1UO6A

Porcine pancreatic elastase/xe-complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the Routine Use of Soft X-Rays in Macromolecular Crystallography. Part II. Data-Collection Wavelength and Scaling Models
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ELASTASE 1
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2003-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uo6A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uo6A01
1V2PT 1BCUH 2ZTZA 4A92A 3LJOA 1O3EA 2BXUH 3M5LA 2HPPH 2ZG0H 4AX9H 3RU4T 1TWXB 1Z8JB 1D6WA 2FOEA 3UY9A 4BAOB 1NS3A 2BYAX 1YPGH 2A7CA 4O9VA 5F8XA 4HGCA 1F0TA 1ZZZA 1SGPE 2XC0A 2XBXA 2G00A 5DP6A 2FLBH 4A1TA 7GCHF 1O2MA 1SMFE 1QGFA 3KGPA 1KXDA 1F0RA 4K1SA 2B9LA 4HFPB 2FO9A 2G4TA 2BMGB 1GDUA 1Q31A 1Q2WA 1XUJA 1GJ5H 3MH4A 5A8YA 1W13U 1K9OE 3E1XB 1P2OA 5GCHF 1EZXC 1QB6A 2VWLA 1DUAA 4K1EA 3FZZA 1WQSA 1W0YH 4JMYA 4FUHA 2QF3A 4AFSA 1HDTH 3L3TA 3HK3B 1ZMNA 2ODPA 1P02A 4ZH8A 1O37A 2UUYA 5ESTE 3BEIB 4UFFH 3RLWH 1TPOA 2F9BH 2KAIB 2BDIA 1EAXA 2H9EH 4TWWA 3F6UH 2FODA 3BTHE 3SNDA 1ESTA 2OCVB 2P16A 2WPIS 1A5IA 1FJSA 4YLQH 2HNTC 1Y3WA 1CSOE 3GOVB 3MH6A 1XVOA 3M5OA 1WAYB 1T8LA 3KQBA 1XKBC 1HYLA 1HBTH 3S7KB 5K7RA 3A8BA 5F8ZA 2C93B 2F9OA 2OQ5A 1FLEE 4IW4E 4WWYA 1YM0A 1F0UA 1ZPBA 4OGYA 1MU8B 1CBWC 1MTVA 1O3OA 3GICB 3SJOA 2OLGA 2JETB 4NIYA 2W7UA 1O2NA 1WBGB 5C3NA 1GBEA 5E0GA 1HAZB 3Q77A 1E34B 1OYTH 1G3DA 2GKVE 1RIWC 1F5RA 1FI8A 1EAWA 3A82A 5EGMA 4ZXYH 4ZKOU 1GJ4H 1NZQH 1C2HA 1SQAA 5G4BA 1C5LH 4GCHF 4D7GA 2HNTF 3ATLA 2EA3A 2A4OA 4INKA 3A84A 3QK1A 1QBVH 5DP7A 1W7XH 2VH0A 4YOJA 2FM2A 3ZZ3A 5L2ZH 4MLFB 1UK2A 1UTLM 1TE0A 3MO6A 1AZ8A 1ZTJA 2FPZA 4WF8A 4B73A 2FESH 1SBWA 1AMHA 1NT1A 2IOTA 4XBCA 1KYNA 4Y0ZE 1C1NA 1ZSJA 4BTIB 2FEQH 1SI5H 2ZC9H 1HGTH 4IC6A 3T5FH 3U1JB 1YPHC 3F1SB 4CH2B 1AGJA 1LQEA 4B76A 1KXEA 4OGXA 1RTLA 1ZR0A 3LJJA 1A61H 2VIPA 3RXVA 1GHAF 4I8GA 1YLDA 2SGPE 1DUEA 2R3YA 3U1IB 1BJVA 3RC4A 1EPTB 3QUMP 4B74A 3GY6A 4DJZB 4B2AA 5EXLA 1V2MT 3ATKA 1GHVH 1O34A 1TGBA 1MTWA 2BY6X 1G3EA 1CVWH 1O35A 3M5MA 3GY8A 2W7SA 1GVZA 2I6QA 1DSUA 1MAYA 1NM6A 5H4IB 2A2QH 1O2YA 1ZOMA 1C9TA 4FUIA 5DK1A 4I7YH 5C67A 3PV4A 3QZRA 5EQQA 4D9QA 1S0RA 1K1IA 4CRDA 1EAIA 1HAVB 2V3HH 4TWYA 1VCPA 1HFDA 4X0WU 1O31A 1V2NT 1SGEE 1P04A 1MTNB 4TY6A 1DX5M 3M37A 3SNCA 2ZQ2A 1O3KA 1GBIA 4CR5A 2QN5T 4GSOA 4NWKA 1MBQA 5C5OA 2Y81A 2FI3E 3Q3XA 1SGNE 1C4V2 1YCPK 5HMAA 1QJ6B 3LPRA 2QC2A 4X2VA 3A87A 1MD7A 2RG3A 4CRAA 2HPQH 2P3FH 3ZVDA 2GV7A 2NU2E 1K1LA 4R0IA 1FPCH 3O8DA 3SO3A 1ORFA 1AFEH 2BQWB 4ABDA 3QDZB 3SU1A 2WV4A 1MKWH 2FOAA 1H8IH 1LKBA 1ZSLA 3MO3A 4PROA 4AFQA 3MNXA 3ATMA 3A7YA 1S84A 2P94A 3B9FH 1DWDH 3T27A 1P10A 1KTSB 5IDKA 1HXEH 5ETXA 4MDSA 2BTCE 1MCTA 3IWMA 4FUDA 3ZYEA 2F9PA 2YNBA 3U98H 3ZZDA 4X6MA 2FOBA 1O2UA 4K3JA 1O2TA 3PMBB 1GI0A 4AG1A 3K65B 1O0DH 1O3NA 2TGAA 3T62A 5E0JA 1FIWA 1NFXA 1P3EA 1BOQA 3AW0A 4IMZA 1GI1A 3A83A 1PPHE 1TMUH 3B23B 2FYRA 1JBUH 1ETSH 1P05A 1TB6H 1NO9H 1SGCA 5HM9A 3PMHB 4O3UA 5EPNA 2BD7A 5GDSH 4I33A 2G4UA 1QL7A 1EPTC 1INCA 1F7ZA 1HJAB 1G36A 4DURA 2QIQA 1KLIH 2ANKH 3F9HA 3E91A 3QN7A 2ODQA 3CS7A 1O2KA 1SQOA 2HALA 2A2XH 2PKAB 3ZVBA 4UE7H 5DP4A 1U6QA 5FBEA 2XWAA 1C4Y2 1DXWA 3EAJA 1DOJA 2C8ZB 4Y7BA 4BNRA 5FCKA 2XCNA 4NIXA 1NRPH 2PWXA 1D3PB 5A0AE 1QJ7B 1J16A 2GCTC 2Y6TA 2PGBB 3RXDA 1JIRA 3D23A 3PTBA 4LOYH 1GI8B 2QF0A 3KQCA 5TJXA 1A3EH 2LNCA 3OTJE 4BAMB 1T31A 4IN2A 5JDUB 1TBZH 2JKHA 2F83A 1N8OB 3ZZ5A 2ALPA 1IQGA 4Y0YE 3R0FA 4OS6A 4X2XA 2G51A 3FAOA 3BTWE 4JZFH 4X6OA 3ZV9A 4ZXXH 1VCWA 3M5NA 5EODA 1C2JA 2J95A 4BTTB 4ZMAH 5T6FA 3SW2B 2Y5GA 3QTOH 2H5CA 3TGKE 1J8AA 5EQRA 1GI2A 1KY9A 3LC5A 3RXEA 4CHAC 2A7JA 1BBRE 2ZGCA 2WUCA 2Z9JA 1FIZA 1J15A 1YPJH 4FVBA 1P11E 4ABEA 2VIQA 2BB4A 1FMGA 1WTHD 1CU1A 4MPUA 1ZSKA 1L1GA 3EE0B 1TONA 2IPHA 3BV9B 1UTMA 2BDCA 2G55A 1QIXB 1SR5C 4NFEA 3ODFA 1O2XA 2B7DH 3A80A 3MYWA 5C5NA 1QY6A 1K2I1 1P2KA 1OWJA 5E8EH 5JYIA 4A1XA 1O3AA 9LPRA 2M5TA 2FXRA 5ABWA 1UTKA 3CS0A 1TNHA 3BTFE 2P93A 2SFAA 5I25A 1BTXA 4AN7A 3M35A 2XCFA 2R2MB 1V2QT 2XBWA 4D7FA 3V0XA 1EJAA 1O2GH 2UWPA 1SB1H 1RTFB 1TNKA 3SV2H 5GJ4B 1O3JA 1QRXA 2VNTA 3S69A 1IQKA 1QRZA 3SU4A 1LVMA 1BMMH 2CHAB 3W95A 2VVUA 1JOUB 1Z8IB 1K1OA 3PO1B 2HRVA 2NWNA 3UNRA 1H1BA 1C1PA 2R2WU 4DVAU 3KN2A 3TITA 1BMAA 3RM2H 7ESTE 2XXLA 1RRKA 1VITH 1GCTC 5A0BA 3VGCC 3SJ9A 4XFQA 1CT0E 4AGKA 3KQEA 2WPKS 2UUKB 2Q6GA 3DT0H 1GJ7B 2H1UA 1QR3E 2ZCKP 1UK4A 1V6DA 3IITA 3LGUA 5L2YH 1BTYA 1C1MA 2ODYB 4AORA 3ZZ7A 1QL8A 2A31A 4JYUH 3SQHE 2PUXB 1N8OC 2AGEX 2KAIA 3QTVH 4ZHMU 4FUCA 5J4SA 1EP6A 4HI3A 3RU4D 1A4WH 5FPTA 1UTJA 1GHYH 3ZZ9A 4U30A 3SUDA 3PMJA 3RDZA 4KGAA 1E0FD 3GCNA 1B0FA 3Q76A 4MTBA 4JZEH 3M7TA 2WINI 3SZNA 3SUEA 4DOQA 1Y5BT 5EQSA 1A2CH 1EB2A 7LPRA 1IQFA 3HGPA 1AKSA 2OC1A 1G37A 1FY4A 2FOCA 4GVUA 1W10U 2D26C 1WOFA 3A7XA 5EW1H 1TQ0B 3O8BA 4CRBA 1UHBB 1ZHRA 3BTDE 2A7HA 1GI7B 1PPEE 3P8NA 1A5GH 2Y5HA 1YPLH 3RXTA 2FDAA 1PFXC 2ZKSA 3KL6A 1DM4B 3LDXH 4NSYA 2QV1A 4GCHG 1LPGB 4ISLA 1GGDB 1ZTKA 2ZHDA 1C5OH 1SGQE 1GVLA 1K22H 4XOJA 2VWMA 1GHXH 1WU1A 2ZFQH 3CENA 1DWCH 2CMYA 3FZDA 2BLVA 2ZI2H 1WYKA 