2ESTE

Crystallographic study of the binding of a trifluoroacetyl dipeptide anilide inhibitor with elastase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Crystallographic study of the binding of a trifluoroacetyl dipeptide anilide inhibitor with elastase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase/hydrolase inhibitor
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1986-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2estE01
3QGNB 2QCYA 3D49H 1O30A 1Z71A 2SFAA 3G01A 3RU4E 3ZZAA 1NFYA 1W11U 1MMJN 2BLWA 4BAKB 3BTEE 5DP6A 1G3CA 4GVUA 1NFUA 5E0JA 4Y8XA 1E35B 1Z8IB 1D6RA 5T6FA 4JZ1A 2WPMS 2UUYA 1ZPCA 2IN2A 2IOTA 1OWKA 3PWBA 2AMQA 3V0XA 2C3SA 1BMMH 1FN6A 1G3EA 2FS8A 1EJNA 1VCWA 1C4V2 1RS0A 2SGAA 3GDSA 1EATA 1KDQA 4INKA 4ASHA 3S69A 2FOEA 1DLKB 3AW0A 4K8YA 3RDZA 3T29A 1HIAA 1UO6A 1VITH 3P17H 2TPIZ 4DJZB 1SFQB 1MKXH 1IQEA 2Z9IA 5FX6A 3B8JA 2SNVA 3MNCA 3VPKA 1GBTA 3A7TA 4IC6A 1Z1IA 1A7SA 2FEQH 1UJ1A 1V2WT 2QN5T 3SNAA 4CRFA 5T3HA 3CP7A 1RGQA 4U32A 2BDHA 2PW8H 4DCDA 1C2HA 1DM4B 1TRMA 2TBSA 1GBBA 3CENA 3LGUA 1OKXA 3RXMA 1MCVA 3VFEA 1TRYA 2HNTE 3RXOA 3PMAB 1A0HB 4ZUHA 4O3UA 5C5OA 1LVOA 4AN7A 1Y5UT 2FESH 4UFEH 2BQWB 2R0LA 3O8RA 1AWHB 2A5KA 1TQ0B 1QL8A 1K22H 1TGCA 1V3XA 2UWPA 8GCHF 1ELDE 3BF6H 3GY5A 5HXFA 1BMAA 1KXDA 4AFQA 1CT2E 2OD3B 1ZGVA 3V3MA 1O3IA 1DWDH 3F9GA 2SGDE 2OC1A 4CRCA 3MH4A 5FHTA 4DIHH 3SU1A 1AIXH 1DLEA 1KIGH 1S0QA 4OS1A 4ABFA 3PTBA 1N6YA 2Z9JA 1B0EA 3ENSB 4MNVA 1W10U 1NRPH 3MU5A 2YOLA 5JBAS 4XFQA 4X1SU 1D6WA 1KLIH 2OP9A 1N8OB 3S9AA 1SGCA 1T8OA 2BLQA 1FPCH 4IBLH 5C67A 1UTQA 1MAXA 2A4GA 5GCHG 1YPLH 1EZQA 3ELAH 3E6PH 1C1MA 1JWTA 3UUZA 1SGRE 1GI8B 3A88A 1BZXE 3VGCC 2QV1A 1SR5C 3GCTF 2AERH 4Y6DA 1O2UA 1G37A 1TNJA 2JETC 1AVGH 3RM2H 1AMHA 3PYHA 3UOPA 2JH5D 3ATIA 3GYLB 2ANYA 1PPFE 3PM3A 1QIXB 3RXGA 1BUIA 1P06A 2A7HA 3V7TA 2GCHG 2RA3A 2VVVA 1GJ8B 3V13A 1K1PA 1LO6A 2IPHA 3I78A 1O2NA 5TJXA 1W2KH 2PKAA 2WINI 2AIQA 1PPHE 2F9UA 3VB3A 1CHOG 5EPYA 2ZU2A 3BSQA 3IWMA 3A89A 4K69A 4HI3A 5FAHA 4I33A 4TYDA 1C2GA 2XC0A 3D62A 4ZKOU 1MU6B 1C5OH 1ELVA 3RXQA 2O8WA 1CT4E 4U30A 5B6OA 2K1QA 1YPMH 1HV7A 2W3IA 4Z6AH 4I32A 4J2YB 8ESTE 1IOEA 2Z94A 4WVPE 1O39A 4KGAA 1C1TA 2ZI2H 1N6XA 3MWIU 3UFAA 4ABDA 2G4UA 1ESBA 5GCHF 1O2SA 3GY2A 4ABGA 3A83A 1UVSH 1WQSA 1ZMJA 2TRMA 3ATKA 3UOUA 3RC4A 4TY7A 1MTUA 4GCHG 1C9TA 2GT8A 3PLPA 5LPEA 1LDTT 3A7WA 4X8UH 2GGVB 2Y5HA 2FX4A 1C5LH 2ZFFH 2XBYA 4CH8B 1WYKA 5LPRA 1EASA 4X1NU 4CR5A 3TNTA 1ETRH 1HBTH 1SGPE 3K6ZA 3MNSA 2W7SA 4X8TH 1GJAB 1P03A 1SGIB 4F49A 2BD4A 1DICA 2DUCA 3UNRA 4FUJA 5GWZA 2THFB 4CRGA 1IQGA 1W12U 3QZRA 3FANA 1C5UA 1TGSZ 1OYTH 2G8TA 2Y82A 2ZHQH 2Y6TA 2Y81A 1TFXA 2CJIA 4WF8A 2BY7X 4X8SH 5FBIA 1XUIA 1GBEA 3C1KA 4MQAA 3BG4B 4MVNA 2BX4A 2HVXA 1J9CH 1G3BA 1SQOA 2ZCKP 5EGMA 1DANH 4AYVB 3SU3A 3B23B 3BEFB 3F9EA 3E0PB 2J94A 3ZYDA 1J16A 2F9PA 2ZTYA 4WMEA 1S84A 4GCHF 1GBKA 3M5LA 2R3UA 4ISLA 1PPCE 1O38A 4O97A 1QCPA 4K1TA 1PQ8A 1YPGH 2GV7A 2Z3EA 1W0YH 4UD9H 1O2KA 1ZMNA 1V2OT 4CRAA 1XUJA 1GHVH 1ANEA 2O9QA 3LU9B 1SPJA 2BLOA 1ZYOA 1HAXB 5C2ZA 5I46H 1ZLRA 2ALPA 1KY9A 3ZYEA 1QY6A 2ZU5A 4XDEA 3ZV9A 2AYWA 5A0BA 7GCHG 1V2RT 1BT7A 1WAYB 1O35A 1T8MA 1UTMA 1V2UT 2BD5A 3M7TA 1A0JA 1H8IH 1C5NH 1A1RA 4K8BA 4ABJA 2C8XB 1D3PB 1MD7A 1QL7A 1WTGH 2F9NA 2HGTH 1TOCB 4WMDA 1EZXC 2FXRA 1G30B 1P2OA 5HGGA 1TONA 1C2DA 1QURH 3SHCH 1GHAF 1ZOMA 1A3BH 2C90B 5A0AE 1BTZA 4IW4E 2A2QH 1JBUH 4TY6A 1LVMA 3FAOA 2OQ5A 1GCDA 4A1TA 5CHAB 5SGAE 1E34B 4XOJA 1TAWA 1LHCH 1GBIA 1Z1JA 1LTOA 1O37A 1DWBH 1YPHC 3KEEA 2WPKS 3QDZB 1B5GH 1EOJA 1SSXA 2D1JA 3S0NA 1O5DH 2BD2A 2BZAA 3RXUA 3BTDE 1GVZA 3H7OA 1ZRKA 1C5VA 1C1OA 1OS8A 4Q7ZA 4NCYA 2DE9A 4U2WA 2GP9B 3QGJA 2G52A 1QB1A 4D8NA 4GLYA 5ESTE 1K2I1 1CGIE 1Z8GA 1UK3A 3RLYH 2ZGJA 4JZIA 3UWJH 1ORFA 4X2XA 1MAYA 2QA9E 2IJOB 1EZUC 1HAGE 1P01A 5EPNA 1NN6A 1N8OC 3NXPA 1H1BA 1P11E 3BIUH 1DE7H 1S6HA 2EI6A 8LPRA 4DY7B 4DW2U 1GMDG 3VB7A 2EI7A 1LQEA 4UDWH 2VWOA 4ISNA 2QXHA 5DGJA 1ABJH 1S83A 1O3OA 5T6DA 1RTKA 1P12E 2Z3CA 2FLRH 3M5OA 4NG9H 3WY8A 4ZHLU 8KME2 1P3EA 4GSOA 1H8DH 1OWHA 3N7OA 4Y0YE 3RC5A 1AD8H 3SV8A 2NU0E 4NIVA 2A5IA 1H9HE 3URCA 1FAKH 4H6TA 4KP0A 2G81E 3DT0H 3SU5A 1EB2A 3RXVA 2FDAA 3KF2A 1O5BB 3QTVH 1CBWB 4K1SA 2XRCA 5AF9H 2A31A 1P2IA 3SBKA 1GI9B 1ZSJA 4INHA 3RMMH 3AW1A 4JYVH 2ZDKA 2ILNA 1ELGA 3K65B 4Z0KA 1E38B 1ZMLA 3P8GA 1AKSB 2ZCHP 1O3CA 2ZHWH 1NT1A 1HIAB 1P57B 1G9IE 1Y59T 4ZXYH 1QHRB 2EEKA 1GMDF 2PTCE 3DUXH 1AVXA 5G4BA 3M3SA 3RXSA 3RXRA 1K1LA 3SGQE 1MTNB 1G36A 1ZJKA 3GY7A 5DK1A 3SU0A 3EA9A 1PPZA 1LQDB 4ABIA 2FYRA 2VGCC 1SFIA 1ZHMA 1K1NA 2UUKB 1Y8TA 2OCVB 1BJVA 1OSSA 1TMBH 3VGCB 2VIWA 1SQAA 5L2ZH 2JETB 1GI7B 2WYGA 1K1JA 3GDUA 4CRDA 1GBCA 2BY6X 2PV9B 1V2QT 3ZZ9A 4Y0ZE 3C27B 2ZFTA 3SQHE 2PHBA 3EDXB 2HNTF 3TGJE 2P3UB 2ZNKH 3SJOA 3M3TA 1TQ7B 3BTWE 3LT3A 4NFEA 1O0DH 4INLA 2FIRH 2FPZA 1SLXB 4BXSA 2B7DH 4AFZA 1Z6JH 2WPHS 1YPHE 3P8OA 2FOBA 1KTSB 2HNTC 1MKWK 3CS7A 4NA8A 2PGQB 1UTJA 1F0RA 5A09A 4UE7H 1ZTKA 2H6MA 1VITG 1O2ZA 4R8TB 1ELAA 1FY4A 3EAJA 4B74A 1O2YA 2G5VA 1YYY1 1DY9A 1VJ9U 1V2LT 4ZROA 4CHAC 3TLOA 1O2IA 