2ESTE

Crystallographic study of the binding of a trifluoroacetyl dipeptide anilide inhibitor with elastase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ELASTASE
publication title Crystallographic study of the binding of a trifluoroacetyl dipeptide anilide inhibitor with elastase.
pubmed doi rcsb
source organism Sus scrofa
total genus 60
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1986-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2estE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2estE01
4K2YA 1WV7H 4Y71A 1AVXA 4M7GA 2SGDE 1FIZA 1GG6C 2A7JA 2ESTE 1LPGB 2A5KA 2XXLA 1FXYA 1WQSA 3D49H 1X7AC 1GJ5H 1WOFA 2QCYA 1ZTLA 3UWJH 2F9VA 1TIOA 6GCHF 1V2RT 3SOSA 4A7IB 2D26C 1GHZA 1C1UH 2AGIX 1TYNA 4MNXA 3ATLA 1XVOA 1NU9A 1D6WA 3F1SB 1KXAA 1BOQA 1K21H 1L0ZA 2UUYA 4HI3A 2BMGB 1Z1JA 2BQ6B 3V7TA 1FZZA 1TQ0B 5GPIB 2CMYA 4FU9A 2FOCA 2J2UA 1GBJA 2C93B 3SU5A 4IMQA 1H9LB 4JMYA 3PMBB 5HXFA 1EJNA 1O2MA 1QR3E 1AKSB 2BLQA 4O97A 1FAKH 3GCOA 1SQAA 3OSYA 1DWEH 2BD9A 1W10U 2AGEX 5LGOA 1T31A 1EXFA 1SSXA 3QUMP 3SJIA 3A86A 4FU7A 4ZMAH 1SHYA 3BTWE 4X1RU 5T6DA 1MTVA 1NRQH 5BRRE 2QYIA 1YPLH 4MQAA 1AFEH 1DSUA 2TRMA 4CRAA 2BD2A 1H8IH 3H7TA 2WYGA 1J17T 3OYPA 4NFEA 3SO3A 1C1TA 5A09A 1O38A 3KQEA 4BAMB 3STJA 8LPRA 2NWNA 2P59A 2Q6DA 1LO6A 3A84A 2CN0H 5GXPA 1FY8E 3TPIZ 1IAUA 4O9VA 2DUCA 2W26A 1GI8B 3UOUA 1QRZA 2UWOA 1C1MA 2A4GA 2GV7A 4FVBA 2WUCA 3VB3A 3KF2A 3UFAA 3EAJA 3QZQA 8ESTE 2FLBH 3MNXA 8GCHG 1LHGH 3TH4H 3KEEA 5EQQA 1BHXF 2F9OA 1C4Y2 1HAHH 1HIAA 4X6MA 1DLKB 1ETSH 1ZHMA 3RXAA 1AGJA 1HXEH 1C4U2 3QK1A 1AY6H 1NC6A 2IN2A 4Q2KA 3UREA 3T2NA 2BYAX 4CBOA 3RXJA 5E2PA 2VVCA 4BTIB 3U1JB 4RSPA 1ANDA 3NPSA 4I8HA 1E38B 1XUGA 2AGGX 3DD2H 1EP5A 1YM0A 4O03A 1ZR0A 1MTUA 1UVSH 4GHTA 3ZZBA 2H9HA 1GHYH 1UO6A 1C5XB 2NU3E 4XBDA 3QDZB 3RXDA 1NU7B 1F0SA 1IQLA 3M7UA 1UTOA 3STIA 1G32B 4AOQA 4Y0YE 2OCVB 3MU8A 3LH3A 4NWKA 1PYTD 2ASUB 3SUEA 2BZAA 3RXIA 1P10A 2GCTC 3TK9A 4YOJA 2J94A 1AWFH 5F6MA 3RU4T 3R3GB 3LJOA 3LT3A 1VJAU 3LJJA 3MOCA 4KKDA 3MH4A 4SGAE 4UD9H 3UTUH 2LPRA 3URDA 3MH5A 1RGQA 2FI3E 3A8DA 3UQOA 1C5QA 4ABGA 1PPCE 4KELA 1PQ5A 1YKTA 1BITA 1Y8TA 1YPKH 1HAXB 1ZPCA 2Q1JA 2W3IA 4ISLA 4CH2B 4D7GA 3NUMA 1O2JA 2TBSA 2CHAC 3EA8A 1ZMLA 5EG4A 1GBLA 1L4DA 2HALA 3TLOA 3F68H 3LC3A 5TCAA 2PTNA 1DVAH 4CRGA 4IS5A 1GCDA 5EQRA 2G8TA 3RP2A 1CSOE 3DFLA 3A89A 1VITG 2ZCKP 1GMHF 2BDBA 5ESTE 2QGRA 3D65E 1P06A 1SG8B 3M61U 1W13U 1DE7H 1XKBC 2A45B 3SV2H 2V6NA 5EW1H 1GHWH 2K1QA 4FU8A 5JBCS 1T32A 1NROH 4YM9A 1P3CA 1Q3XA 1GJ9B 3SN8A 1JRSA 2QXJA 2VWMA 2LNCA 2XNIA 3PO1B 2PW8H 4HGCA 1W2KH 2OC8A 4ZAEA 4RN6A 3E8LA 3TGIE 5CHAB 2ZU1A 1P2QA 3VPKA 2GP9B 5DKMA 1HUTH 1ETTH 3AW1A 2SNVA 3VXFH 2Y7XA 2ZECA 1NZQH 4R8TB 5AHGH 2Y6TA 3DHKH 3QTOH 4WXIA 1NFYA 2PUXB 1A3EH 5JB8S 1P0SH 1TX7A 3C27B 5C1UA 1DX5M 2ZDVH 1EOLA 2THFB 3UPEA 4AG1A 1A0LA 3M3SA 4O3UA 1ZTJA 4X2YA 1QTFA 1GBAA 1P2KA 1AKSA 3MNSA 3UIRA 5GCHG 1DWCH 1UTNA 4LZ4B 2CJIA 2IOTA 4IN2A 4ZXXH 3BTGE 1EAXA 3TJOA 2ZDKA 2BQWB 1Y3XA 2YNAA 1SPJA 1W11U 3SV8A 3A8CA 1TNGA 2TGPZ 1D4PB 3LGIA 4K69A 2O8LA 1TQ7B 3P17H 1UTJA 4DIHH 1NRSH 1JMOH 5J4QA 1GL1A 1ABJH 1GJ4H 1LPKB 2ZO3H 3BTQE 1E37B 3LIWA 3GY2A 3RMOH 2F83A 2G00A 1GJCB 3N7OA 4BAQB 3ZZ7A 1SLXB 1J15A 3GOVB 4ABJA 1GHVH 2TGAA 3LGTA 1MQ5A 1YPEH 4Y76A 2STBE 2VWOA 3LONA 3A88A 4AORA 1LHFH 2OQUA 2ZFQH 1O2IA 1WSSH 1H9IE 1HAZB 1V2ST 5EQSA 1UK3A 3SNEA 1BCUH 1BMAA 3FVFB 5C1XA 1KY9A 3RU4E 2GDEH 1O2YA 4U32A 4Z6AH 5DP4A 1O3NA 1NM6A 1VITH 1MMJN 6CHAB 2GV6A 3OU0A 4NGAH 1PPZA 4AN7A 3NXPA 3AAUA 3RXSA 4D9QA 1GJAB 1KXFA 1SI5H 3BTHE 2XBYA 1GBTA 1DFPA 2FI4E 1E34B 1MU8B 1NN6A 1O5DH 2FX6A 1HAPH 1C2EA 2VWNA 3VFEA 1THSH 1Y5UT 2XYAA 3ZVEA 1S5SA 2BD8A 2ZU4A 1V2WT 1KXBA 1D3QB 7GCHF 5TCCA 1RRKA 1MBMA 5EODA 1GDUA 4NIWA 1DY9A 1GI2A 1V2VT 1PPBH 1SLVB 1QNJA 3P92A 3RMMH 2QXHA 5DP9A 4Y6DA 3B23B 4ABEA 2ZKSA 2BLOA 5EPYA 1BHXB 2FOEA 1O5FH 4ZROA 4O3TA 1QFKH 1TALA 3S69A 1W8BH 1O3KA 1LQEA 3HGNA 3M35A 3VB7A 3LH1A 1AIXH 1QB9A 1DT2A 1O3MA 4CRCA 4LZ1H 3OX7U 3DFJA 3BTME 5L2ZH 1C9PA 1M9UA 4MPVA 1HNEE 3TK6A 1YPJH 2ZTZA 1SGQE 3A7XA 1SL3A 1LCYA 2GT8A 5IDKA 1C5MD 2ZCLP 1ESTA 1O2LA 1C2GA 3GCTG 2PV9B 2ZHEH 1C5OH 4BNRA 2H5DA 2HOBA 1KXDA 2XC4A 1P9UA 3LGVA 4HFPB 1CU1A 1SB1H 2ZGXH 5FPSA 3PLPA 3GY3A 4D7FA 2Z9IA 3R0FA 3T62A 3PWCA 5HGGA 3PWBA 1BTXA 1TGTA 3BEIB 2VINA 3TJNA 1TA2A 1TPPA 1C5PA 1YPHC 3NK8A 2BQ7B 2H2ZA 2ZHDA 4MPXA 3EE0B 2Y5GA 2GGVB 2HPPH 1BB0B 1TNLA 3SJOA 3K6ZA 4WMFA 2A4QA 4AYVB 1FN8A 1SGRE 1TMUH 3SU4A 1HAGE 2QAAA 4IW4E 1P3EA 3V3MA 3VB4A 2ULLA 4B2AA 3ITIA 1EP6A 3FZZA 4Y7BA 5H4IB 1TBQH 2PGBB 1QJ6B 3VB6A 3JZ1B 5DG6A 5LPEA 2VNTA 1T7CA 1TFXA 2R2MB 3KCGH 3CENA 1FLEE 3LDXH 2ZGCA 1TBZH 3NZIA 2C8WB 1A7SA 4YOGA 1YCPK 5CHAC 1CT0E 1SC8U 1O35A 2QF0A 3M5OA 1UVTH 4E7RG 4K1TA 3O8DA 2W7UA 2A5AA 4NWLA 4A1XA 3GDSA 1O3CA 1K1PA 1NTPA 1YF4A 3I78A 2BHGA 1SGEE 1AMHA 2Z6BD 4TPIZ 1O2KA 1MKWH 1ZYOA 5TJXA 5SGAE 1ARBA 2F9BH 2C8XB 1OWDA 1ZMJA 2ZWLH 1YC0A 1DLEA 2JH6D 4RKOB 3FFGA 2BY7X 3B9FH 1A61H 1A5GH 2JKHA 1T8MA 2WPHS 1O3DA 2RA0A 1TX6A 1GBFA 1HGTH 1O3EA 1MH0A 1FY4A 1A3BH 1INCA 2VIVA 1MBQA 2GT7A 