3RU4E 3TJNA 1FPHH 1TPSA 2PKSB 3SI4H 3M7QA 2FX6A 3Q00A 4H6TA 4FXGH 4XBBA 2P3UB 2BDHA 1KXFA 3MHWU 1TAWA 4VGCB 1Y3VA 2CXVA 5GPIB 3ESTA 3ATIA 3SGAE 3SUGA 2P3TB 3RP2A 2EI7A 3SJ8A 5FBIA 1BBRH 4ASHA 1ARCA 1XVMA 2CHAC 2BY7X 3RXKA 2ASUB 3AAVA 3FP8E 4CH8B 2FTLE 2BVSH 2ZU3A 1SOZA 2VWNA 1TGTA 3S9AA 3A81A 2XC5A 1QTFA 4X1QU 1G2MA 3RXPA 1OP0A 2CF9H 1GBJA 1C5VA 1Y59T 3FVFB 4WJG2 4KP0A 1GDQA 2ZTYA 1KXAA 2W3IA 4NA7A 2ZNKH 5GWZA 2AGGX 3U8RH 2FWWA 2ZP0H 1C5MD 1QA0A 1JIMA 1THRH 3RXQA 2PSXA 3MNSA 2ZDLA 1FY3A 3BEUA 1YGCH 1GBBA 4E05H 1H8DH 4RSPA 2TGTA 1OWHA 5DJ7A 4TPIZ 1LCYA 2D8WA 3V12A 3PTNA 1GG6C 1GPZA 1V2LT 3K9XB 1S85A 2EI6A 5AHGH 1X7AC 1BRCE 1AB9C 1GL0E 4B2BA 1TALA 1GJ6A 1O2PA 1GI4A 2PLXA 2WYJA 1PYTC 3VFEA 1L0ZA 3MU5A 3BTGE 3ZVCA 3RXSA 1O3CA 4YTAA 1ETTH 4NIWA 3HGNA 4E7NA 3M3TA 1WSSH 5HM2A 4CRCA 3MWIU 4O3TA 2GX4A 4JYTA 3TU7H 3LGTA 5K0HA 3TK5A 1CA0B 4LZ1H 1WUNH 4AFZA 2R3UA 4WY3A 1O2SA 4J2YB 1Z71A 1L4ZA 1KSNA 1FNIA 1NFUA 1TNJA 2BY9X 1IQMA 1NTPA 2VGCB 3V13A 5C1UA 4XSKU 3KIDU 1HV7A 1FAXA 1BMLA 1MU6B 1NESE 2A4GA 3BTQE 2GZ7A 1DE7H 1W14U 1PYTD 2F9UA 1K1PA 1NN6A 2F91A 2WPLS 4FVDA 4OS2A 1BHXB 3LH1A 1C5YB 1Z1JA 1GMDF 5EU8A 1SGIB 2C8YB 1GJ9B 3GDSA 4WMDA 2BY8X 3U69H 1ZLRA 2ZDMA 2UUFB 2FOMB 1C2FA 1QL9A 2Z9GA 2V3OH 3GCTF 1O2RA 4Y6DA 3DD2H 1AFQC 1V2OT 1SLUB 2UUJB 3E0PB 3H7TA 5L6NH 4DW2U 1GBFA 4B71A 3SJKA 5DP5A 1GL1A 3VB7A 2ZPQA 3MI4A 8ESTE 4SGBE 3A7ZA 2ZDNA 1GHAG 2CJIA 3EGKH 1UTNA 1C5QA 1A3BH 2D1JA 2J94A 3PLBA 1ELFA 4YOIA 3RMLH 2PKAA 3K6ZA 3DFJA 3LGYA 2VWOA 2P95A 2WUBA 1B5GH 2GZ9A 4AG2A 4MPVA 1AWFH 2Q6FA 1IQJA 1DY9A 2Z9IA 5CHAC 1C1TA 1FY8E 3AASA 1QA7A 2WYGA 2LPRA 3QO6A 8KME2 3QZQA 3RXIA 1W2KH 5JBBS 4O03A 2NU1E 1OYQA 2GCTB 1BMNH 3SHAH 1XX9A 1ZRKA 1B7XB 4XBDA 3ZZ6A 1C1VH 4CHAB 3PWBA 1YCPH 1EOLA 1W7GH 1C1QA 2C8XB 7KMEH 5AFZH 1DLEA 3GCHC 4ABGA 3I77A 2XW9A 5LPEA 2DUCA 1PPBH 3GCOA 3SU0A 2P8OB 3M3VA 1MBMA 2IN2A 3BN9A 4Q2KA 2SGDE 2JETC 4ABBA 4UFEH 1EOJA 2VIVA 1KIGH 4NWLA 2ANWA 2BLWA 2O8MA 4A5TS 2F9VA 3D62A 1O39A 1H9IE 1Z6EA 1RJXB 1DITH 1O2OA 2Z9LA 3P8FA 1PPZA 4U32A 2ANMH 4Y10E 2O9QA 2HVXA 2BOKA 3UWJH 5J4QA 3SBKA 3P92A 1SGYE 3PB1E 3TJUA 1GBAA 2Z3DA 1HXFH 3LGWA 2ZWLH 3E16B 5JB8S 3ZZ4A 2VVVA 1GBCA 2OC0A 4KKDA 5E0HA 1M9UA 1QB9A 1TA6A 3DA9B 1DS2E 1TPPA 1BIOA 2ANYA 2FS8A 4JYVH 4F49A 3MH5A 1SGTA 3A7VA 1NFYA 1GMDG 8GCHF 1V2ST 5DP9A 1TIOA 7GCHG 1F0SA 3EQ0H 1UTQA 1D4PB 1HAGE 2FMJA 1P2MA 3PM3A 1VZQH 2PGQB 5EXMA 1YKTA 5TCAA 4UONA 1MH0A 2XRCA 2Z7FE 3NK8A 1N1LA 5CHAB 1JWTA 1XMNB 5EOKA 4ISHH 6ESTA 1PQAA 1TNLA 2TBSA 1VJ9U 1NRNH 3PROA 2BD4A 1ANDA 3I78A 4YO9A 3SI3H 3DFLA 4Y8YA 1Y8TA 1DICA 3GDUA 3VGCB 3VB4A 1CQQA 2FOFA 1GGDC 3SN8A 1TBRH 1Z6JH 1AO5A 3Q3KA 2J38A 1HUTH 1HLTH 5T6DA 1LHGH 4ZUHA 2ILNA 4IGDA 4BANB 1GJ8B 1SG8B 2EC9H 1ANBA 1UVUH 3E6PH 1P57B 3RXJA 1VITF 4AFUA 1E38B 1ELBA 1YPMH 3KCGH 4VGCC 3S7HB 2G5VA 3RXCA 1GJCB 3FP7E 4I8HA 4D9RA 1AIXH 2ZGXH 1O5DH 2HLCA 1QHRB 4WVPE 1LDTT 1DFPA 1TYNA 1VR1H 2O8UA 3UREA 1Z8RA 3RC6A 1TX7A 2SNVA 1ID5H 3EDXB 1C5TA 2WPHS 1RXPA 3UWIA 1ETRH 4GHTA 2PTCE 4M7GA 3ZZ8A 2OXSA 3UTUH 1ACBE 4BTUB 1EZQA 2BX4A 4CR9A 1C9PA 3QLPH 4K60A 5AF9H 3RMOH 3A85A 2BX3A 2PR3A 1O2HA 3VXFH 3F9GA 2OC7A 4NZLA 4TY7A 2Q1JA 1DXPA 1IHSH 5JBCS 4NZQA 1W3CA 3ZVEA 3UNQA 3GY3A 3TLOA 1W8BH 1W12U 2TGDA 4ABIA 2QGRA 4U01A 2ZU5A 3MNBA 2QXIA 1UJ1A 1WTGH 1BZXE 2WPMS 1V2UT 5FPSA 4HTCH 3TGJE 3SNBA 4I32A 1O5BB 2AIPA 3HPTB 1GG6B 4UEHH 1SC8U 1JMOH 1TGNA 1KLTA 1WV7H 5DPAA 1YPHE 1SGRE 4ZHAA 1J14A 3RC5A 1MCVA 1BQYA 4OS5A 4ZROA 1IHTH 1TX8A 1VJAU 3KEEA 1HIAA 1O3LA 3SJIA 1XM1A 3V3MA 2OBQA 1BRBE 1AWHB 1AD8H 1GMCF 1G30B 1BTZA 1GJDB 4RN6A 1ANEA 3BTKE 4H4FA 2VJ1A 4YT6H 3ZZAA 1C5WB 4MNYA 1ELTA 4X8VH 2ZZUH 1SLXB 3QWCH 1FY1A 3TNSA 1S81A 1SFQB 4AYVB 3Q3YA 1UK3A 3RMNH 1P3CA 1QB1A 1UVSH 2HGTH 2J2UA 4WH6A 4Z6AH 1EATA 1GHBF 3LU9B 1TA2A 2NU3E 2QXJA 1Y3YA 2Z3CA 4AOQA 3AVZA 4ISIH 4RKJB 2ZHWH 2QCYA 2ZDKA 5E2PA 1JRTA 3PYHA 3STIA 1GVKB 4Q7YA 4MPXA 3R3GB 4CBNA 2J34A 5FXLA 6GCHF 2BDBA 1LPKB 2AIQA 4ZAEA 1EUFA 4I8JA 5L30H 2BVXH 1HJAC 4J1YA 2VH6A 4D8NA 1AQ7A 1C5RA 2GT7A 2XBYA 1LVOA 5DG6A 3E90B 1GBHA 1A46H 1C2LA 3URDA 3E0NB 2NU4E 1LPZB 5FCRA 1TRYA 2GT8A 1YPEH 3A7WA 3MU1A 1VITG 1FQ3A 1O3FA 1OPHB 5LH8A 5TCCA 3PLKA 1ARBA 1BTPA 3S9BA 4F4OC 4BAKB 2ZDAH 1TRNA 2Z9KA 4JZDH 4X1PU 1OSSA 2PTNA 1O2LA 1O5CB 2ZO3H 1CE5A 3HKIB 1LKAA 2VIOA 3SGBE 2XNIA 2BQ6B 3MMGA 2QY0B 4Z0KA 2TPIZ 3SU6A 4ESTE 1L1NA 1A0LA 1CGJE 2BVRH 4JCNA 1ELCA 3LONA 1UVOA 4GLYA 1UVPA 4NIVA 4X2WA 3RXMA 4AB9A 1YP9A 2ZA5A 1AZZA 2ZFPH 1FDPA 1ZRBA 2ZECA 1HPGA 1P06A 1J9CH 4Y79A 3H5CB 4GAWA 3FANA 3BTEE 4X1SU 3SGQE 3F9FA 8GCHG 3SNAA 2FYQA 3RLYH 1XUHA 4WMEA 1HJ8A 1A1RA 1GCTB 2JH0D 3BEFB 2O8WA 3I29A 1SHHB 2FP7B 2AH4X 1FXYA 2ESTE 2G8TA 2BXTH 1XXDA 2H5DA 1A0HB 5HXFA 1AKSB 1RD3B 1NPMA 3GYMA 4U2WA 1NU7B 2SGEE 4BXSA 1V2WT 1AUJA 3OX7U 4IS5A 5A09A 1QBOA 3GCHB 3MO9A 5LPFA 4K5ZA 2ZGJA 1O2IA 1A5HA 2VB0A 5DGJA 2P8OC 3QX5H 1CGHA 2C3SA 1UMAH 1SSXA 1BJUA 1CGIE 1OOKB 1C1UH 2GDDA 4Y7AA 1HAXB 1C1WH 1LMWB 1PPFE 1UTPA 3L33A 4ISNA 1UO6A 5F03A 4AB8A 5FAHA 1ZJDA 4MG3A 3TNTA 2H9TH 2B0FA 1LHEH 5I46H 2AMDA 1GHBG 