2ZFPH 2ZDVH 2FO9A 3MO9A 3O8BA 1VZQH 5A2MH 2RA0A 1AQ7A 2VNTA 3P8FA 2VVCA 2UUJB 1O5CB 4PROA 2OBQA 1TNIA 3RXCA 1HYLA 1Y3XA 1YC0A 3HATH 2BDAA 2H9TH 1QTFA 1QRWA 1EP5A 4YTAA 2PSXA 3E16B 5DP3A 1S5SA 1L1JA 1YF4A 2FI5E 3MI4A 3MH6A 4K1EA 4AZ2B 4AG1A 4X6OA 4YT6H 2ZDNA 1K1IA 1SI5H 2FYQA 2FS9A 2D2DA 2BXUH 3QX5H 4Y7AA 3E3TA 3GY6A 1P2QA 4R0IA 4ZAEA 5EW1H 2C8WB 2FOHA 1KXBA 4D9RA 4AORA 3HK3B 1D3QB 1FN8A 1GVKB 1CQQA 3BTTE 3NPSA 4J1YA 4U01A 4YOJA 1GHBF 3PLKA 1PQ7A 4ISIH 3L33A 2GZ9A 5AFZH 2ZU1A 3Q3KA 5F6MA 3U9AH 1C4Y2 1NRNH 1BDAA 1BTWA 3E0NB 1C4U2 4DG4A 4F4OC 1K9OE 6GCHF 1HJ9A 1O2JA 2BQ6B 2XTTB 3K6YA 2GCTC 2BYAX 4RKOB 1VCQA 1V2JT 1KXAA 1AN1E 1VJAU 1E37B 1JOUB 2FWWA 1C5SA 3SJIA 2Z9GA 3TK9A 2QY0B 1TGBA 3KHVA 4K3JA 3MU0A 2GD4B 2F9VA 1DWEH 3T25A 1CO7E 1O3NA 1SHYA 1TBRH 5ETXA 3ZVCA 1FI8A 4KELA 4E7NA 2ZDAH 4NSVA 1P2KA 1LPKB 2HRVA 2P3FH 3A81A 3UY9A 1MZAA 4AYYB 4RSPA 1O5AB 2R2MB 2J92A 2BX3A 1GL1A 1O2WA 1FONA 1Q2WA 2HOBA 1LVBA 1O3AA 1V2KT 3A85A 4OS6A 3SUGA 4A92A 1CA0B 2ZU4A 1MU8B 1YLDA 2HPPH 1GCTB 1AUJA 4KKDA 4B1TA 2A1DB 2P94A 4FVDA 1HAOH 5TCAA 3FVFB 1THRH 3TIUA 4B2BA 2P8OB 2A5AA 2V35A 3PMJA 3CS0A 4NFFA 3PWCA 4HZHA 2QC2A 4YO9A 1TA6A 3LOXA 2AS9A 1WCZA 3UTUH 1OYQA 3ZZ6A 2NU2E 2Z7FE 4MPWA 1UK4A 1C2EA 2ZQ1A 1CBWC 3V12A 2CN0H 1IQJA 5EXMA 3VB4A 4ABAA 2GZ7A 1V2NT 2TGDA 4Y10E 1K28D 2A32A 5E2PA 1DITH 2FLBH 3OSYA 5HM9A 3U8TH 4XBCA 4X1PU 2P95A 1XXDA 3TPIZ 4Y11E 1IQFA 3PMBB 1NU7B 5E0HA 1Q3XA 3SNCA 2QIQA 1HAPH 1SMFE 1WU1A 1WSSH 3SI3H 5EQRA 1BRUP 2ANMH 1IHSH 1MTNC 2GX4A 1OP0A 1TNGA 1C1SA 4HFPB 2QXGA 1TBQH 1LPGB 2Y7XA 3RXDA 3LGVA 3UPEA 4AFSA 3ATLA 3PROA 3HGNA 3IG6B 1C1WH 1AUTC 2PSYA 3M35A 4IMQA 1FY3A 3M5MA 1L4ZA 4H42U 5FCRA 2UWLA 1TNLA 2M5TA 2YNAA 3SGBE 1O2HA 1P02A 1A61H 1P3CA 1SGEE 2SGFE 3DHKH 3ESTA 1O2MA 1ZPZA 1YCPK 3GY3A 3SUEA 2XNIA 1AFEH 2PUQH 2JKHA 1GBHA 2P3TB 1Y5AT 1FPHH 1T8LA 3AAVA 5EOKA 3T26A 3ZZ4A 4A6LA 3HPTB 1ZSLA 1C1UH 3M61U 2PFEA 2J2UA 1MQ5A 3U1IB 1UTKA 4K5ZA 2H9HA 4MDSA 1WBGB 4IN1A 1UMAH 4JZEH 4X2YA 1UCYK 1XUFA 3T28A 2BY8X 5JDUB 4FUCA 4Q7YA 1RFNA 3RXJA 2F91A 1VGCC 1GWAA 1S81A 3F68H 1LHFH 2ODPA 1C9PA 1LPZB 4CREA 1KYNA 1P2JA 1SLWB 2BDYA 1QJ1B 3S9BA 1G2MA 1W0ZU 1ZPBA 3M7QA 1A5HA 2OLGA 4AFUA 1IQKA 2CMYA 1SGFG 3Q77A 4AGKA 1SGFA 2FOGA 2VGCB 1A2CH 4X6NA 2FTMA 1O3MA 1OP8A 1BOQA 2ANWA 1EJMA 3RXFA 3BTQE 3HK6B 2PUXB 1TYNA 4I31A 1FXYA 2GCHF 4I8LA 3SNBA 2ZU3A 2FP7B 1L2EA 4MLFB 1WUNH 3HKJB 1EB1H 5AVDA 1O31A 1G2LA 1SB1H 1CHOF 1CVWH 1SGYE 1AVWA 3K2UA 4QT8C 3TGIE 6ESTA 1ETSH 1J17T 1EAUA 4B71A 2QAAA 1EQ9A 2FOAA 4SGAE 3EA8A 1O2GH 2Z9KA 3PLBA 2PLXA 1LVYA 1LHGH 1OP2A 1UTPA 5FXLA 1LHEH 2ZIQH 1QBOA 1E36B 3UQVA 3SJ9A 1JIMA 1TPSA 4D9QA 3LPRA 5BRRE 2W7UA 4O03A 4Y71A 2W5EA 2ZECA 5F03A 4JYUH 1O3KA 1A0LA 2XCFA 2GZ8A 1HCGA 1QA0A 2ZCLP 2G4TA 1BTPA 1ID5H 2W3KA 4Q80A 2AMPA 1SG8B 1DPOA 1IAUA 4BAMB 2BVXH 1GI0A 4CHAB 5IYTA 1GJ5H 3D23A 1TPAE 3SI4H 1SLVB 1NTPA 1QJ7B 3L6PA 4JMYA 1TOMH 2AH4X 2VH0A 5EODA 1TIOA 1GDUA 3BG8A 1W13U 1ANDA 4IS5A 5GJ4B 1PFXC 1AHTH 1S82A 3MO3A 4A1XA 1SC8U 3QK1A 3A84A 1T8NA 2I6SA 1HRTH 2FODA 2GDDA 3B9FH 3SU2A 1TE0A 3RC6A 2AGIX 5A8XA 4Q7XA 5LGOA 3A82A 4OS2A 4YLQH 5ESBA 2A2XH 1NFWA 1YP9A 2BDBA 3T5FH 3I29A 3MTYA 6CHAC 1XM1A 1CA0C 1W7XH 4Y79A 4ZHAA 4DIIH 2BDGA 1HFDA 4IGDA 3SV7A 1GCTC 1OWEA 4FUHA 3RMNH 1XUGA 4YESB 4I8GA 3BTFE 1MD8A 1TB6H 1ZTJA 5DO4H 2FTLE 1QB9A 1ZHPA 1MH0A 1IQLA 5C1YA 3SJKA 2P8OC 4LXBH 3KGPA 1MKXK 1C2IA 3S7KB 1FY5A 1HB0B 3TJNA 2EC9H 3Q3YA 5ABWA 1UVOA 1IQHA 1O33A 2PR3A 3FP7E 2GCTB 2Y7ZA 5EW2H 1P09A 1CU1A 2WYJA 1IQMA 1RIWB 5EQQA 1OWJA 5AFYH 3F6UH 1A3EH 1A5GH 3P6ZB 1O34A 1YPEH 1SLUB 7GCHF 3TJVA 2WPLS 2ZHEH 3KIDU 4BNRA 3ZVFA 3F9FA 1K1MA 2CXVA 2ODYB 3UNQA 3SUDA 3AAUA 2QF0A 5DJ7A 1HAYB 4ISHH 3MU8A 3BEUA 3MYWA 2ZFQH 5J4SA 1ANBA 4LZ4B 2Q6DA 2J95A 3BTME 2BM2A 3FP6E 4DVAU 2H2ZA 3M5NA 1TLDA 1DUEA 1TBZH 2Y5FA 1HNEE 1E0FD 2HLCA 1O3JA 2TGPZ 3MFJA 1GDQA 1Z8JB 3SV9A 1OOKB 2BOKA 5JYIA 1XVOA 1BB0B 1QRZA 3ZZ7A 1AE8H 1HJ8A 1HAVA 4LK4A 1F7ZA 4Q2KA 2F9OA 2FOFA 3I77A 4XE4A 1TPOA 3A8AA 2ZPRA 1LMWB 1BMLA 1F0UA 1O5EH 1RTLA 4JK5A 1DUAA 2OC7A 1DVAH 1BBRE 4YLUA 3Q3XA 1ZJDA 5AHGH 4AG2A 2BTCE 5DG6A 1C5YB 1BCUH 1AY6H 2VWMA 3KQEA 3SW2B 2ULLA 3RXEA 1TPPA 2BLVA 5DP9A 4FUBA 3LKWA 2H9EH 3ZZDA 1HAIH 1MTSA 3SV6A 1EAXA 3VB6A 4BTTB 1KDQB 1D9IA 1YM0A 2Y5GA 2BD3A 1XKAC 4NIWA 3M7UA 2D26C 1INCA 5GPIB 4YZUA 4D7GA 3EGKH 3A8BA 5HMAA 1OXGA 4IMZA 5JBTA 1LKAA 1WQVH 1H4WA 1QA7A 4WJG2 2SGQE 4NZQA 3KL6A 1BJUA 3O8DA 1VCPA 1C1RA 1S85A 2BDIA 1FY1A 1F5RA 1H9IE 1J8AA 2JH0D 4FVBA 1GJ7B 1QQUA 3PMHB 1BRAA 1ELEE 1T32A 2OC0A 7KMEH 5I25A 3TK6A 1V2MT 1W14U 3OU0A 1BTXA 1C2KA 5EXNA 2SNWA 2AGEX 4JZFH 2ZA5A 3R0FA 1L0ZA 1G32B 1ESTA 1P0SH 3AVZA 2C8ZB 1ETTH 3TH4H 2OUAA 4MTBA 5C1UA 5J4QA 1GJDB 1SL3A 3MH7A 1NM6A 1BMNH 1SGDE 3KQBA 5CE1A 3SUFA 3ZZCA 4IN2A 4FU7A 4TWWA 1FQ3A 2PTNA 3PO1B 3GYMA 1MUEB 3SGAE 1ZRBA 5FPYA 2ODQA 3RXHA 2XWAA 1F2SE 1Y3WA 2A7JA 1LCYA 4AB9A 1VGCB 3KN2A 1AZ8A 1O3LA 1JXPA 3RXLA 1GI6A 1QNJA 1TWXB 4X2WA 1UTOA 1MTVA 5JBCS 2BDCA 4UFFH 1DSTA 1IQNA 3GDVA 5JPMH 4ZKRU 4OS5A 1FMGA 3D65E 1MBMA 2LPRA 2P16A 3PV4A 3M37A 