4IN1A

Structural basis of substrate specificity and protease inhibition in norwalk virus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
182
structure length
174
Chain Sequence
SAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSSIAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIASMRIQGRLVHGQSGMLLTLGTIPGDCGAPYVHKRGNDWVVCGVHAAATKSGNTVVCAVQAGEGEINFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of substrate specificity and protease inhibition in norwalk virus.
pubmed doi rcsb
source organism Norovirus hu/1968/us
molecule tags Hydrolase
molecule keywords 3C-like protease
total genus 37
structure length 174
sequence length 182
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4in1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4in1A01
3VB5A 1ZMLA 2F91A 1JIRA 2ZU2A 3N7OA 5C1YA 3E0NB 1O3MA 1C2GA 1C1VH 3U8OH 1C2DA 1D6RA 2BQ6B 3UR9A 1DY9A 1J9CH 3SI4H 1BBRH 1IQKA 2YNAA 1EOLA 1FONA 4WH6A 1SGRE 1S82A 1TPSA 2BLQA 1GHVH 1KDQA 1UCYE 3RXOA 3SUFA 3U69H 3QN7A 1SC8U 3RM0H 1C2EA 4ZAEA 3RXHA 1S84A 5L6NH 5AFZH 1YBWA 2O9QA 1ELDE 4YT7H 2Y5FA 1GG6B 3UWJH 4AFQA 2XC4A 1AUTC 3GY2A 3RXEA 5L30H 1GMDG 2D2DA 5EQRA 2EI8A 1FPCH 3RXRA 1ZSLA 3A8CA 1BMAA 2R3YA 3ZZDA 2PKAB 1ZHMA 2GKVE 5DP7A 2BDAA 2C90B 3KNXA 3SV8A 1J15A 1BRBE 1JRTA 3SV9A 1BRAA 1LHDH 1BTYA 4CREA 4RKJB 5BRRE 2ZCLP 2QAAA 1TGSZ 3R3GB 1LHFH 1C2LA 1HAXB 3TLOA 3MU1A 2XWBI 3O8CA 5HM2A 2P3FH 1YPKH 4JZ1A 1WUNH 3LOXA 2FS9A 2ZDKA 1S83A 1GI8B 5E0HA 3AAUA 1W7XH 1O35A 5I46H 2GT7A 1L0ZA 2VNTA 3QK1A 1TMTH 2DUCA 1A46H 2ZTYA 4JYUH 1M9UA 1XXDA 1SMFE 1VJ9U 1K21H 6CHAC 5FAHA 3AVZA 3V13A 3MNSA 2ZF0H 1UJ1A 1AFQC 1G3BA 1Y8TA 4FVDA 1HIAB 2BD5A 5GXPA 1ZGIA 1L2EA 4GUXA 1LVOA 1CT4E 2FI4E 1GBJA 1T8LA 4ZKOU 2ZHFH 1CA0C 1Y3XA 2ZFTA 4CRCA 2BQ7B 1MAXA 1UHBA 1O2SA 1FY4A 3ATWA 1ELEE 2Y6TA 4YOIA 1O2TA 4NSYA 3A7XA 1C1UH 2BM2A 3DHKH 4UFFH 1O2QA 1N6XA 1TAWA 3HK3B 1RGQA 3ZYEA 2VWOA 4FUDA 2OINA 3NXPA 3A8AA 1B0EA 3RXUA 1HAOH 3V12A 3Q3KA 1FIWA 5LPFA 1TALA 1PQAA 2OXSA 4X6PA 1UTNA 4NA9H 3KCGH 4Y79A 1TPOA 3RMOH 4CH8B 1CT0E 3BEFB 4NA7A 1LKAA 4H4FA 5EU8A 4K60A 2ZTXA 5A2MH 1G3DA 1QBNA 4O03A 4NIVA 3UNQA 3BN9A 3Q00A 1GMHG 2Q6DA 3PMJA 2BDCA 3S7KB 3HATH 1FZZA 1LVMA 3LGWA 4FUJA 1P04A 4GSOA 1BTHH 4X1SU 2A5AA 2F9UA 4UDWH 1BMLA 3GY4A 1QTFA 1E36B 4I8GA 4BAHB 2FOBA 1P01A 1VCPA 2PR3A 1GL0E 2PSXA 3LGUA 2WV5A 2YOLA 2ZU4A 2UUKB 4VGCC 4BAMB 1ABIH 1DVAH 1HV7A 4K8BA 2PUQH 4X2VA 4ABDA 1PPBH 1UO6A 1G3CA 1BA8B 4O9VA 1OWIA 4AGJA 4GLYA 2IOTA 1KXBA 1TLDA 1IAUA 1P10A 1Y3VA 4E7NA 5IYTA 1VR1H 2ILNA 1RIWB 5EG4A 1QB9A 3ATMA 1MKXK 3ODDA 2BMGB 1P06A 5EQSA 1EB2A 1TQ7B 1GJ4H 1O3DA 2GP9B 3AAVA 5CE1A 3TNTA 4IBLH 1P03A 1QQUA 4BANB 1YPJH 1TQ0B 1T4VH 2XBVA 4ABIA 3BG4C 2PSYA 1NS3A 4BAQB 1QB1A 1SHHB 2VJ1A 4Q80A 1V2RT 3S9BA 3LC5A 4FVBA 3P70B 4ZKNU 1O3FA 2R3UA 3ZVGA 1KLJH 1O2GH 1UTPA 2BY5X 3WY8A 1BB0B 1O5FH 3VGCC 4TY7A 2CF9H 4O97A 3KQCA 4MLFB 2F9VA 1BJVA 2BY8X 2P59A 1CBWB 1GJAB 1RRKA 3SW2B 2HGTH 2VGCC 1ARBA 5DP8A 1P09A 5JBAS 2P94A 1Z8GA 2XBXA 3ZV8A 1QNJA 4I8LA 4WY3A 1AN1E 2CV3A 1QR3E 2J9NA 5EPYA 2FWWA 1GI4A 4SGBE 3D23A 1OYQA 5EPNA 2AGEX 3T2NA 2Y5GA 1PJPA 3TJNA 3LIWA 4GCHG 4DG4A 3O8DA 4LK4A 2AMPA 1RTLA 3E1XB 5C67A 1GHBF 3TH4H 3MWIU 1ZPCA 3TH2H 3T5FH 1Y3WA 1V2WT 4X1RU 4D76A 2FX4A 4KTSA 1W11U 2FXRA 3U8RH 4Y0ZE 5LPEA 1C5QA 2GMTC 2B0FA 3JZ2B 4Y71A 3MMGA 1ETTH 1MU8B 2Q1JA 2A4GA 3PMBB 2ZZUH 3AASA 4D8NA 4ZH8A 1BOQA 3S7HB 1SLWB 2ZTZA 1GI6A 2ZECA 3MNCA 3ZVDA 3GDUA 1KIGH 5DJ7A 2JH5D 2ZDVH 1P9SA 3K65B 2UWLA 3O8RA 3SV6A 2JKHA 1O3KA 2ZU1A 2ZGJA 1F0UA 1CBWC 2FYRA 1QGFA 1PQ5A 3LPRA 3SUDA 1CT2E 1DLKB 1G30B 1QJ7B 1AZ8A 1GBKA 4Y7BA 3NK8A 2QGRA 3BTDE 3QZQA 4K3JA 3SJIA 3PMAB 2F3CE 5ESTE 3ZZBA 1OP2A 1ESAA 2A4QA 3PTNA 3K6ZA 4MNWA 4CR5A 4AYYB 1VCQA 2HPQH 3UWIA 4AB9A 2ZGCA 3KQEA 3P8GA 4BNRA 7ESTE 2BOKA 1FNIA 3F9GA 1AQ7A 3BG4B 4FUBA 2EI6A 1HAPH 1V2LT 2A45B 1SGYE 2THFB 3TU7H 5A0CA 4NFEA 1DWBH 3HPTB 1O2MA 3I78A 1A0JA 2O8MA 3E90B 1ANCA 3QO6A 2OP9A 1C4U2 1TX6A 2ZWLH 1O38A 3A7WA 4AFUA 2QIQA 1SGQE 3TH3H 3SHCH 5K0HA 4RN6A 1SLXB 2FX6A 2CHAC 1YGCH 2ZO3H 1GVKB 1Z8JB 2O8UA 1DOJA 3HKIB 1DY8A 3A8BA 2H5DA 1GBDA 1TYNA 3VPKA 1CQQA 1V2ST 1SSXA 5CMXH 9ESTA 2V0BA 1CU1A 1YC0A 4NA8A 1W0ZU 5E0JA 3SU2A 1VZQH 4U2WA 3P95A 3UNSA 1JWTA 1O39A 1B0FA 2FZZA 2ZGHA 1LDTT 4H42U 2AS9A 1CGHA 2Z94A 3QLPH 2KAIB 4Y76A 1EATA 1C9PA 1V2UT 1D9IA 2GTBA 4WXIA 4AZ2B 1AKSA 3EAJA 1GBHA 1UK3A 1S0QA 3UUZA 1W2KH 1YPHE 2W5EA 2BY9X 4NWKA 3OTJE 1EAUA 3OYPA 3GY7A 2FLBH 1MTSA 1N6YA 2QXJA 4Y8YA 4SGAE 4AOQA 1UCYK 1ARCA 1WBGB 3A80A 1C9TA 1MTVA 3MHWU 1NPMA 2OLGA 2C3SA 3AW0A 3HGNA 1FY1A 2A31A 2BB4A 3RU4T 7LPRA 4TPIZ 1LHGH 1Q31A 4I8JA 3MO3A 1XUJA 4B2CA 1TA2A 1TBZH 2O8TA 4MQAA 2FDAA 4X8SH 2ZPSA 2PW8H 2A7CA 2FOAA 1T32A 3EQ0H 4KTUA 3BTQE 1BT7A 5FX6A 1K1IA 8KME2 1K9OE 1RD3B 5J4QA 1SGCA 1GBCA 4DVAU 2CHAB 3PLKA 3MO6A 3C1KA 4WVPE 3SQEE 3NPSA 5ETXA 1D3DB 3RP2A 4B1TA 1BMNH 1EPTB 1HXFH 2QF3A 2VVUA 1UMAH 4GAWA 4FUEA 2O8WA 4ABGA 3M7UA 1V3XA 1O2ZA 2AEIH 5FCRA 3A82A 4CR9A 2H6MA 3QUMP 1NU7B 2BTCE 1X7AC 5DP4A 1SQOA 1LPGB 3PB1E 1NRNH 3Q3XA 3GCTG 3SU5A 1HJ8A 2GCTB 3HK6B 3TJUA 1YLDA 2ZHDA 3M3VA 1FLEE 