3SUGA 5T6FA 4NIXA 3P8OA 1IQNA 3ZVDA 2HGTH 1RIWB 2Q6GA 1GMCG 2W3KA 2ANKH 4MNYA 1GBCA 2WINI 5E8EH 1P57B 1O3PB 2F91A 1AB9B 4ZKNU 3IWMA 4QT8C 1UHBA 2J34A 3V13A 2GD4B 3BG4B 2B0FA 3ATMA 5DGJA 4X8TH 2FYQA 1F92A 1BMLA 3VGCB 3URCA 4CR5A 4Q7ZA 1L4ZA 1ZOMA 1ZJDA 4B71A 3SV7A 1O3OA 3H7OA 5FPTA 2VH0A 3RXQA 4YTAA 1OWIA 2AMPA 4E06H 4AYYB 1IQFA 2AEIH 5F03A 1C2HA 2GZ7A 2G4TA 1O2HA 1S81A 2TIOA 1YBWA 4FUGA 3SGQE 4AFSA 1AWHB 3LPRA 2G81E 3TGKE 4ZHMU 5JPMH 4AB8A 3EGKH 4X1NU 4CRDA 5DP8A 1TONA 1Y59T 1F5RA 5C3NA 3RM0H 1JBUH 1OP8A 5E2OA 2OXSA 4NSYA 1P12E 1PPEE 2A5IA 1VCPA 2FM2A 6LPRA 1W7XH 1MKXK 2P94A 1UTPA 2JH5D 4OGYA 4RKJB 1O2OA 1EB1H 3HKIB 3GY8A 3GY4A 4K5ZA 4GCHG 1QRWA 1BRUP 1C1OA 1DXPA 5CE1A 1OSSA 1D6RA 4ZHAA 3U8TH 2Y81A 2FESH 1GI7B 2PKAB 3T27A 3KN2A 1O0DH 1TMBH 2BDYA 1PFXC 4A6LA 2ZU5A 3AVZA 1SQOA 4B76A 1GVZA 1D9IA 2FOAA 2OD3B 4B1TA 2ODYB 3SNAA 4ABFA 4CH8B 4Y7AA 3RXMA 4XBCA 3NCLA 1MTSA 4BXWA 3BIVH 4KGAA 4MNWA 2OUAA 2CGAA 2ZFRH 2WPMS 1ELTA 2Y5HA 3V0XA 2J92A 1A5IA 4TY7A 2OP9A 4CR9A 1SMFE 1C2IA 3UNRA 1O5CB 1GJ8B 2FTMA 1C5RA 2J95A 3FP6E 3RUOA 1BTZA 1QJ7B 1QY6A 4KTUA 1NO9H 2H5CA 1EJAA 1CGJE 3SW2B 2PGQB 4K1SA 1BIOA 1O32A 1GHAG 1QL7A 1S0QA 1V2KT 2QA9E 1CA8B 3ZV9A 1O3FA 2ALVA 2FOFA 4NIVA 1SGCA 2BTCE 4OS1A 2A7HA 3MFJA 4FUBA 1IQIA 1TOMH 4KTCA 4AZ2B 3U8OH 4JZ1A 1HBTH 1EAUA 1HJAB 1EQ9A 3Q76A 4GSOA 1AZ8A 1TPSA 3SUFA 3G01A 2BB4A 4Q7YA 2A2XH 3TITA 1SGTA 1O31A 2FEQH 1DWDH 4INLA 1AE8H 3PM3A 1DSTA 2AERH 1ELDE 2G51A 4WH8A 1JXPA 1V2MT 1VGCC 1O3GA 2VJ1A 2AS9A 2HNTE 2NU0E 4YT6H 5EOKA 4MG3A 3A7TA 1HXFH 2ZA5A 1C5YB 3TH3H 1HAVB 3JZ2B 1P8VC 3LOXA 1YLDA 5F8XA 1JRTA 2WPIS 4X6OA 1G3DA 1CQQA 2H1UA 4JZIA 3SV9A 3RM2H 3NWUA 1V6DA 2PWXA 3UUZA 2UWLA 3LGWA 2AMQA 4WMDA 1NESE 3KGPA 1Z6EA 2ZFSA 3MU1A 4ZUHA 1O5AB 2Z94A 3MH6A 1A46H 2FS9A 5ABWA 2GVFA 4WVPE 1T8OA 2OBQA 1DPOA 5T6GA 1N6YA 1GJBB 4J2YB 1XX9A 3ZZ9A 1NRNH 5JBBS 1UTMA 3SGBE 3TJVA 5LPFA 2PHBA 2BXTH 2BY5X 2ZFTA 1YPHE 1C5TA 1H8DH 4ESTE 1EB2A 1Z7KA 2PSXA 2C8ZB 5A0BA 1TOCB 4ZXYH 2BDGA 1DXWA 1XUKA 2UWPA 4X8SH 2B7DH 3ZYDA 1T8NA 2GDDA 2Y7ZA 2ANMH 3W94A 1FN6A 1BRAA 1RTKA 1SGDE 1C5SA 1TPAE 1O3IA 1RIWC 3D23A 1HLTH 3FANA 2SGPE 4MDSA 4WWYA 1F5KU 3GICB 1MCTA 3Q3YA 2GCHF 2OBOA 1CT4E 1C2MA 1QJ1B 3RXUA 3SU1A 1U6QA 3ODDA 5B6OA 2CF9H 1BBRK 1OP2A 2C3SA 9LPRA 1IHTH 3BG4C 4NSVA 2FYRA 2G55A 2W7SA 3VGCC 1QURH 1FONA 5DPAA 1IQEA 1ZLRA 1O2ZA 1OWHA 1P2NA 1UVOA 3P6ZB 5DP3A 1XKAC 2ZZUH 3ZVGA 1P04A 3ZZ8A 4BXSA 1J14A 5JDUB 4FXGH 3TK5A 1KTTB 1QL9A 4ISHH 1WCZA 2ZQ1A 5EGMA 3M3TA 1XXDA 3ZZ5A 1AHTH 3S0NA 1T4VH 3A80A 3ATWA 4A1VA 3U69H 2FODA 1EPTB 2DE9A 2GMTB 4B74A 1GVKB 2ZTXA 1HCGA 1CVWH 1EASA 1HB0B 5FHTA 2ZHQH 9ESTA 3SQHE 3PLBA 4GAWA 1K1LA 1S83A 1Q2WA 1ZMNA 1UTQA 1IQMA 1O3HA 3RC4A 1KLIH 5HYOA 1O3LA 4OS4A 3SI3H 2GKVE 2QXIA 3ZZAA 4A5TS 4D76A 3GDVA 2XBXA 7KMEH 4H42U 1GJ7B 1JIRA 3EYDA 2FZZA 4BAKB 2RDLA 3MNCA 3SI4H 3MO6A 2G52A 1W0ZU 1UK4A 4XOJA 3AW0A 1FAXA 3PTBA 1ZSJA 3MU5A 1TRMA 1QBNA 3RXCA 3ZV8A 3KHVA 1B0FA 1FIWA 2P95A 2ILNA 2G5NA 4ISOA 1C5ZB 1P2MA 3A7ZA 3BEUA 3RC5A 1HV7A 1P9SA 5EXNA 3SJKA 1L2EA 5L6NH 3QGNB 1FY3A 1CBWB 4I8JA 3A7YA 4GPGA 1XUFA 2Q6FA 4JYVH 5FXLA 3BF6H 1ANCA 1SGFG 3RXBA 2R3YA 1G37A 1QGFA 3E16B 3ZZCA 3O8CA 1FV9A 1HDTH 1ACBE 1C2LA 1QBOA 3QZRA 5GIBA 4ZHLU 1IQHA 4WH6A 1GHBG 1ELVA 3U1IB 2NU4E 4ABIA 1P2IA 2VB0A 4UFFH 4VGCB 2BDHA 1C1PA 4ZKSU 1KXCA 1F0TA 5HMAA 3T29A 2BDCA 2D1JA 2B9LA 3MO3A 4FUEA 1TB6H 4TWYA 2BOHB 2AIQA 2BY9X 1BBRE 5ESBA 1WQVH 3M7TA 2A4RA 1W12U 4HZHA 1CGHA 1GPZA 2HLCA 4NA7A 2KAIB 3HKJB 3LGUA 1LHDH 3L33A 4I8LA 1SGNE 3ZZDA 4KP0A 4D9RA 1OS8A 1E36B 1O2NA 4ZKOU 1BT7A 4A1TA 2XCNA 4YZUA 1GI1A 1TRNA 1FDPA 2ZGHA 4FUJA 2WPKS 1QA7A 3UY9A 4WF8A 1GBIA 2ZEBA 1H9HE 1QCPA 2D2DA 5DK1A 3GCHB 4MVNA 1P09A 4WXVA 2FXRA 3NKKA 2BLVA 4JK5A 1CHOG 1LMWB 2R0KA 1KDQB 1P2JA 3Q77A 3SU3A 3PTNA 1UVUH 2BOKA 3RXGA 1BMMH 2A7CA 3BV9B 3MYWA 4INHA 2C4FH 3P8NA 1TGNA 3PB1E 2QV1A 3LC5A 3MU0A 1VITF 2AFQB 1QBVH 1YCPH 1ZHPA 4NZQA 1GI3A 1C9TA 1V2JT 1ANEA 1DS2E 1EUFA 2HNTC 3RXFA 3TH2H 4IBLH 5DP6A 4GHQA 1ELCA 3ESTA 3BTTE 1K1JA 2ZGBH 2HPQH 2STAE 3ATIA 2O8TA 1C2JA 3A83A 6ESTA 2ZHFH 1NPMA 1ZRBA 3P8FA 4THNH 4OS6A 1LVOA 3RMNH 1GDNA 1PPHE 1UTKA 3GCNA 4UEHH 2BD4A 1QQ4A 2PKSB 2ZFPH 1OKXA 2PSYA 3UWIA 2ZFFH 2ZDNA 2CF8H 4H6TA 3TNSA 3UR9A 4YT7H 1O3JA 1BTWA 2OINA 2XTTB 4JZEH 5C5NA 3U8RH 4YLUA 3ZYEA 2WPLS 2ZPQA 1L1NA 3TGJE 5GWZA 1ZZZA 1DWBH 4UFEH 1O2SA 2OTVA 4I8KA 3F9GA 3ZZ6A 4NIYA 3C1KA 4YOIA 1Y3YA 1GBDA 3S7HB 1DUAA 5HM9A 1V2LT 3TIUA 1SGIB 4X6PA 4DT7B 3VB5A 3P95A 3HATH 4J1YA 3RU4D 5GCHF 4NA8A 2BZ6H 1L1GA 2G4UA 3QGJA 3CS0A 1SLUB 2Z3CA 3T25A 2VVUA 4DURA 5FCKA 3PROA 3O8BA 6GCHG 1IQGA 4XE4A 5A8YA 2GMTC 3EA9A 1Z71A 1T8LA 3D62A 3PO1C 1MTNB 2JH0D 2ZPSA 3MWIU 2FTLE 3PV4A 4X2WA 1HJ8A 4INKA 2ODQA 2ZP0H 1RXPA 1ZGIA 3RXPA 2FS8A 3SBKA 3T5FH 1OOKB 1T4UH 1F2SE 2Y5FA 1EAWA 2J38A 2F9PA 5I46H 1MKXH 4MTBA 3MNBA 4WY3A 1VZQH 4FUHA 1CO7E 1O36A 4CRBA 3P70B 1S82A 1XUIA 2WV4A 4AFZA 1OPHB 2R9PA 2FOMB 2BX3A 4HTCH 1J9CH 1ID5H 1ZHRA 3RC6A 1GL0E 1O30A 1BTUA 2IPHA 1THRH 2SGEE 4X0WU 2RA3A 3GYLB 1RS0A 1SFIA 1TNHA 1GMDF 4DGJA 3U98H 2UUKB 5AF9H 