1CGJE 1NRSH 3NUMA 3KNXA 4H6SB 2ZWLH 3A87A 1O36A 2ZDLA 4FU8A 4ISOA 3RXPA 5C20A 2Y80A 1P10A 3U98H 2WUBA 2FX6A 2VU8E 3P92A 2VWNA 2XBXA 4OS4A 1NS3A 5F8XA 2AMDA 1ARBA 3GY4A 3JZ2B 1U6QA 1O3HA 1B7XB 3EE0B 2J4IA 4AGJA 1UTLM 3M36A 2AIPA 3GCOA 3OY5U 2PKAB 5BPEA 5DP7A 1F92A 2ZGCA 5HM2A 1THSH 1JRSA 1O2TA 1VITF 1EAWA 2FMJA 4DOQA 4BTUB 4ABEA 3MNBA 1KXCA 4TPIZ 4LZ1H 2QXJA 2GDEH 2R2WU 3SO3A 2ZQ2A 1ZGIA 4ZHMU 1HUTH 1BBRK 1TABE 5FPTA 1L4DA 4XSKU 3ATMA 1UCYE 2BHGA 1Y3VA 5GIBA 3R3GB 1FUJA 3ITIA 1BITA 2J9NA 1TNHA 2A7CA 2WPIS 1CGHA 1DFPA 2STAE 1O3BA 3RXTA 2ZHFH 3AASA 3DA9B 2GMTB 4MNYA 4AX9H 3URDA 1RIWC 2R0KA 5K0HA 1K21H 4ZMAH 4TWYA 4RN6A 4E7RG 3P8NA 7ESTE 1AE5A 1XXFA 1KSNA 1V2ST 2RG3A 4NWLA 5E0GA 3ZZ5A 4FUDA 1MBQA 1KXEA 2VJ1A 1Y3YA 5DP4A 3EA7A 1OWDA 4UONA 1QFKH 2C93B 4UFGH 1F0TA 2F9BH 2F3CE 3SU6A 3RM0H 2BMGB 1EJAA 2B9LA 3DFJA 2TGTA 1H9LB 3LC5A 4BXWA 1O5GH 6CHAB 5GDSH 8GCHG 2ZG0H 1XUKA 3BTKE 1AKSA 3A86A 3TITA 2H1UA 1GI2A 1C5XB 2KAIA 4NA9H 1O3FA 1C5ZB 2HALA 4Y76A 1OWIA 2CV3A 1S0RA 1GGDB 4YM9A 1GI5A 3BTGE 1BTYA 1EPTA 1S6FA 1T4VH 4X6PA 1GBJA 1ELFA 1NC6A 1GHZA 1GHYH 1PYTC 1YCPM 3OY6U 1AI8H 2ZTXA 3E90B 2OC8A 1AGJA 3O8CA 4ZKSU 4B73A 2BY9X 1NPMA 2OQUA 4WY3A 3BV9B 3U1JB 2H5DA 3SOSA 5L30H 2FOMB 4VGCB 3MNXA 3SU4A 2FZZA 1GI4A 1SBWA 3GCTG 1K1OA 3OTJE 2EI8A 1DX5M 2VWLA 3KCGH 1RD3B 2ZZUH 3IITA 1PPGE 3MOCA 3QN7A 3GCHC 1DT2A 1P05A 4TPYA 4DT7B 2UUFB 2FM2A 2G5NA 1GG6B 1PPBH 1C5MD 3ZZ3A 2XCNA 1PJPA 2B0FA 1W3CA 3F9HA 1DSUA 1EP6A 3MH5A 3QUMP 1XX9A 1ZTLA 1NROH 1C1PA 1HXEH 2ZDMA 4B76A 1CT0E 2BQ7B 4MPVA 1O2VA 2NU3E 1P9SA 1GHWH 1N1LA 2D8WA 1C2MA 4FXGH 2C8YB 4HTCH 3SJ8A 1RXPA 1X7AC 1YGCH 2BY5X 4NA7A 4AB8A 7LPRA 3LGYA 1WTHD 3F1SB 3GCNA 4GAWA 4Y8YA 3S9CA 1EPTC 4YT7H 2XW9A 1P2NA 4ABHA 1D4PB 3HKIB 1GPZA 4ABBA 3U8OH 1O3DA 1UVTH 2O8MA 2UWOA 3W94A 3EQ0H 3RU4D 1HJAC 2ZGBH 3VB5A 1Y5BT 1GJ9B 4FU9A 1O2OA 1ZSKA 2CF8H 3PO1C 1ELBA 3VXFH 1BTUA 1FIWA 3QTOH 1A46H 4E05H 4A1VA 5FCKA 4XBDA 4WMFA 3TK5A 3E1XB 3BN9A 4MPUA 1C1NA 3OYPA 1HLTH 2ZTZA 3LH3A 4ZH8A 2VIQA 3T62A 4AOQA 3QLPH 1M9UA 4NIYA 1ZHRA 5A8ZA 1O2LA 2ZEBA 3TGKE 3STIA 4I8KA 5FBEA 1O2QA 3MU1A 1AU8A 1UHBA 4ZXXH 5LPFA 1MQ6A 1TA2A 4WXVA 1SGNE 1AFQB 1A4WH 1GDNA 2BZ6H 2Z3DA 2BXTH 3SN8A 4B2AA 1C5WB 2YNBA 1HAVB 1QJ6B 1HDTH 2A0QB 2J38A 3QO6A 1GMHG 4JCNA 1EX3A 4UFDH 1CE5A 4X2VA 1BIOA 1BRCE 1EAIA 2BVSH 1GI1A 2QGRA 3M3VA 2H5CA 2CF9H 4NZLA 2I6QA 2LNCA 4NWKA 5JB8S 2NU1E 1Z7KA 1VR1H 3FFGA 2BB4A 1NY22 2BD8A 1TGNA 1A5IA 1C1VH 9ESTA 1XUHA 3HGPA 1MKWH 5PTPA 2P59A 3BIVH 2VINA 1EXFA 1MTWA 1BHXF 3H5CB 4WWYA 2ZF0H 3UNSA 4CH2B 5C3NA 1NRRH 1TX6A 5EXLA 5CMXH 4X0WU 5F8TA 4M7GA 4XBBA 3NCLA 2A4RA 3ATWA 1MCTA 1NU9A 1UTNA 4WXIA 3P70B 2ZKSA 1FDPA 4E06H 2ZFSA 3LONA 4CBNA 2ZO3H 1IHTH 4Y7BA 1KLJH 4YOIA 1GMHF 1DS2E 2GMTC 4LOYH 2V3HH 1V2TT 2AEIH 3MO6A 1JMOH 5F8ZA 1TMTH 1ESAA 1QRXA 1L1GA 1YBWA 5GXPA 2VVUA 1AZZA 1C5TA 1YKTA 4CBOA 1GHAG 1SVPA 3BEIB 4OGXA 4SGBE 2ANKH 5A8YA 1RTFB 3RXIA 5JBBS 2XBWA 1PQ5A 3LDXH 1DY8A 2QF3A 1QBNA 4JZDH 4BAQB 2PKSB 5DP5A 2XBVA 2Q6FA 1KLTA 2WV5A 1J14A 4NGAH 2CHAB 1UK2A 1GJ6A 1HGTH 3ZV8A 2Z9LA 1WV7H 2AFQB 3OX7U 1YPKH 3L3TA 1O2XA 1ELCA 5L2YH 1NRQH 4MPXA 1V2VT 2NU4E 1G3DA 1NO9H 2WV4A 4MNWA 1ZR0A 2A45B 3SV2H 3UR6A 1BBRH 2XYAA 1C2LA 1V6DA 2ZPQA 3DD2H 1TX7A 3FZDA 2A4OA 5DPAA 1ELTA 3RU4T 4ESTE 1O2PA 2G51A 5FPSA 1QBVH 1GGDC 2Q1JA 3A8CA 1OPHB 3TH3H 3W95A 1GBLA 1LHDH 2W26A 1GJ4H 4UEHH 5K7RA 1XVMA 1ZZZA 1FAXA 2RCEA 3UWIA 1DXPA 2GKVE 1BTHH 2VIPA 3JZ1B 4H4FA 5LH8A 1AB9B 5DP8A 4IC5A 5EG4A 1C1QA 2OINA 4FUEA 1P9UA 1GI3A 3LJJA 4YOGA 2ZPSA 1TMUH 1QB6A 4GHTA 1T4UH 4JK6A 1W8BH 1P2MA 4K60A 1J15A 4FUGA 4VGCC 1GBMA 4O9VA 1GJBB 4NSYA 1PQAA 4A5TS 2RDLA 3SHAH 4D76A 1C5QA 5C1XA 3RMLH 1B0FA 4JYTA 3QZQA 3FP8E 3ZVEA 1UVUH 2TIOA 3MU4A 5E8EH 1HAZB 1GL0E 3NK8A 2F83A 2PGBB 2J34A 2QXIA 1GG6C 2SGEE 3LJOA 4X1RU 3SORA 1EKBB 1P8VC 1GBFA 3A7XA 2VIVA 9LPRA 1TALA 5T6GA 1D3TB 3BTHE 1QL9A 1QQ4A 2ZGHA 4I8HA 4X1QU 1D3DB 1C2JA 2XC4A 3GICB 1NZQH 3NWUA 2FI4E 1QR3E 1TX8A 1MZDA 1CSOE 1SOTA 3TVJB 1O2RA 1THPB 2DE8A 1P04A 1PYTD 1CA8B 3RMOH 1EOLA 1CHGA 4DURA 1FY8E 3T27A 1BRBE 2XC5A 2EA3A 2OBOA 1FIZA 1TNKA 2AGGX 1KXFA 3RP2A 1YPJH 1GMCG 1OX1A 2HWLB 1FV9A 1JRTA 4X6MA 3E8LA 2ZFRH 2ZGXH 3RXKA 3TH2H 3U69H 2V6NA 4FUIA 5H4IB 4B2CA 4K2YA 3Q76A 4RKJB 4FUFA 1C5RA 5C5NA 1Z8RA 1V2PT 1FZZA 1RRKA 4BTIB 5TCCA 5E2OA 1SGQE 2ESTE 3GCHB 3LGWA 1SGTA 2GTBA 2O8TA 3NZIA 3U8RH 3ZVBA 3T2NA 3H7TA 1ANCA 3RXBA 3DFLA 1W7GH 5DKMA 2V0BA 1SQTA 3GISB 2R9PA 1T7CA 1F5KU 5A0CA 4WH8A 1FJSA 3QWCH 2VIDA 1O5FH 3A7YA 3ODFA 1GVLA 1DOJA 1AFQC 4MNXA 2BOHB 3VXEH 3A8DA 2KAIB 6LPRA 3EYDA 3KQDA 1DWCH 1T31A 2P93A 2WPJS 1F0SA 1GBDA 4GHQA 2TGAA 1YCPH 4I8JA 3SNDA 1BA8B 1EPTB 1GMCF 3FZZA 1EZSC 2QYIA 3TJOA 1FLEE 5HYOA 2VB0A 2OTVA 2G00A 3ZVDA 4GPGA 1HAHH 1DXWA 1AO5A 1HJAB 4OS7A 3UR9A 1ARCA 3K9XB 3ODDA 1XKBC 2WUCA 1GBAA 2GT7A 2JH6D 4I7YH 1UCYH 2HPQH 3GY8A 1NESE 3STJA 2B5TB 4BOHA 3PTNA 2V3OH 1GHXH 1LKBA 2G55A 4HGCA 3RLWH 4B75A 2ASUB 3A80A 3P95A 4CRBA 1TGTA 3A7VA 1EUFA 2BVRH 4BANB 3UREA 1F5LA 4KTCA 1HPGA 4BAHB 5EQSA 1FNIA 3BG4C 1SHHB 3LC3A 3MMGA 3ZVGA 1WOFA 3ZZBA 4KTSA 1Q31A 1Y3UA 2BD7A 4O3TA 5L6NH 3LH1A 4WH6A 1DDJA 1YLCA 1RJXB 2PWXA 1O3EA 2ZP0H 3RXAA 2VIOA 3PB1E 2FOCA 1GHBG 3UQOA 2O8LA 4THNH 1L1NA 4KTUA 3LGTA 2ZHDA 3KQCA 3SQEE 3Q00A 3TJUA 1KTTB 3VEQB 2PKSC 3LGIA 2C4FH 3TU7H 6GCHG 3S7HB 1C2FA 2FI3E 4D7FA 2GV6A 1GJCB 3LIWA 2B8OH 4NIXA 2Z6BD 2CHAC 1QGFA 2XXLA 4BAOB 4DGJA 2VH6A 1C5PA 1UVPA 1NFXA 3E91A 5JB9S 1ACBE 1PPEE 2STBE 4CR9A 3SNEA 2CGAA 5IDKA 1BHXB 1XMNB 1O32A 1JIRA 1HXFH 3RUOA 1BQYA 2NWNA 1O3GA 2GVFA 2Q6GA 1IQIA 4MG3A 2ZC9H 2SGPE 1O3PB 3TNSA 2R3YA 2ALVA 1AWFH 4A7IB 1UHBB 2XWBI 4GUXA 1SOZA 1AB9C 4ZKNU 4Y8ZA 3ZZ8A 5FX5A 3GOVB 3MHWU 2OXSA 2A4QA 5CHAC 3ZVAA 4X8VH 1Z6EA 2BD9A 2O8UA 4OGYA 5EU8A 3NKKA 3UIRA 3SZNA 1ABIH 3A7ZA 1TRNA
