5FPTA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 2-(1-methyl-1h-indol-3-yl)acetic acid (at3437) in an alternate binding site.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
total genus 199
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fptA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fptA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fptA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA03
3SE0A 4NWLA 1E9RA 1U8YA 5H68A 4F91B 3LX5A 4XTCS 2GWHA 2CCJA 1Z6GA 1LB1B 3LBNA 4WW0A 1XUHA 2BQ7B 3EPHA 4C0HA 1KZGB 3IBYA 1QF9A 1W44A 1GMDG 3F68H 1EB2A 3BEUA 2CCGA 2D1JA 2Y80A 3EPKA 1K9OE 1SR5C 2C77A 2FESH 4MNYA 1ETTH 2BDHA 4CRFA 3GMTA 3R9IA 2BY7X 2PMKA 2W6IA 4AY2A 1WSSH 1JOUB 4Q00A 2QSYA 1KY9A 1P06A 4WZBE 3WY8A 4BFTA 1YLDA 3LBIA 7KMEH 1Z07A 4KV9A 1E1QA 2QAJA 1HGTH 1GGDB 1Q3XA 5T6GA 2I6SA 1JQLB 5GIBA 2AX4A 1SLWB 4BLRA 3L3TA 1SLXB 1E37B 4QNMA 2X19A 2G00A 3SV7A 4QGAA 3QZQA 1LV7A 1FQ3A 1OSNA 4BASA 1W48A 3A7XA 3SZNA 3O8BA 2BY6X 2A9KA 3QWCH 1D2EA 3REGA 2O8CA 2I1VB 2W7SA 2G52A 2F3CE 2V1XA 3EIQA 3BB3A 1SVMA 4PQRA 1UTOA 1ZVQA 4LGMA 1X1SA 3ZZ9A 2J9RA 2PW8H 1HAOH 3C7KA 2LCFA 3LNCA 4B2CA 4OI2A 1EATA 1P03A 2ZO3H 1AWHB 1NKSA 2QT1A 1C1TA 4LXBH 1JI0A 4OS5A 3QEJA 3V7TA 2RGCA 3A1UA 2P8OC 2UWLA 1Z71A 3WMFA 1DWBH 2ZREA 4X1SU 3TVJB 2QQ0A 3FP7E 1QHHA 1G21E 2IUTA 4JLDA 1GI1A 4P3YA 1XX6A 2QPAA 3QF4B 1UF9A 1O2UA 2BVSH 1HJAB 2JIZD 1MMJN 1QJ6B 1FP6A 1M7GA 1W2GA 1A0JA 1XD2A 3MI4A 3I8SA 1KI2A 4CBNA 2EQBA 1O2OA 4BAKB 2JJ1A 1GMCF 1IHTH 1S0RA 2A0QB 3RXPA 5HM9A 1DUAA 2BMFA 2QAGB 2GZ8A 3UWOA 1GI8B 2Q21A 1A3BH 2Q9CA 2ZU0C 2QGNA 2Z4RA 1S1CA 2DUCA 1P2VA 3ZD7A 3LGUA 2FWRA 1IOEA 3SFZA 1GL7A 4AKGA 8GCHF 4MA4A 2REXB 1WQVH 4PO8A 2K1QA 4OQXA 2ONKA 2B0FA 2ULLA 5LPFA 4CHAB 1V5WA 1AKYA 1GITA 1TX8A 5EW2H 4K69A 3RNLA 1N6XA 5C1XA 8LPRA 1KTVA 3PUWA 1D6RA 5JHHB 1XDBA 5LPRA 5B58C 2RCNA 2JLYA 2J87A 3F9FA 3PLBA 4AYYB 4O3UA 