4WMDA 3HKJB 2VH6A 5F8ZA 2Z9JA 1O3LA 1DXPA 1GDQA 2ZQ1A 5TCAA 1EX3A 2GD4B 1HJAC 2ZQ2A 1HJ9A 2V3OH 1SGEE 3BTEE 4OS1A 1FUJA 1QJ1B 3D65E 5C1XA 1T31A 5E2PA 1BRUP 3SI3H 1SFIA 3F9FA 4NG9H 1O5DH 2NU4E 4YO9A 1BUIA 1CE5A 1HB0B 3KN2A 3LH1A 4NSVA 1RJXB 1FJSA 1GBBA 4K5ZA 1TNHA 1GI1A 3GCHB 1AI8H 3GCTF 1TNKA 4Y7AA 2ODQA 2QY0B 1P05A 2TBSA 3SU0A 5EW1H 2AFQB 3STIA 2ALPA 1DWEH 1GBTA 1OWDA 2F9PA 1NFXA 4OS2A 4DW2U 1AD8H 1O3PB 2PKAA 1SGPE 3STJA 4Q7XA 2OTVA 1O36A 1C5MD 2R9PA 3GCOA 1TE0A 4GPGA 3RC6A 1CA8B 1F0RA 3T29A 4D9QA 2C4FH 1O3IA 1SI5H 2H9TH 2KAIA 4UONA 3UTUH 5C5NA 2P3UB 2M5TA 2ZU3A 3ATIA 1ZRBA 5AFYH 2TGDA 1OWEA 2OC7A 2VU8E 5C5OA 2C8WB 2A32A 2J4IA 3Q76A 1YM0A 3CS7A 4ZXYH 1SG8B 1SLVB 4JK5A 1PPHE 1F5LA 2Z3DA 3SNBA 1UVUH 2FP7B 1XKAC 4JYVH 6ESTA 2ANYA 2RA0A 3RC5A 4IC6A 2C93B 5JB8S 1KTSB 2SGDE 2VVCA 2VGCB 5EODA 2XRCA 2XTTB 2W7UA 3M3TA 4Y10E 2V35A 4DCDA 1ELCA 3TIUA 1TWXB 3MH4A 3P6ZB 4A7IB 1P3EA 1VITG 6GCHF 1E37B 3LKWA 1JBUH 1RTFB 5A0AE 2ZC9H 1MH0A 1DANH 2G4UA 1JIMA 1L4DA 1P8VC 1ZHRA 1SL3A 1L1NA 2BD3A 3KF2A 1OX1A 1MUEB 2PUXB 2XW9A 1WU1A 3ESTA 2FOGA 3KGPA 3LONA 1C5YB 5B6OA 2FPZA 4XBCA 3ZZAA 1OXGA 1WQVH 2AIPA 2QCYA 1K28D 3MU8A 1MKXH 2I6QA 3TK6A 2OUAA 3VXFH 2HLCA 4DURA 5PTPA 3PYHA 1ETRH 4ZUHA 2CN0H 5G4BA 4CRGA 4A1XA 2ZDMA 3VXEH 1EPTA 3KQBA 3GY3A 2EEKA 1O2WA 2R2WU 4LZ1H 1ABJH 1KTTB 1O2OA 2D1JA 4AGKA 1C5SA 3U1IB 1XUFA 3FANA 3DD2H 4CRFA 3C27B 1NO9H 3SNEA 4X1QU 2ZGBH 2HVXA 2PLXA 1J8AA 5DK1A 3MU5A 2NU0E 1CGIE 1MAYA 1IQIA 2NU3E 4CHAB 1QRXA 3QZRA 4YLUA 3RMLH 3FFGA 3SNAA 2WPIS 1UTKA 2Q6FA 1PPGE 4X8VH 2JH0D 1NZQH 1C1QA 1V6DA 2BD8A 4X2WA 5HGGA 1RFNA 1XUHA 2FOCA 1K22H 4HGCA 1TRMA 3P8FA 2QN5T 3PLPA 1D6WA 1IQLA 1XVOA 1NRRH 1TNIA 3TK9A 1YCPH 1SGDE 3UOUA 1C1NA 5L2YH 1RXPA 1DE7H 2Y81A 1GJ8B 2ODYB 1MMJN 2Z6BD 3A89A 1AU8A 3FVFB 1IQNA 1KLIH 1OS8A 1SQAA 1YPHC 1SGFA 1C5UA 1ZGVA 1TGNA 4K1TA 1THSH 1GVZA 1V2JT 1IHSH 2HNTC 1HNEE 1V2KT 3S0NA 4ZKRU 1QBVH 3NUMA 4I8KA 4D7GA 4JMYA 1KXAA 3BTKE 3RXSA 3ZZ5A 4UD9H 1F0SA 4MVNA 3A84A 3FZZA 5JPMH 4Z0KA 5AF9H 1G2MA 1IQGA 4X6NA 1AY6H 3A81A 7KMEH 3VB4A 3MU0A 1OYTH 3RXFA 4CRBA 1XUIA 3K2UA 5DP6A 4TYDA 4Q7YA 1Z8RA 1XM1A 3UQOA 3T62A 4AYVB 3LT3A 4AG1A 3SJ8A 1LQEA 1GI2A 4MNXA 1ZTKA 4K2YA 5DP3A 1CO7E 2STBE 3GDSA 1GDUA 2H9EH 1GBAA 4DJZB 2P8OC 3MOCA 5IDKA 2BD2A 1GWAA 1C5OH 3UIRA 1VCWA 2GDDA 4AG2A 2SFAA 4OGXA 1GHYH 1ANEA 2FTMA 1H8DH 3F9EA 1HBTH 1C2IA 5T3HA 2FOEA 4NWLA 1ZMNA 2Y7XA 4U32A 2WYJA 3DUXH 4NGAH 1G32B 3MTYA 4KELA 5EXLA 4OS6A 1GG6C 1TNGA 4XDEA 1TRYA 1HAVA 2BVXH 1QHRB 2ZU5A 1O2LA 1GDNA 2PKSB 3M7TA 3BF6H 1PYTC 1QJ6B 3W94A 2J95A 4X2XA 4AN7A 1MTWA 4H6TA 4JZIA 1C5TA 4YOJA 1QCPA 1C1SA 1ZSJA 1OWJA 4ABFA 5FBEA 2D8WA 1C2FA 1A61H 1ZHPA 1WCZA 5FBIA 3LDXH 4BAOB 1DM4B 2PKSC 1TRNA 1JMOH 1VITH 2WUCA 5GCHG 3SUGA 1O3JA 3QGJA 3A85A 4K8YA 3RXKA 3URDA 2W26A 1YPLH 3LGTA 1ELVA 1ZYOA 4XBDA 3M5OA 3R0FA 5A8XA 2G4TA 4R0IA 1P2JA 4IGDA 2ZG0H 5E0GA 2AERH 3ITIA 1P57B 1VGCB 1C1WH 3SU1A 2A7JA 2HRVA 3ZV9A 4MPXA 2FODA 1QBOA 1GGDC 5C3NA 4Z6AH 3ZVEA 2WV4A 5GIBA 1OOKB 2GCHF 1AE8H 1GMCG 1JXPA 2A0QB 3KIDU 1ID5H 5GCHF 1S0RA 1TBQH 1GI7B 2UWPA 1AZZA 5A8YA 1LVYA 3ATLA 2Y80A 4FUHA 1O33A 1A0LA 4MNYA 1FY5A 3BV9B 1BDAA 3BTFE 1O5CB 2AGGX 3QTVH 1XVMA 4JK6A 2ZNKH 3M36A 4TPYA 2XBWA 1RS0A 3BTWE 2P3TB 3PLBA 5GDSH 1FAXA 3RLWH 3D62A 4BXSA 4FUCA 2WPHS 1Z6EA 1BJUA 1YPGH 1GBEA 3NZIA 1A5HA 1ZRKA 2FIRH 4BAKB 1AB9C 5EGMA 4DY7B 1OKXA 4BTIB 2ZFPH 5T6FA 1O3BA 3BTME 4E7RG 1IHTH 1EASA 2WUBA 2ZKSA 1ZZZA 4HZHA 4INKA 4DGJA 3ZZ8A 1S6FA 1HPGA 1GHZA 2F9OA 2IJOB 2SGQE 2VIPA 1EAXA 5T6GA 2BDBA 3NCLA 2GGVB 3MNXA 5EXMA 2ZFQH 2CXVA 1TNLA 3H5CB 4X1NU 4GHQA 3RU4E 5F03A 2Y7ZA 4ZXXH 3IG6B 2EC9H 1U6QA 2XBYA 3RXTA 3GYLB 2V6NA 4TWWA 3S9AA 4K1EA 1YCPK 5DP9A 3RXBA 2OC1A 3T28A 1AE5A 2DE8A 1KYNA 1C2JA 4UFGH 4A6LA 1IQJA 2Q6GA 4JZEH 1UTJA 1HFDA 1W14U 5LGOA 1A5GH 1E38B 1O2RA 1L1GA 1GGDB 4D7FA 1O5BB 1INCA 3SU4A 2BVSH 4WMEA 2G51A 1D3QB 5EW2H 5HYOA 1Q3XA 4ZKSU 4ABAA 1TNJA 3O8BA 5SGAE 2FI5E 1K1OA 3BTHE 2A5IA 3TVJB 2ZFSA 4HFPB 3BTTE 3IWMA 1W0YH 2B7DH 2ANKH 1O2XA 3SV2H 3L6PA 3ZVCA 2OC8A 1CHOG 2RDLA 1YPEH 1SQTA 1EP6A 1OP8A 2VINA 3RXPA 1OWKA 2ZP0H 3T26A 1ESBA 1O2JA 4XE4A 3KL6A 1NFUA 1BTPA 3M5NA 1SBWA 4HI3A 1AKSB 1O5GH 3RDZA 3UOPA 4JZDH 3E6PH 1BTWA 1SLUB 1TFXA 2V3HH 1DX5M 4DIIH 3CP7A 1BIOA 4KP0A 2GZ8A 1EJNA 1GBLA 4D9RA 1AO5A 1CHOF 2Z3CA 1K1LA 1N8OB 1TA6A 1LHEH 1MBMA 3P8NA 1MQ6A 4WH8A 1IQMA 2BDYA 3SJOA 2R0KA 4YZUA 2CF8H 1B7XB 2SGEE 3H7OA 1WAYB 1FN6A 2ZDNA 4INLA 1ZJKA 5AVDA 2XC0A 4XBBA 2Z9KA 1J14A 1TMBH 2OBOA 2P8OB 2VB0A 3MU4A 1BQYA 2H9HA 4WWYA 5C20A 3RXCA 3SJKA 2GCTC 1K1PA 4AFZA 1C2KA 3VB7A 5JBTA 1V2QT 4LOYH 5L2ZH 3BEIB 1EQ9A 5FPSA 2ZGXH 3GY6A 3KHVA 1F2SE 1LTOA 3PMHB 3SGAE 2PFEA 2J34A 1C4Y2 1EXFA 3QX5H 4GCHF 2DE9A 2QA9E 4NIWA 4RKOB 1LVBA 1FPHH 2CGAA 1C1TA 4FU7A 3GOVB 3VFEA 2HNTE 1ACBE 3BEUA 1GJBB 4TWYA 2K1QA 1OP0A 2AIQA 2PWXA 1SB1H 2QXHA 5F6MA 2VWLA 1G9IE 2IN2A 2BHGA 8GCHF 1QA7A 3LGYA 4I8HA 1UTMA 1O3GA 3FP8E 3UREA 5H4IB 2QC2A 3SQHE 1NT1A 2ZPRA 1UVSH 1V2PT 1O5EH 3F6UH 1F92A 3KQDA 3B8JA 1MKWK 4J2YB 1N1LA 4KTCA 3LC3A 4ZMAH 1H1BA 1C5LH 1DSUA 1RTKA 2UUJB 3RXVA 1ZOMA 3S9CA 1GI5A 2A5KA 3ZZCA 