3UIRA

Crystal structure of the plasmin-textilinin-1 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
243
Chain Sequence
DCGKPQVEPKKCPVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmin light chain B
publication title The structure of human microplasmin in complex with textilinin-1, an aprotinin-like inhibitor from the Australian brown snake.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 243
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2011-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uirA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3uirA01
2ASUB 4JZ1A 4GCHG 5C20A 2GT8A 2VH6A 5IDKA 3A7VA 2GTBA 4QT8C 1HAGE 3OY6U 1ELAA 4B2BA 2OCVB 1O3DA 1O32A 1AIXH 3ZZDA 3EQ0H 2XXLA 9LPRA 3RMLH 2ZKSA 1MKWH 1TNGA 3KQCA 1S0RA 4ZKOU 4Q7YA 3HKJB 1BTYA 1P2IA 4I31A 1EAIA 2A5KA 5EQQA 4AFSA 1OXGA 2GD4B 3ZVCA 1MKXH 3EGKH 1QB1A 3F9EA 3RXRA 1TNKA 3P95A 2OD3B 1ETSH 3SJ8A 1P09A 3HATH 3Q00A 2HNTF 1MTVA 1O2OA 2XBYA 2FTLE 3BV9B 2IPHA 3QGJA 2G4UA 3EA7A 1INCA 3QO6A 3SV9A 3UOUA 4UDWH 2O8WA 1ZTJA 1GBTA 1V2LT 4Q2KA 4LXBH 2ZPQA 2NU2E 3JZ2B 1TABE 4IBLH 1HCGA 4UFGH 1HYLA 1LTOA 1WV7H 2RDLA 3DUXH 4VGCC 4ZMAH 3ZZAA 5EXNA 1C5UA 4NA9H 1ZPBA 7GCHF 4NFEA 3VGCB 3HPTB 4MPXA 1ZJKA 5DKMA 1G36A 3F9FA 1K1LA 1YPEH 4LZ1H 1O5BB 1P10A 1TBRH 1QCPA 2CXVA 2LPRA 4YLQH 1OSSA 3LT3A 1O3JA 5FHTA 2FDAA 3TGIE 1O36A 3LJJA 1ZHMA 1P2MA 1VCPA 3TITA 1C5XB 1FY1A 4D76A 4Y8XA 1ABJH 1SB1H 1V6DA 1FXYA 4U2WA 3RXKA 3ZVDA 2NWNA 4AGJA 5CMXH 3RXSA 1G3CA 3S9AA 3A7ZA 3FVFB 1BZXE 1J15A 1IQLA 4BAHB 5FPTA 1HUTH 3RC6A 2R0KA 3MWIU 1A61H 3KQDA 3A86A 4NWLA 6CHAB 1XKAC 1AKSA 2UUYA 2EEKA 1VZQH 3GYMA 4BNRA 3PLPA 4MNXA 1HFDA 2Z9KA 4NWKA 1CU1A 1TRYA 2W7UA 1Z8GA 1HAVA 3URDA 3UQVA 2IN2A 1DWBH 1O2VA 1QBVH 1BRAA 1RTKA 3GY7A 3PB1E 2ZZUH 2OP9A 3GCHB 3VEQB 1EOJA 2AFQB 2BXUH 1D3TB 3H7OA 1MUEB 2A7HA 2J38A 1Z7KA 5EXMA 4DG4A 1NRSH 1HV7A 3NUMA 3LH1A 5L30H 1W10U 1KXAA 1W0ZU 1AZZA 1PQ5A 2ZQ2A 1RD3B 3FFGA 4ZXYH 1UTNA 1GI6A 1ARBA 1ZTLA 1BJVA 4HI3A 2PTCE 1YLDA 4KKDA 4K1EA 1DM4B 3SUDA 4ISLA 2QYIA 2CMYA 2ZPRA 5C3NA 3CS0A 1SC8U 1UHBB 3FZDA 1EASA 3NCLA 2AIPA 1CT4E 4FUCA 1Q3XA 2WPMS 2OC7A 5T3HA 1GMHG 1FLEE 3R3GB 1PYTC 2PSXA 4XDEA 4H4FA 1AFQC 3A81A 1MBQA 5GCHF 4JZFH 2PGQB 1ZHRA 2ODPA 2M5TA 1A0LA 3AW0A 3V0XA 1GCTB 5E0GA 4U01A 2WPKS 1GJ7B 1P3CA 4NZLA 4WF8A 3DHKH 1UK2A 1XX9A 4UONA 1C5NH 3RU4D 2PTNA 3U69H 3KNXA 4INHA 1GBKA 4WY3A 1GI8B 2BZ6H 2CF9H 2D2DA 1Z1IA 3D65E 3LGYA 4K8BA 4GHTA 4AX9H 1SGEE 2RA3A 1HBTH 1QJ7B 1GBBA 2R2MB 2AGEX 1AD8H 1ELVA 2QY0B 3GDUA 1AFEH 3TH3H 3SHCH 1GL0E 4AZ2B 1YCPK 2R9PA 3RMOH 3UY9A 3MO9A 2A0QB 1DANH 1T8MA 1A46H 4JYVH 3P6ZB 2FODA 1OX1A 1K1OA 1FY5A 1HJAC 3T5FH 3UR9A 2Z6BD 3OSYA 1EAUA 2AERH 1NTPA 1WCZA 1BHXF 2OINA 3VB4A 4AYYB 1VJ9U 5J4SA 4B71A 1A0JA 1T7CA 1P06A 1N8OB 2A4QA 1JBUH 1PPGE 5T6DA 2WPHS 4TPIZ 3RXBA 1O5DH 2QXGA 1IQHA 2H5DA 2B8OH 4X6PA 1SVPA 1GBDA 3BIUH 3TJNA 4YM9A 1V2RT 2FOCA 3MNBA 2H9EH 3S69A 2VIOA 1BBRE 1BMAA 1EPTC 2XCNA 3KQBA 1GDUA 1RIWB 2THFB 4AORA 1EP5A 2RG3A 1UVTH 2F9BH 5CE1A 2GP9B 1O5GH 1DUEA 3V7TA 3OY5U 3RXOA 2BDHA 4Y0ZE 4DGJA 2ZFTA 2V35A 2GMTB 2BXTH 2PWXA 4RKOB 3TGJE 1UK3A 2F9PA 1P57B 1V2QT 1LDTT 1C1RA 2QF0A 3RXDA 1PPFE 1S81A 5CHAC 2ZECA 1GI3A 3D23A 2P3TB 4GPGA 1BMNH 1TPPA 1DX5M 2F3CE 4Y76A 1RTLA 3LC3A 4AFUA 4Y79A 2Y6TA 1CGIE 3SNBA 3M5MA 1V2ST 1FN8A 1K9OE 1LVOA 3Q76A 3FP6E 1SGCA 1MCVA 4CRBA 3M3VA 5DJ7A 3SI4H 4K1SA 5E2OA 5EOKA 2BHGA 6LPRA 2ZPSA 4ZUHA 1V2MT 2R3UA 5ETXA 4A1TA 2P8OC 4AYVB 4MNWA 1EPTA 3A85A 1BOQA 1FV9A 1BB0B 2GVFA 4OS1A 5A09A 2AEIH 3QX5H 1CT2E 1C1MA 3F6UH 1YLCA 1O3BA 3ZV9A 2STBE 2NU0E 4XSKU 5GCHG 1O2KA 1EP6A 2Y80A 2V0BA 2VIQA 3MU8A 3N7OA 3A87A 2C4FH 4X2WA 2A2XH 2HPPH 1HGTH 2AH4X 1AI8H 1CGJE 1ESAA 3BSQA 3GY3A 3D62A 1GMCF 1MD8A 1GI7B 1AUTC 5HMAA 1DLEA 1SFQB 1SQTA 1K1MA 1RS0A 4DIHH 3S7KB 1AB9C 2OBQA 5TJXA 1C5SA 4PROA 2QXJA 7LPRA 4NA7A 1V2JT 3SV8A 3E16B 1GJBB 1AWFH 2XBVA 1S0QA 4B2AA 2STAE 2Z3DA 1C1UH 2VNTA 1G37A 1SHYA 1CVWH 2XWAA 3M5OA 3P8GA 1EJMA 2Z9JA 4Y7BA 3BEUA 1ZMJA 4X6OA 3PMAB 2W7SA 2FTMA 1SGPE 3TPIZ 1RRKA 3FZZA 3S9BA 1TPOA 4YT6H 2HVXA 4X1PU 4O3UA 1WTGH 2XYAA 1C5ZB 5JB8S 1BQYA 1TNLA 4IGDA 5DK1A 2ESTE 1XMNB 1MTSA 2D26C 1VITH 4ZHLU 4FUBA 5AVDA 3BG8A 1UVSH 3UUZA 4F4OC 1O2YA 3QGNB 1DITH 2JETC 2OQUA 3BTGE 1HAZB 1DSTA 3SOSA 3SJ9A 4YO9A 2BLOA 1YC0A 1Y3YA 1H9IE 3BTTE 1C5OH 3PLKA 2VU8E 3MH4A 3PWCA 4ZAEA 3MU0A 1BMMH 1O3AA 3TH4H 3S0NA 1QL7A 4WMDA 1MH0A 5DO4H 1O2XA 1EZUC 4THNH 1TX6A 1H1BA 1PJPA 5TCAA 1CA8B 4MNYA 2BLVA 1S6FA 1N6XA 2W5EA 1C4V2 1LHCH 3A8BA 3SQHE 2Q1JA 4O3TA 1IQEA 1Y3UA 2GT7A 2YNAA 3W95A 2ZC9H 1C9TA 1YBWA 1VCQA 1TMTH 5FX5A 4IS5A 3P8NA 1KLIH 3RP2A 3SU0A 3RDZA 2QGRA 3MTYA 3SN8A 1SGRE 3T2NA 1W14U 2ZGJA 5A0BA 1F92A 2ODQA 4CH2B 1S6HA 4BAMB 3SNDA 4MPUA 5LPFA 1RTFB 3RU4T 3SW2B 4E7NA 1ZTKA 3RXFA 4GVUA 1CBWB 4K8YA 3SU4A 4WXVA 1IQFA 1O2RA 3CP7A 4X1RU 3TNSA 3HK6B 1Z8IB 1GGDB 2JKHA 3A8DA 1NRRH 5DP4A 1XXDA 1G30B 1PQAA 2FX4A 5EW1H 1K1PA 4U32A 2FWWA 7ESTE 1O3CA 1TPSA 2LNCA 1BTXA 3BTME 1ZLRA 2F9VA 7KMEH 1F0UA 4X2XA 1YCPM 1TOCB 4Y11E 2C8XB 4MNVA 1Y5BT 4XBDA 1DWEH 1PYTD 1ESBA 3GY8A 