chains in the Genus database with same CATH superfamily
3QGNB 2QCYA 3D49H 1O30A 1Z71A 2SFAA 3G01A 3RU4E 3ZZAA 2JDID 1NFYA 1W11U 1MMJN 2BLWA 4BAKB 3BTEE 5DP6A 1G3CA 3N99A 4GVUA 4ZCNA 1NFUA 5E0JA 4Y8XA 1E35B 1Z8IB 1D6RA 5T6FA 4JZ1A 2WPMS 2UUYA 1ZPCA 2IN2A 2IOTA 1OWKA 3PWBA 2AMQA 3V0XA 2C3SA 1BMMH 1FN6A 1G3EA 2FS8A 1EJNA 1VCWA 1C4V2 1RS0A 2SGAA 3GDSA 1EATA 1KDQA 4INKA 4ASHA 3S69A 2FOEA 1DLKB 2L74A 3AW0A 4K8YA 3RDZA 3T29A 1HIAA 1UO6A 1VITH 3P17H 2TPIZ 4DJZB 1SFQB 1MKXH 1IQEA 2Z9IA 5FX6A 3B8JA 2SNVA 3MNCA 3VPKA 1GBTA 3A7TA 4IC6A 1Z1IA 1A7SA 2FEQH 3F3BA 1UJ1A 1V2WT 2QN5T 3SNAA 5EJ1A 4CRFA 5T3HA 3CP7A 1RGQA 4U32A 2BDHA 2PW8H 4DCDA 1C2HA 1DM4B 1TRMA 2TBSA 1GBBA 3KQ5A 3CENA 3LGUA 1OKXA 3RXMA 1MCVA 3VFEA 1TRYA 2HNTE 3RXOA 3PMAB 1A0HB 4ZUHA 4O3UA 5C5OA 1LVOA 4AN7A 1Y5UT 2FESH 4UFEH 2BQWB 2R0LA 3O8RA 1AWHB 2A5KA 1TQ0B 1QL8A 1K22H 1TGCA 3F2FA 1V3XA 3DCLA 2UWPA 8GCHF 1ELDE 3BF6H 3GY5A 5HXFA 1BMAA 1KXDA 4AFQA 1CT2E 2OD3B 1ZGVA 3V3MA 1O3IA 1DWDH 3F9GA 2SGDE 2OC1A 4CRCA 3MH4A 5FHTA 4DIHH 3SU1A 1AIXH 1DLEA 1KIGH 1S0QA 4OS1A 4ABFA 3PTBA 1N6YA 2Z9JA 1B0EA 3ENSB 4MNVA 4Q4LA 2IJD1 1W10U 1NRPH 3MU5A 2YOLA 5JBAS 4XFQA 4X1SU 1D6WA 1KLIH 2OP9A 1N8OB 3S9AA 1SGCA 1T8OA 2BLQA 1FPCH 2GJGA 3DSPA 4IBLH 5C67A 1UTQA 1MAXA 4I86A 2A4GA 5GCHG 1YPLH 1EZQA 3ELAH 3E6PH 1C1MA 1JWTA 3UUZA 1SGRE 1GI8B 3A88A 1BZXE 3VGCC 2QV1A 1SR5C 3GCTF 2AERH 4Y6DA 1O2UA 1G37A 3NRLA 1TNJA 2JETC 1AVGH 3RM2H 1AMHA 3PYHA 3UOPA 2JH5D 3ATIA 3GYLB 2ANYA 1PPFE 3PM3A 1QIXB 3RXGA 1BUIA 1P06A 2A7HA 3V7TA 2GCHG 2RA3A 2VVVA 1GJ8B 3V13A 1K1PA 1LO6A 2IPHA 3I78A 1O2NA 5TJXA 1W2KH 2PKAA 2WINI 2AIQA 1PPHE 2F9UA 3VB3A 1CHOG 5EPYA 2ZU2A 3BSQA 3IWMA 3A89A 4K69A 4HI3A 5FAHA 4I33A 4TYDA 1C2GA 2XC0A 3D62A 4ZKOU 1MU6B 1C5OH 1ELVA 3RXQA 2O8WA 1CT4E 4U30A 5B6OA 2K1QA 1YPMH 1HV7A 1E1RD 2W3IA 3H09A 4Z6AH 4I32A 4J2YB 8ESTE 1IOEA 2Z94A 4WVPE 1O39A 4KGAA 1C1TA 2ZI2H 1N6XA 3MWIU 3UFAA 4ABDA 2G4UA 1ESBA 5GCHF 1O2SA 3GY2A 4ABGA 3A83A 1UVSH 1WQSA 1ZMJA 2TRMA 3ATKA 3UOUA 3RC4A 4TY7A 1MTUA 4GCHG 1C9TA 2GT8A 3PLPA 5LPEA 1LDTT 3A7WA 4X8UH 2GGVB 2Y5HA 2FX4A 1C5LH 2ZFFH 2XBYA 4CH8B 1WYKA 5LPRA 1EASA 4X1NU 4CR5A 3TNTA 1ETRH 1HBTH 1SGPE 3K6ZA 3MNSA 2W7SA 4X8TH 1GJAB 1P03A 1SGIB 4F49A 2BD4A 1DICA 2DUCA 3UNRA 4FUJA 5GWZA 2THFB 4CRGA 1IQGA 1W12U 3QZRA 3FANA 1C5UA 1TGSZ 1OYTH 2G8TA 2Y82A 2ZHQH 2Y6TA 2Y81A 1TFXA 2CJIA 4WF8A 2BY7X 4X8SH 5FBIA 1XUIA 1GBEA 3C1KA 4MQAA 3BG4B 4MVNA 2BX4A 2HVXA 1J9CH 1G3BA 1SQOA 2ZCKP 5EGMA 1DANH 4AYVB 3SU3A 3B23B 3BEFB 3F9EA 3E0PB 2J94A 3ZYDA 1J16A 2F9PA 2ZTYA 4WMEA 1S84A 4GCHF 1GBKA 3M5LA 2R3UA 4ISLA 1PPCE 1O38A 4O97A 1QCPA 2EQNA 4K1TA 1PQ8A 1YPGH 2GV7A 2Z3EA 1W0YH 4UD9H 1O2KA 1ZMNA 1V2OT 4CRAA 1XUJA 1GHVH 1ANEA 2O9QA 3LU9B 2QE7D 1SPJA 2BLOA 1ZYOA 1HAXB 5C2ZA 5I46H 1ZLRA 2ALPA 1KY9A 3ZYEA 1QY6A 2ZU5A 4XDEA 3ZV9A 2AYWA 5A0BA 7GCHG 1V2RT 1BT7A 1WAYB 3KYFA 1O35A 4RT0A 1T8MA 1UTMA 1V2UT 2BD5A 3M7TA 1A0JA 1H8IH 1C5NH 1A1RA 4B6FA 4K8BA 4ABJA 2C8XB 1D3PB 1MD7A 1QL7A 1WTGH 2F9NA 2HGTH 1TOCB 4WMDA 1EZXC 2FXRA 1G30B 1P2OA 5HGGA 1TONA 1C2DA 1QURH 3SHCH 1GHAF 1ZOMA 1A3BH 2C90B 5A0AE 1BTZA 4IW4E 2A2QH 1JBUH 4TY6A 1LVMA 3FAOA 2OQ5A 1GCDA 4A1TA 5CHAB 5SGAE 1E34B 1H8ED 4XOJA 1TAWA 1FX0B 1LHCH 1GBIA 1Z1JA 1LTOA 1O37A 1DWBH 1YPHC 3KEEA 2WPKS 3QDZB 1B5GH 1EOJA 1SSXA 2D1JA 3S0NA 1O5DH 2BD2A 1KMHB 2BZAA 3RXUA 3BTDE 1GVZA 3H7OA 1ZRKA 1C5VA 1C1OA 1OS8A 4Q7ZA 4NCYA 4P00A 2DE9A 4U2WA 2GP9B 3QGJA 2G52A 1QB1A 4D8NA 4GLYA 5ESTE 5DN6D 1K2I1 1CGIE 1Z8GA 1UK3A 3RLYH 2ZGJA 4OM9A 4JZIA 3UWJH 1ORFA 4X2XA 1MAYA 4ACBA 2QA9E 1SQRA 2IJOB 1EZUC 1HAGE 1P01A 5EPNA 1NN6A 1N8OC 3NXPA 1H1BA 1P11E 3BIUH 3OFND 1DE7H 1E79D 1S6HA 2EI6A 4DY7B 8LPRA 4DW2U 1GMDG 3VB7A 2EI7A 1LQEA 4UDWH 2VWOA 4ISNA 2QXHA 3F2GA 5DGJA 1ABJH 1S83A 1O3OA 5T6DA 1RTKA 1P12E 2Z3CA 2FLRH 3M5OA 4NG9H 3WY8A 4ZHLU 8KME2 1P3EA 4GSOA 1H8DH 1OWHA 3N7OA 4Y0YE 3RC5A 1AD8H 3SV8A 2NU0E 4NIVA 2A5IA 1H9HE 3N7EA 3URCA 1FAKH 4H6TA 4KP0A 2G81E 3DT0H 3SU5A 1EB2A 3RXVA 2FDAA 3KF2A 1O5BB 3QTVH 1CBWB 4K1SA 2XRCA 5AF9H 2A31A 1P2IA 3SBKA 1GI9B 1ZSJA 4INHA 3MQKC 3RMMH 3AW1A 5HIZA 4JYVH 2ZDKA 2ILNA 1ELGA 3K65B 4Z0KA 1E38B 1ZMLA 3P8GA 1AKSB 2ZCHP 1O3CA 2ZHWH 1NT1A 1HIAB 1P57B 1G9IE 1Y59T 4ZXYH 1QHRB 2EEKA 1GMDF 2PTCE 2V3MA 3DUXH 1AVXA 5G4BA 3M3SA 3RXSA 3RXRA 1K1LA 3SGQE 1MTNB 5EJLA 1G36A 1BMFD 1ZJKA 3GY7A 5DK1A 3SU0A 3EA9A 1PPZA 