3UIRA

Crystal structure of the plasmin-textilinin-1 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
243
Chain Sequence
DCGKPQVEPKKCPVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Plasmin light chain B
publication title The structure of human microplasmin in complex with textilinin-1, an aprotinin-like inhibitor from the Australian brown snake.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 243
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2011-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uirA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uirA01
2BDGA 4IC5A 4MPVA 1C5XB 5EPYA 1T8OA 5J4SA 1N8OC 1NPMA 1GBKA 1DX5M 1ELFA 2G4UA 4X6MA 1QGFA 4UD9H 3A8BA 2AMDA 2ANYA 1TPOA 2GMTB 4R0IA 1C9PA 1CGJE 4BAHB 1YBWA 1WBGB 4B71A 4I7YH 1MMJN 3T2NA 3MO6A 3SJ8A 2V35A 2B7DH 1MD8A 1NU9A 3CP7A 4PROA 1LPKB 2Y80A 1O37A 1A5HA 5DP9A 1RIWC 4TWYA 1IHTH 1O31A 3UOUA 1PYTD 1XVMA 1NFYA 1O2OA 2A5KA 1EAUA 3BTFE 3SV8A 4ABEA 4CBNA 2ESTE 1QBVH 1A0LA 2Y5GA 3A83A 1LVYA 1GHZA 3OY5U 3LGWA 1UVOA 3TGJE 3MU8A 1BMMH 3FP6E 1HRTH 1O35A 5FPSA 1GGDB 3NXPA 3RDZA 5J4QA 3RMLH 3TGKE 2QF0A 1DY8A 1ETTH 1T8NA 3SGBE 4ISNA 2G52A 2OQ5A 1O2RA 3RC6A 3S7HB 1HBTH 1Z8RA 3SUEA 4TY7A 1HAGE 1K1OA 3E0NB 1TBRH 5DP8A 1GMCG 1MKWH 1NO9H 2ZHFH 4NIXA 1E35B 1P03A 2TBSA 5FCRA 1DM4B 4ABAA 1ZYOA 3T27A 2GMTC 2ZHEH 4MDSA 1F2SE 2OUAA 3E16B 2A7HA 1TRMA 1CGHA 2TGAA 1ANCA 1S6HA 3BTME 4MLFB 1O2VA 1C1MA 3ZV8A 1O36A 2J9NA 1ABJH 1C2EA 2H9EH 2XWAA 1HXEH 2FEQH 4ABJA 1F5RA 9LPRA 5SGAE 1QHRB 2VWOA 3SUDA 3QO6A 2WUCA 1OS8A 5A0AE 2FTMA 1DWBH 1EZXC 2SFAA 4HFPB 5C5OA 3SHCH 2R2WU 1ELDE 2I6SA 4KTSA 1GI9B 3ZZ7A 1FZZA 2PTCE 3TGIE 2ZO3H 1ACBE 1ZGVA 3SJOA 1TGSZ 1DWCH 1QJ1B 1UVUH 5DP3A 4CRGA 3UNQA 1O3AA 1V2QT 3F9HA 1D6WA 2ZFTA 1GMDG 3PROA 3P92A 2ZHQH 2ZG0H 1ZSLA 1OOKB 1GJCB 1TPPA 3M35A 4NWKA 1NU7B 2ZU3A 2UUJB 4FUHA 4DIHH 1O3BA 4B76A 1TRYA 1EXFA 4ISHH 3JZ2B 1EZUC 4NA8A 4JZIA 1C4V2 5F03A 4DURA 2XYAA 1AFEH 1SGCA 2BLWA 7LPRA 4K2YA 3EA7A 3LPRA 1NFWA 4NZLA 1AFQB 4Y10E 2HLCA 1SQAA 3QN7A 5TCAA 1GBEA 1O2GH 3R0FA 4K1TA 2YNAA 1P3CA 4AYYB 1WUNH 1ZJKA 2Q1JA 1HFDA 1L1NA 1HB0B 2P94A 1MKXH 3KQEA 1UVTH 3UWIA 2H1UA 1ARCA 1INCA 1W7GH 1FY5A 3P8NA 4NCYA 4A1XA 1BRAA 1LVBA 1TNLA 2F9BH 4YZUA 2AEIH 1AO5A 4GLYA 4D7FA 2R2MB 3DD2H 1HJ9A 2ZA5A 2GZ8A 3M5MA 1H8DH 2A0QB 2W5EA 5GWZA 2Z9LA 4B2AA 4AG1A 3SGAE 4XSKU 1ELVA 1YF4A 2VGCC 3LGYA 2R3UA 3SNEA 4UFGH 1SC8U 2SGFE 3QGJA 5L2YH 1AUJA 1W2KH 4WMFA 3C1KA 1DT2A 4NSYA 2H6MA 1MZDA 3Q3XA 2THFB 3UTUH 4OS7A 3W94A 1LMWB 4FXGH 4YO9A 1AFQC 5DK1A 1H8IH 4JYTA 3PMHB 1VCPA 1Y3XA 1UTKA 1G3DA 3UR6A 3T26A 3MH5A 4CR5A 3PMBB 1CA8B 2SGDE 1BITA 3ATIA 2P95A 3PWCA 4AORA 1D3TB 3ZZ4A 1QL9A 2Q6DA 1Z6EA 2CGAA 1ABIH 1TNJA 1E34B 4I31A 3SNCA 3GOVB 4JK6A 1TA6A 1UCYE 1UTQA 3RXGA 1ELAA 1W7XH 3A82A 7KMEH 1TGCA 2ODQA 4B75A 3V0XA 2BD3A 2FP7B 3SU3A 5HYOA 3MHWU 6CHAB 2TGTA 4NA9H 4JZFH 5E2PA 1CVWH 4DOQA 1YPJH 1H9IE 1V2WT 4JZ1A 2VU8E 1PPCE 1TNHA 1OWDA 1OWHA 1BCUH 5GDSH 1BHXB 2PUXB 2V0BA 1K1PA 4FVBA 2FS9A 1T8LA 5ABWA 3LJJA 4MVNA 2A5AA 2ZEBA 3SN8A 4NA7A 2VINA 1OWJA 2ODYB 1C1RA 1QL8A 1RD3B 4O3UA 5L6NH 5E8EH 1EAXA 1F0SA 1GHAG 2WPHS 1K1NA 4Y11E 1Z7KA 1IQKA 1YC0A 2XW9A 1TX6A 4RKOB 2R3YA 2AGGX 3OSYA 1XXDA 1HAXB 1V2LT 4D9QA 1T4VH 3O8DA 1WYKA 4YESB 2ILNA 3E3TA 2PWXA 4Y8YA 4Y0ZE 4LK4A 5T6FA 1O3DA 1ELTA 2A32A 3ZVAA 4ESTE 1C4Y2 2JH6D 3HK6B 2B8OH 1ANBA 1ETRH 1BBRK 3VGCB 1UO6A 1P2MA 1YLDA 1IOEA 4BXSA 2WUBA 6CHAC 2ANMH 1UJ1A 3RC4A 2ZHDA 1Z8IB 8KME2 1TABE 3M7UA 2FX4A 1J14A 1CBWB 4B2CA 3RXUA 3GCHC 5FX5A 4FUBA 5EQRA 4D8NA 1QNJA 2ZFRH 5C1YA 1GJAB 1C1WH 1LTOA 2PKSC 3KQDA 1P2JA 1NRPH 1QRXA 1MBQA 2C8WB 3FZDA 4TPYA 1ZMLA 1O5DH 2HNTF 2QC2A 2BM2A 1EOLA 2ZU4A 2BDCA 4X1PU 1NESE 2BDIA 1MZAA 1UVPA 4WH8A 4WF8A 2CJIA 1K1LA 2XBXA 6GCHF 4JK5A 1S84A 1LHCH 3KF2A 1L4DA 1C2JA 2Y7XA 3V13A 4MTBA 1CT4E 2R0LA 2C8ZB 1P04A 1EPTA 4I8LA 1NRQH 1GDQA 1YKTA 1V2MT 1V2KT 2D1JA 2BOKA 2EC9H 2CN0H 1GCTB 4KELA 3VGCC 3SORA 3ZV9A 1O2NA 4MPUA 3RXPA 3ZZBA 3AAVA 1LQDB 2A31A 4A6LA 4ZKOU 5HMAA 1OXGA 1IHSH 5TCCA 1E0FD 3EAJA 1CBWC 1GHVH 1LHEH 1N1LA 1QCPA 4GCHF 4DVAU 1ELEE 1SGEE 3FAOA 1DXPA 5DG6A 5FCKA 1GI8B 1H9LB 1AY6H 2AH4X 4AYVB 4Z6AH 1SPJA 2TPIZ 2FZZA 4INHA 4LZ1H 1DSTA 3BIUH 3M36A 3A7WA 3L3TA 3O8BA 1IQGA 4GAWA 3U69H 4TWWA 1VGCB 2P59A 4FUIA 1ZOMA 1A46H 1DLEA 1O32A 3A88A 1K1JA 1VJ9U 1YPHC 2GGVB 3PLPA 1F5LA 1ZRKA 1TGNA 5T6GA 4OS6A 5GIBA 2B5TB 1GBTA 1KTSB 1YPEH 3Q76A 2ZGXH 1KDQA 4ISOA 5LGOA 1GCTC 1XUHA 4X1NU 3GCNA 4ZMAH 4H6TA 3MMGA 1C5VA 2J4IA 1A61H 4YT6H 1NRNH 1V2RT 5E0HA 1Y5BT 3DUXH 4FUJA 2W26A 1FDPA 1QBNA 3F9EA 1Y3UA 1C1NA 4X8TH 2ZGHA 1ID5H 4WVPE 1GBLA 1OYTH 1EKBB 1O2MA 1GI3A 1RGQA 3SOSA 1F0RA 3KQBA 3LGIA 1GI0A 3BG4B 4UE7H 2QA9E 2J34A 1JBUH 3V3MA 2VIQA 3Q3YA 2A2XH 1VGCC 5CMXH 1KXEA 1AE8H 3STJA 3U1IB 1CT0E 3RP2A 1SOZA 1Z1IA 2ULLA 3TPIZ 2P16A 1AMHA 1TBZH 3S69A 4D7GA 5A2MH 1AVGH 4B1TA 2RA3A 3VB7A 2WYJA 2YOLA 3BTKE 2P93A 3BTWE 1EAIA 3L33A 2CHAB 2QXIA 3KNXA 3NZIA 2FX6A 1O3KA 1JWTA 1FQ3A 1VJAU 2BLVA 2ZDNA 4J1YA 4MNXA 5C20A 5C5NA 1C1SA 3M5LA 1SGDE 1YPMH 2NU0E 3MU4A 3SI4H 2H9HA 4KP0A 4Y79A 1GHXH 