1MAYA 1SLUB 3VXEH 4A6LA 1C5PA 2JH0D 3SU6A 5FPSA 2Y7XA 4Q7XA 2NU4E 2AMDA 4IMZA 1XUIA 1G3EA 1GJ6A 4ISOA 1IQGA 3U98H 2H1UA 2BMGB 1O2ZA 3SV6A 1T4UH 2BLWA 2GZ8A 1PPCE 1ESTA 2J4IA 3B23B 1FZZA 1GBCA 4Y6DA 1DSUA 2VVCA 1MTUA 2DE9A 2IOTA 2QIQA 2BDBA 1HAYB 4VGCB 1O2SA 1BJUA 1O5EH 1KXDA 4R0IA 1V2KT 1WQSA 2KAIA 2W3KA 1SGFG 1AKSB 1C5TA 2NU1E 2Y81A 3PTBA 1C5QA 1F5KU 1SL3A 4TWYA 5DG6A 2GX4A 3OTJE 2QN5T 1HAVB 1BTPA 3VB7A 3LGTA 1YPLH 5C2ZA 2BY9X 3LH3A 2PKAA 1GJAB 1WOFA 2G51A 4FUJA 4CH8B 1GBEA 5BRRE 2DE8A 4IN1A 3E90B 1IAUA 1P2NA 3RU4E 1YPKH 3F1SB 5DP9A 4B76A 3EAJA 1T8OA 2QCYA 4X6NA 4MG3A 2ZCKP 1P04A 2FS9A 2FZZA 5EPNA 3TJOA 1QGFA 2CV3A 3ATKA 4JMYA 1X7AC 1Y5UT 1YCPH 2BQ6B 4UEHH 1Q2WA 1EQ9A 1HJ9A 1Y8TA 3GY2A 3ENSB 2PKSC 5LH8A 1NPMA 3SGBE 1K22H 4IC6A 2GGVB 3GICB 5DP8A 5FCRA 4MPVA 1O2PA 4SGAE 1BCUH 3LONA 3AVZA 2ANWA 4OS6A 4AN7A 3U8TH 1FQ3A 1Z6EA 1W13U 3ZVEA 3PV4A 2XC0A 1TNHA 1K21H 1LO6A 2UWLA 2ZU2A 3DA9B 1XM1A 3AAUA 1THSH 3NPSA 1BDAA 2SGAA 1UTJA 1WQVH 2FIRH 3EA9A 4ZKRU 3BEFB 1GI4A 3TNTA 1LPGB 1UO6A 4XBCA 1KXFA 1GHWH 3ZZ4A 3A8CA 5EQSA 3T27A 3Q3KA 1VR1H 1PPHE 2I6SA 4GLYA 1QRXA 3EYDA 3ITIA 1GVZA 2G00A 1HAXB 1DVAH 4I8HA 3BTFE 1MQ5A 2ALPA 1O3LA 5LPEA 3QK1A 2C90B 4YTAA 3W94A 1YPHE 3TVJB 1J16A 1A3BH 2XRCA 4AG1A 5FBEA 3BN9A 3GYLB 4NSVA 2IJOB 2PHBA 2XTTB 2O8TA 3LIWA 1G2LA 1O2TA 1V2PT 1S84A 3BF6H 1CSOE 1TOMH 3A7WA 1U6QA 5ESTE 1G9IE 2O8LA 1NU9A 1AFQB 2A5IA 4UFEH 5C67A 1HPGA 1NFUA 1C5RA 5DP6A 4I8KA 1K2I1 1GWAA 3PROA 1ZGIA 1A3EH 2F9OA 4OS4A 1YPGH 2ANKH 1DS2E 1GJ5H 1TALA 1DXWA 1O34A 3RMNH 1C1WH 1LHDH 3PMHB 1OP0A 2CF8H 1L0ZA 1WBGB 1ID5H 5DP7A 1W3CA 1FN6A 1A7SA 4AFZA 2BLQA 4NGAH 2XC5A 1HIAA 4JZDH 4BTUB 1KTTB 1GJDB 3M7QA 1LHGH 4Q80A 1NFWA 2ZFPH 1LKAA 4X2VA 1WAYB 2EI8A 2AGIX 1W11U 5K7RA 3LGIA 1TX8A 4BTTB 1OP8A 1PFXC 2BM2A 4CREA 2O8MA 1VITG 1JMOH 1NROH 3UIRA 4LOYH 2A45B 1KDQB 2P94A 2HOBA 1IQMA 1FIWA 4UFDH 3O8DA 2TBSA 1P11E 3MYWA 3VPKA 3SUEA 3BG4C 3TJVA 2H9TH 2FX6A 2VIDA 1C1NA 1QB9A 2HNTC 1SQOA 1GMDF 2A4OA 4X8TH 3ZZ5A 2QXIA 3UWJH 1NRQH 1AUJA 1GPZA 1XUFA 4JCNA 4UFFH 1ZRKA 1BRUP 1QJ1B 2BDIA 4K60A 1HAPH 4KTSA 3ZV8A 6ESTA 1P05A 2UUJB 1NC6A 1WU1A 1MMJN 4Y0YE 2I6QA 4JK6A 1BRBE 1QFKH 3VFEA 5A8ZA 1D3QB 1D6WA 1HJ8A 1Z8RA 3NKKA 2O8UA 5C1XA 4HFPB 3DT0H 3M5LA 2G8TA 1SGDE 1OOKB 4BTIB 3C27B 5C1UA 2FM2A 2Z9IA 3A7TA 1GHXH 2BX3A 3WY8A 2VINA 5JBAS 3SHAH 3TK6A 1FY8E 1P9SA 3AAVA 1FMGA 4LZ4B 3HGNA 4D7GA 2BYAX 1L2EA 1ZJDA 4Y8ZA 1GJ8B 3MI4A 1EB1H 1K1JA 1NESE 2BB4A 5CHAB 1C2FA 1DWCH 1F2SE 1QRWA 2ZDLA 1ORFA 4AB9A 2F83A 1K1NA 3TH2H 4AFQA 1GBAA 1OWKA 2RCEA 1MD7A 2ULLA 1QA7A 3SU2A 4GSOA 1WUNH 1NZQH 2O9QA 4E05H 3BTWE 2XW9A 2Y5FA 3BEIB 7GCHG 3S9CA 1BBRK 2AGGX 1JIMA 4X1QU 4I32A 2P8OB 3LDXH 2PFEA 1GBLA 2H2ZA 2HWLB 4O9VA 2BY6X 1YP9A 4DVAU 3KF2A 4ZHAA 1EXFA 2Z3CA 2TRMA 1AQ7A 3LU9B 3A88A 1T8LA 2XBWA 2BOHB 3GDVA 1NM6A 4INKA 3ZZ6A 1P01A 5LGOA 1ELBA 1HAIH 1C5VA 3ZZ7A 1JIRA 1C2DA 4ZXXH 4SGBE 5A0AE 3PO1B 1C2MA 4X2YA 3PTNA 1P03A 1UCYH 1E0FD 1ZZZA 2GV6A 5I25A 2ZU4A 3TGKE 2QC2A 4DCDA 1BTZA 4D7FA 4GHQA 1J8AA 1BIOA 1Z8JB 1O3OA 3M37A 3S7HB 1F5LA 2VGCC 1OPHB 3KEEA 4CHAC 1UVUH 2A7CA 2TGAA 1L1NA 2FLBH 1F0TA 1TWXB 2GZ7A 1GBJA 3EDXB 1LKBA 2VB0A 1HLTH 1C2IA 2TGPZ 1CHGA 4FUGA 1ANEA 5C1YA 4CRGA 1CHOF 2FPZA 1YGCH 1ABIH 2ZHDA 2PW8H 3E3TA 1C1PA 4ISHH 5DP5A 1UVPA 2OUAA 1EX3A 1Z71A 1ZHPA 4KELA 4I8LA 1CO7E 5EGMA 5GIBA 2JETB 1CA0C 2QXHA 3ZVAA 1NS3A 2PUQH 4UD9H 4YOJA 2VWLA 8GCHF 4DT7B 2FOAA 1OWJA 5T6GA 1ELCA 1O2NA 1QTFA 1ZSKA 3MH6A 2OLGA 2A5AA 1PPBH 1FPHH 1ZRBA 5JBCS 1C4U2 2ZFFH 1TGBA 3GCOA 4CR5A 1S5SA 1O3PB 1QBOA 1TA6A 1SQAA 4HGCA 2ZDKA 3QWCH 1TYNA 2ZDAH 2ZHQH 3KQEA 2ZFQH 3P92A 1DWDH 4NIWA 1KXCA 4U30A 1TBZH 1AN1E 1C1TA 3KGPA 3MOCA 2J92A 2FI5E 2P3UB 3E1XB 3K9XB 1QQ4A 1SGYE 2XBXA 4DY7B 4I7YH 2QV1A 1B5GH 4NSYA 4XFQA 1GG6C 1GHYH 1LVBA 3SGQE 2ZU3A 3SJIA 1TX7A 9ESTA 3ZYEA 1ETRH 1IQIA 2SGFE 1OWDA 3T28A 1KYNA 1F0RA 1UHBA 4WVPE 1ZYOA 2A32A 1KSNA 1AWHB 1P2KA 1GI5A 1FDPA 2Z94A 3U8OH 3M7UA 2BDAA 2B5TB 2V3HH 2BQ7B 1SLWB 3MMGA 1OWIA 4IW4E 2BQWB 3A7XA 2FEQH 3SV2H 1FI8A 1Y59T 2ZU1A 1HXEH 2ANYA 1KIGH 2OTVA 4LK4A 4JZEH 2KAIB 1XXFA 3B9FH 3ODDA 1AVXA 4ISIH 1Y3WA 3FP8E 2SGDE 5ESBA 1Y5AT 1DXPA 1PPEE 3ODFA 2GCTC 1FJSA 4MQAA 2AYWA 3OX7U 3EA8A 3KL6A 2ZF0H 2FO9A 1LMWB 4HZHA 1AGJA 2WUCA 1P12E 2PKAB 4H6TA 2B9LA 2UUFB 1NFXA 3GCNA 2EI7A 1ARCA 1TA2A 5EW2H 5GPIB 3JZ1B 4NIXA 1LVMA 1AY6H 3G01A 3P17H 1ZMLA 2J2UA 2BY8X 4CBOA 5FPYA 2FYRA 1O3KA 1GI1A 3LGWA 3MHWU 2A7JA 5SGAE 2ILNA 1IHTH 1RIWC 3V12A 2J34A 3STJA 1O3EA 1O35A 1T32A 2PUXB 3HKIB 5L2ZH 3M3SA 3UFAA 1H8DH 4XOJA 1OYQA 1LCYA 3MNSA 1ZMNA 5C5NA 2ZWLH 2H9HA 1MZAA 3RXEA 2FOEA 4BAOB 1CHOG 3RM0H 4ABJA 1TBQH 4OGYA 3MFJA 4RN6A 3TU7H 4I33A 1HAHH 1NY22 2QA9E 4NZQA 4Q7ZA 1NRNH 3T25A 3H5CB 1RGQA 1B0FA 1EZQA 4F49A 2BDGA 1P2QA 3NWUA 3LOXA 2G4TA 2FOFA 3BIVH 3STIA 3M7TA 2B7DH 3RXVA 3RXAA 1FUJA 1O5AB 4FUEA 1KLTA 1YPJH 2BZAA 1XUHA 2G5NA 3A7YA 1HAOH 4DW2U 4YOIA 2Z9LA 3SO3A 3F9GA 3RC5A 1SLXB 1TRNA 3Q3YA 1C9PA 1G32B 1QA0A 1W2KH 1EAWA 2BDYA 2ZTXA 2VIPA 3GY4A 5A0CA 1UTOA 5FCKA 1P2OA 1OS8A 2BVSH 3PWBA 4NFFA 1AHTH 2NU3E 5H4IB 3RMMH 1JWTA 1A5GH 