1O39A 2P8OB 1C5NH 3PMJA 2XRCA 1OWJA 4I8GA 3SNDA 5ETXA 1GGDB 3A8BA 2GTBA 4H6SB 3RXTA 3EA7A 5FCRA 1DUEA 1O2UA 4K1EA 3ZZ3A 1CBWC 2Z3EA 1C2DA 1THPB 2BX4A 2V35A 2WYJA 2Z9GA 5FX6A 5GJ4B 2NU1E 4IN1A 1Y5BT 3OY6U 4GVUA 2QC2A 1G2MA 1OYTH 3AASA 4H4FA 5AVDA 3ENSB 2KAIA 2XBVA 3F9EA 1AVWA 1FNIA 3RLWH 5A8ZA 2O8WA 4VGCC 2QY0B 2A0QB 1WYKA 2VIQA 3E3TA 1LKAA 1TGCA 1A0HB 1AFQB 1HAOH 1LPZB 4MNVA 1MU6B 1ELGA 1SOTA 1C2KA 1BQYA 3F6UH 4ABBA 1K1NA 3UOPA 3MO9A 1FI8A 1HAIH 4TYDA 2Z9LA 4F49A 3QWCH 6CHAC 4U2WA 1OYQA 3GCTF 1Y5AT 2ZNKH 2HRVA 1ANBA 4JCNA 1O5GH 4Y79A 1UCYK 3HK3B 1SVPA 2J4IA 2WPJS 2ZQ2A 3SU6A 4X2XA 2CV3A 2VVVA 1TE0A 2P3UB 2ZCHP 4MLFB 3FP7E 1NS3A 3GCHC 1DANH 8KME2 4FUDA 1O2TA 1FUJA 2VGCB 1DM4B 2B5TB 3LGYA 3A81A 2Z3DA 1GDQA 4JZFH 4PROA 3I29A 5L2YH 1C1WH 1G9IE 2UUFB 3KQDA 1ELEE 1ORFA 4DJZB 1VCQA 2Y80A 5I25A 1LVMA 1LQDB 1OP0A 3RXRA 4AG2A 1RJXB 1QRXA 4NA9H 5LH8A 4CBNA 1V2QT 3TNTA 3K6YA 1TWXB 3QLPH 1WTHD 3TU7H 2QF3A 2ZI2H 1PQ8A 4E05H 2BD3A 4U30A 1S6HA 4NCYA 2FWWA 1KIGH 2PTCE 1GI5A 2Z9KA 3MTYA 3RXOA 5PTPA 3OTJE 4U01A 2H9EH 1LVBA 3CP7A 5LPRA 1GI6A 4XSKU 4BAOB 2HWLB 1GMHG 1TMTH 2FIRH 2PKSC 3DUXH 2VWLA 4DCDA 1F5LA 1KLTA 4Y8YA 3M37A 4JZDH 7ESTE 5A0AE 5JB9S 2ZDAH 4BTUB 4DIIH 1W7GH 3B8JA 1V2PT 1TAWA 1A0JA 3GISB 2P16A 4CHAB 1EJMA 4WMEA 4DY7B 1TRYA 1S0RA 2R3UA 1SR5C 1BMNH 1BBRH 4IC5A 5IYTA 4A92A 1TNKA 1SQTA 3UNSA 5A2MH 3SV6A 3SU2A 1B7XB 2WV5A 4DG4A 3MMGA 3T26A 2TGDA 3IITA 2FPZA 3BSQA 1GMCF 4ABAA 1PPFE 1WBGB 3S9AA 1C1NA 3A87A 3E0PB 1GCTB 1MTNC 1UK2A 4Y10E 4JYUH 4I33A 1AN1E 3L3TA 3BIUH 4D8NA 4K8BA 4LOYH 1TGBA 1O2RA 1FY1A 1MZAA 3QN7A 4R0IA 2VIWA 3BN9A 4K60A 3MHWU 2ALPA 4JK6A 2DE8A 1TGSZ 2TPIZ 1UCYE 1FPHH 2O9QA 4UDWH 1LHCH 4IMZA 1QHRB 4GLYA 3SJ9A 1O3BA 2I6QA 2M5TA 2ZC9H 4YO9A 2XCFA 4I7YH 2OLGA 1K22H 3ZVCA 3FZDA 5G4BA 3A85A 1MCVA 3TVJB 2VH6A 1GBKA 2Y82A 1JWTA 1O5EH 3MH7A 1CHGA 2AH4X 2ZDLA 4B73A 3BG8A 2RCEA 5FBIA 4X2VA 1OWEA 5EXLA 1ELFA 2P8OC 5FAHA 1A4WH 1F0UA 1GGDC 1K1IA 1SBWA 2ZU2A 1AB9C 4GCHF 4BAHB 2GZ9A 5JBAS 4Y11E 1OWKA 3LKWA 5FX5A 4X1PU 1J16A 1GBMA 1BUIA 1DOJA 1YP9A 2P93A 3FP8E 1ZPZA 1ELAA 1DICA 2ODPA 3L6PA 1UJ1A 1D3TB 1MUEB 2YNBA 1MQ6A 4DVAU 2F9NA 2ZHWH 2FP7B 2TGTA 3PYHA 1NRPH 1QB6A 4ISNA 1HFDA 2Z7FE 3F9HA 2XW9A 3IG6B 1AFQC 1AQ7A 1P03A 1AZZA 4LXBH 2BDIA 7GCHG 1FMGA 4FVDA 1AO5A 1F7ZA 4B2BA 2I6SA 1QIXB 4I31A 3GYMA 1GI9B 1MAXA 2Z9JA 1DY8A 3W95A 1AU8A 5C67A 1GWAA 1O2QA 1FY5A 5C20A 3QX5H 2PKAA 3RXVA 4OS5A 2SGQE 1GHAF 4X6NA 5FPYA 1IOEA 4AFQA 3ZVAA 1SFQB 3UR6A 1YGCH 5C2ZA 3GY5A 3S9CA 2VGCC 2BVRH 2B8OH 3MU4A 1E35B 1ZRKA 2PR3A 2FX4A 3GY6A 2BLWA 1G3BA 1ZSLA 3Q00A 1BTHH 1S84A 1KYNA 2FOHA 3V12A 1TNIA 1CE5A 4F4OC 2EI7A 1G30B 1CA0B 3KQBA 1GBHA 3E90B 2BD7A 3ZVFA 1IHSH 1Y3VA 2C8YB 2A31A 3SZNA 3A7VA 1EZXC 2FO9A 3E1XB 4LK4A 1EKBB 2O8UA 5DP5A 1W14U 5C5OA 1PQ7A 2NU2E 1EOJA 1RTLA 3EDXB 4TPYA 1NY22 3K2UA 8GCHF 3OY5U 2A2QH 1QL8A 2BXUH 1HRTH 7LPRA 1IQJA 1NT1A 2AYWA 3ZZ4A 1V2NT 3VEQB 1ETRH 3S7KB 3AAVA 1PQAA 4BTTB 3BTKE 2F3CE 2XWBI 2EC9H 1FJSA 1UMAH 1YPMH 1VR1H 4UE7H 3S9BA 2W5EA 1C1RA 3RLYH 3PMAB 1XUHA 2ANWA 1CGIE 3DT0H 3M7QA 3RXEA 1Z8IB 4ZH8A 3PMHB 2BM2A 1K2I1 1BRCE 3BTEE 3M5NA 5A0CA 1B0EA 5BPEA 4CHAC 1HJAC 1KSNA 3P8GA 1H1BA 1PPGE 3MI4A 2FI5E 1G2LA 4OS7A 4ABHA 1HAVA 1SGPE 5EU8A 4UONA 5C1YA 1O2VA 1FQ3A 2R0LA 4YLQH 1N8OB 2AIPA 1C5WB 1O2XA 1PYTC 1ZGVA 1AUTC 1SGFA 5FBEA 3RXHA 1UHBB 3SQEE 1WUNH 3SU0A 2UUJB 2WUBA 3ZVBA 4CRFA 3VXEH 4NG9H 1QA0A 3K9XB 1N6XA 4DOQA 5DJ7A 2SGAA 1V2TT 5K0HA 5E0JA 1ZPBA 5AFZH 4ABDA 1GCTC 1C1QA 5F8ZA 1GJDB 2P3TB 3SUDA 1TA6A 4Y8ZA 5AFYH 1EAIA 1L1JA 1BDAA 2ZGJA 3RMLH 1XM1A 1GMDG 2ZDMA 2ZF0H 4X8UH 5DO4H 1G3CA 1SGYE 4UFGH 1GI0A 2OC7A 2BDAA 1ELBA 2FLRH 1P2OA 1GJ6A 2JETB 1SOZA 2EI6A 2HVXA 5DP7A 1KXEA 1ESAA 3M5MA 1MD7A 4X1QU 3E0NB 3RXLA 4UFDH 3M3VA 1GG6B 1V2OT 4X1SU 2A32A 1SHHB 1Y3UA 1N1LA 1C5VA 4YESB 2C90B 4B2CA 3CS7A 3KIDU 3KQCA 2FDAA 1A1RA 2A4OA 4NZLA 1A2CH 3HK6B 3Q3KA 1O34A 1XXFA 2GZ8A 1P05A 4MPUA 2V0BA 3A8AA 3F9FA 2OC1A 4Q7XA 1HAYB 3M36A 1EZQA 1AI8H 3SNBA 1BA8B 2BY8X 1WTGH 1EZUC 1O33A 4AGJA 2XBWA 5T3HA 1KLJH 2ZU3A 2ZTYA 3LU9B 1YPGH 3WY8A 5J4SA 4E7NA 3SHAH 3TJUA 1S6FA 2PLXA 1BJUA 2OC0A 4K8YA 4XFQA 5E0HA 4XDEA 4FUIA 1Z8RA 4CREA 4K3JA 1TNJA 2O8MA 1LHEH 1O2PA 1P02A 1VCWA 3ELAH 1HYLA 3U9AH 4I32A 1EPTA 2XC0A 3KL6A 1QB1A 2RG3A 2SGFE 2ZG0H 3SJ8A 4TY6A 1W0YH 1KTSB 1OX1A 1C1SA 1O37A 1RTFB 2QXGA 1C5LH 2QN5T 2XWAA 2ZPRA 1ARCA 2A1DB 5HM2A 1D3DB 1C1VH 1EZSC 1O3AA 3SGAE 1B5GH 4XBBA 1A5HA 1G36A 1ESBA 2J9NA 3E6PH 1EPTC 2P3FH 3GY7A 4FUFA 5K7RA 1PJPA 2VIOA 1GI4A 1V3XA 1VGCB 3PLKA 2H6MA 2V3OH 2R2WU 3GDUA 1Z8GA 1ZSKA 3SNCA 1WAYB 5F8TA 3EQ0H 5A8XA 1G3EA 2VU8E 1TBRH 1YCPM 1GHBF 4FUCA 1V2UT 2FMJA 3SHCH 1K9OE 1EX3A 5EW2H 1UCYH 4ZKRU 4AX9H 1EATA 2SFAA 1YLCA 1GHXH 1NFXA 1NRRH 4JYTA 3QTVH 2EEKA 4ISIH 2HNTF 3K65B 1YYY1 4Y0ZE 1C5UA 1TLDA 1P01A 2ANYA 1TX8A 2BVXH 1IQKA 1CA0C 4GUXA 2GX4A 1JOUB 4Z0KA 1K1MA 1HIAB 2ZIQH 2VIDA 2BY6X 5L30H 1Z8JB 1LVYA 3HPTB 4ASHA 1FPCH 5EPNA 4Y8XA 3E91A 1O5BB 4SGBE 3T28A 1J8AA 5E0GA 3UQVA 1LDTT 2VIPA 2GCTB 3RDZA 1BTYA 1UVPA 1RD3B 1GBBA 1AD8H 1C4V2 1CHOF 4TWWA 3BTFE 1TABE 