3PTBA 2PT7A 3QKRA 4TTRA 5AVDA 1BIFA 2PUXB 2FF7A 4QKQA 3GEHA 4SGBE 2VHTA 1NZQH 1TX4B 4CIDA 4E05H 2ZQ2A 2GZ7A 1SQAA 4Q19A 2REBA 1MRSA 1QQ4A 1KO1A 2NG1A 3RXEA 1ZD9A 4B74A 1G291 2GD4B 4WF8A 1MAXA 3PCRB 4E07A 3CNNA 4QOSA 2H9TH 1O2IA 1T4VH 1CULC 1GKUB 1U81A 3UK6A 1G37A 1NY5A 1BTWA 4TPIZ 3T1OA 1ID5H 5DP5A 4FCTA 1JB1A 5EP4A 2PZGA 4B34A 2C8VA 1N6YA 2ZRKA 2C03A 5J40A 2TPIZ 3PV4A 5FPKA 4DEYA 5C4GB 2ZCHP 3QN7A 3R8FA 1VG9B 1LS6A 1VCPA 3LGIA 5CYOA 3EA8A 2D8WA 1G7TA 4QJ4A 5FTJA 3U60B 2VIIA 1YPJH 2C8ZB 4GL2A 4CZ2A 2FMXA 1WTGH 3L43A 1RTFB 5JYIA 4RVCA 2OBMA 1F0UA 4DCTA 1EQ9A 2ORWA 1FPHH 4CBOA 4QHTA 1RIFA 3ZZUA 5FCKA 3UREA 3E0PB 2XX3A 3A36A 1JWTA 1JXPA 1XU4A 3ZVFA 5AUOB 2HYIC 4OHXA 2Y82A 3KQHA 3TK6A 4DLRA 4E7NA 3E6PH 2W26A 2D2FA 4B76A 2EU8A 4BNRA 1O3BA 1W0JA 3ADDA 2V9PA 5C46F 2A4QA 3TJZA 4PHFA 2HJVA 1CS4C 5JSZB 3ASZA 2O8LA 2ZFTA 2IS6A 4ZV4A 3RRYA 2ZE8A 2CDNA 4LOYH 1ZRHA 5G53C 1UTJA 1YZQA 5JSZA 1GP2A 1Z47A 2DHRA 1SGNE 3OEHA 3E1SA 1ANCA 2XOKA 1UTQA 2ZEBA 2G83A 5DH9A 4C0KA 1C5SA 1N1LA 3ZZ7A 3B78A 4NSVA 2EI8A 2UWOA 4ASHA 1GMDF 5SZKB 1AB9C 2O52A 4TL6A 4D8NA 2CHGA 3HYTA 5GPIB 1LS1A 1VCOA 1VG0B 4ISNA 3VHXA 2CLSA 1RTKA 2SFAA 5FPTA 1TNKA 4M2LA 4AFUA 3OIUA 2BDTA 4UFDH 4AK9A 3OHMA 1S3GA 1UVUH 2FOBA 5AUNB 3S9CA 1GBEA 3I72A 2EI7A 4O3MA 2XWAA 2IXFA 1HDTH 4YLGA 1R5BA 3UOPA 2FZ4A 2UZIR 3KDSE 2ZJ8A 1W36D 4JVMA 4NCNA 4GDFA 2VLIA 3STJA 1BBRK 2O8TA 4NIXA 1FZQA 5SZJA 2Q0HA 1II0A 2G88A 1TGBA 1VYVA 1GL1A 1ZAKA 3IIKA 1E1QD 4RKJB 1V2QT 1QFKH 3KKQA 2IUSA 4INLA 4B35A 1ANKA 4E09A 3GY6A 4HZUA 2JLUA 1OIWA 2NZ8A 3TW4A 4O9VA 1HQYE 2IF2A 3A1TA 1K21H 2GBLC 4AOQA 4V0ME 5J47A 5EQRA 1ZLRA 4DCNA 4NA8A 3PJRA 4Y10E 4Q80A 4ZDJA 3PENA 1AGPA 2BD7A 3QENA 3A37A 4D4LA 3KX2A 1NRSH 3QOFA 2FZZA 5C1UA 4JBYA 2FX4A 1NVVQ 3PEVA 5DGXA 1X1RA 4KYUA 4FMDB 3I73A 2BDYA 2QXHA 1H8HD 3B9PA 1FMLA 1ZPZA 2HT1A 3EZ7A 1G5TA 1OHHD 4MRNA 2RGNA 3F1SB 1LVGA 2G3YA 1TWXB 1O31A 4UQOA 