1HB0B 4MLFB 1TQ0B 2EA3A 1DDJA 4IC5A 5FX6A 2TGTA 4GUXA 2WPLS 1GMCG 1D4PB 3MO6A 1UCYK 1ZGVA 5EODA 1HNEE 3GY5A 2ZNKH 3SV7A 1ZSJA 3K65B 1GHZA 3LKWA 1CT0E 2VWMA 5HYOA 3K6ZA 3SBKA 3L33A 1W12U 1RFNA 3RXUA 3U1IB 1DY9A 5F8XA 3P70B 4K2YA 3MU4A 2BY7X 2BD8A 1GBFA 4Y7AA 2ZHWH 5PTPA 1C4Y2 5ABWA 1EAXA 3A83A 1NO9H 5FXLA 3KHVA 2D1JA 1IHSH 2C8WB 1YYY1 4Y10E 1GL1A 1GI0A 3RXHA 1P3EA 2FOMB 2BD3A 4B1TA 1V2UT 3GISB 1O3FA 1LPZB 1C2EA 3QTVH 4ZROA 4RKJB 2FXRA 2ZO3H 1Q31A 3AASA 4JYTA 1LHFH 1MCTA 2G5VA 2R2WU 4X1NU 2G55A 4NIYA 4I8GA 1BBRH 1SGFA 3SORA 4NCYA 5F8TA 1OWHA 2FP7B 1GJ9B 2PLXA 1ZR0A 3PM3A 1GBMA 2A4GA 2OC1A 5J4QA 4A7IB 2VH0A 1T8NA 2Y5HA 3I77A 1JRTA 4K69A 2BD5A 3OYPA 3U9AH 2Q6GA 1MAXA 2DUCA 2P95A 2VIWA 4ZHMU 4DURA 1B7XB 3QLPH 3BTDE 5EG4A 4AGKA 3E0PB 4GAWA 1ZPCA 1GHBF 1QL9A 4ISNA 4KGAA 1MQ6A 2HGTH 1A5HA 1J17T 2V3OH 1EOLA 2SGQE 1YF4A 2YOLA 1SHHB 2BY5X 3RXJA 4YOGA 4X1SU 3ATLA 2RA0A 3BTQE 3URCA 1UMAH 1FAXA 2ZGXH 2K1QA 3ATMA 5E0HA 1QHRB 1IQJA 1GGDC 5E2PA 1E35B 3LJOA 1QIXB 1O2WA 3DD2H 5F6MA 3HGPA 3BG4B 1M9UA 1ZSLA 5EQRA 1C1VH 1FY4A 1H4WA 4X8SH 3L3TA 4MTBA 1SGNE 2D8WA 1MTNC 4ABAA 1GHVH 4CR9A 1KTSB 5EU8A 1O39A 3RXGA 2J94A 3RLYH 1V2TT 4K1TA 1BTWA 1GMHF 1SI5H 2ZU5A 1XKBC 3M5NA 4J1YA 3UQOA 3O8CA 3OU0A 2AMQA 1TMBH 4FXGH 1OP2A 3KCGH 1UK4A 1EUFA 4AB8A 1GJCB 1UTQA 4M7GA 2CHAC 3BTHE 4WJG2 2H5CA 2OXSA 2R3YA 2BTCE 3M35A 1T31A 1BITA 1QRZA 1SOTA 3MNCA 1SFIA 3NXPA 1O2IA 1TE0A 4DIIH 4FU8A 3ATWA 1C1QA 4XE4A 1UJ1A 3R0FA 1ELEE 3ZZ8A 1A5IA 1WYKA 3M3TA 1GBIA 1OYTH 1L1GA 1YKTA 1GBHA 1JRSA 4WMEA 1GI2A 1ZOMA 2HRVA 1O3NA 2BD9A 1LQEA 1TAWA 1C5YB 2Z9GA 2JH5D 1G3DA 1QURH 4D9QA 2ZDMA 1OWEA 1QR3E 3Q77A 4H42U 2A4RA 1C2GA 3PYHA 1GJ4H 1O2QA 4H6SB 1VGCC 1FPCH 5HM2A 1O3GA 2ZFRH 4ESTE 2GCHF 5GDSH 4K3JA 1TONA 4B73A 1Z1JA 3O8RA 3RUOA 4YT7H 4ASHA 1JXPA 1TB6H 1YPMH 3MU1A 3RXIA 2FOHA 2F9UA 4JZIA 1FIZA 3GCTF 4D9RA 5E0JA 1MU6B 1HRTH 1O3HA 2ZGBH 1GHAF 1P9UA 3U8RH 1CQQA 1P2JA 4JK5A 4AOQA 1ANCA 3LC5A 1LQDB 1HJAB 3K2UA 1GHBG 5AHGH 2BX4A 1SGIB 4E06H 4A92A 3UNRA 1O2LA 3SNAA 1O0DH 2AIQA 2WUBA 2WPIS 3BTKE 2VIVA 2GKVE 1E36B 3A82A 4CRCA 2VGCB 1EATA 3QN7A 1P0SH 2Y7ZA 4NG9H 4ZH8A 1ACBE 4CHAB 3U1JB 4BXSA 3ZZ9A 2Q6FA 4BXWA 1QY6A 3V13A 1E37B 2JH6D 2YNBA 1G3BA 1EPTB 1V2OT 3GY6A 1TLDA 1RXPA 1MZDA 4A1VA 1V3XA 2VWOA 1QQUA 3Q3XA 3ZZBA 1AO5A 1ELDE 3A84A 2FOGA 5GJ4B 1S83A 1D6RA 3PLBA 1E38B 2VVUA 2ALVA 1IQNA 1PQ7A 1F7ZA 1CA0B 3TLOA 1T4VH 1TNIA 3VGCC 4HTCH 2V6NA 1PQ8A 3QZRA 1TMUH 1BT7A 2PR3A 4A1XA 3VXFH 1XUJA 3SGAE 3CS7A 1TFXA 1BTHH 2ZGCA 5L6NH 3AW1A 5DPAA 1XVMA 2Q6DA 3M36A 2FI3E 1BRCE 1ZPZA 2AMPA 1GDQA 3FP7E 4WWYA 1J9CH 1EZXC 2HNTE 3TK5A 4Z6AH 5FBIA 1P8VC 1A0HB 4BOHA 1H9HE 4ZKSU 1RJXB 2HALA 4CBNA 5AF9H 1Z6JH 1O2JA 5GXPA 1LVYA 1W7XH 1EZSC 1N6YA 2SFAA 5F8ZA 4ABDA 2ZGHA 2FS8A 4X6MA 3ESTA 3SJKA 2ZHEH 1GG6B 2ZTZA 2Y5GA 3SI3H 1C2KA 3TIUA 4TY6A 6CHAC 1SR5C 1YM0A 4FU9A 5IYTA 3E6PH 2ZCHP 2VWNA 1AVWA 1SGQE 2XWBI 3ZYDA 1AB9B 1D3PB 1DPOA 1BHXB 2PSYA 1SLVB 4NIVA 2Y82A 3E0NB 1C2JA 1A2CH 2GCHG 1A4WH 2F9NA 3RXPA 1W0YH 3QDZB 1VJAU 1NFYA 1QBNA 1AZ8A 1C5MD 3GCHC 4E7RG 3L6PA 4JYUH 5AFYH 2ZCLP 1KY9A 2BD7A 3GCTG 5AFZH 2BD4A 1GVKB 2GCTB 2UUKB 4O97A 3RC4A 5FAHA 5F03A 1S85A 4WH6A 5JPMH 1GHAG 3FANA 1MKWK 4AG2A 5HM9A 2G81E 1N1LA 1SSXA 1H9LB 2OBOA 1SOZA 4FUFA 4MDSA 1BMLA 1SGTA 1GMDG 2ZHFH 2TIOA 3RXQA 1MKXK 4Z0KA 1TGCA 2BOKA 2FESH 1L4ZA 3KN2A 1SG8B 2P3FH 4FUIA 3NZIA 4FVDA 1QJ6B 3F9HA 5DGJA 1C1OA 1O2MA 3SNEA 3LGUA 3P8FA 1NU7B 2J95A 1H8IH 1C2HA 1W7GH 5G4BA 1KDQA 3HK3B 4TPYA 4YLUA 5C5OA 1E34B 2FLRH 3O8BA 1S82A 2CN0H 4D8NA 4BAKB 4O03A 1ELTA 1UTPA 4KTCA 2QF3A 1HDTH 2CJIA 1SMFE 3MU5A 1GCTC 2ZEBA 3IWMA 3ATIA 2FI4E 3UNQA 1UTMA 4OGXA 1CE5A 1AU8A 1O30A 2H6MA 2OC0A 6GCHF 4OS5A 1ELFA 4X0WU 5A2MH 2A2QH 2W3IA 3VB3A 4Y71A 1O2GH 4B74A 2ZDVH 2ZQ1A 4OS7A 3FAOA 1TNJA 2HLCA 2OC8A 1EJAA 4A5TS 1TIOA 1XUKA 1O5CB 3SU3A 1DT2A 1F0SA 5DP3A 1DUAA 1QNJA 1HXFH 2ZG0H 1LPKB 5HXFA 8KME2 1KLJH 2FMJA 1NN6A 1WSSH 3I78A 1DICA 1LHEH 4TYDA 1IQKA 4XBBA 3TJUA 4ABBA 4X8VH 3P8OA 1UTKA 3PO1C 2ZA5A 2W26A 2SGEE 4FVBA 1THRH 4CRFA 2A1DB 1C5LH 2PV9B 2Z7FE 5TCCA 4OS2A 1SPJA 1FONA 3NK8A 1N8OC 1BUIA 2QAAA 3M61U 1BTUA 2ZFSA 1GVLA 5I46H 4ABGA 1TGSZ 3GDSA 4ABFA 4BANB 3MH7A 5T6FA 8ESTE 5L2YH 3SUFA 3T26A 2SGPE 1C1SA 2FYQA 2HPQH 2EI6A 4NA8A 5BPEA 4FUHA 1BA8B 1TGTA 3H7TA 2XCFA 3PMBB 3RXLA 2GV7A 2VVVA 4Y8YA 1XVOA 3QTOH 2C8ZB 3SZNA 1GI9B 2GMTC 1QL8A 5JB9S 1O3IA 3E8LA 3RXMA 1NRPH 2FOBA 3GOVB 4IN2A 4X8UH 4FUDA 1THPB 2VJ1A 1UVOA 2WV5A 2UWPA 4DJZB 1L4DA 3BTEE 3QUMP 1VCWA 1XUGA 2UWOA 5HGGA 2BVXH 1AE5A 1EKBB 1KXBA 4RSPA 4ABEA 4ZKNU 4WH8A 1O2HA 2P93A 1ETTH 4WMFA 1IOEA 4ABHA 1Y3VA 1O38A 1Y3XA 1SBWA 2ZDNA 3ZVFA 2WYJA 2XC4A 8GCHG 3SQEE 3A8AA 4GCHF 4CRDA 3ELAH 1C5WB 3VB6A 1DOJA 3UOPA 5A8XA 2OQ5A 3C1KA 4MPWA 1AE8H 8LPRA 2XNIA 1MU8B 2C3SA 3QZQA 2C93B 3MNXA 2TPIZ 3UNSA 5EXLA 1CGHA 2PKSB 2Z3EA 5GWZA 5A8YA 1W8BH 2WPJS 2ZP0H 2ZTYA 3EE0B 1GDNA 2ODYB 1NT1A 4INLA 4B2CA 1K28D 1DLKB 5LPRA 6GCHG 1DE7H 1AVGH 1KXEA 4FU7A 5JBTA 3I29A 1MBMA 1L1JA 3E91A 4TWWA 2TGDA 2GDEH 1P02A 3A80A 3IG6B 4BAQB 2J9NA 1EJNA 5EPYA 3SU5A 1WTHD 3UPEA 3LGVA 2C8YB 