3RXUA 3SU2A 4INHA 3BIUH 3ZVAA 2ZFRH 1OWKA 3A7TA 1FUJA 3TJOA 5DP8A 1OP8A 4DY7B 3GY2A 3BG4B 2PFEA 2ZTXA 3GDVA 2ZF0H 4ZKSU 1KDQA 3OYPA 1F5KU 2ZFSA 3TH4H 1O3HA 3UNSA 3UFAA 1LQDB 3T2NA 1HJ9A 2AS9A 1TMBH 4SGAE 1G3BA 1YC0A 2OD3B 3MTYA 1O36A 3T26A 2XYAA 1RGQA 3NXPA 2A5KA 1UVTH 1S6HA 2BD8A 1O2VA 2EEKA 1AVGH 3LKWA 1C2GA 1TOCB 2ZU4A 4NCYA 1C1SA 1S82A 1O3GA 4Y11E 2ULLA 3RXOA 4K2YA 1IQHA 2BHGA 1TNIA 1FN8A 1C1RA 2CV3A 1ESBA 4Y71A 1GJAB 4ZHLU 1AHTH 1P12E 2BOHB 2V6NA 1W0ZU 1QRWA 4BOHA 1S6FA 3UOPA 2FOHA 1HB0B 4JK6A 1YCPM 2QXGA 1QFKH 3A86A 2PV9B 4MNVA 2GCHF 2GGVB 1ABIH 3EA9A 4E7RG 1XUGA 1HAYB 1RIWB 1RFNA 1GMHF 2ZIQH 3EA8A 1EXFA 5GCHG 3SUFA 1ZYOA 4CREA 4THNH 1AU8A 2TGPZ 3RXAA 2ZGHA 3JZ2B 1P2JA 2FLRH 1OWEA 1FN6A 1YLCA 2A45B 1O3PB 4MNWA 1ELEE 1P2NA 3WY8A 3TH3H 1NRQH 1HNEE 1O5AB 1V2TT 2GCHG 2ZHFH 1PPGE 4JZ1A 5C20A 1BITA 3P17H 1ZPCA 1QJ1B 1DLKB 4MQAA 2BY5X 3IG6B 1SVPA 1TBQH 4FUBA 1AB9B 3M3SA 3B8JA 3PO1C 3SV9A 1EZUC 4IMQA 1MQ6A 4DG4A 1C5XB 2FOGA 3GISB 5EPYA 1QURH 4DGJA 1GJBB 4FUGA 1MTUA 3U8OH 2SNWA 3LIWA 1SGFA 2VINA 4FUJA 1QNJA 2V35A 1O5EH 1BUIA 4MPWA 2W5EA 1ELAA 2ZQ1A 2AERH 1EZSC 2YOLA 3M7UA 1Y3UA 1HAPH 5IYTA 1W11U 1XKAC 2STAE 2JH5D 1C5ZB 4IBLH 1Y3XA 5T6GA 1CHOG 3S0NA 2ZPSA 4UFDH 4DIHH 1MAXA 1J17T 2Z3EA 1H9LB 3HK6B 4IC5A 3UQVA 4JZIA 2FS9A 1IQNA 1LHFH 2B5TB 1O3IA 1HAHH 1BB0B 1TGSZ 1TOMH 4LXBH 1ZHPA 4CRGA 3SV8A 4KTUA 3NCLA 4DT7B 1S0QA 4XE4A 1TFXA 3TH2H 1O3BA 3MU0A 4ABHA 1ELVA 4JK5A 1JRSA 1V2VT 3U9AH 3TPIZ 4B75A 1V3XA 3CP7A 3URCA 1AVWA 1RS0A 3ZZBA 2ZCHP 3HKJB 1SPJA 3W94A 2RCEA 1B0EA 2GD4B 2BLQA 1T8OA 5A8XA 1DWBH 6LPRA 1THSH 1UCYK 5F8TA 2VIWA 1V2KT 1MMJN 2A5IA 3OU0A 4ABJA 1NRSH 2BDYA 3P6ZB 3LOXA 4WH8A 4WXIA 3TK6A 1SGFG 2G81E 1KTTB 1GI3A 5C1YA 4FU9A 1QCPA 4I8KA 1C2IA 1WQVH 3L6PA 3P8OA 2TIOA 5DP3A 2BZ6H 2R9PA 1EJNA 4FU7A 1C5PA 1UHBA 2PW8H 2THFB 4OS4A 2QA9E 2W26A 3RUOA 1FAKH 1T8MA 2STBE 2BQ7B 1MTSA 3E8LA 5AFYH 4KTSA 3ATWA 2ZFFH 2BD5A 2GZ8A 1AE5A 4K8BA 2OQUA 4I8LA 1KLJH 1FONA 2ZU2A 2B8OH 1N6XA 5BRRE 5GXPA 1PQ8A 5T3HA 1NC6A 3VB3A 3FFGA 1GI9B 5LGOA 4E06H 1EQ9A 4X2YA 1LTOA 4UD9H 1D3QB 2VU8E 4NA8A 1IQLA 1EB1H 2FI5E 1K1JA 4GHQA 1FZZA 3ZYDA 1ZGIA 2GVFA 2ZFTA 1MQ5A 1L2EA 1HAOH 2V0BA 4TPYA 4WXVA 3A8CA 1VGCB 5JB9S 4Q7ZA 3SQEE 1PJPA 4UFGH 5A8ZA 2ZHQH 3TK9A 1DSTA 2RDLA 1MZDA 1P9SA 1G2LA 3UPEA 3HATH 4OS1A 1IQEA 1BTHH 1A7SA 2OINA 2FX4A 3GY4A 4X6PA 4X8TH 2A4RA 2BZAA 3K2UA 1KXCA 1BHXF 1EPTA 3SHCH 1Y5UT 3LT3A 1XUKA 1CT2E 1XXFA 2PHBA 5A0CA 4CRFA 2HWLB 1UCYH 2O8TA 1ABJH 2G5NA 4IN1A 1P03A 1MKXH 1QQ4A 4NSVA 4INLA 4I31A 3SNEA 1DANH 1Q3XA 4X8UH 1GMCG 1O2QA 1CT4E 3LH3A 4O97A 2I6SA 1C5SA 1S5SA 4KELA 1KXBA 1D6RA 1AY6H 3BTME 1GBMA 2P59A 3DHKH 2XC4A 1VGCC 1AE8H 1V2JT 4AZ2B 1O33A 3BSQA 1SGDE 4YZUA 2GV6A 2C8WB 1C2EA 3TJVA 2VGCC 3E3TA 3SU3A 2HNTE 3EYDA 2Z94A 1SLWB 1TNGA 3MU8A 1P01A 4ISOA 1BT7A 2BD2A 3LC3A 5C1XA 3O8CA 2OP9A 1UCYE 1O2JA 3RXHA 1MKXK 3F68H 5EG4A 2AGIX 1PQ7A 1GBKA 2K1QA 2TRMA 3AW1A 2ZHEH 4K8YA 4Y8XA 3BF6H 2XBVA 3P95A 2W3KA 4Y8ZA 4A7IB 1O5FH 4MVNA 1YF4A 1JXPA 1T4UH 2Y82A 1GCDA 1C1OA 2BDGA 3JZ1B 2VVCA 3NPSA 3K6YA 1O3DA 4KTCA 1PPCE 2WPJS 1GI6A 2RA0A 4DIIH 1BBRK 1D3DB 3GCTG 1CA8B 4ABFA 1BRUP 1QBNA 3P8GA 1O32A 4FU8A 4X1RU 3PWCA 1GBTA 4Y76A 1GMHG 2PKSC 2OTVA 4B1TA 1BA8B 2ZCLP 3A88A 1N6YA 1O2ZA 1GWAA 4GPGA 1NRRH 2A1DB 2OBOA 1FY5A 2H6MA 3FP6E 4GUXA 1ANCA 2F3CE 1RTKA 1MKWK 2UWLA 1C5UA 3H7OA 3ITIA 1C5NH 1LO6A 4OS7A 3T29A 1ESAA 2ZDVH 1CHOF 1FV9A 3U8TH 3RXGA 1G3CA 1ZMJA 3KHVA 2QYIA 3MU4A 1IOEA 3MOCA 2ZPRA 3BG8A 2QAAA 1XUFA 5EXNA 1EKBB 1ZPZA 3NUMA 1IQIA 1YPKH 4XDEA 1YYY1 5EW2H 2CF8H 1HRTH 5F6MA 1WCZA 2PSYA 1OWDA 2BDAA 5FPYA 4TYDA 1P9UA 2ZEBA 3M36A 3MH7A 4X6NA 4CBOA 1DT2A 4FUEA 2FTMA 4X8SH 4X1NU 3ZZCA 2A4QA 2BD9A 1E37B 1HAVA 3UUZA 3A8AA 1GHZA 1H9HE 3D49H 3T25A 2CN0H 3BIVH 2G52A 5CE1A 1AN1E 4MNXA 1K1MA 1BTWA 1UTOA 1LVBA 1O38A 3UQOA 1YBWA 3A89A 4Q80A 5FHTA 1EP5A 1O3MA 1Z8GA 3C27B 4A6LA 3ZVFA 2EI8A 2R0KA 1P2IA 3G01A 3RXBA 1LHCH 1C2MA 3GYLB 2Y5FA 2Q6DA 3DUXH 4B2CA 2OC8A 4H6SB 1O5GH 3UIRA 3MFJA 4H42U 3SV7A 4HZHA 4LZ4B 3UR6A 4BAHB 2BLOA 1TABE 1LVYA 3RM0H 3TGIE 1ELGA 2YNAA 1ZGVA 2GP9B 3SORA 3N7OA 3STJA 3VEQB 2Y7ZA 3F9EA 1F5LA 1HCGA 1T8NA 2C4FH 2ZU1A 1SOTA 1MD8A 2PUQH 1OKXA 1GDNA 1PQ5A 2GMTC 3KQDA 1T32A 1NU9A 2J4IA 3NKKA 3KF2A 1CHGA 1HAIH 1BRAA 4ZKRU 1OX1A 2D2DA 2AEIH 1Z1IA 1TMTH 2DE9A 1F92A 2HOBA 4YESB 2IJOB 3D65E 1L1JA 3VB5A 9ESTA 2Z6BD 3PLPA 1P0SH 6CHAC 1QQUA 1ZHMA 1TGCA 2AMPA 2A32A 1GHWH 3VXEH 3SV6A 3BTTE 5FX5A 1OS8A 3SU5A 6GCHG 1DY8A 2JH6D 1T4VH 5C2ZA 3ODDA 2DE8A 2Y7XA 2NU0E 2GMTB 1F2SE 1THPB 4BAQB 5LPRA 1ELDE 1Z7KA 1NFWA 2FI4E 1LHDH 2FIRH 2O8LA 1ZJKA 2Y80A 5E2OA 3M61U 5HGGA 1SFIA 4A1VA 1EX3A 2H9HA 1MTNC 2UWOA 4YLUA 1DDJA 5FX6A 1G32B 1SLVB 1TRMA 3LGVA 3NWUA 1O30A 5DO4H 2RA3A 1EJMA 5ESBA 3OY5U 1GI5A 1L4DA 2SGFE 2WV5A 1ZTLA 1K1NA 3OSYA 4UDWH 3LGIA 1C4U2 2AYWA 3OY6U 1DVAH 1GBDA 4R8TB 3ENSB 5B6OA 1ZMLA 4WMFA 4NA9H 3EA7A 5SGAE 3MNCA 2QXHA 3RXRA 2GDEH 2C90B 2R0LA 3GY7A 1T7CA 4ZKNU 2A0QB 2CGAA 4D76A 2OUAA 2SGQE 1G9IE 3A8DA 2F9NA 1TLDA 2SGAA 1VCQA 3V7TA 1MUEB 2AFQB 2H2ZA 5DKMA 1HIAB 4YT7H 4K69A 1TPAE 3RXLA 5A2MH 2J9NA 1MZAA 4NFFA 2VIDA 5CMXH 1SL3A 2J92A 1D9IA 1DWEH 4NG9H 1S83A 1V2RT 3NZIA 4Q7XA 2GTBA 1SQTA 4QT8C 5JPMH 3QGJA 4AYYB 1DPOA 3TIUA 3O8RA 1OP2A 1AUTC 1C2KA 1P2QA 1TX6A 5GIBA 3VB6A 1O2WA 8LPRA 4YOGA 1EASA 3T28A 1SHYA 1D3TB 1KDQB 1TQ7B 4AGJA 2FZZA 1OWIA 1E35B 1AFQB 4FUFA 4YM9A 3KNXA 5HYOA 3P70B 1K21H 1NROH 2AMQA 6CHAB 3QGNB 3SOSA 4ABAA 2BD3A 3C1KA 3RXFA 1OXGA 2ZGBH 1P8VC 4RKOB 5JBTA 1P09A 3ZVGA 1BTUA 3TVJB 3ZV8A 1AVXA 1CA0C 3GY5A 2XWBI 1H4WA 3BG4C 1CBWB 5JBAS 3ELAH 4K1TA 1K28D 4BXWA 1C2DA 5PTPA 3UOUA 1BDAA 1XUIA 1E36B 4DCDA 4LK4A 2A5AA 3RMMH 2BM2A 1IAUA 1A0JA 2ALVA 1NY22 1GBLA 3S9CA 3PMAB 3UR9A 1AI8H 1CO7E 4NGAH 3AAUA 5BPEA 1Y5AT 3VPKA 1EAUA 5AVDA 2XTTB
