 4OS2A 1THRH 3GISB 1SQTA 4CH2B 1BITA 3ZYDA 1VJAU 1BBRK 1C2KA 1G9IE 2GGVB 2ZCLP 3PMAB 2FOBA 2O8LA 3D62A 2G8TA 1O3PB 3ZV9A 2VIWA 1RTFB 1UTKA 3OTJE 4JYUH 1GDQA 2BDCA 4FUCA 4ZXXH 1SR5C 1GHYH 4JMYA 3A7VA 4NIVA 4OS1A 5F8XA 4DG4A 3FANA 3P70B 2OCVB 1Y3WA 1CU1A 1D3PB 4BOHA 4LOYH 1O3MA 3A8AA 2VWLA 3ZVBA 2FI4E 2GTBA 3AASA 3UNQA 1QQ4A 1FY1A 1P9SA 1KSNA 1GCDA 2P16A 3UREA 1MQ6A 3BTWE 1TPPA 2DE9A 3BV9B 4H4FA 5GCHG 1BMNH 2B0FA 1DOJA 4MVNA 5DPAA 5DP5A 3TPIZ 3A84A 1DITH 1AE8H 1LVOA 3UTUH 1UK4A 3M5NA 4A5TS 1P05A 3T5FH 3BG4C 1CHOF 4JZ1A 1AU8A 1UVPA 6CHAC 4IGDA 1C5MD 3AVZA 5JBAS 3U9AH 2VVUA 1P06A 1K2I1 3NUMA 4GVUA 5CHAC 3EA8A 4TWWA 1DVAH 3D65E 1YGCH 3ZZ7A 2R3YA 1MQ5A 3MO3A 2OBOA 4Y10E 1BBRH 2WYJA 1WTGH 1UVOA 4TY7A 4WMFA 3ZVCA 1MTVA 1EPTB 2VB0A 2Y82A 4K69A 4UONA 2NU3E 1KYNA 3JZ2B 7LPRA 1KTSB 2YNBA 4UFFH 5DKMA 1SFIA 1W0YH 1WQVH 2ZPSA 5I46H 3RP2A 2OC7A 2O8TA 3B9FH 5LGOA 2QV1A 3LGWA 1S81A 2ZHWH 4UFGH 4CHAC 1O3BA 3U1IB 1TWXB 4YOIA 4ZAEA 4X1SU 4Q7YA 1ZHPA 3KQBA 5JDUB 1J8AA 3K9XB 3C1KA 2WUBA 1DLKB 1SGQE 3LT3A 2ZGJA 3UWIA 2ZFTA 1QL8A 2ALPA 1IQLA 2VGCB 4ZHMU 1YPGH 1AHTH 4INLA 5HYOA 1P8VC 3BTDE 2C8YB 1LVMA 4TWYA 5E2OA 2AGEX 4QT8C 3ZZ9A 2BOHB 2JETB 1T7CA 1H9IE 4ISOA 2R3UA 3H5CB 4MQAA 3A7WA 2GX4A 4NFFA 5E0JA 1DSTA 1NRRH 1NU7B 1OOKB 1DY8A 3F68H 3F6UH 1A46H 1OS8A 1BTZA 3SBKA 2GDDA 2WPMS 1ZGIA 1GBMA 1TMBH 1EATA 1EP5A 4WVPE 3TNTA 6GCHF 1KY9A 2UWLA 3KGPA 1NFYA 2GCHF 4WJG2 2BYAX 1MZDA 1A7SA 1AVXA 3QO6A 2XWAA 4D9QA 1O3IA 3SV8A 4SGBE 3SGQE 1GL0E 1WOFA 1L1JA 2SGAA 1PQ7A 1O2TA 2AMDA 4FUIA 2TBSA 1PJPA 3ZZ5A 2AH4X 1CA8B 2ZCHP 3KN2A 3U98H 1F0UA 1BTYA 1SI5H 2ZPRA 1Q2WA 4CBNA 2XNIA 3GY8A 1C4U2 4D9RA 1V2PT 1DWBH 2AMPA 5HMAA 3GCHC 4Y79A 2QGRA 1NC6A 4INHA 2RG3A 2OC1A 2FOMB 3ZZCA 1GPZA 1C1SA 5C3NA 4IN1A 2RA0A 4A1XA 3IITA 1LQDB 2Y80A 3SOSA 1O3EA 3TJVA 3DFJA 1S6HA 1ZZZA 4ZH8A 2BDAA 2SGDE 2Z9LA 1AE5A 1PFXC 1O2LA 2O8WA 1FUJA 3BEIB 1AUJA 3VEQB 1CGIE 3V3MA 1A3BH 4HZHA 3V13A 2GZ9A 2OQ5A 1ARBA 2FS9A 2FLRH 1UTPA 2ODPA 4GCHF 1SL3A 1TA2A 