2KCOA 1LQDB 4ABIA 2FYRA 2VGCC 1SFIA 1ZHMA 1K1NA 2UUKB 1Y8TA 2OCVB 1BJVA 1OSSA 1TMBH 3VGCB 2VIWA 1SQAA 5L2ZH 2LELA 2JETB 1GI7B 2WYGA 1K1JA 3GDUA 4CRDA 1GBCA 2BY6X 2PV9B 1V2QT 3ZZ9A 3FN8A 4Y0ZE 3C27B 2ZFTA 3SQHE 2PHBA 3EDXB 2HNTF 3TGJE 2P3UB 2ZNKH 3SJOA 3M3TA 1TQ7B 3BTWE 3LT3A 4NFEA 1O0DH 4INLA 2FIRH 2FPZA 1SLXB 4BXSA 2B7DH 5KECA 4AFZA 1Z6JH 2WPHS 1YPHE 3P8OA 2FOBA 1KTSB 2HNTC 5EIYA 1MKWK 3CS7A 4NA8A 2PGQB 1UTJA 1F0RA 5A09A 4UE7H 3U28C 1ZTKA 2H6MA 1VITG 1O2ZA 4R8TB 1ELAA 1FY4A 3EAJA 4B74A 1O2YA 2KCYA 2G5VA 1YYY1 1DY9A 1VJ9U 1V2LT 4ZROA 4CHAC 3TLOA 1O2IA 2ZFPH 2ZDVH 2FO9A 3MO9A 3O8BA 1VZQH 5A2MH 2RA0A 1AQ7A 2VNTA 3P8FA 2VVCA 2UUJB 1O5CB 4PROA 2OBQA 1TNIA 3RXCA 1HYLA 4FETA 1Y3XA 1YC0A 3HATH 2BDAA 2H9TH 1QTFA 1QRWA 1EP5A 4YTAA 2PSXA 3E16B 5DP3A 1S5SA 1L1JA 1YF4A 2FI5E 3MI4A 3MH6A 4K1EA 4AZ2B 4AG1A 4X6OA 4YT6H 2ZDNA 1K1IA 1SI5H 2FYQA 5DSFA 2FS9A 2D2DA 2BXUH 3QX5H 4Y7AA 3E3TA 3GY6A 1P2QA 4R0IA 4ZAEA 5EW1H 2C8WB 2FOHA 2K8IA 1KXBA 4D9RA 4AORA 3HK3B 1D3QB 1FN8A 1GVKB 1CQQA 3BTTE 3NPSA 4J1YA 4U01A 4YOJA 1GHBF 3PLKA 1PQ7A 4ISIH 3L33A 2GZ9A 5AFZH 2ZU1A 3Q3KA 5F6MA 3OE7D 3U9AH 1C4Y2 1NRNH 1BDAA 1BTWA 3E0NB 1C4U2 4DG4A 2XOKD 4F4OC 1K9OE 6GCHF 1HJ9A 1O2JA 2BQ6B 2XTTB 3K6YA 2GCTC 2BYAX 4RKOB 1VCQA 5B6LA 1V2JT 1KXAA 1AN1E 1VJAU 1E37B 1JOUB 2FWWA 1C5SA 3SJIA 2QF5A 3SYJA 2Z9GA 3TK9A 2QY0B 1TGBA 3KHVA 4K3JA 3MU0A 3WW7A 2GD4B 2F9VA 1DWEH 3T25A 1CO7E 1O3NA 1SHYA 1TBRH 5ETXA 3ZVCA 1FI8A 4KELA 4E7NA 2ZDAH 4NSVA 1P2KA 1LPKB 2HRVA 2P3FH 3A81A 3UY9A 1MZAA 4AYYB 4RSPA 1O5AB 2R2MB 5IK2D 2J92A 2BX3A 1GL1A 2HOBA 1O2WA 1COWD 1FONA 1Q2WA 4M9FA 1LVBA 1O3AA 1V2KT 3A85A 4OS6A 3SUGA 4A92A 1CA0B 2ZU4A 1MU8B 1YLDA 2HPPH 1GCTB 5KEDA 1AUJA 4KKDA 4B1TA 2A1DB 2P94A 4FVDA 3EE7A 1HAOH 5TCAA 4XD7D 3FVFB 4ACAA 1THRH 1W0JD 3TIUA 4B2BA 2P8OB 2A5AA 2V35A 3PMJA 3CS0A 4NFFA 3PWCA 4HZHA 2QC2A 4YO9A 1TA6A 3GS9A 3LOXA 4Z1MD 2AS9A 1WCZA 3UTUH 1OYQA 3ZZ6A 2W6JD 2NU2E 2Z7FE 4MPWA 1UK4A 1C2EA 2ZQ1A 1CBWC 3V12A 2CN0H 1IQJA 5EXMA 3VB4A 4ABAA 2F43B 2GZ7A 1V2NT 2TGDA 2KM0A 4Y10E 1K28D 2A32A 5E2PA 1DITH 2FLBH 3OSYA 5HM9A 3U8TH 4XBCA 4X1PU 2P95A 1XXDA 3TPIZ 4Y11E 4ASUD 1IQFA 3PMBB 1NU7B 5E0HA 1Q3XA 3SNCA 2QIQA 1HAPH 1SMFE 1WU1A 3F2HA 4FOUC 1WSSH 3W1EA 3SI3H 5EQRA 1BRUP 2ANMH 1IHSH 1MTNC 2YMSC 2GX4A 1OP0A 1TNGA 1C1SA 4HFPB 2QXGA 1TBQH 1LPGB 2Y7XA 3RXDA 3LGVA 3UPEA 4AFSA 3ATLA 3PROA 3HGNA 3IG6B 1C1WH 1AUTC 2PSYA 3AK5A 3M35A 4IMQA 1FY3A 3M5MA 1L4ZA 4H42U 5FCRA 2UWLA 1TNLA 2M5TA 2YNAA 3SGBE 1O2HA 1P02A 1A61H 5C17A 1P3CA 1SGEE 2SGFE 3DHKH 3ESTA 1O2MA 1ZPZA 1YCPK 3OTPA 3GY3A 3SUEA 2XNIA 1AFEH 2PUQH 2JKHA 1GBHA 2P3TB 1Y5AT 1FPHH 1T8LA 3AAVA 5EOKA 3T26A 3ZZ4A 5KGOA 4A6LA 3HPTB 1ZSLA 1C1UH 3M61U 2PFEA 2J2UA 1MQ5A 3U1IB 1UTKA 4K5ZA 4F55A 2H9HA 4MDSA 1WBGB 4IN1A 1UMAH 4JZEH 4X2YA 1UCYK 1XUFA 5T1VA 2BY8X 3T28A 5JDUB 4FUCA 4Q7YA 1RFNA 3RXJA 2F91A 1VGCC 1GWAA 1S81A 3F68H 1LHFH 2ODPA 1C9PA 1LPZB 4CREA 1KYNA 1P2JA 1SLWB 2BDYA 1QJ1B 3S9BA 1G2MA 1W0ZU 1ZPBA 3M7QA 1A5HA 2OLGA 4AFUA 1IQKA 2CMYA 1SGFG 3Q77A 4Q63A 4AGKA 1SGFA 2FOGA 2VGCB 1A2CH 4X6NA 2FTMA 1O3MA 1OP8A 1BOQA 2ANWA 5C0UA 1EJMA 3RXFA 4RT1A 3BTQE 3HK6B 2PUXB 1TYNA 4I31A 1FXYA 2GCHF 4I8LA 3SNBA 2ZU3A 2FP7B 1L2EA 4MLFB 1WUNH 3HKJB 1EB1H 5AVDA 1O31A 1G2LA 1SB1H 1CHOF 1CVWH 1SGYE 1AVWA 3K2UA 4QT8C 3TGIE 6ESTA 1ETSH 1J17T 1EAUA 4B71A 2QAAA 2KX4A 1EQ9A 2FOAA 4SGAE 3EA8A 4HG6A 1O2GH 2Z9KA 3OEED 3PLBA 2PLXA 1LVYA 1LHGH 1OP2A 2QF4A 1UTPA 5FXLA 1LHEH 2ZIQH 1QBOA 1E36B 3UQVA 3SJ9A 1JIMA 1TPSA 4D9QA 3LPRA 5BRRE 2W7UA 4O03A 4Y71A 2W5EA 2ZECA 5F03A 4JYUH 1O3KA 1A0LA 2XCFA 2GZ8A 1HCGA 1QA0A 2ZCLP 2G4TA 1BTPA 1ID5H 2W3KA 4Q80A 2AMPA 1SG8B 1DPOA 1IAUA 4BAMB 2BVXH 1GI0A 4CHAB 5IYTA 1GJ5H 3D23A 1TPAE 3SI4H 1SLVB 1NTPA 1QJ7B 3L6PA 4JMYA 1NBME 1TOMH 2AH4X 2VH0A 5EODA 1H8HD 1TIOA 1GDUA 3BG8A 1W13U 1ANDA 4IS5A 5GJ4B 1PFXC 1AHTH 1S82A 3MO3A 4A1XA 1SC8U 3QK1A 3A84A 1T8NA 2I6SA 1HRTH 2FODA 2GDDA 3B9FH 1OHHD 3SU2A 1TE0A 3RC6A 2AGIX 5A8XA 4Q7XA 5LGOA 2JJ1D 3A82A 4OS2A 4YLQH 5ESBA 2A2XH 2OK5A 1NFWA 1YP9A 2BDBA 3T5FH 3I29A 3MTYA 6CHAC 1XM1A 1CA0C 1W7XH 4Y79A 4ZHAA 4DIIH 2BDGA 1HFDA 4IGDA 3SV7A 1GCTC 1OWEA 4FUHA 3RMNH 1XUGA 4YESB 4I8GA 3BTFE 1MD8A 1TB6H 1ZTJA 5DO4H 2FTLE 1QB9A 1ZHPA 1MH0A 1IQLA 5C1YA 1EFRD 3SJKA 4B6EA 2P8OC 4LXBH 3KGPA 1MKXK 1C2IA 3S7KB 1FY5A 1HB0B 3TJNA 2EC9H 3Q3YA 5ABWA 1UVOA 1IQHA 1O33A 2PR3A 3FP7E 2GCTB 2Y7ZA 2HLDD 5EW2H 1P09A 1CU1A 2WYJA 1IQMA 1RIWB 5EQQA 1OWJA 5AFYH 3F6UH 1A3EH 1A5GH 3P6ZB 1O34A 1YPEH 1SLUB 7GCHF 3TJVA 2WPLS 2ZHEH 3KIDU 4BNRA 3ZVFA 3F9FA 1K1MA 2CXVA 2ODYB 1SKYE 3UNQA 3SUDA 3AAUA 2QF0A 5DJ7A 1HAYB 4ISHH 3MU8A 3BEUA 3MYWA 2ZFQH 5J4SA 1ANBA 4LZ4B 2Q6DA 2J95A 3BTME 2BM2A 3FP6E 4DVAU 2H2ZA 3M5NA 1TLDA 1DUEA 1TBZH 2Y5FA 1HNEE 1E0FD 2HLCA 1O3JA 2TGPZ 3MFJA 2WPDD 1GDQA 1Z8JB 3SV9A 1OOKB 2BOKA 5JYIA 1XVOA 1BB0B 1QRZA 3ZZ7A 1AE8H 1HJ8A 1HAVA 4LK4A 1F7ZA 4Q2KA 2F9OA 2FOFA 3I77A 4XE4A 1TPOA 3A8AA 3CNRA 2ZPRA 1LMWB 1BMLA 1F0UA 1O5EH 1RTLA 4JK5A 1DUAA 4AC9A 2OC7A 1DVAH 1BBRE 4YLUA 3Q3XA 1ZJDA 5AHGH 4AG2A 2BTCE 5DG6A 1C5YB 1BCUH 1AY6H 2VWMA 3KQEA 