1UO6A

Porcine pancreatic elastase/xe-complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ELASTASE 1
publication title On the Routine Use of Soft X-Rays in Macromolecular Crystallography. Part II. Data-Collection Wavelength and Scaling Models
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uo6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uo6A01
4CRCA 1NROH 2PKSB 2VGCB 4D9QA 1IHSH 4Z0KA 1FJSA 1BITA 3ELAH 4Y8ZA 3MMGA 3ZZ7A 2BVRH 1K1IA 1U6QA 2G5VA 1K22H 2J95A 1HNEE 2QF0A 4B76A 3C27B 2R3YA 2P3TB 5HXFA 3VB3A 1CGHA 4X8UH 2FI3E 1S0QA 3SNAA 1AUTC 3JZ2B 3DFLA 1F5KU 1TIOA 2WPHS 1GDUA 3GY2A 2GMTC 2XWAA 4YM9A 1RJXB 3BEFB 4MNWA 3SV2H 1O5BB 2LPRA 3UQVA 1H9IE 2XRCA 1CHOG 4ABEA 1EOJA 2GCHG 2G4TA 1SG8B 2Y5GA 3CP7A 3QO6A 2VNTA 1MTVA 2RG3A 3BTHE 1F92A 2AGGX 3BSQA 2FZZA 3A89A 1BHXB 1QFKH 3UWIA 2XW9A 4ZXXH 1MTNB 1K1JA 3BTKE 5DP8A 1O2MA 3MNXA 3MNBA 1HYLA 2BY8X 1UTOA 1E37B 2BD2A 2RA3A 2UUFB 1YF4A 3GISB 4ZKNU 1GI0A 3T2NA 1DSTA 4RKJB 1K1MA 4BXWA 3MTYA 3DT0H 2C90B 2SGPE 3A7VA 1H9LB 4X6PA 2JH5D 2P93A 4X8TH 4Y7AA 2HNTF 1MU6B 1GCTC 1SL3A 2BY6X 3K6YA 1NY22 2FYQA 3RXDA 1LKAA 3R0FA 4ZXYH 4ABBA 4K60A 1TOMH 3A84A 1D4PB 1BTPA 1MQ6A 2EEKA 2GX4A 4J1YA 1SQTA 2OD3B 3LKWA 3LOXA 4CRDA 1CO7E 3ODFA 1AFQC 1G9IE 1V2JT 3ZV9A 1MZDA 1CQQA 1OYQA 1XKBC 1ZRKA 1XKAC 8ESTE 1AWHB 1ID5H 5F8XA 3KIDU 1H8DH 2BX3A 2SNWA 3A8AA 3EAJA 2QYIA 1Z1JA 2R2WU 2PGQB 2XBWA 5DK1A 2ZKSA 3SJOA 3UTUH 1C5PA 3PV4A 4ISLA 4A6LA 1FXYA 3PMJA 3BG4B 5DGJA 2AYWA 4A1XA 2FI4E 3OSYA 3TH2H 2CN0H 1GJBB 3MU8A 5ESTE 4FUBA 2V6NA 3ODDA 3DA9B 2DE8A 3Q77A 4FU8A 2ZGXH 2OC7A 1P9SA 4I8GA 4U30A 3GYMA 5K7RA 1YM0A 1BRCE 1QL9A 4I8KA 1FZZA 1KIGH 3EQ0H 3NXPA 1TMBH 2AEIH 2BD9A 2D1JA 2WPIS 1XVOA 5DP3A 3F9FA 1HAVA 4H42U 1ELFA 1HJ8A 2GVFA 3QTOH 1EOLA 4K69A 3D23A 2A5KA 1UHBB 3T62A 1CA0B 3HKIB 4BAMB 1LVMA 4AFUA 2D8WA 1DLEA 1NO9H 2A4RA 4AYYB 1C5NH 3BTWE 1H1BA 5DP7A 3HGNA 4CBNA 4WWYA 2QC2A 1F0SA 3ZV8A 1DPOA 3ZVDA 1NS3A 1GWAA 1QBNA 3DHKH 4FXGH 1EP6A 3RU4E 1FV9A 1PQ8A 1UCYH 3ITIA 2HGTH 2BD5A 1P2QA 2CHAC 1L4DA 2RDLA 3URCA 1OPHB 3ZYEA 2OQUA 1TNGA 4RSPA 2AH4X 3KNXA 4Y8XA 3S9BA 3TNTA 1RFNA 1O5CB 5T6GA 1NRRH 3HPTB 1HIAB 1C5ZB 1HJAB 4UE7H 3SNEA 1TONA 1J8AA 1VCWA 1AO5A 5FBEA 3S9CA 3Q3KA 1ETRH 4XE4A 2QV1A 2F83A 4Y8YA 1HXEH 1QA0A 1V3XA 3BF6H 2H6MA 1BMAA 2ZI2H 1KXBA 3PO1C 1P03A 1GGDC 2FOMB 2ZPSA 3IITA 1GMHG 2A2QH 3TVJB 4AYVB 1V2ST 3W95A 2F9OA 3O8CA 3O8DA 1LVOA 1SOZA 2QXJA 1S5SA 3ENSB 1S6FA 5FCRA 1Y5UT 3LGTA 2R3UA 5DG6A 3QTVH 5LPEA 4MPVA 2BD3A 1SGFG 4I33A 2FTLE 1J9CH 2XTTB 4INKA 3AAUA 2HALA 3KQBA 4X8VH 4ZKSU 4RKOB 4UFEH 1S0RA 1FPCH 1O3GA 2VU8E 2ZU2A 1O37A 3VB4A 1EQ9A 1KXCA 2A5AA 5GPIB 5EGMA 1VITG 1XUHA 5AFZH 3ZVEA 1EJMA 1ZHMA 6ESTA 2ZU1A 3P8NA 2ZDAH 3HKJB 3TNSA 1EJNA 4JYTA 1ETSH 1VZQH 1VJ9U 1MTUA 1CHOF 3RXSA 2STAE 4CRGA 2GCHF 1TA6A 2Z3CA 2AMQA 2GZ8A 5AFYH 5EODA 5C2ZA 1C1RA 1GI1A 1NRPH 1BMMH 2J9NA 2TGPZ 1GJ8B 4R8TB 1GI6A 1G32B 4AORA 1YLDA 3FP7E 1IAUA 3OTJE 4F49A 1E34B 5EQSA 2CF8H 5EXNA 1MAXA 1DUEA 3NWUA 4XDEA 1C2GA 2PSXA 2ZDVH 1P0SH 1O2YA 1UTJA 5FX6A 1OS8A 4XBBA 1TNJA 3GOVB 4KELA 5EW1H 1LMWB 3AVZA 4E7NA 1EAXA 3QUMP 5T6DA 1T4UH 3M3SA 3PB1E 2FX4A 3AASA 5EQQA 1QQUA 1G3DA 1V2QT 2A7HA 4E05H 4IC6A 1UVPA 3A7ZA 1V2TT 5EPNA 3MYWA 7LPRA 4AN7A 5F8TA 1XXFA 2ASUB 2W7UA 3FVFB 4UD9H 2SGDE 5DP5A 1GPZA 3TJOA 4JZDH 2GGVB 2THFB 1KDQB 3WY8A 1BHXF 2Z94A 5LGOA 4AX9H 2ANWA 1C2LA 2J94A 2VIPA 1O5FH 1QB6A 3SV6A 1MBMA 1T8OA 4LK4A 1EPTC 1UTNA 1SVPA 1PPFE 5EOKA 2AFQB 3RXEA 4BAOB 1YBWA 3ZZAA 9ESTA 4R0IA 2ODQA 3SGBE 2FLBH 1DY9A 2HWLB 4B2BA 1EPTA 3GDVA 5EXLA 1O2NA 3F9HA 5F8ZA 3GY6A 1SB1H 4J2YB 1LPZB 2Q6FA 1T8LA 3GCHB 4NZQA 4YO9A 1ZMJA 4YOGA 1W0ZU 2HNTC 2XC4A 1YCPH 1GI5A 1BRUP 1ELBA 2HLCA 2Z3DA 1ELDE 5FAHA 1KY9A 1AIXH 2A2XH 1QB9A 3SHAH 1ZRBA 4NFEA 3SNBA 5DP6A 1KLTA 5CHAC 3SW2B 1LHEH 1GBHA 1GI7B 2ZCKP 1BMNH 2BMGB 2PV9B 1CA8B 3LJJA 2IPHA 1A3BH 3O8RA 1IQGA 2PTCE 2ILNA 1GBCA 2VIQA 3SNCA 3H5CB 3E1XB 2WV5A 1LHDH 4IN2A 1D3QB 2DUCA 4X8SH 2Z9IA 1GJ7B 2OXSA 2BYAX 1EJAA 3QLPH 1QRZA 1RGQA 1UK4A 2WPLS 1LHGH 2ZO3H 3E16B 1UMAH 2QN5T 1BRAA 4WF8A 1TAWA 1TA2A 2C8ZB 2ANMH 2ZDLA 1INCA 5L2YH 1ELEE 2O8MA 2NU4E 5L30H 1W11U 4A1VA 4ABIA 4FUGA 3KL6A 5JBCS 2OTVA 3H7OA 2ZC9H 3HATH 3SHCH 4GHTA 2BD4A 1GBMA 3UPEA 2D26C 1O3AA 4H6SB 3TJNA 1D3PB 1VGCB 2STBE 3A86A 1HAPH 4I32A 4NSYA 2JETC 1UTPA 5FPYA 3BTME 2ZGCA 2FOFA 3AW1A 2XWBI 4DURA 1MKXH 3IG6B 1SLXB 1GG6B 6CHAB 3DFJA 1T7CA 4CRBA 1QY6A 1ZHRA 1EATA 4CRFA 3LGWA 1S84A 2BQWB 3O8BA 4ZKRU 1G3CA 1A0JA 1KSNA 4MTBA 3RXIA 4TY7A 4WH8A 2NU0E 1KXAA 1TB6H 1G2MA 1QRXA 2BD7A 2AMPA 2BZ6H 1QL7A 2AMDA 4GPGA 1TPOA 1WSSH 1O3EA 2VJ1A 1BQYA 2EI7A 1EX3A 1K21H 4A92A 4ESTE 5DO4H 1QBOA 4B73A 1BJVA 1SGQE 1VITF 3A7YA 2QF3A 1RRKA 5HM2A 3ZZ5A 2B9LA 1TGBA 4Q7ZA 4KP0A 4X2WA 3SUGA 2PFEA 5GJ4B 5C1YA 1CGJE 3MH5A 1NRNH 1GVLA 2F9BH 1SGCA 1FLEE 5IYTA 4LZ4B 1TMTH 3RMNH 4K5ZA 5E0HA 5GCHF 3VFEA 1XUJA 4GCHG 1O3KA 2XYAA 2XXLA 3E8LA 4Y0ZE 2A1DB 1O3NA 2ZDMA 1Y3WA 5EG4A 2FX6A 4CHAB 3MWIU 4ABFA 1LKBA 2ZP0H 4XBCA 2VVCA 5FX5A 4MNYA 3M3TA 3QWCH 2HOBA 1CT4E 1BCUH 1O2VA 1KXEA 2VB0A 