3NWUA 4AORA 2UUFB 2ESTE 1YCPM 2A1DB 1O2PA 3ZZ4A 1WTGH 5HM9A 2VH0A 1Z71A 2BOHB 2P95A 1ZTJA 1FXYA 4M7GA 3RMMH 1S85A 1Z8IB 2GX4A 1P9UA 1HRTH 1O3HA 1AVGH 4NIXA 1KY9A 2Y5HA 1MTNB 1DITH 2JETB 1MD8A 2WPMS 3VGCB 1ZSKA 3F68H 3MYWA 1WSSH 1EKBB 3A7TA 3M3SA 5FXLA 2FOMB 5A09A 3ZZ9A 3LU9B 3MH5A 1P12E 1ELFA 1EZUC 1WTHD 4X1PU 4ISLA 2NWNA 1DLEA 1PPEE 3A87A 5DPAA 1ANDA 1B5GH 1BZXE 1JRSA 1AGJA 1TABE 1DICA 5FCKA 1V2VT 1VJAU 1A0HB 1K1MA 3SHAH 2WPJS 4YOGA 4IMZA 1TOMH 2BY6X 1BTZA 2PTCE 1MCTA 4B71A 1IQEA 3U1JB 1EPTC 1CGJE 2F9BH 3RXLA 1CSOE 4B76A 4JYTA 3LJOA 3TJOA 1DFPA 1P0SH 1ZLRA 5DP5A 2TIOA 5GJ4B 3SBKA 5GPIB 1CHGA 1HUTH 5FHTA 2ZCHP 4I33A 1MTUA 1AVWA 4WMFA 8GCHG 3F1SB 1YPMH 2SGFE 3M7QA 1HAIH 1S81A 3PV4A 4VGCB 1GJCB 5LPRA 4DOQA 1T8NA 1AMHA 1EJMA 2STAE 4NZLA 1A3BH 1MZAA 1O32A 2GV7A 2B5TB 1FDPA 1GHAG 1XKBC 1O2UA 3EYDA 4KGAA 1C1PA 1OWHA 3E0PB 1GHBG 1YYY1 3KEEA 4A5TS 3ODFA 1QL9A 3M5LA 5JDUB 1C1MA 2Z3EA 5JB9S 2F9NA 5FPYA 3A7VA 1WOFA 2GV6A 2CJIA 1J16A 2XCNA 1O3CA 2G81E 1DDJA 1P2KA 2PGQB 5CHAC 4MDSA 1GI9B 2CMYA 1IOEA 5I25A 2RA3A 3SV7A 2C8ZB 3L3TA 1BHXF 1T8OA 1THRH 4U30A 4YTAA 1TIOA 5C1UA 2PV9B 1V2MT 1ORFA 1DSTA 2SNWA 2WPLS 1NROH 2VIQA 4MG3A 5FPTA 2ZI2H 1V2TT 1DS2E 4X0WU 1EOJA 3FP6E 4OS5A 3BIUH 4OGYA 3A88A 1NRSH 4CBOA 1W8BH 2EA3A 2OQ5A 3PWBA 3M37A 3SO3A 3UY9A 4KKDA 1P2IA 4WJG2 1GCTB 1QB6A 2PGBB 1F0TA 3DA9B 3RXIA 2SNVA 1K2I1 3EA9A 5HMAA 4X6MA 2BD4A 2FEQH 1OPHB 2LNCA 2A4OA 3RMNH 1BTXA 4XOJA 5DG6A 3UPEA 5ESBA 2G8TA 2XYAA 4JCNA 2ZHEH 3UQVA 3EGKH 3RM2H 3HGPA 3MFJA 1EZQA 1A1RA 3V7TA 2P16A 3GCHC 1DWCH 1UVOA 2QF0A 4CBNA 2BZAA 4X2YA 1HCGA 3F9HA 1QL8A 1FQ3A 1ZTLA 5A8ZA 3BG8A 1IQFA 1Z6JH 5LH8A 3TGKE 1HJAB 2BQWB 1KDQB 3PM3A 2VIWA 2ZFRH 4FU9A 2FS8A 2ALVA 1ZPZA 4YLQH 2LPRA 1HIAA 3RXDA 1MU6B 1D4PB 2Z9GA 1P3CA 5TJXA 4E05H 1E34B 1HAVB 1W10U 2Y82A 1H9HE 4YT6H 2PTNA 1C2MA 3VB3A 2VWNA 4UE7H 1J17T 1PPFE 3OSYA 3RXGA 1QRWA 4WXVA 1E0FD 3U98H 1GCDA 1NESE 1H4WA 1TONA 3DFJA 2HWLB 4NZQA 3SZNA 4A1TA 5HXFA 2Z7FE 4GVUA 1NY22 1O2KA 1O2NA 3W95A 2XC5A 3RXQA 2ODPA 1ZPBA 8ESTE 2WINI 1C5PA 1TX8A 1TGCA 2C8YB 4HTCH 1P2OA 1ZJDA 5F8XA 2TRMA 1GMCF 2BDIA 1PQ8A 3ZZ7A 4AB8A 5T6DA 4CRDA 1QY6A 3MNBA 7GCHF 2H1UA 4FUIA 1UHBB 1MD7A 1PPZA 1GCTC 3E3TA 1ELBA 2W3KA 1LKBA 4F4OC 1Y5BT 2B9LA 1A2CH 2XWAA 1THPB 3UFAA 1C5XB 1C4V2 1O2VA 3T25A 3ATKA 3ZVFA 1MKWH 1FI8A 1MZDA 1O2HA 2YNBA 3L33A 1GJ7B 1DUAA 3OY6U 2FO9A 3RLYH 1O2YA 4U01A 4THNH 2C8XB 3EDXB 3SN8A 2UWOA 3K9XB 1FV9A 1VITF 4Y8XA 6GCHG 1SGNE 4JZFH 4AX9H 7GCHG 5EOKA 1BBRE 1GBIA 4I7YH 5CHAB 2OBQA 4FUFA 1AUJA 5F8TA 2H2ZA 4IC5A 1EAIA 3GISB 4DT7B 1HLTH 2RCEA 4Q7ZA 2OQUA 3M35A 5JBBS 5J4SA 1TX7A 2VVVA 1FY3A 1V2NT 3ZZ3A 4NIYA 1O3OA 2XXLA 4PROA 1C5RA 2GZ7A 3I77A 3SORA 2OCVB 1EUFA 1HAZB 2QV1A 2VWMA 1GHXH 4X8UH 3M61U 1W13U 4I32A 1NRPH 2HALA 2FM2A 4CH2B 2ZPQA 3EA8A 3LH3A 1PPCE 1XXFA 3DFLA 3BIVH 2GDEH 1BCUH 4FUGA 3TPIZ 3UR6A 2FOHA 2BLOA 3FZDA 3S69A 1GJDB 1C1OA 1P2NA 1TB6H 3Q3YA 4B74A 1H9IE 3SNDA 3B9FH 1GBFA 1PYTD 2GVFA 1Y5AT 3ENSB 1RIWC 1NRQH 1MBQA 3GICB 8LPRA 1K1NA 3E8LA 1ESTA 3CENA 2SGAA 1L4ZA 1O34A 2P93A 2VIOA 4DIHH 1CVWH 2PHBA 2FI3E 1GMHF 3SGBE 1TMUH 1YP9A 1PFXC 1ZR0A 4NCYA 3ZVBA 1TPAE 1KXFA 1TGTA 2BY7X 1Z1IA 4Q2KA 3A86A 3BTGE 2AMDA 4YM9A 2G00A 1LQDB 4ISNA 1GMDF 1UTQA 1EAWA 1S6HA 2BXTH 1UTOA 1E35B 2Z9LA 1KXEA 1V2OT 3MH7A 2B8OH 2G5VA 1C5ZB 1YLCA 2JETC 3D49H 1XUKA 1MTNC 2GZ9A 5BPEA 1BITA 5DO4H 1AFEH 2QXGA 4ZHLU 3AW1A 1O5AB 4IS5A 1SGIB 1H8IH 9LPRA 2A2QH 4X6OA 1LHCH 2GT8A 1FIZA 2WPKS 1O3AA 2AGIX 2BZ6H 1HYLA 2W7SA 1KLTA 3MO9A 1GI0A 4BTUB 1SR5C 1DWDH 1A4WH 1H9LB 2H5CA 3EE0B 3DT0H 1EJAA 4B73A 2XCFA 1AWHB 1GI3A 2GMTB 1FN8A 2ZHWH 1P2MA 1DPOA 1AHTH 3GCNA 2NU2E 1NM6A 3A83A 4K69A 3TNSA 1T8MA 1SOZA 1P11E 4K1SA 1TOCB 1F5KU 2FESH 3Q77A 3PO1C 1SGTA 3URCA 4ABHA 1GHWH 1WYKA 3OY5U 3TGJE 4ZHAA 3SU6A 1UK2A 5A0BA 5AHGH 3LGIA 1XX9A 3VEQB 1CA0B 4XSKU 1ELAA 3T27A 2BDGA 4TY6A 3JZ1B 5DKMA 3RUOA 1MCVA 4ISIH 2F83A 5C2ZA 1C1RA 1O0DH 3RXAA 2HNTF 3EA7A 1HAYB 2JH6D 3CS0A 5JBCS 2ZIQH 3SOSA 1W12U 6CHAB 2AMQA 1OSSA 1ETSH 1FAKH 4MPUA 5DGJA 4I31A 2QXIA 1MQ5A 4UFEH 4O3UA 2D26C 2G5NA 4ISHH 1SVPA 1HAGE 1A5IA 4H6SB 3ZZ6A 1K1JA 1GVLA 1SPJA 1XMNB 1W7GH 4MPWA 1PQ7A 4QT8C 2ZDAH 3RU4D 2BVRH 3U9AH 1TPPA 4J1YA 4XFQA 2BLVA 3P92A 3GYMA 1HAHH 2W3IA 3E91A 1Y5UT 4IN1A 1FMGA 2TGAA 4CRAA 3GY5A 1T4UH 1Y3YA 2FYQA 1O30A 1Q2WA 3GDVA 3OU0A 2HPPH 1EB1H 4ASHA 2IPHA 3SJ9A 2TGTA 4YESB 4UFDH 2J38A 3SGQE 4ZHMU 1LPZB 2BDHA 4NFFA 2ZFFH 1NC6A 4RSPA 1KXCA 4B75A 1AB9B 2BX4A 3H7TA 1C5NH 4INHA 2FMJA 1DUEA 2XNIA 4MPVA 3OX7U 4A92A 2A4RA 2O8LA 2BXUH 5GWZA 1DXWA 4MTBA 1GJ5H 2I6SA 1L1JA 3PO1B 1A3EH 4O3TA 4OS7A 2WYGA 3QDZB 1AWFH 5EQQA 1UTLM 3VB6A 2AYWA 3RXJA 2QYIA 1O2IA 4B2AA 3FAOA 4R8TB 1IQHA 1Y59T 2VIDA 1HGTH 2HOBA 3E16B 1UCYH 3UNRA 2FOFA 1QFKH 2EI7A 3BSQA 2BD7A 3TGIE 1P2QA 2BLWA 1QA0A 3QTOH 1W3CA 4Y0YE 2ZCKP 3ZYDA 1G36A 1S5SA 3QGNB 3A7ZA 4Y11E 3SUEA 3TK5A 1KXDA 1O37A 1UK4A 1GPZA 1TBRH 2AH4X 2UUYA 2BYAX 1Y3UA 1ELTA 1BRCE 1G3EA 1QURH 3MI4A 3PROA 4GHTA 4ABBA 1O3NA 2J94A 4X8TH 3SNCA 1D3TB 6LPRA 3ELAH 4CHAC 3V3MA 3FP7E 2NU1E 5E8EH 1LMWB 3M5MA 2J2UA 4BXWA 1NU9A 1GBMA 3GY8A 4Y6DA 2Z9IA 1HDTH 