5GNDA 3SW2B 2ULLA 3RXEA 1TPPA 2BLVA 5DP9A 4FUBA 3LKWA 2H9EH 3ZZDA 1HAIH 1MTSA 3SV6A 1EAXA 3VB6A 4BTTB 1KDQB 1D9IA 1YM0A 2Y5GA 2BD3A 1XKAC 4NIWA 3M7UA 2D26C 1INCA 5GPIB 4YZUA 4D7GA 3EGKH 3A8BA 5HMAA 1OXGA 3VG8A 2LP6A 4IMZA 5JBTA 1LKAA 1WQVH 2YMSB 1H4WA 1QA7A 4WJG2 2SGQE 4NZQA 3KL6A 1BJUA 3O8DA 1VCPA 1C1RA 1S85A 2BDIA 1FY1A 1F5RA 1H9IE 1J8AA 2JH0D 4FVBA 1GJ7B 1QQUA 3PMHB 1BRAA 1ELEE 1T32A 2OC0A 7KMEH 5I25A 4TSFD 3TK6A 1V2MT 1W14U 3OU0A 1BTXA 1C2KA 2AHME 5EXNA 2SNWA 3SZEA 2AGEX 4JZFH 2ZA5A 3R0FA 1L0ZA 1G32B 1ESTA 1P0SH 1WDIA 3AVZA 2C8ZB 1ETTH 3TH4H 2OUAA 4MTBA 5C1UA 5J4QA 1GJDB 1SL3A 3MH7A 1NM6A 1BMNH 1SGDE 3KQBA 5CE1A 3SUFA 3ZZCA 4IN2A 4FU7A 4TWWA 1FQ3A 2PTNA 3PO1B 3GYMA 1MUEB 3SGAE 1ZRBA 5FPYA 2ODQA 3RXHA 2XWAA 1F2SE 1Y3WA 2A7JA 1LCYA 1QZ8A 4AB9A 1UW7A 1VGCB 3KN2A 1AZ8A 1O3LA 1JXPA 3RXLA 1GI6A 1QNJA 1TWXB 4X2WA 1UTOA 1MTVA 5JBCS 2BDCA 4UFFH 1DSTA 1IQNA 3GDVA 5JPMH 4ZKRU 4OS5A 1FMGA 3D65E 1MBMA 2LPRA 2P16A 3PV4A 3M37A 1CGJE 1NRSH 3NUMA 3KNXA 4H6SB 2ZWLH 3A87A 1O36A 2ZDLA 4FU8A 4ISOA 3RXPA 5C20A 2Y80A 1P10A 3U98H 2PP6A 2WUBA 2FX6A 2VU8E 3P92A 2VWNA 2XBXA 4OS4A 2W6ID 1NS3A 5F8XA 3UB0A 2AMDA 3PV2A 1ARBA 3GY4A 3JZ2B 1U6QA 1O3HA 1B7XB 3EE0B 2J4IA 4AGJA 1UTLM 3M36A 2AIPA 3GCOA 3OY5U 2PKAB 5BPEA 5DP7A 1F92A 2ZGCA 5HM2A 1THSH 1JRSA 1O2TA 1VITF 1EAWA 2FMJA 4DOQA 4BTUB 4ABEA 3MNBA 1KXCA 4TPIZ 4LZ1H 2QXJA 2GDEH 2R2WU 3SO3A 2ZQ2A 1ZGIA 4ZHMU 1HUTH 1BBRK 1TABE 5FPTA 1L4DA 4XSKU 3ATMA 1UCYE 2BHGA 1Y3VA 5GIBA 3R3GB 1FUJA 3ITIA 1BITA 2J9NA 1TNHA 2A7CA 2WPIS 1CGHA 1DFPA 2STAE 1O3BA 3RXTA 2ZHFH 3AASA 3DA9B 2GMTB 4MNYA 4AX9H 3URDA 1RIWC 2R0KA 5K0HA 1K21H 4ZMAH 4TWYA 4RN6A 4E7RG 3KYGA 3P8NA 1W0KD 7ESTE 1AE5A 1XXFA 2J98A 1KSNA 1V2ST 2RG3A 4NWLA 5E0GA 3ZZ5A 4FUDA 1MBQA 1KXEA 2VJ1A 1Y3YA 5DP4A 3UAIC 3EA7A 1OWDA 4UONA 1QFKH 2C93B 4UFGH 1F0TA 2F9BH 2F3CE 3SU6A 3RM0H 2BMGB 1EJAA 2B9LA 3DFJA 2TGTA 1H9LB 3LC5A 4BXWA 1O5GH 6CHAB 5GDSH 8GCHG 2ZG0H 5C94A 1XUKA 3BTKE 1AKSA 3A86A 3TITA 2H1UA 1GI2A 1C5XB 2KAIA 4NA9H 1O3FA 1C5ZB 2HALA 4Y76A 1OWIA 2CV3A 1S0RA 1GGDB 3DSGA 4YM9A 1GI5A 3BTGE 1BTYA 1EPTA 1S6FA 1T4VH 4X6PA 1GBJA 1ELFA 1NC6A 1GHZA 1GHYH 3PRBA 1PYTC 1YCPM 3OY6U 1AI8H 2ZTXA 3E90B 2OC8A 1AGJA 3O8CA 4ZKSU 4B73A 2BY9X 1NPMA 2OQUA 4WY3A 3BV9B 3U1JB 2H5DA 3SOSA 5L30H 2FOMB 4VGCB 3MNXA 3SU4A 2FZZA 1GI4A 1SBWA 3GCTG 1K1OA 3OTJE 2EI8A 1DX5M 2VWLA 3KCGH 1RD3B 2ZZUH 3IITA 1PPGE 3MOCA 3QN7A 3PV5A 3GCHC 1DT2A 1P05A 4YXWD 4TPYA 4DT7B 2UUFB 2FM2A 2G5NA 2J5UA 1GG6B 1PPBH 1C5MD 3ZZ3A 2XCNA 1PJPA 2B0FA 1W3CA 3F9HA 1DSUA 1EP6A 3MH5A 3QUMP 1XX9A 1ZTLA 1NROH 5CHBA 1C1PA 1HXEH 2ZDMA 4B76A 1CT0E 2BQ7B 4MPVA 3WWBA 1O2VA 2NU3E 1P9SA 1GHWH 1N1LA 2D8WA 5HKKD 1C2MA 4FXGH 2C8YB 4HTCH 3SJ8A 1RXPA 1X7AC 1YLNA 1YGCH 5CDFE 2BY5X 4NA7A 4AB8A 7LPRA 3LGYA 1WTHD 3F1SB 3GCNA 4GAWA 4Y8YA 3S9CA 2KFWA 1EPTC 4YT7H 2XW9A 1P2NA 4ABHA 1D4PB 2J97A 3HKIB 1GPZA 4ABBA 3U8OH 1O3DA 1UVTH 2O8MA 2UWOA 3W94A 3EQ0H 1YWUA 3RU4D 1HJAC 2RDEA 2ZGBH 3VB5A 1Y5BT 1GJ9B 4FU9A 1O2OA 1ZSKA 2CF8H 3PO1C 1ELBA 3VXFH 1BTUA 1FIWA 3QTOH 1A46H 4E05H 4A1VA 2VBCA 5FCKA 4XBDA 4WMFA 3TK5A 2KR7A 3E1XB 3BN9A 4MPUA 1C1NA 3OYPA 1HLTH 2ZTZA 3LH3A 4ZH8A 2VIQA 3T62A 4AOQA 3QLPH 1M9UA 4NIYA 1ZHRA 5A8ZA 1O2LA 2ZEBA 3TGKE 3STIA 4I8KA 5FBEA 1MABB 1O2QA 3MU1A 1AU8A 1UHBA 4ZXXH 4RI0A 5LPFA 1MQ6A 1TA2A 4WXVA 1SGNE 1AFQB 1A4WH 1GDNA 2BZ6H 2Z3DA 2BXTH 3SN8A 1WXRA 4B2AA 1C5WB 2YNBA 1HAVB 1QJ6B 1HDTH 2A0QB 2J38A 3QO6A 1YY3A 1GMHG 4JCNA 1EX3A 3OEHD 4UFDH 1CE5A 4X2VA 1BIOA 1BRCE 1EAIA 2BVSH 1GI1A 1E1QD 2QGRA 3M3VA 2H5CA 2CF9H 4NZLA 2I6QA 2LNCA 4NWKA 5JB8S 2NU1E 1Z7KA 2WV9A 2JJ2D 1VR1H 3FFGA 2BB4A 1NY22 2BD8A 1TGNA 1A5IA 1C1VH 9ESTA 1XUHA 3HGPA 1MKWH 5PTPA 2P59A 3BIVH 2VINA 1EXFA 1MTWA 1BHXF 3H5CB 4WWYA 2ZF0H 4XRNA 3UNSA 4CH2B 5C3NA 1NRRH 1TX6A 5EXLA 5CMXH 4X0WU 5F8TA 4M7GA 4XBBA 3NCLA 2RFKC 2F4LA 2A4RA 3ATWA 1MCTA 1NU9A 1UTNA 4WXIA 3P70B 2ZKSA 1FDPA 4E06H 2KZ4A 2ZFSA 3LONA 4CBNA 2ZO3H 1IHTH 4Y7BA 1KLJH 4YOIA 1GMHF 1DS2E 2GMTC 4LOYH 2V3HH 1V2TT 2AEIH 3MO6A 1JMOH 5F8ZA 1TMTH 1ESAA 1QRXA 2HVYB 1L1GA 1YBWA 5GXPA 2VVUA 1AZZA 4TT3D 1C5TA 1YKTA 4CBOA 1GHAG 1SVPA 3BEIB 4OGXA 4SGBE 2ANKH 5A8YA 1RTFB 2XNDD 3RXIA 5JBBS 2XBWA 1PQ5A 3LDXH 1DY8A 2QF3A 1QBNA 4JZDH 4BAQB 2PKSB 5DP5A 2XBVA 2Q6FA 1KLTA 2WV5A 1J14A 4NGAH 2CHAB 1UK2A 1GJ6A 1HGTH 3ZV8A 2Z9LA 1WV7H 2AFQB 3OX7U 1YPKH 3L3TA 1O2XA 1ELCA 5L2YH 3ZIAD 1NRQH 4MPXA 1V2VT 2NU4E 1G3DA 1NO9H 2WV4A 4MNWA 1ZR0A 2A45B 3SV2H 3UR6A 1BBRH 2XYAA 1C2LA 1V6DA 2ZPQA 3DD2H 1TX7A 3FZDA 2A4OA 5DPAA 1ELTA 3RU4T 4ESTE 1O2PA 2G51A 5FL7D 5FPSA 1QBVH 1GGDC 2Q1JA 3A8CA 1OPHB 3TH3H 3W95A 1GBLA 1LHDH 2W26A 1GJ4H 4UEHH 5K7RA 1XVMA 1ZZZA 1FAXA 2RCEA 3UWIA 1DXPA 2GKVE 1BTHH 2VIPA 3JZ1B 4H4FA 2WZQA 5LH8A 1AB9B 5DP8A 3DSOA 4IC5A 5EG4A 1C1QA 2OINA 4FUEA 1P9UA 5HIYA 1GI3A 3LJJA 4YOGA 2ZPSA 1TMUH 1QB6A 4GHTA 1T4UH 4JK6A 1W8BH 1P2MA 4K60A 1J15A 4FUGA 4VGCC 1GBMA 4O9VA 1GJBB 4NSYA 1PQAA 4A5TS 2RDLA 3SHAH 4D76A 1C5QA 5C1XA 3RMLH 1B0FA 4JYTA 3QZQA 3FP8E 3ZVEA 1UVUH 2TIOA 3MU4A 5E8EH 1HAZB 1GL0E 3NK8A 2F83A 2PGBB 2J34A 2QXIA 1GG6C 2SGEE 3LJOA 