3A89A 4B75A 1O33A 2F91A 2BDCA 3ZVGA 4MVNA 1O2UA 3VB5A 3CENA 2ANMH 3RM2H 1TPAE 2WINI 1FNIA 1TGNA 5E8EH 3UTUH 3ZZ3A 1MTWA 3ZZCA 1FY3A 1O3MA 1V2WT 4CRAA 1MTNB 1V2VT 1PPZA 2P16A 4KTUA 3RXTA 1OKXA 5JDUB 3UR6A 1TQ7B 3MO3A 3K6YA 3SUGA 1HIAB 2ZIQH 2AS9A 1B0EA 4IMQA 3PMJA 5JYIA 2BVRH 1QB6A 1V2NT 2R0LA 4KP0A 2SNWA 1J14A 3ZVBA 3V3MA 1O37A 2CHAB 4WXIA 2GZ9A 4TY7A 3SU1A 1UTLM 2GDDA 1ELGA 3KIDU 1ANDA 2EC9H 2WYGA 1JOUB 3B8JA 4DOQA 1GCDA 2G52A 2BD2A 5B6OA 3MH5A 1G2MA 2SNVA 1AMHA 3T62A 2PGBB 1TRMA 5JBBS 1F5RA 3UWIA 2CGAA 3RLWH 3SNCA 1FAKH 1O5FH 1D9IA 2A31A 2P59A 1C2LA 1ANBA 3SJOA 4K5ZA 3TK9A 3DFLA 4R8TB 1DFPA 3F68H 2WV4A 2ZI2H 1DY8A 3D49H 2B0FA 1D3DB 4UE7H 4ABIA 1VITF 4I8JA 1O31A 1VGCB 3LPRA 3UREA 3DFJA 1UCYE 1YPHC 4YZUA 5K0HA 1K1IA 3IITA 3RXCA 1CBWC 1A1RA 4YESB 4J2YB 3T29A 1EB2A
chains in the Genus database with same CATH superfamily
2ASUB 4JZ1A 4GCHG 5C20A 2GT8A 2VH6A 5IDKA 3A7VA 2GTBA 4QT8C 1HAGE 3OY6U 1ELAA 4B2BA 1O3DA 2OCVB 1O32A 1AIXH 3ZZDA 3EQ0H 2XXLA 9LPRA 3RMLH 2ZKSA 1MKWH 1TNGA 3KQCA 1S0RA 4ZKOU 4Q7YA 3HKJB 1BTYA 1P2IA 4I31A 1EAIA 2A5KA 5EQQA 4AFSA 1OXGA 2GD4B 3ZVCA 1MKXH 3EGKH 1QB1A 3F9EA 3RXRA 1TNKA 3P95A 2OD3B 1ETSH 3SJ8A 1P09A 3HATH 3Q00A 2HNTF 1MTVA 1O2OA 2XBYA 2FTLE 3BV9B 2IPHA 3QGJA 2G4UA 3EA7A 1INCA 3QO6A 3SV9A 3UOUA 4UDWH 4RT0A 2O8WA 3F2HA 1ZTJA 3AK5A 1GBTA 3SZEA 1V2LT 4Q2KA 4LXBH 2ZPQA 2NU2E 3JZ2B 1TABE 4IBLH 1HCGA 4UFGH 1HYLA 1LTOA 1WV7H 2RDLA 3DUXH 4VGCC 4ZMAH 3ZZAA 5EXNA 1C5UA 4NA9H 1ZPBA 7GCHF 4NFEA 3VGCB 3HPTB 4MPXA 1ZJKA 5DKMA 1G36A 3F9FA 1K1LA 1YPEH 4LZ1H 1O5BB 1P10A 1TBRH 1QCPA 2CXVA 2LPRA 4YLQH 1OSSA 3LT3A 3PRBA 1O3JA 5FHTA 2FDAA 3TGIE 1O36A 3LJJA 1ZHMA 1P2MA 1VCPA 3TITA 1C5XB 1FY1A 4D76A 1WXRA 3ZIAD 4Y8XA 1ABJH 1SB1H 1V6DA 1FXYA 4U2WA 2KM0A 3RXKA 3ZVDA 2NWNA 4AGJA 5CMXH 3RXSA 1G3CA 3S9AA 3A7ZA 3FVFB 1BZXE 1J15A 1IQLA 4BAHB 5FPTA 1HUTH 3RC6A 2R0KA 3MWIU 1A61H 3KQDA 3A86A 4NWLA 6CHAB 1XKAC 1AKSA 2UUYA 2EEKA 1VZQH 2V3MA 3GYMA 3PLPA 4MNXA 4BNRA 1HFDA 2Z9KA 4NWKA 1CU1A 1TRYA 2W7UA 1Z8GA 1HAVA 3URDA 3UQVA 2V7QD 2IN2A 1DWBH 1O2VA 1QBVH 3KYFA 1BRAA 1RTKA 3GY7A 3PB1E 2ZZUH 2OP9A 3F0OA 3GCHB 3VEQB 1EOJA 2AFQB 2BXUH 1D3TB 3H7OA 1MUEB 2A7HA 2J38A 1Z7KA 5EXMA 4DG4A 1NRSH 1HV7A 3NUMA 3LH1A 2K0QA 5L30H 1W10U 1KXAA 1W0ZU 1AZZA 1PQ5A 2ZQ2A 1RD3B 3FFGA 4ZXYH 1UTNA 1GI6A 1ARBA 1ZTLA 1BJVA 2VBCA 4HI3A 2PTCE 4TT3D 1H8HD 1YLDA 4KKDA 4K1EA 1DM4B 3SUDA 5GNDA 4ISLA 2QE7D 2QYIA 2CMYA 2ZPRA 5C3NA 3CS0A 1SC8U 1UHBB 3FZDA 1EASA 3NCLA 2AIPA 1CT4E 4YXWD 4FUCA 1Q3XA 2WPMS 2OC7A 5T3HA 1FX0B 1FLEE 1GMHG 3R3GB 1PYTC 2PSXA 4XDEA 4H4FA 1AFQC 3A81A 1MBQA 5GCHF 4JZFH 1ZHRA 2PGQB 2ODPA 2M5TA 1A0LA 3AW0A 2WHXA 3V0XA 1GCTB 5E0GA 4U01A 2WPKS 1GJ7B 1P3CA 4NZLA 4WF8A 3DHKH 1UK2A 1XX9A 4UONA 4M9FA 1C5NH 1MABB 2PTNA 3RU4D 3U69H 3KNXA 4INHA 1GBKA 3OAAD 4WY3A 1GI8B 2BZ6H 5F53A 2CF9H 2D2DA 1Z1IA 3D65E 3LGYA 4K8BA 4GHTA 4AX9H 1SGEE 2RA3A 1HBTH 1QJ7B 1GBBA 2R2MB 2AGEX 1AD8H 1ELVA 2QY0B 2J97A 4OM9A 3GDUA 1AFEH 3TH3H 3SHCH 1GL0E 4AZ2B 1YCPK 2R9PA 3RMOH 3UY9A 3MO9A 2A0QB 1DANH 1E1QD 1T8MA 1A46H 4JYVH 3P6ZB 2FODA 1OX1A 1K1OA 1FY5A 1HJAC 1SKYE 3T5FH 2Z6BD 3UR9A 3OSYA 1EAUA 1SQRA 2AERH 1NTPA 1WCZA 1K0HA 1BHXF 2OINA 3VB4A 4AYYB 1VJ9U 5J4SA 4B71A 1A0JA 1T7CA 1P06A 1N8OB 2A4QA 1JBUH 1PPGE 5T6DA 2WPHS 4TPIZ 3RXBA 1O5DH 2QXGA 1IQHA 2H5DA 2B8OH 4X6PA 1SVPA 1GBDA 3BIUH 3TJNA 4YM9A 1V2RT 2FOCA 3MNBA 2H9EH 3S69A 2VIOA 1BBRE 1BMAA 1EPTC 2XCNA 3KQBA 1GDUA 1RIWB 2THFB 4AORA 1EP5A 2RG3A 1UVTH 2F9BH 5CE1A 2GP9B 1O5GH 1DUEA 3V7TA 3OY5U 3RXOA 2BDHA 4Y0ZE 1NBMD 4DGJA 2ZFTA 2V35A 2GMTB 2BXTH 2LP6A 2PWXA 4RKOB 3TGJE 1KMHB 1UK3A 5HKKD 2F9PA 1P57B 2QF4A 1V2QT 1LDTT 1C1RA 2QF0A 3RXDA 2KCOA 1PPFE 1S81A 5CHAC 2ZECA 1GI3A 5CHBA 3D23A 2P3TB 4GPGA 1BMNH 1TPPA 1DX5M 2F3CE 4Y76A 1RTLA 3LC3A 4AFUA 4Y79A 2Y6TA 1CGIE 3SNBA 3M5MA 1V2ST 1FN8A 1K9OE 1LVOA 3Q76A 3FP6E 1SGCA 1MCVA 4CRBA 3M3VA 5DJ7A 3SI4H 4K1SA 5E2OA 5EOKA 4TSFD 2BHGA 6LPRA 2ZPSA 4ZUHA 1V2MT 2R3UA 5ETXA 4A1TA 2P8OC 4AYVB 4MNWA 1EPTA 3A85A 1BOQA 1FV9A 1BB0B 2GVFA 4OS1A 5A09A 2AEIH 3QX5H 5EJZA 1CT2E 1C1MA 3F6UH 1YLCA 1O3BA 3ZV9A 2STBE 2NU0E 4XSKU 5GCHG 1O2KA 1EP6A 2Y80A 2V0BA 2VIQA 3MU8A 3N7OA 3A87A 2C4FH 4X2WA 2A2XH 2HPPH 1HGTH 2AH4X 1AI8H 1CGJE 1E1RD 1ESAA 3BSQA 3GY3A 3D62A 1GMCF 1MD8A 1GI7B 1AUTC 5HMAA 1DLEA 2RFKC 1SFQB 1SQTA 1K1MA 1RS0A 4DIHH 3S7KB 1AB9C 2OBQA 2M2AA 5TJXA 4B6EA 3W1EA 1C5SA 4PROA 2QXJA 7LPRA 4NA7A 1V2JT 3SV8A 3E16B 1GJBB 1AWFH 2XBVA 1S0QA 4B2AA 2STAE 2Z3DA 1C1UH 2VNTA 1G37A 1SHYA 1CVWH 2XWAA 3M5OA 3P8GA 1EJMA 2Z9JA 4Y7BA 3BEUA 1UW7A 1ZMJA 4X6OA 3PMAB 2W7SA 2FTMA 1SGPE 3TPIZ 1RRKA 3FZZA 4XD7D 1OHHD 1TPOA 4YT6H 2HVXA 3S9BA 4X1PU 4O3UA 1WTGH 2XYAA 1C5ZB 5JB8S 1BQYA 1TNLA 4IGDA 5DK1A 2ESTE 1XMNB 1MTSA 2D26C 1VITH 4ZHLU 4FUBA 5AVDA 3BG8A 1UVSH 3UUZA 4F4OC 1O2YA 3QGNB 1DITH 2JETC 2OQUA 2J98A 1HAZB 3BTGE 1DSTA 3SOSA 3SJ9A 4YO9A 2BLOA 1YC0A 1Y3YA 1H9IE 3BTTE 1C5OH 3PLKA 2CK3D 2VU8E 3MH4A 3PWCA 4ZAEA 3MU0A 1BMMH 1O3AA 3TH4H 3S0NA 1QL7A 4WMDA 1MH0A 5DO4H 1O2XA 1EZUC 4THNH 1TX6A 1H1BA 1PJPA 5TCAA 1CA8B 4MNYA 2BLVA 1S6FA 1N6XA 2W5EA 1C4V2 1LHCH 