3PWCA 4WF8A 1GJ9B 1O3EA 2ULLA 5E2OA 1G37A 2ASUB 4AFSA 1FY8E 1QQ4A 4MNVA 1EZSC 1HXEH 4FU8A 1EP5A 1P02A 1NFWA 3A8DA 1QIXB 1ANBA 3MH6A 3SU3A 5ABWA 1XUGA 1D3PB 2ZHQH 4ABJA 4LZ4B 4LXBH 1NFYA 1Z7KA 3K6YA 1JOUB 3RC4A 1ZMJA 1T7CA 3I29A 1C5VA 1C5WB 1F5RA 1KSNA 1SGFG 4UEHH 5K7RA 1LCYA 2ZDLA 2ANWA 2VIVA 1BHXB 2RG3A 4BOHA 3P17H 2OD3B 1A7SA 3G01A 2FTLE 1WQSA 1F7ZA 1AIXH 1TGBA 3ZVAA 2GCHG 3RXMA 4B2BA 5JYIA 1AFQB 1C2HA 4Y8ZA 1QL7A 5EXNA 1WV7H 1BBRK 2OC0A 1LO6A 1YKTA 2TPIZ 4ABEA 4ZROA 1Z1JA 1O31A 1G2LA 3NKKA 5TCCA 1GL1A 4A1VA 3LJJA 2SGPE 3U8TH 2R2MB 1SFQB 3P8OA 4FXGH 2ZEBA 2TGPZ 2ANMH 4IN2A 4ISOA 4IW4E 4OS4A 1GHAF 5FX5A 4E06H 3TJVA 1DT2A 3TITA 2BX3A 2A7HA 1BMMH 1SOTA 2R0LA 3LGVA 2G52A 1LPKB 1YF4A 2A2XH 1BTUA 4ESTE 2J92A 1UVTH 4IMQA 1UVPA 1VGCC 1ELGA 3V0XA 4F49A 1EZXC 1AVXA 3IITA 1N8OC 1QRZA 2FLRH 3QWCH 1GJ6A 4BTTB 2ZA5A 1NN6A 2BD9A 3A7YA 2G55A 3PTBA 1NTPA 1SHYA 3B23B
chains in the Genus database with same CATH superfamily
3VB5A 1ZMLA 2F91A 1JIRA 2ZU2A 3N7OA 5C1YA 5KEDA 1QZ8A 3E0NB 1O3MA 1C2GA 1C1VH 3U8OH 1C2DA 1D6RA 2BQ6B 3UR9A 1DY9A 1J9CH 3SI4H 1BBRH 1IQKA 2YNAA 1EOLA 1FONA 4WH6A 1SGRE 1S82A 1TPSA 2BLQA 1GHVH 1KDQA 1UCYE 3RXOA 3SUFA 3U69H 3QN7A 1SC8U 3RM0H 1C2EA 4ZAEA 3RXHA 1S84A 5L6NH 5AFZH 1YBWA 2O9QA 1ELDE 4YT7H 2Y5FA 1GG6B 3UWJH 4AFQA 2XC4A 1AUTC 3GY2A 3RXEA 4RT0A 5L30H 1GMDG 2D2DA 5EQRA 2EI8A 1FPCH 3RXRA 1ZSLA 3A8CA 1BMAA 2R3YA 3ZZDA 2PKAB 1ZHMA 2GKVE 5DP7A 2BDAA 2C90B 3KNXA 3SV8A 1J15A 1BRBE 1JRTA 3SV9A 1BRAA 1LHDH 1BTYA 4CREA 4RKJB 5BRRE 2ZCLP 2QAAA 1TGSZ 3R3GB 1LHFH 1C2LA 1HAXB 3TLOA 3MU1A 2XWBI 3O8CA 5HM2A 2P3FH 1YPKH 4JZ1A 1WUNH 3LOXA 2FS9A 2ZDKA 1S83A 2KR7A 1GI8B 5E0HA 3AAUA 1W7XH 1O35A 5I46H 2GT7A 3KQ5A 1L0ZA 2VNTA 3QK1A 1TMTH 2DUCA 1A46H 1OHHD 2ZTYA 4JYUH 1M9UA 1XXDA 1SMFE 1VJ9U 1K21H 6CHAC 5FAHA 3AVZA 3V13A 3MNSA 2ZF0H 1UJ1A 1AFQC 1G3BA 1Y8TA 4FVDA 1HIAB 2BD5A 5GXPA 1ZGIA 2JJ2D 1L2EA 4GUXA 1LVOA 1CT4E 2FI4E 1GBJA 1T8LA 4ZKOU 2ZHFH 1CA0C 1Y3XA 2ZFTA 4CRCA 2BQ7B 1MAXA 1UHBA 1O2SA 1FY4A 3ATWA 1ELEE 2Y6TA 4YOIA 1O2TA 4NSYA 3A7XA 1C1UH 2BM2A 3DHKH 4UFFH 1O2QA 1N6XA 1TAWA 3HK3B 1RGQA 3ZYEA 2VWOA 4FUDA 2OINA 3NXPA 3A8AA 1B0EA 3RXUA 1HAOH 3V12A 3Q3KA 1FIWA 5LPFA 1TALA 1PQAA 2OXSA 4X6PA 1UTNA 4NA9H 3KCGH 4Y79A 3KYGA 1TPOA 3RMOH 4CH8B 1CT0E 3BEFB 4NA7A 1LKAA 4H4FA 5EU8A 4K60A 2ZTXA 5A2MH 3UB0A 1G3DA 1QBNA 4O03A 4NIVA 3UNQA 3BN9A 3Q00A 1GMHG 2Q6DA 3PMJA 2BDCA 3S7KB 3HATH 1FZZA 1LVMA 2KFWA 3LGWA 3OE7D 4FUJA 1P04A 4GSOA 1BTHH 4X1SU 2A5AA 2F9UA 4UDWH 2JJ1D 1BMLA 3GY4A 1QTFA 1E36B 4I8GA 4BAHB 2FOBA 1VKYA 1P01A 1VCPA 2PR3A 1GL0E 2PSXA 3LGUA 2WV5A 2YOLA 2ZU4A 2UUKB 4VGCC 3FN8A 4BAMB 1ABIH 1DVAH 1HV7A 4K8BA 2PUQH 4X2VA 1S6LA 4ABDA 1PPBH 1UO6A 1G3CA 1BA8B 4O9VA 1OWIA 4AGJA 2YMSB 4GLYA 2IOTA 1KXBA 1TLDA 1IAUA 1P10A 1Y3VA 4E7NA 5IYTA 1VR1H 2ILNA 1RIWB 5EG4A 1QB9A 3ATMA 1MKXK 3ODDA 2BMGB 1P06A 5EQSA 1EB2A 1TQ7B 1GJ4H 1O3DA 4P02A 2GP9B 3AAVA 5CE1A 3TNTA 4IBLH 1P03A 1QQUA 4BANB 1YPJH 1TQ0B 1T4VH 2XBVA 4ABIA 3BG4C 2PSYA 1NS3A 4BAQB 1QB1A 1SHHB 1YWUA 2VJ1A 4Q80A 1V2RT 3S9BA 5B6LA 3LC5A 4FVBA 3P70B 4ZKNU 1O3FA 2R3UA 3ZVGA 1KLJH 1O2GH 1UTPA 2BY5X 3WY8A 1BB0B 1O5FH 1KMHB 3VGCC 4TY7A 2CF9H 4O97A 3KQCA 4MLFB 2F9VA 1BJVA 2BY8X 2P59A 2LELA 1CBWB 1GJAB 1RRKA 3SW2B 2HGTH 2VGCC 1ARBA 5DP8A 1P09A 5JBAS 2P94A 1Z8GA 2XBXA 3ZV8A 1QNJA 4I8LA 4WY3A 1AN1E 2CV3A 1QR3E 2J9NA 5EPYA 2FWWA 1GI4A 4SGBE 3D23A 1OYQA 5EPNA 2AGEX 3T2NA 4FOUC 2Y5GA 1PJPA 3TJNA 3LIWA 4GCHG 4DG4A 3O8DA 4LK4A 2AMPA 1RTLA 3E1XB 5C67A 1GHBF 3TH4H 3MWIU 1ZPCA 5FL7D 3TH2H 5KECA 1FX0B 3T5FH 1Y3WA 3NRLA 1V2WT 5C17A 4X1RU 4D76A 2FX4A 4KTSA 1W11U 2FXRA 3U8RH 4Y0ZE 5LPEA 1C5QA 2GMTC 2B0FA 3JZ2B 4Y71A 3MMGA 1ETTH 1MU8B 4FETA 2Q1JA 2A4GA 3PMBB 2ZZUH 3AASA 4D8NA 4F55A 4ZH8A 1BOQA 3S7HB 1SLWB 2ZTZA 1GI6A 2ZECA 3MNCA 3ZVDA 3GDUA 1KIGH 5DJ7A 2JH5D 2ZDVH 1P9SA 3K65B 2UWLA 3O8RA 3SV6A 2JKHA 1O3KA 2ZU1A 3OTPA 2ZGJA 1F0UA 3PRDA 1CBWC 2FYRA 1QGFA 1PQ5A 3LPRA 3SUDA 1CT2E 1DLKB 1G30B 1QJ7B 1AZ8A 1GBKA 4Y7BA 3NK8A 2QGRA 3BTDE 3QZQA 4K3JA 3SJIA 3PMAB 2F3CE 5ESTE 3ZZBA 1OP2A 1MABB 1ESAA 2A4QA 3PTNA 3K6ZA 4MNWA 4CR5A 4AYYB 1VCQA 2HPQH 3UWIA 4AB9A 4ACAA 2ZGCA 3KQEA 3P8GA 4BNRA 7ESTE 2BOKA 1FNIA 3F9GA 1AQ7A 3BG4B 4FUBA 2EI6A 1HAPH 1V2LT 2A45B 1SGYE 2THFB 3TU7H 5A0CA 4NFEA 3WWFA 1YLNA 1DWBH 3HPTB 1O2MA 3I78A 1A0JA 2O8MA 3E90B 1ANCA 3QO6A 1COWD 2OP9A 1C4U2 1TX6A 2ZWLH 1O38A 2IJD1 3A7WA 4AFUA 2QIQA 1SGQE 3TH3H 3SHCH 5K0HA 4RN6A 1SLXB 2FX6A 2CHAC 1YGCH 2ZO3H 1GVKB 1NBMD 1Z8JB 2O8UA 1DOJA 3HKIB 1DY8A 3A8BA 2H5DA 3DSGA 2KM0A 1GBDA 1TYNA 3VPKA 1CQQA 1V2ST 1SSXA 5CMXH 9ESTA 2V0BA 1CU1A 1YC0A 4NA8A 1W0ZU 5E0JA 3SU2A 1VZQH 4U2WA 3P95A 3UNSA 1JWTA 1O39A 1B0FA 2FZZA 2ZGHA 1LDTT 4H42U 2AS9A 1CGHA 2Z94A 2HLDD 3QLPH 2KAIB 4Y76A 1EATA 1C9PA 1V2UT 2L74A 1D9IA 2GTBA 4WXIA 4AZ2B 1AKSA 3EAJA 1GBHA 1UK3A 3EE7A 1S0QA 3UUZA 1W2KH 1YPHE 2W5EA 2BY9X 4NWKA 3OTJE 1EAUA 3OYPA 3GY7A 2FLBH 1MTSA 1N6YA 2QXJA 4Y8YA 4SGAE 4AOQA 1UCYK 1ARCA 1WBGB 3A80A 1C9TA 1MTVA 3MHWU 1NPMA 2OLGA 2C3SA 3AW0A 3HGNA 1FY1A 2A31A 2BB4A 3RU4T 7LPRA 4TPIZ 1LHGH 1Q31A 4I8JA 3MO3A 1XUJA 4B2CA 1TA2A 1WXRA 1TBZH 3VG8A 