4WJG2 3A82A 4AGKA 3M5LA 1K1OA 1BZXE 2QIQA 3Q3XA 3BTDE 2FOGA 1BJVA 1SLWB 1Z1IA 1LKBA 1XVMA 2EA3A 3I77A 1O2GH 4X8VH 2H9TH 1ZTKA 1ZJKA 3SORA 1NFUA 5CMXH 4BOHA 2G5VA 5EXMA 1BRBE 1CT2E 4NFFA 4DW2U 1GVLA 3ATKA 4BANB 2EI8A 3KNXA 4OGXA 2CHAB 1MAYA 3ODFA 2AMDA 3HGPA 1VJ9U 1TPOA 2D8WA 1N8OC 1XMNB 3O8RA 2PUQH 1S85A 1MZDA 2BVSH 1DDJA 1E0FD 1AUJA 1KDQA 3DA9B 1NFWA 1RFNA 2BD5A 3BEFB 2FOBA 1Z6JH 1HJ9A 1JIMA 2OQ5A 1LTOA 1MD8A 2SNWA 2V3HH 5JBTA 1D3PB 1WU1A 2F9UA 1ABIH 1Y3WA 2CXVA 2XC5A 4OS2A 1W3CA 3QO6A 1MTWA 1K28D 4KTSA 1C2FA 1XUJA 1O2WA 1GBEA 3UNQA 5JYIA 4AFUA 1AE5A 1OXGA 3RXKA 4B75A 2PFEA 4MPWA 1MKWK 4IGDA 2IJOB 5GDSH 1DITH 4Q80A 4AB9A 1UTLM 3FAOA 1BTPA 1HPGA 1P11E 2YOLA 4IC6A 1F0RA 2GCHG 1Q31A 2JETC 1AVGH 3A7WA 1QQUA 3H5CB 1H4WA
chains in the Genus database with same CATH superfamily
4K2YA 1WV7H 4Y71A 1AVXA 4M7GA 2SGDE 1FIZA 1GG6C 2A7JA 2ESTE 1LPGB 2A5KA 2XXLA 1FXYA 1WQSA 3D49H 1X7AC 1GJ5H 1WOFA 2QCYA 1ZTLA 3UWJH 2F9VA 1TIOA 6GCHF 1V2RT 3SOSA 4A7IB 2D26C 1GHZA 1C1UH 2AGIX 1TYNA 4I86A 4MNXA 3ATLA 1XVOA 1NU9A 1D6WA 3F1SB 1KXAA 1BOQA 1K21H 1L0ZA 2UUYA 4HI3A 2BMGB 1Z1JA 2BQ6B 3V7TA 1FZZA 1TQ0B 5GPIB 2CMYA 4FU9A 2FOCA 2J2UA 1GBJA 2C93B 1NBMD 3SU5A 4IMQA 1H9LB 4JMYA 3PMBB 5HXFA 1EJNA 1O2MA 1QR3E 1AKSB 2BLQA 4O97A 1FAKH 3GCOA 1SQAA 3DSPA 3OSYA 1DWEH 2BD9A 1W10U 2AGEX 5LGOA 1T31A 1EXFA 1SSXA 3QUMP 3SJIA 3A86A 4FU7A 4ZMAH 1SHYA 3BTWE 4X1RU 5T6DA 1MTVA 1NRQH 5BRRE 2QYIA 1YPLH 4MQAA 1AFEH 1DSUA 2TRMA 4CRAA 2BD2A 1H8IH 1YWUA 3H7TA 2WYGA 1J17T 3OYPA 4NFEA 3SO3A 1C1TA 5A09A 1O38A 3KQEA 4BAMB 3STJA 8LPRA 2NWNA 2P59A 2Q6DA 1LO6A 3A84A 2IJD1 2CN0H 5GXPA 1FY8E 3TPIZ 1IAUA 4O9VA 4P02A 2DUCA 2W26A 1GI8B 3UOUA 1QRZA 2UWOA 1C1MA 2A4GA 2GV7A 4FVBA 2WUCA 3VB3A 3KF2A 3UFAA 3EAJA 3QZQA 8ESTE 2FLBH 3MNXA 8GCHG 3NRLA 1LHGH 3TH4H 4DT4A 3KEEA 5EQQA 1BHXF 4F55A 2F9OA 2QE7D 1C4Y2 1HAHH 1HIAA 3KYFA 4X6MA 1DLKB 1ETSH 1ZHMA 3RXAA 1AGJA 1HXEH 1C4U2 3QK1A 1AY6H 1NC6A 2IN2A 4Q2KA 3UREA 3T2NA 2BYAX 4CBOA 3RXJA 5E2PA 2VVCA 4BTIB 3U1JB 4RSPA 1ANDA 3NPSA 4I8HA 1E38B 1XUGA 2AGGX 3DD2H 1EP5A 1YM0A 4O03A 1ZR0A 1MTUA 1UVSH 4GHTA 3ZZBA 2H9HA 1GHYH 1UO6A 1C5XB 2NU3E 4XBDA 3QDZB 3RXDA 1NU7B 1F0SA 1IQLA 3M7UA 1UTOA 3STIA 1G32B 4AOQA 4Y0YE 2OCVB 3MU8A 3LH3A 4NWKA 1PYTD 5KECA 2ASUB 3SUEA 2BZAA 3RXIA 1P10A 2GCTC 3TK9A 4YOJA 2J94A 1AWFH 5F6MA 3RU4T 3R3GB 3LJOA 3LT3A 1VJAU 5GNDA 3LJJA 3MOCA 4KKDA 3MH4A 4SGAE 4UD9H 3UTUH 2LPRA 3URDA 3MH5A 1RGQA 2FI3E 3A8DA 3UQOA 1C5QA 4ABGA 1PPCE 4KELA 1PQ5A 1YKTA 3UB0A 1BITA 1Y8TA 1YPKH 1HAXB 1ZPCA 2Q1JA 2W3IA 4ISLA 4CH2B 4D7GA 3NUMA 1O2JA 2TBSA 2CHAC 3EA8A 1ZMLA 5EG4A 1GBLA 1L4DA 2HALA 3TLOA 3F68H 3LC3A 5TCAA 2PTNA 1DVAH 4CRGA 4IS5A 1GCDA 5EQRA 2G8TA 1WXRA 3RP2A 1CSOE 3DFLA 3A89A 1VITG 2ZCKP 1GMHF 2BDBA 5ESTE 2QGRA 3D65E 1P06A 1SG8B 3M61U 1W13U 1DE7H 1XKBC 2A45B 3SV2H 2V6NA 3PRDA 5EW1H 1GHWH 2K1QA 4FU8A 4Q4LA 5JBCS 1T32A 1NROH 1W0JD 4YM9A 1P3CA 1Q3XA 1GJ9B 3SN8A 1JRSA 2QXJA 2VWMA 2WPDD 2LNCA 2XNIA 3PO1B 2PW8H 2W6JD 4HGCA 1W2KH 4OM9A 2OC8A 4ZAEA 4RN6A 3E8LA 3TGIE 5CHAB 2ZU1A 1P2QA 3VPKA 2GP9B 5DKMA 1HUTH 1ETTH 3AW1A 5B6LA 2SNVA 3VXFH 2Y7XA 2ZECA 1NZQH 4R8TB 5AHGH 2Y6TA 3DHKH 3QTOH 4WXIA 1NFYA 2PUXB 1A3EH 5JB8S 1P0SH 1TX7A 3C27B 5C1UA 1DX5M 2ZDVH 1EOLA 2THFB 3UPEA 4AG1A 1A0LA 3M3SA 4O3UA 1ZTJA 4X2YA 1QTFA 3MQKC 1GBAA 1P2KA 1AKSA 2KCAA 3MNSA 3UIRA 5GCHG 1DWCH 1UTNA 4LZ4B 2CJIA 2IOTA 4IN2A 4ZXXH 3BTGE 1EAXA 3TJOA 2ZDKA 2BQWB 1Y3XA 2YNAA 1SPJA 1W11U 3SV8A 3A8CA 1TNGA 2TGPZ 1D4PB 3LGIA 4K69A 2O8LA 1TQ7B 3P17H 1UTJA 4DIHH 1NRSH 1JMOH 5J4QA 1GL1A 1ABJH 1GJ4H 1LPKB 2ZO3H 3BTQE 1E37B 3LIWA 3GY2A 3RMOH 2F83A 2G00A 1GJCB 3N7OA 4BAQB 3ZZ7A 1SLXB 2RDEA 1J15A 3GOVB 4ABJA 1GHVH 2TGAA 3LGTA 1MQ5A 1YPEH 4Y76A 2STBE 2VWOA 3LONA 3A88A 4AORA 1LHFH 2OQUA 3WWFA 2ZFQH 1O2IA 1WSSH 1H9IE 1HAZB 1V2ST 5EQSA 1UK3A 3SNEA 1BCUH 1BMAA 3FVFB 5C1XA 1KY9A 3RU4E 2GDEH 1O2YA 4U32A 1H8HD 4Z6AH 1QZ8A 5DP4A 1K0HA 2W6ID 1O3NA 1NM6A 1VITH 1MMJN 6CHAB 2GV6A 3OU0A 4NGAH 1PPZA 4AN7A 3NXPA 3AAUA 3RXSA 4D9QA 1GJAB 1KXFA 1SI5H 3BTHE 2XBYA 1GBTA 1DFPA 2FI4E 1E34B 1MU8B 1NN6A 1O5DH 2FX6A 1HAPH 1C2EA 2AHME 2VWNA 3VFEA 1THSH 1Y5UT 2XYAA 3ZVEA 1S5SA 2BD8A 2ZU4A 1V2WT 1KXBA 1D3QB 7GCHF 5TCCA 1RRKA 1MBMA 5EODA 1GDUA 4NIWA 1DY9A 1GI2A 4B6EA 1V2VT 1PPBH 1SLVB 1QNJA 3P92A 3RMMH 2QXHA 5DP9A 4Y6DA 3B23B 4ABEA 2ZKSA 2BLOA 5EPYA 1BHXB 2FOEA 1O5FH 4ZROA 4O3TA 1QFKH 1TALA 3S69A 2J98B 1W8BH 1O3KA 1LQEA 3HGNA 3M35A 3VB7A 3LH1A 1AIXH 1QB9A 1DT2A 1O3MA 4CRCA 4LZ1H 3OX7U 3DFJA 3BTME 5L2ZH 1C9PA 1M9UA 4MPVA 1HNEE 3TK6A 1YPJH 2ZTZA 1SGQE 3A7XA 1SL3A 1LCYA 2GT8A 5IDKA 1C5MD 2ZCLP 1ESTA 1O2LA 1C2GA 3GCTG 2XNDD 2PV9B 2ZHEH 1C5OH 2WSSD 4BNRA 2H5DA 2HOBA 1KXDA 2XC4A 1P9UA 3LGVA 4HFPB 1CU1A 1SB1H 2ZGXH 5FPSA 3PLPA 3GY3A 4D7FA 2Z9IA 3R0FA 3T62A 3PWCA 5HGGA 3PWBA 1BTXA 1TGTA 3BEIB 2VINA 3TJNA 1TA2A 1TPPA 1C5PA 1YPHC 3EE7A 3NK8A 2BQ7B 2H2ZA 2ZHDA 4MPXA 3EE0B 2Y5GA 2GGVB 2HPPH 1BB0B 1TNLA 3SJOA 3K6ZA 4WMFA 2A4QA 4ACBA 4AYVB 1FN8A 1SGRE 1TMUH 3SU4A 1HAGE 2QAAA 4IW4E 1P3EA 3V3MA 3VB4A 2ULLA 4B2AA 3ITIA 1EP6A 3FZZA 4Y7BA 5H4IB 1TBQH 2PGBB 1QJ6B 