4WMDA 1O2UA 1LDTT 3E1XB 1GDUA 4XE4A 1FY8E 2ZNKH 1G2LA 3MWIU 3WY8A 1HPGA 3PM3A 3I29A 3SU2A 1TE0A 3BG4C 1XUIA 5BRRE 3A80A 1A2CH 3CS0A 1EATA 3ESTA 1PPFE 1WOFA 1VR1H 3LGUA 2F9VA 5I46H 1CGIE 1AN1E 3EYDA 1PYTC 2ZGCA 3MI4A 4ZROA 4OS2A 1C5LH 2P3FH 2A2QH 1PQ5A 2FOFA 2CHAC 1RS0A 2CXVA 2Y81A 2BB4A 3RMNH 1D3PB 4JCNA 3HKJB 5A8YA 9ESTA 2FS8A 1V2UT 2GX4A 1VZQH 3NUMA 4Y76A 2BTCE 1SHHB 4RSPA 1GG6B 1Y59T 1OWKA 1O3GA 1NS3A 2ZQ2A 3QZRA 2Q6GA 1SLUB 2A4QA 3ATMA 3NWUA 1ZGIA 2BQ6B 3DHKH 4B74A 3GY4A 3QGNB 2OP9A 1QJ6B 1QB1A 1A7SA 2EEKA 3MOCA 3UQVA 2BD7A 3A7VA 2FI5E 2GT8A 2WPJS 5FHTA 4ZKNU 5JB9S 1D9IA 4Y8ZA 1NTPA 3GYLB 1O3FA 2CV3A 1YGCH 1NZQH 3RXRA 1EPTB 2AIQA 1D3DB 4ABHA 1C2DA 2BOHB 2C93B 4INLA 4WY3A 4AN7A 1HAVA 4WWYA 4FU8A 1ZJDA 3QUMP 4ISIH 5GPIB 1O2JA 1ORFA 2ZIQH 1JIRA 2BX3A 2RDLA 1HIAA 3U8TH 6LPRA 1BTZA 4FUGA 2AFQB 5C3NA 4X1SU 3RC5A 1QY6A 2P3TB 3SJKA 1GI7B 3RXJA 3VB5A 5C1UA 1GG6C 1MAXA 1OPHB 1AVWA 1K2I1 3SUFA 3TNSA 2BD4A 4H4FA 4U30A 3LOXA 1DPOA 3IITA 3P8OA 4NIYA 2EA3A 4IBLH 1YCPM 1O2TA 5DGJA 1T32A 5HGGA 1TYNA 1P09A 3ZZ8A 2BVXH 3SU6A 3UIRA 5HM9A 3MNCA 5I25A 3K2UA 1Y5UT 1W12U 2ZTXA 2FOMB 2UUYA 1S5SA 1OP2A 5AFZH 1GL1A 1EPTC 2FPZA 3ODDA 3Q3KA 1DWDH 1P2QA 4QT8C 1C2HA 5GXPA 1PPEE 2BXUH 1C5NH 1LO6A 1KDQB 3OU0A 1G36A 2BY8X 1QB6A 4ZXXH 5LPEA 4Y8XA 4CRDA 5JBCS 1MUEB 1J17T 4JYUH 2EI6A 2PGBB 3GY6A 3SNDA 3RMMH 1SHYA 5DJ7A 1LKAA 3B8JA 4MNYA 1L1GA 1NC6A 1Y5AT 1KLTA 3A87A 3ZYEA 3I78A 3HATH 4DG4A 2CF9H 3E6PH 1EQ9A 3GY8A 2PFEA 3BV9B 6ESTA 1TRNA 1JIMA 3U1JB 3RXCA 5JBTA 4WMEA 2PR3A 3RXOA 1PFXC 1TBQH 1AUTC 1EX3A 1O3MA 2GDDA 4FUDA 1GCDA 1PPZA 1WAYB 1ZTJA 1C5OH 3TH2H 4GUXA 2LNCA 1BTUA 1SB1H 3GDUA 1RTKA 2V3OH 2F9OA 1C1OA 3U8OH 4DT7B 1M9UA 2Z9JA 1RFNA 2ZDLA 1GGDC 2TGDA 2SGAA 1Z8GA 1FPHH 4F4OC 1N6XA 4B73A 1KXCA 1O30A 1MTUA 1Y3WA 1FNIA 3QTOH 4XFQA 3FP7E 3P17H 3E90B 1A5IA 3RXDA 4XOJA 5IYTA 1QQ4A 3VXEH 1EOJA 4K1EA 5JDUB 2PUQH 1P8VC 4CRAA 2FOAA 2Z3CA 2H5CA 3URCA 1SR5C 1V2OT 1GHBF 3C27B 2VIPA 2STBE 2QN5T 2TIOA 1HJ8A 1WQVH 3LONA 1SGTA 4J2YB 1OYQA 1CHOF 2XCFA 3QDZB 3RM2H 3RU4T 4OGYA 4F49A 2G5NA 4IMQA 3KQCA 1E36B 1MQ5A 1SLWB 3RXBA 4I8JA 1QBOA 1GI1A 1WTHD 1SSXA 1TALA 1G9IE 1BDAA 1VITF 1C2MA 2P8OB 1GHYH 1GBHA 1DANH 3MU5A 1XKBC 2BDAA 2SNWA 5T3HA 3T28A 5FXLA 1MBMA 4YM9A 3VB4A 5TJXA 2Z9IA 2BD9A 3BN9A 2VWMA 1J16A 5C67A 3D62A 2FO9A 1GJ6A 2FOCA 1SFIA 1SGFG 1P3EA 1ZPCA 4IN1A 4X6OA 3A7XA 4LXBH 3ENSB 1ZTLA 4ZKSU 3UUZA 2KAIB 2OC8A 8GCHF 1MTNB 1SVPA 1XM1A 1TNIA 2G00A 2XC5A 1LHFH 4CRFA 5AF9H 1XKAC 1OP8A 2FYQA 1SLVB 1VCQA 1LQEA 2AIPA 3RM0H 2PV9B 1J15A 3ZZDA 2G81E 5EOKA 4BOHA 2Y5FA 1O5AB 3H5CB 4DJZB 1XXFA 4UONA 3SV9A 1HAVB 3SJ9A 3D49H 3IG6B 5A0CA 5F8XA 2PW8H 4D9RA 1TOMH 1FY3A 1P0SH 5A8ZA 3SV6A 1QURH 7GCHF 1SLXB 2P8OC 1U6QA 3N7OA 1Z8JB 4FUEA 4NFFA 2ZGBH 4NIWA 1SGFA 1HIAB 4HZHA 2ZU1A 2Q6FA 2Z7FE 4ZAEA 1C1VH 3FP8E 2QV1A 3PMAB 1AGJA 1S0RA 1Z71A 1NFUA 1P9UA 3AVZA 2XCNA 1A5GH 1FLEE 4HTCH 3ZVDA 2GTBA 4OS5A 3E8LA 3RLYH 1MCVA 1FN8A 1MTNC 2FTLE 2G51A 1TWXB 1UTMA 2O8UA 1V2PT 4K8YA 2O9QA 5CHAB 3R3GB 4H42U 4K8BA 3HK3B 1P57B 2XXLA 1GI2A 3H7TA 3RUOA 1HXFH 2FYRA 2VH6A 4OS4A 2BDYA 1C1QA 4ZHMU 2ZCHP 1UCYK 2ZFQH 1Z6JH 5EXMA 2GCHF 1SI5H 1ZMNA 1TNGA 5ESTE 1O38A 2Z9GA 4M7GA 2UWOA 4KTCA 2Y82A 1O3CA 2JH0D 2HNTE 1GJ5H 2ZP0H 3GCOA 1BBRE 2GT7A 5FPYA 2NU1E 1SQTA 1XUFA 1NT1A 2AYWA 4K60A 1O3JA 3BTDE 1JRTA 1F92A 4E7NA 2D26C 2ZCKP 2BY9X 4BAQB 4AGJA 4X8VH 4AB9A 5K0HA 4HGCA 2GKVE 2IOTA 3K6ZA 4ISLA 4ABBA 1XUJA 2F3CE 4U2WA 1WCZA 3GCTF 3RXIA 5DP5A 2AMPA 1NRRH 2GV7A 3GICB 3GDVA 5HM2A 1KIGH 1AKSA 3ZVGA 5CHAC 1TLDA 3UWJH 3VB6A 1YP9A 2ZDMA 4JZDH 1O2WA 1RRKA 3M3VA 1O2SA 4K5ZA 1HAPH 1DLKB 3TJUA 2TRMA 4E7RG 2QF3A 4A1TA 5A8XA 2OC7A 1GI5A 2C4FH 1TAWA 1C2GA 1GVZA 1FN6A 3W95A 1W0ZU 2AGEX 5AVDA 1XX9A 1AVXA 1J9CH 1PQAA 3OTJE 1IAUA 2ZFPH 3ZZCA 2ZDKA 2VVVA 1PPBH 3UNRA 1G30B 1P02A 1PQ7A 3P95A 2ZC9H 3P70B 5GCHF 3BEIB 1S0QA 3S9AA 3TK9A 3ZVEA 4FVDA 1AU8A 1NN6A 3F1SB 1AB9B 2W3KA 5LPRA 3T62A 5E2OA 2ZZUH 3RU4D 2BQ7B 3PO1B 2FMJA 1SGIB 3SJIA 2F83A 2Y5HA 1KYNA 2ZFFH 3H7OA 4TYDA 4CRBA 4BAKB 1FIWA 1UTPA 1A0HB 2RA0A 1TX8A 2A1DB 1V2VT 4R8TB 1DS2E 1YCPK 3BSQA 3AASA 3A85A 2BZ6H 1TONA 3P8GA 3PTNA 4ZH8A 3QX5H 2GZ7A 1GMHF 3TJNA 2FIRH 2WPLS 3K9XB 1O5BB 1AI8H 1QQUA 1W0YH 4YOJA 1G2MA 3OX7U 2BD5A 5JB8S 1F5KU 1TGTA 3E91A 2ZGJA 1LCYA 4VGCB 1Y3YA 4THNH 1GI6A 3T25A 1SQOA 1GVKB 1HYLA 1MU6B 3KEEA 3M5NA 1GBMA 2BVSH 3M37A 5EQQA 1LKBA 3M61U 1C5YB 8ESTE 3K65B 4KTUA 4GHTA 1BHXF 1BBRH 1FV9A 1ZRBA 2EI8A 1SBWA 4A7IB 1O3NA 1A3EH 1HJAB 4NG9H 1AB9C 5FX6A 1QB9A 1CO7E 1NY22 3S0NA 2TGPZ 1TFXA 1THPB 3TITA 1C5PA 1B7XB 4XBBA 1O2KA 4ABFA 1AE5A 4MNWA 2QCYA 2QXHA 2VVUA 4E06H 5FBIA 3ATLA 3FVFB 2PKAA 3SGQE 2IPHA 1DVAH 3PTBA 3NK8A 3PLBA 3MNBA 4UFEH 4Y71A 4AB8A 2UWPA 1BRCE 5EXNA 2ZHWH 1BRUP 4NFEA 1YPKH 2A4RA 5EGMA 2J92A 1QL7A 3BTGE 1EJMA 1DOJA 3DT0H 2JH5D 1O2QA 2O8LA 4YOGA 1D4PB 1B5GH 2JKHA 1RJXB 1THSH 3ZZAA 1WSSH 1C5SA 3A8CA 5E0JA 2XC0A 3DFLA 1BTHH 3SQHE 2FOEA 1H4WA 1GMCF 1KY9A 4CHAB 4ZHAA 1VCWA 4WXVA 5PTPA 4JMYA 1GI4A 1S6FA 3LC5A 1TQ7B 1KSNA 1EJAA 4AFUA 2FDAA 5LPFA 2GP9B 2BXTH 2PHBA 1EZSC 1PPGE 4X2XA 3S7KB 