2O8TA 4MQAA 2FDAA 4X8SH 2ZPSA 2PW8H 2A7CA 2FOAA 1T32A 3EQ0H 4KTUA 3BTQE 1BT7A 5FX6A 1K1IA 8KME2 1K9OE 1RD3B 5J4QA 1SGCA 1GBCA 4DVAU 2CHAB 3PLKA 3MO6A 3C1KA 4WVPE 3SQEE 3NPSA 5ETXA 1D3DB 3RP2A 4B1TA 1BMNH 1EPTB 1HXFH 2QF3A 2VVUA 1UMAH 4GAWA 4FUEA 2O8WA 4ABGA 2QF5A 3FOAA 3M7UA 1V3XA 1O2ZA 2AEIH 5FCRA 2VBCA 3N7DA 3A82A 4CR9A 2H6MA 3QUMP 1NU7B 2BTCE 1X7AC 5DP4A 1SQOA 1LPGB 3PB1E 1NRNH 3Q3XA 5GNDA 3GCTG 3SU5A 1HJ8A 2GCTB 3HK6B 3TJUA 1YLDA 2ZHDA 3M3VA 1FLEE 4WMDA 3HKJB 2VH6A 5F8ZA 2Z9JA 1O3LA 1DXPA 1GDQA 2ZQ1A 5TCAA 1EX3A 2GD4B 1HJAC 2ZQ2A 1HJ9A 2V3OH 1SGEE 3BTEE 4OS1A 1FUJA 1QJ1B 3D65E 5C1XA 1T31A 5E2PA 1BRUP 3SI3H 1SFIA 4F48B 3F9FA 4NG9H 1O5DH 2NU4E 4YO9A 1BUIA 1CE5A 1HB0B 3KN2A 3LH1A 4NSVA 2QF4A 1RJXB 1FJSA 1GBBA 4K5ZA 1TNHA 2J5UA 1GI1A 3GCHB 2K0QA 1AI8H 3GCTF 1TNKA 4Y7AA 2ODQA 2QY0B 1P05A 2TBSA 3SU0A 3F2GA 5EW1H 2AFQB 3STIA 1SKYE 2ALPA 1DWEH 1GBTA 1OWDA 2F9PA 1NFXA 4OS2A 4DW2U 1AD8H 1O3PB 2PKAA 2WHXA 1H8HD 1SGPE 2CK3D 2V7QD 3STJA 4Q7XA 2OTVA 1O36A 1C5MD 2R9PA 3GCOA 1TE0A 4GPGA 3RC6A 1CA8B 1F0RA 2KX4A 3T29A 4D9QA 2C4FH 1O3IA 1SI5H 2H9TH 2KAIA 4UONA 3UTUH 5C5NA 2P3UB 2M5TA 2ZU3A 3ATIA 1ZRBA 5AFYH 2TGDA 5F53A 1OWEA 2OC7A 2VU8E 5C5OA 2C8WB 2A32A 2J4IA 3Q76A 1YM0A 3CS7A 4ZXYH 1SG8B 1SLVB 4JK5A 1PPHE 1F5LA 2Z3DA 3SNBA 1UVUH 2FP7B 1WDIA 1XKAC 4JYVH 6ESTA 2ANYA 2RA0A 3RC5A 4IC6A 2C93B 5JB8S 1KTSB 2SGDE 2VVCA 2VGCB 5EODA 2XRCA 2XTTB 2W7UA 3M3TA 4Y10E 2V35A 4DCDA 1ELCA 3TIUA 1TWXB 3MH4A 3P6ZB 4A7IB 1P3EA 1VITG 6GCHF 1E37B 3LKWA 1JBUH 1RTFB 5A0AE 2ZC9H 1MH0A 1DANH 2G4UA 1JIMA 1L4DA 3UAIC 1P8VC 1ZHRA 1SL3A 1L1NA 2BD3A 3KF2A 1OX1A 1MUEB 2PUXB 2XW9A 2F4LA 1WU1A 3ESTA 1YY3A 2FOGA 5C0UA 3KGPA 3LONA 1C5YB 5B6OA 2FPZA 4XBCA 3ZZAA 1OXGA 1WQVH 2AIPA 2QCYA 1K28D 3MU8A 1MKXH 2I6QA 3TK6A 2OUAA 3VXFH 2HLCA 4DURA 5PTPA 3PYHA 1ETRH 4ZUHA 2CN0H 5G4BA 4CRGA 4A1XA 2ZDMA 3VXEH 1EPTA 3KQBA 3GY3A 2EEKA 1O2WA 2R2WU 4LZ1H 1ABJH 1KTTB 1O2OA 2D1JA 4AGKA 1C5SA 3U1IB 1XUFA 3FANA 3DD2H 4CRFA 3C27B 1NO9H 3SNEA 4X1QU 2ZGBH 2HVXA 2PLXA 1J8AA 5DK1A 3MU5A 2NU0E 4ACBA 1CGIE 1MAYA 3OEED 1IQIA 2NU3E 4CHAB 1QRXA 3QZRA 4YLUA 3RMLH 3FFGA 3SNAA 2WPIS 2XOKD 1UTKA 2Q6FA 1PPGE 4X8VH 2JH0D 1NZQH 1C1QA 1V6DA 2YMSD 2BD8A 4X2WA 5HGGA 1RFNA 1XUHA 2FOCA 1K22H 4HGCA 1TRMA 3P8FA 2QN5T 3PLPA 1D6WA 1IQLA 2KCOA 5HIZA 1XVOA 1NRRH 3WW7A 1TNIA 3TK9A 1YCPH 1SGDE 3UOUA 1C1NA 5L2YH 1RXPA 1DE7H 2Y81A 1GJ8B 3ZIAD 2ODYB 1MMJN 2Z6BD 3A89A 1AU8A 3FVFB 1IQNA 1KLIH 1OS8A 1SQAA 1YPHC 1SGFA 1C5UA 1ZGVA 1TGNA 4K1TA 1THSH 5T1VA 1GVZA 1V2JT 1IHSH 2HNTC 1HNEE 1V2KT 3S0NA 4ZKRU 1QBVH 3NUMA 4I8KA 4D7GA 4JMYA 1KXAA 3BTKE 3RXSA 3ZZ5A 4UD9H 1F0SA 4MVNA 3A84A 5IK2D 3FZZA 5JPMH 4Z0KA 5AF9H 1G2MA 1IQGA 4X6NA 1AY6H 3A81A 7KMEH 3VB4A 4Z1MD 3MU0A 1OYTH 3RXFA 4CRBA 1XUIA 3K2UA 5DP6A 4TYDA 4Q7YA 1Z8RA 1XM1A 1K0HA 3UQOA 2JDID 3T62A 4AYVB 4OM9A 3LT3A 4AG1A 3SJ8A 1LQEA 1GI2A 4MNXA 1ZTKA 4K2YA 5DP3A 1CO7E 2STBE 3GDSA 3DSPA 1GDUA 2H9EH 1GBAA 4DJZB 2P8OC 3MOCA 5IDKA 2BD2A 1GWAA 1C5OH 3UIRA 1VCWA 2GDDA 4AG2A 2SFAA 4OGXA 1GHYH 1ANEA 2FTMA 1H8DH 3F9EA 1HBTH 1C2IA 5T3HA 2FOEA 2JIZD 4NWLA 1ZMNA 2Y7XA 4U32A 2WYJA 3DUXH 4NGAH 1G32B 3MTYA 4KELA 2RDEA 5EXLA 4OS6A 1GG6C 1TNGA 4XDEA 1TRYA 1HAVA 2BVXH 1QHRB 2ZU5A 1O2LA 1GDNA 2PKSB 3M7TA 2YMSC 3BF6H 3N99A 2WPDD 4TSFD 1PYTC 1QJ6B 3W94A 2J95A 4X2XA 4AN7A 1MTWA 4H6TA 4JZIA 1C5TA 4YOJA 1QCPA 1C1SA 1ZSJA 1OWJA 4ABFA 5FBEA 2D8WA 1C2FA 1A61H 1ZHPA 1WCZA 5FBIA 3LDXH 4BAOB 1DM4B 2PKSC 1TRNA 1JMOH 1VITH 2WUCA 5GCHG 3SUGA 1O3JA 3QGJA 3A85A 4K8YA 3RXKA 3URDA 2W26A 1YPLH 3LGTA 1ELVA 1ZYOA 4XBDA 3M5OA 3R0FA 5A8XA 2G4TA 4R0IA 1P2JA 4IGDA 2ZG0H 5E0GA 2AERH 3ITIA 1P57B 1VGCB 1C1WH 3SU1A 2A7JA 2HRVA 3ZV9A 4MPXA 2FODA 1QBOA 1GGDC 5C3NA 4Z6AH 3ZVEA 2WV4A 5GIBA 1OOKB 2GCHF 1AE8H 1GMCG 1JXPA 2A0QB 3KIDU 1ID5H 5GCHF 1S0RA 1TBQH 1GI7B 2UWPA 1AZZA 5A8YA 1LVYA 3ATLA 2Y80A 4FUHA 1O33A 1A0LA 4MNYA 1FY5A 3BV9B 1BDAA 4XRNA 3BTFE 1O5CB 2AGGX 3QTVH 1XVMA 4JK6A 2ZNKH 3M36A 4TPYA 2XBWA 1RS0A 4M9FA 3BTWE 2P3TB 3PLBA 5GDSH 1FAXA 3RLWH 3D62A 4BXSA 4FUCA 2WPHS 1Z6EA 1BJUA 1YPGH 1GBEA 3NZIA 1A5HA 1ZRKA 2FIRH 4BAKB 1AB9C 5EGMA 4DY7B 1OKXA 4BTIB 2ZFPH 5T6FA 1O3BA 3BTME 4E7RG 1IHTH 1EASA 2WUBA 2ZKSA 1ZZZA 5DN6D 4HZHA 4INKA 4DGJA 3ZZ8A 1S6FA 1HPGA 1GHZA 2F9OA 2IJOB 2SGQE 2VIPA 1EAXA 5T6GA 2BDBA 3NCLA 2GGVB 2K8IA 3MNXA 5EXMA 2ZFQH 2CXVA 1TNLA 3H5CB 4X1NU 4GHQA 3RU4E 5F03A 2Y7ZA 4ZXXH 3IG6B 2EC9H 1U6QA 2XBYA 3RXTA 3GYLB 2V6NA 4TWWA 3S9AA 1E1RD 4K1EA 1YCPK 5DP9A 3RXBA 2OC1A 3T28A 1AE5A 2DE8A 1KYNA 1C2JA 4UFGH 4RI0A 4A6LA 1IQJA 2Q6GA 4JZEH 1UTJA 1HFDA 3F0OA 1W14U 3F0PA 5LGOA 1A5GH 1E38B 1O2RA 1L1GA 1GGDB 4D7FA 1O5BB 1INCA 3SU4A 2BVSH 4WMEA 2G51A 1D3QB 5EW2H 5HYOA 1Q3XA 4ZKSU 4ABAA 1TNJA 3O8BA 5SGAE 2FI5E 1K1OA 3BTHE 2A5IA 3TVJB 2ZFSA 4HFPB 3BTTE 3IWMA 1W0YH 2B7DH 2QE7D 2ANKH 1O2XA 2V3MA 3SV2H 3L6PA 3ZVCA 2OC8A 1CHOG 2RDLA 1YPEH 1SQTA 1EP6A 1OP8A 2VINA 3RXPA 1OWKA 2EQNA 2ZP0H 3T26A 1ESBA 1O2JA 4XE4A 3KL6A 1NFUA 1BTPA 3F2HA 3M5NA 1SBWA 4HI3A 1AKSB 1O5GH 3RDZA 3UOPA 4JZDH 3E6PH 1BTWA 1SLUB 1TFXA 2V3HH 4B6FA 1DX5M 4DIIH 3CP7A 1BIOA 4HG6A 4KP0A 2GZ8A 1EJNA 1GBLA 4D9RA 5EIYA 1AO5A 1CHOF 