3VB6A 3JZ1B 5DG6A 5LPEA 2VNTA 1T7CA 1TFXA 2R2MB 3KCGH 3CENA 1FLEE 3LDXH 1E1RD 2ZGCA 4P00A 1TBZH 3NZIA 2C8WB 1A7SA 4YOGA 1YCPK 5CHAC 1CT0E 1SC8U 1O35A 2QF0A 3M5OA 1UVTH 4E7RG 4K1TA 3O8DA 2W7UA 2A5AA 4NWLA 4A1XA 3GDSA 1O3CA 1K1PA 1NTPA 1YF4A 3I78A 2BHGA 1SGEE 1AMHA 2Z6BD 4TPIZ 1O2KA 1MKWH 1ZYOA 5TJXA 5SGAE 1ARBA 2F9BH 2C8XB 1OWDA 1ZMJA 2ZWLH 1YC0A 1DLEA 2JH6D 4RKOB 3FFGA 2BY7X 2KX4A 3B9FH 1A61H 1A5GH 2JKHA 2K0QA 1T8MA 2WPHS 1O3DA 2RA0A 1TX6A 1GBFA 1HGTH 1O3EA 2YMSB 1MH0A 1FY4A 1A3BH 1INCA 2VIVA 1MBQA 2GT7A 3SUGA 5T6FA 4NIXA 3P8OA 1IQNA 3ZVDA 2HGTH 1RIWB 2Q6GA 1GMCG 2W3KA 2ANKH 4MNYA 1GBCA 2WINI 5E8EH 1P57B 1O3PB 2F91A 1AB9B 4ZKNU 3IWMA 4QT8C 1UHBA 2J34A 3V13A 2GD4B 3BG4B 2B0FA 3ATMA 5DGJA 4X8TH 2FYQA 1F92A 1BMLA 3VGCB 3URCA 4CR5A 4Q7ZA 1L4ZA 1ZOMA 1ZJDA 4B71A 3SV7A 1O3OA 1OHHD 2WV9A 3H7OA 5FPTA 2VH0A 3RXQA 4YTAA 1OWIA 2AMPA 4E06H 4AYYB 1IQFA 2AEIH 5F03A 1C2HA 2GZ7A 2G4TA 1O2HA 1S81A 2TIOA 1YBWA 4FUGA 3SGQE 4AFSA 1AWHB 3LPRA 2G81E 3TGKE 4ZHMU 5JPMH 4AB8A 3EGKH 4X1NU 4CRDA 5DP8A 1TONA 1Y59T 1F5RA 5C3NA 3OEHD 3RM0H 1JBUH 1OP8A 5E2OA 2OXSA 4NSYA 1P12E 1PPEE 2A5IA 3PRBA 4ZCNA 1VCPA 2FM2A 6LPRA 1W7XH 1MKXK 2P94A 1UTPA 2JH5D 4OGYA 4RKJB 1O2OA 1EB1H 3HKIB 3GY8A 3GY4A 4K5ZA 2J98A 4GCHG 1QRWA 1BRUP 1C1OA 1DXPA 5CE1A 1OSSA 1D6RA 4ZHAA 3U8TH 2Y81A 2FESH 2HVYB 1GI7B 2PKAB 3T27A 3KN2A 1O0DH 1TMBH 2BDYA 1PFXC 4A6LA 2ZU5A 3AVZA 1SQOA 4B76A 1GVZA 1D9IA 2FOAA 2OD3B 4B1TA 2ODYB 3CNRA 3SNAA 4ABFA 4CH8B 4Y7AA 3RXMA 4XBCA 3NCLA 1MTSA 4BXWA 3BIVH 4KGAA 4MNWA 2OUAA 2CGAA 2ZFRH 2WPMS 1ELTA 2Y5HA 3V0XA 2J92A 1A5IA 4TY7A 2OP9A 4CR9A 1SMFE 1C2IA 3UNRA 1O5CB 5KGOA 1GJ8B 2FTMA 1C5RA 2J95A 3FP6E 3RUOA 1BTZA 1QJ7B 1QY6A 4KTUA 1NO9H 2H5CA 1EJAA 1CGJE 3SW2B 2PGQB 4K1SA 1BIOA 1O32A 1GHAG 1QL7A 1S0QA 1V2KT 2LELA 2QA9E 1CA8B 3ZV9A 1O3FA 2ALVA 2FOFA 4NIVA 1SGCA 2BTCE 4OS1A 2A7HA 3MFJA 4FUBA 1IQIA 1TOMH 5IK2D 4KTCA 4AZ2B 3U8OH 4JZ1A 1HBTH 1EAUA 1HJAB 1EQ9A 3Q76A 4GSOA 1AZ8A 1TPSA 3SUFA 3G01A 2BB4A 4Q7YA 2A2XH 3TITA 1SGTA 1O31A 2FEQH 1DWDH 4INLA 1AE8H 3PM3A 1DSTA 2AERH 1ELDE 2G51A 4WH8A 1JXPA 2JDID 1V2MT 1VGCC 1O3GA 2VJ1A 2AS9A 2HNTE 2NU0E 4YT6H 5EOKA 4MG3A 3A7TA 1HXFH 2ZA5A 1C5YB 3TH3H 1HAVB 3JZ2B 1P8VC 3LOXA 1YLDA 5F8XA 4TT3D 2KZ4A 1JRTA 2WPIS 4X6OA 1G3DA 1CQQA 2H1UA 4JZIA 3SV9A 3RM2H 3NWUA 1V6DA 2PWXA 3UUZA 2UWLA 3LGWA 3DSOA 2AMQA 4WMDA 1NESE 3KGPA 1Z6EA 2ZFSA 3MU1A 4ZUHA 1O5AB 2Z94A 3MH6A 1A46H 2FS9A 5ABWA 2GVFA 4WVPE 1T8OA 2OBQA 1DPOA 5T6GA 1N6YA 1H8ED 1GJBB 4J2YB 1XX9A 4XD7D 1NRNH 5JBBS 3ZZ9A 1UTMA 3SGBE 3TJVA 5LPFA 2PHBA 2BXTH 2BY5X 2ZFTA 1YPHE 1C5TA 1H8DH 4ESTE 1EB2A 1Z7KA 2PSXA 2YMSC 2C8ZB 5A0BA 1TOCB 4ZXYH 2BDGA 1DXWA 1XUKA 2UWPA 4X8SH 2B7DH 3ZYDA 1T8NA 2GDDA 2Y7ZA 2ANMH 3W94A 1FN6A 1BRAA 1RTKA 1SGDE 1C5SA 1TPAE 1O3IA 1RIWC 3D23A 1HLTH 3FANA 2SGPE 4MDSA 4WWYA 1F5KU 3GICB 1MCTA 3Q3YA 2GCHF 2OBOA 1CT4E 1C2MA 2KCPA 1QJ1B 3OAAD 3RXUA 3SU1A 1U6QA 3ODDA 5B6OA 2CF9H 1BBRK 1OP2A 2C3SA 3F2HA 9LPRA 1IHTH 3BG4C 4NSVA 2FYRA 2G55A 2W7SA 3VGCC 3DSGA 1QURH 1FONA 5DPAA 1IQEA 1ZLRA 1O2ZA 1OWHA 1P2NA 1UVOA 3P6ZB 3SYJA 5DP3A 1XKAC 2JJ1D 2ZZUH 1P04A 3ZVGA 3ZZ8A 4BXSA 1J14A 5JDUB 4FXGH 3TK5A 1KTTB 1QL9A 4ISHH 1WCZA 2ZQ1A 5EGMA 3M3TA 1XXDA 3ZZ5A 1AHTH 3S0NA 1T4VH 3A80A 1VKYA 3ATWA 4A1VA 3F2FA 3U69H 2FODA 1EPTB 2DE9A 2GMTB 4B74A 1GVKB 2ZTXA 1HCGA 1CVWH 1EASA 1HB0B 5FHTA 2ZHQH 9ESTA 3SQHE 3PLBA 4GAWA 1K1LA 1S83A 1Q2WA 1ZMNA 1UTQA 1IQMA 1O3HA 3RC4A 5HIYA 1KLIH 5HYOA 1O3LA 4OS4A 3SI3H 2GKVE 2QXIA 3ZZAA 4A5TS 4D76A 3PV2A 3GDVA 2XBXA 7KMEH 4H42U 1GJ7B 1JIRA 3EYDA 2FZZA 3GS9A 5EJZA 2RDLA 3MNCA 4BAKB 3SI4H 3MO6A 2G52A 1W0ZU 1UK4A 4XOJA 3AW0A 1FAXA 3PTBA 1ZSJA 3MU5A 1TRMA 1KMHB 1QBNA 2L6OA 3RXCA 3ZV8A 3KHVA 1B0FA 1FIWA 2P95A 2ILNA 2G5NA 4ISOA 1C5ZB 1P2MA 3A7ZA 3BEUA 3RC5A 1HV7A 2RFKC 3FOAA 1P9SA 2L74A 5EXNA 3SJKA 1L2EA 5L6NH 3QGNB 1FY3A 3N7DA 1CBWB 4I8JA 3A7YA 5HIZA 4GPGA 1XUFA 2Q6FA 4JYVH 5FXLA 3BF6H 1ANCA 1SGFG 3RXBA 2R3YA 1G37A 1QGFA 3E16B 3ZZCA 3O8CA 1FV9A 1HDTH 1ACBE 1C2LA 1QBOA 3QZRA 5GIBA 4ZHLU 1IQHA 2KFWA 1GHBG 1ELVA 4WH6A 3U1IB 2NU4E 4ABIA 1P2IA 2VB0A 4UFFH 4VGCB 2BDHA 1C1PA 4ZKSU 1KXCA 1F0TA 2KCOA 5HMAA 3T29A 2BDCA 2D1JA 2B9LA 3MO3A 4FUEA 1TB6H 4TWYA 2BOHB 2AIQA 2BY9X 1BBRE 5ESBA 1WQVH 3M7TA 2A4RA 1W12U 4HZHA 1CGHA 1GPZA 2HLCA 4NA7A 2KAIB 3HKJB 3LGUA 1LHDH 3L33A 4I8LA 1SGNE 3ZZDA 4KP0A 4D9RA 1OS8A 1E36B 1O2NA 4ZKOU 1BT7A 1UW7A 4A1TA 2XCNA 1EFRD 4YZUA 1GI1A 1TRNA 1FDPA 2ZGHA 4FUJA 2WPKS 1QA7A 3UY9A 4WF8A 1GBIA 2ZEBA 1H9HE 1QCPA 2D2DA 5DK1A 4F48B 3GCHB 4MVNA 4RT0A 1P09A 4WXVA 2FXRA 3NKKA 3WW7A 2BLVA 4JK5A 1CHOG 1WDIA 1LMWB 2R0KA 1KDQB 1P2JA 3Q77A 3SU3A 3PTNA 1UVUH 2BOKA 3RXGA 1BMMH 2A7CA 3BV9B 3MYWA 4INHA 2C4FH 3P8NA 1TGNA 3PB1E 2QV1A 3LC5A 3MU0A 1VITF 2AFQB 1QBVH 1YCPH 1ZHPA 4NZQA 1GI3A 1C9TA 1V2JT 1ANEA 1DS2E 1EUFA 2HNTC 2F43B 3RXFA 3TH2H 4IBLH 5DP6A 4Z1MD 4GHQA 1ELCA 3ESTA 3BTTE 1K1JA 2ZGBH 2HPQH 2STAE 3ATIA 2O8TA 1C2JA 3A83A 6ESTA 2ZHFH 1NPMA 1ZRBA 3P8FA 4THNH 4RT1A 4OS6A 5FL7D 1LVOA 3RMNH 3PV5A 3OEED 1GDNA 1PPHE 1UTKA 3GCNA 4UEHH 2BD4A 1QQ4A 2PKSB 2ZFPH 1OKXA 2PSYA 3UWIA 2ZFFH 