1MH0A 2F9NA 2ANKH 2HWLB 2BLQA 1A1RA 1TQ0B 1L4ZA 1O2HA 1C2FA 4AG2A 3HPTB 4NZQA 1TX7A 2XC4A 4DGJA 1BZXE 4GSOA 3KGPA 1UK4A 1QIXB 4Q7YA 5L2ZH 1PPHE 4SGAE 3D65E 1GJ4H 2GVFA 3LC3A 6GCHG 4X2WA 3RXLA 4CRCA 3ODFA 3OYPA 1AKSB 1AIXH 1Y3VA 4DY7B 2BX4A 1GMDF 3B9FH 4SGBE 2DE8A 2QXJA 1FPCH 4ZKRU 5JBBS 1O3EA 1N8OB 2BD2A 2BD8A 1AD8H 4CHAC 1GBFA 1YM0A 1SGPE 5DP7A 3FZZA 1MKWK 1FAXA 1C5QA 3D23A 7ESTE 3TLOA 4GCHG 3RMOH 4AFQA 2IN2A 1P01A 1EP5A 2A4GA 1BUIA 3A7TA 2AS9A 2NWNA 1FI8A 4K3JA 2GDEH 5H4IB 1G37A 2O8WA 2OBOA 4Y7BA 4X2VA 1GVLA 1GWAA 3BG8A 4DCDA 1HAZB 2VH0A 3FANA 2BY7X 5EPNA 2PSYA 2ZPSA 2H5DA 1C4U2 3GY7A 1LPZB 3EGKH 3RXHA 1G32B 1W13U 2XRCA 1ZSJA 3KL6A 3UQOA 3S9BA 1W8BH 1T31A 2ALPA 1L1JA 3SV2H 3QZQA 3SV7A 1TMTH 4DW2U 1UMAH 2ZQ1A 3NKKA 3LIWA 4MPWA 3MH7A 4IS5A 3TNTA 1ZHPA 2BY5X 2YNBA 3LH3A 1G3CA 1V2NT 3OY6U 5LH8A 1D3QB 1TA2A 3ZVFA 2C8XB 1GHWH 3M7TA 3URDA 4A1VA 1BA8B 4U32A 2FXRA 1JRSA 1O5FH 1GJ7B 1IQFA 2F9UA 3TK5A 3RXSA 2VWLA 4AGKA 3VB3A 4NSVA 1C5ZB 1P9SA 1V6DA 2GCTB 3RXFA 1YYY1 3PV4A 3LGTA 2H2ZA 4X0WU 3A81A 5ESBA 3LJOA 1C2LA 1AWFH 1HAYB 1BMNH 3SBKA 2CMYA 1IQIA 1HAOH 2OQUA 1O5CB 1MKXK 2WV5A 4Y0YE 1ESAA 1CQQA 1FY4A 1B0EA 3T5FH 3V7TA 3SHAH 4TPIZ 2OC1A 1IQMA 2QGRA 2HOBA 5AFYH 4BTTB 1EASA 2FM2A 1MTWA 1GL0E 1BMLA 2FLRH 1C9TA 3F68H 2VIOA 3MH6A 1MU8B 1FIZA 1SGRE 2PKAB 3GYMA 1GJ9B 1GBJA 1KXFA 2A45B 1MTSA 2WPMS 1BIOA 3SUGA 3BTTE 3A86A 4A5TS 1OP0A 1C2IA 3JZ1B 4CH2B 8LPRA 1C1UH 3GDSA 2J94A 3EDXB 1AQ7A 3RLWH 1K22H 2BDHA 1O34A 1THRH 2G5VA 1P10A 3DFJA 4A92A 2GCTC 4INKA 1BRBE 1QJ7B 2HGTH 3K6YA 4WXIA 2VIWA 4YLUA 1O2YA 1SG8B 2K1QA 1ZZZA 2BHGA 2WYGA 1KXAA 3GY3A 2ZCLP 3LH1A 3SU4A 1MCTA 1XUKA 3CENA 1LPGB 3F6UH 1WQSA 1G3BA 1KXBA 1GHAF 3ATWA 5BPEA 4K69A 2XBYA 4WJG2 3TH3H 3IWMA 2F9PA 2QY0B 3UY9A 1B0FA 2PGQB 2JETB 1C1PA 5C1XA 2FOGA 1ZSKA 1DUAA 1SL3A 5DPAA 1S82A 1GPZA 4ZXYH 3ZVBA 1HNEE 2A5IA 2W7SA 1BOQA 1GJBB 1P2OA 1V2TT 4CR9A 1FAKH 4NIVA 1P06A 2DUCA 4X8UH 1P11E 3MNXA 1DFPA 1FY1A 1CT2E 1BTXA 3A8AA 2VNTA 1TB6H 4I8HA 1EB1H 5DKMA 3PMJA 5G4BA 3U9AH 4FUFA 1EAWA 5JYIA 3MFJA 5DO4H 1O5EH 1CSOE 3BEFB 1XUGA 2ZTYA 2VGCB 1GBAA 2FWWA 1J8AA 4XBCA 1JXPA 2XWBI 4FU9A 3AAUA 3HGNA 4BTUB 3STIA 1F0TA 2J95A 1O3HA 4AOQA 5DP6A 1K21H 2Z6BD 4FUCA 2NU2E 1GJ8B 2D8WA 3MTYA 3VXFH 1FJSA 3TU7H 2V6NA 2V3HH 1EJNA 2FOBA 4TY6A 4X1QU 3SZNA 2DE9A 5L30H 4GPGA 1UHBA 2JETC 2W3IA 3A7YA 3UREA 5EXLA 3RXKA 2ZDVH 1CE5A 3VEQB 1Q3XA 4MPXA 3ATKA 4AFZA 1OWIA 1S81A 3U98H 2O8TA 4E05H 2QXGA 5K7RA 4JZEH 3T29A 3UOPA 2OINA 1C5TA 1BJUA 2Z3EA 4X8SH 1GBDA 1TOCB 4ABGA 3M5OA 2Y7ZA 3M7QA 3NCLA 2G55A 2HPQH 5B6OA 2NU4E 1TPAE 3U8RH 4BTIB 3EQ0H 2WV4A 4BAMB 2J38A 2RCEA 2OTVA 3ITIA 1UK3A 3LGVA 3VFEA 1A0JA 1YPGH 4RN6A 3SNBA 2D2DA 1UTOA 2FLBH 4ASHA 5T6DA 3TH4H 1QRZA 1P12E 3F9FA 3SU0A 2HPPH 3SO3A 1D6RA 4X2YA 1G3EA 1ZHRA 3V12A 1SGYE 1JMOH 1LHGH 1Q2WA 1HAIH 1GJDB 1QA0A 1ZLRA 1O0DH 4NGAH 2ALVA 4ABIA 3A8DA 4DIIH 5A09A 5IDKA 2OBQA 1WU1A 4KKDA 1HDTH 1NFXA 3TVJB 1GBCA 5ETXA 1PQ8A 3EA9A 2EI7A 2AERH 1VITH 4X6PA 1T4UH 1BT7A 3TK6A 1A3BH 1RXPA 4UEHH 3GY2A 1QA7A 1RTFB 2HNTC 2HVXA 1ELGA 2A7JA 1ZTKA 2W7UA 3KHVA 3VPKA 1YPLH 4CREA 2ZECA 2QIQA 5FAHA 1DICA 1BMAA 1DXWA 3Q77A 3HGPA 1K1MA 3GCHB 3ZZ3A 1ZHMA 2SGQE 1HCGA 1BJVA 1HLTH 5EU8A 3RXTA 2OD3B 2PKSB 2GZ9A 1NRSH 2AGIX 3UNSA 5EW2H 4XBDA 1MQ6A 4X6NA 1O2XA 1ZMJA 3SNAA 1ZR0A 2BVRH 2QAAA 1O2ZA 4OS1A 1DUEA 1O33A 3RU4E 3RXQA 1UTNA 4I8GA 5AHGH 2WPIS 3BTEE 3RXVA 1EB2A 1EP6A 2ZU5A 4YOIA 1AWHB 1QR3E 4ZHLU 2HALA 3SI3H 1GHBG 1ZPZA 2P3UB 4HI3A 4Q7XA 1DWEH 3UPEA 2WINI 4I8KA 1UTLM 1OSSA 3E0PB 4IMZA 3DA9B 4YT7H 2NU3E 1ESTA 1CHOG 1KTTB 3ZVCA 2WPKS 4AX9H 2ZDAH 1TPSA 2PTNA 4O9VA 1MTVA 3MU1A 3RXMA 2FI3E 2UUKB 1VITG 2ODPA 1IQJA 1UTJA 3GY5A 1H9HE 5EODA 1ANEA 3PLKA 5FBEA 2G4TA 2FOHA 1V2JT 1K9OE 3PB1E 1C5RA 2VB0A 3QTVH 1TGBA 2BLOA 4CBOA 1HV7A 1T8MA 1OX1A 4Q2KA 4JYVH 1IQHA 1Z1JA 2SGPE 1C2KA 3BIVH 1N6YA 2XTTB 3EE0B 1WV7H 1O2LA 1GDNA 1W11U 8GCHG 4D76A 1CHGA 3MU0A 2M5TA 1IQNA 1LVOA 3PYHA 2H9TH 2PLXA 1RTLA 1ESBA 2I6QA 1P05A 3KN2A 3SQEE 1Q31A 3A7ZA 3TJOA 3RXAA 5JBAS 2XBVA 2J2UA 1UCYH 1O3LA 2SGEE 2FI4E 1X7AC 1HUTH 5CE1A 1QRWA 4ZUHA 1P2KA 1UHBB 7GCHG 5A0BA 3BTQE 3FFGA 1O2IA 3MO9A 1JOUB 1P2NA 1GBBA 1S85A 2XNIA 1MD7A 1PJPA 2VIVA 1F7ZA 3F9GA 4B2BA 3MYWA 5F8TA 4Y6DA 4K1SA 1L0ZA 2BZAA 2ZFSA 5FPTA 2CF8H 4UFFH 4AFSA 1NROH 2C90B 2ZI2H 1DY9A 4H6SB 3LU9B 4XDEA 1TMUH 1W3CA 3EA8A 2XBWA 1NM6A 2OC0A 3PO1C 4IW4E 1O5GH 4Q7ZA 3SU1A 1OWEA 4O3TA 3GISB 3QK1A 4IGDA 3L6PA 1ELCA 4CH8B 4BNRA 1AHTH 2AMQA 1ANDA 1FUJA 3TIUA 1O3IA 2HRVA 3A84A 3AW1A 1A4WH 2ZPQA 1CU1A 1F0UA 2GCHG 1YPHE 2VJ1A 4I33A 2FESH 4MQAA 2Z3DA 1TNKA 2UUFB 4IC6A 4Z0KA 1E37B 4VGCC 1QFKH 1BQYA 2BQWB 2F91A 1HGTH 1TIOA 2ZKSA 1C1TA 2OXSA 2GD4B 1FMGA 1S83A 1K1IA 2BMGB 2SNVA 2RG3A 1MAYA 3LDXH 2C3SA 3P6ZB 2VWNA 3M3TA 1W10U 3Q00A 1C5UA 3KIDU 1XVOA 2LPRA 4YTAA 1HAHH 5EW1H 3QLPH 2ASUB 2OLGA 5F8ZA 1DE7H 1CA0B 1O3PB 2Z94A 2ZF0H 3KCGH 5F6MA 1ELBA 1DSUA 2Z9KA 1HJAC 2B0FA 3GCTG 1ARBA 1O2PA 5EG4A 1YLCA 1IQLA 2Y6TA 3S9CA 1EZQA 2OCVB 1IQEA 1Y8TA 1EUFA 1AZ8A 2ZTZA 4I32A 2PSXA 4UDWH 1YCPH 2UWLA 5E0GA 3MO3A 5GJ4B 4MG3A 3BTHE 1XMNB 