2GP9B 2J94A 2ZHQH 1ZTJA 1GVKB 3VB4A 1JRTA 1ACBE 2A4QA 2ZDMA 3BG4B 3BSQA 2OC8A 2FO9A 2XBYA 3UUZA 3RXJA 2SNWA 4FVBA 3ITIA 3EGKH 1YPHC 3F9FA 3PTBA 2IJOB 1TOCB 3FZDA 1XUIA 3MH7A 2A5KA 3FP8E 4SGAE 2Z3EA 1MU6B 1IQGA 1NFUA 1IHTH 1T8OA 4XBBA 3MH4A 2ZCKP 4ISIH 1O35A 3ZZ4A 4DGJA 2BXUH 1WAYB 3KIDU 5GXPA 5ESBA 3BIUH 4AG2A 1DUAA 3RMLH 3LGYA 4YLQH 1ANCA 2ULLA 2BLQA 4A6LA 2DE8A 1HYLA 3SJIA 1RGQA 2GCTC 1O3HA 1NRSH 2ZDAH 3VXEH 1TMUH 3PYHA 2D2DA 4CH8B 5K7RA 4CHAB 2JKHA 1J9CH 4K3JA 3SUDA 3VGCC 1V2KT 1W0ZU 1DUEA 4CR9A 1Z8IB 1L4ZA 5A0BA 2A31A 3FVFB 4X8SH 4WH8A 3RDZA 5LPFA 2XW9A 1C5LH 3ZVDA 2WPHS 4NA8A 2SFAA 1UVTH 1YPEH 1EQ9A 1FQ3A 4MLFB 2B7DH 1O2HA 1GWAA 1BA8B 1W11U 2HWLB 2J38A 3SJ8A 1ZYOA 4BNRA 3QK1A 3EAJA 1ZMJA 1L1GA 2BVXH 1C2LA 1XKAC 1C1MA 2WPJS 5IYTA 4F4OC 4I8GA 2ZU1A 1O5BB 3SU2A 1LHFH 1ABIH 2G00A 3T62A 5FPTA 3PLPA 4GUXA 1OP0A 2OBQA 1WCZA 4X0WU 2ZQ2A 4JCNA 1P03A 3K2UA 1FAKH 3SV9A 2BVSH 1YPJH 2TRMA 1VITG 1E38B 3PLKA 3M5OA 1FXYA 3MMGA 3GY2A 1KLTA 5SGAE 4I33A 5AVDA 3CP7A 5FXLA 1LO6A 4UEHH 2ZG0H 5E2PA 1EUFA 1SGNE 1GI2A 4U01A 2RDLA 4AORA 2ZFFH 1L2EA 1EAWA 1DS2E 3N7OA 5EXNA 2O8UA 3K6YA 1QL7A 3QGNB 5EPNA 1P9UA 5EW2H 1G37A 1GMCG 3TK5A 5DP6A 3PROA 4AFSA 1MBMA 1P3EA 3LGUA 1XKBC 1UK2A 1BTUA 3GCHB 3IWMA 1NY22 1K22H 5EODA 1TX6A 3VB6A 4ZUHA 1NN6A 4DVAU 2PR3A 4FUBA 4RKJB 2ZKSA 4PROA 2ZPQA 3RC4A 1C2EA 4DIHH 3M7QA 1WSSH 5JBBS 2ZP0H 3HKJB 1AN1E 3BIVH 2PGQB 3TH2H 4Y8XA 4BAKB 1K21H 3P8FA 3RM0H 4GHTA 1D6RA 3HATH 2R2MB 1C5RA 1UCYK 2FODA 2A7JA 3D23A 1PQAA 4Y8ZA 4MG3A 1Z8RA 3PO1B 4OS7A 1ZPBA 4DY7B 1QFKH 2HNTC 1T32A 1GJ9B 2NWNA 4X1PU 1XXFA 2QCYA 1GBKA 2F3CE 1P2NA 2TIOA 4GLYA 4U2WA 3E0NB 4OGXA 1G3CA 1F5KU 3ODFA 4BAMB 1P01A 4X2WA 2AMQA 3LH1A 1GHVH 4FU9A 1GJ6A 1BJVA 3UQOA 1G32B 1D9IA 2PKAA 3ATKA 3BTEE 1UMAH 1TNLA 1DSUA 1O31A 4TYDA 3RXPA 1GMHF 1PPZA 4R0IA 4B2AA 2ZGXH 1Y3YA 3T29A 2FOAA 5F8TA 2GKVE 1JIRA 8ESTE 1CGJE 1BRUP 1CHGA 2P93A 1FN8A 2ZDVH 1Y5AT 1RJXB 3ZVFA 3VGCB 1V2UT 1C2FA 3MU1A 1BMLA 3URCA 2A1DB 2QIQA 1EJAA 3OY5U