4X1RU 3SORA 1EKBB 1P8VC 1GBFA 3A7XA 2VIVA 9LPRA 1TALA 5T6GA 1D3TB 3BTHE 1QL9A 1QQ4A 2ZGHA 4I8HA 4X1QU 1D3DB 1C2JA 2XC4A 3GICB 1NZQH 3NWUA 2FI4E 1QR3E 1TX8A 1MZDA 1CSOE 1SOTA 3TVJB 1O2RA 1THPB 2DE8A 1P04A 1PYTD 1CA8B 3RMOH 1EOLA 2EY4C 1CHGA 4DURA 3OAAD 1FY8E 3T27A 1BRBE 2XC5A 2EA3A 2OBOA 1FIZA 1TNKA 2AGGX 1KXFA 3RP2A 1YPJH 1GMCG 1OX1A 2HWLB 1FV9A 1JRTA 4X6MA 3E8LA 2ZFRH 2ZGXH 3RXKA 3TH2H 2JIZD 3U69H 2V6NA 3N7DA 4FUIA 5H4IB 4B2CA 4K2YA 2J98B 3Q76A 1NBMD 3F0OA 4RKJB 4FUFA 1C5RA 5C5NA 1Z8RA 1V2PT 1FZZA 1RRKA 4BTIB 5TCCA 5E2OA 1SGQE 2ESTE 3GCHB 3LGWA 1SGTA 2YMSD 5F53A 2GTBA 2O8TA 3NZIA 3U8RH 3ZVBA 3T2NA 3H7TA 1ANCA 3RXBA 3DFLA 1W7GH 5DKMA 2V0BA 1SQTA 3GISB 2R9PA 1T7CA 3FO8D 1F5KU 2IPQX 5A0CA 3FOAA 4WH8A 1FJSA 3QWCH 2WSSD 2VIDA 1O5FH 3A7YA 3ODFA 1GVLA 1DOJA 5C0TA 1AFQC 4MNXA 2BOHB 3PRDA 3VXEH 3A8DA 2KAIB 6LPRA 3WWFA 3EYDA 3KQDA 1DWCH 1T31A 2P93A 2WPJS 1F0SA 1VKYA 1GBDA 4GHQA 2TGAA 5EJZA 1YCPH 4I8JA 3SNDA 1BA8B 1EPTB 1GMCF 3FZZA 1EZSC 2QYIA 3TJOA 1FLEE 5HYOA 2VB0A 2OTVA 2G00A 3ZVDA 4GPGA 1HAHH 1DXWA 1AO5A 1HJAB 2KCPA 4OS7A 3UR9A 1ARCA 3K9XB 3ODDA 1XKBC 2WUCA 1GBAA 2GT7A 2JH6D 4I7YH 1UCYH 2HPQH 3F0PA 3GY8A 1NESE 3STJA 2B5TB 4BOHA 3PTNA 2V3OH 1GHXH 1LKBA 2WHXA 2G55A 3FKSD 4HGCA 3RLWH 2CK3D 4B75A 2ASUB 3A80A 3P95A 4CRBA 1TGTA 3A7VA 1EUFA 2KCAA 2BVRH 4BANB 3UREA 1F5LA 4KTCA 1HPGA 4BAHB 5EQSA 1FNIA 3BG4C 1SHHB 3LC3A 3MMGA 3ZVGA 1WOFA 3ZZBA 4KTSA 1Q31A 1Y3UA 2BD7A 4O3TA 5L6NH 3LH1A 4WH6A 1DDJA 1YLCA 1RJXB 2K0QA 2PWXA 1O3EA 2ZP0H 3RXAA 2VIOA 3PB1E 2FOCA 1GHBG 3UQOA 2V7QD 2O8LA 4THNH 1L1NA 4KTUA 3LGTA 2ZHDA 3KQCA 3SQEE 3Q00A 3TJUA 1KTTB 3VEQB 2PKSC 3LGIA 2C4FH 3TU7H 6GCHG 3S7HB 1S6LA 1C2FA 2FI3E 4D7FA 2M2AA 2GV6A 1GJCB 1K0HA 3LIWA 2B8OH 4NIXA 2Z6BD 2CHAC 1QGFA 2XXLA 4BAOB 4DGJA 2VH6A 4DT4A 1C5PA 1UVPA 1NFXA 3E91A 5JB9S 1ACBE 1PPEE 2STBE 4CR9A 3SNEA 2CGAA 5IDKA 1BHXB 1XMNB 1O32A 1JIRA 1HXFH 3RUOA 1BQYA 2NWNA 1O3GA 2GVFA 2Q6GA 1IQIA 4MG3A 2ZC9H 2SGPE 1O3PB 3TNSA 2R3YA 2ALVA 1AWFH 4A7IB 2L6OA 1UHBB 2XWBI 4GUXA 1SOZA 1AB9C 4ZKNU 4Y8ZA 3ZZ8A 5FX5A 3GOVB 3MHWU 4P02A 2OXSA 2A4QA 5CHAC 3ZVAA 4X8VH 1Z6EA 4F48B 2BD9A 2O8UA 4OGYA 5EU8A 3NKKA 3UIRA 3SZNA 1ABIH 3A7ZA 1TRNA
chains in the Genus database with same CATH topology
3QGNB 2QCYA 3D49H 1O30A 1Z71A 2SFAA 3G01A 3RU4E 3ZZAA 1NFYA 1W11U 1MMJN 2BLWA 4BAKB 3BTEE 5DP6A 1G3CA 4GVUA 1NFUA 5E0JA 4Y8XA 1E35B 1Z8IB 1D6RA 5T6FA 4JZ1A 2WPMS 2UUYA 1ZPCA 2IN2A 2IOTA 1OWKA 3PWBA 2AMQA 3V0XA 2C3SA 1BMMH 1FN6A 1G3EA 2FS8A 1EJNA 1VCWA 1C4V2 1RS0A 2SGAA 3GDSA 1EATA 1KDQA 4INKA 4ASHA 3S69A 2FOEA 1DLKB 3AW0A 4K8YA 3RDZA 3T29A 1HIAA 1UO6A 1VITH 3P17H 2TPIZ 4DJZB 1SFQB 1MKXH 1IQEA 2Z9IA 5FX6A 3B8JA 2SNVA 3MNCA 3VPKA 1GBTA 3A7TA 4IC6A 1Z1IA 1A7SA 2FEQH 1UJ1A 1V2WT 2QN5T 3SNAA 4CRFA 5T3HA 3CP7A 1RGQA 4U32A 2BDHA 2PW8H 4DCDA 1C2HA 1DM4B 1TRMA 2TBSA 1GBBA 3CENA 3LGUA 1OKXA 3RXMA 1MCVA 3VFEA 1TRYA 2HNTE 3RXOA 3PMAB 1A0HB 4ZUHA 4O3UA 5C5OA 1LVOA 4AN7A 1Y5UT 2FESH 4UFEH 2BQWB 2R0LA 3O8RA 1AWHB 2A5KA 1TQ0B 1QL8A 1K22H 1TGCA 1V3XA 2UWPA 8GCHF 1ELDE 3BF6H 3GY5A 5HXFA 1BMAA 1KXDA 4AFQA 1CT2E 2OD3B 1ZGVA 3V3MA 1O3IA 1DWDH 3F9GA 2SGDE 2OC1A 4CRCA 3MH4A 5FHTA 4DIHH 3SU1A 1AIXH 1DLEA 1KIGH 1S0QA 4OS1A 4ABFA 3PTBA 1N6YA 2Z9JA 1B0EA 3ENSB 4MNVA 1W10U 1NRPH 3MU5A 2YOLA 5JBAS 4XFQA 4X1SU 1D6WA 1KLIH 2OP9A 1N8OB 3S9AA 1SGCA 1T8OA 2BLQA 1FPCH 4IBLH 5C67A 1UTQA 1MAXA 2A4GA 5GCHG 1YPLH 1EZQA 3ELAH 3E6PH 1C1MA 1JWTA 3UUZA 1SGRE 1GI8B 3A88A 1BZXE 3VGCC 2QV1A 1SR5C 3GCTF 2AERH 4Y6DA 1O2UA 1G37A 1TNJA 2JETC 1AVGH 3RM2H 1AMHA 3PYHA 3UOPA 2JH5D 3ATIA 3GYLB 2ANYA 1PPFE 3PM3A 1QIXB 3RXGA 1BUIA 1P06A 2A7HA 3V7TA 2GCHG 2RA3A 2VVVA 1GJ8B 3V13A 1K1PA 1LO6A 2IPHA 3I78A 1O2NA 5TJXA 1W2KH 2PKAA 2WINI 2AIQA 1PPHE 2F9UA 3VB3A 1CHOG 5EPYA 2ZU2A 3BSQA 3IWMA 3A89A 4K69A 4HI3A 5FAHA 4I33A 4TYDA 1C2GA 2XC0A 3D62A 4ZKOU 1MU6B 1C5OH 1ELVA 3RXQA 2O8WA 1CT4E 4U30A 5B6OA 2K1QA 1YPMH 1HV7A 2W3IA 4Z6AH 4I32A 4J2YB 8ESTE 1IOEA 2Z94A 4WVPE 1O39A 4KGAA 1C1TA 2ZI2H 1N6XA 3MWIU 3UFAA 4ABDA 2G4UA 1ESBA 5GCHF 1O2SA 3GY2A 4ABGA 3A83A 1UVSH 1WQSA 1ZMJA 2TRMA 3ATKA 3UOUA 3RC4A 4TY7A 1MTUA 4GCHG 1C9TA 2GT8A 3PLPA 5LPEA 1LDTT 3A7WA 4X8UH 2GGVB 2Y5HA 2FX4A 1C5LH 2ZFFH 2XBYA 4CH8B 1WYKA 5LPRA 1EASA 4X1NU 4CR5A 3TNTA 1ETRH 1HBTH 1SGPE 3K6ZA 3MNSA 2W7SA 4X8TH 1GJAB 1P03A 1SGIB 4F49A 2BD4A 1DICA 2DUCA 3UNRA 4FUJA 5GWZA 2THFB 4CRGA 1IQGA 1W12U 3QZRA 3FANA 1C5UA 1TGSZ 1OYTH 2G8TA 2Y82A 2ZHQH 2Y6TA 2Y81A 1TFXA 2CJIA 4WF8A 2BY7X 4X8SH 5FBIA 1XUIA 1GBEA 3C1KA 4MQAA 3BG4B 4MVNA 2BX4A 2HVXA 1J9CH 1G3BA 1SQOA 2ZCKP 5EGMA 1DANH 4AYVB 3SU3A 3B23B 3BEFB 3F9EA 3E0PB 2J94A 3ZYDA 1J16A 2F9PA 2ZTYA 4WMEA 1S84A 4GCHF 1GBKA 3M5LA 2R3UA 4ISLA 1PPCE 1O38A 4O97A 1QCPA 4K1TA 1PQ8A 1YPGH 2GV7A 2Z3EA 1W0YH 4UD9H 1O2KA 1ZMNA 1V2OT 4CRAA 1XUJA 1GHVH 1ANEA 2O9QA 3LU9B 1SPJA 2BLOA 1ZYOA 1HAXB 5C2ZA 5I46H 1ZLRA 2ALPA 1KY9A 3ZYEA 1QY6A 2ZU5A 4XDEA 3ZV9A 2AYWA 5A0BA 7GCHG 1V2RT 1BT7A 1WAYB 1O35A 1T8MA 1UTMA 1V2UT 2BD5A 3M7TA 1A0JA 1H8IH 1C5NH 1A1RA 4K8BA 4ABJA 2C8XB 1D3PB 1MD7A 1QL7A 1WTGH 2F9NA 2HGTH 1TOCB 4WMDA 