2EI8A 2YOLA 3U69H 3VB5A 4DW2U 4ZMAH 2ALVA 1BZXE 1QCPA 4IMZA 4ISNA 3FP8E 1HPGA 3DUXH 2F91A 3E0PB 3EA7A 2ZPQA 2M5TA 3ATKA 1EKBB 1RTFB 4IMQA 3VGCB 1YLCA 1V2NT 1S6HA 3E6PH 1O2LA 2C4FH 4ABHA 4GSOA 3A7WA 1YYY1 3P8OA 1LVBA 2GCTB 2H9EH 3SJ8A 1OWEA 4CBOA 1OKXA 2FMJA 2ZDNA 1OSSA 1Z8RA 2PW8H 1A4WH 2FOGA 2PKSC 1KTSB 2VGCC 2A31A 3M7QA 3MO6A 1ANDA 1TPSA 3TGJE 1KXDA 1DSUA 3LPRA 1ZJKA 4B71A 1BTZA 3B9FH 1DM4B 2UUYA 1IQHA 3MHWU 3ATIA 4WXVA 4BOHA 1ZPBA 4KTSA 2Z6BD 1Q3XA 3P6ZB 5DPAA 2PUQH 1O2TA 1TGNA 3SQHE 1AKSB 4IGDA 1SGDE 1VCPA 2ZIQH 3SI3H 4GUXA 3ZVGA 1H9HE 1KXFA 4INHA 1ZPCA 4UFFH 2GV6A 2G4UA 1MAYA 2GT8A 3KF2A 3PMAB 3SU1A 5C1XA 1MTWA 4M7GA 2ZF0H 2ZFPH 3SU4A 3EA8A 1AFEH 2R2MB 1NU9A 1LQEA 2JH6D 5FBIA 2BXUH 1HLTH 5CE1A 1EB1H 1YKTA 3PTNA 4FUCA 4YOJA 1SQAA 1JMOH 3NKKA 2O9QA 1RIWB 3UREA 2PSYA 3F68H 4FUFA 3A87A 4X2YA 3L3TA 1MTNC 2AGEX 4UEHH 1ZTKA 2B0FA 1WU1A 4HI3A 4AGJA 2BDIA 1DWCH 1EAWA 5E2OA 1LHFH 3RMOH 1GMCG 3W94A 3BIVH 1HJ9A 1PPHE 1LO6A 1LQDB 2IJOB 3OX7U 1GL1A 3AAVA 4Y10E 2A4OA 1UCYK 1E35B 2OBQA 1V2RT 3IWMA 1C2JA 3I77A 3S69A 5J4QA 1K28D 3SU3A 2HNTE 2W5EA 1IQIA 3LDXH 4JZEH 2B5TB 4ABDA 5A0AE 1ARBA 4OGXA 3KQEA 1C2DA 1V2PT 4O9VA 1C5RA 1EXFA 2ODYB 1P2NA 3RC6A 5JBTA 1C1OA 2FWWA 3I29A 1HAZB 2EI6A 1LPKB 1GCTB 1B0EA 3QX5H 2FXRA 1S85A 3BG4C 3SBKA 2GD4B 2TGAA 5ESBA 1P11E 2ZCHP 2KAIB 3MOCA 1ANBA 2C8WB 3F9EA 4YLUA 2J2UA 4JZ1A 4H6TA 2J4IA 1J17T 3MH4A 3OU0A 4AB9A 5EQRA 1KYNA 1DXWA 1BTUA 4O3UA 4MPWA 1ZSJA 1F2SE 4ISIH 3KEEA 3V0XA 5T3HA 1TNLA 1DS2E 3PYHA 3SV7A 1D3DB 3RXQA 2HPQH 3KCGH 1GBBA 2Z7FE 1GBFA 2WPJS 2OBOA 4X1SU 2CV3A 1WQSA 3LJOA 5LH8A 2BZAA 2SGAA 3P8GA 1CA0C 2CGAA 1QHRB 2CF9H 2FI5E 1UHBA 1Z6JH 3K9XB 3E90B 1TGCA 1ZOMA 3FAOA 1WCZA 1C5MD 3NK8A 6GCHG 4INLA 1C4U2 4BNRA 4FVDA 2ZGJA 3QDZB 1MZAA 1HUTH 1RTKA 3GDSA 4Q7XA 2XC0A 3A7TA 4KTCA 1C5YB 3OY5U 1IHTH 1P01A 5JB8S 2H1UA 2ZTYA 4GCHF 1QJ1B 2BVSH 4WMDA 1C5LH 2P16A 2FYRA 4IC5A 3S0NA 1Y5BT 2FTMA 3RXGA 1BUIA 2LNCA 4X6MA 1YPMH 1MD8A 1YPHE 1EAIA 4K1TA 2UWLA 2GTBA 4GAWA 4SGBE 1ELGA 1TQ7B 1AI8H 3NZIA 1IQKA 2B8OH 4B74A 4MQAA 1HGTH 2JH0D 1NTPA 1X7AC 1Z6EA 3E3TA 1S82A 2GDEH 3HK3B 4JK5A 1SGFA 1P05A 3ZZ4A 1DWBH 2P95A 1UTLM 2A45B 1BTYA 2BLOA 3M3VA 4ZUHA 2C8XB 1LPGB 1HJAC 3EE0B 3P92A 4XOJA 1N8OB 1ESTA 4DJZB 1A46H 5FPTA 1HIAA 8KME2 2BB4A 1V2MT 1DUAA 2FO9A 1B7XB 1THRH 4JK6A 1NFXA 2H9TH 2TPIZ 3A82A 4Y76A 2V3OH 5L2ZH 1AB9C 2BDBA 5I25A 1KTTB 3RXHA 3SJ9A 1BRBE 4AG1A 4TWWA 1GJCB 3KQCA 5EPYA 3P95A 4FUJA 1AE5A 1AY6H 1BA8B 1ZYOA 2VINA 1GJ6A 1O2SA 4Y7BA 1QA7A 1EB2A 1UJ1A 2SGFE 2F9NA 2WPKS 5BPEA 1P9UA 2Y7XA 1CVWH 1BOQA 2SFAA 5CMXH 5ETXA 2ZG0H 2ZCLP 3NPSA 1BDAA 1C1QA 2P3UB 1A2CH 3M35A 5EW2H 1C5SA 1Z8JB 4I31A 1F5RA 1YCPK 1GCDA 2Q6GA 2ZQ1A 1MCVA 1WUNH 3L33A 5TCCA 2AIPA 3SU2A 1O2WA 1P09A 3Q3YA 2CJIA 1HAIH 3U1IB 2NU1E 1L0ZA 3EGKH 2CXVA 4Y71A 3B23B 5GCHG 2VH0A 2OLGA 2VIOA 1ZTJA 1ESAA 3LGVA 5FHTA 5AHGH 3VPKA 1HCGA 4WXIA 1CT0E 1A61H 3LGUA 1Z8GA 1GJ4H 2PTNA 1A5GH 1J15A 1C4V2 1SOTA 4BAQB 1K9OE 1C1TA 1O0DH 4JMYA 3UIRA 4X2XA 5E2PA 1ZMNA 1M9UA 1EZXC 2J38A 4PROA 1QURH 1GMCF 3BV9B 3FANA 3T25A 1TFXA 3P17H 4THNH 1GBDA 3FZZA 1P8VC 1SGIB 2ZU4A 1GVKB 1UCYE 3QK1A 2BY9X 2BHGA 3M37A 1QJ6B 3HGPA 1QL8A 1ZLRA 2NWNA 2QXGA 3MNSA 1EP5A 2SGEE 1O32A 4HFPB 2ANYA 3A8DA 3GICB 3M5NA 3R3GB 1ESBA 3TK6A 3E0NB 2A7JA 1ZSKA 5JBBS 1CBWB 1O3DA 1N6YA 2K1QA 2ZHEH 3TGIE 3GCNA 4WJG2 1Z7KA 1KDQA 1MKXK 2G52A 2O8UA 3RM0H 5JDUB 3SU6A 4K8YA 2OP9A 3Q76A 1AVWA 1W12U 2R0KA 1SI5H 1WAYB 5JPMH 1SSXA 1GBKA 1GDNA 1LCYA 4CR5A 3G01A 1CHGA 1TWXB 3A83A 5AVDA 2AS9A 1A0HB 4K1SA 3T29A 8GCHG 3GCHC 1XUFA 1EUFA 2G81E 2G8TA 4A5TS 1BTWA 1BBRH 5GDSH 1GHXH 1XX9A 1MUEB 4AFQA 1O2RA 4NFFA 1QQ4A 3RXPA 4OS1A 1OWIA 2R0LA 2P8OB 3UOPA 3M7UA 2WYGA 3SJIA 1PQAA 2OCVB 1Q31A 1Y3XA 2A0QB 1QGFA 1GBLA 5AF9H 1C9PA 1P04A 5C5NA 1O2IA 3RXTA 1TLDA 6GCHF 1DLKB 1MKWH 5TCAA 5C1UA 1SHHB 1B5GH 1O2OA 4HGCA 5FCKA 1DT2A 1GHZA 4I8JA 4DOQA 5CHAB 2TIOA 3K65B 2QGRA 3BG8A 5A0BA 3SORA 1BJUA 1W14U 1XUGA 1O5AB 3M5MA 1AD8H 1AGJA 1L4ZA 1G3EA 1T32A 1DICA 5E0GA 3GY7A 1SGYE 2G51A 1BIOA 2OQ5A 3JZ1B 3I78A 1TNHA 4FVBA 4UFDH 1VGCC 1O36A 4TYDA 4K1EA 3H7TA 2FOHA 2BLVA 4MG3A 5SGAE 2FOAA 3EA9A 1O39A 5A09A 3OY6U 4YESB 3RXLA 1AUJA 1SPJA 1C2IA 1CU1A 1ZTLA 3CS0A 4FUEA 3PMBB 5F03A 4E06H 2VVUA 2VWLA 4YOIA 2ZHQH 5C3NA 3A80A 1AU8A 3ESTA 1GG6C 6CHAC 2P3FH 2QXHA 1VJAU 1ELTA 2C3SA 2QIQA 3HK6B 4ASHA 3SGAE 1E36B 2QCYA 1AQ7A 2TBSA 1HAOH 1YPHC 4AFSA 1G3BA 2ODPA 1UK3A 4MNXA 2GDDA 2ZTXA 4BAKB 3MU4A 1RTLA 2VWOA 1FIZA 1GI8B 1JWTA 1UTKA 2C93B 1SLVB 1GVZA 2BOKA 3EYDA 2ZECA 5LPFA 1MTSA 3BN9A 1O3MA 1C1NA 1CSOE 1VCQA 4LZ1H 1OP8A 2PGBB 1E38B 2Q6DA 1H4WA 2WUBA 3PLPA 1UVOA 4YLQH 1D3TB 2V35A 2IOTA 3KHVA 1QIXB 1P2JA 1RXPA 2ZDKA 4O3TA 3V13A 1FUJA 1T8NA 1NT1A 1O3IA 2ZFFH 4X1QU 4ABGA 4NA8A 2ZNKH 3RDZA 2ZU5A 3FP6E 4DG4A 3RXMA 1S81A 1C9TA 1GBEA 3GCTG 1UO6A 5GXPA 4D8NA 2PKAB 4D9RA 4NG9H 2GP9B 2OC0A 2BDCA 3SZNA 1SLWB 3SV8A 1W7XH 3PLKA 4WMEA 5DJ7A 1DXPA 2ZFRH 3VEQB 2V0BA 2BM2A 2QXIA 1O3CA 3K6ZA 2Y7ZA 2H2ZA 1P57B 3BEIB 4NIWA 3LIWA 3VXEH 1F5LA 1DANH 2W26A 1O5DH 3RC5A 1SR5C 1P02A 3MFJA 1O3OA 