3FKSD 2ZDNA 2CF8H 3OTPA 4H6TA 3TNSA 3UR9A 4YT7H 1O3JA 1BTWA 2OINA 2XTTB 4JZEH 5C5NA 3U8RH 4YLUA 3ZYEA 2WPLS 2ZPQA 1L1NA 3TGJE 5GWZA 1ZZZA 1DWBH 4UFEH 1O2SA 5EJ1A 2OTVA 4I8KA 3F9GA 3ZZ6A 4NIYA 3C1KA 4YOIA 1Y3YA 1GBDA 3S7HB 1DUAA 2V7QD 5HM9A 1YLNA 1V2LT 3TIUA 1SGIB 4X6PA 4DT7B 4M9FA 3VB5A 3P95A 3HATH 4J1YA 2CK3D 3RU4D 5GCHF 4NA8A 2BZ6H 1L1GA 2G4UA 3QGJA 3CS0A 1SLUB 2Z3CA 3T25A 2VVUA 4DURA 5FCKA 3PROA 3O8BA 6GCHG 1IQGA 4XE4A 5A8YA 2GMTC 3EA9A 1Z71A 1T8LA 3D62A 3PO1C 1MTNB 2JH0D 2ZPSA 3MWIU 2FTLE 3PV4A 4X2WA 1HJ8A 4INKA 2ODQA 2ZP0H 1RXPA 1ZGIA 3RXPA 2FS8A 3SBKA 1BMFD 2KCYA 3T5FH 1OOKB 1T4UH 1F2SE 2Y5FA 1EAWA 2J38A 2F9PA 5I46H 2LP6A 1MKXH 3KQ5A 4MTBA 3MNBA 4WY3A 1VZQH 4FUHA 1CO7E 1O36A 4CRBA 2XOKD 3P70B 1S82A 1XUIA 2WV4A 4AFZA 1OPHB 2R9PA 4HG6A 2FOMB 2BX3A 4HTCH 1J9CH 1ID5H 1ZHRA 3RC6A 1GL0E 1O30A 1BTUA 2IPHA 1THRH 2SGEE 4X0WU 2RA3A 3GYLB 1SQRA 3FN8A 1RS0A 1SFIA 1TNHA 1GMDF 4DGJA 3U98H 2UUKB 5AF9H 1O39A 2P8OB 1C5NH 3PMJA 2XRCA 1OWJA 4I8GA 3SNDA 5ETXA 1GGDB 3A8BA 2GTBA 4H6SB 3RXTA 3EA7A 5FCRA 1DUEA 1O2UA 4K1EA 3ZZ3A 1CBWC 2Z3EA 1C2DA 1THPB 2BX4A 2V35A 2WYJA 2Z9GA 5FX6A 5GJ4B 2NU1E 4IN1A 5F53A 1Y5BT 3OY6U 4GVUA 1E79D 2QC2A 1G2MA 1OYTH 4B6FA 3AASA 4H4FA 5AVDA 3ENSB 2KAIA 2XBVA 3F9EA 1AVWA 1FNIA 3RLWH 5A8ZA 2O8WA 4VGCC 2QY0B 2A0QB 1WYKA 2VIQA 3E3TA 1LKAA 5C17A 1TGCA 1A0HB 1AFQB 1HAOH 1LPZB 4MNVA 1MU6B 1ELGA 1SOTA 1C2KA 1BQYA 3F6UH 4ABBA 1K1NA 3UOPA 3MO9A 1S6LA 1FI8A 1HAIH 4TYDA 2Z9LA 4F49A 3QWCH 6CHAC 4U2WA 1OYQA 3GCTF 1Y5AT 2ZNKH 2HRVA 1ANBA 2HLDD 1YY3A 4JCNA 1O5GH 4Y79A 1UCYK 4RI0A 3HK3B 1SVPA 2J4IA 2WPJS 2ZQ2A 3SU6A 4X2XA 3KYGA 4TSFD 2CV3A 2VVVA 1TE0A 2P3UB 2ZCHP 4MLFB 3WWBA 3FP7E 2EQNA 1NS3A 3GCHC 1DANH 8KME2 4FUDA 1O2TA 1FUJA 2VGCB 1DM4B 2B5TB 3LGYA 3A81A 2Z3DA 1GDQA 2M2AA 4JZFH 3DCLA 4PROA 3I29A 5L2YH 1C1WH 1G9IE 2UUFB 3KQDA 1ELEE 1ORFA 4DJZB 1VCQA 2Y80A 5I25A 1LVMA 4ACAA 1LQDB 1OP0A 3RXRA 4AG2A 1RJXB 1QRXA 4NA9H 5LH8A 4CBNA 1V2QT 3TNTA 3K6YA 1TWXB 3QLPH 1WTHD 3TU7H 2QF3A 2ZI2H 1PQ8A 4E05H 2BD3A 4U30A 1S6HA 2JJ2D 4NCYA 2FWWA 1KIGH 2PTCE 1GI5A 2Z9KA 3MTYA 3RXOA 5PTPA 3OTJE 4U01A 2H9EH 1LVBA 3CP7A 5LPRA 1GI6A 4XSKU 5C94A 4BAOB 2HWLB 1GMHG 1TMTH 2FIRH 2PKSC 3DUXH 2VWLA 4DCDA 5EIYA 1F5LA 1KLTA 4Y8YA 3M37A 4FOUC 4JZDH 7ESTE 5A0AE 5JB9S 2ZDAH 4BTUB 4DIIH 1W7GH 3B8JA 1V2PT 1TAWA 1A0JA 3GISB 2P16A 4CHAB 1EJMA 4WMEA 4DY7B 1TRYA 1S0RA 2R3UA 3ZIAD 5C0TA 1SR5C 1BMNH 3VG8A 1BBRH 4IC5A 5IYTA 4A92A 1TNKA 1SQTA 3UNSA 5A2MH 3SV6A 3SU2A 1B7XB 2WV5A 4DG4A 3MMGA 1E1QD 3T26A 2TGDA 3IITA 2FPZA 3BSQA 1GMCF 2VBCA 4ABAA 1PPFE 1WBGB 5EJLA 2V3MA 3H09A 3S9AA 1C1NA 3A87A 3E0PB 1GCTB 1MTNC 1UK2A 4Y10E 4JYUH 4I33A 1AN1E 3L3TA 3BIUH 4D8NA 4K8BA 4LOYH 1TGBA 1O2RA 1FY1A 1MZAA 3QN7A 4R0IA 2VIWA 3BN9A 4K60A 3MHWU 2ALPA 4JK6A 2DE8A 1TGSZ 2TPIZ 1UCYE 1FPHH 2O9QA 4UDWH 1LHCH 4IMZA 1QHRB 4GLYA 3SJ9A 1O3BA 2I6QA 2M5TA 2ZC9H 4YO9A 2XCFA 4I7YH 2QF5A 2OLGA 1K22H 3ZVCA 3FZDA 5G4BA 3A85A 1MCVA 3TVJB 2VH6A 1GBKA 2J5UA 2Y82A 1JWTA 1O5EH 3MH7A 1CHGA 2AH4X 2ZDLA 2EY4C 4B73A 3BG8A 2RCEA 5FBIA 4X2VA 1OWEA 5EXLA 1ELFA 2P8OC 5FAHA 1A4WH 1F0UA 1GGDC 1K1IA 3N7EA 1SBWA 2ZU2A 1AB9C 4GCHF 4BAHB 2GZ9A 5JBAS 4Y11E 1OWKA 3LKWA 5FX5A 4X1PU 1J16A 1GBMA 1BUIA 1DOJA 1YP9A 2P93A 3FP8E 1ZPZA 1SKYE 1ELAA 1DICA 2ODPA 2QF4A 3L6PA 1UJ1A 1D3TB 1MUEB 2YNBA 1MQ6A 4DVAU 2F9NA 2ZHWH 2FP7B 2TGTA 3PYHA 1NRPH 1QB6A 4ISNA 1HFDA 2Z7FE 3F9HA 2XW9A 3IG6B 1AFQC 1AQ7A 1P03A 1AZZA 4LXBH 2BDIA 7GCHG 1FMGA 4FVDA 1AO5A 1F7ZA 4B2BA 2I6SA 1QIXB 4I31A 3GYMA 1GI9B 1MAXA 2IPQX 2Z9JA 1DY8A 3W95A 5DSFA 1AU8A 5C67A 1GWAA 1O2QA 1FY5A 5C20A 3QX5H 2PKAA 3RXVA 4OS5A 2SGQE 1GHAF 4X6NA 5FPYA 1IOEA 4AFQA 3ZVAA 1SFQB 3UR6A 1YGCH 2F4LA 5C2ZA 3GY5A 3S9CA 2VGCC 3OFND 2BVRH 2KR7A 3N99A 2B8OH 3MU4A 1E35B 1ZRKA 2PR3A 2FX4A 3GY6A 2BLWA 1G3BA 5T1VA 1ZSLA 3Q00A 1BTHH 1S84A 1KYNA 2FOHA 3V12A 1TNIA 1CE5A 4F4OC 2EI7A 1G30B 1CA0B 3KQBA 1GBHA 3E90B 2BD7A 3ZVFA 1IHSH 1Y3VA 2C8YB 2A31A 3SZNA 3A7VA 1EZXC 2FO9A 3E1XB 4LK4A 1EKBB 2O8UA 5DP5A 1W14U 5C5OA 1PQ7A 2NU2E 1EOJA 1RTLA 3EDXB 4Q63A 4TPYA 1NY22 3K2UA 8GCHF 3OY5U 2A2QH 1QL8A 2BXUH 1HRTH 7LPRA 5C0UA 1IQJA 1NT1A 2AYWA 3ZZ4A 1V2NT 3VEQB 1ETRH 3S7KB 3AAVA 1PQAA 3F0OA 3BTKE 4BTTB 2F3CE 2XWBI 2K8IA 2EC9H 1FJSA 1UMAH 1YPMH 1VR1H 4UE7H 3S9BA 2W5EA 1C1RA 5DN6D 3RLYH 3PMAB 1XUHA 2ANWA 5KEDA 1CGIE 3DT0H 3M7QA 3RXEA 1Z8IB 4ZH8A 3PMHB 2BM2A 1K2I1 1BRCE 3BTEE 3M5NA 5A0CA 1B0EA 5BPEA 4CHAC 1HJAC 1KSNA 3P8GA 1H1BA 1PPGE 3MI4A 2FI5E 1G2LA 4OS7A 4ABHA 1HAVA 1SGPE 5EU8A 4UONA 5C1YA 1O2VA 1FQ3A 2R0LA 3F3BA 4YLQH 1N8OB 2AIPA 1C5WB 1O2XA 1PYTC 1ZGVA 1AUTC 1SGFA 5FBEA 3RXHA 4AC9A 1UHBB 3SQEE 1WUNH 3SU0A 2UUJB 2WUBA 3ZVBA 4CRFA 3VXEH 4NG9H 1QA0A 3K9XB 1N6XA 4DOQA 5DJ7A 2SGAA 1V2TT 5K0HA 5E0JA 1ZPBA 5AFZH 4ABDA 1GCTC 2WZQA 1C1QA 5F8ZA 1GJDB 2P3TB 3SUDA 1TA6A 4Y8ZA 5AFYH 1EAIA 1L1JA 1BDAA 3AK5A 2ZGJA 3RMLH 1XM1A 1GMDG 2ZDMA 2ZF0H 4X8UH 5DO4H 1G3CA 1SGYE 4UFGH 1GI0A 2OC7A 2BDAA 1ELBA 2FLRH 1P2OA 1GJ6A 2JETB 1SOZA 2EI6A 2HVXA 5DP7A 1KXEA 1ESAA 3M5MA 1MD7A 4X1QU 3E0NB 3RXLA 4UFDH 3M3VA 1GG6B 1V2OT 4X1SU 2A32A 1SHHB 1Y3UA 1N1LA 