chains in the Genus database with same CATH superfamily
1V2PT 1BCUH 2ZTZA 4A92A 2QF5A 3LJOA 1O3EA 4Q4LA 2BXUH 3M5LA 2HPPH 2ZG0H 4AX9H 3RU4T 1TWXB 1Z8JB 1D6WA 2FOEA 3UY9A 4BAOB 1NS3A 2BYAX 1VKYA 1YPGH 2A7CA 4O9VA 5F8XA 4HGCA 1F0TA 1ZZZA 1SGPE 2XC0A 2XBXA 2G00A 5DP6A 2FLBH 3OTPA 4A1TA 7GCHF 1O2MA 1SMFE 1QGFA 3KGPA 1KXDA 1F0RA 4K1SA 2B9LA 4HFPB 2FO9A 3GS9A 2G4TA 2BMGB 1GDUA 1Q31A 1Q2WA 4B6FA 1XUJA 1GJ5H 3MH4A 5A8YA 1W13U 1K9OE 3E1XB 1P2OA 5GCHF 1FX0B 1EZXC 1QB6A 2VWLA 1DUAA 4K1EA 3FZZA 1WQSA 1W0YH 4JMYA 4FUHA 2QF3A 4AFSA 1HDTH 3L3TA 3HK3B 1ZMNA 2ODPA 1P02A 2V7QD 4ZH8A 1O37A 4FETA 2UUYA 5ESTE 3BEIB 4UFFH 3RLWH 1TPOA 2F9BH 2KAIB 5EJZA 2BDIA 1EAXA 2H9EH 4TWWA 3F6UH 2FODA 3BTHE 3SNDA 1ESTA 2OCVB 2P16A 2WPIS 1A5IA 1FJSA 4YLQH 2HNTC 1Y3WA 1CSOE 3GOVB 3MH6A 1XVOA 3M5OA 1WAYB 1T8LA 3KQBA 1XKBC 1HYLA 1HBTH 2CK3D 3S7KB 5K7RA 3A8BA 5F8ZA 2C93B 2F9OA 2OQ5A 1FLEE 4IW4E 4WWYA 4M9FA 1YM0A 1F0UA 1ZPBA 4OGYA 1MU8B 1CBWC 1MTVA 1O3OA 3GICB 3SJOA 2OLGA 2JETB 4NIYA 2W7UA 1O2NA 1WBGB 5C3NA 1GBEA 5E0GA 1HAZB 3Q77A 1E34B 1OYTH 1G3DA 2GKVE 1RIWC 1F5RA 1FI8A 1EAWA 3A82A 5EGMA 4ZXYH 4ZKOU 1GJ4H 1NZQH 1C2HA 1SQAA 5G4BA 1C5LH 4GCHF 4D7GA 2HNTF 3ATLA 2EA3A 2A4OA 4INKA 3A84A 3SZEA 3QK1A 1QBVH 5DP7A 1W7XH 2VH0A 4YOJA 2FM2A 3ZZ3A 5L2ZH 4MLFB 1UK2A 1UTLM 1TE0A 3MO6A 1AZ8A 1ZTJA 2HLDD 2FPZA 4WF8A 4B73A 2FESH 1SBWA 1AMHA 1NT1A 2IOTA 4XBCA 1KYNA 4Y0ZE 1C1NA 1ZSJA 3PV2A 4BTIB 2FEQH 1SI5H 2ZC9H 1HGTH 4IC6A 3T5FH 3U1JB 1YPHC 3F1SB 4CH2B 1AGJA 1LQEA 4B76A 1KXEA 4OGXA 1RTLA 2WSSD 1ZR0A 3LJJA 1A61H 2VIPA 3RXVA 1GHAF 4I8GA 1YLDA 2SGPE 2QF4A 1DUEA 2R3YA 3U1IB 1BJVA 3RC4A 1EPTB 3QUMP 4B74A 3GY6A 4DJZB 4B2AA 5EXLA 1V2MT 3ATKA 1GHVH 1O34A 1TGBA 1MTWA 2BY6X 1G3EA 1CVWH 1O35A 2JDID 3M5MA 3GY8A 2W7SA 1GVZA 2I6QA 1DSUA 1MAYA 1NM6A 5H4IB 2A2QH 1O2YA 1ZOMA 1C9TA 4FUIA 5DK1A 4I7YH 5C67A 3PV4A 3QZRA 5EQQA 4D9QA 1S0RA 1K1IA 4CRDA 1EAIA 1HAVB 2V3HH 4TWYA 1VCPA 1HFDA 4X0WU 1O31A 1V2NT 1SGEE 1P04A 4AC9A 1MTNB 4TY6A 1DX5M 3M37A 3SNCA 2ZQ2A 2LELA 1O3KA 1GBIA 4CR5A 2QN5T 4GSOA 4NWKA 1MBQA 5C5OA 2Y81A 2FI3E 3Q3XA 1SGNE 1C4V2 1YCPK 5HMAA 1QJ6B 3LPRA 2QC2A 4X2VA 3A87A 1MD7A 2RG3A 4CRAA 2HPQH 2P3FH 3ZVDA 2GV7A 2NU2E 1K1LA 4R0IA 1FPCH 3O8DA 3SO3A 1ORFA 1AFEH 2BQWB 4ABDA 3QDZB 3SU1A 3OEHD 2WV4A 1MKWH 2FOAA 1H8IH 1LKBA 1ZSLA 3MO3A 4PROA 4AFQA 3MNXA 3ATMA 3A7YA 1S84A 2P94A 3B9FH 1DWDH 3T27A 1P10A 1KTSB 5IDKA 1HXEH 5ETXA 4MDSA 2BTCE 1MCTA 3IWMA 4FUDA 3ZYEA 2F9PA 2YNBA 3U98H 3ZZDA 4X6MA 2FOBA 1O2UA 4K3JA 1O2TA 3PMBB 1GI0A 4AG1A 3K65B 1O0DH 1O3NA 2TGAA 3T62A 5E0JA 1FIWA 1NFXA 1P3EA 2AHME 3UAIC 1BOQA 3AW0A 4IMZA 1GI1A 3A83A 1PPHE 1TMUH 3B23B 2FYRA 1JBUH 1ETSH 1P05A 1TB6H 1NO9H 1SGCA 5HM9A 3PMHB 4O3UA 5EPNA 2BD7A 5GDSH 4I33A 5EIYA 2G4UA 2EQNA 1QL7A 1EPTC 2K0QA 1INCA 1F7ZA 1HJAB 1G36A 4DURA 2QIQA 1KLIH 2ANKH 3F9HA 3E91A 3QN7A 2ODQA 3CS7A 1O2KA 1SQOA 2HALA 2A2XH 2PKAB 3ZVBA 4UE7H 5DP4A 1U6QA 5FBEA 2XWAA 2JJ1D 1C4Y2 1DXWA 3EAJA 1DOJA 2C8ZB 4Y7BA 4BNRA 5FCKA 2XCNA 4NIXA 1NRPH 2RDEA 2PWXA 1D3PB 2KCAA 5A0AE 1QJ7B 1J16A 2GCTC 2Y6TA 2PGBB 3RXDA 1JIRA 3D23A 3PTBA 4LOYH 1GI8B 2QF0A 3KQCA 5TJXA 1A3EH 2LNCA 3OTJE 4BAMB 1T31A 4IN2A 5JDUB 1TBZH 2JKHA 4RT1A 2F83A 1N8OB 3ZZ5A 2ALPA 1IQGA 4Y0YE 3R0FA 4OS6A 4X2XA 2G51A 3FAOA 3BTWE 4JZFH 2M2AA 4X6OA 3ZV9A 3EE7A 5C0UA 4ZXXH 1VCWA 3M5NA 5EODA 1C2JA 2J95A 4BTTB 4ZMAH 5T6FA 3SW2B 2Y5GA 3QTOH 2H5CA 3TGKE 1J8AA 5EQRA 1GI2A 1KY9A 3LC5A 3RXEA 4CHAC 2A7JA 1BBRE 2ZGCA 2WUCA 2Z9JA 1FIZA 1J15A 1YPJH 4FVBA 1P11E 4ABEA 2VIQA 2BB4A 1FMGA 1WTHD 1CU1A 4MPUA 1ZSKA 1L1GA 3EE0B 4RI0A 1TONA 2IPHA 3BV9B 1UTMA 2YMSD 2BDCA 2G55A 1QIXB 1SR5C 4NFEA 3ODFA 1O2XA 2B7DH 3A80A 3MYWA 5C5NA 1QY6A 1K2I1 1P2KA 1OWJA 5E8EH 5JYIA 4A1XA 2F43B 1O3AA 9LPRA 2M5TA 2FXRA 5ABWA 1UTKA 3CS0A 1TNHA 3BTFE 2P93A 2SFAA 5I25A 1BTXA 4AN7A 3M35A 2XCFA 2R2MB 1V2QT 2XBWA 4D7FA 3V0XA 1EJAA 1O2GH 2UWPA 1SB1H 1RTFB 1TNKA 3SV2H 5GJ4B 2W6ID 1O3JA 1QRXA 2VNTA 3S69A 1IQKA 1QRZA 3SU4A 1LVMA 1BMMH 2CHAB 2OK5A 3W95A 2VVUA 1JOUB 1Z8IB 3AK5A 1K1OA 3PO1B 2HRVA 2NWNA 3UNRA 1H1BA 1C1PA 2R2WU 4DVAU 3KN2A 3TITA 1BMAA 3RM2H 7ESTE 2XXLA 1RRKA 2KFWA 1VITH 1GCTC 5A0BA 2K8IA 4P00A 3VGCC 3SJ9A 4XFQA 1CT0E 4AGKA 3KQEA 2WPKS 2UUKB 2Q6GA 3DT0H 1GJ7B 2H1UA 4OM9A 1QR3E 2ZCKP 1UK4A 1V6DA 3IITA 3LGUA 5L2YH 1BTYA 2YMSC 1C1MA 2ODYB 4AORA 3ZZ7A 1QL8A 2A31A 4JYUH 3SQHE 2PUXB 1N8OC 2AGEX 2KAIA 