2XBVA 2ZGHA 1UVTH 3T26A 1O2KA 2GZ7A 4ZHLU 2PR3A 4Y11E 1EZQA 2VWMA 3SNDA 3RU4T 1FMGA 4JZIA 1O2XA 4XFQA 1DE7H 4NA9H 1FI8A 4CRAA 2Y5FA 5C20A 4WH6A 4CR9A 2BTCE 1ZMLA 1TALA 3PMHB 4X2VA 3VGCC 1IQLA 4UFGH 3SJKA 1MU8B 1EASA 1HFDA 1FY3A 4VGCB 1G36A 1NPMA 1TE0A 1V2UT 2PLXA 3QN7A 1G2LA 1WOFA 4Y79A 3SGQE 3UOUA 4D7GA 4FUDA 2YNBA 1Y3VA 5E0JA 4MDSA 2A7CA 2GCTC 1O5EH 1FQ3A 1WBGB 2Z9LA 1P2MA 1XMNB 2BY5X 3M5LA 2OINA 1GJ5H 2ZZUH 1ETTH 5A0CA 2W3IA 2AIQA 3U8TH 5GWZA 1HAXB 2TGTA 3RP2A 4X1NU 1QB1A 3Q3XA 3M61U 1O2UA 4DCDA 1SC8U 4BXSA 1BTXA 3VXFH 3RXUA 1FAKH 1WTHD 2A4GA 4BTUB 2FP7B 2HPPH 1QRWA 2I6QA 3SQEE 5G4BA 2HVXA 1ZR0A 2XBYA 1NFYA 2XNIA 1O38A 6LPRA 3MNCA 3EDXB 8GCHF 2P94A 3A88A 3MO9A 1YPLH 2BXTH 3GY5A 3ZVAA 4TWYA 3RXRA 1AKSA 4TPYA 1PQ5A 4UDWH 1EZSC 1GMDF 1O35A 1F0RA 4DT7B 1TOCB 1V2WT 2O8LA 1B0FA 2ESTE 3T27A 5LPRA 1TX7A 1A0LA 1E0FD 2BVXH 3CENA 4AZ2B 1HBTH 1L2EA 1W3CA 1O2ZA 3A8CA 3URDA 1GBIA 1Y59T 1P06A 1Y8TA 1A1RA 1O2HA 4A1TA 3CS7A 3QGNB 1DWDH 5FXLA 1FN6A 1GHAG 3LC5A 1RIWC 1QJ7B 2GV7A 1SGNE 2GMTB 2RCEA 4LOYH 1SGEE 5E8EH 1ZSLA 3MU5A 4E7RG 5HYOA 5PTPA 3UUZA 3D62A 4Q7YA 3S7KB 2G55A 1TBRH 4RN6A 2ZFQH 3SO3A 4NIYA 4ZHAA 4ZH8A 3A81A 1SLUB 3SUFA 3RLYH 2P59A 1C5OH 2FOCA 3ATWA 2BDGA 3P8FA 3RXFA 3M7TA 4WVPE 2BOHB 4K3JA 1NFWA 3RXKA 1BT7A 2VVVA 2OC8A 1V2KT 2VIVA 1TGTA 7GCHG 1SMFE 2JKHA 3PWBA 4O97A 1AVXA 3GDUA 1WQVH 1DY8A 3STIA 3S7HB 1GHBG 1ABIH 1JBUH 1PPEE 3GCOA 1F0TA 1YPGH 3RM2H 1A7SA 1MH0A 2UUJB 1N6XA 3OYPA 1GHVH 1O3FA 2WPMS 2WV4A 4DIHH 5TJXA 3A7XA 1O33A 2KAIA 4X6OA 3BTFE 1AFQB 2QA9E 4UONA 4SGAE 1TNKA 4DVAU 2ZTZA 1WYKA 3TK5A 1ARCA 1NESE 4FU9A 3TGKE 3C1KA 1W2KH 2FLRH 1ANCA 3PWCA 3QGJA 1TPPA 1PPBH 3BTEE 2W7SA 1GJAB 2CMYA 3BEUA 4OS7A 5ABWA 3FFGA 5EU8A 1JXPA 1W13U 1OP2A 3TH4H 3GCTF 1ORFA 1SFQB 3NCLA 2WUCA 5HM9A 1F0UA 1OX1A 3TK9A 4NIVA 2BDYA 1HAVB 1FY1A 1MD7A 2OUAA 4JCNA 3TU7H 1W7GH 4OS6A 1TMUH 4OGYA 1P3EA 4WMFA 1OXGA 3PM3A 1UK2A 4A7IB 1HXFH 1O3HA 8LPRA 5EXMA 1D6RA 2ZQ2A 3RXBA 1VR1H 4I8HA 1IQNA 2H5DA 1K1LA 3UY9A 1HV7A 2ZGBH 1S83A 2FEQH 1CGIE 1P10A 2GZ9A 1K2I1 4QT8C 1W8BH 1DX5M 4MVNA 3U8RH 3RC4A 1GJDB 1AVGH 3LGYA 1WTGH 1C1UH 1SBWA 4GLYA 4NGAH 4D76A 4CH8B 1K1PA 4Z6AH 1N8OC 3VB7A 3SU5A 3ZZCA 4B2CA 3AW0A 4Q80A 4ZHMU 2UWPA 2QAAA 1THSH 1EAUA 2R9PA 4JYUH 5A8ZA 1YGCH 4LXBH 4MNVA 2Z9KA 5GIBA 1C1WH 3TLOA 2CHAB 1C1MA 3P70B 1FPHH 2Y80A 4KTUA 1FAXA 3LONA 3LH3A 1P2KA 4HZHA 4IN1A 1YCPM 3RXCA 9LPRA 1TBZH 2NU2E 3U98H 1ELAA 1QBVH 4KKDA 1C4Y2 4FU7A 4DGJA 1FY8E 1FY5A 3T5FH 2BY7X 5K0HA 1GBJA 1DWEH 1GI2A 1TABE 1PQ7A 2Y81A 2TRMA 2FOEA 1C5TA 3ZZBA 1IQFA 5T6FA 3KQDA 1A5HA 1NN6A 1DFPA 1T8MA 2J34A 4OS5A 4X0WU 4CREA 1TQ0B 3TITA 2PUXB 1K1OA 4K2YA 3BTTE 1AB9B 4U32A 2ZU3A 2BDHA 3PO1B 4K8BA 1DOJA 1GGDB 1KLJH 1ZHPA 4I7YH 4H4FA 1SHYA 3ATMA 2J92A 2EC9H 1PPGE 1QNJA 3TJUA 1ACBE 3RXVA 1W10U 5A8XA 1BBRK 3LH1A 2VWNA 1O34A 3SV9A 4GVUA 1JOUB 3SN8A 5I46H 3UNRA 2ZHDA 3BTQE 2B7DH 3ZYDA 1MCTA 1BTHH 1TPAE 1GJ9B 3F6UH 1AMHA 4U01A 3MH7A 1L1GA 5JYIA 5DKMA 1GHAF 3V12A 4YT7H 1O30A 3FZDA 1ELCA 3TPIZ 2FIRH 1HAYB 1BB0B 5L6NH 2BD8A 2FESH 1CE5A 3GY3A 1MKWK 3PTBA 1XM1A 3UQOA 3RXAA 1O3LA 1GI9B 3SUDA 1AZ8A 1JRTA 3LC3A 4U2WA 3ZZDA 5B6OA 4BTTB 5JBAS 7ESTE 2WINI 1TGSZ 1PYTD 2G00A 1FIWA 2F3CE 3GY4A 3RU4D 1Y3YA 1IQJA 1MQ5A 4IS5A 2Z9GA 3U9AH 2A5IA 2YNAA 3D49H 2WYJA 1OWJA 1F7ZA 1IOEA 4O03A 1QR3E 3SU0A 1DITH 3RXJA 4ABAA 4OS2A 7GCHF 3RMMH 3GYLB 3MH6A 4DIIH 3MU1A 1CBWC 1XUIA 1CT2E 1YPEH 1Z1IA 1C5VA 2XC5A 1GHBF 1Z8IB 4GHQA 4BTIB 1UTQA 5HGGA 3STJA 1O2GH 2ZHWH 2ZFSA 1ZGIA 1H8IH 1C2MA 1O3JA 2XCFA 1XXDA 4FUHA 1C1VH 1MBQA 1Y3UA 1OWHA 3BTDE 1ELVA 2BQ6B 4IBLH 4ISHH 5F6MA 1T31A 1OYTH 3ZZ6A 1PJPA 1ANEA 1UVSH 2A32A 1YPKH 4IW4E 4Y6DA 1G30B 3VB6A 4Q2KA 1GMDG 2P8OC 2ZA5A 1EPTB 1XUKA 1GDQA 1NRQH 4AFZA 2OC1A 1JRSA 2TGDA 1OWDA 2XCNA 1UVUH 1Z71A 4YZUA 3S9AA 1LDTT 1FY4A 1V2LT 2AGIX 1JIMA 1A3EH 5C5OA 1OOKB 1TYNA 1ZPZA 3N7OA 2XBXA 4AB8A 4B75A 3UR9A 3V7TA 4XSKU 2SGQE 1FN8A 2H9HA 3SUEA 3PROA 3V3MA 5JB9S 1VITH 2IN2A 1P12E 3MO3A 2FODA 1HB0B 1IQMA 1ZZZA 1NC6A 3ATLA 2G5NA 3RUOA 1AE8H 3RXOA 4ISOA 3UR6A 3ZZ3A 1T4VH 1C1PA 3B8JA 3T28A 3L6PA 3F9GA 3A8BA 3KN2A 3F1SB 4OS4A 1P2OA 4ZKOU 4D7FA 2V3HH 1EZUC 2BLQA 1HAGE 5H4IB 2ZWLH 1PPZA 1GBAA 2UWOA 4NCYA 2BQ7B 1TX8A 4MPXA 4NZLA 3SI4H 2GKVE 1N1LA 4FUIA 2FOBA 5A8YA 3KGPA 3NUMA 4MLFB 1C2KA 3GY8A 3ZZ9A 2SNVA 1O2PA 1DVAH 2AERH 2ZFTA 2HRVA 2RA0A 1V2VT 2FS8A 4ABJA 1P2IA 5DP4A 1TRMA 1V2OT 1RS0A 1LVYA 3QZRA 1BMLA 1JIRA 3MU0A 2QY0B 1C2HA 1GHWH 2BX4A 2JETB 4Y0YE 1D6WA 4DY7B 1ZJDA 2O8WA 1IQEA 2VIDA 3M5OA 4NSVA 1WV7H 1ZGVA 1W0YH 1C1SA 3DD2H 3Q00A 4TY6A 1HRTH 1GHYH 3TH3H 1SGPE 4BANB 1G37A 2ZEBA 4B1TA 1C5UA 3A85A 1PYTC 2W3KA 3RLWH 1GI3A 1K1NA 3ZVFA 1SGTA 1A5IA 1GMHF 2BDAA 1TRNA 2F9PA 4XBDA 2VH6A 2Y6TA 4AGKA 3MI4A 2D2DA 1GL0E 3ZZ8A 1ABJH 1O2JA 2ZPRA 1BBRE 2PHBA 1OWKA 2C8YB 1TX6A 3ZVBA 2FS9A 1AZZA 4I8LA 5IDKA 2PKAA 1OP0A 4AOQA 1P3CA 1C2FA 2Z9JA 1NZQH 2F9UA 3TIUA 3K2UA 1J14A 1FNIA 4NWLA 1O2QA 5A2MH 2EA3A 2BLWA 1UTMA 2FM2A 1NFUA 3E91A 4AG2A 1TBQH 4CH2B 1TNIA 2Z3EA 4MPUA 4WY3A 5C67A 4X6NA 2O8TA 1PPCE 4NWKA 3BTGE 4CHAC 1J16A 4X1RU 4HTCH 2FDAA 2ANKH 1KLIH 1L1JA 1PFXC 5FPSA 1AWFH 4YTAA 1Q2WA 4NIXA 3LGIA 3LT3A 4TPIZ 1C5WB 5HMAA 1GBTA 1YPJH 1O5GH 1GI4A 3TJVA 3UFAA 1O31A 3M36A 1HDTH 5DP9A 2F9VA 4VGCC 1XVMA 5J4SA 2ZHFH 3RMLH 1QTFA 1FONA 2ULLA 1THPB 1L1NA 4BAHB 4NA7A 1D9IA 2ALPA 3SOSA 1LHCH 2GT7A 1SFIA 1NM6A 2Y82A 1C2EA 4JYVH 1NU7B 4KGAA 3D65E 2UUKB 1SQOA 1O3BA 1LTOA 1TRYA 4ZROA 5BRRE 2Q1JA 2H5CA 1AN1E 1NRSH 2FPZA 2A4QA 1HAHH 4ZAEA 3UNSA 1DDJA 2NU3E 3ZVCA 4YT6H 3UNQA 4B2AA 1AHTH 7KMEH 3QZQA 2VIWA 1V6DA 3UWJH 1C5QA 1RD3B 3BIUH 2DE9A 2Y5HA 4F4OC 3PLBA 4X1PU 3U1JB 1Y5AT 1O3PB 1C5XB 1SGRE 1YP9A 2I6SA 3U8OH 3LU9B 1MMJN 1FDPA 2PWXA 1YC0A 4JZFH