2FLRH 4DY7B 5EG4A 3BORA 5CDFA 2PTCE 4FWTA 4G01B 3QXJA 2DYKA 3VR2A 1PQ7A 3U4QB 4EFLA 2VGCB 2IYVA 1W13U 2ZHFH 5A0CA 2JDID 4QM6A 2V7QA 1KMQA 4WBSA 2OC1A 1KXDA 5CDFE 1RE0A 2BMGB 1SHKA 4ZIRB 2H18A 3LAWA 5JHGB 2TIOA 5CLLA 1NRJB 1TNDA 4Q1DA 3PLPA 4UEHH 1G9IE 3NK8A 5EGMA 3DEFA 1GMHF 3MMPA 2FPMA 2J7PA 2P6RA 1SULA 1QB9A 1T3SA 3CR7A 1ODFA 2BJVA 4JZKA 3QE0A 1VJ9U 3MJRA 1DWCH 2A5JA 3UWIA 1PPEE 3KQLA 3RUOA 1U0HC 4MUAA 1UCYE 2W58A 3BTWE 1TRMA 2WIAA 4HAVA 4BFWA 3U7FB 1Q57A 2ODQA 2SNVA 1P62B 3S9AA 1E34B 1O5GH 3SBEA 5DHAA 2WM9B 5B57C 2ZGBH 2VA8A 2O0JA 4BAHB 1OXXK 1A4WH 3P26A 4RZ2A 4TN1A 2IUUA 2QGRA 3C5HA 1EWQA 5KOYA 4TTPA 5LD2C 1DOJA 3BF6H 4MYCA 1IAUA 2E1RA 1HJ8A 2BDGA 2O8DA 1KDQA 3PUVA 3VPKA 1OP8A 2O8CB 4GFDA 1XXFA 2BHGA 1HURA 4OGXA 1XZPA 4D7GA 1Q0UA 5KPDA 1GAJA 2W5EA 3I78A 3V9PA 2O8BA 1F0TA 2BY8X 4JSTA 1C4U2 6CHAC 4GZLA 2STBE 1KHTA 2ZI7A 4F4IA 2PKSC 1ESMA 8OHMA 3SFVA 5D3MA 4DRZA 5G41A 1SLUB 4C9BA 5JDUB 5GXPA 1F2SE 1T8MA 3CH4B 2A3RA 1P0SH 3GDSA 2AD5A 1ABJH 3ZYCA 3BRWD 2RCEA 1G5PA 2VF8A 1ZGIA 1MZAA 1K6MA 4I8KA 1DY8A 3UMFA 1C9TA 1ZTKA 4MTBA 3QPUA 1QJ7B 1ELTA 5L3QA 2FLBH 2WPIS 2QNRA 5K8TA 2ZAOA 1NFUA 4TSFA 3MWJA 2G0TA 1Q1EA 1GJ5H 1CJTC 1DPFA 4BZPA 1QURH 2VWNA 4P4SB 1O32A 3IQXA 1PPCE 1G8PA 3X1DA 3UXMA 1HIAA 3BE4A 3ATIA 1ORFA 3NDPA 4EIWA 3I5XA 1OIXA 2EFCB 1MT0A 5A0BA 1CF4A 1LW7A 3SU5A 4HUQA 2WSSA 3DOFA 3R8CA 3ZVGA 1GPZA 1XEXA 1YVDA 3RXMA 3W90A 1F92A 2BJWA 3H7TA 4PC3A 3UMSA 5DI3B 4HB2A 4BFYA 4ZUHA 2A7JA 1J2JA 5FL7A 1S8FA 3C16C 2ZITA 5CHAC 2C78A 4W5JA 2FGJA 2UZ3A 2ZR7A 2FOHA 4YTAA 3URCA 3Q85A 1GCTC 3Q3JB 3TU7H 1WTHD 4MDFA 5JWRA 1MTUA 2DFKB 3T26A 1TNJA 1CBWB 4TPYA 1N6PA 4BLQA 4CR9A 1T32A 2ZGXH 3K70B 3Q7QA 3MMGA 3K09C 2ZUBA 2R6FA 1C5OH 1ELFA 1PJPA 4JKIA 2ZRIA 1WOFA 2OT3B 4BANB 1HY3A 3H0KA 2XCFA 2FOLA 4FIDA 3RXJA 1K22H 2VIQA 2WIBA 1BMAA 3D7MA 2R62A 1MCVA 2WWXA 4FU9A 4HUTA 2KAIB 3PFIA 2QRZA 4TMWA 2QE7D 5C18A 3GFPA 3ZZ3A 1RJXB 