3QTVH 4ZHMU 4FUCA 5J4SA 1EP6A 4HI3A 3RU4D 1A4WH 5FPTA 1UTJA 1GHYH 3ZZ9A 4U30A 3SUDA 3PMJA 3RDZA 4KGAA 1E0FD 3GCNA 1B0FA 3Q76A 4MTBA 4JZEH 4ZCNA 3M7TA 2WINI 3SZNA 3SUEA 4DOQA 1Y5BT 3FKSD 5EQSA 1A2CH 1EB2A 7LPRA 1IQFA 3HGPA 1AKSA 2OC1A 1G37A 1FY4A 2FOCA 4GVUA 1W10U 2D26C 1WOFA 3A7XA 5EW1H 1TQ0B 3O8BA 4CRBA 1UHBB 1ZHRA 3BTDE 2A7HA 1GI7B 1PPEE 3P8NA 1A5GH 3F2HA 2Y5HA 1YPLH 3RXTA 2FDAA 1PFXC 2ZKSA 3KL6A 1DM4B 3LDXH 4NSYA 2QV1A 4GCHG 1LPGB 4ISLA 1GGDB 1ZTKA 2ZHDA 1C5OH 1SGQE 1GVLA 1K22H 4XOJA 2VWMA 1GHXH 1WU1A 2ZFQH 3CENA 1DWCH 2CMYA 3FZDA 2BLVA 2ZI2H 1WYKA 3RU4E 3TJNA 1FPHH 1TPSA 2PKSB 3SI4H 3M7QA 2FX6A 3Q00A 3VG8A 4H6TA 4FXGH 4XBBA 2P3UB 2BDHA 1KXFA 5HIZA 2PP6A 3MHWU 1TAWA 4VGCB 1Y3VA 2CXVA 5GPIB 3ESTA 3ATIA 3OFND 3SGAE 3SUGA 2P3TB 3RP2A 2EI7A 3SJ8A 5FBIA 1BBRH 4ASHA 1ARCA 1XVMA 2CHAC 2BY7X 3RXKA 2ASUB 3AAVA 3UB0A 3FP8E 4CH8B 2FTLE 2BVSH 2ZU3A 1SOZA 2VWNA 1TGTA 3S9AA 3A81A 2XC5A 1WXRA 1QTFA 4X1QU 1G2MA 3RXPA 1YWUA 1OP0A 2CF9H 1GBJA 1C5VA 1Y59T 3FVFB 4WJG2 4KP0A 1GDQA 2ZTYA 1KXAA 2W3IA 4NA7A 2J98A 2ZNKH 5GWZA 2AGGX 3U8RH 2FWWA 2ZP0H 1C5MD 1QA0A 1JIMA 3OEED 1THRH 3RXQA 2PSXA 3MNSA 2ZDLA 5KEDA 1FY3A 3F3BA 3BEUA 1YGCH 1GBBA 4E05H 1WDIA 1H8DH 4RSPA 4F48B 2TGTA 1OWHA 5DJ7A 4TPIZ 1LCYA 2D8WA 3V12A 3PTNA 1GG6C 2KCOA 1GPZA 3FN8A 1V2LT 3K9XB 1S85A 2EI6A 5AHGH 1X7AC 1BRCE 1AB9C 1GL0E 4B2BA 1TALA 1GJ6A 1O2PA 1GI4A 2PLXA 2WYJA 1PYTC 3VFEA 1L0ZA 3MU5A 3BTGE 3ZVCA 3RXSA 1O3CA 4YTAA 1ETTH 4NIWA 3HGNA 4E7NA 3M3TA 1WSSH 5HM2A 4CRCA 3MWIU 4O3TA 2GX4A 2EY4C 4JYTA 3TU7H 3LGTA 5K0HA 3TK5A 1CA0B 4LZ1H 1WUNH 4AFZA 2R3UA 4WY3A 1O2SA 4J2YB 1Z71A 1L4ZA 2WHXA 1KSNA 1FNIA 1NFUA 1TNJA 2BY9X 1IQMA 1NTPA 5C94A 2VGCB 3V13A 5C1UA 4XSKU 3KIDU 1HV7A 1FAXA 1BMLA 1MU6B 1NESE 2A4GA 3BTQE 2GZ7A 1DE7H 1W14U 1PYTD 3ZIAD 2F9UA 1K1PA 1NN6A 2F91A 2WPLS 3PV5A 4FVDA 4OS2A 1BHXB 3LH1A 1C5YB 1Z1JA 1GMDF 5EU8A 1SGIB 2C8YB 1GJ9B 3GDSA 4WMDA 2BY8X 3U69H 1ZLRA 2ZDMA 2UUFB 2FOMB 1C2FA 1QL9A 2Z9GA 2V3OH 3GCTF 1O2RA 4Y6DA 3DD2H 1AFQC 1V2OT 1SLUB 2UUJB 3E0PB 3H7TA 5L6NH 4DW2U 1GBFA 4B71A 3SJKA 5DP5A 1GL1A 3VB7A 2ZPQA 3MI4A 8ESTE 4SGBE 3A7ZA 2ZDNA 1GHAG 2CJIA 3EGKH 1UTNA 1C5QA 1A3BH 2D1JA 2J94A 3PLBA 1ELFA 4YOIA 3RMLH 2PKAA 3K6ZA 3DFJA 3LGYA 2VWOA 2VBCA 2P95A 2WUBA 1B5GH 2GZ9A 4AG2A 4MPVA 1AWFH 2Q6FA 1IQJA 1DY9A 2Z9IA 5CHAC 1C1TA 2KCPA 1FY8E 3AASA 1QA7A 2WYGA 2LPRA 3QO6A 8KME2 3QZQA 3RXIA 1W2KH 5JBBS 4O03A 2NU1E 1OYQA 2GCTB 1BMNH 3SHAH 1XX9A 1ZRKA 1B7XB 4XBDA 3ZZ6A 1C1VH 4CHAB 3PWBA 1YCPH 1EOLA 1W7GH 1C1QA 2C8XB 7KMEH 5AFZH 1DLEA 3GCHC 4ABGA 3I77A 2XW9A 5LPEA 2DUCA 1PPBH 3GCOA 3SU0A 2P8OB 4XD7D 3M3VA 1MBMA 2IN2A 3BN9A 4Q2KA 2SGDE 2JETC 4ABBA 4UFEH 1EOJA 2VIVA 1KIGH 4NWLA 2ANWA 2BLWA 2O8MA 4A5TS 2F9VA 3D62A 1O39A 5EJ1A 1H9IE 1Z6EA 1RJXB 1DITH 1O2OA 2Z9LA 3P8FA 1PPZA 4U32A 2ANMH 4Y10E 2O9QA 2HVXA 2BOKA 3UWJH 5J4QA 3SBKA 3P92A 1SGYE 3PB1E 3TJUA 1GBAA 3F0OA 2Z3DA 1HXFH 3LGWA 2ZWLH 3FO8D 3E16B 5JB8S 3ZZ4A 2VVVA 1SKYE 1GBCA 2OC0A 4KKDA 5E0HA 1M9UA 1QB9A 1TA6A 3DA9B 1DS2E 1TPPA 1H8ED 1BIOA 2ANYA 2FS8A 4JYVH 4F49A 3MH5A 1SGTA 3A7VA 1NFYA 1GMDG 8GCHF 1V2ST 5DP9A 1TIOA 7GCHG 4I86A 1F0SA 3EQ0H 1UTQA 1D4PB 1HAGE 2FMJA 1P2MA 3PM3A 1VZQH 2PGQB 5EXMA 1YKTA 5TCAA 4UONA 1MH0A 2YMSB 2XRCA 2Z7FE 3DSGA 1H8HD 3NK8A 1N1LA 5CHAB 1JWTA 1XMNB 5EOKA 4ISHH 3KYFA 6ESTA 1PQAA 1TNLA 2TBSA 1VJ9U 1NRNH 3PROA 2BD4A 1ANDA 3I78A 4YO9A 3SI3H 3DFLA 4Y8YA 1Y8TA 1DICA 3GDUA 3VGCB 3VB4A 1CQQA 1W0KD 2FOFA 1GGDC 3SN8A 1TBRH 1Z6JH 1AO5A 3Q3KA 2J38A 1HUTH 1E79D 1HLTH 5T6DA 1LHGH 4ZUHA 2ILNA 4IGDA 4BANB 1GJ8B 1SG8B 4ACBA 2EC9H 1ANBA 1UVUH 3N99A 3E6PH 1P57B 3RXJA 1VITF 4AFUA 1E38B 1ELBA 1YPMH 3KCGH 4VGCC 3S7HB 2G5VA 3RXCA 1GJCB 3FP7E 4I8HA 4D9RA 1AIXH 2ZGXH 2WV9A 1O5DH 1OHHD 1QHRB 2HLCA 4WVPE 1LDTT 1DFPA 1TYNA 1VR1H 2O8UA 3UREA 1Z8RA 3RC6A 1TX7A 2SNVA 1ID5H 3FOAA 3EDXB 1C5TA 2WPHS 1RXPA 3UWIA 1ETRH 3U28C 4GHTA 5GNDA 2PTCE 4M7GA 3ZZ8A 2OXSA 5F53A 3UTUH 1ACBE 4BTUB 3WW7A 1EZQA 2BX4A 4CR9A 1C9PA 3QLPH 4K60A 5AF9H 3RMOH 3A85A 2BX3A 2PR3A 2JJ2D 1O2HA 3VXFH 3F9GA 2OC7A 4NZLA 4TY7A 2Q1JA 1DXPA 1IHSH 5JBCS 4NZQA 1W3CA 3ZVEA 3UNQA 3GY3A 3TLOA 1W8BH 1W12U 2TGDA 4ABIA 2QGRA 4U01A 2ZU5A 3MNBA 2QXIA 1UJ1A 1WTGH 1BZXE 3DSPA 1V2UT 2WPMS 2HVYB 5FPSA 4HTCH 3TGJE 3SNBA 4I32A 1O5BB 2AIPA 3HPTB 1GG6B 4UEHH 1SC8U 1JMOH 1TGNA 5FL7D 1KLTA 1WV7H 5DPAA 1YPHE 1SGRE 4ZHAA 1J14A 3RC5A 1MCVA 1BQYA 4OS5A 2JIZD 4ZROA 1IHTH 1TX8A 1VJAU 3KEEA 1HIAA 1O3LA 3SJIA 1XM1A 3V3MA 2OBQA 1BRBE 1AWHB 1AD8H 1GMCF 1G30B 1BTZA 1GJDB 4RN6A 1ANEA 3BTKE 4H4FA 2VJ1A 4YT6H 3ZZAA 1C5WB 4MNYA 1ELTA 4X8VH 2ZZUH 5CDFE 1SLXB 3QWCH 1FY1A 3TNSA 1S81A 1SFQB 4AYVB 3SYJA 3Q3YA 1UK3A 3RMNH 1P3CA 1QB1A 1UVSH 2HGTH 2J2UA 4WH6A 4Z6AH 2KZ4A 1EATA 1GHBF 3LU9B 1TA2A 2NU3E 2QXJA 1Y3YA 2Z3CA 4AOQA 3DCLA 3AVZA 4ISIH 4RKJB 2ZHWH 2QCYA 2ZDKA 5E2PA 1JRTA 3PYHA 3STIA 1GVKB 4Q7YA 4MPXA 3R3GB 4CBNA 2J34A 5FXLA 6GCHF 2BDBA 1LPKB 2AIQA 4ZAEA 1EUFA 4I8JA 5L30H 2BVXH 1HJAC 4J1YA 5C0TA 2VH6A 4D8NA 1AQ7A 1C5RA 2GT7A 2XBYA 1LVOA 5DG6A 3E90B 3OAAD 4TT3D 1GBHA 1A46H 1C2LA 3URDA 5DSFA 3E0NB 2NU4E 1LPZB 5FCRA 1TRYA 