chains in the Genus database with same CATH superfamily
4CRCA 1NROH 2PKSB 2VGCB 4D9QA 1IHSH 4Z0KA 1FJSA 1BITA 3ELAH 4Y8ZA 3MMGA 3ZZ7A 2BVRH 1K1IA 1U6QA 2G5VA 1K22H 2J95A 1HNEE 2QF0A 4B76A 3C27B 2R3YA 2P3TB 5HXFA 3VB3A 1CGHA 4X8UH 2FI3E 1S0QA 3SNAA 1AUTC 3JZ2B 3DFLA 1F5KU 1TIOA 2WPHS 1GDUA 3GY2A 2GMTC 2XWAA 4YM9A 1RJXB 3BEFB 4MNWA 3SV2H 1O5BB 2LPRA 3UQVA 1H9IE 2XRCA 1CHOG 4ABEA 1EOJA 2GCHG 2G4TA 1SG8B 2Y5GA 3CP7A 3QO6A 2VNTA 1MTVA 2RG3A 3BTHE 1F92A 2AGGX 3BSQA 2FZZA 3A89A 1BHXB 1QFKH 3N7EA 3UWIA 2XW9A 4ZXXH 1MTNB 1K1JA 4XD7D 3BTKE 5DP8A 1O2MA 3MNXA 3MNBA 1HYLA 2BY8X 1UTOA 1E37B 2BD2A 2RA3A 2UUFB 1YF4A 3GISB 4ZKNU 1GI0A 3T2NA 1DSTA 4RKJB 1K1MA 4BXWA 4F55A 3MTYA 3DT0H 2KCYA 2C90B 2SGPE 3A7VA 1H9LB 4X6PA 2JH5D 1W0KD 1MABB 1KMHB 2P93A 4X8TH 4Y7AA 2HNTF 1MU6B 1GCTC 1SL3A 2BY6X 3K6YA 1NY22 2FYQA 3RXDA 1LKAA 3R0FA 4ZXYH 4ABBA 4K60A 1TOMH 3A84A 1D4PB 1BTPA 1MQ6A 2EEKA 2GX4A 4B6FA 4J1YA 1SQTA 2OD3B 3LKWA 3LOXA 4CRDA 1CO7E 3ODFA 1AFQC 1G9IE 1V2JT 3ZV9A 1MZDA 1CQQA 1OYQA 1XKBC 1ZRKA 1XKAC 8ESTE 1AWHB 1ID5H 5F8XA 3KIDU 1H8DH 2BX3A 2SNWA 3A8AA 1EFRD 2QYIA 3EAJA 1Z1JA 4RT1A 2R2WU 2PGQB 2XBWA 5DK1A 2ZKSA 3SJOA 3UTUH 2EY4C 1C5PA 3PV4A 4ISLA 4A6LA 1FXYA 3PMJA 3BG4B 3FO8D 5DGJA 2AYWA 4A1XA 2FI4E 3OSYA 3TH2H 2CN0H 1GJBB 3MU8A 5ESTE 4FUBA 2V6NA 3ODDA 3DA9B 2DE8A 3Q77A 4FU8A 2ZGXH 3DSOA 2OC7A 1P9SA 4I8GA 2EQNA 4U30A 3GYMA 5K7RA 1YM0A 1BRCE 1QL9A 4I8KA 1FZZA 1KIGH 3EQ0H 3NXPA 1TMBH 2AEIH 2BD9A 2D1JA 2WPIS 1XVOA 5DP3A 3F9FA 1HAVA 4H42U 1ELFA 1HJ8A 2GVFA 2KR7A 3QTOH 1EOLA 4K69A 3D23A 2A5KA 1UHBB 3T62A 1CA0B 3HKIB 4BAMB 1LVMA 4AFUA 2D8WA 1DLEA 2JIZD 1NO9H 2A4RA 4AYYB 1C5NH 3BTWE 1H1BA 5DP7A 3HGNA 2J98B 5KECA 4CBNA 4WWYA 2QC2A 1F0SA 3ZV8A 1DPOA 3ZVDA 1NS3A 1GWAA 1QBNA 3DHKH 4FXGH 1EP6A 3RU4E 1FV9A 1PQ8A 1UCYH 3ITIA 2HGTH 2BD5A 1P2QA 2CHAC 1L4DA 2RDLA 3URCA 1OPHB 3ZYEA 2OQUA 1TNGA 4RSPA 2AH4X 3KNXA 4Y8XA 3S9BA 3TNTA 1RFNA 1O5CB 5T6GA 1NRRH 3HPTB 1HIAB 3PRBA 1C5ZB 1HJAB 4UE7H 3SNEA 1TONA 1J8AA 1VCWA 1AO5A 5FBEA 3S9CA 3Q3KA 1ETRH 4XE4A 2QV1A 2F83A 4Y8YA 1HXEH 1QA0A 1V3XA 3BF6H 2H6MA 3SZEA 2YMSD 1BMAA 2ZI2H 1KXBA 3PO1C 1P03A 1GGDC 2FOMB 2ZPSA 3IITA 1GMHG 2A2QH 3TVJB 4AYVB 1V2ST 3W95A 2F9OA 3O8CA 3O8DA 1LVOA 1SOZA 2QXJA 1S5SA 2QF5A 3ENSB 1S6FA 5FCRA 1Y5UT 3LGTA 2R3UA 5DG6A 3QTVH 5LPEA 2KFWA 4MPVA 2BD3A 1SGFG 4I33A 2FTLE 1J9CH 2QE7D 2XTTB 4INKA 3AAUA 3WW7A 5EIYA 2HALA 3KQBA 4X8VH 4ZKSU 4RKOB 4UFEH 1S0RA 1FPCH 1O3GA 2VU8E 2ZU2A 1O37A 3VB4A 1EQ9A 1KXCA 2A5AA 5GPIB 5EGMA 1VITG 1XUHA 5AFZH 3ZVEA 1EJMA 1ZHMA 6ESTA 2ZU1A 3P8NA 2ZDAH 5HIZA 3HKJB 3TNSA 1EJNA 4JYTA 1ETSH 1VZQH 1VJ9U 1MTUA 1CHOF 4ASUD 3RXSA 2STAE 4CRGA 2GCHF 1TA6A 2Z3CA 2AMQA 2GZ8A 5AFYH 5EODA 5C2ZA 1C1RA 1GI1A 1NRPH 1BMMH 2J9NA 2TGPZ 1GJ8B 4R8TB 1GI6A 1G32B 4AORA 1YLDA 3FP7E 1IAUA 3OTJE 4F49A 1E34B 5EQSA 2CF8H 5EXNA 1MAXA 1DUEA 3NWUA 2WHXA 4XDEA 1C2GA 2PSXA 2ZDVH 1P0SH 1O2YA 1UTJA 5FX6A 1OS8A 4XBBA 1TNJA 3GOVB 4KELA 5EW1H 1LMWB 3AVZA 4E7NA 1EAXA 3QUMP 5T6DA 1T4UH 3M3SA 3PB1E 2FX4A 3AASA 5EQQA 1QQUA 1G3DA 1V2QT 2A7HA 4E05H 4IC6A 1UVPA 3A7ZA 1V2TT 5EPNA 3MYWA 7LPRA 4AN7A 5F8TA 1XXFA 2ASUB 2W7UA 3FVFB 4UD9H 2SGDE 5DP5A 1GPZA 3TJOA 4JZDH 2GGVB 2THFB 1KDQB 3WY8A 1BHXF 2Z94A 5LGOA 4AX9H 2ANWA 1C2LA 2J94A 2VIPA 1O5FH 1QB6A 3KYGA 3SV6A 1MBMA 1T8OA 4LK4A 1EPTC 1UTNA 1SVPA 1PPFE 5EOKA 2AFQB 3RXEA 4BAOB 1YBWA 3ZZAA 9ESTA 4R0IA 2ODQA 3SGBE 2FLBH 1DY9A 2HWLB 4B2BA 1EPTA 3GDVA 5EXLA 2RFKC 1O2NA 3F9HA 5F8ZA 3GY6A 1SB1H 4J2YB 1LPZB 2Q6FA 1T8LA 3GCHB 4NZQA 4YO9A 1ZMJA 4YOGA 1W0ZU 2HNTC 2XC4A 1YCPH 1GI5A 1BRUP 1ELBA 2HLCA 2Z3DA 1ELDE 5FAHA 1KY9A 1AIXH 2A2XH 1QB9A 3SHAH 1ZRBA 4NFEA 3SNBA 5DP6A 1KLTA 5CHAC 3SW2B 1LHEH 1GBHA 1GI7B 2ZCKP 1BMNH 2BMGB 2PV9B 1CA8B 3LJJA 2IPHA 1A3BH 3O8RA 1IQGA 2PTCE 2ILNA 1GBCA 2VIQA 3SNCA 3H5CB 3E1XB 2WV5A 1LHDH 4IN2A 1D3QB 2DUCA 4X8SH 2Z9IA 1GJ7B 2OXSA 2YMSB 2BYAX 1EJAA 3QLPH 2KX4A 1QRZA 1RGQA 1UK4A 2WPLS 1LHGH 2ZO3H 3E16B 1UMAH 4FETA 2QN5T 1BRAA 4WF8A 1TAWA 1TA2A 2C8ZB 2ANMH 2ZDLA 1INCA 5L2YH 1ELEE 2O8MA 2NU4E 5L30H 1W11U 4A1VA 4ABIA 4FUGA 3KL6A 5JBCS 2OTVA 3H7OA 2ZC9H 3HATH 3SHCH 4GHTA 2BD4A 1GBMA 3UPEA 2D26C 1O3AA 4H6SB 3TJNA 1D3PB 1VGCB 2LP6A 2STBE 3A86A 1HAPH 4I32A 4NSYA 2JETC 1UTPA 5FPYA 2XOKD 3BTME 2ZGCA 2FOFA 3AW1A 2XWBI 4DURA 1MKXH 3IG6B 2KM0A 1SLXB 1GG6B 6CHAB 3DFJA 1T7CA 4CRBA 1QY6A 2V3MA 1ZHRA 1EATA 4CRFA 3LGWA 2LELA 1S84A 2BQWB 3O8BA 4ZKRU 1G3CA 1A0JA 1KSNA 