3OEED 3A8BA 3SQHE 2Q1JA 4O3TA 1IQEA 1Y3UA 2GT7A 2YNAA 3W95A 2ZC9H 1C9TA 1YBWA 1VCQA 1TMTH 5FX5A 4IS5A 3P8NA 1KLIH 3RP2A 3SU0A 3RDZA 2QGRA 3MTYA 3SN8A 1SGRE 3T2NA 1W14U 2ZGJA 5A0BA 1F92A 2ODQA 4CH2B 1S6HA 4BAMB 5KECA 3SNDA 4MPUA 5LPFA 1RTFB 3RU4T 3SW2B 3UB0A 4E7NA 1ZTKA 2W6JD 3RXFA 4GVUA 1CBWB 4K8YA 3SU4A 4WXVA 1IQFA 1O2RA 1BMFD 3CP7A 4X1RU 3TNSA 3HK6B 2YMSB 1Z8IB 1GGDB 2JKHA 3A8DA 1NRRH 3OFND 5DP4A 1XXDA 1G30B 1PQAA 2FX4A 5EW1H 1K1PA 4U32A 2K8IA 2FWWA 7ESTE 1O3CA 1TPSA 1BTXA 2LNCA 3BTME 1ZLRA 2F9VA 7KMEH 1F0UA 4X2XA 1YCPM 1TOCB 4Y11E 2C8XB 4MNVA 1Y5BT 4XBDA 1DWEH 2KR7A 2XOKD 1PYTD 1ESBA 3GY8A 1MAYA 1SLUB 3VXEH 4A6LA 1C5PA 2JH0D 5C0UA 3SU6A 5FPSA 3CNRA 2Y7XA 4Q7XA 2NU4E 2AMDA 4IMZA 1XUIA 1G3EA 1GJ6A 4ISOA 1IQGA 3U98H 2H1UA 2BMGB 1O2ZA 3SV6A 1T4UH 2BLWA 4HG6A 2GZ8A 1PPCE 1ESTA 2J4IA 3B23B 1FZZA 1GBCA 4Y6DA 1DSUA 2VVCA 1MTUA 2OK5A 2HVYB 5EIYA 2DE9A 2IOTA 2QIQA 2BDBA 1HAYB 4VGCB 1O2SA 1BJUA 1O5EH 1KXDA 4R0IA 1V2KT 1WQSA 2KAIA 2W3KA 1SGFG 1AKSB 1C5TA 2NU1E 2Y81A 3PTBA 1C5QA 1F5KU 1SL3A 4TWYA 5DG6A 2GX4A 3OTJE 2QN5T 1HAVB 1BTPA 3VB7A 3LGTA 1YPLH 5C2ZA 2BY9X 3LH3A 2PKAA 1GJAB 5C0TA 1WOFA 2G51A 4FUJA 4CH8B 1GBEA 5BRRE 2DE8A 4IN1A 2WZQA 3E90B 1IAUA 1P2NA 3RU4E 1YPKH 3F1SB 5DP9A 4B76A 3EAJA 1T8OA 3FOAA 2QCYA 4X6NA 4MG3A 2ZCKP 1P04A 2FS9A 2FZZA 5EPNA 3TJOA 1QGFA 2CV3A 3ATKA 4JMYA 1X7AC 1Y5UT 1YCPH 2BQ6B 4UEHH 1Q2WA 1EQ9A 1HJ9A 1Y8TA 3GY2A 3ENSB 2PKSC 5LH8A 1NPMA 3SGBE 1K22H 2WV9A 4IC6A 2GGVB 3GICB 5DP8A 5FCRA 4MPVA 2IPQX 1O2PA 4SGAE 1BCUH 3LONA 3AVZA 2ANWA 4OS6A 4AN7A 3U8TH 1FQ3A 1Z6EA 1W13U 3ZVEA 3PV4A 2XC0A 1TNHA 1K21H 1LO6A 2UWLA 2ZU2A 3DA9B 1XM1A 3AAUA 1THSH 3NPSA 1BDAA 2SGAA 1UTJA 1WQVH 2FIRH 3EA9A 4ZKRU 3BEFB 1GI4A 3TNTA 1LPGB 1UO6A 4XBCA 1KXFA 1GHWH 3ZZ4A 3A8CA 5EQSA 3T27A 3Q3KA 1VR1H 1PPHE 2I6SA 4GLYA 1QRXA 3EYDA 3ITIA 1GVZA 2G00A 1HAXB 1DVAH 4I8HA 3BTFE 4AC9A 1MQ5A 2ALPA 1O3LA 5LPEA 3QK1A 2C90B 1NBME 4YTAA 3W94A 1YPHE 3TVJB 1J16A 1A3BH 2XRCA 4AG1A 5FBEA 3BN9A 3GYLB 4NSVA 2IJOB 2PHBA 2XTTB 2O8TA 3LIWA 1G2LA 1O2TA 1V2PT 2L74A 1S84A 3BF6H 1CSOE 1TOMH 2KCPA 3A7WA 3GS9A 1U6QA 5ESTE 1G9IE 2O8LA 3U28C 1NU9A 1AFQB 2A5IA 4UFEH 5C67A 1HPGA 1NFUA 1C5RA 5DP6A 4I8KA 1K2I1 1GWAA 3PROA 1ZGIA 1A3EH 2F9OA 4OS4A 4ACBA 1YPGH 2ANKH 1DS2E 1GJ5H 1TALA 1DXWA 1O34A 3RMNH 1C1WH 1LHDH 3PMHB 1OP0A 2CF8H 1L0ZA 1WBGB 1ID5H 5DP7A 1W3CA 1FN6A 2AHME 1A7SA 2RDEA 4AFZA 2BLQA 4NGAH 2XC5A 1HIAA 4JZDH 4BTUB 1KTTB 1GJDB 3M7QA 1LHGH 4Q80A 1NFWA 2ZFPH 1LKAA 4X2VA 1WAYB 2EI8A 2AGIX 1W11U 3OTPA 5K7RA 3LGIA 1TX8A 4BTTB 1OP8A 1PFXC 2BM2A 4CREA 2O8MA 1VITG 1JMOH 1NROH 2JJ2D 3UIRA 4LOYH 2QF5A 2A45B 1KDQB 2P94A 2EY4C 2HOBA 1IQMA 1FIWA 4UFDH 3O8DA 2TBSA 1P11E 3MYWA 3VPKA 3SUEA 3BG4C 3TJVA 2H9TH 2FX6A 2VIDA 1C1NA 1QB9A 2HNTC 1SQOA 1GMDF 2A4OA 4X8TH 3ZZ5A 2QXIA 3UWJH 1NRQH 2WPDD 1AUJA 1GPZA 1XUFA 4JCNA 4UFFH 1ZRKA 3DSGA 1BRUP 1QJ1B 2BDIA 4K60A 1HAPH 4KTSA 3ZV8A 6ESTA 1P05A 2UUJB 1NC6A 1WU1A 1MMJN 4Y0YE 2I6QA 4JK6A 1BRBE 1QFKH 3VFEA 5A8ZA 1D3QB 1D6WA 1HJ8A 1Z8RA 3NKKA 2O8UA 5C1XA 4HFPB 3DT0H 3M5LA 2G8TA 1SGDE 1OOKB 4BTIB 3C27B 5C1UA 2FM2A 2Z9IA 3A7TA 1GHXH 2BX3A 3WY8A 2VINA 5JBAS 3SHAH 3TK6A 1FY8E 1P9SA 3AAVA 1H8ED 1FMGA 4LZ4B 3HGNA 4D7GA 4RI0A 2BYAX 1L2EA 1ZJDA 4Y8ZA 1GJ8B 3MI4A 1EB1H 1K1JA 1NESE 2BB4A 5CHAB 1C2FA 1DWCH 1F2SE 1QRWA 2ZDLA 1ORFA 4AB9A 2F83A 1K1NA 3TH2H 4AFQA 1GBAA 1OWKA 4DT4A 2RCEA 1MD7A 2ULLA 1QA7A 3SU2A 4GSOA 1WUNH 1NZQH 2O9QA 4E05H 3BTWE 2XW9A 2Y5FA 3BEIB 3N7EA 7GCHG 3S9CA 4ACAA 1BBRK 2AGGX 1JIMA 4X1QU 4I32A 2P8OB 3LDXH 1WDIA 2PFEA 3F0PA 4FETA 1GBLA 2H2ZA 2HWLB 4O9VA 2BY6X 1YP9A 4DVAU 3KF2A 4ZHAA 1EXFA 2Z3CA 2TRMA 1AQ7A 3LU9B 3A88A 1T8LA 2XBWA 2BOHB 3GDVA 1NM6A 4INKA 3ZZ6A 1P01A 5LGOA 1ELBA 1HAIH 1C5VA 3ZZ7A 1JIRA 1C2DA 4ZXXH 4SGBE 5A0AE 3PO1B 1C2MA 4X2YA 3PTNA 1P03A 1UCYH 1E0FD 1ZZZA 2GV6A 5I25A 2ZU4A 3TGKE 2QC2A 4DCDA 1E79D 1BTZA 4D7FA 4GHQA 1J8AA 1BIOA 1Z8JB 1O3OA 3M37A 3S7HB 1F5LA 2VGCC 1OPHB 3KEEA 4CHAC 1UVUH 2A7CA 2TGAA 1L1NA 2FLBH 1F0TA 1TWXB 2GZ7A 1GBJA 3EDXB 2GJGA 1LKBA 2VB0A 1HLTH 1C2IA 2TGPZ 1CHGA 4FUGA 1ANEA 5C1YA 4CRGA 1CHOF 2FPZA 1YGCH 1ABIH 2ZHDA 2PW8H 3E3TA 1C1PA 4ISHH 5DP5A 1UVPA 2OUAA 1EX3A 1Z71A 1ZHPA 4FOUC 4KELA 4I8LA 1CO7E 5EGMA 5GIBA 2JETB 1CA0C 4I86A 2QXHA 3ZVAA 1NS3A 2PUQH 4UD9H 4YOJA 2VWLA 8GCHF 4DT7B 2FOAA 1OWJA 5T6GA 1ELCA 1O2NA 1QTFA 1ZSKA 3MH6A 2OLGA 2A5AA 1PPBH 1FPHH 1ZRBA 5JBCS 1C4U2 5KGOA 2ZFFH 1TGBA 3GCOA 4CR5A 1S5SA 1O3PB 1QBOA 1TA6A 1SQAA 4HGCA 2ZDKA 3QWCH 1TYNA 2ZDAH 2ZHQH 3KQEA 5HIYA 2ZFQH 3P92A 2IJD1 1DWDH 4NIWA 1KXCA 4U30A 1TBZH 1AN1E 1C1TA 3KGPA 3MOCA 2J92A 2FI5E 2P3UB 3E1XB 3K9XB 1QQ4A 1SGYE 2XBXA 4DY7B 4I7YH 2QV1A 1B5GH 4NSYA 4XFQA 1GG6C 1GHYH 1LVBA 2PP6A 3SGQE 2ZU3A 3SJIA 1TX7A 9ESTA 3ZYEA 1ETRH 1IQIA 2SGFE 1OWDA 3T28A 1KYNA 1F0RA 1UHBA 4WVPE 1ZYOA 2A32A 1KSNA 1AWHB 1P2KA 1GI5A 1FDPA 2Z94A 3U8OH 1YY3A 3M7UA 2BDAA 2B5TB 2V3HH 2BQ7B 1SLWB 3MMGA 1OWIA 4IW4E 2BQWB 3A7XA 2FEQH 3SV2H 1FI8A 1Y59T 2ZU1A 1HXEH 2ANYA 1KIGH 2OTVA 4LK4A 4JZEH 2KAIB 1XXFA 3B9FH 3ODDA 1AVXA 4ISIH 1Y3WA 3FP8E 2SGDE 5ESBA 1Y5AT 1DXPA 1PPEE 3ODFA 2GCTC 1FJSA 