2GT8A 1YPEH 3A7WA 3MU1A 1VITG 1FQ3A 1O3FA 1OPHB 5LH8A 5TCCA 3PLKA 1ARBA 1BTPA 3S9BA 4F4OC 4BAKB 2ZDAH 1TRNA 2Z9KA 4JZDH 4X1PU 1OSSA 2KR7A 3NRLA 1E1RD 1O2LA 2PTNA 5KECA 1O5CB 2ZO3H 1CE5A 3HKIB 1LKAA 2VIOA 3SGBE 4DT4A 2XNIA 2BQ6B 3MMGA 2QY0B 4Z0KA 2TPIZ 3SU6A 4ESTE 1L1NA 1A0LA 1CGJE 2BVRH 4JCNA 1ELCA 3LONA 3WWFA 1UVOA 4GLYA 1UVPA 4B6EA 4NIVA 4X2WA 3RXMA 4AB9A 1YP9A 2ZA5A 1AZZA 2ZFPH 1FDPA 1ZRBA 2ZECA 1HPGA 1P06A 1J9CH 4Y79A 3H5CB 4GAWA 3FANA 3BTEE 4X1SU 3SGQE 3F9FA 8GCHG 3SNAA 2FYQA 3RLYH 1XUHA 4WMEA 1HJ8A 1A1RA 1GCTB 2JH0D 3BEFB 2O8WA 3I29A 1SHHB 2FP7B 2AH4X 1FXYA 1YY3A 2ESTE 2G8TA 2BXTH 1XXDA 2H5DA 1A0HB 5HXFA 1AKSB 1RD3B 1NPMA 3GYMA 4U2WA 1NU7B 2SGEE 4BXSA 1V2WT 1AUJA 3OX7U 4IS5A 5A09A 1QBOA 3GCHB 3MO9A 5LPFA 4K5ZA 2ZGJA 1O2IA 1A5HA 2VB0A 5DGJA 2P8OC 3QX5H 1CGHA 2C3SA 1UMAH 2XOKD 1SSXA 1BJUA 1CGIE 1OOKB 1C1UH 2GDDA 4Y7AA 1HAXB 1C1WH 1LMWB 1PPFE 1UTPA 3L33A 4ISNA 1UO6A 5F03A 4AB8A 5FAHA 1ZJDA 4MG3A 3TNTA 2H9TH 2B0FA 1LHEH 5I46H 2AMDA 1GHBG 3RXUA 3SU2A 4INHA 4ACAA 3BIUH 3ZVAA 2ZFRH 1OWKA 3A7TA 1FUJA 3TJOA 5DP8A 1OP8A 4DY7B 3GY2A 3BG4B 2PFEA 2ZTXA 3GDVA 2ZF0H 4ZKSU 1KDQA 3OYPA 1F5KU 2ZFSA 3TH4H 1O3HA 2F4LA 3UNSA 3UFAA 1LQDB 3T2NA 1HJ9A 2AS9A 1TMBH 4SGAE 1G3BA 1YC0A 2OD3B 3MTYA 1O36A 3T26A 2XYAA 1RGQA 3NXPA 2A5KA 1UVTH 1S6HA 2BD8A 1O2VA 2EEKA 1AVGH 3LKWA 1C2GA 1TOCB 2ZU4A 4NCYA 1C1SA 1S82A 1O3GA 4Y11E 2ULLA 3RXOA 4K2YA 1IQHA 2BHGA 1TNIA 1FN8A 1C1RA 2CV3A 1ESBA 4Y71A 1GJAB 4ZHLU 1AHTH 1P12E 2BOHB 2V6NA 1W0ZU 1QRWA 4BOHA 1S6FA 3UOPA 2FOHA 1HB0B 4JK6A 1YCPM 2QXGA 1QFKH 3A86A 2PV9B 4MNVA 2GCHF 2GGVB 3F2GA 3KYGA 1ABIH 3EA9A 4E7RG 1XUGA 1HAYB 1RIWB 1RFNA 1GMHF 2ZIQH 3EA8A 1EXFA 5GCHG 3SUFA 1ZYOA 4CREA 4THNH 1AU8A 2TGPZ 3RXAA 2ZGHA 3JZ2B 1P2JA 2FLRH 2KM0A 1OWEA 1FN6A 1YLCA 2A45B 3OE7D 1O3PB 4MNWA 1ELEE 2IJD1 2LP6A 1P2NA 2J97A 5KGOA 3WY8A 3TH3H 1NRQH 1HNEE 1O5AB 1V2TT 2GCHG 2ZHFH 1PPGE 4JZ1A 5C20A 1BITA 3P17H 1ZPCA 1QJ1B 1DLKB 4MQAA 2BY5X 3IG6B 1SVPA 1TBQH 4FUBA 1AB9B 3M3SA 3B8JA 3PO1C 3SV9A 1EZUC 4IMQA 1MQ6A 4DG4A 1C5XB 2FOGA 3GISB 5EPYA 1QURH 4DGJA 1GJBB 4FUGA 1MTUA 3U8OH 2SNWA 1EFRD 3LIWA 1SGFA 2VINA 4FUJA 1QNJA 2V35A 1O5EH 1BUIA 4MPWA 2W5EA 1ELAA 2ZQ1A 2J5UA 2AERH 1EZSC 2YOLA 3M7UA 1Y3UA 1HAPH 5IYTA 1W11U 1XKAC 2STAE 2JH5D 1C5ZB 4IBLH 1Y3XA 5T6GA 1CHOG 3S0NA 2ZPSA 4UFDH 4DIHH 1MAXA 1NBME 1J17T 2Z3EA 1H9LB 3HK6B 4IC5A 3UQVA 4JZIA 2FS9A 1IQNA 1LHFH 2B5TB 1O3IA 2RFKC 1HAHH 1BB0B 1TGSZ 1TOMH 4LXBH 2GJGA 1ZHPA 4CRGA 3SV8A 4KTUA 3NCLA 4DT7B 1S0QA 4XE4A 1TFXA 3TH2H 1O3BA 3MU0A 4ABHA 1ELVA 4JK5A 4TSFD 1JRSA 1V2VT 3U9AH 3TPIZ 4B75A 1V3XA 3CP7A 3URCA 1AVWA 1RS0A 3ZZBA 2ZCHP 3HKJB 1SPJA 3W94A 2L6OA 2RCEA 1B0EA 2GD4B 2BLQA 1T8OA 5A8XA 1DWBH 6LPRA 1THSH 1UCYK 5F8TA 2VIWA 1V2KT 1MMJN 2A5IA 3OU0A 4ABJA 1NRSH 2BDYA 3P6ZB 3LOXA 4WH8A 4WXIA 3TK6A 1SGFG 2G81E 1KTTB 1GI3A 5C1YA 4FU9A 4FOUC 1QCPA 4I8KA 1C2IA 1WQVH 3L6PA 3P8OA 2TIOA 5DP3A 2BZ6H 2R9PA 1EJNA 4FU7A 1C5PA 1UHBA 2PW8H 2THFB 4OS4A 2QA9E 2W26A 3RUOA 1FAKH 1T8MA 2STBE 2BQ7B 1MTSA 3E8LA 5AFYH 4KTSA 3ATWA 2ZFFH 2BD5A 2GZ8A 5T1VA 1AE5A 4K8BA 2OQUA 4I8LA 1KLJH 1FONA 2ZU2A 2B8OH 1N6XA 5BRRE 5GXPA 1PQ8A 5T3HA 1NC6A 3VB3A 3FFGA 1GI9B 5LGOA 4E06H 1EQ9A 4X2YA 1LTOA 4UD9H 1D3QB 2VU8E 4NA8A 1IQLA 1EB1H 2FI5E 1K1JA 1MABB 1FZZA 4GHQA 3ZYDA 1ZGIA 2GVFA 2ZFTA 1MQ5A 1L2EA 1HAOH 2V0BA 4TPYA 4WXVA 3A8CA 1VGCB 2WZQA 5JB9S 4Q7ZA 3SQEE 1PJPA 4UFGH 5A8ZA 2ZHQH 3TK9A 1DSTA 2RDLA 1MZDA 1P9SA 1G2LA 3UPEA 3HATH 4OS1A 3PRDA 1IQEA 1BTHH 1A7SA 2OINA 2FX4A 3GY4A 4X6PA 4X8TH 2IPQX 2A4RA 2BZAA 3K2UA 1KXCA 1BHXF 1EPTA 2WPDD 3SHCH 1Y5UT 3LT3A 1XUKA 1CT2E 1XXFA 2PHBA 5A0CA 4CRFA 2HWLB 1UCYH 2O8TA 1ABJH 2G5NA 3KQ5A 4IN1A 1KMHB 1P03A 1MKXH 1QQ4A 4NSVA 4INLA 4I31A 3SNEA 1DANH 1Q3XA 4X8UH 1GMCG 1O2QA 1CT4E 3LH3A 4O97A 2I6SA 1C5SA 1S5SA 4KELA 1KXBA 1D6RA 1AY6H 3BTME 1GBMA 2P59A 3DHKH 2XC4A 1VGCC 1AE8H 1V2JT 4AZ2B 2KX4A 1O33A 3BSQA 1SGDE 4YZUA 2GV6A 2C8WB 1C2EA 3TJVA 2VGCC 3E3TA 3SU3A 2HNTE 3EYDA 2Z94A 1SLWB 1TNGA 3MU8A 1P01A 4ISOA 1BT7A 2BD2A 3LC3A 5C1XA 3O8CA 1SQRA 2OP9A 1UCYE 5C17A 1O2JA 3RXHA 1MKXK 3F68H 5EG4A 2AGIX 1PQ7A 1GBKA 2K1QA 2TRMA 3AW1A 2ZHEH 3N7DA 4K8YA 4Y8XA 3BF6H 2XBVA 3P95A 1K0HA 2W3KA 4Y8ZA 4A7IB 1O5FH 4MVNA 3W1EA 1YF4A 1JXPA 1T4UH 5IK2D 2Y82A 1GCDA 1C1OA 2BDGA 3JZ1B 2VVCA 3NPSA 3K6YA 1O3DA 4KTCA 1PPCE 2WPJS 1GI6A 2RA0A 4DIIH 1BBRK 1D3DB 3GCTG 1CA8B 4ABFA 1BRUP 1QBNA 3P8GA 1O32A 4FU8A 1QZ8A 4X1RU 3PWCA 5DN6D 4F55A 1GBTA 4Y76A 3F0PA 1GMHG 2PKSC 2OTVA 4B1TA 1BA8B 2ZCLP 3A88A 1N6YA 1O2ZA 1GWAA 4GPGA 1NRRH 2A1DB 2OBOA 1FY5A 2H6MA 3FP6E 4GUXA 1ANCA 2F3CE 1NBMD 1RTKA 1MKWK 2UWLA 1C5UA 3H7OA 3ITIA 1C5NH 1LO6A 4OS7A 3T29A 1ESAA 2ZDVH 1CHOF 1FV9A 2QE7D 3U8TH 4YXWD 3RXGA 1G3CA 1ZMJA 2KCYA 3KHVA 2QYIA 3MU4A 1IOEA 3MOCA 2ZPRA 3BG8A 2QAAA 1XUFA 5EXNA 1EKBB 1ZPZA 3NUMA 1IQIA 1YPKH 4XDEA 1YYY1 5EW2H 2CF8H 1HRTH 5F6MA 1WCZA 1UW7A 2PSYA 1OWDA 2BDAA 5FPYA 2XNDD 4TYDA 1P9UA 2ZEBA 3M36A 3MH7A 4X6NA 4CBOA 1DT2A 4FUEA 2FTMA 4X8SH 4X1NU 3ZZCA 2A4QA 2BD9A 1E37B 1HAVA 3UUZA 3A8AA 1GHZA 5B6LA 1H9HE 4ASUD 3D49H 3T25A 3H09A 2CN0H 3BIVH 2G52A 