4MTBA 3RXIA 4TY7A 4WH8A 2NU0E 1KXAA 1TB6H 1G2MA 1QRXA 2BD7A 2AMPA 2BZ6H 1QL7A 2AMDA 4GPGA 1TPOA 3WWFA 1WSSH 1O3EA 2VJ1A 1BQYA 3N7DA 2EI7A 1EX3A 1K21H 4A92A 4ESTE 5DO4H 1QBOA 4B73A 1BJVA 1SGQE 1VITF 3A7YA 2QF3A 1RRKA 5HM2A 3ZZ5A 2B9LA 3SYJA 1TGBA 3F0PA 4Q7ZA 4KP0A 4X2WA 3SUGA 2PFEA 5GJ4B 5C1YA 1CGJE 3MH5A 1NRNH 1GVLA 2F9BH 1SGCA 1FLEE 5IYTA 4LZ4B 1TMTH 3RMNH 4K5ZA 5E0HA 5GCHF 3VFEA 1XUJA 4GCHG 1O3KA 2XYAA 2XXLA 3E8LA 4Y0ZE 2A1DB 1O3NA 3PRDA 2ZDMA 1Y3WA 5EG4A 1NBMD 2FX6A 4CHAB 3MWIU 4ABFA 1LKBA 2ZP0H 4XBCA 2VVCA 5FX5A 4MNYA 2KCPA 3M3TA 3QWCH 1H8ED 2HOBA 1CT4E 1BCUH 1O2VA 1KXEA 2VB0A 2EI8A 2YOLA 3U69H 3VB5A 4DW2U 4ZMAH 2ALVA 1BZXE 1QCPA 4IMZA 4ISNA 3FP8E 1HPGA 3DUXH 2F91A 3E0PB 3EA7A 1OHHD 2ZPQA 4OM9A 2M5TA 3ATKA 1EKBB 1RTFB 4IMQA 3VGCB 1YLCA 1V2NT 1S6HA 3E6PH 1O2LA 2C4FH 4ABHA 4GSOA 3A7WA 1VKYA 1S6LA 1YYY1 3P8OA 1LVBA 2GCTB 2H9EH 5C0UA 3SJ8A 1OWEA 4CBOA 1OKXA 2FMJA 2ZDNA 1OSSA 1Z8RA 2PW8H 1A4WH 2FOGA 2PKSC 1KTSB 2VGCC 2A31A 3M7QA 3MO6A 1ANDA 1TPSA 3TGJE 1KXDA 1DSUA 3LPRA 1ZJKA 4B71A 2JJ2D 1BTZA 3B9FH 1DM4B 2UUYA 1IQHA 3MHWU 3ATIA 4WXVA 4BOHA 1ZPBA 4KTSA 2Z6BD 1Q3XA 3P6ZB 5DPAA 2PUQH 1O2TA 1TGNA 3SQHE 1AKSB 4IGDA 1SGDE 1VCPA 2ZIQH 3SI3H 4GUXA 3ZVGA 1H9HE 1KXFA 4INHA 1ZPCA 4UFFH 2GV6A 2G4UA 1MAYA 2GT8A 3KF2A 3PMAB 3SU1A 5C1XA 1MTWA 4M7GA 2ZF0H 2ZFPH 3SU4A 3EA8A 1AFEH 2R2MB 1NU9A 1LQEA 2JH6D 5FBIA 2BXUH 2KCAA 1HLTH 5CE1A 1EB1H 1YKTA 3PTNA 4FUCA 4YOJA 1SQAA 1JMOH 3NKKA 2O9QA 1RIWB 4TSFD 3UREA 2L6OA 2PSYA 3DCLA 3F68H 4FUFA 3A87A 4X2YA 3L3TA 1MTNC 2VBCA 2AGEX 4UEHH 1ZTKA 2B0FA 1WU1A 4HI3A 4AGJA 2BDIA 1DWCH 1EAWA 5E2OA 1LHFH 3RMOH 1GMCG 3W94A 3BIVH 3OE7D 1HJ9A 1PPHE 1LO6A 1LQDB 2IJOB 3OX7U 1GL1A 3AAVA 4Y10E 2A4OA 1UCYK 1E35B 2OBQA 1V2RT 4F48B 3IWMA 1C2JA 3I77A 3S69A 5J4QA 1K28D 3SU3A 5KGOA 2HNTE 2W5EA 5EJLA 1IQIA 3LDXH 4JZEH 2B5TB 4ABDA 5A0AE 1ARBA 4OGXA 3KQEA 1C2DA 1V2PT 4O9VA 1C5RA 1EXFA 2ODYB 1P2NA 3RC6A 5JBTA 1C1OA 2FWWA 3I29A 1HAZB 2EI6A 1LPKB 1GCTB 1B0EA 3QX5H 2FXRA 1S85A 3BG4C 3SBKA 2GD4B 2TGAA 5ESBA 1P11E 2ZCHP 2HLDD 2KAIB 3MOCA 4RT0A 1ANBA 2C8WB 3F9EA 4YLUA 2J2UA 4JZ1A 4H6TA 2J4IA 1J17T 3MH4A 3OU0A 4AB9A 5EQRA 1KYNA 1DXWA 1BTUA 4O3UA 4MPWA 1ZSJA 1F2SE 3OEED 4ISIH 3KEEA 3V0XA 5T3HA 1TNLA 1DS2E 3PYHA 3SV7A 1D3DB 3RXQA 2HPQH 3KCGH 1GBBA 2Z7FE 1GBFA 2WPJS 2OBOA 3F3BA 4X1SU 2CV3A 1WQSA 3LJOA 5LH8A 1QZ8A 2BZAA 2SGAA 3P8GA 1CA0C 2CGAA 1QHRB 2CF9H 2FI5E 1UHBA 1Z6JH 3K9XB 3E90B 1TGCA 1ZOMA 3FAOA 1W0JD 1WCZA 1C5MD 3NK8A 6GCHG 4INLA 1C4U2 4BNRA 4FVDA 2ZGJA 3QDZB 1MZAA 1HUTH 1RTKA 3GDSA 4Q7XA 2XC0A 3A7TA 4KTCA 1C5YB 3OY5U 1IHTH 1P01A 5JB8S 2H1UA 2ZTYA 4GCHF 1QJ1B 2BVSH 2J98A 4WMDA 1C5LH 2P16A 2FYRA 4IC5A 3S0NA 1Y5BT 2FTMA 3RXGA 1BUIA 2LNCA 4X6MA 1YPMH 1MD8A 1YPHE 1EAIA 4K1TA 2UWLA 2WZQA 2GTBA 4GAWA 4SGBE 1ELGA 1TQ7B 1AI8H 3NZIA 1IQKA 2B8OH 4B74A 4MQAA 1HGTH 2JH0D 1NTPA 1X7AC 1Z6EA 2QF4A 1S82A 2GDEH 3E3TA 3HK3B 4JK5A 1SGFA 1P05A 3PV2A 3ZZ4A 1DWBH 2P95A 1UTLM 2A45B 1BTYA 2BLOA 2K8IA 3M3VA 4ZUHA 2C8XB 1LPGB 1HJAC 3EE0B 4XRNA 3P92A 4XOJA 1N8OB 1ESTA 4DJZB 1A46H 5FPTA 1HIAA 8KME2 2BB4A 1V2MT 1DUAA 2FO9A 1B7XB 1THRH 4JK6A 1NFXA 2H9TH 2TPIZ 3A82A 4Q63A 4Y76A 2V3OH 5L2ZH 1AB9C 2BDBA 5I25A 1KTTB 3RXHA 3SJ9A 1BRBE 1E79D 4AG1A 4TWWA 1GJCB 3KQCA 5EPYA 3P95A 4FUJA 1AE5A 2F43B 1AY6H 1BA8B 1ZYOA 2VINA 1GJ6A 1O2SA 4Y7BA 1QA7A 1EB2A 1UJ1A 2SGFE 2F9NA 2WPKS 5BPEA 1P9UA 2Y7XA 1CVWH 3FN8A 1BOQA 2SFAA 3WWBA 5CMXH 5ETXA 2ZG0H 2ZCLP 3NPSA 1BDAA 1C1QA 4YXWD 2P3UB 1A2CH 3M35A 5EW2H 1C5SA 1Z8JB 4I31A 1F5RA 1YCPK 1GCDA 2Q6GA 2ZQ1A 3OEHD 1MCVA 1WUNH 3L33A 5TCCA 2AIPA 3SU2A 4AC9A 1O2WA 1P09A 3Q3YA 2CJIA 1HAIH 3U1IB 2NU1E 1L0ZA 3EGKH 3ZIAD 2CXVA 4Y71A 3B23B 5GCHG 2VH0A 2L74A 2OLGA 2VIOA 1ZTJA 1ESAA 3LGVA 5FHTA 5AHGH 5F53A 3VPKA 3VG8A 1HCGA 4WXIA 1CT0E 1A61H 3LGUA 1Z8GA 1GJ4H 2PTNA 1A5GH 1J15A 1C4V2 1SOTA 4BAQB 1K9OE 1C1TA 1O0DH 1FX0B 4JMYA 3UIRA 4X2XA 4DT4A 5E2PA 1ZMNA 1M9UA 1EZXC 4FOUC 3FKSD 5DSFA 2J38A 4PROA 1QURH 1GMCF 3BV9B 3FANA 3T25A 1TFXA 3P17H 4THNH 1GBDA 3FZZA 1P8VC 1SGIB 2ZU4A 1GVKB 1UCYE 3QK1A 2BY9X 2BHGA 3M37A 1QJ6B 3HGPA 1QL8A 1ZLRA 2NWNA 2QXGA 1SKYE 3MNSA 1EP5A 2SGEE 1O32A 4HFPB 2ANYA 3A8DA 3GICB 3M5NA 3R3GB 1ESBA 3TK6A 3E0NB 2A7JA 1ZSKA 5JBBS 1CBWB 1O3DA 1N6YA 2K1QA 2ZHEH 3TGIE 3F2GA 3GCNA 4WJG2 1Z7KA 3OAAD 1KDQA 1MKXK 2G52A 2O8UA 3RM0H 5JDUB 3SU6A 4K8YA 2OP9A 3Q76A 1AVWA 1W12U 2R0KA 1SI5H 1WAYB 5JPMH 1SSXA 1GBKA 1GDNA 1LCYA 4CR5A 3G01A 1CHGA 1TWXB 3A83A 5AVDA 2AS9A 1A0HB 3PV5A 4K1SA 3T29A 8GCHG 3GCHC 1XUFA 1EUFA 2G81E 2G8TA 4A5TS 5DN6D 1BTWA 1BBRH 5GDSH 1GHXH 1XX9A 1MUEB 4AFQA 1O2RA 4NFFA 1QQ4A 3RXPA 1WDIA 4OS1A 1OWIA 2R0LA 2P8OB 3UOPA 2J5UA 3M7UA 2WYGA 5B6LA 3SJIA 1PQAA 2OCVB 2V7QD 1Q31A 1Y3XA 2A0QB 1QGFA 1GBLA 5AF9H 1C9PA 1P04A 5C5NA 1O2IA 3RXTA 1TLDA 6GCHF 1DLKB 1MKWH 2YMSC 5TCAA 5C1UA 1SHHB 1B5GH 1O2OA 4HGCA 5FCKA 1DT2A 1GHZA 4I8JA 4P00A 4DOQA 5CHAB 2TIOA 3K65B 2QGRA 3BG8A 5A0BA 3SORA 1BJUA 5C0TA 1W14U 1XUGA 1O5AB 3M5MA 1SQRA 1AD8H 1AGJA 1L4ZA 1G3EA 2J97A 1T32A 1DICA 5E0GA 3GY7A 1SGYE 2G51A 1NBME 1BIOA 2OQ5A 3JZ1B 3I78A 1TNHA 4FVBA 