2JLXA 4IHQA 4BXSA 1S85A 4LJ9A 3SS8A 1E9SA 4M8NE 4G5RA 4BAMB 3EA0A 1ZIPA 4DB4A 4AFZA 1C4V2 1LO6A 3M6AA 1GI2A 1FY8E 5DKMA 3TIFA 1DAEA 4R0IA 2JETC 3B82A 4Q9HA 2TRMA 2J7PD 3NG1A 4MITA 4KP0A 2OCVB 4WXIA 3LW7A 9ESTA 1SXJB 2QPOA 3RYTC 4OQFA 2AD1A 3RXCA 1G8YA 2CGAA 2GT7A 2XZLA 1X8JA 3ZS9A 2X1VA 3BERA 2WAXA 1ETUA 3B13B 1V2MT 3VR4A 3UOUA 2ZRPA 3FKQA 1NO9H 3EWAA 3D62A 2RGBA 3U44A 1VR1H 3MNBA 3I62A 4B2BA 3U61B 1KMHB 1UTMA 2SGEE 4ZKOU 1KO7A 4IXMA 1O5FH 1IQEA 4NIYA 1OHHA 2FOAA 4H4FA 2BOHB 5CE1A 3Q3KA 2BY9X 5DGJA 1FLEE 1UTLM 3RC6A 2XBVA 3RMMH 2MSCB 5G3YA 1C1PA 3SV2H 2Z6VA 1TPOA 3NUMA 1XMSA 2VHJA 1Z0IA 4H9GA 5HMAA 3VTKA 2O8EA 1KDTA 3N2EA 1DICA 3GJXC 1CRQA 4KBFA 2IEZA 2FMJA 2FV8A 4CH8B 3BWDD 3RLYH 4TMVA 1UJ2A 1V2TT 1H9LB 1BMFA 2ODBA 2QY9A 3BTGE 4NDZA 3U7EB 3E2IA 1EFRD 2ZRGA 1C4Y2 2Z4SA 2BM0A 2ZSBA 3LQRA 3HU2A 1S4QA 2W6ID 1QGFA 3M7UA 1ZIOA 2O8UA 1P2QA 3EZ6A 3KXLA 4A0GA 3K0EA 4DURA 4HDQB 1V2JT 2BY5X 1GI4A 1A82A 3P32A 5KSYA 1K1LA 4K1EA 5GCHG 3ZVNA 2ZRCA 2AWNA 3BTHE 5JEDA 1TGCA 3ZZBA 2QMUA 3MSXA 1EESA 3CPJB 3RDZA 4JLJA 3I77A 1SXJE 2RB4A 1TLDA 4CEIB 1CA8B 4NGAH 4C3ZA 1MH0A 4ESHA 4PR0A 1KO5A 4KBGA 1N0UA 3R7WA 3OTPA 3W6PA 2O8DB 3MO6A 1IXRC 1PJRA 1T0HB 4Y71A 2Y81A 1N6RA 2N42A 4H6TA 5K7RA 4PAMA 1BO6A 4MYUA 4JCNA 1F0RA 2Z9JA 5C2ZA 2HPQH 5TCAA 4PANA 2GVFA 3U69H 4ZDWA 3GYLB 1I4LD 3KUCA 3JZAA 1DAIA 4GNKA 1ZMNA 4A1VA 3EZFA 2FOGA 4MQAA 3UPUA 2GZAA 1DADA 4ISHH 4HDOB 2VIPA 2R8RA 3UNRA 4KI0A 4DIDA 4CF7A 2IOTA 4B6EA 1JQJC 3PB1E 4MGIR 2J9NA 3D6TB 3MGCA 4P0TA 5HE9A 2Y5FA 2GJ8A 5KYKA 3TUZC 4WXVA 2C04A 1TQ2A 2OV2A 3LBHA 1EPTC 1W47A 2JA1A 2ZFSA 2IYXA 4UD9H 2ONJA 4AC9A 2JEOA 3C41J 1EFUA 3A7WA 3H1TA 3NXSA 1TAGA 2GXQA 2G5NA 1DVAH 4TL7A 5FXLA 1P9RA 1IN8A 2FTLE 4PHGA 3UR9A 1OH5A 2R6CA 2V8OA 4CT5A 1XEXB 3BG4B 1R5NA 3WHKA 4NONA 1SVSA 2V3CC 4F93B 4KKDA 1ZJ6A 4M7GA 3AP1A 2GMTC 2D62A 4QGHA 3V3MA 2ZNKH 3LH3A 1VG1A 4QHSA 3GEEA 2BDIA 1EZSC 4X1NU 