2Z3CA 1K1LA 1N8OB 1TA6A 1LHEH 1MBMA 3P8NA 1MQ6A 4WH8A 1IQMA 2BDYA 2PP6A 2R0KA 4YZUA 3SJOA 2CF8H 1B7XB 2SGEE 3H7OA 1WAYB 1FN6A 2ZDNA 4INLA 1ZJKA 2KCYA 5AVDA 2XC0A 4XBBA 2Z9KA 1J14A 1TMBH 2OBOA 2P8OB 2VB0A 3MU4A 1BQYA 2H9HA 1SQRA 4WWYA 5C20A 3RXCA 3SJKA 2GCTC 1K1PA 4AFZA 2WV9A 1C2KA 3PV5A 3VB7A 5JBTA 1V2QT 2L6OA 4LOYH 5L2ZH 3BEIB 1EQ9A 5FPSA 2ZGXH 3GY6A 3KHVA 1F2SE 1LTOA 3PMHB 3SGAE 3KYFA 2PFEA 2J34A 1C4Y2 5HIYA 1EXFA 3QX5H 4GCHF 2DE9A 2QA9E 4NIWA 4RKOB 1LVBA 1FPHH 2CGAA 1C1TA 4FU7A 3GOVB 3N7EA 3VFEA 2HNTE 1ACBE 3BEUA 1GJBB 4TWYA 4YXWD 2K1QA 1OP0A 2AIQA 2PWXA 1SB1H 2QXHA 5F6MA 2VWLA 1G9IE 2IN2A 2BHGA 3DSOA 8GCHF 3OEHD 1QA7A 3LGYA 4I8HA 1UTMA 1O3GA 3FP8E 3UREA 5H4IB 2QC2A 3SQHE 1NT1A 2HVYB 2ZPRA 2W6JD 1UVSH 1V2PT 1O5EH 3F6UH 1F92A 3KQDA 3B8JA 1MKWK 4J2YB 1N1LA 4KTCA 3LC3A 4ZMAH 1H1BA 1C5LH 1DSUA 1RTKA 2UUJB 3RXVA 1ZOMA 3S9CA 5KGOA 1GI5A 2A5KA 3ZZCA 3NWUA 4AORA 2UUFB 2ESTE 1YCPM 2A1DB 1O2PA 3ZZ4A 1WTGH 5HM9A 2VH0A 1Z71A 2BOHB 2W6ID 2P95A 1ZTJA 1FXYA 4M7GA 3RMMH 1S85A 1Z8IB 2GX4A 1P9UA 1HRTH 1O3HA 1AVGH 4NIXA 1KY9A 2Y5HA 1MTNB 5C94A 1DITH 2JETB 1MD8A 2WPMS 3VGCB 1ZSKA 3F68H 3MYWA 1WSSH 4ZCNA 1EKBB 3A7TA 3M3SA 5FXLA 2FOMB 5A09A 3ZZ9A 3LU9B 3MH5A 1P12E 1ELFA 1EZUC 2AHME 1WTHD 4X1PU 4ISLA 2NWNA 1DLEA 1PPEE 3A87A 5DPAA 1ANDA 1B5GH 1BZXE 1JRSA 1AGJA 1TABE 1DICA 3F2FA 1V2VT 5FCKA 5C0TA 1VJAU 1A0HB 1K1MA 3SHAH 2WPJS 4YOGA 4IMZA 1TOMH 2BY6X 1EFRD 1BTZA 2PTCE 1MCTA 4B71A 1IQEA 3U1JB 1EPTC 1CGJE 2F9BH 3RXLA 1CSOE 4B76A 4JYTA 3LJOA 3TJOA 1DFPA 1P0SH 1ZLRA 5DP5A 2TIOA 5GJ4B 3SBKA 5GPIB 1CHGA 1HUTH 5FHTA 2ZCHP 4I33A 1MTUA 1AVWA 4XD7D 4WMFA 8GCHG 3F1SB 1YPMH 2SGFE 3M7QA 1HAIH 1S81A 3PV4A 4VGCB 1GJCB 5LPRA 4DOQA 1T8NA 1UW7A 1AMHA 1EJMA 2IPQX 2STAE 1A3BH 4NZLA 1MZAA 1O32A 2GV7A 2B5TB 1FDPA 1GHAG 1XKBC 1O2UA 3EYDA 4KGAA 1C1PA 1OWHA 3E0PB 1GHBG 1YYY1 3KEEA 4A5TS 3ODFA 1QL9A 3M5LA 5JDUB 1C1MA 2Z3EA 5JB9S 2F9NA 5FPYA 3A7VA 1WOFA 2GV6A 2CJIA 1J16A 2XCNA 1O3CA 2G81E 1DDJA 1P2KA 2PGQB 5CHAC 4MDSA 1GI9B 2CMYA 1IOEA 5I25A 2RA3A 3SV7A 2C8ZB 3L3TA 1BHXF 1T8OA 1THRH 4U30A 4YTAA 1TIOA 5C1UA 2PV9B 1V2MT 1ORFA 1DSTA 2SNWA 2WPLS 1NROH 2M2AA 2VIQA 4MG3A 5FPTA 2ZI2H 1V2TT 1DS2E 4X0WU 1EOJA 3FP6E 4OS5A 3BIUH 4OGYA 3A88A 1NRSH 4CBOA 1W8BH 2EA3A 2OQ5A 3PWBA 3M37A 3SO3A 3UY9A 3OFND 4KKDA 1P2IA 4WJG2 1GCTB 1QB6A 2PGBB 1F0TA 4P00A 3DA9B 3RXIA 2SNVA 1K2I1 3EA9A 5HMAA 4X6MA 2J97A 2BD4A 2FEQH 1OPHB 2LNCA 2A4OA 3RMNH 1BTXA 4XOJA 5DG6A 3UPEA 5ESBA 2G8TA 2F43B 2XYAA 4JCNA 2ZHEH 2OK5A 3UQVA 3EGKH 3RM2H 3HGPA 3MFJA 1EZQA 1A1RA 3V7TA 2P16A 3GCHC 1DWCH 1UVOA 2QF0A 4CBNA 4I86A 2BZAA 4X2YA 1HCGA 3F9HA 1QL8A 1FQ3A 1ZTLA 5A8ZA 3BG8A 1IQFA 1Z6JH 5LH8A 3TGKE 1HJAB 2BQWB 1KDQB 3PM3A 2VIWA 2ZFRH 4FU9A 2FS8A 2ALVA 1ZPZA 4YLQH 2LPRA 1HIAA 3RXDA 1MU6B 1D4PB 2Z9GA 1P3CA 5TJXA 4E05H 1E34B 1HAVB 1W10U 2Y82A 1H9HE 4YT6H 2PTNA 1C2MA 3VB3A 2VWNA 4UE7H 3W1EA 1J17T 1PPFE 3OSYA 3RXGA 1QRWA 4WXVA 1E0FD 3U98H 1GCDA 1NESE 1H4WA 1TONA 3DFJA 2HWLB 4NZQA 3SZNA 4A1TA 5HXFA 2Z7FE 4GVUA 1NY22 1O2KA 1O2NA 3W95A 2XC5A 3RXQA 2ODPA 1W0JD 1ZPBA 8ESTE 2WINI 1C5PA 1TX8A 1TGCA 2C8YB 4HTCH 1P2OA 1ZJDA 5F8XA 2TRMA 1GMCF 2BDIA 2WZQA 1PQ8A 2LP6A 3ZZ7A 4AB8A 5T6DA 4CRDA 1QY6A 3FO8D 3MNBA 7GCHF 3MQKC 2H1UA 4FUIA 1UHBB 1MD7A 1PPZA 1GCTC 5CHBA 1H8ED 3E3TA 1BMFD 1ELBA 2W3KA 1LKBA 4F4OC 1Y5BT 2B9LA 1A2CH 2XWAA 1THPB 3UFAA 1C5XB 1C4V2 1O2VA 3T25A 3ATKA 3ZVFA 1MKWH 1FI8A 1MZDA 1O2HA 2YNBA 3L33A 1GJ7B 1DUAA 3OY6U 2FO9A 3RLYH 1O2YA 4U01A 4THNH 2C8XB 3EDXB 3SN8A 2UWOA 3K9XB 1FV9A 1VITF 4Y8XA 6GCHG 1SGNE 4JZFH 4AX9H 7GCHG 5EOKA 1BBRE 1GBIA 4I7YH 5CHAB 2OBQA 4FUFA 1AUJA 5F8TA 2H2ZA 4IC5A 1EAIA 3GISB 4DT7B 1HLTH 2RCEA 4Q7ZA 2OQUA 5EJLA 3M35A 5JBBS 5J4SA 1TX7A 2VVVA 1FY3A 1V2NT 3ZZ3A 4NIYA 1O3OA 2XXLA 4PROA 1C5RA 2GZ7A 3I77A 3SORA 2OCVB 1EUFA 1HAZB 2QV1A 2VWMA 1GHXH 4X8UH 3M61U 1W13U 4I32A 4RT1A 1NRPH 2HALA 1W0KD 4B6EA 2FM2A 4CH2B 2ZPQA 3EA8A 3LH3A 3GS9A 1PPCE 1XXFA 3DFLA 3BIVH 2GDEH 1BCUH 4FUGA 3TPIZ 3UR6A 2FOHA 2BLOA 4DT4A 3FZDA 3S69A 1GJDB 1C1OA 1P2NA 1TB6H 3Q3YA 4B74A 1H9IE 3SNDA 3B9FH 1GBFA 1PYTD 2GVFA 1Y5AT 3ENSB 1RIWC 1NRQH 1MBQA 3GICB 3AK5A 8LPRA 1K1NA 3E8LA 1ESTA 3CENA 2SGAA 1L4ZA 1O34A 2P93A 2VIOA 4DIHH 1CVWH 2PHBA 2FI3E 1GMHF 3SGBE 1TMUH 1YP9A 1PFXC 1ZR0A 4NCYA 3ZVBA 1TPAE 1KXFA 1TGTA 3CNRA 2J98A 2BY7X 1Z1IA 4Q2KA 3F3BA 3A86A 3BTGE 2AMDA 4YM9A 2G00A 1LQDB 4ISNA 1GMDF 1UTQA 1EAWA 1S6HA 2BXTH 1UTOA 1E35B 2Z9LA 3SZEA 1KXEA 1V2OT 3MH7A 2B8OH 2G5VA 1C5ZB 1YLCA 2JETC 3D49H 1XUKA 1MTNC 2GZ9A 5BPEA 1BITA 5DO4H 1AFEH 2QXGA 4Q63A 4ZHLU 3AW1A 1O5AB 4IS5A 1SGIB 1H8IH 9LPRA 3SYJA 2A2QH 4X6OA 1LHCH 2GT8A 1FIZA 2WPKS 1O3AA 2AGIX 2BZ6H 1HYLA 2W7SA 3PRBA 1KLTA 3MO9A 1GI0A 4BTUB 1SR5C 1DWDH 1A4WH 1H9LB 2H5CA 3EE0B 3DT0H 1EJAA 4B73A 2XCFA 1AWHB 1GI3A 2GMTB 1FN8A 2ZHWH 1P2MA 4AC9A 1DPOA 1AHTH 3GCNA 2NU2E 1NM6A 3A83A 4K69A 4Q4LA 3TNSA 1T8MA 1SOZA 1P11E 4K1SA 1TOCB 1F5KU 2FESH 3Q77A 3PO1C 1SGTA 3URCA 4ABHA 1GHWH 1WYKA 3OY5U 3TGJE 4ZHAA 3SU6A 1UK2A 5A0BA 5AHGH 3LGIA 1XX9A 3VEQB 1CA0B 4XSKU 1ELAA 3T27A 2BDGA 4TY6A 5DSFA 3JZ1B 5DKMA 3RUOA 1MCVA 4ISIH 2F83A 5C2ZA 1C1RA 3PV2A 1O0DH 3RXAA 