4UFDH 1VGCC 1O36A 3DSPA 4TYDA 4K1EA 3H7TA 2FOHA 2BLVA 4MG3A 5SGAE 2FOAA 3EA9A 1O39A 5A09A 3OY6U 4YESB 3RXLA 1AUJA 1SPJA 1C2IA 1CU1A 1ZTLA 3CS0A 4FUEA 3PMBB 5F03A 4E06H 2VVUA 2VWLA 4YOIA 2ZHQH 5C3NA 3A80A 1AU8A 3ESTA 1GG6C 6CHAC 2P3FH 2QXHA 1VJAU 1ELTA 2C3SA 2QIQA 3HK6B 4ASHA 3SGAE 1E36B 2QCYA 1AQ7A 2TBSA 1HAOH 1YPHC 4AFSA 1G3BA 2ODPA 1UK3A 4MNXA 2GDDA 2ZTXA 4BAKB 3MU4A 1RTLA 2VWOA 1FIZA 1GI8B 1JWTA 1UTKA 2C93B 1SLVB 1GVZA 2BOKA 3EYDA 2ZECA 5LPFA 1MTSA 3BN9A 1O3MA 1C1NA 1BMFD 1CSOE 2WPDD 1VCQA 4LZ1H 1OP8A 2PGBB 1E38B 2Q6DA 1H4WA 2WUBA 3PLPA 4B6EA 1UVOA 4YLQH 1D3TB 2V35A 2IOTA 3KHVA 1QIXB 2M2AA 1P2JA 1RXPA 2ZDKA 4O3TA 3V13A 1FUJA 1T8NA 1NT1A 1O3IA 2ZFFH 4X1QU 4ABGA 4NA8A 2ZNKH 3RDZA 2ZU5A 3FP6E 4DG4A 3RXMA 1S81A 1C9TA 4RI0A 1GBEA 3GCTG 1UO6A 5GXPA 4D8NA 2PKAB 4D9RA 4NG9H 2GP9B 2OC0A 2BDCA 3SZNA 1SLWB 3SV8A 1W7XH 3PLKA 4WMEA 5DJ7A 1DXPA 2ZFRH 3VEQB 2V0BA 2BM2A 2QXIA 1O3CA 3K6ZA 2Y7ZA 2H2ZA 1P57B 3BEIB 4NIWA 3LIWA 3VXEH 1F5LA 1DANH 2W26A 1O5DH 3RC5A 1SR5C 1P02A 3MFJA 1O3OA 2XBVA 2ZGHA 1UVTH 3T26A 1O2KA 2GZ7A 2XNDD 4ZHLU 2PR3A 3UB0A 4Y11E 1EZQA 2VWMA 3SNDA 4P02A 3RU4T 1FMGA 3F2FA 4JZIA 1O2XA 4XFQA 1DE7H 4NA9H 1FI8A 4CRAA 2Y5FA 5C20A 4WH6A 4CR9A 2BTCE 1ZMLA 1TALA 3PMHB 4X2VA 3VGCC 1IQLA 4UFGH 3SJKA 1MU8B 1EASA 1HFDA 1FY3A 4VGCB 1G36A 1NPMA 1TE0A 1UW7A 1V2UT 2PLXA 3QN7A 1G2LA 1WOFA 4Y79A 3SGQE 3UOUA 4D7GA 4FUDA 2YNBA 1Y3VA 5E0JA 4MDSA 2A7CA 2GCTC 1O5EH 1FQ3A 1WBGB 2Z9LA 1P2MA 1XMNB 3DSGA 3FOAA 2BY5X 3M5LA 2OINA 1GJ5H 2ZZUH 1ETTH 5A0CA 2W3IA 2AIQA 3U8TH 5GWZA 1HAXB 2TGTA 3RP2A 4X1NU 1QB1A 3Q3XA 3M61U 1O2UA 4DCDA 1SC8U 4BXSA 1BTXA 3VXFH 3RXUA 1FAKH 1WTHD 2A4GA 4BTUB 2FP7B 2HPPH 1QRWA 2I6QA 3SQEE 5G4BA 2HVXA 1ZR0A 2XBYA 1NFYA 3KYFA 2XNIA 1O38A 6LPRA 3MNCA 3EDXB 8GCHF 2P94A 3A88A 3MO9A 1YPLH 5FL7D 2BXTH 3GY5A 3ZVAA 4TWYA 3RXRA 1AKSA 3EE7A 4TPYA 1PQ5A 4UDWH 1EZSC 1GMDF 1O35A 1F0RA 4DT7B 1TOCB 1V2WT 2O8LA 1B0FA 2ESTE 3T27A 5LPRA 1TX7A 1A0LA 1E0FD 2BVXH 3CENA 4AZ2B 1HBTH 1L2EA 1W3CA 1O2ZA 3A8CA 3URDA 1GBIA 1Y59T 1P06A 1Y8TA 1A1RA 1O2HA 4A1TA 3CS7A 3QGNB 1DWDH 5FXLA 1FN6A 1GHAG 3LC5A 1RIWC 5IK2D 1QJ7B 2GV7A 1SGNE 2GMTB 2RCEA 4LOYH 1SGEE 5E8EH 1ZSLA 3MU5A 4E7RG 5HYOA 5PTPA 3UUZA 3D62A 4Q7YA 3S7KB 2G55A 1TBRH 4RN6A 2ZFQH 3SO3A 4NIYA 4ZHAA 4ZH8A 3A81A 1SLUB 2W6ID 3SUFA 3RLYH 2P59A 1C5OH 2FOCA 3ATWA 2BDGA 3P8FA 3RXFA 3M7TA 4WVPE 2BOHB 4K3JA 1NFWA 3RXKA 1BT7A 2VVVA 2OC8A 1V2KT 2VIVA 1TGTA 7GCHG 1SMFE 2JKHA 3PWBA 4O97A 1AVXA 3GDUA 1WQVH 1DY8A 3STIA 3S7HB 1GHBG 1ABIH 4ACBA 1JBUH 1PPEE 3GCOA 1F0TA 1YPGH 3RM2H 1A7SA 1MH0A 2UUJB 1N6XA 3OYPA 1GHVH 5KEDA 1O3FA 2WPMS 2WV4A 4DIHH 5TJXA 3A7XA 1O33A 2KAIA 2RDEA 4X6OA 3BTFE 1AFQB 2QA9E 4UONA 4SGAE 1TNKA 4DVAU 2ZTZA 1WYKA 3TK5A 1ARCA 1NESE 4FU9A 3TGKE 3C1KA 1W2KH 2FLRH 1ANCA 3PWCA 3QGJA 1TPPA 1PPBH 3BTEE 2W7SA 1GJAB 2CMYA 3BEUA 4OS7A 5ABWA 3FFGA 5EU8A 1JXPA 1E1QD 1OP2A 1W13U 1YY3A 3F0OA 5EJ1A 3TH4H 3GCTF 1ORFA 1SFQB 3NCLA 2WUCA 5HM9A 1F0UA 1OX1A 3TK9A 4NIVA 2BDYA 1HAVB 1FY1A 1MD7A 2OUAA 4JCNA 3TU7H 1W7GH 2KZ4A 4OS6A 1TMUH 4OGYA 1P3EA 4WMFA 1OXGA 3PM3A 4ACAA 3MQKC 1UK2A 4A7IB 1HXFH 1O3HA 8LPRA 5EXMA 1D6RA 2ZQ2A 3RXBA 1VR1H 3U28C 4I8HA 1IQNA 2H5DA 1K1LA 3UY9A 1HV7A 2ZGBH 1S83A 2FEQH 1CGIE 1P10A 3W1EA 2GZ9A 1K2I1 4QT8C 1W8BH 1DX5M 4MVNA 3U8RH 3RC4A 1GJDB 1AVGH 3LGYA 1WTGH 1C1UH 1SBWA 4GLYA 4NGAH 4D76A 4CH8B 1K1PA 4Z6AH 1N8OC 3VB7A 3SU5A 3ZZCA 4B2CA 3AW0A 4Q80A 4ZHMU 2UWPA 2QAAA 1THSH 1EAUA 2R9PA 4JYUH 5A8ZA 1YGCH 4LXBH 4MNVA 2Z9KA 5GIBA 1C1WH 3TLOA 2CHAB 1C1MA 3P70B 1FPHH 2Y80A 4KTUA 1FAXA 3LONA 3LH3A 1P2KA 4HZHA 4IN1A 1YCPM 3RXCA 9LPRA 1TBZH 2NU2E 3U98H 1ELAA 1QBVH 4KKDA 1C4Y2 4FU7A 4DGJA 1FY8E 1FY5A 3T5FH 2BY7X 1WXRA 5K0HA 1GBJA 1DWEH 1GI2A 1TABE 1PQ7A 2Y81A 2TRMA 2FOEA 1C5TA 3CNRA 3ZZBA 1IQFA 5T6FA 2W6JD 3KQDA 1A5HA 1NN6A 1DFPA 1T8MA 2J34A 4OS5A 4X0WU 4CREA 5C94A 1TQ0B 2WV9A 3TITA 2PUXB 1K1OA 4K2YA 3BTTE 1AB9B 4U32A 2ZU3A 2BDHA 3PO1B 4K8BA 1DOJA 1GGDB 1KLJH 1ZHPA 4I7YH 4H4FA 1SHYA 3ATMA 2J92A 2EC9H 1PPGE 1QNJA 3TJUA 1ACBE 3RXVA 1W10U 5A8XA 1BBRK 3LH1A 2VWNA 1O34A 3SV9A 4GVUA 1JOUB 3SN8A 5I46H 3UNRA 2KCOA 2ZHDA 3BTQE 2B7DH 3ZYDA 1MCTA 1YLNA 1BTHH 1TPAE 1GJ9B 3H09A 3F6UH 1AMHA 4U01A 3MH7A 2OK5A 1L1GA 5JYIA 5DKMA 1GHAF 3V12A 4YT7H 1O30A 3FZDA 1ELCA 2PP6A 4M9FA 3TPIZ 2FIRH 1HAYB 1BB0B 5L6NH 2BD8A 2FESH 1CE5A 3GY3A 1MKWK 3PTBA 1XM1A 3UQOA 4Z1MD 3RXAA 1O3LA 1GI9B 3SUDA 1AZ8A 1JRTA 3LC3A 4U2WA 3ZZDA 5B6OA 4BTTB 5JBAS 7ESTE 2WINI 1TGSZ 1PYTD 2G00A 1FIWA 2F3CE 3GY4A 3RU4D 1Y3YA 1IQJA 1MQ5A 4IS5A 2Z9GA 3U9AH 2A5IA 2YNAA 3D49H 2WYJA 1OWJA 1F7ZA 1IOEA 4O03A 1QR3E 3SU0A 1DITH 2JDID 3RXJA 4ABAA 4OS2A 7GCHF 3F2HA 3GYLB 3MH6A 3RMMH 4DIIH 2HVYB 3MU1A 1CBWC 1XUIA 1CT2E 1YPEH 5HKKD 1Z1IA 1C5VA 2XC5A 1GHBF 1Z8IB 4GHQA 4BTIB 1UTQA 5HGGA 3STJA 1O2GH 2ZHWH 1E1RD 2ZFSA 1ZGIA 1H8IH 1C2MA 1O3JA 2XCFA 1XXDA 2GJGA 4FUHA 1C1VH 1MBQA 1Y3UA 1OWHA 3BTDE 1YWUA 1ELVA 2BQ6B 4IBLH 4ISHH 5F6MA 1T31A 1OYTH 3ZZ6A 1PJPA 1ANEA 1UVSH 2A32A 1YPKH 4IW4E 4Y6DA 1G30B 3VB6A 4Q2KA 4TT3D 1GMDG 2P8OC 2ZA5A 3OTPA 1EPTB 1XUKA 1GDQA 1NRQH 4AFZA 