4MQAA 2AYWA 3OX7U 3EA8A 3KL6A 2ZF0H 2FO9A 1LMWB 4HZHA 1AGJA 2WUCA 1P12E 2PKAB 4H6TA 2B9LA 2UUFB 1NFXA 3GCNA 2EI7A 1ARCA 1TA2A 2KZ4A 5GPIB 3JZ1B 4NIXA 5EW2H 1LVMA 1AY6H 3G01A 3P17H 1ZMLA 2J2UA 2BY8X 4CBOA 5FPYA 2FYRA 1O3KA 1GI1A 3LGWA 3MHWU 3OEHD 2A7JA 5SGAE 2ILNA 1IHTH 1RIWC 3WWFA 3V12A 2J34A 3STJA 1O3EA 1O35A 1T32A 2PUXB 3HKIB 5L2ZH 3M3SA 3UFAA 1H8DH 4XOJA 1OYQA 1LCYA 3F2GA 3MNSA 1ZMNA 5C5NA 2ZWLH 2H9HA 1MZAA 3RXEA 2FOEA 4BAOB 1CHOG 3RM0H 4ABJA 1TBQH 4OGYA 3FO8D 3MFJA 4RN6A 3TU7H 4I33A 1HAHH 1NY22 2QA9E 4NZQA 4Q7ZA 1NRNH 3T25A 3DCLA 3H5CB 1RGQA 1B0FA 1EZQA 4F49A 2BDGA 1P2QA 3NWUA 3LOXA 2G4TA 2FOFA 3BIVH 3STIA 3M7TA 2B7DH 3RXVA 3RXAA 1FUJA 1O5AB 4FUEA 5EJ1A 1KLTA 1YPJH 2BZAA 1XUHA 2G5NA 3A7YA 1HAOH 4DW2U 4YOIA 2Z9LA 3SO3A 3F9GA 3RC5A 1SLXB 1TRNA 3Q3YA 1C9PA 1G32B 1QA0A 1W2KH 1EAWA 2BDYA 2ZTXA 2VIPA 3GY4A 5A0CA 1UTOA 5FCKA 1P2OA 1OS8A 2BVSH 3PWBA 4NFFA 1AHTH 2NU3E 5H4IB 3RMMH 1JWTA 1A5GH 1HB0B 4MLFB 1TQ0B 2EA3A 1DDJA 4IC5A 5FX6A 2TGTA 4GUXA 2WPLS 1GMCG 1D4PB 3MO6A 1UCYK 1ZGVA 5EODA 1HNEE 3GY5A 2ZNKH 3SV7A 1ZSJA 3K65B 1GHZA 2WSSD 3LKWA 1CT0E 2VWMA 5HYOA 3K6ZA 3SBKA 3L33A 1W12U 1RFNA 3RXUA 3U1IB 1DY9A 3PV5A 5F8XA 3P70B 4K2YA 3MU4A 2BY7X 2BD8A 1GBFA 4Y7AA 2ZHWH 5PTPA 1C4Y2 5ABWA 1EAXA 3A83A 1NO9H 5FXLA 3KHVA 2D1JA 1IHSH 2C8WB 1YYY1 4Y10E 1GL1A 1GI0A 3RXHA 1P3EA 2FOMB 2BD3A 4B1TA 1V2UT 3GISB 1O3FA 1VKYA 1LPZB 1C2EA 3QTVH 4ZROA 4RKJB 2FXRA 2KFWA 2ZO3H 1Q31A 3AASA 4JYTA 1LHFH 1MCTA 2G5VA 2R2WU 3EE7A 4X1NU 2G55A 4NIYA 4I8GA 1BBRH 1SGFA 3SORA 4NCYA 5F8TA 3PV2A 1OWHA 2FP7B 1GJ9B 2PLXA 1ZR0A 3PM3A 1GBMA 1EFRD 2A4GA 2OC1A 5J4QA 2KX4A 4A7IB 2VH0A 1T8NA 2Y5HA 3I77A 1JRTA 4K69A 2BD5A 3OYPA 3U9AH 2Q6GA 1MAXA 2DUCA 2P95A 2VIWA 4ZHMU 4DURA 1B7XB 3QLPH 3BTDE 5EG4A 4AGKA 3E0PB 4GAWA 1ZPCA 1GHBF 1QL9A 4ISNA 4KGAA 1MQ6A 2HGTH 1A5HA 1J17T 2V3OH 1YLNA 1EOLA 2SGQE 1YF4A 2YOLA 1SHHB 2BY5X 3RXJA 4YOGA 2JJ1D 4X1SU 3ATLA 2RA0A 3BTQE 3URCA 1UMAH 1FAXA 2ZGXH 2K1QA 3ATMA 5E0HA 2YMSC 1QHRB 1IQJA 1GGDC 5E2PA 1E35B 3LJOA 1QIXB 1O2WA 3DD2H 5F6MA 3HGPA 3BG4B 1M9UA 1ZSLA 5EQRA 1C1VH 1FY4A 1H4WA 4X8SH 3L3TA 4MTBA 1SGNE 4Q4LA 2D8WA 1MTNC 4ABAA 1GHVH 4CR9A 1KTSB 5EU8A 4F55A 1O39A 3RXGA 2J94A 3RLYH 1V2TT 4K1TA 1BTWA 1GMHF 1SI5H 2ZU5A 1XKBC 3M5NA 4J1YA 3UQOA 3O8CA 3OU0A 2AMQA 1TMBH 4FXGH 1OP2A 3KCGH 1UK4A 1EUFA 4AB8A 4ZCNA 1GJCB 1UTQA 4M7GA 2CHAC 3BTHE 4WJG2 2H5CA 2OXSA 2R3YA 2BTCE 3KQ5A 3M35A 4F48B 1T31A 1BITA 1QRZA 1SOTA 3MNCA 1SFIA 3NXPA 1O2IA 1TE0A 4DIIH 4FU8A 3ATWA 1C1QA 4XE4A 1UJ1A 3R0FA 1ELEE 3ZZ8A 1A5IA 1WYKA 3M3TA 1GBIA 1OYTH 1L1GA 1YKTA 1GBHA 1JRSA 4WMEA 1GI2A 1ZOMA 2HRVA 1O3NA 2BD9A 1LQEA 1TAWA 1C5YB 2Z9GA 2JH5D 1G3DA 1QURH 4D9QA 2ZDMA 1OWEA 1QR3E 3Q77A 4H42U 2A4RA 1C2GA 3PYHA 1GJ4H 1O2QA 4H6SB 1VGCC 1FPCH 5DSFA 5HM2A 1O3GA 2ZFRH 4ESTE 2GCHF 5GDSH 4K3JA 1TONA 4B73A 1Z1JA 3O8RA 3RUOA 4YT7H 4ASHA 1JXPA 1TB6H 1YPMH 3MU1A 3RXIA 2FOHA 2F9UA 4JZIA 1FIZA 3GCTF 4D9RA 5E0JA 1MU6B 3KYGA 1HRTH 1O3HA 2ZGBH 1YWUA 1GHAF 1P9UA 3U8RH 1CQQA 1P2JA 3FN8A 4JK5A 4AOQA 5DN6D 1ANCA 3LC5A 1LQDB 1HJAB 3K2UA 1GHBG 5AHGH 2BX4A 1SGIB 4E06H 4A92A 3UNRA 1O2LA 3SNAA 1O0DH 2AIQA 2WUBA 2WPIS 3BTKE 2VIVA 2GKVE 1E36B 3A82A 4CRCA 2VGCB 1EATA 3QN7A 1P0SH 2Y7ZA 4NG9H 4ZH8A 1ACBE 4CHAB 3U1JB 4BXSA 3ZZ9A 2Q6FA 4BXWA 1QY6A 3V13A 3F3BA 1E37B 2JH6D 2YNBA 1G3BA 1EPTB 1V2OT 3GY6A 1TLDA 1RXPA 1MZDA 4A1VA 1V3XA 2VWOA 1QQUA 2KCYA 3Q3XA 3ZZBA 1AO5A 1ELDE 3A84A 2FOGA 5GJ4B 1S83A 1D6RA 3PLBA 4Q63A 1E38B 2VVUA 2ALVA 1IQNA 1PQ7A 1F7ZA 1CA0B 3TLOA 1T4VH 1TNIA 3VGCC 4HTCH 2V6NA 2JIZD 1PQ8A 3QZRA 1TMUH 5B6LA 1BT7A 2PR3A 4A1XA 3VXFH 1XUJA 3SGAE 3CS7A 1TFXA 1BTHH 2ZGCA 5L6NH 2F43B 3AW1A 5DPAA 1XVMA 2Q6DA 3M36A 2FI3E 1BRCE 1ZPZA 2AMPA 1GDQA 3FP7E 4WWYA 1J9CH 1EZXC 2HNTE 3TK5A 4Z6AH 2L6OA 5FBIA 1P8VC 1A0HB 4BOHA 1H9HE 4ZKSU 1RJXB 2HALA 4CBNA 5AF9H 1Z6JH 1O2JA 5GXPA 1LVYA 1W7XH 1EZSC 1N6YA 2LELA 2SFAA 5F8ZA 4ABDA 2ZGHA 2FS8A 4X6MA 3ESTA 3SJKA 2ZHEH 1GG6B 2ZTZA 2Y5GA 3SI3H 1C2KA 3TIUA 4TY6A 6CHAC 1SR5C 1YM0A 4FU9A 5IYTA 3E6PH 2ZCHP 2VWNA 1AVWA 1SGQE 2XWBI 3ZYDA 1AB9B 2J98B 1D3PB 1DPOA 1BHXB 2PSYA 1SLVB 4NIVA 2Y82A 3E0NB 1C2JA 1A2CH 2GCHG 1A4WH 2F9NA 3F2FA 3RXPA 1W0YH 3QDZB 1VJAU 1NFYA 1QBNA 1AZ8A 1C5MD 3GCHC 4E7RG 3DSOA 3L6PA 4JYUH 5AFYH 2ZCLP 1KY9A 2BD7A 3GCTG 5AFZH 2BD4A 1GVKB 2GCTB 2UUKB 4O97A 3RC4A 5FAHA 5F03A 1S85A 4WH6A 5JPMH 1GHAG 3FANA 1MKWK 4AG2A 5HM9A 2G81E 1N1LA 1SSXA 3DSPA 1H9LB 2OBOA 1SOZA 4FUFA 4MDSA 1BMLA 4B6FA 1SGTA 1GMDG 2ZHFH 2TIOA 3RXQA 1MKXK 4Z0KA 1TGCA 2BOKA 2FESH 1L4ZA 3KN2A 3WWBA 1SG8B 2P3FH 4FUIA 3NZIA 4FVDA 1QJ6B 3F9HA 5DGJA 1C1OA 5HIZA 4ASUD 1O2MA 3SNEA 3LGUA 3P8FA 1NU7B 2J95A 1H8IH 1C2HA 1W7GH 5G4BA 1KDQA 3HK3B 4TPYA 4YLUA 5C5OA 1E34B 2FLRH 3O8BA 1S82A 4P00A 2CN0H 4D8NA 3UAIC 4BAKB 4O03A 1ELTA 1UTPA 2YMSD 4KTCA 2QF3A 1HDTH 2CJIA 1SMFE 3MU5A 1GCTC 2ZEBA 3IWMA 3ATIA 2FI4E 3UNQA 1UTMA 4OGXA 1CE5A 1AU8A 1O30A 3OE7D 3MQKC 2H6MA 2OC0A 6GCHF 4OS5A 1ELFA 4X0WU 5A2MH 2A2QH 2W3IA 3VB3A 4Y71A 2EQNA 1O2GH 4B74A 2ZDVH 2ZQ1A 4OS7A 3FAOA 1S6LA 1TNJA 2HLCA 2OC8A 1EJAA 4A5TS 1TIOA 1XUKA 1O5CB 3SU3A 3PRDA 1DT2A 1F0SA 