4AZ2B 1KLIH 2VVCA 1C5WB 4BANB 5DP4A 2ZWLH 4GHQA 4KGAA 3QWCH 3A89A 4OGXA 3O8CA 4LZ4B 1DDJA 1E38B 3LKWA 2B9LA 4WH6A 1V2ST 3NPSA 1AZZA 5C2ZA 3B23B 3ZZ5A 3SU5A 3ELAH 2STAE 1SGNE 2G8TA 4GVUA 3LT3A 3ZYDA 4BAOB 1FONA 3HKIB 2ZPRA 3SW2B 3ZZ9A 1TMBH 3RXEA 2GV6A 1CA0C 3MNSA 4U01A 3O8RA 2ANWA 4Q80A 5GCHG 1ZPBA 1SOTA 1T7CA 1SMFE 4O03A 5EQSA 1UVSH 1SGQE 2VIDA 4RKJB 4Y7AA 2O8MA 4ABDA 3AW0A 3BEUA 3M3SA 3I77A 1UK2A 3MH4A 4X1RU 2C8YB 3BF6H 4YLQH 1L2EA 3P8FA 2FODA 2BDBA 1BTYA 1BB0B 2BY6X 3TJVA 2ZU2A 1O39A 1SFQB 4O97A 3CS7A 2R0KA 1BTPA 1OKXA 1C5MD 1FXYA 2BYAX 1GMHG 2A4OA 3ZZ6A 4LOYH 1DITH 4BXWA 1RIWB 1KLJH 1LHDH 3PWBA 1WTGH 1K28D 3G01A 5HXFA 2KAIA 3UFAA 1BTWA 2A7CA 1P2IA 5JPMH 2IJOB 4UFDH 1QTFA 2R9PA 1KXDA 4FU7A 4IN2A 2QYIA 1GBIA 1LVMA 4MNVA 1ETSH 4NWLA 1W14U 1O3OA 1H1BA 3UR9A 1V3XA
chains in the Genus database with same CATH superfamily
2BDGA 5FL7D 4IC5A 4MPVA 1C5XB 5EPYA 1T8OA 5J4SA 1N8OC 1NPMA 1GBKA 1DX5M 1ELFA 2G4UA 4X6MA 1QGFA 4UD9H 3A8BA 2AMDA 2ANYA 1TPOA 2GMTB 4R0IA 1C9PA 1CGJE 4BAHB 1YBWA 1WBGB 4B71A 4I7YH 1MMJN 3T2NA 5EIYA 3MO6A 3SJ8A 2V35A 2B7DH 1MD8A 1NU9A 3CP7A 4PROA 1LPKB 2Y80A 1O37A 1A5HA 5DP9A 1RIWC 4TWYA 1IHTH 1O31A 3UOUA 1PYTD 1XVMA 1NFYA 1O2OA 2A5KA 1EAUA 3BTFE 3SV8A 4ABEA 4CBNA 2ESTE 4ACBA 1QBVH 1A0LA 2Y5GA 5KECA 3A83A 1LVYA 1GHZA 3OY5U 3LGWA 1UVOA 3TGJE 3MU8A 1BMMH 3FP6E 1HRTH 1O35A 5FPSA 1GGDB 3NXPA 3RDZA 5J4QA 3RMLH 3TGKE 2QF0A 1DY8A 1ETTH 1T8NA 3SGBE 4ISNA 2G52A 2OQ5A 1O2RA 3RC6A 3S7HB 1HBTH 1Z8RA 3SUEA 4TY7A 1HAGE 1K1OA 3E0NB 1TBRH 5DP8A 1GMCG 1MKWH 1NO9H 2ZHFH 4NIXA 1E35B 1P03A 2TBSA 5FCRA 1DM4B 4ABAA 1ZYOA 3T27A 2GMTC 2ZHEH 4MDSA 1F2SE 2OUAA 3E16B 5EJLA 2A7HA 1TRMA 1CGHA 2TGAA 1ANCA 1S6HA 3BTME 4MLFB 1O2VA 1C1MA 3ZV8A 1O36A 2J9NA 1ABJH 1C2EA 2H9EH 2XWAA 1HXEH 2FEQH 4ABJA 1F5RA 9LPRA 5SGAE 1QHRB 3PRDA 3N99A 2VWOA 3SUDA 2WHXA 3QO6A 2WUCA 1OS8A 5A0AE 2FTMA 1DWBH 1EZXC 2SFAA 4HFPB 5C5OA 3SHCH 2R2WU 1ELDE 2I6SA 4KTSA 1GI9B 3ZZ7A 1FZZA 2PTCE 2WSSD 3F2GA 3TGIE 2ZO3H 1ACBE 1ZGVA 2KCAA 3SJOA 1TGSZ 1DWCH 1QJ1B 1UVUH 1K0HA 5DP3A 4CRGA 3UNQA 1O3AA 1V2QT 3F9HA 1D6WA 2ZFTA 1GMDG 3PROA 3P92A 2ZHQH 2ZG0H 1ZSLA 1OOKB 1GJCB 1TPPA 3M35A 4NWKA 5EJ1A 1NU7B 2ZU3A 2UUJB 4FUHA 4DIHH 1O3BA 4XRNA 1UW7A 4B76A 1TRYA 1EXFA 4ISHH 5C0TA 3JZ2B 1EZUC 4NA8A 4JZIA 1C4V2 5F03A 4DURA 2XYAA 1AFEH 1SGCA 2BLWA 2KCOA 3OFND 4K2YA 3EA7A 7LPRA 3LPRA 1NFWA 4NZLA 1AFQB 4Y10E 2HLCA 1SQAA 3QN7A 5TCAA 1GBEA 2QF5A 1O2GH 3R0FA 4K1TA 2YNAA 2EQNA 1P3CA 4AYYB 1WUNH 1ZJKA 2Q1JA 1HFDA 1L1NA 1HB0B 2P94A 1MKXH 3KQEA 1UVTH 3UWIA 2H1UA 1ARCA 4Q4LA 1INCA 1W7GH 1FY5A 3P8NA 4NCYA 4A1XA 1BRAA 1LVBA 1TNLA 2F9BH 2VBCA 4YZUA 2AEIH 1AO5A 4GLYA 4D7FA 2R2MB 3DD2H 1HJ9A 2ZA5A 2GZ8A 3M5MA 1H8DH 2A0QB 2W5EA 5GWZA 2Z9LA 4B2AA 4AG1A 1QZ8A 3SGAE 4XSKU 1ELVA 1YF4A 4Q63A 2XOKD 2VGCC 1W0KD 3LGYA 2R3UA 3SNEA 4UFGH 1SC8U 2SGFE 3QGJA 5L2YH 1AUJA 1W2KH 4P00A 3C1KA 4WMFA 1DT2A 4NSYA 2H6MA 1MZDA 3Q3XA 2THFB 3UTUH 4OS7A 3W94A 1LMWB 4FXGH 4YO9A 1AFQC 5DK1A 1H8IH 4JYTA 3PMHB 1VCPA 1Y3XA 1UTKA 1G3DA 3UR6A 4Z1MD 3T26A 3MH5A 4CR5A 3PMBB 1CA8B 2SGDE 1BITA 3ATIA 2P95A 3PWCA 4AORA 1D3TB 3ZZ4A 1QL9A 2Q6DA 1Z6EA 2CGAA 1ABIH 1SKYE 1E34B 1TNJA 4I31A 3SNCA 3GOVB 4JK6A 1TA6A 1UCYE 1UTQA 3RXGA 1ELAA 1W7XH 3A82A 7KMEH 1TGCA 2ODQA 4B75A 3V0XA 2AHME 2BD3A 2FP7B 3SU3A 5HYOA 3MHWU 6CHAB 2TGTA 4NA9H 4JZFH 5E2PA 1CVWH 4DOQA 1YPJH 1H9IE 1V2WT 4JZ1A 3OAAD 2VU8E 1PPCE 1TNHA 4ASUD 1OWDA 1OWHA 1BCUH 5GDSH 1BHXB 2PUXB 2V0BA 1K1PA 4FVBA 2FS9A 1T8LA 5ABWA 3LJJA 4MVNA 2A5AA 2ZEBA 3SN8A 4NA7A 2VINA 1OWJA 2ODYB 1C1RA 1QL8A 1RD3B 4O3UA 5L6NH 5E8EH 1EAXA 1F0SA 1GHAG 2WPHS 3KYFA 2JDID 1K1NA 4Y11E 1Z7KA 1IQKA 1YC0A 2XW9A 1TX6A 2IPQX 4RKOB 3WWFA 2R3YA 2AGGX 3OSYA 1XXDA 1HAXB 1V2LT 4D9QA 1T4VH 3O8DA 1WYKA 4YESB 2ILNA 3E3TA 2PWXA 4Y8YA 4Y0ZE 4LK4A 5T6FA 1O3DA 1ELTA 2A32A 3ZVAA 4ESTE 1C4Y2 2JH6D 3HK6B 2B8OH 1ANBA 1ETRH 1BBRK 3VGCB 1UO6A 1P2MA 1YLDA 1IOEA 4BXSA 2WUBA 6CHAC 2ANMH 1UJ1A 3RC4A 2ZHDA 1Z8IB 8KME2 2W6ID 1TABE 3M7UA 2FX4A 1J14A 1CBWB 4B2CA 3RXUA 3GCHC 5FX5A 4FUBA 5EQRA 4D8NA 1QNJA 2ZFRH 5C1YA 1GJAB 1C1WH 1LTOA 2PKSC 3OE7D 3KQDA 1P2JA 1NRPH 1QRXA 1MBQA 2C8WB 3FZDA 4TPYA 2HNTF 1O5DH 1ZMLA 2QC2A 2BM2A 1EOLA 2ZU4A 3SZEA 2BDCA 4X1PU 1NESE 5F53A 2BDIA 1MZAA 1UVPA 4WH8A 4WF8A 2CJIA 1K1LA 2XBXA 6GCHF 4JK5A 1S84A 1LHCH 3KF2A 1L4DA 1C2JA 2Y7XA 3V13A 4MTBA 1CT4E 2R0LA 2C8ZB 1P04A 1EPTA 4I8LA 1NRQH 1GDQA 5B6LA 1YKTA 1V2MT 1V2KT 2D1JA 2BOKA 2EC9H 2CN0H 1GCTB 4KELA 3VGCC 3SORA 3ZV9A 1O2NA 4MPUA 3RXPA 3ZZBA 3AAVA 1LQDB 2A31A 4A6LA 4ZKOU 5HMAA 1OXGA 1IHSH 5TCCA 1E0FD 3EAJA 1CBWC 1GHVH 1LHEH 1N1LA 1QCPA 4GCHF 4DVAU 1ELEE 1SGEE 3FAOA 1DXPA 5DG6A 5FCKA 1GI8B 1H9LB 1AY6H 2AH4X 4AYVB 4Z6AH 1SPJA 2TPIZ 2FZZA 4INHA 4LZ1H 1DSTA 3BIUH 3M36A 3A7WA 3L3TA 3O8BA 1IQGA 4GAWA 3U69H 4TWWA 1VGCB 2P59A 4FUIA 2YMSD 1ZOMA 1A46H 1DLEA 1O32A 3A88A 1K1JA 1VJ9U 1YPHC 2GGVB 3PLPA 1F5LA 1ZRKA 1TGNA 5T6GA 4OS6A 5GIBA 2B5TB 1GBTA 1KTSB 1YPEH 3Q76A 2ZGXH 1KDQA 4ISOA 5LGOA 1GCTC 1XUHA 4X1NU 3GCNA 4ZMAH 4H6TA 3MMGA 1C5VA 2J4IA 1A61H 4YT6H 1YLNA 1NRNH 1V2RT 5E0HA 1Y5BT 3DUXH 4FUJA 2W26A 1FDPA 