5HIYA 2OC1A 1JRSA 2TGDA 1OWDA 2XCNA 1UVUH 2IJD1 1Z71A 4YZUA 3S9AA 1LDTT 1FY4A 1V2LT 2AGIX 1JIMA 1A3EH 5C5OA 1OOKB 1TYNA 1ZPZA 3N7OA 2XBXA 4AB8A 4B75A 3UR9A 3V7TA 4XSKU 2SGQE 1FN8A 2H9HA 3SUEA 3NRLA 3PROA 3V3MA 5JB9S 3UAIC 1VITH 2IN2A 1P12E 3MO3A 2FODA 1HB0B 1IQMA 1ZZZA 1NC6A 3ATLA 2G5NA 3RUOA 1AE8H 3RXOA 4ISOA 3UR6A 3ZZ3A 5GNDA 1T4VH 1C1PA 3B8JA 3T28A 3L6PA 3F9GA 3A8BA 3KN2A 2AHME 3F1SB 4OS4A 4Q4LA 1P2OA 4ZKOU 4D7FA 2V3HH 1EZUC 2BLQA 1HAGE 5H4IB 2ZWLH 1PPZA 1GBAA 2UWOA 4NCYA 2BQ7B 1TX8A 4MPXA 4NZLA 3SI4H 2GKVE 1N1LA 4FUIA 2FOBA 5A8YA 3KGPA 3NUMA 4MLFB 1C2KA 3GY8A 4ZCNA 3ZZ9A 2SNVA 1H8HD 1O2PA 1DVAH 2AERH 2ZFTA 2HRVA 2RA0A 1V2VT 2FS8A 4ABJA 1P2IA 5DP4A 1TRMA 1V2OT 1RS0A 1LVYA 3QZRA 1BMLA 1JIRA 3MU0A 2K0QA 2QY0B 5CDFE 1C2HA 1GHWH 2BX4A 2JETB 4Y0YE 1D6WA 4DY7B 1ZJDA 1IQEA 2O8WA 2VIDA 3M5OA 4NSVA 1WV7H 1ZGVA 1W0YH 1C1SA 3DD2H 3Q00A 4TY6A 1HRTH 1GHYH 3AK5A 3TH3H 1SGPE 4BANB 1G37A 2ZEBA 4B1TA 1C5UA 3A85A 5T1VA 1PYTC 2W3KA 3RLWH 1GI3A 1K1NA 3ZVFA 1SGTA 1A5IA 1GMHF 2BDAA 1TRNA 2F9PA 4XBDA 2VH6A 2Y6TA 4AGKA 3MI4A 2D2DA 1GL0E 1COWD 3ZZ8A 1ABJH 1O2JA 2ZPRA 1BBRE 2PHBA 1OWKA 2C8YB 1TX6A 3ZVBA 2FS9A 3N99A 1AZZA 4I8LA 5IDKA 2PKAA 1OP0A 4AOQA 1P3CA 1C2FA 2Z9JA 1NZQH 2F9UA 3TIUA 3K2UA 1J14A 1FNIA 4NWLA 1O2QA 5A2MH 2EA3A 2BLWA 1UTMA 2FM2A 1NFUA 3E91A 4AG2A 1TBQH 4CH2B 1TNIA 2Z3EA 4MPUA 4WY3A 5C67A 4X6NA 2O8TA 5EJZA 2WSSD 1PPCE 4NWKA 3BTGE 4CHAC 1J16A 3KQ5A 4X1RU 4HTCH 2FDAA 2ANKH 1KLIH 1L1JA 1PFXC 5FPSA 1AWFH 2IPQX 4YTAA 1Q2WA 4NIXA 3LGIA 3LT3A 4TPIZ 1C5WB 5HMAA 1GBTA 1YPJH 1O5GH 1GI4A 3GS9A 3TJVA 3UFAA 1O31A 3M36A 1HDTH 5DP9A 2CK3D 2F9VA 4VGCC 1XVMA 5J4SA 2ZHFH 3RMLH 1QTFA 1K0HA 1FONA 2ULLA 1THPB 1L1NA 2F4LA 4BAHB 4NA7A 1D9IA 2ALPA 3SOSA 1LHCH 2GT7A 1SFIA 1NM6A 2Y82A 5C17A 1C2EA 4JYVH 1NU7B 4KGAA 3D65E 2UUKB 4I86A 1SQOA 1O3BA 1LTOA 1TRYA 4ZROA 5BRRE 2Q1JA 2H5CA 1AN1E 1NRSH 2FPZA 2A4QA 1HAHH 4ZAEA 3UNSA 4HG6A 1DDJA 2NU3E 3ZVCA 4YT6H 3UNQA 4B2AA 1AHTH 7KMEH 3QZQA 2VIWA 1V6DA 3UWJH 1C5QA 1RD3B 3BIUH 2DE9A 5CHBA 2Y5HA 4F4OC 3PLBA 4X1PU 3U1JB 1Y5AT 1O3PB 1C5XB 1SGRE 1YP9A 2I6SA 3OFND 3U8OH 3LU9B 1MMJN 2JJ1D 1FDPA 2PWXA 1YC0A 4JZFH
chains in the Genus database with same CATH topology
4CRCA 1NROH 2PKSB 2VGCB 4D9QA 1IHSH 4Z0KA 1FJSA 1BITA 3ELAH 4Y8ZA 3MMGA 3ZZ7A 2BVRH 1K1IA 1U6QA 2G5VA 1K22H 2J95A 1HNEE 2QF0A 4B76A 3C27B 2R3YA 2P3TB 5HXFA 3VB3A 1CGHA 4X8UH 2FI3E 1S0QA 3SNAA 1AUTC 3JZ2B 3DFLA 1F5KU 1TIOA 2WPHS 1GDUA 3GY2A 2GMTC 2XWAA 4YM9A 1RJXB 3BEFB 4MNWA 3SV2H 1O5BB 2LPRA 3UQVA 1H9IE 2XRCA 1CHOG 4ABEA 1EOJA 2GCHG 2G4TA 1SG8B 2Y5GA 3CP7A 3QO6A 2VNTA 1MTVA 2RG3A 3BTHE 1F92A 2AGGX 3BSQA 2FZZA 3A89A 1BHXB 1QFKH 3UWIA 2XW9A 4ZXXH 1MTNB 1K1JA 3BTKE 5DP8A 1O2MA 3MNXA 3MNBA 1HYLA 2BY8X 1UTOA 1E37B 2BD2A 2RA3A 2UUFB 1YF4A 3GISB 4ZKNU 1GI0A 3T2NA 1DSTA 4RKJB 1K1MA 4BXWA 3MTYA 3DT0H 2C90B 2SGPE 3A7VA 1H9LB 4X6PA 2JH5D 2P93A 4X8TH 4Y7AA 2HNTF 1MU6B 1GCTC 1SL3A 2BY6X 3K6YA 1NY22 2FYQA 3RXDA 1LKAA 3R0FA 4ZXYH 4ABBA 4K60A 1TOMH 3A84A 1D4PB 1BTPA 1MQ6A 2EEKA 2GX4A 4J1YA 1SQTA 2OD3B 3LKWA 3LOXA 4CRDA 1CO7E 3ODFA 1AFQC 1G9IE 1V2JT 3ZV9A 1MZDA 1CQQA 1OYQA 1XKBC 1ZRKA 1XKAC 8ESTE 1AWHB 1ID5H 5F8XA 3KIDU 1H8DH 2BX3A 2SNWA 3A8AA 3EAJA 2QYIA 1Z1JA 2R2WU 2PGQB 2XBWA 5DK1A 2ZKSA 3SJOA 3UTUH 1C5PA 3PV4A 4ISLA 4A6LA 1FXYA 3PMJA 3BG4B 5DGJA 2AYWA 4A1XA 2FI4E 3OSYA 3TH2H 2CN0H 1GJBB 3MU8A 5ESTE 4FUBA 2V6NA 3ODDA 3DA9B 2DE8A 3Q77A 4FU8A 2ZGXH 2OC7A 1P9SA 4I8GA 4U30A 3GYMA 5K7RA 1YM0A 1BRCE 1QL9A 4I8KA 1FZZA 1KIGH 3EQ0H 3NXPA 1TMBH 2AEIH 2BD9A 2D1JA 2WPIS 1XVOA 5DP3A 3F9FA 1HAVA 4H42U 1ELFA 1HJ8A 2GVFA 3QTOH 1EOLA 4K69A 3D23A 2A5KA 1UHBB 3T62A 1CA0B 3HKIB 4BAMB 1LVMA 4AFUA 2D8WA 1DLEA 1NO9H 2A4RA 4AYYB 1C5NH 3BTWE 1H1BA 5DP7A 3HGNA 4CBNA 4WWYA 2QC2A 1F0SA 3ZV8A 1DPOA 3ZVDA 1NS3A 1GWAA 1QBNA 3DHKH 4FXGH 1EP6A 3RU4E 1FV9A 1PQ8A 1UCYH 3ITIA 2HGTH 2BD5A 1P2QA 2CHAC 1L4DA 2RDLA 3URCA 1OPHB 3ZYEA 2OQUA 1TNGA 4RSPA 2AH4X 3KNXA 4Y8XA 3S9BA 3TNTA 1RFNA 1O5CB 5T6GA 1NRRH 3HPTB 1HIAB 1C5ZB 1HJAB 4UE7H 3SNEA 1TONA 1J8AA 1VCWA 1AO5A 5FBEA 3S9CA 3Q3KA 1ETRH 4XE4A 2QV1A 2F83A 4Y8YA 1HXEH 1QA0A 1V3XA 3BF6H 2H6MA 1BMAA 2ZI2H 1KXBA 3PO1C 1P03A 1GGDC 2FOMB 2ZPSA 3IITA 1GMHG 2A2QH 3TVJB 4AYVB 1V2ST 3W95A 2F9OA 3O8CA 3O8DA 1LVOA 1SOZA 2QXJA 1S5SA 3ENSB 1S6FA 5FCRA 1Y5UT 3LGTA 2R3UA 5DG6A 3QTVH 5LPEA 4MPVA 2BD3A 1SGFG 4I33A 2FTLE 1J9CH 2XTTB 4INKA 3AAUA 2HALA 3KQBA 4X8VH 4ZKSU 4RKOB 4UFEH 1S0RA 1FPCH 1O3GA 2VU8E 2ZU2A 1O37A 3VB4A 1EQ9A 1KXCA 2A5AA 5GPIB 5EGMA 1VITG 1XUHA 5AFZH 3ZVEA 1EJMA 1ZHMA 6ESTA 2ZU1A 3P8NA 2ZDAH 3HKJB 3TNSA 1EJNA 4JYTA 1ETSH 1VZQH 1VJ9U 1MTUA 1CHOF 3RXSA 2STAE 4CRGA 2GCHF 1TA6A 2Z3CA 2AMQA 2GZ8A 5AFYH 5EODA 5C2ZA 1C1RA 1GI1A 1NRPH 1BMMH 2J9NA 2TGPZ 1GJ8B 4R8TB 1GI6A 1G32B 4AORA 1YLDA 3FP7E 1IAUA 3OTJE 4F49A 1E34B 5EQSA 2CF8H 5EXNA 1MAXA 1DUEA 3NWUA 4XDEA 1C2GA 2PSXA 2ZDVH 1P0SH 1O2YA 1UTJA 5FX6A 1OS8A 4XBBA 1TNJA 3GOVB 4KELA 5EW1H 1LMWB 3AVZA 4E7NA 1EAXA 3QUMP 5T6DA 1T4UH 3M3SA 3PB1E 2FX4A 3AASA 5EQQA 1QQUA 1G3DA 1V2QT 2A7HA 4E05H 4IC6A 1UVPA 3A7ZA 1V2TT 5EPNA 3MYWA 