5DP3A 1DUAA 1QNJA 5C94A 1HXFH 2ZG0H 5CDFE 1LPKB 5HXFA 8KME2 1KLJH 1W0KD 2FMJA 1NN6A 1WSSH 1QZ8A 3I78A 1DICA 1LHEH 4TYDA 1IQKA 4XBBA 3TJUA 4ABBA 4X8VH 5T1VA 3P8OA 1UTKA 2HLDD 3PO1C 2ZA5A 2W26A 2SGEE 4FVBA 1THRH 4CRFA 5FL7D 2A1DB 4XRNA 1C5LH 2PV9B 2XNDD 2Z7FE 5TCCA 4OS2A 3SYJA 1SPJA 1FONA 3NK8A 1N8OC 1BUIA 2QAAA 3M61U 1BTUA 2ZFSA 1GVLA 5I46H 4ABGA 1TGSZ 3GDSA 4ABFA 4BANB 3MH7A 5T6FA 8ESTE 5L2YH 3SUFA 3T26A 2SGPE 1C1SA 2FYQA 2HPQH 2EI6A 4NA8A 5BPEA 4FUHA 1BA8B 1TGTA 3H7TA 2XCFA 3PMBB 3RXLA 2GV7A 2F4LA 2VVVA 4Y8YA 1XVOA 3QTOH 2C8ZB 3SZNA 1GI9B 2GMTC 1QL8A 5JB9S 1O3IA 3E8LA 3RXMA 1NRPH 2FOBA 3GOVB 4IN2A 4X8UH 4FUDA 1THPB 2VJ1A 1UVOA 2WV5A 2UWPA 4DJZB 1L4DA 3BTEE 3QUMP 1VCWA 1XUGA 2UWOA 5HGGA 2BVXH 1AE5A 1EKBB 1KXBA 4RSPA 4ABEA 4ZKNU 4WH8A 1O2HA 2P93A 1ETTH 4WMFA 1IOEA 4ABHA 1Y3VA 1O38A 1Y3XA 1SBWA 2ZDNA 5KEDA 3ZVFA 2WYJA 2XC4A 8GCHG 3SQEE 3A8AA 4GCHF 4P02A 4CRDA 3ELAH 1C5WB 3VB6A 1DOJA 3UOPA 5A8XA 2OQ5A 3C1KA 4MPWA 1AE8H 8LPRA 2XNIA 1MU8B 3VG8A 5C17A 2C3SA 3QZQA 2C93B 3MNXA 2TPIZ 3UNSA 5EXLA 1CGHA 2PKSB 2Z3EA 3H09A 3WW7A 5GWZA 5A8YA 1W8BH 2WPJS 2ZP0H 2ZTYA 3EE0B 1GDNA 2ODYB 1NT1A 4INLA 4B2CA 1K28D 1DLKB 5LPRA 6GCHG 1DE7H 3FKSD 1AVGH 1KXEA 4FU7A 5JBTA 3I29A 2W6ID 1MBMA 1L1JA 3E91A 4TWWA 2TGDA 2GDEH 1P02A 3A80A 3IG6B 4BAQB 2J9NA 1EJNA 5EPYA 3SU5A 1WTHD 3UPEA 4Z1MD 3LGVA 2C8YB 3A89A 4B75A 1O33A 2F91A 2BDCA 3ZVGA 4MVNA 1O2UA 3VB5A 3CENA 2ANMH 3RM2H 1TPAE 2WINI 1FNIA 1TGNA 5E8EH 3UTUH 3ZZ3A 1MTWA 3ZZCA 1FY3A 5EJLA 1O3MA 1V2WT 4CRAA 1MTNB 1V2VT 1PPZA 2P16A 4KTUA 5IK2D 3RXTA 1OKXA 5JDUB 3UR6A 1TQ7B 3NRLA 3N7DA 3MO3A 3K6YA 3SUGA 1HIAB 2ZIQH 2AS9A 1B0EA 4IMQA 3PMJA 5JYIA 2BVRH 1QB6A 1V2NT 2R0LA 4KP0A 2SNWA 1J14A 3ZVBA 3V3MA 1O37A 2CHAB 4WXIA 2GZ9A 4TY7A 3SU1A 1UTLM 2KCAA 2GDDA 1ELGA 3KIDU 1ANDA 2EC9H 2WYGA 1JOUB 3B8JA 4DOQA 1GCDA 2G52A 1COWD 2BD2A 5B6OA 3MH5A 1G2MA 2SNVA 1AMHA 2JDID 3T62A 2PGBB 1TRMA 5JBBS 1F5RA 3UWIA 2CGAA 3RLWH 3SNCA 1FAKH 1O5FH 1D9IA 2A31A 2P59A 1C2LA 1ANBA 3SJOA 4K5ZA 3TK9A 2J5UA 3DFLA 4R8TB 1DFPA 3F68H 2WV4A 3N99A 2ZI2H 1DY8A 3D49H 1W0JD 2B0FA 1D3DB 4UE7H 4ABIA 1VITF 4I8JA 1O31A 1VGCB 3LPRA 3UREA 3DFJA 1UCYE 1YPHC 4YZUA 5K0HA 1K1IA 4RT1A 3IITA 3RXCA 1CBWC 1A1RA 4YESB 4J2YB 3T29A 1EB2A
chains in the Genus database with same CATH topology
2ASUB 4JZ1A 4GCHG 5C20A 2GT8A 2VH6A 5IDKA 3A7VA 2GTBA 4QT8C 1HAGE 3OY6U 1ELAA 4B2BA 2OCVB 1O3DA 1O32A 1AIXH 3ZZDA 3EQ0H 2XXLA 9LPRA 3RMLH 2ZKSA 1MKWH 1TNGA 3KQCA 1S0RA 4ZKOU 4Q7YA 3HKJB 1BTYA 1P2IA 4I31A 1EAIA 2A5KA 5EQQA 4AFSA 1OXGA 2GD4B 3ZVCA 1MKXH 3EGKH 1QB1A 3F9EA 3RXRA 1TNKA 3P95A 2OD3B 1ETSH 3SJ8A 1P09A 3HATH 3Q00A 2HNTF 1MTVA 1O2OA 2XBYA 2FTLE 3BV9B 2IPHA 3QGJA 2G4UA 3EA7A 1INCA 3QO6A 3SV9A 3UOUA 4UDWH 2O8WA 1ZTJA 1GBTA 1V2LT 4Q2KA 4LXBH 2ZPQA 2NU2E 3JZ2B 1TABE 4IBLH 1HCGA 4UFGH 1HYLA 1LTOA 1WV7H 2RDLA 3DUXH 4VGCC 4ZMAH 3ZZAA 5EXNA 1C5UA 4NA9H 1ZPBA 7GCHF 4NFEA 3VGCB 3HPTB 4MPXA 1ZJKA 5DKMA 1G36A 3F9FA 1K1LA 1YPEH 4LZ1H 1O5BB 1P10A 1TBRH 1QCPA 2CXVA 2LPRA 4YLQH 1OSSA 3LT3A 1O3JA 5FHTA 2FDAA 3TGIE 1O36A 3LJJA 1ZHMA 1P2MA 1VCPA 3TITA 1C5XB 1FY1A 4D76A 4Y8XA 1ABJH 1SB1H 1V6DA 1FXYA 4U2WA 3RXKA 3ZVDA 2NWNA 4AGJA 5CMXH 3RXSA 1G3CA 3S9AA 3A7ZA 3FVFB 1BZXE 1J15A 1IQLA 4BAHB 5FPTA 1HUTH 3RC6A 2R0KA 3MWIU 1A61H 3KQDA 3A86A 4NWLA 6CHAB 1XKAC 1AKSA 2UUYA 2EEKA 1VZQH 3GYMA 4BNRA 3PLPA 4MNXA 1HFDA 2Z9KA 4NWKA 1CU1A 1TRYA 2W7UA 1Z8GA 1HAVA 3URDA 3UQVA 2IN2A 1DWBH 1O2VA 1QBVH 1BRAA 1RTKA 3GY7A 3PB1E 2ZZUH 2OP9A 3GCHB 3VEQB 1EOJA 2AFQB 2BXUH 1D3TB 3H7OA 1MUEB 2A7HA 2J38A 1Z7KA 5EXMA 4DG4A 1NRSH 1HV7A 3NUMA 3LH1A 5L30H 1W10U 1KXAA 1W0ZU 1AZZA 1PQ5A 2ZQ2A 1RD3B 3FFGA 4ZXYH 1UTNA 1GI6A 1ARBA 1ZTLA 1BJVA 4HI3A 2PTCE 1YLDA 4KKDA 4K1EA 1DM4B 3SUDA 4ISLA 2QYIA 2CMYA 2ZPRA 5C3NA 3CS0A 1SC8U 1UHBB 3FZDA 1EASA 3NCLA 2AIPA 1CT4E 4FUCA 1Q3XA 2WPMS 2OC7A 5T3HA 1GMHG 1FLEE 3R3GB 1PYTC 2PSXA 4XDEA 4H4FA 1AFQC 3A81A 1MBQA 5GCHF 4JZFH 2PGQB 1ZHRA 2ODPA 2M5TA 1A0LA 3AW0A 3V0XA 1GCTB 5E0GA 4U01A 2WPKS 1GJ7B 1P3CA 4NZLA 4WF8A 3DHKH 1UK2A 1XX9A 4UONA 1C5NH 3RU4D 2PTNA 3U69H 3KNXA 4INHA 1GBKA 4WY3A 1GI8B 2BZ6H 2CF9H 2D2DA 1Z1IA 3D65E 3LGYA 4K8BA 4GHTA 4AX9H 1SGEE 2RA3A 1HBTH 1QJ7B 1GBBA 2R2MB 2AGEX 1AD8H 1ELVA 2QY0B 3GDUA 1AFEH 3TH3H 3SHCH 1GL0E 4AZ2B 1YCPK 2R9PA 3RMOH 3UY9A 3MO9A 2A0QB 1DANH 1T8MA 1A46H 4JYVH 3P6ZB 2FODA 1OX1A 1K1OA 1FY5A 1HJAC 3T5FH 3UR9A 2Z6BD 3OSYA 1EAUA 2AERH 1NTPA 1WCZA 1BHXF 2OINA 3VB4A 4AYYB 1VJ9U 5J4SA 4B71A 1A0JA 1T7CA 1P06A 1N8OB 2A4QA 1JBUH 1PPGE 5T6DA 2WPHS 4TPIZ 3RXBA 1O5DH 2QXGA 1IQHA 2H5DA 2B8OH 4X6PA 1SVPA 1GBDA 3BIUH 3TJNA 4YM9A 1V2RT 2FOCA 3MNBA 2H9EH 3S69A 2VIOA 1BBRE 1BMAA 1EPTC 2XCNA 3KQBA 1GDUA 1RIWB 2THFB 4AORA 1EP5A 2RG3A 1UVTH 2F9BH 5CE1A 2GP9B 1O5GH 1DUEA 3V7TA 3OY5U 3RXOA 2BDHA 4Y0ZE 4DGJA 2ZFTA 2V35A 2GMTB 2BXTH 2PWXA 4RKOB 3TGJE 1UK3A 2F9PA 1P57B 1V2QT 1LDTT 1C1RA 2QF0A 3RXDA 1PPFE 1S81A 5CHAC 2ZECA 1GI3A 3D23A 2P3TB 4GPGA 1BMNH 1TPPA 1DX5M 2F3CE 4Y76A 1RTLA 3LC3A 4AFUA 4Y79A 2Y6TA 1CGIE 3SNBA 3M5MA 1V2ST 1FN8A 1K9OE 1LVOA 3Q76A 3FP6E 1SGCA 1MCVA 4CRBA 3M3VA 5DJ7A 3SI4H 4K1SA 5E2OA 