1QBNA 3F9EA 1Y3UA 1C1NA 4X8TH 2ZGHA 1ID5H 4WVPE 1GBLA 1OYTH 4I86A 1EKBB 1O2MA 1GI3A 1RGQA 3SOSA 1F0RA 3KQBA 3LGIA 1GI0A 3BG4B 4UE7H 2QA9E 2J34A 1JBUH 3V3MA 2VIQA 3Q3YA 2A2XH 1VGCC 5CMXH 1KXEA 1AE8H 3F2HA 3STJA 3U1IB 3ZIAD 1NBME 1CT0E 3RP2A 1SOZA 1Z1IA 2ULLA 3TPIZ 2P16A 1AMHA 1TBZH 1H8ED 3S69A 4D7GA 5A2MH 1AVGH 4B1TA 2RA3A 3VB7A 2WYJA 2YOLA 3BTKE 2P93A 3BTWE 1EAIA 3L33A 2CHAB 2QXIA 3KNXA 3NZIA 4YXWD 2FX6A 4ZCNA 3VG8A 5HKKD 1O3KA 1JWTA 3AK5A 1FQ3A 1VJAU 2BLVA 2ZDNA 4J1YA 4MNXA 5C20A 5C5NA 1C1SA 3M5LA 1SGDE 1YPMH 2NU0E 3MU4A 2L6OA 3SI4H 2H9HA 4KP0A 4Y79A 1GHXH 4WMDA 1O2UA 1LDTT 3E1XB 1GDUA 4XE4A 1FY8E 2ZNKH 1G2LA 3MWIU 3WY8A 1HPGA 2V3MA 3PM3A 3I29A 3SU2A 1TE0A 3BG4C 1XUIA 5BRRE 3A80A 1A2CH 3CS0A 1EATA 3ESTA 1PPFE 4RI0A 1WOFA 1VR1H 3LGUA 2F9VA 5I46H 1CGIE 1AN1E 3EYDA 1PYTC 2ZGCA 3MI4A 4ZROA 4OS2A 1C5LH 2P3FH 2A2QH 1PQ5A 2FOFA 2CHAC 1RS0A 2CXVA 2Y81A 2BB4A 3RMNH 1D3PB 2RFKC 4JCNA 3HKJB 5A8YA 9ESTA 2FS8A 1V2UT 2GX4A 1VZQH 3NUMA 4Y76A 2BTCE 1SHHB 2HLDD 4RSPA 1GG6B 1Y59T 1OWKA 1O3GA 1NS3A 2ZQ2A 1E79D 3QZRA 2Q6GA 1SLUB 2A4QA 3FKSD 3ATMA 3NWUA 1ZGIA 2BQ6B 3DHKH 4B74A 3GY4A 3QGNB 2OP9A 1QJ6B 1QB1A 1A7SA 2EEKA 3MOCA 3UQVA 2BD7A 3A7VA 2FI5E 2GT8A 2WPJS 5FHTA 4ZKNU 5JB9S 1D9IA 4Y8ZA 3WWBA 1NTPA 3GYLB 1O3FA 2CV3A 1YGCH 1NZQH 3RXRA 1EPTB 2AIQA 1D3DB 5KEDA 4ABHA 1C2DA 2BOHB 4RT1A 2C93B 4INLA 4WY3A 4AN7A 1HAVA 4WWYA 4FU8A 3DSOA 1ZJDA 3QUMP 4ISIH 3DSPA 5GPIB 1O2JA 1ORFA 2ZIQH 1JIRA 2BX3A 2RDLA 1H8HD 1WDIA 1HIAA 3U8TH 6LPRA 1BTZA 4FUGA 3MQKC 2AFQB 5C3NA 4X1SU 3RC5A 1QY6A 2P3TB 3SJKA 1GI7B 3RXJA 3VB5A 5C1UA 1GG6C 1MAXA 1OPHB 1AVWA 1K2I1 3SUFA 3TNSA 2BD4A 4H4FA 4U30A 3LOXA 1DPOA 3IITA 3KYGA 3P8OA 4NIYA 2EA3A 4IBLH 1YCPM 1O2TA 5DGJA 1T32A 5HGGA 1TYNA 1P09A 3ZZ8A 2BVXH 3SU6A 3UIRA 5HM9A 2J97A 3MNCA 5I25A 3K2UA 1Y5UT 1W12U 2ZTXA 2FOMB 2UUYA 1S5SA 1OP2A 5AFZH 1GL1A 1EPTC 2FPZA 3ODDA 3Q3KA 1DWDH 1P2QA 4QT8C 5KGOA 1C2HA 5GXPA 1PPEE 2BXUH 1C5NH 1LO6A 1KDQB 3OU0A 1G36A 2BY8X 1QB6A 4ZXXH 5LPEA 4Y8XA 4CRDA 5JBCS 1MUEB 1J17T 4JYUH 2EI6A 3KQ5A 2PGBB 3GY6A 3SNDA 3RMMH 1SHYA 1BMFD 5DJ7A 1LKAA 3B8JA 4MNYA 1L1GA 1NC6A 1Y5AT 1KLTA 3A87A 3ZYEA 3I78A 3HATH 5CDFE 3PV2A 2K8IA 4DG4A 2CF9H 3E6PH 1EQ9A 3GY8A 2PFEA 3BV9B 6ESTA 1TRNA 3DCLA 1JIMA 3U1JB 3RXCA 5JBTA 4WMEA 2PR3A 3RXOA 1PFXC 1TBQH 1AUTC 1EX3A 1O3MA 2GDDA 4FUDA 1GCDA 1PPZA 1WAYB 1ZTJA 1C5OH 3TH2H 4GUXA 2LNCA 1BTUA 1SB1H 3GDUA 1RTKA 2V3OH 2F9OA 1C1OA 3U8OH 3W1EA 4DT7B 1M9UA 2Z9JA 1RFNA 2ZDLA 1GGDC 2TGDA 2SGAA 3NRLA 1Z8GA 1FPHH 4F4OC 1N6XA 4B73A 1KXCA 1O30A 1MTUA 1Y3WA 1FNIA 3QTOH 4XFQA 3FP7E 3P17H 3E90B 1A5IA 3RXDA 4XOJA 5IYTA 1QQ4A 3VXEH 1EOJA 4K1EA 5JDUB 2PUQH 1P8VC 4CRAA 2FOAA 2Z3CA 2H5CA 3URCA 1SR5C 5C0UA 1V2OT 1GHBF 3C27B 2VIPA 2STBE 2QN5T 4RT0A 2TIOA 1HJ8A 1WQVH 5HIYA 3LONA 1SGTA 4J2YB 1OYQA 1CHOF 2XCFA 3QDZB 3RM2H 3RU4T 4OGYA 4OM9A 4F49A 2G5NA 4IMQA 3KQCA 1E36B 1MQ5A 1SLWB 3RXBA 4I8JA 1QBOA 1GI1A 1WTHD 1SSXA 1TALA 1G9IE 1BDAA 1VITF 1C2MA 2P8OB 1GHYH 1GBHA 1DANH 3MU5A 1XKBC 1E1QD 2BDAA 2SNWA 5T3HA 5FXLA 3T28A 1MBMA 4YM9A 3VB4A 5TJXA 2Z9IA 2BD9A 3BN9A 2VWMA 1J16A 5C67A 3D62A 2FO9A 1GJ6A 2FOCA 4AC9A 1SFIA 1SGFG 1P3EA 1ZPCA 4IN1A 4X6OA 3A7XA 4LXBH 3ENSB 1ZTLA 4ZKSU 3UUZA 2KAIB 2OC8A 8GCHF 1MTNB 1SVPA 1XM1A 1TNIA 2G00A 2XC5A 1LHFH 4CRFA 5AF9H 1XKAC 1OP8A 2FYQA 1SLVB 1VCQA 1LQEA 2AIPA 3RM0H 2PV9B 2HVYB 1J15A 3ZZDA 2G81E 5EOKA 4BOHA 2Y5FA 1O5AB 3H5CB 4DJZB 1XXFA 4UONA 3SV9A 1HAVB 3SJ9A 3D49H 3IG6B 5A0CA 5F8XA 2PW8H 4D9RA 1TOMH 1FY3A 1P0SH 5A8ZA 3SV6A 1QURH 7GCHF 1SLXB 2P8OC 1U6QA 3N7OA 1Z8JB 4FUEA 4NFFA 2ZGBH 4NIWA 1SGFA 1HIAB 4HZHA 2ZU1A 2Q6FA 2Z7FE 4ZAEA 1C1VH 3FP8E 2QV1A 3PMAB 1AGJA 3U28C 1S0RA 1Z71A 1NFUA 1P9UA 3AVZA 2XNDD 2XCNA 1A5GH 1FLEE 4HTCH 3ZVDA 2GTBA 4OS5A 2YMSB 3E8LA 3RLYH 1MCVA 1FN8A 1MTNC 2FTLE 2G51A 1TWXB 2IJD1 1UTMA 2O8UA 1V2PT 4K8YA 2O9QA 5CHAB 5T1VA 3R3GB 4H42U 4K8BA 4P02A 3HK3B 1P57B 2XXLA 1GI2A 3H7TA 3RUOA 1HXFH 2FYRA 2VH6A 4OS4A 2BDYA 1C1QA 4ZHMU 2ZCHP 1UCYK 2ZFQH 1Z6JH 5EXMA 2GCHF 1SI5H 1ZMNA 1TNGA 5ESTE 1O38A 2Z9GA 4M7GA 2UWOA 4KTCA 2Y82A 1O3CA 2JH0D 2HNTE 4ACAA 1GJ5H 2ZP0H 3GCOA 1BBRE 5C17A 2GT7A 5FPYA 2NU1E 1SQTA 1XUFA 1NT1A 2AYWA 4K60A 1O3JA 3BTDE 1JRTA 1F92A 4E7NA 2D26C 2ZCKP 2BY9X 4BAQB 4AGJA 4X8VH 4AB9A 5K0HA 4HGCA 2GKVE 2IOTA 3K6ZA 4ISLA 4ABBA 1XUJA 2F3CE 4U2WA 1WCZA 3GCTF 3RXIA 2YMSC 2EY4C 5DP5A 2WZQA 2AMPA 1NRRH 2GV7A 3GICB 3GDVA 5HM2A 1KIGH 1AKSA 3ZVGA 5CHAC 1TLDA 3UWJH 4M9FA 3VB6A 1YP9A 3F3BA 2ZDMA 4JZDH 1O2WA 1RRKA 3M3VA 1O2SA 4K5ZA 1HAPH 1DLKB 3TJUA 2TRMA 4E7RG 2QF3A 4A1TA 5A8XA 2OC7A 1GI5A 2C4FH 3FO8D 1TAWA 1C2GA 1GVZA 1FN6A 3W95A 1W0ZU 2AGEX 5AVDA 2PP6A 1XX9A 1AVXA 1J9CH 1PQAA 3OTJE 1IAUA 2ZFPH 3ZZCA 2ZDKA 2VVVA 1PPBH 3UNRA 1G30B 1P02A 1PQ7A 3P95A 2ZC9H 3P70B 5GCHF 3BEIB 1S0QA 3S9AA 3TK9A 4DT4A 3ZVEA 4FVDA 1AU8A 1NN6A 3F1SB 1AB9B 2W3KA 5LPRA 3T62A 5E2OA 2ZZUH 3RU4D 2BQ7B 3PO1B 2FMJA 1SGIB 3SJIA 2F83A 2Y5HA 1KYNA 2ZFFH 3H7OA 4TYDA 4CRBA 4BAKB 1FIWA 1UTPA 1A0HB 2RA0A 1TX8A 2A1DB 1YY3A 1V2VT 4R8TB 1DS2E 1YCPK 3BSQA 3AASA 3A85A 2BZ6H 1TONA 3P8GA 3PTNA 4F55A 4ZH8A 3QX5H 2GZ7A 1GMHF 3TJNA 