1EZXC 2FXRA 1G30B 1P2OA 5HGGA 1TONA 1C2DA 1QURH 3SHCH 1GHAF 1ZOMA 1A3BH 2C90B 5A0AE 1BTZA 4IW4E 2A2QH 1JBUH 4TY6A 1LVMA 3FAOA 2OQ5A 1GCDA 4A1TA 5CHAB 5SGAE 1E34B 4XOJA 1TAWA 1LHCH 1GBIA 1Z1JA 1LTOA 1O37A 1DWBH 1YPHC 3KEEA 2WPKS 3QDZB 1B5GH 1EOJA 1SSXA 2D1JA 3S0NA 1O5DH 2BD2A 2BZAA 3RXUA 3BTDE 1GVZA 3H7OA 1ZRKA 1C5VA 1C1OA 1OS8A 4Q7ZA 4NCYA 2DE9A 4U2WA 2GP9B 3QGJA 2G52A 1QB1A 4D8NA 4GLYA 5ESTE 1K2I1 1CGIE 1Z8GA 1UK3A 3RLYH 2ZGJA 4JZIA 3UWJH 1ORFA 4X2XA 1MAYA 2QA9E 2IJOB 1EZUC 1HAGE 1P01A 5EPNA 1NN6A 1N8OC 3NXPA 1H1BA 1P11E 3BIUH 1DE7H 1S6HA 2EI6A 8LPRA 4DY7B 4DW2U 1GMDG 3VB7A 2EI7A 1LQEA 4UDWH 2VWOA 4ISNA 2QXHA 5DGJA 1ABJH 1S83A 1O3OA 5T6DA 1RTKA 1P12E 2Z3CA 2FLRH 3M5OA 4NG9H 3WY8A 4ZHLU 8KME2 1P3EA 4GSOA 1H8DH 1OWHA 3N7OA 4Y0YE 3RC5A 1AD8H 3SV8A 2NU0E 4NIVA 2A5IA 1H9HE 3URCA 1FAKH 4H6TA 4KP0A 2G81E 3DT0H 3SU5A 1EB2A 3RXVA 2FDAA 3KF2A 1O5BB 3QTVH 1CBWB 4K1SA 2XRCA 5AF9H 2A31A 1P2IA 3SBKA 1GI9B 1ZSJA 4INHA 3RMMH 3AW1A 4JYVH 2ZDKA 2ILNA 1ELGA 3K65B 4Z0KA 1E38B 1ZMLA 3P8GA 1AKSB 2ZCHP 1O3CA 2ZHWH 1NT1A 1HIAB 1P57B 1G9IE 1Y59T 4ZXYH 1QHRB 2EEKA 1GMDF 2PTCE 3DUXH 1AVXA 5G4BA 3M3SA 3RXSA 3RXRA 1K1LA 3SGQE 1MTNB 1G36A 1ZJKA 3GY7A 5DK1A 3SU0A 3EA9A 1PPZA 1LQDB 4ABIA 2FYRA 2VGCC 1SFIA 1ZHMA 1K1NA 2UUKB 1Y8TA 2OCVB 1BJVA 1OSSA 1TMBH 3VGCB 2VIWA 1SQAA 5L2ZH 2JETB 1GI7B 2WYGA 1K1JA 3GDUA 4CRDA 1GBCA 2BY6X 2PV9B 1V2QT 3ZZ9A 4Y0ZE 3C27B 2ZFTA 3SQHE 2PHBA 3EDXB 2HNTF 3TGJE 2P3UB 2ZNKH 3SJOA 3M3TA 1TQ7B 3BTWE 3LT3A 4NFEA 1O0DH 4INLA 2FIRH 2FPZA 1SLXB 4BXSA 2B7DH 4AFZA 1Z6JH 2WPHS 1YPHE 3P8OA 2FOBA 1KTSB 2HNTC 1MKWK 3CS7A 4NA8A 2PGQB 1UTJA 1F0RA 5A09A 4UE7H 1ZTKA 2H6MA 1VITG 1O2ZA 4R8TB 1ELAA 1FY4A 3EAJA 4B74A 1O2YA 2G5VA 1YYY1 1DY9A 1VJ9U 1V2LT 4ZROA 4CHAC 3TLOA 1O2IA 2ZFPH 2ZDVH 2FO9A 3MO9A 3O8BA 1VZQH 5A2MH 2RA0A 1AQ7A 2VNTA 3P8FA 2VVCA 2UUJB 1O5CB 4PROA 2OBQA 1TNIA 3RXCA 1HYLA 1Y3XA 1YC0A 3HATH 2BDAA 2H9TH 1QTFA 1QRWA 1EP5A 4YTAA 2PSXA 3E16B 5DP3A 1S5SA 1L1JA 1YF4A 2FI5E 3MI4A 3MH6A 4K1EA 4AZ2B 4AG1A 4X6OA 4YT6H 2ZDNA 1K1IA 1SI5H 2FYQA 2FS9A 2D2DA 2BXUH 3QX5H 4Y7AA 3E3TA 3GY6A 1P2QA 4R0IA 4ZAEA 5EW1H 2C8WB 2FOHA 1KXBA 4D9RA 4AORA 3HK3B 1D3QB 1FN8A 1GVKB 1CQQA 3BTTE 3NPSA 4J1YA 4U01A 4YOJA 1GHBF 3PLKA 1PQ7A 4ISIH 3L33A 2GZ9A 5AFZH 2ZU1A 3Q3KA 5F6MA 3U9AH 1C4Y2 1NRNH 1BDAA 1BTWA 3E0NB 1C4U2 4DG4A 4F4OC 1K9OE 6GCHF 1HJ9A 1O2JA 2BQ6B 2XTTB 3K6YA 2GCTC 2BYAX 4RKOB 1VCQA 1V2JT 1KXAA 1AN1E 1VJAU 1E37B 1JOUB 2FWWA 1C5SA 3SJIA 2Z9GA 3TK9A 2QY0B 1TGBA 3KHVA 4K3JA 3MU0A 2GD4B 2F9VA 1DWEH 3T25A 1CO7E 1O3NA 1SHYA 1TBRH 5ETXA 3ZVCA 1FI8A 4KELA 4E7NA 2ZDAH 4NSVA 1P2KA 1LPKB 2HRVA 2P3FH 3A81A 3UY9A 1MZAA 4AYYB 4RSPA 1O5AB 2R2MB 2J92A 2BX3A 1GL1A 1O2WA 1FONA 1Q2WA 2HOBA 1LVBA 1O3AA 1V2KT 3A85A 4OS6A 3SUGA 4A92A 1CA0B 2ZU4A 1MU8B 1YLDA 2HPPH 1GCTB 1AUJA 4KKDA 4B1TA 2A1DB 2P94A 4FVDA 1HAOH 5TCAA 3FVFB 1THRH 3TIUA 4B2BA 2P8OB 2A5AA 2V35A 3PMJA 3CS0A 4NFFA 3PWCA 4HZHA 2QC2A 4YO9A 1TA6A 3LOXA 2AS9A 1WCZA 3UTUH 1OYQA 3ZZ6A 2NU2E 2Z7FE 4MPWA 1UK4A 1C2EA 2ZQ1A 1CBWC 3V12A 2CN0H 1IQJA 5EXMA 3VB4A 4ABAA 2GZ7A 1V2NT 2TGDA 4Y10E 1K28D 2A32A 5E2PA 1DITH 2FLBH 3OSYA 5HM9A 3U8TH 4XBCA 4X1PU 2P95A 1XXDA 3TPIZ 4Y11E 1IQFA 3PMBB 1NU7B 5E0HA 1Q3XA 3SNCA 2QIQA 1HAPH 1SMFE 1WU1A 1WSSH 3SI3H 5EQRA 1BRUP 2ANMH 1IHSH 1MTNC 2GX4A 1OP0A 1TNGA 1C1SA 4HFPB 2QXGA 1TBQH 1LPGB 2Y7XA 3RXDA 3LGVA 3UPEA 4AFSA 3ATLA 3PROA 3HGNA 3IG6B 1C1WH 1AUTC 2PSYA 3M35A 4IMQA 1FY3A 3M5MA 1L4ZA 4H42U 5FCRA 2UWLA 1TNLA 2M5TA 2YNAA 3SGBE 1O2HA 1P02A 1A61H 1P3CA 1SGEE 2SGFE 3DHKH 3ESTA 1O2MA 1ZPZA 1YCPK 3GY3A 3SUEA 2XNIA 1AFEH 2PUQH 2JKHA 1GBHA 2P3TB 1Y5AT 1FPHH 1T8LA 3AAVA 5EOKA 3T26A 3ZZ4A 4A6LA 3HPTB 1ZSLA 1C1UH 3M61U 2PFEA 2J2UA 1MQ5A 3U1IB 1UTKA 4K5ZA 2H9HA 4MDSA 1WBGB 4IN1A 1UMAH 4JZEH 4X2YA 1UCYK 1XUFA 3T28A 2BY8X 5JDUB 4FUCA 4Q7YA 1RFNA 3RXJA 2F91A 1VGCC 1GWAA 1S81A 3F68H 1LHFH 2ODPA 1C9PA 1LPZB 4CREA 1KYNA 1P2JA 1SLWB 2BDYA 1QJ1B 3S9BA 1G2MA 1W0ZU 1ZPBA 3M7QA 1A5HA 2OLGA 4AFUA 1IQKA 2CMYA 1SGFG 3Q77A 4AGKA 1SGFA 2FOGA 2VGCB 1A2CH 4X6NA 2FTMA 1O3MA 1OP8A 1BOQA 2ANWA 1EJMA 3RXFA 3BTQE 3HK6B 2PUXB 1TYNA 4I31A 1FXYA 2GCHF 4I8LA 3SNBA 2ZU3A 2FP7B 1L2EA 4MLFB 1WUNH 3HKJB 1EB1H 5AVDA 1O31A 1G2LA 1SB1H 1CHOF 1CVWH 1SGYE 1AVWA 3K2UA 4QT8C 3TGIE 6ESTA 1ETSH 1J17T 1EAUA 4B71A 2QAAA 1EQ9A 2FOAA 4SGAE 3EA8A 1O2GH 2Z9KA 3PLBA 2PLXA 1LVYA 1LHGH 1OP2A 1UTPA 5FXLA 1LHEH 2ZIQH 1QBOA 1E36B 3UQVA 3SJ9A 1JIMA 1TPSA 4D9QA 3LPRA 5BRRE 2W7UA 4O03A 4Y71A 2W5EA 2ZECA 5F03A 4JYUH 1O3KA 1A0LA 2XCFA 2GZ8A 1HCGA 1QA0A 2ZCLP 2G4TA 1BTPA 1ID5H 2W3KA 4Q80A 2AMPA 1SG8B 1DPOA 1IAUA 4BAMB 2BVXH 1GI0A 4CHAB 5IYTA 1GJ5H 3D23A 1TPAE 3SI4H 1SLVB 1NTPA 1QJ7B 3L6PA 4JMYA 1TOMH 2AH4X 2VH0A 5EODA 1TIOA 1GDUA 3BG8A 1W13U 1ANDA 4IS5A 5GJ4B 1PFXC 1AHTH 1S82A 3MO3A 4A1XA 1SC8U 3QK1A 3A84A 1T8NA 2I6SA 1HRTH 2FODA 2GDDA 3B9FH 3SU2A 1TE0A 3RC6A 2AGIX 5A8XA 4Q7XA 5LGOA 3A82A 4OS2A 4YLQH 5ESBA 2A2XH 1NFWA 1YP9A 2BDBA 3T5FH 3I29A 3MTYA 6CHAC 1XM1A 1CA0C 1W7XH 4Y79A 4ZHAA 4DIIH 2BDGA 1HFDA 4IGDA 3SV7A 1GCTC 1OWEA 4FUHA 3RMNH 1XUGA 4YESB 4I8GA 3BTFE