5CE1A 1AN1E 4MNXA 1K1MA 1BTWA 1UTOA 1LVBA 1O38A 3UQOA 1YBWA 3A89A 4Q80A 5FHTA 1EP5A 1O3MA 1Z8GA 3C27B 4A6LA 3ZVFA 2EI8A 2R0KA 1P2IA 3G01A 3RXBA 1LHCH 1C2MA 3GYLB 2Y5FA 2Q6DA 3DUXH 4B2CA 2OC8A 4H6SB 1O5GH 3UIRA 3MFJA 4H42U 3SV7A 4HZHA 4LZ4B 3UR6A 4BAHB 2BLOA 1TABE 1LVYA 3RM0H 1S6LA 3TGIE 1ELGA 2YNAA 1ZGVA 2GP9B 3SORA 4XRNA 3N7OA 3STJA 3VEQB 2Y7ZA 3F9EA 1F5LA 1HCGA 1T8NA 2C4FH 2ZU1A 1SOTA 1MD8A 2PUQH 1OKXA 1GDNA 1PQ5A 2GMTC 3KQDA 1T32A 2L74A 1NU9A 2J4IA 3NKKA 3KF2A 1CHGA 4Q63A 1HAIH 1BRAA 4ZKRU 1OX1A 2D2DA 2AEIH 1Z1IA 1TMTH 2DE9A 1F92A 2HOBA 4YESB 2IJOB 3D65E 1L1JA 3VB5A 9ESTA 2Z6BD 3PLPA 1P0SH 6CHAC 1QQUA 1ZHMA 1TGCA 2AMPA 2A32A 1GHWH 3VXEH 3F2FA 3BTTE 5FX5A 1OS8A 3SV6A 3SU5A 6GCHG 1DY8A 2JH6D 1T4VH 5C2ZA 3ODDA 2DE8A 2Y7XA 2NU0E 2GMTB 1W0JD 1F2SE 1THPB 5CHBA 4BAQB 5LPRA 1ELDE 1Z7KA 1NFWA 2FI4E 1LHDH 2FIRH 2O8LA 1ZJKA 2Y80A 4Z1MD 5E2OA 3MQKC 3M61U 5HGGA 3PRBA 1SFIA 4A1VA 1EX3A 2H9HA 1MTNC 4P02A 2UWOA 4YLUA 1DDJA 5FX6A 1G32B 1SLVB 1TRMA 3WWBA 3LGVA 3NWUA 1O30A 5DO4H 2RA3A 1EJMA 5ESBA 3OY5U 1GI5A 1L4DA 2SGFE 2WV5A 1ZTLA 1K1NA 3OSYA 4UDWH 3LGIA 1C4U2 2AYWA 3OY6U 1DVAH 1BMFD 1GBDA 4R8TB 3ENSB 5B6OA 1ZMLA 4WMFA 2V3MA 3N7EA 4NA9H 3EA7A 5SGAE 3MNCA 2QXHA 3CNRA 3RXRA 2GDEH 2C90B 2R0LA 3GY7A 1T7CA 5HIYA 4ZKNU 2A0QB 2CGAA 4D76A 2OUAA 2SGQE 1G9IE 3A8DA 2F9NA 1TLDA 2SGAA 1VCQA 3V7TA 1MUEB 2AFQB 2H2ZA 5DKMA 1HIAB 4YT7H 4K69A 1TPAE 3RXLA 5A2MH 2J9NA 1MZAA 4NFFA 2VIDA 5CMXH 1SL3A 2J92A 1D9IA 1DWEH 4NG9H 2W6JD 1S83A 1V2RT 3NZIA 4Q7XA 2GTBA 1SQTA 4QT8C 5JPMH 3QGJA 4AYYB 1DPOA 3TIUA 3O8RA 1OP2A 1AUTC 1C2KA 1P2QA 1TX6A 5GIBA 3VB6A 1O2WA 8LPRA 4YOGA 1EASA 3T28A 1SHYA 1D3TB 1KDQB 1TQ7B 4AGJA 2FZZA 1OWIA 1E35B 3DSOA 1AFQB 4FUFA 4YM9A 3KNXA 5HYOA 3P70B 5EJLA 1K21H 4RT0A 1NROH 2AMQA 6CHAB 3QGNB 3SOSA 4ABAA 2BD3A 3C1KA 3RXFA 1YLNA 1OXGA 2ZGBH 1P8VC 4RKOB 5JBTA 1P09A 3ZVGA 1BTUA 3TVJB 3ZV8A 1AVXA 1CA0C 3GY5A 2XWBI 1H4WA 3BG4C 1CBWB 5JBAS 3ELAH 1COWD 4K1TA 1K28D 4BXWA 1C2DA 5PTPA 3UOUA 1BDAA 1XUIA 1E1QD 1E36B 4DCDA 4LK4A 5HKKD 2A5AA 3RMMH 2BM2A 1IAUA 1A0JA 2ALVA 4HG6A 1NY22 1GBLA 3S9CA 3PMAB 3UR9A 1AI8H 1CO7E 4NGAH 2J98B 3AAUA 5BPEA 1Y5AT 3VPKA 1EAUA 5AVDA 2XTTB
chains in the Genus database with same CATH topology
1V2PT 1BCUH 2ZTZA 4A92A 3LJOA 1O3EA 2BXUH 3M5LA 2HPPH 2ZG0H 4AX9H 3RU4T 1TWXB 1Z8JB 1D6WA 2FOEA 3UY9A 4BAOB 1NS3A 2BYAX 1YPGH 2A7CA 4O9VA 5F8XA 4HGCA 1F0TA 1ZZZA 1SGPE 2XC0A 2XBXA 2G00A 5DP6A 2FLBH 4A1TA 7GCHF 1O2MA 1SMFE 1QGFA 3KGPA 1KXDA 1F0RA 4K1SA 2B9LA 4HFPB 2FO9A 2G4TA 2BMGB 1GDUA 1Q31A 1Q2WA 1XUJA 1GJ5H 3MH4A 5A8YA 1W13U 1K9OE 3E1XB 1P2OA 5GCHF 1EZXC 1QB6A 2VWLA 1DUAA 4K1EA 3FZZA 1WQSA 1W0YH 4JMYA 4FUHA 2QF3A 4AFSA 1HDTH 3L3TA 3HK3B 1ZMNA 2ODPA 1P02A 4ZH8A 1O37A 2UUYA 5ESTE 3BEIB 4UFFH 3RLWH 1TPOA 2F9BH 2KAIB 2BDIA 1EAXA 2H9EH 4TWWA 3F6UH 2FODA 3BTHE 3SNDA 1ESTA 2OCVB 2P16A 2WPIS 1A5IA 1FJSA 4YLQH 2HNTC 1Y3WA 1CSOE 3GOVB 3MH6A 1XVOA 3M5OA 1WAYB 1T8LA 3KQBA 1XKBC 1HYLA 1HBTH 3S7KB 5K7RA 3A8BA 5F8ZA 2C93B 2F9OA 2OQ5A 1FLEE 4IW4E 4WWYA 1YM0A 1F0UA 1ZPBA 4OGYA 1MU8B 1CBWC 1MTVA 1O3OA 3GICB 3SJOA 2OLGA 2JETB 4NIYA 2W7UA 1O2NA 1WBGB 5C3NA 1GBEA 5E0GA 1HAZB 3Q77A 1E34B 1OYTH 1G3DA 2GKVE 1RIWC 1F5RA 1FI8A 1EAWA 3A82A 5EGMA 4ZXYH 4ZKOU 1GJ4H 1NZQH 1C2HA 1SQAA 5G4BA 1C5LH 4GCHF 4D7GA 2HNTF 3ATLA 2EA3A 2A4OA 4INKA 3A84A 3QK1A 1QBVH 5DP7A 1W7XH 2VH0A 4YOJA 2FM2A 3ZZ3A 5L2ZH 4MLFB 1UK2A 1UTLM 1TE0A 3MO6A 1AZ8A 1ZTJA 2FPZA 4WF8A 4B73A 2FESH 1SBWA 1AMHA 1NT1A 2IOTA 4XBCA 1KYNA 4Y0ZE 1C1NA 1ZSJA 4BTIB 2FEQH 1SI5H 2ZC9H 1HGTH 4IC6A 3T5FH 3U1JB 1YPHC 3F1SB 4CH2B 1AGJA 1LQEA 4B76A 1KXEA 4OGXA 1RTLA 1ZR0A 3LJJA 1A61H 2VIPA 3RXVA 1GHAF 4I8GA 1YLDA 2SGPE 1DUEA 2R3YA 3U1IB 1BJVA 3RC4A 1EPTB 3QUMP 4B74A 3GY6A 4DJZB 4B2AA 5EXLA 1V2MT 3ATKA 1GHVH 1O34A 1TGBA 1MTWA 2BY6X 1G3EA 1CVWH 1O35A 3M5MA 3GY8A 2W7SA 1GVZA 2I6QA 1DSUA 1MAYA 1NM6A 5H4IB 2A2QH 1O2YA 1ZOMA 1C9TA 4FUIA 5DK1A 4I7YH 5C67A 3PV4A 3QZRA 5EQQA 4D9QA 1S0RA 1K1IA 4CRDA 1EAIA 1HAVB 2V3HH 4TWYA 1VCPA 1HFDA 4X0WU 1O31A 1V2NT 1SGEE 1P04A 1MTNB 4TY6A 1DX5M 3M37A 3SNCA 2ZQ2A 1O3KA 1GBIA 4CR5A 2QN5T 4GSOA 4NWKA 1MBQA 5C5OA 2Y81A 2FI3E 3Q3XA 1SGNE 1C4V2 1YCPK 5HMAA 1QJ6B 3LPRA 2QC2A 4X2VA 3A87A 1MD7A 2RG3A 4CRAA 2HPQH 2P3FH 3ZVDA 2GV7A 2NU2E 1K1LA 4R0IA 1FPCH 3O8DA 3SO3A 1ORFA 1AFEH 2BQWB 4ABDA 3QDZB 3SU1A 2WV4A 1MKWH 2FOAA 1H8IH 1LKBA 1ZSLA 3MO3A 4PROA 4AFQA 3MNXA 3ATMA 3A7YA 1S84A 2P94A 3B9FH 1DWDH 3T27A 1P10A 1KTSB 5IDKA 1HXEH 5ETXA 4MDSA 2BTCE 1MCTA 3IWMA 4FUDA 3ZYEA 2F9PA 2YNBA 3U98H 3ZZDA 4X6MA 2FOBA 1O2UA 4K3JA 1O2TA 3PMBB 1GI0A 4AG1A 3K65B 1O0DH 1O3NA 2TGAA 3T62A 5E0JA 1FIWA 1NFXA 1P3EA 1BOQA 3AW0A 4IMZA 1GI1A 3A83A 1PPHE 1TMUH 3B23B 2FYRA 1JBUH 1ETSH 1P05A 1TB6H 1NO9H 1SGCA 5HM9A 3PMHB 4O3UA 5EPNA 2BD7A 5GDSH 4I33A 2G4UA 1QL7A 1EPTC 1INCA 1F7ZA 1HJAB 1G36A 4DURA 2QIQA 1KLIH 2ANKH 3F9HA 3E91A 3QN7A 2ODQA 3CS7A 1O2KA 1SQOA 2HALA 2A2XH 2PKAB 3ZVBA 4UE7H 5DP4A 1U6QA 5FBEA 2XWAA 1C4Y2 1DXWA 3EAJA 1DOJA 2C8ZB 4Y7BA 4BNRA 5FCKA 2XCNA 4NIXA 1NRPH 2PWXA 1D3PB 5A0AE 1QJ7B 1J16A 2GCTC 2Y6TA 2PGBB 3RXDA 1JIRA 3D23A 