7LPRA 4AN7A 5F8TA 1XXFA 2ASUB 2W7UA 3FVFB 4UD9H 2SGDE 5DP5A 1GPZA 3TJOA 4JZDH 2GGVB 2THFB 1KDQB 3WY8A 1BHXF 2Z94A 5LGOA 4AX9H 2ANWA 1C2LA 2J94A 2VIPA 1O5FH 1QB6A 3SV6A 1MBMA 1T8OA 4LK4A 1EPTC 1UTNA 1SVPA 1PPFE 5EOKA 2AFQB 3RXEA 4BAOB 1YBWA 3ZZAA 9ESTA 4R0IA 2ODQA 3SGBE 2FLBH 1DY9A 2HWLB 4B2BA 1EPTA 3GDVA 5EXLA 1O2NA 3F9HA 5F8ZA 3GY6A 1SB1H 4J2YB 1LPZB 2Q6FA 1T8LA 3GCHB 4NZQA 4YO9A 1ZMJA 4YOGA 1W0ZU 2HNTC 2XC4A 1YCPH 1GI5A 1BRUP 1ELBA 2HLCA 2Z3DA 1ELDE 5FAHA 1KY9A 1AIXH 2A2XH 1QB9A 3SHAH 1ZRBA 4NFEA 3SNBA 5DP6A 1KLTA 5CHAC 3SW2B 1LHEH 1GBHA 1GI7B 2ZCKP 1BMNH 2BMGB 2PV9B 1CA8B 3LJJA 2IPHA 1A3BH 3O8RA 1IQGA 2PTCE 2ILNA 1GBCA 2VIQA 3SNCA 3H5CB 3E1XB 2WV5A 1LHDH 4IN2A 1D3QB 2DUCA 4X8SH 2Z9IA 1GJ7B 2OXSA 2BYAX 1EJAA 3QLPH 1QRZA 1RGQA 1UK4A 2WPLS 1LHGH 2ZO3H 3E16B 1UMAH 2QN5T 1BRAA 4WF8A 1TAWA 1TA2A 2C8ZB 2ANMH 2ZDLA 1INCA 5L2YH 1ELEE 2O8MA 2NU4E 5L30H 1W11U 4A1VA 4ABIA 4FUGA 3KL6A 5JBCS 2OTVA 3H7OA 2ZC9H 3HATH 3SHCH 4GHTA 2BD4A 1GBMA 3UPEA 2D26C 1O3AA 4H6SB 3TJNA 1D3PB 1VGCB 2STBE 3A86A 1HAPH 4I32A 4NSYA 2JETC 1UTPA 5FPYA 3BTME 2ZGCA 2FOFA 3AW1A 2XWBI 4DURA 1MKXH 3IG6B 1SLXB 1GG6B 6CHAB 3DFJA 1T7CA 4CRBA 1QY6A 1ZHRA 1EATA 4CRFA 3LGWA 1S84A 2BQWB 3O8BA 4ZKRU 1G3CA 1A0JA 1KSNA 4MTBA 3RXIA 4TY7A 4WH8A 2NU0E 1KXAA 1TB6H 1G2MA 1QRXA 2BD7A 2AMPA 2BZ6H 1QL7A 2AMDA 4GPGA 1TPOA 1WSSH 1O3EA 2VJ1A 1BQYA 2EI7A 1EX3A 1K21H 4A92A 4ESTE 5DO4H 1QBOA 4B73A 1BJVA 1SGQE 1VITF 3A7YA 2QF3A 1RRKA 5HM2A 3ZZ5A 2B9LA 1TGBA 4Q7ZA 4KP0A 4X2WA 3SUGA 2PFEA 5GJ4B 5C1YA 1CGJE 3MH5A 1NRNH 1GVLA 2F9BH 1SGCA 1FLEE 5IYTA 4LZ4B 1TMTH 3RMNH 4K5ZA 5E0HA 5GCHF 3VFEA 1XUJA 4GCHG 1O3KA 2XYAA 2XXLA 3E8LA 4Y0ZE 2A1DB 1O3NA 2ZDMA 1Y3WA 5EG4A 2FX6A 4CHAB 3MWIU 4ABFA 1LKBA 2ZP0H 4XBCA 2VVCA 5FX5A 4MNYA 3M3TA 3QWCH 2HOBA 1CT4E 1BCUH 1O2VA 1KXEA 2VB0A 2EI8A 2YOLA 3U69H 3VB5A 4DW2U 4ZMAH 2ALVA 1BZXE 1QCPA 4IMZA 4ISNA 3FP8E 1HPGA 3DUXH 2F91A 3E0PB 3EA7A 2ZPQA 2M5TA 3ATKA 1EKBB 1RTFB 4IMQA 3VGCB 1YLCA 1V2NT 1S6HA 3E6PH 1O2LA 2C4FH 4ABHA 4GSOA 3A7WA 1YYY1 3P8OA 1LVBA 2GCTB 2H9EH 3SJ8A 1OWEA 4CBOA 1OKXA 2FMJA 2ZDNA 1OSSA 1Z8RA 2PW8H 1A4WH 2FOGA 2PKSC 1KTSB 2VGCC 2A31A 3M7QA 3MO6A 1ANDA 1TPSA 3TGJE 1KXDA 1DSUA 3LPRA 1ZJKA 4B71A 1BTZA 3B9FH 1DM4B 2UUYA 1IQHA 3MHWU 3ATIA 4WXVA 4BOHA 1ZPBA 4KTSA 2Z6BD 1Q3XA 3P6ZB 5DPAA 2PUQH 1O2TA 1TGNA 3SQHE 1AKSB 4IGDA 1SGDE 1VCPA 2ZIQH 3SI3H 4GUXA 3ZVGA 1H9HE 1KXFA 4INHA 1ZPCA 4UFFH 2GV6A 2G4UA 1MAYA 2GT8A 3KF2A 3PMAB 3SU1A 5C1XA 1MTWA 4M7GA 2ZF0H 2ZFPH 3SU4A 3EA8A 1AFEH 2R2MB 1NU9A 1LQEA 2JH6D 5FBIA 2BXUH 1HLTH 5CE1A 1EB1H 1YKTA 3PTNA 4FUCA 4YOJA 1SQAA 1JMOH 3NKKA 2O9QA 1RIWB 3UREA 2PSYA 3F68H 4FUFA 3A87A 4X2YA 3L3TA 1MTNC 2AGEX 4UEHH 1ZTKA 2B0FA 1WU1A 4HI3A 4AGJA 2BDIA 1DWCH 1EAWA 5E2OA 1LHFH 3RMOH 1GMCG 3W94A 3BIVH 1HJ9A 1PPHE 1LO6A 1LQDB 2IJOB 3OX7U 1GL1A 3AAVA 4Y10E 2A4OA 1UCYK 1E35B 2OBQA 1V2RT 3IWMA 1C2JA 3I77A 3S69A 5J4QA 1K28D 3SU3A 2HNTE 2W5EA 1IQIA 3LDXH 4JZEH 2B5TB 4ABDA 5A0AE 1ARBA 4OGXA 3KQEA 1C2DA 1V2PT 4O9VA 1C5RA 1EXFA 2ODYB 1P2NA 3RC6A 5JBTA 1C1OA 2FWWA 3I29A 1HAZB 2EI6A 1LPKB 1GCTB 1B0EA 3QX5H 2FXRA 1S85A 3BG4C 3SBKA 2GD4B 2TGAA 5ESBA 1P11E 2ZCHP 2KAIB 3MOCA 1ANBA 2C8WB 3F9EA 4YLUA 2J2UA 4JZ1A 4H6TA 2J4IA 1J17T 3MH4A 3OU0A 4AB9A 5EQRA 1KYNA 1DXWA 1BTUA 4O3UA 4MPWA 1ZSJA 1F2SE 4ISIH 3KEEA 3V0XA 5T3HA 1TNLA 1DS2E 3PYHA 3SV7A 1D3DB 3RXQA 2HPQH 3KCGH 1GBBA 2Z7FE 1GBFA 2WPJS 2OBOA 4X1SU 2CV3A 1WQSA 3LJOA 5LH8A 2BZAA 2SGAA 3P8GA 1CA0C 2CGAA 1QHRB 2CF9H 2FI5E 1UHBA 1Z6JH 3K9XB 3E90B 1TGCA 1ZOMA 3FAOA 1WCZA 1C5MD 3NK8A 6GCHG 4INLA 1C4U2 4BNRA 4FVDA 2ZGJA 3QDZB 1MZAA 1HUTH 1RTKA 3GDSA 4Q7XA 2XC0A 3A7TA 4KTCA 1C5YB 3OY5U 1IHTH 1P01A 5JB8S 2H1UA 2ZTYA 4GCHF 1QJ1B 2BVSH 4WMDA 1C5LH 2P16A 2FYRA 4IC5A 3S0NA 1Y5BT 2FTMA 3RXGA 1BUIA 2LNCA 4X6MA 1YPMH 1MD8A 1YPHE 1EAIA 4K1TA 2UWLA 2GTBA 4GAWA 4SGBE 1ELGA 1TQ7B 1AI8H 3NZIA 1IQKA 2B8OH 4B74A 4MQAA 1HGTH 2JH0D 1NTPA 1X7AC 1Z6EA 3E3TA 1S82A 2GDEH 3HK3B 4JK5A 1SGFA 1P05A 3ZZ4A 1DWBH 2P95A 1UTLM 2A45B 1BTYA 2BLOA 3M3VA 4ZUHA 2C8XB 1LPGB 1HJAC 3EE0B 3P92A 4XOJA 1N8OB 1ESTA 4DJZB 1A46H 5FPTA 1HIAA 8KME2 2BB4A 1V2MT 1DUAA 2FO9A 1B7XB 1THRH 4JK6A 1NFXA 2H9TH 2TPIZ 3A82A 4Y76A 2V3OH 5L2ZH 1AB9C 2BDBA 5I25A 1KTTB 3RXHA 3SJ9A 1BRBE 4AG1A 4TWWA 1GJCB 3KQCA 5EPYA 3P95A 4FUJA 1AE5A 1AY6H 1BA8B 1ZYOA 2VINA 1GJ6A 1O2SA 4Y7BA 1QA7A 1EB2A 1UJ1A 2SGFE 2F9NA 2WPKS 5BPEA 1P9UA 2Y7XA 1CVWH 1BOQA 2SFAA 5CMXH 5ETXA 2ZG0H 2ZCLP 3NPSA 1BDAA 1C1QA 2P3UB 1A2CH 3M35A 5EW2H 1C5SA 1Z8JB 4I31A 1F5RA 1YCPK 1GCDA 2Q6GA 2ZQ1A 1MCVA 1WUNH 3L33A 5TCCA 2AIPA 3SU2A 1O2WA 1P09A 3Q3YA 2CJIA 1HAIH 3U1IB 2NU1E 1L0ZA 3EGKH 2CXVA 4Y71A 3B23B 5GCHG 2VH0A 2OLGA 2VIOA 1ZTJA 1ESAA 3LGVA 5FHTA 5AHGH 3VPKA 1HCGA 4WXIA 1CT0E 1A61H 3LGUA 1Z8GA 1GJ4H 2PTNA 1A5GH 1J15A 1C4V2 1SOTA 4BAQB 1K9OE 1C1TA 1O0DH 4JMYA 3UIRA 4X2XA 5E2PA 1ZMNA 1M9UA 1EZXC 2J38A 4PROA 1QURH 1GMCF 3BV9B 3FANA 3T25A 1TFXA 3P17H 4THNH 1GBDA 3FZZA 1P8VC 1SGIB 2ZU4A 1GVKB 1UCYE 3QK1A 2BY9X 2BHGA 3M37A 1QJ6B 3HGPA 1QL8A 1ZLRA 2NWNA 2QXGA 3MNSA 1EP5A 2SGEE 1O32A 4HFPB 2ANYA