2HNTF 3EA7A 1HAYB 2JH6D 3CS0A 5JBCS 2ZIQH 3SOSA 1W12U 6CHAB 2AMQA 4TT3D 1OSSA 1ETSH 1FAKH 4MPUA 5DGJA 4I31A 2QXIA 2J98B 1MQ5A 4UFEH 2WSSD 4O3UA 2D26C 2G5NA 4ISHH 1SVPA 2KCPA 1HAGE 1A5IA 4H6SB 3ZZ6A 1K1JA 1GVLA 1SPJA 1XMNB 1W7GH 4MPWA 1PQ7A 4QT8C 2ZDAH 3RU4D 2BVRH 3U9AH 1TPPA 4J1YA 4XFQA 2BLVA 3P92A 3GYMA 1HAHH 2W3IA 3E91A 1Y5UT 4IN1A 1FMGA 2TGAA 4CRAA 3GY5A 1T4UH 1Y3YA 3H09A 2FYQA 1O30A 1Q2WA 3GDVA 3FKSD 3OU0A 2HPPH 1EB1H 4ASHA 2IPHA 3SJ9A 2TGTA 4YESB 4UFDH 2J38A 3SGQE 4ZHMU 1LPZB 2BDHA 4NFFA 2ZFFH 1NC6A 4RSPA 1KXCA 4B75A 1AB9B 2BX4A 3H7TA 1C5NH 4INHA 2FMJA 1DUEA 2XNIA 4MPVA 3OX7U 4A92A 2A4RA 2O8LA 2BXUH 5GWZA 1DXWA 4MTBA 1GJ5H 2I6SA 2KZ4A 1L1JA 3PO1B 1A3EH 4O3TA 4OS7A 3OAAD 2WYGA 3QDZB 1AWFH 5EQQA 1UTLM 3VB6A 2AYWA 3RXJA 2QYIA 1O2IA 4B2AA 3FAOA 4R8TB 1IQHA 1Y59T 2VIDA 1HGTH 2HOBA 3E16B 1UCYH 4ASUD 3UNRA 2FOFA 1QFKH 2EI7A 3BSQA 2BD7A 3TGIE 1NBME 1P2QA 1QA0A 2BLWA 3QTOH 1W3CA 4Y0YE 2ZCKP 3ZYDA 3WWBA 1G36A 2EY4C 1S5SA 3QGNB 3A7ZA 4Y11E 3SUEA 3TK5A 1KXDA 1O37A 1UK4A 2KCAA 1GPZA 1TBRH 2AH4X 2UUYA 2BYAX 1Y3UA 1ELTA 1BRCE 1G3EA 1QURH 3MI4A 3PROA 4GHTA 4ABBA 1O3NA 2J94A 4X8TH 3SNCA 1D3TB 6LPRA 5HKKD 3ELAH 4CHAC 3V3MA 3FP7E 2NU1E 5E8EH 1LMWB 3M5MA 2J2UA 4BXWA 1NU9A 1GBMA 3GY8A 4Y6DA 2Z9IA 1HDTH 3PWCA 4WF8A 5EJZA 1GJ9B 1O3EA 2ULLA 5E2OA 1G37A 2ASUB 4AFSA 3DCLA 1FY8E 1QQ4A 4MNVA 1EZSC 1HXEH 4FU8A 1EP5A 1P02A 1NFWA 5EJ1A 2XNDD 3A8DA 1QIXB 1ANBA 3MH6A 3SU3A 5ABWA 1XUGA 1D3PB 2ZHQH 4ABJA 4LZ4B 4LXBH 1NFYA 1Z7KA 3K6YA 1JOUB 3RC4A 1ZMJA 1T7CA 3I29A 1C5VA 1C5WB 1F5RA 1KSNA 1SGFG 4UEHH 5K7RA 1LCYA 1E79D 2ANWA 2ZDLA 2VIVA 1BHXB 2RG3A 4BOHA 3P17H 2OD3B 1A7SA 3G01A 2FTLE 1WQSA 1F7ZA 1AIXH 1TGBA 3ZVAA 2GCHG 3RXMA 4B2BA 5JYIA 1AFQB 1C2HA 4Y8ZA 1QL7A 5EXNA 1WV7H 1BBRK 2OC0A 1LO6A 1YKTA 2TPIZ 4ABEA 2GJGA 4ZROA 1Z1JA 1O31A 1G2LA 3NKKA 5TCCA 1GL1A 4A1VA 3LJJA 2SGPE 3U8TH 2R2MB 1SFQB 3P8OA 4FXGH 2ZEBA 2TGPZ 2ANMH 4IN2A 4ISOA 4IW4E 4OS4A 1GHAF 5FX5A 4E06H 3TJVA 1DT2A 3TITA 2BX3A 2A7HA 1BMMH 1SOTA 2R0LA 3LGVA 2G52A 5CDFE 3U28C 1LPKB 1YF4A 2A2XH 1BTUA 4ESTE 2RFKC 2J92A 1UVTH 4IMQA 1UVPA 1VGCC 1ELGA 3V0XA 4F49A 1EZXC 1AVXA 3IITA 1N8OC 1QRZA 2FLRH 3QWCH 1GJ6A 4BTTB 2ZA5A 1NN6A 2BD9A 1E1QD 3A7YA 2G55A 3PTBA 1NTPA 1SHYA 3B23B
chains in the Genus database with same CATH topology
3VB5A 1ZMLA 2F91A 1JIRA 2ZU2A 3N7OA 5C1YA 3E0NB 1O3MA 1C2GA 1C1VH 3U8OH 1C2DA 1D6RA 2BQ6B 3UR9A 1DY9A 1J9CH 3SI4H 1BBRH 1IQKA 2YNAA 1EOLA 1FONA 4WH6A 1SGRE 1S82A 1TPSA 2BLQA 1GHVH 1KDQA 1UCYE 3RXOA 3SUFA 3U69H 3QN7A 1SC8U 3RM0H 1C2EA 4ZAEA 3RXHA 1S84A 5L6NH 5AFZH 1YBWA 2O9QA 1ELDE 4YT7H 2Y5FA 1GG6B 3UWJH 4AFQA 2XC4A 1AUTC 3GY2A 3RXEA 5L30H 1GMDG 2D2DA 5EQRA 2EI8A 1FPCH 3RXRA 1ZSLA 3A8CA 1BMAA 2R3YA 3ZZDA 2PKAB 1ZHMA 2GKVE 5DP7A 2BDAA 2C90B 3KNXA 3SV8A 1J15A 1BRBE 1JRTA 3SV9A 1BRAA 1LHDH 1BTYA 4CREA 4RKJB 5BRRE 2ZCLP 2QAAA 1TGSZ 3R3GB 1LHFH 1C2LA 1HAXB 3TLOA 3MU1A 2XWBI 3O8CA 5HM2A 2P3FH 1YPKH 4JZ1A 1WUNH 3LOXA 2FS9A 2ZDKA 1S83A 1GI8B 5E0HA 3AAUA 1W7XH 1O35A 5I46H 2GT7A 1L0ZA 2VNTA 3QK1A 1TMTH 2DUCA 1A46H 2ZTYA 4JYUH 1M9UA 1XXDA 1SMFE 1VJ9U 1K21H 6CHAC 5FAHA 3AVZA 3V13A 3MNSA 2ZF0H 1UJ1A 1AFQC 1G3BA 1Y8TA 4FVDA 1HIAB 2BD5A 5GXPA 1ZGIA 1L2EA 4GUXA 1LVOA 1CT4E 2FI4E 1GBJA 1T8LA 4ZKOU 2ZHFH 1CA0C 1Y3XA 2ZFTA 4CRCA 2BQ7B 1MAXA 1UHBA 1O2SA 1FY4A 3ATWA 1ELEE 2Y6TA 4YOIA 1O2TA 4NSYA 3A7XA 1C1UH 2BM2A 3DHKH 4UFFH 1O2QA 1N6XA 1TAWA 3HK3B 1RGQA 3ZYEA 2VWOA 4FUDA 2OINA 3NXPA 3A8AA 1B0EA 3RXUA 1HAOH 3V12A 3Q3KA 1FIWA 5LPFA 1TALA 1PQAA 2OXSA 4X6PA 1UTNA 4NA9H 3KCGH 4Y79A 1TPOA 3RMOH 4CH8B 1CT0E 3BEFB 4NA7A 1LKAA 4H4FA 5EU8A 4K60A 2ZTXA 5A2MH 1G3DA 1QBNA 4O03A 4NIVA 3UNQA 3BN9A 3Q00A 1GMHG 2Q6DA 3PMJA 2BDCA 3S7KB 3HATH 1FZZA 1LVMA 3LGWA 4FUJA 1P04A 4GSOA 1BTHH 4X1SU 2A5AA 2F9UA 4UDWH 1BMLA 3GY4A 1QTFA 1E36B 4I8GA 4BAHB 2FOBA 1P01A 1VCPA 2PR3A 1GL0E 2PSXA 3LGUA 2WV5A 2YOLA 2ZU4A 2UUKB 4VGCC 4BAMB 1ABIH 1DVAH 1HV7A 4K8BA 2PUQH 4X2VA 4ABDA 1PPBH 1UO6A 1G3CA 1BA8B 4O9VA 1OWIA 4AGJA 4GLYA 2IOTA 1KXBA 1TLDA 1IAUA 1P10A 1Y3VA 4E7NA 5IYTA 1VR1H 2ILNA 1RIWB 5EG4A 1QB9A 3ATMA 1MKXK 3ODDA 2BMGB 1P06A 5EQSA 1EB2A 1TQ7B 1GJ4H 1O3DA 2GP9B 3AAVA 5CE1A 3TNTA 4IBLH 1P03A 1QQUA 4BANB 1YPJH 1TQ0B 1T4VH 2XBVA 4ABIA 3BG4C 2PSYA 1NS3A 4BAQB 1QB1A 1SHHB 2VJ1A 4Q80A 1V2RT 3S9BA 3LC5A 4FVBA 3P70B 4ZKNU 1O3FA 2R3UA 3ZVGA 1KLJH 1O2GH 1UTPA 2BY5X 3WY8A 1BB0B 1O5FH 3VGCC 4TY7A 2CF9H 4O97A 3KQCA 4MLFB 2F9VA 1BJVA 2BY8X 2P59A 1CBWB 1GJAB 1RRKA 3SW2B 2HGTH 2VGCC 1ARBA 5DP8A 1P09A 5JBAS 2P94A 1Z8GA 2XBXA 3ZV8A 1QNJA 4I8LA 4WY3A 1AN1E 2CV3A 1QR3E 2J9NA 5EPYA 2FWWA 1GI4A 4SGBE 3D23A 1OYQA 5EPNA 2AGEX 3T2NA 2Y5GA 1PJPA 3TJNA 3LIWA 4GCHG 4DG4A 3O8DA 4LK4A 2AMPA 1RTLA 3E1XB 5C67A 1GHBF 3TH4H 3MWIU 1ZPCA 3TH2H 3T5FH 1Y3WA 1V2WT 4X1RU 4D76A 2FX4A 4KTSA 1W11U 2FXRA 3U8RH 4Y0ZE 5LPEA 1C5QA 2GMTC 2B0FA 3JZ2B 4Y71A 3MMGA 1ETTH 1MU8B 2Q1JA 2A4GA 3PMBB 2ZZUH 3AASA 4D8NA 4ZH8A 1BOQA 3S7HB 1SLWB 2ZTZA 1GI6A 2ZECA 3MNCA 3ZVDA 3GDUA 1KIGH 5DJ7A 2JH5D 2ZDVH 1P9SA 3K65B 2UWLA 3O8RA 3SV6A 2JKHA 1O3KA 2ZU1A 2ZGJA 1F0UA 1CBWC 2FYRA 1QGFA 1PQ5A 3LPRA 3SUDA 1CT2E 1DLKB 1G30B 1QJ7B 1AZ8A 1GBKA 