1MTWA 2YWFA 1WV7H 4YMTA 3ADCA 3GJ4A 1KY2A 3SNEA 5JMTA 2HYDA 1A0HB 5JJIA 4HLQB 4I7YH 1SKYB 4O25A 2WWFA 1FONA 1SQOA 5L6NH 1T31A 1VTKA 2EWWA 4HLDA 4TYYA 1J8AA 1SGCA 2OZEA 4X6PA 1FJSA 2ZS7A 4DUGA 3T61A 3SGBE 1PPHE 1KI9A 3AM1A 4BLOA 3GY8A 3U1JB 4A0FA 4TZ0A 2WKRA 1UCYH 5B30A 1IXSB 4Y7BA 1GIAA 1ZRKA 1D9IA 2ANMH 1I2DA 1M1YE 2GP9B 1A3EH 1XCGB 2VU8E 2FGKA 1NY6A 5GJBA 4X1RU 4JLPA 1QHRB 2ZI2H 3BBPA 1C2FA 1D2MA 1AK2A 1KI1A 2IEYA 3ATWA 2ZJOA 2JATA 4A82A 5DYIA 1D6WA 2P94A 2PHBA 2Q3HA 2HXSA 2WWWA 1GHBG 1C2IA 4Q7LA 2RGDA 3QGNB 2PKAA 4N0EA 1KXFA 1SGEE 5DI3A 1IAQA 4BTTB 1XFAA 1QIXB 3P6ZB 1ZCBA 4DW2U 3WP0A 3RWMB 3M5NA 4YO9A 4ZDKA 3NIBA 3V4FA 1MABA 3M35A 5FUVA 4ABJA 1AO5A 3GY7A 4JLMA 1JPJA 2ZU2A 3FB4A 2GEUA 2Q9BA 4AYTA 4LZ4B 2JETB 3PV0A 4Q1FA 4KHZA 4FXGH 3DOEA 5L3QB 1O2JA 2BZAA 1DSTA 4YXWA 2NO7A 4Q66C 5SZHB 3O8CA 2HLCA 2B92A 2R9PA 4XWAA 1TAWA 2BEJA 1C1UH 1LTOA 1O3GA 4ABEA 1K1IA 1HAHH 3UFAA 1XTKA 2AEIH 4F4CA 5BRRE 4DDWA 1JR6A 1BCUH 1GVLA 2OC8A 2ZRJA 1OXTA 5E7JA 2A2XH 1G2MA 3K09A 4M9SA 5E0HA 5DP9A 2DB3A 1GRRA 3M5MA 4ZAEA 2GJ9A 1L4DA 4Y0AA 3QPWA 5FOWA 1DANH 1UVTH 2VL7A 1PV4A 3HWSA 1NC6A 1YZTA 1P9SA 2VP5A 1NMZA 3ZZ6A 3SQXA 1NNEA 3EA5A 1NVXQ 3RM2H 1W14U 2XITA 4IBLH 1P2JA 2FODA 3QG5A 4MNXA 3BN9A 1HYLA 2FDCA 1P3EA 1H8ED 2SGFE 2FTMA 5B2ZA 1Q12A 4B3XA 4EKDA 5JB8S 3SYKA 1LVYA 2WPJS 3AK5A 1XJ0A 2FFBA 2QIQA 5PTPA 1W2KH 2ASUB 5E8EH 2XC5A 2V1UA 2J95A 4I8JA 1TU3A 1NRQH 2ALVA 4JL8A 5TARA 1IHSH 1NBMD 4QRHA 1PYTC 2WKPA 5C5OA 3PIRA 3FTQA 4AYVB 4LCBA 5L8VA 3BGWA 3B9FH 4A5TS 1VECA 5HKKA 4EPYA 1G3MA 4DLZA 3WHLA 1A61H 1EX6A 2ZDAH 1GG6C 2GT8A 4MNWA 3G82C 2D7DA 1KIMA 3WRXC 2ZZUH 3LONA 4OS7A 1AZZA 1ZMXA 2CCKA 1Z6AA 1QL9A 3B1YA 1VPLA 4Y8ZA 1C5WB 3VGCC 6GCHF 1KKLA 3NZIA 4QBFA 5EP3A 1MR3F 5CM8B 3KQKA 4XE4A 4ASUA 1KI4A 3U5ZB 4JL6A 3HU1A 5M04A 3OZXA 3F3YA 5E3HA 1GMCG 4EFNA 4EQ6A 1CHOF 1JNYA 1DAMA 2UUJB 5A8ZA 2O5VA 3AP3A 2QF0A 7GCHG 2VO1A 1J17T 