3PTBA 4LOYH 1GI8B 2QF0A 3KQCA 5TJXA 1A3EH 2LNCA 3OTJE 4BAMB 1T31A 4IN2A 5JDUB 1TBZH 2JKHA 2F83A 1N8OB 3ZZ5A 2ALPA 1IQGA 4Y0YE 3R0FA 4OS6A 4X2XA 2G51A 3FAOA 3BTWE 4JZFH 4X6OA 3ZV9A 4ZXXH 1VCWA 3M5NA 5EODA 1C2JA 2J95A 4BTTB 4ZMAH 5T6FA 3SW2B 2Y5GA 3QTOH 2H5CA 3TGKE 1J8AA 5EQRA 1GI2A 1KY9A 3LC5A 3RXEA 4CHAC 2A7JA 1BBRE 2ZGCA 2WUCA 2Z9JA 1FIZA 1J15A 1YPJH 4FVBA 1P11E 4ABEA 2VIQA 2BB4A 1FMGA 1WTHD 1CU1A 4MPUA 1ZSKA 1L1GA 3EE0B 1TONA 2IPHA 3BV9B 1UTMA 2BDCA 2G55A 1QIXB 1SR5C 4NFEA 3ODFA 1O2XA 2B7DH 3A80A 3MYWA 5C5NA 1QY6A 1K2I1 1P2KA 1OWJA 5E8EH 5JYIA 4A1XA 1O3AA 9LPRA 2M5TA 2FXRA 5ABWA 1UTKA 3CS0A 1TNHA 3BTFE 2P93A 2SFAA 5I25A 1BTXA 4AN7A 3M35A 2XCFA 2R2MB 1V2QT 2XBWA 4D7FA 3V0XA 1EJAA 1O2GH 2UWPA 1SB1H 1RTFB 1TNKA 3SV2H 5GJ4B 1O3JA 1QRXA 2VNTA 3S69A 1IQKA 1QRZA 3SU4A 1LVMA 1BMMH 2CHAB 3W95A 2VVUA 1JOUB 1Z8IB 1K1OA 3PO1B 2HRVA 2NWNA 3UNRA 1H1BA 1C1PA 2R2WU 4DVAU 3KN2A 3TITA 1BMAA 3RM2H 7ESTE 2XXLA 1RRKA 1VITH 1GCTC 5A0BA 3VGCC 3SJ9A 4XFQA 1CT0E 4AGKA 3KQEA 2WPKS 2UUKB 2Q6GA 3DT0H 1GJ7B 2H1UA 1QR3E 2ZCKP 1UK4A 1V6DA 3IITA 3LGUA 5L2YH 1BTYA 1C1MA 2ODYB 4AORA 3ZZ7A 1QL8A 2A31A 4JYUH 3SQHE 2PUXB 1N8OC 2AGEX 2KAIA 3QTVH 4ZHMU 4FUCA 5J4SA 1EP6A 4HI3A 3RU4D 1A4WH 5FPTA 1UTJA 1GHYH 3ZZ9A 4U30A 3SUDA 3PMJA 3RDZA 4KGAA 1E0FD 3GCNA 1B0FA 3Q76A 4MTBA 4JZEH 3M7TA 2WINI 3SZNA 3SUEA 4DOQA 1Y5BT 5EQSA 1A2CH 1EB2A 7LPRA 1IQFA 3HGPA 1AKSA 2OC1A 1G37A 1FY4A 2FOCA 4GVUA 1W10U 2D26C 1WOFA 3A7XA 5EW1H 1TQ0B 3O8BA 4CRBA 1UHBB 1ZHRA 3BTDE 2A7HA 1GI7B 1PPEE 3P8NA 1A5GH 2Y5HA 1YPLH 3RXTA 2FDAA 1PFXC 2ZKSA 3KL6A 1DM4B 3LDXH 4NSYA 2QV1A 4GCHG 1LPGB 4ISLA 1GGDB 1ZTKA 2ZHDA 1C5OH 1SGQE 1GVLA 1K22H 4XOJA 2VWMA 1GHXH 1WU1A 2ZFQH 3CENA 1DWCH 2CMYA 3FZDA 2BLVA 2ZI2H 1WYKA 3RU4E 3TJNA 1FPHH 1TPSA 2PKSB 3SI4H 3M7QA 2FX6A 3Q00A 4H6TA 4FXGH 4XBBA 2P3UB 2BDHA 1KXFA 3MHWU 1TAWA 4VGCB 1Y3VA 2CXVA 5GPIB 3ESTA 3ATIA 3SGAE 3SUGA 2P3TB 3RP2A 2EI7A 3SJ8A 5FBIA 1BBRH 4ASHA 1ARCA 1XVMA 2CHAC 2BY7X 3RXKA 2ASUB 3AAVA 3FP8E 4CH8B 2FTLE 2BVSH 2ZU3A 1SOZA 2VWNA 1TGTA 3S9AA 3A81A 2XC5A 1QTFA 4X1QU 1G2MA 3RXPA 1OP0A 2CF9H 1GBJA 1C5VA 1Y59T 3FVFB 4WJG2 4KP0A 1GDQA 2ZTYA 1KXAA 2W3IA 4NA7A 2ZNKH 5GWZA 2AGGX 3U8RH 2FWWA 2ZP0H 1C5MD 1QA0A 1JIMA 1THRH 3RXQA 2PSXA 3MNSA 2ZDLA 1FY3A 3BEUA 1YGCH 1GBBA 4E05H 1H8DH 4RSPA 2TGTA 1OWHA 5DJ7A 4TPIZ 1LCYA 2D8WA 3V12A 3PTNA 1GG6C 1GPZA 1V2LT 3K9XB 1S85A 2EI6A 5AHGH 1X7AC 1BRCE 1AB9C 1GL0E 4B2BA 1TALA 1GJ6A 1O2PA 1GI4A 2PLXA 2WYJA 1PYTC 3VFEA 1L0ZA 3MU5A 3BTGE 3ZVCA 3RXSA 1O3CA 4YTAA 1ETTH 4NIWA 3HGNA 4E7NA 3M3TA 1WSSH 5HM2A 4CRCA 3MWIU 4O3TA 2GX4A 4JYTA 3TU7H 3LGTA 5K0HA 3TK5A 1CA0B 4LZ1H 1WUNH 4AFZA 2R3UA 4WY3A 1O2SA 4J2YB 1Z71A 1L4ZA 1KSNA 1FNIA 1NFUA 1TNJA 2BY9X 1IQMA 1NTPA 2VGCB 3V13A 5C1UA 4XSKU 3KIDU 1HV7A 1FAXA 1BMLA 1MU6B 1NESE 2A4GA 3BTQE 2GZ7A 1DE7H 1W14U 1PYTD 2F9UA 1K1PA 1NN6A 2F91A 2WPLS 4FVDA 4OS2A 1BHXB 3LH1A 1C5YB 1Z1JA 1GMDF 5EU8A 1SGIB 2C8YB 1GJ9B 3GDSA 4WMDA 2BY8X 3U69H 1ZLRA 2ZDMA 2UUFB 2FOMB 1C2FA 1QL9A 2Z9GA 2V3OH 3GCTF 1O2RA 4Y6DA 3DD2H 1AFQC 1V2OT 1SLUB 2UUJB 3E0PB 3H7TA 5L6NH 4DW2U 1GBFA 4B71A 3SJKA 5DP5A 1GL1A 3VB7A 2ZPQA 3MI4A 8ESTE 4SGBE 3A7ZA 2ZDNA 1GHAG 2CJIA 3EGKH 1UTNA 1C5QA 1A3BH 2D1JA 2J94A 3PLBA 1ELFA 4YOIA 3RMLH 2PKAA 3K6ZA 3DFJA 3LGYA 2VWOA 2P95A 2WUBA 1B5GH 2GZ9A 4AG2A 4MPVA 1AWFH 2Q6FA 1IQJA 1DY9A 2Z9IA 5CHAC 1C1TA 1FY8E 3AASA 1QA7A 2WYGA 2LPRA 3QO6A 8KME2 3QZQA 3RXIA 1W2KH 5JBBS 4O03A 2NU1E 1OYQA 2GCTB 1BMNH 3SHAH 1XX9A 1ZRKA 1B7XB 4XBDA 3ZZ6A 1C1VH 4CHAB 3PWBA 1YCPH 1EOLA 1W7GH 1C1QA 2C8XB 7KMEH 5AFZH 1DLEA 3GCHC 4ABGA 3I77A 2XW9A 5LPEA 2DUCA 1PPBH 3GCOA 3SU0A 2P8OB 3M3VA 1MBMA 2IN2A 3BN9A 4Q2KA 2SGDE 2JETC 4ABBA 4UFEH 1EOJA 2VIVA 1KIGH 4NWLA 2ANWA 2BLWA 2O8MA 4A5TS 2F9VA 3D62A 1O39A 1H9IE 1Z6EA 1RJXB 1DITH 1O2OA 2Z9LA 3P8FA 1PPZA 4U32A 2ANMH 4Y10E 2O9QA 2HVXA 2BOKA 3UWJH 5J4QA 3SBKA 3P92A 1SGYE 3PB1E 3TJUA 1GBAA 2Z3DA 1HXFH 3LGWA 2ZWLH 3E16B 5JB8S 3ZZ4A 2VVVA 1GBCA 2OC0A 4KKDA 5E0HA 1M9UA 1QB9A 1TA6A 3DA9B 1DS2E 1TPPA 1BIOA 2ANYA 2FS8A 4JYVH 4F49A 3MH5A 1SGTA 3A7VA 1NFYA 1GMDG 8GCHF 1V2ST 5DP9A 1TIOA 7GCHG 1F0SA 3EQ0H 1UTQA 1D4PB 1HAGE 2FMJA 1P2MA 3PM3A 1VZQH 2PGQB 5EXMA 1YKTA 5TCAA 4UONA 1MH0A 2XRCA 2Z7FE 3NK8A 1N1LA 5CHAB 1JWTA 1XMNB 5EOKA 4ISHH 6ESTA 1PQAA 1TNLA 2TBSA 1VJ9U 1NRNH 3PROA 2BD4A 1ANDA 3I78A 4YO9A 3SI3H 3DFLA 4Y8YA 1Y8TA 1DICA 3GDUA 3VGCB 3VB4A 1CQQA 2FOFA 1GGDC 3SN8A 1TBRH 1Z6JH 1AO5A 3Q3KA 2J38A 1HUTH 1HLTH 5T6DA 1LHGH 4ZUHA 2ILNA 4IGDA 4BANB 1GJ8B 1SG8B 2EC9H 1ANBA 1UVUH 3E6PH 1P57B 3RXJA 1VITF 4AFUA 1E38B 1ELBA 1YPMH 3KCGH 4VGCC 3S7HB 2G5VA 3RXCA 1GJCB 3FP7E 4I8HA 4D9RA 1AIXH 2ZGXH 1O5DH 2HLCA 1QHRB 4WVPE 1LDTT 1DFPA 1TYNA 1VR1H 2O8UA 3UREA 1Z8RA 3RC6A 1TX7A 2SNVA 1ID5H 3EDXB 1C5TA 2WPHS 1RXPA 3UWIA 1ETRH 4GHTA 2PTCE 4M7GA 3ZZ8A 2OXSA 3UTUH 1ACBE 4BTUB 1EZQA 2BX4A 4CR9A 1C9PA 3QLPH 4K60A 5AF9H 3RMOH 3A85A 2BX3A 2PR3A 1O2HA 3VXFH 3F9GA 2OC7A 4NZLA 4TY7A 2Q1JA 1DXPA 1IHSH 5JBCS 4NZQA 1W3CA 3ZVEA 3UNQA 3GY3A 3TLOA 1W8BH 1W12U 2TGDA 4ABIA 2QGRA 4U01A 2ZU5A 3MNBA 2QXIA 1UJ1A 1WTGH 1BZXE 2WPMS