1C5VA 4YESB 2C90B 3FO8D 4B2CA 3CS7A 3KIDU 3KQCA 2FDAA 1A1RA 2A4OA 4NZLA 1A2CH 3HK6B 3Q3KA 1O34A 1XXFA 2GZ8A 1P05A 3OE7D 4MPUA 2JIZD 2V0BA 3A8AA 3F9FA 2OC1A 4Q7XA 1HAYB 3M36A 1EZQA 1AI8H 3SNBA 1BA8B 2BY8X 1WTGH 1EZUC 1O33A 4AGJA 2XBWA 5T3HA 1KLJH 2ZU3A 2ZTYA 3LU9B 1YPGH 3WY8A 5J4SA 4E7NA 3SHAH 3TJUA 1S6FA 2PLXA 1BJUA 2OK5A 2OC0A 4K8YA 4XFQA 5E0HA 1W0KD 4XDEA 4FUIA 1Z8RA 4CREA 4K3JA 1TNJA 2O8MA 1LHEH 1O2PA 1P02A 1VCWA 3ELAH 1HYLA 3U9AH 4I32A 1EPTA 2XC0A 3KL6A 1QB1A 2RG3A 2SGFE 2ZG0H 3SJ8A 4TY6A 1W0YH 1KTSB 1OX1A 1C1SA 1O37A 1RTFB 2QXGA 1C5LH 2QN5T 1FX0B 2XWAA 2ZPRA 1ARCA 2A1DB 5HM2A 1D3DB 1C1VH 1EZSC 1O3AA 3SGAE 1B5GH 4XBBA 1A5HA 1G36A 5CHBA 1ESBA 2J9NA 3E6PH 1EPTC 2P3FH 4ASUD 3GY7A 4FUFA 5K7RA 1PJPA 2VIOA 1GI4A 1V3XA 1VGCB 3PLKA 2H6MA 2V3OH 2R2WU 3GDUA 1Z8GA 1ZSKA 3W1EA 3SNCA 1WAYB 5F8TA 3EQ0H 4YXWD 5A8XA 1G3EA 2VU8E 1TBRH 1YCPM 1GHBF 4FUCA 1V2UT 5CDFE 2FMJA 3SHCH 1K9OE 1EX3A 5EW2H 1UCYH 4ZKRU 4AX9H 1EATA 2SFAA 1YLCA 1GHXH 1COWD 1NFXA 1NRRH 4XRNA 4JYTA 3QTVH 2EEKA 4ISIH 2HNTF 3K65B 1YYY1 3F0PA 4Y0ZE 1C5UA 1TLDA 1P01A 2ANYA 1TX8A 2BVXH 1IQKA 1CA0C 4GUXA 2GX4A 1JOUB 4Z0KA 1K1MA 1HIAB 2ZIQH 2KM0A 2VIDA 2BY6X 5L30H 1Z8JB 2J97A 2PP6A 1LVYA 3HPTB 4ASHA 1FPCH 1MABB 5EPNA 4Y8XA 3E91A 1O5BB 4SGBE 3T28A 1J8AA 5E0GA 3UQVA 1LDTT 2VIPA 5HKKD 2GCTB 3RDZA 3U28C 1BTYA 1UVPA 1RD3B 1GBBA 1AD8H 1C4V2 1CHOF 4TWWA 3BTFE 1TABE 4WJG2 3A82A 4AGKA 3M5LA 1K1OA 1BZXE 2QIQA 3Q3XA 3BTDE 2FOGA 1NBME 1BJVA 1SLWB 1Z1IA 1LKBA 1XVMA 2EA3A 3I77A 1O2GH 4X8VH 2H9TH 1ZTKA 1ZJKA 3SORA 1NFUA 5CMXH 3SZEA 2G5VA 4BOHA 5EXMA 1BRBE 3F2GA 1CT2E 4NFFA 4DW2U 1GVLA 3ATKA 4BANB 3UAIC 2EI8A 3KNXA 4OGXA 2CHAB 1MAYA 3ODFA 2AMDA 3HGPA 1VJ9U 1TPOA 2D8WA 4FETA 1N8OC 1XMNB 3O8RA 2PUQH 1S85A 1MZDA 2BVSH 1DDJA 1E0FD 1AUJA 1KDQA 2YMSD 1NFWA 3DA9B 1RFNA 2BD5A 3BEFB 2FOBA 1Z6JH 1HJ9A 1JIMA 2OQ5A 1LTOA 1MD8A 2SNWA 2V3HH 5JBTA 1D3PB 1WU1A 2F9UA 1ABIH 1Y3WA 2CXVA 2XC5A 4OS2A 1W3CA 3QO6A 1MTWA 1K28D 4KTSA 2GJGA 1C2FA 1XUJA 1O2WA 1GBEA 3UNQA 5JYIA 4AFUA 1AE5A 1OXGA 2WHXA 3RXKA 4B75A 2PFEA 4MPWA 1MKWK 4IGDA 2IJOB 5GDSH 1DITH 4Q80A 4AB9A 1UTLM 3FAOA 1BTPA 1HPGA 1P11E 2YOLA 4IC6A 1F0RA 2GCHG 1Q31A 2JETC 1AVGH 3A7WA 1QQUA 3H5CB 1H4WA
chains in the Genus database with same CATH topology
4K2YA 1WV7H 4Y71A 1AVXA 4M7GA 2SGDE 1FIZA 1GG6C 2A7JA 2ESTE 1LPGB 2A5KA 2XXLA 1FXYA 1WQSA 3D49H 1X7AC 1GJ5H 1WOFA 2QCYA 1ZTLA 3UWJH 2F9VA 1TIOA 6GCHF 1V2RT 3SOSA 4A7IB 2D26C 1GHZA 1C1UH 2AGIX 1TYNA 4MNXA 3ATLA 1XVOA 1NU9A 1D6WA 3F1SB 1KXAA 1BOQA 1K21H 1L0ZA 2UUYA 4HI3A 2BMGB 1Z1JA 2BQ6B 3V7TA 1FZZA 1TQ0B 5GPIB 2CMYA 4FU9A 2FOCA 2J2UA 1GBJA 2C93B 3SU5A 4IMQA 1H9LB 4JMYA 3PMBB 5HXFA 1EJNA 1O2MA 1QR3E 1AKSB 2BLQA 4O97A 1FAKH 3GCOA 1SQAA 3OSYA 1DWEH 2BD9A 1W10U 2AGEX 5LGOA 1T31A 1EXFA 1SSXA 3QUMP 3SJIA 3A86A 4FU7A 4ZMAH 1SHYA 3BTWE 4X1RU 5T6DA 1MTVA 1NRQH 5BRRE 2QYIA 1YPLH 4MQAA 1AFEH 1DSUA 2TRMA 4CRAA 2BD2A 1H8IH 3H7TA 2WYGA 1J17T 3OYPA 4NFEA 3SO3A 1C1TA 5A09A 1O38A 3KQEA 4BAMB 3STJA 8LPRA 2NWNA 2P59A 2Q6DA 1LO6A 3A84A 2CN0H 5GXPA 1FY8E 3TPIZ 1IAUA 4O9VA 2DUCA 2W26A 1GI8B 3UOUA 1QRZA 2UWOA 1C1MA 2A4GA 2GV7A 4FVBA 2WUCA 3VB3A 3KF2A 3UFAA 3EAJA 3QZQA 8ESTE 2FLBH 3MNXA 8GCHG 1LHGH 3TH4H 3KEEA 5EQQA 1BHXF 2F9OA 1C4Y2 1HAHH 1HIAA 4X6MA 1DLKB 1ETSH 1ZHMA 3RXAA 1AGJA 1HXEH 1C4U2 3QK1A 1AY6H 1NC6A 2IN2A 4Q2KA 3UREA 3T2NA 2BYAX 4CBOA 3RXJA 5E2PA 2VVCA 4BTIB 3U1JB 4RSPA 1ANDA 3NPSA 4I8HA 1E38B 1XUGA 2AGGX 3DD2H 1EP5A 1YM0A 4O03A 1ZR0A 1MTUA 1UVSH 4GHTA 3ZZBA 2H9HA 1GHYH 1UO6A 1C5XB 2NU3E 4XBDA 3QDZB 3RXDA 1NU7B 1F0SA 1IQLA 3M7UA 1UTOA 3STIA 1G32B 4AOQA 4Y0YE 2OCVB 3MU8A 3LH3A 4NWKA 1PYTD 2ASUB 3SUEA 2BZAA 3RXIA 1P10A 2GCTC 3TK9A 4YOJA 2J94A 1AWFH 5F6MA 3RU4T 3R3GB 3LJOA 3LT3A 1VJAU 3LJJA 3MOCA 4KKDA 3MH4A 4SGAE 4UD9H 3UTUH 2LPRA 3URDA 3MH5A 1RGQA 2FI3E 3A8DA 3UQOA 1C5QA 4ABGA 1PPCE 4KELA 1PQ5A 1YKTA 1BITA 1Y8TA 1YPKH 1HAXB 1ZPCA 2Q1JA 2W3IA 4ISLA 4CH2B 4D7GA 3NUMA 1O2JA 2TBSA 2CHAC 3EA8A 1ZMLA 5EG4A 1GBLA 1L4DA 2HALA 3TLOA 3F68H 3LC3A 5TCAA 2PTNA 1DVAH 4CRGA 4IS5A 1GCDA 5EQRA 2G8TA 3RP2A 1CSOE 3DFLA 3A89A 1VITG 2ZCKP 1GMHF 2BDBA 5ESTE 2QGRA 3D65E 1P06A 1SG8B 3M61U 1W13U 1DE7H 1XKBC 2A45B 3SV2H 2V6NA 5EW1H 1GHWH 2K1QA 4FU8A 5JBCS 1T32A 1NROH 4YM9A 1P3CA 1Q3XA 1GJ9B 3SN8A 1JRSA 2QXJA 2VWMA 2LNCA 2XNIA 3PO1B 2PW8H 4HGCA 1W2KH 2OC8A 4ZAEA 4RN6A 3E8LA 3TGIE 5CHAB 2ZU1A 1P2QA 3VPKA 2GP9B 5DKMA 1HUTH 1ETTH 3AW1A 2SNVA 3VXFH 2Y7XA 2ZECA 1NZQH 4R8TB 5AHGH 2Y6TA 3DHKH 3QTOH 4WXIA 1NFYA 2PUXB 1A3EH 5JB8S 1P0SH 1TX7A 3C27B 5C1UA 1DX5M 2ZDVH 1EOLA 2THFB 3UPEA 4AG1A 1A0LA 3M3SA 4O3UA 1ZTJA 4X2YA 1QTFA 1GBAA 1P2KA 1AKSA 3MNSA 3UIRA 5GCHG 1DWCH 1UTNA 4LZ4B 2CJIA 2IOTA 4IN2A 4ZXXH 3BTGE 1EAXA 3TJOA 2ZDKA 2BQWB 1Y3XA 2YNAA 1SPJA 1W11U 3SV8A 3A8CA 1TNGA 2TGPZ 1D4PB 3LGIA 4K69A 2O8LA 1TQ7B 3P17H 1UTJA 4DIHH 1NRSH 1JMOH 5J4QA 1GL1A 1ABJH 1GJ4H 1LPKB 2ZO3H 3BTQE 1E37B 3LIWA 3GY2A 3RMOH 2F83A 2G00A 1GJCB 3N7OA 4BAQB 3ZZ7A 1SLXB 1J15A 3GOVB 4ABJA 1GHVH 2TGAA 3LGTA 1MQ5A 1YPEH 4Y76A 2STBE 2VWOA 3LONA 3A88A 4AORA 1LHFH 2OQUA 2ZFQH 1O2IA 1WSSH 1H9IE 1HAZB 1V2ST 