3RABA 1E9AA 2GETA 1E99A 2XEXA 3SV8A 4NIVA 2OP9A 1AQ7A 3MLEA 2VF7A 1ELVA 1ARCA 2WYGA 4IKEA 4FCVA 3LT3A 2P16A 1BKDR 1F2UA 1Z1JA 2QI9C 3KQNA 4CEHB 1G41A 5F98A 4AKEA 1LHFH 3VGCB 3SJBA 3NTUA 3ENSB 4DJTA 1ZUIA 2CLCX 1KLJH 4RD0A 1GI5A 2NU0E 3FVFB 2CJWB 5FOTA 2PJRA 1BYUA 1MD7A 2ZJZA 4KJZA 2IYZA 1C5VA 1A5HA 4WOPA 4DSUA 1FX0A 4YESB 3A88A 5FBLB 1SHYA 3QSYA 4ARZA 1U0JA 2NOAA 3GDUA 2YOFA 3RS7A 2BDCA 3OY6U 3OE7D 2H16A 2HEIA 1DAKA 2WPLS 4M9FA 2XB4A 3UATA 1WU1A 3FYHA 3D31A 421PA 1YHNA 2XXAB 3MHWU 4TWWA 1GJAB 3TNSA 1Z5ZA 5JBTA 3TR5A 2GA8A 2BD9A 4JZIA 1GSIA 4IVQA 4Q47A 4YM9A 2QMOA 3TBKA 3CO5A 3U9AH 4B3FX 2PZEA 3SJKA 2G1JA 5L3VA 1EG7A 1P12E 2BVXH 6ESTA 2F9BH 1RXPA 1HA3A 1VITG 3NEYA 2AL7A 3BTQE 2BIFA 1IQJA 1XXHE 1RD3B 1S1MA 3CS7A 1JIMA 2G0NA 1O2HA 4JJKA 3AVOA 1SGIB 3MTYA 1W11U 1C5LH 3TIUA 1UKZA 1TRYA 2X2EA 4GUXA 1C5YB 1JRTA 1D8TA 1SXJD 3TAHA 4LOAA 5JBAS 2TBSA 1FX0B 1FQJA 1E9CA 4P33A 1QHXA 2ERXA 3K0SA 4I31A 1LY1A 1HFDA 5JBCS 3B1VA 1NFYA 2XTNA 1K1MA 2QXIA 3SHFA 3RXQA 2CNWA 1V2RT 1YKTA 2VQSA 1IN5A 4NA9H 3TK9A 5A8YA 1H65A 1RJ9A 2HNTC 1FY4A 2JJ1D 1YPKH 2OUAA 1S0QA 2OCYC 2A30A 1RJ9B 4R8TB 3A1WA 4IEEA 2CE7A 4RJLA 4AFSA 1V2UT 3DFLA 1GNPA 4IC6A 4AG2A 4OHVA 1HIAB 1ZYOA 1LNZA 1F2TB 5E0GA 5FUXA 1M7HA 2OK5A 1GBMA 4FUDA 3EW9A 4A6XA 2J45A 4G5OA 2Z9IA 2XZOA 3I61A 3CRMA 4DT7B 2FI5E 5FUWA 2ZR9A 1Q20A 2FSHA 3KKMA 2OCBA 3A8BA 1CHGA 3UQVA 4ITRC 1LPZB 4MRVA 2YOHA 2XOKD 4A92A 2VSXA 3L6PA 2PLXA 5LBIA 1C5PA 1UTPA 3TLOA 1QBVH 3TJUA 3C27B 3SHAH 4D4JA 4CRAA 4NZYA 2C9OA 5FI1B 5K8IA 1IBRA 2GZHA 1KDOA 1BZXE 2EC9H 3V4RA 4TLAA 3NBFA 1WQ1R 4XWKA 1MD8A 1FN8A 3OESA 3O47A 2RHMA 2BMEA 3FP6E 1SHHB 2ZI4A 2ZE5A 2QTVB 4FU7A 1WBBA 3MO3A 2H1LA 2R3YA 3QNUA 2QAAA 1NVUQ 3IEVA 4KFSA 1OFUX 1OE0A 2IC5A 3X1XA 4IW4E 3RXIA 3THYB 1A5GH 2WV9A 4JLKA 3PXGA 4EPRA 2EFHB 2HCJB 2OFWA 4DOQA 3CRQA 4PQYA 1D9ZA 3M1IA 3NWUA 1TIOA 1JMOH 3BC1A 4FMBB 1VHTA 2A32A 4ABHA 4M1KA 1FMGA 1SVKA 