2FIRH 2WPLS 3K9XB 1O5BB 1AI8H 1QQUA 1W0YH 4YOJA 1G2MA 3OX7U 2BD5A 5JB8S 1F5KU 1TGTA 3E91A 2ZGJA 1LCYA 4VGCB 4HG6A 1Y3YA 4THNH 1GI6A 3T25A 1SQOA 1GVKB 1HYLA 1MU6B 3KEEA 3M5NA 1GBMA 2BVSH 3M37A 5EQQA 1LKBA 3M61U 1C5YB 8ESTE 3K65B 4KTUA 4GHTA 1BHXF 1BBRH 1FV9A 1ZRBA 2EI8A 1SBWA 4A7IB 1O3NA 4FETA 1A3EH 1HJAB 4NG9H 2QE7D 1AB9C 5FX6A 1QB9A 1CO7E 1NY22 3S0NA 2LP6A 2TGPZ 1TFXA 1THPB 3TITA 1C5PA 1B7XB 4XBBA 1O2KA 4ABFA 1AE5A 4MNWA 2QCYA 2QXHA 2VVUA 4E06H 5FBIA 3ATLA 3FVFB 2PKAA 3SGQE 2IPHA 1DVAH 3PTBA 3NK8A 3PLBA 3MNBA 4UFEH 4Y71A 4AB8A 2UWPA 1BRCE 5EXNA 2ZHWH 1BRUP 4NFEA 1YPKH 2A4RA 5EGMA 2J92A 1QL7A 3BTGE 1EJMA 1DOJA 3DT0H 2JH5D 1O2QA 2O8LA 4YOGA 1D4PB 5GNDA 1B5GH 2JKHA 1RJXB 1THSH 3ZZAA 1WSSH 1C5SA 3A8CA 5E0JA 2XC0A 3DFLA 1BTHH 3SQHE 3H09A 2FOEA 1H4WA 1GMCF 1KY9A 4CHAB 4ZHAA 1VCWA 4WXVA 5PTPA 2WPDD 4JMYA 1GI4A 1S6FA 3LC5A 1TQ7B 1KSNA 2KFWA 1EJAA 4AFUA 2FDAA 5LPFA 2GP9B 2BXTH 2PHBA 1EZSC 1PPGE 4X2XA 3S7KB 1MH0A 2F9NA 2ANKH 2HWLB 2BLQA 1A1RA 1TQ0B 1L4ZA 1O2HA 1C2FA 4AG2A 3N7EA 3HPTB 4NZQA 1TX7A 2XC4A 4DGJA 1BZXE 4GSOA 3KGPA 1UK4A 1QIXB 4Q7YA 5L2ZH 1PPHE 4SGAE 3D65E 1GJ4H 2GVFA 3LC3A 6GCHG 1COWD 4X2WA 3RXLA 4CRCA 3ODFA 3OYPA 1AKSB 1AIXH 4F48B 2JJ2D 1Y3VA 3PRBA 4DY7B 2BX4A 1GMDF 3B9FH 4SGBE 2DE8A 2QXJA 1FPCH 4ZKRU 5JBBS 1O3EA 1N8OB 2BD2A 2BD8A 1AD8H 4CHAC 1GBFA 1YM0A 1SGPE 5DP7A 3FZZA 1MKWK 1FAXA 1C5QA 3D23A 7ESTE 3TLOA 4GCHG 3RMOH 4AFQA 2IN2A 1P01A 1EP5A 2A4GA 1BUIA 3A7TA 2AS9A 2KM0A 2NWNA 1FI8A 4K3JA 2GDEH 5H4IB 1G37A 2O8WA 2OBOA 4Y7BA 4X2VA 1GVLA 1GWAA 3BG8A 4DCDA 1HAZB 1WXRA 2VH0A 2J5UA 3FANA 2KR7A 2BY7X 5EPNA 2PSYA 2ZPSA 2H5DA 1C4U2 3GY7A 1LPZB 3EGKH 3RXHA 1G32B 1W13U 2XRCA 1ZSJA 3KL6A 3UQOA 3S9BA 1W8BH 2J98A 1T31A 3FOAA 2ALPA 1L1JA 3SV2H 3QZQA 3SV7A 1TMTH 2KCYA 4DW2U 1UMAH 2ZQ1A 3NKKA 3LIWA 4MPWA 3MH7A 4IS5A 3TNTA 1ZHPA 2BY5X 2YNBA 3LH3A 1G3CA 1V2NT 3OY6U 5LH8A 1D3QB 1TA2A 2F4LA 3ZVFA 2C8XB 1GHWH 3M7TA 3URDA 4A1VA 1BA8B 4U32A 2FXRA 1JRSA 1O5FH 1GJ7B 1IQFA 2F9UA 3TK5A 3RXSA 2VWLA 4AGKA 3VB3A 4NSVA 1C5ZB 1P9SA 1V6DA 2GCTB 3RXFA 1YYY1 3PV4A 3LGTA 2H2ZA 4X0WU 3A81A 5ESBA 3LJOA 1C2LA 1AWFH 1HAYB 1BMNH 3SBKA 2CMYA 1IQIA 1HAOH 2OQUA 1O5CB 1MKXK 2WV5A 4Y0YE 1ESAA 1CQQA 1FY4A 1B0EA 3T5FH 3V7TA 3SHAH 4TPIZ 2OC1A 1IQMA 2QGRA 2HOBA 2M2AA 5AFYH 4BTTB 1EASA 2FM2A 2KX4A 1MTWA 1GL0E 1BMLA 2FLRH 1C9TA 3F68H 2VIOA 3MH6A 1MU8B 1FIZA 1SGRE 2PKAB 3GYMA 1GJ9B 1GBJA 1KXFA 2A45B 5DSFA 1MTSA 2WPMS 1BIOA 3SUGA 3BTTE 3A86A 4A5TS 1OP0A 1C2IA 3JZ1B 4CH2B 8LPRA 1C1UH 3GDSA 2J94A 3EDXB 1AQ7A 3RLWH 1K22H 2BDHA 1O34A 1THRH 2G5VA 1P10A 3DFJA 4A92A 3PV5A 2GCTC 4INKA 1BRBE 1QJ7B 2HGTH 3K6YA 4WXIA 2VIWA 4YLUA 1O2YA 1SG8B 2K1QA 1ZZZA 2BHGA 2W6JD 2WYGA 1KXAA 3GY3A 2ZCLP 3LH1A 3SU4A 1MCTA 1XUKA 3CENA 1LPGB 3F6UH 1WQSA 1G3BA 1KXBA 1GHAF 3ATWA 5BPEA 4K69A 2XBYA 4WJG2 3TH3H 2JIZD 3IWMA 2F9PA 2QY0B 3UY9A 1B0FA 2PGQB 2JETB 1C1PA 5C1XA 2FOGA 1ZSKA 4B6FA 1DUAA 1SL3A 5DPAA 1S82A 1GPZA 4ZXYH 3ZVBA 1HNEE 2A5IA 2W7SA 1BOQA 1GJBB 1P2OA 1V2TT 4CR9A 1FAKH 4NIVA 1P06A 2DUCA 4X8UH 1P11E 3MNXA 1DFPA 1FY1A 1CT2E 1BTXA 3A8AA 2VNTA 2JJ1D 1TB6H 4I8HA 1EB1H 5DKMA 3PMJA 5G4BA 3U9AH 4FUFA 1EAWA 5JYIA 3MFJA 5DO4H 1O5EH 2GJGA 1CSOE 2RDEA 3BEFB 1XUGA 2ZTYA 5EJZA 2VGCB 1GBAA 2FWWA 1J8AA 4XBCA 1JXPA 2XWBI 3OTPA 4TSFD 3FN8A 4FU9A 3AAUA 3HGNA 4BTUB 3STIA 1F0TA 2J95A 5IK2D 1O3HA 4AOQA 5DP6A 1K21H 1OHHD 2Z6BD 4FUCA 2NU2E 1GJ8B 2D8WA 3MTYA 3VXFH 1FJSA 3TU7H 2V6NA 2V3HH 1EJNA 2FOBA 4TY6A 4X1QU 3SZNA 2DE9A 5L30H 4GPGA 1UHBA 2JETC 2W3IA 3A7YA 3UREA 5EXLA 3RXKA 2ZDVH 1CE5A 3VEQB 1Q3XA 4MPXA 3ATKA 4AFZA 1OWIA 1S81A 3U98H 2O8TA 4E05H 2QXGA 5K7RA 4JZEH 2CK3D 3T29A 3UOPA 2OINA 1C5TA 1BJUA 2Z3EA 4X8SH 2L74A 1GBDA 1TOCB 4ABGA 3M5OA 2Y7ZA 3M7QA 3NCLA 2G55A 2HPQH 3CNRA 5B6OA 2NU4E 1TPAE 3U8RH 4BTIB 3EQ0H 2WV4A 4BAMB 2J38A 2RCEA 2OTVA 3ITIA 1UK3A 3LGVA 3VFEA 1A0JA 1YPGH 3OEED 4RN6A 3SNBA 2D2DA 1UTOA 2FLBH 3F0PA 5T6DA 4ASHA 2J98B 1FX0B 3TH4H 1QRZA 1P12E 3F9FA 3SU0A 2HPPH 3SO3A 1D6RA 4X2YA 1G3EA 1ZHRA 3V12A 1SGYE 1JMOH 1LHGH 1Q2WA 1HAIH 1GJDB 1QA0A 1ZLRA 1O0DH 4NGAH 2ALVA 4ABIA 3A8DA 4DIIH 5A09A 5IDKA 2OBQA 1WU1A 4KKDA 1HDTH 1NFXA 3TVJB 1GBCA 5ETXA 1PQ8A 3EA9A 2EI7A 2AERH 1VITH 4X6PA 1T4UH 1BT7A 3TK6A 1A3BH 1RXPA 4UEHH 3GY2A 1QA7A 1RTFB 2HNTC 2KCPA 2HVXA 3EE7A 1ELGA 2A7JA 1ZTKA 2W7UA 3KHVA 3VPKA 1YPLH 4CREA 2ZECA 2QIQA 5FAHA 1DICA 1BMAA 1DXWA 3Q77A 3HGPA 1K1MA 3GCHB 4FOUC 3ZZ3A 1ZHMA 2SGQE 1HCGA 1BJVA 1HLTH 5EU8A 3RXTA 2OD3B 2PKSB 3GS9A 2GZ9A 1NRSH 2AGIX 3UNSA 5EW2H 4XBDA 1MQ6A 4X6NA 1O2XA 1ZMJA 3SNAA 1ZR0A 2BVRH 2QAAA 1O2ZA 4OS1A 1DUEA 1O33A 3RU4E 3RXQA 1UTNA 4I8GA 5AHGH 2WPIS 3BTEE 3RXVA 1EB2A 1EP6A 2ZU5A 4YOIA 2K0QA 1AWHB 1QR3E 4ZHLU 2HALA 4TT3D 3SI3H 1GHBG 1ZPZA 2P3UB 4HI3A 4Q7XA 1DWEH 3UPEA 2WINI 4I8KA 1UTLM 1OSSA 3E0PB 4IMZA 3DA9B 4YT7H 2NU3E 1ESTA 5CHBA 1CHOG 1KTTB 3ZVCA 2WPKS 4AX9H 2ZDAH 1TPSA 2PTNA 4O9VA 1MTVA 3MU1A 3RXMA 2FI3E 2UUKB 1VITG 2ODPA 1IQJA 1UTJA 3GY5A 1H9HE 5EODA 1ANEA 3PLKA 5FBEA 2G4TA 2FOHA 1V2JT 1K9OE 3PB1E 1C5RA 2VB0A 3QTVH 1TGBA 2BLOA 4CBOA 1HV7A 1T8MA 1OX1A 4Q2KA 4JYVH 1IQHA 1Z1JA 2SGPE 1C2KA 3BIVH 