4Y7BA 3NK8A 2QGRA 3BTDE 3QZQA 4K3JA 3SJIA 3PMAB 2F3CE 5ESTE 3ZZBA 1OP2A 1ESAA 2A4QA 3PTNA 3K6ZA 4MNWA 4CR5A 4AYYB 1VCQA 2HPQH 3UWIA 4AB9A 2ZGCA 3KQEA 3P8GA 4BNRA 7ESTE 2BOKA 1FNIA 3F9GA 1AQ7A 3BG4B 4FUBA 2EI6A 1HAPH 1V2LT 2A45B 1SGYE 2THFB 3TU7H 5A0CA 4NFEA 1DWBH 3HPTB 1O2MA 3I78A 1A0JA 2O8MA 3E90B 1ANCA 3QO6A 2OP9A 1C4U2 1TX6A 2ZWLH 1O38A 3A7WA 4AFUA 2QIQA 1SGQE 3TH3H 3SHCH 5K0HA 4RN6A 1SLXB 2FX6A 2CHAC 1YGCH 2ZO3H 1GVKB 1Z8JB 2O8UA 1DOJA 3HKIB 1DY8A 3A8BA 2H5DA 1GBDA 1TYNA 3VPKA 1CQQA 1V2ST 1SSXA 5CMXH 9ESTA 2V0BA 1CU1A 1YC0A 4NA8A 1W0ZU 5E0JA 3SU2A 1VZQH 4U2WA 3P95A 3UNSA 1JWTA 1O39A 1B0FA 2FZZA 2ZGHA 1LDTT 4H42U 2AS9A 1CGHA 2Z94A 3QLPH 2KAIB 4Y76A 1EATA 1C9PA 1V2UT 1D9IA 2GTBA 4WXIA 4AZ2B 1AKSA 3EAJA 1GBHA 1UK3A 1S0QA 3UUZA 1W2KH 1YPHE 2W5EA 2BY9X 4NWKA 3OTJE 1EAUA 3OYPA 3GY7A 2FLBH 1MTSA 1N6YA 2QXJA 4Y8YA 4SGAE 4AOQA 1UCYK 1ARCA 1WBGB 3A80A 1C9TA 1MTVA 3MHWU 1NPMA 2OLGA 2C3SA 3AW0A 3HGNA 1FY1A 2A31A 2BB4A 3RU4T 7LPRA 4TPIZ 1LHGH 1Q31A 4I8JA 3MO3A 1XUJA 4B2CA 1TA2A 1TBZH 2O8TA 4MQAA 2FDAA 4X8SH 2ZPSA 2PW8H 2A7CA 2FOAA 1T32A 3EQ0H 4KTUA 3BTQE 1BT7A 5FX6A 1K1IA 8KME2 1K9OE 1RD3B 5J4QA 1SGCA 1GBCA 4DVAU 2CHAB 3PLKA 3MO6A 3C1KA 4WVPE 3SQEE 3NPSA 5ETXA 1D3DB 3RP2A 4B1TA 1BMNH 1EPTB 1HXFH 2QF3A 2VVUA 1UMAH 4GAWA 4FUEA 2O8WA 4ABGA 3M7UA 1V3XA 1O2ZA 2AEIH 5FCRA 3A82A 4CR9A 2H6MA 3QUMP 1NU7B 2BTCE 1X7AC 5DP4A 1SQOA 1LPGB 3PB1E 1NRNH 3Q3XA 3GCTG 3SU5A 1HJ8A 2GCTB 3HK6B 3TJUA 1YLDA 2ZHDA 3M3VA 1FLEE 4WMDA 3HKJB 2VH6A 5F8ZA 2Z9JA 1O3LA 1DXPA 1GDQA 2ZQ1A 5TCAA 1EX3A 2GD4B 1HJAC 2ZQ2A 1HJ9A 2V3OH 1SGEE 3BTEE 4OS1A 1FUJA 1QJ1B 3D65E 5C1XA 1T31A 5E2PA 1BRUP 3SI3H 1SFIA 3F9FA 4NG9H 1O5DH 2NU4E 4YO9A 1BUIA 1CE5A 1HB0B 3KN2A 3LH1A 4NSVA 1RJXB 1FJSA 1GBBA 4K5ZA 1TNHA 1GI1A 3GCHB 1AI8H 3GCTF 1TNKA 4Y7AA 2ODQA 2QY0B 1P05A 2TBSA 3SU0A 5EW1H 2AFQB 3STIA 2ALPA 1DWEH 1GBTA 1OWDA 2F9PA 1NFXA 4OS2A 4DW2U 1AD8H 1O3PB 2PKAA 1SGPE 3STJA 4Q7XA 2OTVA 1O36A 1C5MD 2R9PA 3GCOA 1TE0A 4GPGA 3RC6A 1CA8B 1F0RA 3T29A 4D9QA 2C4FH 1O3IA 1SI5H 2H9TH 2KAIA 4UONA 3UTUH 5C5NA 2P3UB 2M5TA 2ZU3A 3ATIA 1ZRBA 5AFYH 2TGDA 1OWEA 2OC7A 2VU8E 5C5OA 2C8WB 2A32A 2J4IA 3Q76A 1YM0A 3CS7A 4ZXYH 1SG8B 1SLVB 4JK5A 1PPHE 1F5LA 2Z3DA 3SNBA 1UVUH 2FP7B 1XKAC 4JYVH 6ESTA 2ANYA 2RA0A 3RC5A 4IC6A 2C93B 5JB8S 1KTSB 2SGDE 2VVCA 2VGCB 5EODA 2XRCA 2XTTB 2W7UA 3M3TA 4Y10E 2V35A 4DCDA 1ELCA 3TIUA 1TWXB 3MH4A 3P6ZB 4A7IB 1P3EA 1VITG 6GCHF 1E37B 3LKWA 1JBUH 1RTFB 5A0AE 2ZC9H 1MH0A 1DANH 2G4UA 1JIMA 1L4DA 1P8VC 1ZHRA 1SL3A 1L1NA 2BD3A 3KF2A 1OX1A 1MUEB 2PUXB 2XW9A 1WU1A 3ESTA 2FOGA 3KGPA 3LONA 1C5YB 5B6OA 2FPZA 4XBCA 3ZZAA 1OXGA 1WQVH 2AIPA 2QCYA 1K28D 3MU8A 1MKXH 2I6QA 3TK6A 2OUAA 3VXFH 2HLCA 4DURA 5PTPA 3PYHA 1ETRH 4ZUHA 2CN0H 5G4BA 4CRGA 4A1XA 2ZDMA 3VXEH 1EPTA 3KQBA 3GY3A 2EEKA 1O2WA 2R2WU 4LZ1H 1ABJH 1KTTB 1O2OA 2D1JA 4AGKA 1C5SA 3U1IB 1XUFA 3FANA 3DD2H 4CRFA 3C27B 1NO9H 3SNEA 4X1QU 2ZGBH 2HVXA 2PLXA 1J8AA 5DK1A 3MU5A 2NU0E 1CGIE 1MAYA 1IQIA 2NU3E 4CHAB 1QRXA 3QZRA 4YLUA 3RMLH 3FFGA 3SNAA 2WPIS 1UTKA 2Q6FA 1PPGE 4X8VH 2JH0D 1NZQH 1C1QA 1V6DA 2BD8A 4X2WA 5HGGA 1RFNA 1XUHA 2FOCA 1K22H 4HGCA 1TRMA 3P8FA 2QN5T 3PLPA 1D6WA 1IQLA 1XVOA 1NRRH 1TNIA 3TK9A 1YCPH 1SGDE 3UOUA 1C1NA 5L2YH 1RXPA 1DE7H 2Y81A 1GJ8B 2ODYB 1MMJN 2Z6BD 3A89A 1AU8A 3FVFB 1IQNA 1KLIH 1OS8A 1SQAA 1YPHC 1SGFA 1C5UA 1ZGVA 1TGNA 4K1TA 1THSH 1GVZA 1V2JT 1IHSH 2HNTC 1HNEE 1V2KT 3S0NA 4ZKRU 1QBVH 3NUMA 4I8KA 4D7GA 4JMYA 1KXAA 3BTKE 3RXSA 3ZZ5A 4UD9H 1F0SA 4MVNA 3A84A 3FZZA 5JPMH 4Z0KA 5AF9H 1G2MA 1IQGA 4X6NA 1AY6H 3A81A 7KMEH 3VB4A 3MU0A 1OYTH 3RXFA 4CRBA 1XUIA 3K2UA 5DP6A 4TYDA 4Q7YA 1Z8RA 1XM1A 3UQOA 3T62A 4AYVB 3LT3A 4AG1A 3SJ8A 1LQEA 1GI2A 4MNXA 1ZTKA 4K2YA 5DP3A 1CO7E 2STBE 3GDSA 1GDUA 2H9EH 1GBAA 4DJZB 2P8OC 3MOCA 5IDKA 2BD2A 1GWAA 1C5OH 3UIRA 1VCWA 2GDDA 4AG2A 2SFAA 4OGXA 1GHYH 1ANEA 2FTMA 1H8DH 3F9EA 1HBTH 1C2IA 5T3HA 2FOEA 4NWLA 1ZMNA 2Y7XA 4U32A 2WYJA 3DUXH 4NGAH 1G32B 3MTYA 4KELA 5EXLA 4OS6A 1GG6C 1TNGA 4XDEA 1TRYA 1HAVA 2BVXH 1QHRB 2ZU5A 1O2LA 1GDNA 2PKSB 3M7TA 3BF6H 1PYTC 1QJ6B 3W94A 2J95A 4X2XA 4AN7A 1MTWA 4H6TA 4JZIA 1C5TA 4YOJA 1QCPA 1C1SA 1ZSJA 1OWJA 4ABFA 5FBEA 2D8WA 1C2FA 1A61H 1ZHPA 1WCZA 5FBIA 3LDXH 4BAOB 1DM4B 2PKSC 1TRNA 1JMOH 1VITH 2WUCA 5GCHG 3SUGA 1O3JA 3QGJA 3A85A 4K8YA 3RXKA 3URDA 2W26A 1YPLH 3LGTA 1ELVA 1ZYOA 4XBDA 3M5OA 3R0FA 5A8XA 2G4TA 4R0IA 1P2JA 4IGDA 2ZG0H 5E0GA 2AERH 3ITIA 1P57B 1VGCB 1C1WH 3SU1A 2A7JA 2HRVA 3ZV9A 4MPXA 2FODA 1QBOA 1GGDC 5C3NA 4Z6AH 3ZVEA 2WV4A 5GIBA 1OOKB 2GCHF 1AE8H 1GMCG 1JXPA 2A0QB 3KIDU 1ID5H 5GCHF 1S0RA 1TBQH 1GI7B 2UWPA 1AZZA 5A8YA 1LVYA 3ATLA 2Y80A 4FUHA 1O33A 1A0LA 4MNYA 1FY5A 3BV9B 1BDAA 3BTFE 1O5CB 2AGGX 3QTVH 1XVMA 4JK6A 2ZNKH 3M36A 4TPYA 2XBWA 1RS0A 3BTWE 2P3TB 3PLBA 5GDSH 1FAXA 3RLWH 3D62A 4BXSA 4FUCA 2WPHS 1Z6EA 1BJUA 1YPGH 1GBEA 3NZIA 1A5HA 1ZRKA 2FIRH 4BAKB 1AB9C 5EGMA 4DY7B 1OKXA 4BTIB 2ZFPH 5T6FA 1O3BA 3BTME 4E7RG 1IHTH 1EASA 2WUBA 2ZKSA 1ZZZA 4HZHA 4INKA 4DGJA 3ZZ8A 1S6FA 1HPGA 1GHZA 2F9OA 2IJOB 2SGQE 2VIPA 1EAXA 5T6GA 2BDBA 3NCLA 2GGVB 3MNXA 5EXMA 2ZFQH 2CXVA 1TNLA 3H5CB 4X1NU 4GHQA 3RU4E 5F03A 2Y7ZA