1ZSLA 3VX4A 1VMAA 1W10U 2V0BA 4O2RA 3QG1A 4E06H 4FMDF 4B32A 2XTZA 2EEKA 2QYIA 3GOVB 4R98A 3LGYA 5T3HA 1IM2A 1KNXA 1SGRE 2VP2A 3EQ0H 2ZI6A 1HYQA 4JSYA 3SR0A 1F48A 3RMLH 2K5UA 1T0JB 5FFMA 3EC2A 1C5XB 1EX3A 4XOIA 5AJYA 1HUQA 1ACBE 1G1MA 1LKBA 3BH0A 4I1VA 2JLQA 1G7SA 1RFNA 1FFHA 4MPVA 3P4XA 3NH6A 1N8OC 5JCZA 4I8HA 2J7KA 1Y3XA 1TONA 4NSYA 3L0PA 1P09A 2XBYA 1LVBA 3E3TA 4FCWA 4BWYA 1CBUA 1QVRA 3F8TA 5BQ5A 3U3MA 5ETXA 1RRGA 4HZUB 2ZA5A 1A2CH 4D9QA 2ZFFH 3L0OA 3E1XB 3HGNA 3LX8A 3B60A 4Y8YA 4HTCH 2CBZA 1SBWA 4LC1A 2QROA 3GCOA 2H92A 3KQDA 1MO3A 2VH6A 4KSBA 1ZHMA 3ELAH 3ZVMA 1NL3A 2KAIA 1WXRA 1FV9A 1IQFA 1RTLA 1ZU5A 4I1SA 1C1OA 2VNTA 1ABIH 1BITA 1C5MD 1ANBA 1XMIA 2BM2A 1MTNC 3VR5A 4HAXA 5BW8A 1N0VC 1TGSZ 2PEYA 2ILNA 2F7SA 2NTYC 1AI8H 1MQ6A 2AS9A 2EA3A 2HF8A 4J2YB 2XSZA 3KXIA 3RXOA 2PGQB 3LIWA 3A4NA 3EYDA 4JLVA 1EGAA 2Z83A 2QENA 1DITH 4RSGA 1QB6A 3TH3H 4O3TA 5FCRA 4XSGA 2BCGY 1HAZB 4NYIR 2G81E 2BD3A 1YF4A 3SI4H 4L16A 3WMEA 1IXZA 5CK5A 4UE7H 5BYKA 1ZD1A 1OXUA 4LYAA 3RXRA 4HYYA 5A0FA 4DCVA 3RXTA 1Z83A 3AVYA 2ZI3A 1J15A 1HPGA 1O3CA 1F3OA 1NLZA 1XCMA 4URYR 1BBRH 5SGAE 1YRBA 2KE5A 2XNIA 3DO6A 3CPHA 1E4YA 2ZI5A 2W2VA 2ZGHA 1VYTA 1FI8A 4M1MA 5ELXA 3B8JA 3SU6A 2VHCA 2R2MB 1GI0A 2GMTB 4TZ6A 3BEFB 3AAUA 4XSKU 2J38A 4RKOB 3KJIA 4US2R 4UFEH 1G3IA 5ABWA 4NH0A 1W5TA 3LGTA 4GRAA 2A7QA 2J34A 2J41A 2CHQA 1L1JA 3TJVA 1EOLA 2BX3A 1Z0JA 3LVQE 5DYGA 5E4FA 5ESTE 2ODEA 3W6OA 1RPZA 3CF2A 3U1IB 2RGNC 2HF9A 3A1VA 2ERYA 2PX0A 1GKIA 2ZRHA 2FS9A 4US0R 3RXVA 1XJCA 3GLGA 3MCAA 1P02A 5JPMH 4M53A 1KK1A 4PHHA 3BSQA 1O3IA 1JAHA 4K46A 4YOJA 3AVPA 5CITA 3TAUA 2ZTZA 2XRCA 4ZKEA 4OQMA 4OHZA 1HAYB 1SGTA 2Q3MA 1THRH 5BXQC 2JDIA 1NPMA 1GRNA 1ELCA 5J4QA 2VHQA 5SZIA 1FMJA 5IDVA 2GGVB 5DP7A 3ZS8A 5AFZH 2DR3A 2H5EA 3ECCA 2CEAA 1WUNH 4KAXA 1BHXB 4JBWA 5KU1A 1YR6A 3UWKA 3O8DA 1ZC3A 1P9WA 5KHOC 2P3UB 3EE0B 2ZM5A 4LJ6A 3VB4A 2I1QA 1O34A 1M9UA 2WZQA 1SFIA 