1N6YA 2XTTB 3EE0B 1WV7H 1O2LA 1GDNA 1W11U 8GCHG 4D76A 1CHGA 3MU0A 2M5TA 1IQNA 1LVOA 3PYHA 2H9TH 2PLXA 1RTLA 1ESBA 2I6QA 1P05A 3KN2A 3SQEE 2QF4A 1Q31A 3A7ZA 3TJOA 3RXAA 5JBAS 2XBVA 2J2UA 1UCYH 1O3LA 2SGEE 2FI4E 1X7AC 1HUTH 5CE1A 1QRWA 4ZUHA 3UB0A 1P2KA 1UHBB 1MABB 7GCHG 5A0BA 3BTQE 3FFGA 1O2IA 3MO9A 1JOUB 1P2NA 1GBBA 1S85A 2XNIA 1MD7A 1PJPA 2VIVA 1F7ZA 3F9GA 4B2BA 3MYWA 5F8TA 4Y6DA 4K1SA 1L0ZA 2BZAA 2ZFSA 5FPTA 2CF8H 4UFFH 4AFSA 1NROH 2C90B 2ZI2H 1DY9A 4H6SB 3LU9B 4XDEA 1TMUH 1W3CA 3EA8A 2XBWA 1NM6A 2OC0A 3PO1C 4IW4E 1O5GH 4Q7ZA 3SU1A 5DN6D 1OWEA 4O3TA 3GISB 3QK1A 4IGDA 3L6PA 1ELCA 4CH8B 4BNRA 1AHTH 2AMQA 1ANDA 1FUJA 3TIUA 1O3IA 2HRVA 3A84A 3AW1A 1A4WH 2ZPQA 1CU1A 1F0UA 2OK5A 2GCHG 1YPHE 2VJ1A 4I33A 2FESH 4MQAA 2Z3DA 1TNKA 2UUFB 3SYJA 4IC6A 4Z0KA 1E37B 4VGCC 3N7DA 1QFKH 1BQYA 2BQWB 2F91A 1HGTH 1TIOA 2ZKSA 1C1TA 2GD4B 2OXSA 1FMGA 1S83A 1KMHB 1K1IA 2BMGB 2SNVA 1W0JD 2RG3A 5C94A 2V7QD 1MAYA 3LDXH 2C3SA 3P6ZB 2VWNA 3M3TA 1W10U 3Q00A 1C5UA 3KIDU 1XVOA 2LPRA 4YTAA 1HAHH 5EW1H 3QLPH 2ASUB 1E1RD 2OLGA 5F8ZA 1DE7H 1CA0B 1O3PB 2Z94A 2ZF0H 3KCGH 5F6MA 1ELBA 1DSUA 2Z9KA 1HJAC 2B0FA 3GCTG 1ARBA 1O2PA 5EG4A 1YLCA 1IQLA 2Y6TA 3S9CA 1EZQA 2OCVB 1IQEA 1Y8TA 1EUFA 1S6LA 1AZ8A 2ZTZA 4I32A 2PSXA 4UDWH 5HIZA 1YCPH 2UWLA 5E0GA 3MO3A 5GJ4B 4MG3A 3BTHE 1YWUA 1XMNB 4AZ2B 3UAIC 1KLIH 2VVCA 1C5WB 4BANB 3DSGA 5DP4A 2ZWLH 4GHQA 4KGAA 3QWCH 4B6EA 3A89A 4OGXA 3O8CA 4LZ4B 1DDJA 1E38B 3LKWA 2B9LA 4WH6A 1V2ST 1SQRA 3NPSA 1AZZA 5C2ZA 3B23B 3ZZ5A 3F2FA 3SU5A 3ELAH 2WV9A 2STAE 3WW7A 1SGNE 2G8TA 4GVUA 3LT3A 3ZYDA 4BAOB 1FONA 3HKIB 2ZPRA 3SW2B 3ZZ9A 1TMBH 2LELA 3RXEA 3OEHD 2GV6A 1CA0C 3MNSA 4U01A 3O8RA 2ANWA 4Q80A 5GCHG 1ZPBA 1SOTA 1T7CA 1SMFE 4O03A 5EQSA 1UVSH 1SGQE 2VIDA 4RKJB 4Y7AA 1NBMD 2O8MA 1VKYA 4ABDA 3AW0A 3BEUA 3M3SA 3I77A 1UK2A 3MH4A 4X1RU 2C8YB 3BF6H 4YLQH 1L2EA 3P8FA 2FODA 2BDBA 1BTYA 1BB0B 2BY6X 3TJVA 2ZU2A 1O39A 1SFQB 4O97A 3CS7A 2R0KA 1BTPA 1OKXA 1C5MD 1FXYA 2BYAX 1GMHG 2KZ4A 2A4OA 3ZZ6A 4LOYH 3F0OA 1DITH 1EFRD 4BXWA 1RIWB 1KLJH 1LHDH 3PWBA 1WTGH 1K28D 3G01A 5HXFA 2KAIA 3UFAA 1BTWA 2A7CA 1P2IA 5JPMH 2IJOB 4UFDH 1QTFA 2R9PA 1KXDA 4FU7A 4IN2A 2QYIA 1GBIA 1LVMA 4XD7D 4MNVA 1ETSH 4NWLA 1W14U 1O3OA 2F43B 1H1BA 3UR9A 1V3XA
chains in the Genus database with same CATH topology
2BDGA 4IC5A 4MPVA 1C5XB 5EPYA 1T8OA 5J4SA 1N8OC 1NPMA 1GBKA 1DX5M 1ELFA 2G4UA 4X6MA 1QGFA 4UD9H 3A8BA 2AMDA 2ANYA 1TPOA 2GMTB 4R0IA 1C9PA 1CGJE 4BAHB 1YBWA 1WBGB 4B71A 4I7YH 1MMJN 3T2NA 3MO6A 3SJ8A 2V35A 2B7DH 1MD8A 1NU9A 3CP7A 4PROA 1LPKB 2Y80A 1O37A 1A5HA 5DP9A 1RIWC 4TWYA 1IHTH 1O31A 3UOUA 1PYTD 1XVMA 1NFYA 1O2OA 2A5KA 1EAUA 3BTFE 3SV8A 4ABEA 4CBNA 2ESTE 1QBVH 1A0LA 2Y5GA 3A83A 1LVYA 1GHZA 3OY5U 3LGWA 1UVOA 3TGJE 3MU8A 1BMMH 3FP6E 1HRTH 1O35A 5FPSA 1GGDB 3NXPA 3RDZA 5J4QA 3RMLH 3TGKE 2QF0A 1DY8A 1ETTH 1T8NA 3SGBE 4ISNA 2G52A 2OQ5A 1O2RA 3RC6A 3S7HB 1HBTH 1Z8RA 3SUEA 4TY7A 1HAGE 1K1OA 3E0NB 1TBRH 5DP8A 1GMCG 1MKWH 1NO9H 2ZHFH 4NIXA 1E35B 1P03A 2TBSA 5FCRA 1DM4B 4ABAA 1ZYOA 3T27A 2GMTC 2ZHEH 4MDSA 1F2SE 2OUAA 3E16B 2A7HA 1TRMA 1CGHA 2TGAA 1ANCA 1S6HA 3BTME 4MLFB 1O2VA 1C1MA 3ZV8A 1O36A 2J9NA 1ABJH 1C2EA 2H9EH 2XWAA 1HXEH 2FEQH 4ABJA 1F5RA 9LPRA 5SGAE 1QHRB 2VWOA 3SUDA 3QO6A 2WUCA 1OS8A 5A0AE 2FTMA 1DWBH 1EZXC 2SFAA 4HFPB 5C5OA 3SHCH 2R2WU 1ELDE 2I6SA 4KTSA 1GI9B 3ZZ7A 1FZZA 2PTCE 3TGIE 2ZO3H 1ACBE 1ZGVA 3SJOA 1TGSZ 1DWCH 1QJ1B 1UVUH 5DP3A 4CRGA 3UNQA 1O3AA 1V2QT 3F9HA 1D6WA 2ZFTA 1GMDG 3PROA 3P92A 2ZHQH 2ZG0H 1ZSLA 1OOKB 1GJCB 1TPPA 3M35A 4NWKA 1NU7B 2ZU3A 2UUJB 4FUHA 4DIHH 1O3BA 4B76A 1TRYA 1EXFA 4ISHH 3JZ2B 1EZUC 4NA8A 4JZIA 1C4V2 5F03A 4DURA 2XYAA 1AFEH 1SGCA 2BLWA 7LPRA 4K2YA 3EA7A 3LPRA 1NFWA 4NZLA 1AFQB 4Y10E 2HLCA 1SQAA 3QN7A 5TCAA 1GBEA 1O2GH 3R0FA 4K1TA 2YNAA 1P3CA 4AYYB 1WUNH 1ZJKA 2Q1JA 1HFDA 1L1NA 1HB0B 2P94A 1MKXH 3KQEA 1UVTH 3UWIA 2H1UA 1ARCA 1INCA 1W7GH 1FY5A 3P8NA 4NCYA 4A1XA 1BRAA 1LVBA 1TNLA 2F9BH 4YZUA 2AEIH 1AO5A 4GLYA 4D7FA 2R2MB 3DD2H 1HJ9A 2ZA5A 2GZ8A 3M5MA 1H8DH 2A0QB 2W5EA 5GWZA 2Z9LA 4B2AA 4AG1A 3SGAE 4XSKU 1ELVA 1YF4A 2VGCC 3LGYA 2R3UA 3SNEA 4UFGH 1SC8U 2SGFE 3QGJA 5L2YH 1AUJA 1W2KH 4WMFA 3C1KA 1DT2A 4NSYA 2H6MA 1MZDA 3Q3XA 2THFB 3UTUH 4OS7A 3W94A 1LMWB 4FXGH 4YO9A 1AFQC 5DK1A 1H8IH 4JYTA 3PMHB 1VCPA 1Y3XA 1UTKA 1G3DA 3UR6A 3T26A 3MH5A 4CR5A 3PMBB 1CA8B 2SGDE 1BITA 3ATIA 2P95A 3PWCA 4AORA 1D3TB 3ZZ4A 1QL9A 2Q6DA 1Z6EA 2CGAA 1ABIH 1TNJA 1E34B 4I31A 3SNCA 3GOVB 4JK6A 1TA6A 1UCYE 1UTQA 3RXGA 1ELAA 1W7XH 3A82A 7KMEH 1TGCA 2ODQA 4B75A 3V0XA 2BD3A 2FP7B 3SU3A 5HYOA 3MHWU 6CHAB 2TGTA 4NA9H 4JZFH 5E2PA 1CVWH 4DOQA 1YPJH 1H9IE 1V2WT 4JZ1A 2VU8E 1PPCE 1TNHA 1OWDA 1OWHA 1BCUH 5GDSH 1BHXB 2PUXB 2V0BA 1K1PA 4FVBA 2FS9A 1T8LA 5ABWA 3LJJA 4MVNA 2A5AA 2ZEBA 3SN8A 4NA7A 2VINA 1OWJA 2ODYB 1C1RA 1QL8A 1RD3B 4O3UA 5L6NH 5E8EH 1EAXA 1F0SA 1GHAG 2WPHS 1K1NA 4Y11E 1Z7KA 1IQKA 1YC0A 2XW9A 1TX6A 4RKOB 2R3YA 2AGGX 3OSYA 1XXDA 1HAXB 1V2LT 4D9QA 1T4VH 3O8DA 1WYKA 4YESB 2ILNA 3E3TA 2PWXA 4Y8YA 4Y0ZE 4LK4A 5T6FA 1O3DA 1ELTA 2A32A 3ZVAA 4ESTE 1C4Y2 2JH6D 3HK6B 2B8OH 1ANBA 1ETRH 1BBRK 3VGCB 1UO6A 1P2MA 