5EQSA 1UK3A 3SNEA 1BCUH 1BMAA 3FVFB 5C1XA 1KY9A 3RU4E 2GDEH 1O2YA 4U32A 4Z6AH 5DP4A 1O3NA 1NM6A 1VITH 1MMJN 6CHAB 2GV6A 3OU0A 4NGAH 1PPZA 4AN7A 3NXPA 3AAUA 3RXSA 4D9QA 1GJAB 1KXFA 1SI5H 3BTHE 2XBYA 1GBTA 1DFPA 2FI4E 1E34B 1MU8B 1NN6A 1O5DH 2FX6A 1HAPH 1C2EA 2VWNA 3VFEA 1THSH 1Y5UT 2XYAA 3ZVEA 1S5SA 2BD8A 2ZU4A 1V2WT 1KXBA 1D3QB 7GCHF 5TCCA 1RRKA 1MBMA 5EODA 1GDUA 4NIWA 1DY9A 1GI2A 1V2VT 1PPBH 1SLVB 1QNJA 3P92A 3RMMH 2QXHA 5DP9A 4Y6DA 3B23B 4ABEA 2ZKSA 2BLOA 5EPYA 1BHXB 2FOEA 1O5FH 4ZROA 4O3TA 1QFKH 1TALA 3S69A 1W8BH 1O3KA 1LQEA 3HGNA 3M35A 3VB7A 3LH1A 1AIXH 1QB9A 1DT2A 1O3MA 4CRCA 4LZ1H 3OX7U 3DFJA 3BTME 5L2ZH 1C9PA 1M9UA 4MPVA 1HNEE 3TK6A 1YPJH 2ZTZA 1SGQE 3A7XA 1SL3A 1LCYA 2GT8A 5IDKA 1C5MD 2ZCLP 1ESTA 1O2LA 1C2GA 3GCTG 2PV9B 2ZHEH 1C5OH 4BNRA 2H5DA 2HOBA 1KXDA 2XC4A 1P9UA 3LGVA 4HFPB 1CU1A 1SB1H 2ZGXH 5FPSA 3PLPA 3GY3A 4D7FA 2Z9IA 3R0FA 3T62A 3PWCA 5HGGA 3PWBA 1BTXA 1TGTA 3BEIB 2VINA 3TJNA 1TA2A 1TPPA 1C5PA 1YPHC 3NK8A 2BQ7B 2H2ZA 2ZHDA 4MPXA 3EE0B 2Y5GA 2GGVB 2HPPH 1BB0B 1TNLA 3SJOA 3K6ZA 4WMFA 2A4QA 4AYVB 1FN8A 1SGRE 1TMUH 3SU4A 1HAGE 2QAAA 4IW4E 1P3EA 3V3MA 3VB4A 2ULLA 4B2AA 3ITIA 1EP6A 3FZZA 4Y7BA 5H4IB 1TBQH 2PGBB 1QJ6B 3VB6A 3JZ1B 5DG6A 5LPEA 2VNTA 1T7CA 1TFXA 2R2MB 3KCGH 3CENA 1FLEE 3LDXH 2ZGCA 1TBZH 3NZIA 2C8WB 1A7SA 4YOGA 1YCPK 5CHAC 1CT0E 1SC8U 1O35A 2QF0A 3M5OA 1UVTH 4E7RG 4K1TA 3O8DA 2W7UA 2A5AA 4NWLA 4A1XA 3GDSA 1O3CA 1K1PA 1NTPA 1YF4A 3I78A 2BHGA 1SGEE 1AMHA 2Z6BD 4TPIZ 1O2KA 1MKWH 1ZYOA 5TJXA 5SGAE 1ARBA 2F9BH 2C8XB 1OWDA 1ZMJA 2ZWLH 1YC0A 1DLEA 2JH6D 4RKOB 3FFGA 2BY7X 3B9FH 1A61H 1A5GH 2JKHA 1T8MA 2WPHS 1O3DA 2RA0A 1TX6A 1GBFA 1HGTH 1O3EA 1MH0A 1FY4A 1A3BH 1INCA 2VIVA 1MBQA 2GT7A 3SUGA 5T6FA 4NIXA 3P8OA 1IQNA 3ZVDA 2HGTH 1RIWB 2Q6GA 1GMCG 2W3KA 2ANKH 4MNYA 1GBCA 2WINI 5E8EH 1P57B 1O3PB 2F91A 1AB9B 4ZKNU 3IWMA 4QT8C 1UHBA 2J34A 3V13A 2GD4B 3BG4B 2B0FA 3ATMA 5DGJA 4X8TH 2FYQA 1F92A 1BMLA 3VGCB 3URCA 4CR5A 4Q7ZA 1L4ZA 1ZOMA 1ZJDA 4B71A 3SV7A 1O3OA 3H7OA 5FPTA 2VH0A 3RXQA 4YTAA 1OWIA 2AMPA 4E06H 4AYYB 1IQFA 2AEIH 5F03A 1C2HA 2GZ7A 2G4TA 1O2HA 1S81A 2TIOA 1YBWA 4FUGA 3SGQE 4AFSA 1AWHB 3LPRA 2G81E 3TGKE 4ZHMU 5JPMH 4AB8A 3EGKH 4X1NU 4CRDA 5DP8A 1TONA 1Y59T 1F5RA 5C3NA 3RM0H 1JBUH 1OP8A 5E2OA 2OXSA 4NSYA 1P12E 1PPEE 2A5IA 1VCPA 2FM2A 6LPRA 1W7XH 1MKXK 2P94A 1UTPA 2JH5D 4OGYA 4RKJB 1O2OA 1EB1H 3HKIB 3GY8A 3GY4A 4K5ZA 4GCHG 1QRWA 1BRUP 1C1OA 1DXPA 5CE1A 1OSSA 1D6RA 4ZHAA 3U8TH 2Y81A 2FESH 1GI7B 2PKAB 3T27A 3KN2A 1O0DH 1TMBH 2BDYA 1PFXC 4A6LA 2ZU5A 3AVZA 1SQOA 4B76A 1GVZA 1D9IA 2FOAA 2OD3B 4B1TA 2ODYB 3SNAA 4ABFA 4CH8B 4Y7AA 3RXMA 4XBCA 3NCLA 1MTSA 4BXWA 3BIVH 4KGAA 4MNWA 2OUAA 2CGAA 2ZFRH 2WPMS 1ELTA 2Y5HA 3V0XA 2J92A 1A5IA 4TY7A 2OP9A 4CR9A 1SMFE 1C2IA 3UNRA 1O5CB 1GJ8B 2FTMA 1C5RA 2J95A 3FP6E 3RUOA 1BTZA 1QJ7B 1QY6A 4KTUA 1NO9H 2H5CA 1EJAA 1CGJE 3SW2B 2PGQB 4K1SA 1BIOA 1O32A 1GHAG 1QL7A 1S0QA 1V2KT 2QA9E 1CA8B 3ZV9A 1O3FA 2ALVA 2FOFA 4NIVA 1SGCA 2BTCE 4OS1A 2A7HA 3MFJA 4FUBA 1IQIA 1TOMH 4KTCA 4AZ2B 3U8OH 4JZ1A 1HBTH 1EAUA 1HJAB 1EQ9A 3Q76A 4GSOA 1AZ8A 1TPSA 3SUFA 3G01A 2BB4A 4Q7YA 2A2XH 3TITA 1SGTA 1O31A 2FEQH 1DWDH 4INLA 1AE8H 3PM3A 1DSTA 2AERH 1ELDE 2G51A 4WH8A 1JXPA 1V2MT 1VGCC 1O3GA 2VJ1A 2AS9A 2HNTE 2NU0E 4YT6H 5EOKA 4MG3A 3A7TA 1HXFH 2ZA5A 1C5YB 3TH3H 1HAVB 3JZ2B 1P8VC 3LOXA 1YLDA 5F8XA 1JRTA 2WPIS 4X6OA 1G3DA 1CQQA 2H1UA 4JZIA 3SV9A 3RM2H 3NWUA 1V6DA 2PWXA 3UUZA 2UWLA 3LGWA 2AMQA 4WMDA 1NESE 3KGPA 1Z6EA 2ZFSA 3MU1A 4ZUHA 1O5AB 2Z94A 3MH6A 1A46H 2FS9A 5ABWA 2GVFA 4WVPE 1T8OA 2OBQA 1DPOA 5T6GA 1N6YA 1GJBB 4J2YB 1XX9A 3ZZ9A 1NRNH 5JBBS 1UTMA 3SGBE 3TJVA 5LPFA 2PHBA 2BXTH 2BY5X 2ZFTA 1YPHE 1C5TA 1H8DH 4ESTE 1EB2A 1Z7KA 2PSXA 2C8ZB 5A0BA 1TOCB 4ZXYH 2BDGA 1DXWA 1XUKA 2UWPA 4X8SH 2B7DH 3ZYDA 1T8NA 2GDDA 2Y7ZA 2ANMH 3W94A 1FN6A 1BRAA 1RTKA 1SGDE 1C5SA 1TPAE 1O3IA 1RIWC 3D23A 1HLTH 3FANA 2SGPE 4MDSA 4WWYA 1F5KU 3GICB 1MCTA 3Q3YA 2GCHF 2OBOA 1CT4E 1C2MA 1QJ1B 3RXUA 3SU1A 1U6QA 3ODDA 5B6OA 2CF9H 1BBRK 1OP2A 2C3SA 9LPRA 1IHTH 3BG4C 4NSVA 2FYRA 2G55A 2W7SA 3VGCC 1QURH 1FONA 5DPAA 1IQEA 1ZLRA 1O2ZA 1OWHA 1P2NA 1UVOA 3P6ZB 5DP3A 1XKAC 2ZZUH 3ZVGA 1P04A 3ZZ8A 4BXSA 1J14A 5JDUB 4FXGH 3TK5A 1KTTB 1QL9A 4ISHH 1WCZA 2ZQ1A 5EGMA 3M3TA 1XXDA 3ZZ5A 1AHTH 3S0NA 1T4VH 3A80A 3ATWA 4A1VA 3U69H 2FODA 1EPTB 2DE9A 2GMTB 4B74A 1GVKB 2ZTXA 1HCGA 1CVWH 1EASA 1HB0B 5FHTA 2ZHQH 9ESTA 3SQHE 3PLBA 4GAWA 1K1LA 1S83A 1Q2WA 1ZMNA 1UTQA 1IQMA 1O3HA 3RC4A 1KLIH 5HYOA 1O3LA 4OS4A 3SI3H 2GKVE 2QXIA 3ZZAA 4A5TS 4D76A 3GDVA 2XBXA 7KMEH 4H42U 1GJ7B 1JIRA 3EYDA 2FZZA 4BAKB 2RDLA 3MNCA 3SI4H 3MO6A 2G52A 1W0ZU 1UK4A 4XOJA 3AW0A 1FAXA 3PTBA 1ZSJA 3MU5A 1TRMA 1QBNA 3RXCA 3ZV8A 3KHVA 1B0FA 1FIWA 2P95A 2ILNA 2G5NA 4ISOA 1C5ZB 1P2MA 3A7ZA 3BEUA 3RC5A 1HV7A 1P9SA 5EXNA 3SJKA 1L2EA 5L6NH 3QGNB 1FY3A 1CBWB 4I8JA 3A7YA 4GPGA 1XUFA 2Q6FA 4JYVH 5FXLA 3BF6H 1ANCA 1SGFG 3RXBA 2R3YA 1G37A 1QGFA 3E16B 3ZZCA 3O8CA 1FV9A 1HDTH 1ACBE 1C2LA 1QBOA 3QZRA 5GIBA 4ZHLU 1IQHA 4WH6A 1GHBG 1ELVA 3U1IB 2NU4E 4ABIA 1P2IA 2VB0A 4UFFH 4VGCB 2BDHA 1C1PA 4ZKSU 1KXCA 1F0TA 5HMAA 3T29A 2BDCA