5EOKA 2BHGA 6LPRA 2ZPSA 4ZUHA 1V2MT 2R3UA 5ETXA 4A1TA 2P8OC 4AYVB 4MNWA 1EPTA 3A85A 1BOQA 1FV9A 1BB0B 2GVFA 4OS1A 5A09A 2AEIH 3QX5H 1CT2E 1C1MA 3F6UH 1YLCA 1O3BA 3ZV9A 2STBE 2NU0E 4XSKU 5GCHG 1O2KA 1EP6A 2Y80A 2V0BA 2VIQA 3MU8A 3N7OA 3A87A 2C4FH 4X2WA 2A2XH 2HPPH 1HGTH 2AH4X 1AI8H 1CGJE 1ESAA 3BSQA 3GY3A 3D62A 1GMCF 1MD8A 1GI7B 1AUTC 5HMAA 1DLEA 1SFQB 1SQTA 1K1MA 1RS0A 4DIHH 3S7KB 1AB9C 2OBQA 5TJXA 1C5SA 4PROA 2QXJA 7LPRA 4NA7A 1V2JT 3SV8A 3E16B 1GJBB 1AWFH 2XBVA 1S0QA 4B2AA 2STAE 2Z3DA 1C1UH 2VNTA 1G37A 1SHYA 1CVWH 2XWAA 3M5OA 3P8GA 1EJMA 2Z9JA 4Y7BA 3BEUA 1ZMJA 4X6OA 3PMAB 2W7SA 2FTMA 1SGPE 3TPIZ 1RRKA 3FZZA 3S9BA 1TPOA 4YT6H 2HVXA 4X1PU 4O3UA 1WTGH 2XYAA 1C5ZB 5JB8S 1BQYA 1TNLA 4IGDA 5DK1A 2ESTE 1XMNB 1MTSA 2D26C 1VITH 4ZHLU 4FUBA 5AVDA 3BG8A 1UVSH 3UUZA 4F4OC 1O2YA 3QGNB 1DITH 2JETC 2OQUA 3BTGE 1HAZB 1DSTA 3SOSA 3SJ9A 4YO9A 2BLOA 1YC0A 1Y3YA 1H9IE 3BTTE 1C5OH 3PLKA 2VU8E 3MH4A 3PWCA 4ZAEA 3MU0A 1BMMH 1O3AA 3TH4H 3S0NA 1QL7A 4WMDA 1MH0A 5DO4H 1O2XA 1EZUC 4THNH 1TX6A 1H1BA 1PJPA 5TCAA 1CA8B 4MNYA 2BLVA 1S6FA 1N6XA 2W5EA 1C4V2 1LHCH 3A8BA 3SQHE 2Q1JA 4O3TA 1IQEA 1Y3UA 2GT7A 2YNAA 3W95A 2ZC9H 1C9TA 1YBWA 1VCQA 1TMTH 5FX5A 4IS5A 3P8NA 1KLIH 3RP2A 3SU0A 3RDZA 2QGRA 3MTYA 3SN8A 1SGRE 3T2NA 1W14U 2ZGJA 5A0BA 1F92A 2ODQA 4CH2B 1S6HA 4BAMB 3SNDA 4MPUA 5LPFA 1RTFB 3RU4T 3SW2B 4E7NA 1ZTKA 3RXFA 4GVUA 1CBWB 4K8YA 3SU4A 4WXVA 1IQFA 1O2RA 3CP7A 4X1RU 3TNSA 3HK6B 1Z8IB 1GGDB 2JKHA 3A8DA 1NRRH 5DP4A 1XXDA 1G30B 1PQAA 2FX4A 5EW1H 1K1PA 4U32A 2FWWA 7ESTE 1O3CA 1TPSA 2LNCA 1BTXA 3BTME 1ZLRA 2F9VA 7KMEH 1F0UA 4X2XA 1YCPM 1TOCB 4Y11E 2C8XB 4MNVA 1Y5BT 4XBDA 1DWEH 1PYTD 1ESBA 3GY8A 1MAYA 1SLUB 3VXEH 4A6LA 1C5PA 2JH0D 3SU6A 5FPSA 2Y7XA 4Q7XA 2NU4E 2AMDA 4IMZA 1XUIA 1G3EA 1GJ6A 4ISOA 1IQGA 3U98H 2H1UA 2BMGB 1O2ZA 3SV6A 1T4UH 2BLWA 2GZ8A 1PPCE 1ESTA 2J4IA 3B23B 1FZZA 1GBCA 4Y6DA 1DSUA 2VVCA 1MTUA 2DE9A 2IOTA 2QIQA 2BDBA 1HAYB 4VGCB 1O2SA 1BJUA 1O5EH 1KXDA 4R0IA 1V2KT 1WQSA 2KAIA 2W3KA 1SGFG 1AKSB 1C5TA 2NU1E 2Y81A 3PTBA 1C5QA 1F5KU 1SL3A 4TWYA 5DG6A 2GX4A 3OTJE 2QN5T 1HAVB 1BTPA 3VB7A 3LGTA 1YPLH 5C2ZA 2BY9X 3LH3A 2PKAA 1GJAB 1WOFA 2G51A 4FUJA 4CH8B 1GBEA 5BRRE 2DE8A 4IN1A 3E90B 1IAUA 1P2NA 3RU4E 1YPKH 3F1SB 5DP9A 4B76A 3EAJA 1T8OA 2QCYA 4X6NA 4MG3A 2ZCKP 1P04A 2FS9A 2FZZA 5EPNA 3TJOA 1QGFA 2CV3A 3ATKA 4JMYA 1X7AC 1Y5UT 1YCPH 2BQ6B 4UEHH 1Q2WA 1EQ9A 1HJ9A 1Y8TA 3GY2A 3ENSB 2PKSC 5LH8A 1NPMA 3SGBE 1K22H 4IC6A 2GGVB 3GICB 5DP8A 5FCRA 4MPVA 1O2PA 4SGAE 1BCUH 3LONA 3AVZA 2ANWA 4OS6A 4AN7A 3U8TH 1FQ3A 1Z6EA 1W13U 3ZVEA 3PV4A 2XC0A 1TNHA 1K21H 1LO6A 2UWLA 2ZU2A 3DA9B 1XM1A 3AAUA 1THSH 3NPSA 1BDAA 2SGAA 1UTJA 1WQVH 2FIRH 3EA9A 4ZKRU 3BEFB 1GI4A 3TNTA 1LPGB 1UO6A 4XBCA 1KXFA 1GHWH 3ZZ4A 3A8CA 5EQSA 3T27A 3Q3KA 1VR1H 1PPHE 2I6SA 4GLYA 1QRXA 3EYDA 3ITIA 1GVZA 2G00A 1HAXB 1DVAH 4I8HA 3BTFE 1MQ5A 2ALPA 1O3LA 5LPEA 3QK1A 2C90B 4YTAA 3W94A 1YPHE 3TVJB 1J16A 1A3BH 2XRCA 4AG1A 5FBEA 3BN9A 3GYLB 4NSVA 2IJOB 2PHBA 2XTTB 2O8TA 3LIWA 1G2LA 1O2TA 1V2PT 1S84A 3BF6H 1CSOE 1TOMH 3A7WA 1U6QA 5ESTE 1G9IE 2O8LA 1NU9A 1AFQB 2A5IA 4UFEH 5C67A 1HPGA 1NFUA 1C5RA 5DP6A 4I8KA 1K2I1 1GWAA 3PROA 1ZGIA 1A3EH 2F9OA 4OS4A 1YPGH 2ANKH 1DS2E 1GJ5H 1TALA 1DXWA 1O34A 3RMNH 1C1WH 1LHDH 3PMHB 1OP0A 2CF8H 1L0ZA 1WBGB 1ID5H 5DP7A 1W3CA 1FN6A 1A7SA 4AFZA 2BLQA 4NGAH 2XC5A 1HIAA 4JZDH 4BTUB 1KTTB 1GJDB 3M7QA 1LHGH 4Q80A 1NFWA 2ZFPH 1LKAA 4X2VA 1WAYB 2EI8A 2AGIX 1W11U 5K7RA 3LGIA 1TX8A 4BTTB 1OP8A 1PFXC 2BM2A 4CREA 2O8MA 1VITG 1JMOH 1NROH 3UIRA 4LOYH 2A45B 1KDQB 2P94A 2HOBA 1IQMA 1FIWA 4UFDH 3O8DA 2TBSA 1P11E 3MYWA 3VPKA 3SUEA 3BG4C 3TJVA 2H9TH 2FX6A 2VIDA 1C1NA 1QB9A 2HNTC 1SQOA 1GMDF 2A4OA 4X8TH 3ZZ5A 2QXIA 3UWJH 1NRQH 1AUJA 1GPZA 1XUFA 4JCNA 4UFFH 1ZRKA 1BRUP 1QJ1B 2BDIA 4K60A 1HAPH 4KTSA 3ZV8A 6ESTA 1P05A 2UUJB 1NC6A 1WU1A 1MMJN 4Y0YE 2I6QA 4JK6A 1BRBE 1QFKH 3VFEA 5A8ZA 1D3QB 1D6WA 1HJ8A 1Z8RA 3NKKA 2O8UA 5C1XA 4HFPB 3DT0H 3M5LA 2G8TA 1SGDE 1OOKB 4BTIB 3C27B 5C1UA 2FM2A 2Z9IA 3A7TA 1GHXH 2BX3A 3WY8A 2VINA 5JBAS 3SHAH 3TK6A 1FY8E 1P9SA 3AAVA 1FMGA 4LZ4B 3HGNA 4D7GA 2BYAX 1L2EA 1ZJDA 4Y8ZA 1GJ8B 3MI4A 1EB1H 1K1JA 1NESE 2BB4A 5CHAB 1C2FA 1DWCH 1F2SE 1QRWA 2ZDLA 1ORFA 4AB9A 2F83A 1K1NA 3TH2H 4AFQA 1GBAA 1OWKA 2RCEA 1MD7A 2ULLA 1QA7A 3SU2A 4GSOA 1WUNH 1NZQH 2O9QA 4E05H 3BTWE 2XW9A 2Y5FA 3BEIB 7GCHG 3S9CA 1BBRK 2AGGX 1JIMA 4X1QU 4I32A 2P8OB 3LDXH 2PFEA 1GBLA 2H2ZA 2HWLB 4O9VA 2BY6X 1YP9A 4DVAU 3KF2A 4ZHAA 1EXFA 2Z3CA 2TRMA 1AQ7A 3LU9B 3A88A 1T8LA 2XBWA 2BOHB 3GDVA 1NM6A 4INKA 3ZZ6A 1P01A 5LGOA 1ELBA 1HAIH 1C5VA 3ZZ7A 1JIRA 1C2DA 4ZXXH 4SGBE 5A0AE 3PO1B 1C2MA 4X2YA 3PTNA 1P03A 1UCYH 1E0FD 1ZZZA 2GV6A 5I25A 2ZU4A 3TGKE 2QC2A 4DCDA 1BTZA 4D7FA 4GHQA 1J8AA 1BIOA 1Z8JB 1O3OA 3M37A 3S7HB 1F5LA 2VGCC 1OPHB 3KEEA 4CHAC 1UVUH 2A7CA 2TGAA 1L1NA 2FLBH 1F0TA 1TWXB 2GZ7A 1GBJA 3EDXB 1LKBA 2VB0A 1HLTH 1C2IA 2TGPZ 1CHGA 4FUGA 1ANEA 5C1YA 4CRGA 1CHOF 2FPZA 1YGCH 1ABIH 2ZHDA 2PW8H 3E3TA 1C1PA 4ISHH 5DP5A 1UVPA 2OUAA 1EX3A 1Z71A 1ZHPA 4KELA 4I8LA 1CO7E 5EGMA 5GIBA 2JETB 1CA0C 2QXHA 3ZVAA 1NS3A 2PUQH 4UD9H 4YOJA 2VWLA 8GCHF