1YLDA 1IOEA 4BXSA 2WUBA 6CHAC 2ANMH 1UJ1A 3RC4A 2ZHDA 1Z8IB 8KME2 1TABE 3M7UA 2FX4A 1J14A 1CBWB 4B2CA 3RXUA 3GCHC 5FX5A 4FUBA 5EQRA 4D8NA 1QNJA 2ZFRH 5C1YA 1GJAB 1C1WH 1LTOA 2PKSC 3KQDA 1P2JA 1NRPH 1QRXA 1MBQA 2C8WB 3FZDA 4TPYA 1ZMLA 1O5DH 2HNTF 2QC2A 2BM2A 1EOLA 2ZU4A 2BDCA 4X1PU 1NESE 2BDIA 1MZAA 1UVPA 4WH8A 4WF8A 2CJIA 1K1LA 2XBXA 6GCHF 4JK5A 1S84A 1LHCH 3KF2A 1L4DA 1C2JA 2Y7XA 3V13A 4MTBA 1CT4E 2R0LA 2C8ZB 1P04A 1EPTA 4I8LA 1NRQH 1GDQA 1YKTA 1V2MT 1V2KT 2D1JA 2BOKA 2EC9H 2CN0H 1GCTB 4KELA 3VGCC 3SORA 3ZV9A 1O2NA 4MPUA 3RXPA 3ZZBA 3AAVA 1LQDB 2A31A 4A6LA 4ZKOU 5HMAA 1OXGA 1IHSH 5TCCA 1E0FD 3EAJA 1CBWC 1GHVH 1LHEH 1N1LA 1QCPA 4GCHF 4DVAU 1ELEE 1SGEE 3FAOA 1DXPA 5DG6A 5FCKA 1GI8B 1H9LB 1AY6H 2AH4X 4AYVB 4Z6AH 1SPJA 2TPIZ 2FZZA 4INHA 4LZ1H 1DSTA 3BIUH 3M36A 3A7WA 3L3TA 3O8BA 1IQGA 4GAWA 3U69H 4TWWA 1VGCB 2P59A 4FUIA 1ZOMA 1A46H 1DLEA 1O32A 3A88A 1K1JA 1VJ9U 1YPHC 2GGVB 3PLPA 1F5LA 1ZRKA 1TGNA 5T6GA 4OS6A 5GIBA 2B5TB 1GBTA 1KTSB 1YPEH 3Q76A 2ZGXH 1KDQA 4ISOA 5LGOA 1GCTC 1XUHA 4X1NU 3GCNA 4ZMAH 4H6TA 3MMGA 1C5VA 2J4IA 1A61H 4YT6H 1NRNH 1V2RT 5E0HA 1Y5BT 3DUXH 4FUJA 2W26A 1FDPA 1QBNA 3F9EA 1Y3UA 1C1NA 4X8TH 2ZGHA 1ID5H 4WVPE 1GBLA 1OYTH 1EKBB 1O2MA 1GI3A 1RGQA 3SOSA 1F0RA 3KQBA 3LGIA 1GI0A 3BG4B 4UE7H 2QA9E 2J34A 1JBUH 3V3MA 2VIQA 3Q3YA 2A2XH 1VGCC 5CMXH 1KXEA 1AE8H 3STJA 3U1IB 1CT0E 3RP2A 1SOZA 1Z1IA 2ULLA 3TPIZ 2P16A 1AMHA 1TBZH 3S69A 4D7GA 5A2MH 1AVGH 4B1TA 2RA3A 3VB7A 2WYJA 2YOLA 3BTKE 2P93A 3BTWE 1EAIA 3L33A 2CHAB 2QXIA 3KNXA 3NZIA 2FX6A 1O3KA 1JWTA 1FQ3A 1VJAU 2BLVA 2ZDNA 4J1YA 4MNXA 5C20A 5C5NA 1C1SA 3M5LA 1SGDE 1YPMH 2NU0E 3MU4A 3SI4H 2H9HA 4KP0A 4Y79A 1GHXH 4WMDA 1O2UA 1LDTT 3E1XB 1GDUA 4XE4A 1FY8E 2ZNKH 1G2LA 3MWIU 3WY8A 1HPGA 3PM3A 3I29A 3SU2A 1TE0A 3BG4C 1XUIA 5BRRE 3A80A 1A2CH 3CS0A 1EATA 3ESTA 1PPFE 1WOFA 1VR1H 3LGUA 2F9VA 5I46H 1CGIE 1AN1E 3EYDA 1PYTC 2ZGCA 3MI4A 4ZROA 4OS2A 1C5LH 2P3FH 2A2QH 1PQ5A 2FOFA 2CHAC 1RS0A 2CXVA 2Y81A 2BB4A 3RMNH 1D3PB 4JCNA 3HKJB 5A8YA 9ESTA 2FS8A 1V2UT 2GX4A 1VZQH 3NUMA 4Y76A 2BTCE 1SHHB 4RSPA 1GG6B 1Y59T 1OWKA 1O3GA 1NS3A 2ZQ2A 3QZRA 2Q6GA 1SLUB 2A4QA 3ATMA 3NWUA 1ZGIA 2BQ6B 3DHKH 4B74A 3GY4A 3QGNB 2OP9A 1QJ6B 1QB1A 1A7SA 2EEKA 3MOCA 3UQVA 2BD7A 3A7VA 2FI5E 2GT8A 2WPJS 5FHTA 4ZKNU 5JB9S 1D9IA 4Y8ZA 1NTPA 3GYLB 1O3FA 2CV3A 1YGCH 1NZQH 3RXRA 1EPTB 2AIQA 1D3DB 4ABHA 1C2DA 2BOHB 2C93B 4INLA 4WY3A 4AN7A 1HAVA 4WWYA 4FU8A 1ZJDA 3QUMP 4ISIH 5GPIB 1O2JA 1ORFA 2ZIQH 1JIRA 2BX3A 2RDLA 1HIAA 3U8TH 6LPRA 1BTZA 4FUGA 2AFQB 5C3NA 4X1SU 3RC5A 1QY6A 2P3TB 3SJKA 1GI7B 3RXJA 3VB5A 5C1UA 1GG6C 1MAXA 1OPHB 1AVWA 1K2I1 3SUFA 3TNSA 2BD4A 4H4FA 4U30A 3LOXA 1DPOA 3IITA 3P8OA 4NIYA 2EA3A 4IBLH 1YCPM 1O2TA 5DGJA 1T32A 5HGGA 1TYNA 1P09A 3ZZ8A 2BVXH 3SU6A 3UIRA 5HM9A 3MNCA 5I25A 3K2UA 1Y5UT 1W12U 2ZTXA 2FOMB 2UUYA 1S5SA 1OP2A 5AFZH 1GL1A 1EPTC 2FPZA 3ODDA 3Q3KA 1DWDH 1P2QA 4QT8C 1C2HA 5GXPA 1PPEE 2BXUH 1C5NH 1LO6A 1KDQB 3OU0A 1G36A 2BY8X 1QB6A 4ZXXH 5LPEA 4Y8XA 4CRDA 5JBCS 1MUEB 1J17T 4JYUH 2EI6A 2PGBB 3GY6A 3SNDA 3RMMH 1SHYA 5DJ7A 1LKAA 3B8JA 4MNYA 1L1GA 1NC6A 1Y5AT 1KLTA 3A87A 3ZYEA 3I78A 3HATH 4DG4A 2CF9H 3E6PH 1EQ9A 3GY8A 2PFEA 3BV9B 6ESTA 1TRNA 1JIMA 3U1JB 3RXCA 5JBTA 4WMEA 2PR3A 3RXOA 1PFXC 1TBQH 1AUTC 1EX3A 1O3MA 2GDDA 4FUDA 1GCDA 1PPZA 1WAYB 1ZTJA 1C5OH 3TH2H 4GUXA 2LNCA 1BTUA 1SB1H 3GDUA 1RTKA 2V3OH 2F9OA 1C1OA 3U8OH 4DT7B 1M9UA 2Z9JA 1RFNA 2ZDLA 1GGDC 2TGDA 2SGAA 1Z8GA 1FPHH 4F4OC 1N6XA 4B73A 1KXCA 1O30A 1MTUA 1Y3WA 1FNIA 3QTOH 4XFQA 3FP7E 3P17H 3E90B 1A5IA 3RXDA 4XOJA 5IYTA 1QQ4A 3VXEH 1EOJA 4K1EA 5JDUB 2PUQH 1P8VC 4CRAA 2FOAA 2Z3CA 2H5CA 3URCA 1SR5C 1V2OT 1GHBF 3C27B 2VIPA 2STBE 2QN5T 2TIOA 1HJ8A 1WQVH 3LONA 1SGTA 4J2YB 1OYQA 1CHOF 2XCFA 3QDZB 3RM2H 3RU4T 4OGYA 4F49A 2G5NA 4IMQA 3KQCA 1E36B 1MQ5A 1SLWB 3RXBA 4I8JA 1QBOA 1GI1A 1WTHD 1SSXA 1TALA 1G9IE 1BDAA 1VITF 1C2MA 2P8OB 1GHYH 1GBHA 1DANH 3MU5A 1XKBC 2BDAA 2SNWA 5T3HA 3T28A 5FXLA 1MBMA 4YM9A 3VB4A 5TJXA 2Z9IA 2BD9A 3BN9A 2VWMA 1J16A 5C67A 3D62A 2FO9A 1GJ6A 2FOCA 1SFIA 1SGFG 1P3EA 1ZPCA 4IN1A 4X6OA 3A7XA 4LXBH 3ENSB 1ZTLA 4ZKSU 3UUZA 2KAIB 2OC8A 8GCHF 1MTNB 1SVPA 1XM1A 1TNIA 2G00A 2XC5A 1LHFH 4CRFA 5AF9H 1XKAC 1OP8A 2FYQA 1SLVB 1VCQA 1LQEA 2AIPA 3RM0H 2PV9B 1J15A 3ZZDA 2G81E 5EOKA 4BOHA 2Y5FA 1O5AB 3H5CB 4DJZB 1XXFA 4UONA 3SV9A 1HAVB 3SJ9A 3D49H 3IG6B 5A0CA 5F8XA 2PW8H 4D9RA 1TOMH 1FY3A 1P0SH 5A8ZA 3SV6A 1QURH 7GCHF 1SLXB 2P8OC 1U6QA 3N7OA 1Z8JB 4FUEA 4NFFA 2ZGBH 4NIWA 1SGFA 1HIAB 4HZHA 2ZU1A 2Q6FA 2Z7FE 4ZAEA 1C1VH 3FP8E 2QV1A 3PMAB 1AGJA 1S0RA 1Z71A 1NFUA 1P9UA 3AVZA 2XCNA 1A5GH 1FLEE 4HTCH 3ZVDA 2GTBA 4OS5A 3E8LA 3RLYH 1MCVA 1FN8A 1MTNC 2FTLE 2G51A 1TWXB 1UTMA 2O8UA 1V2PT 4K8YA 2O9QA 5CHAB 3R3GB 4H42U 4K8BA 3HK3B 1P57B 2XXLA 1GI2A 3H7TA 3RUOA 1HXFH 2FYRA 2VH6A 4OS4A 2BDYA 1C1QA 4ZHMU 2ZCHP 1UCYK 2ZFQH 1Z6JH 5EXMA 2GCHF 1SI5H 1ZMNA 1TNGA 5ESTE 1O38A 2Z9GA 4M7GA 2UWOA 4KTCA 2Y82A 1O3CA 2JH0D 2HNTE 1GJ5H 2ZP0H 3GCOA 1BBRE 2GT7A 5FPYA 2NU1E 1SQTA 1XUFA 1NT1A 2AYWA 4K60A 1O3JA 3BTDE 1JRTA 1F92A 4E7NA 2D26C 2ZCKP 2BY9X 4BAQB 4AGJA 4X8VH 4AB9A 5K0HA 4HGCA 2GKVE