1SKYE 1KI6B 1N5JA 5EOKA 5TXGA 2BD8A 3RXFA 1OWIA 1Y5BT 1LDTT 2OILA 3RS5A 3K9NA 3RXSA 4LWZA 2Z7FE 1AE8H 2D2EA 2AK2A 5FBQB 2O8WA 3V00A 2VVCA 1GUAA 1RGQA 3VB7A 3K0CC 1HV8A 3B1ZA 4LHYA 4PXAA 3P20A 2NO9A 2HOBA 4QT8C 4UNQA 1NKTA 3IPXA 4HDCA 1AFEH 4ZXYH 3K70D 4L9WA 1BQYA 4IOLA 1G64A 5HR5A 4UXHA 2WSMA 2IX3A 2REOA 1ESTA 3THWA 1XD2B 1GBKA 1QTFA 5IYTA 3K0FB 1CJMA 1X6VA 5EXPA 1P2OA 4I33A 1A4RA 4FUCA 4D2IA 4ON9A 1U98A 1O38A 1W4RA 3LVRE 3AF0A 4ZCLA 3U6KA 5KTYA 2R6AA 1VCWA 2Z9LA 4Y0YE 2QY0B 1GBCA 3VR1A 2OEPA 5DSZA 4F92B 4B2LA 2BLWA 1R6BX 1FDPA 3TLXA 4JVSB 5K8UA 1GHAG 4XD7A 1GHBF 5HM2A 3KKNA 3FOZA 5FUYA 1Q1ZA 1H8DH 5JI2E 3WBJA 1EFRA 4PAQA 1O37A 2ZRMA 2GF9A 4DKXA 1D5CA 1KK3A 2J94A 1EK0A 4KFRA 1H4WA 4IOKA 2IN2A 3QEOA 1R4AA 3UIEA 2V6JA 1E2MA 2D74A 3UPEA 1C5UA 1ZNZA 3GY3A 2BC9A 1HT2E 4G0NA 4II7A 1O30A 2QRNA 1GBJA 1V3XA 4A15A 4OHYA 3SDZA 3NCLA 1IQLA 3WMGA 4CRDA 4I99A 5GJVC 3QIAA 1GDQA 1O3NA 4IFEA 4TLCA 1CSOE 5T1VA 1EP5A 2Q6FA 4MRPA 1RC8A 3QY0A 1HAIH 2WJGA 3DZ8A 1B7XB 1ZPBA 2G51A 2QBYB 1SVLA 3DHWC 3ATLA 2VP0A 2C95A 1S81A 5AF9H 4DGJA 1XTSA 1BMNH 1R8SA 3LO5A 1DE0A 4K8OA 2A2QH 4LJ4A 3DZDA 4B3GA 1HE8B 1YKSA 1QG2A 3IBGA 2QP9X 1CTQA 3RC3A 1UMAH 3MYWA 4TYDA 2PLRA 3K6YA 4DT1B 1KDQB 1RVDA 2VIDA 3TSOA 4MPUA 1ONBA 1W7AA 1SZPA 2Z3EA 2OXCA 3X1ZA 1LHDH 1P11E 3KIDU 3LV8A 1W0KA 2ZDKA 2ZXUA 2AXNA 2IK8A 3D3QA 1GCDA 8KME2 2EWVA 3FE2A 1UCYK 1GGDC 2ZANA 2DY1A 2VRWA 5L3RA 1HAPH 4JK5A 4POAA 5J4VA 2YKGA 1ELBA 3CWZA 3K9LA 5DG6A 3OF5A 2NWNA 2G6BA 2GKSA 5FPYA 2BKEA 2JJ8A 2WWYA 3ZVDA 1Q31A 1W0KD 2W2TA 2ZF0H 4GSOA 1UEIA 3M37A 1BRCE 1QR3E 1O3AA 3ICEA 5L2ZH 4DCSA 3AV0B 1Z6EA 3X2SA 4OK3A 3W9YA 1HJAC 1QRZA 1MAYA 4X8UH 1XVMA 4V03A 1YR7A 2GAAA 5FTMA 4K5ZA 1UVSH 4Q9JA 3S7HB 3KB1A 2ZYUX 4ACBA 1AB9B 1QBOA 1LPGB 1Z22A 1JBUH 2FP7B 5HZKA 1I4TD 2QM8A 1G18A 1PLKA 1XZQA 5AFYH 2LNCA 5CIWA 2W83A 3LH1A 1AQUA 5EPNA 2FI4E 2HDNB 2DWPA 2ZETA 3A8TA 1H9IE 4GI7A 1QRXA 1TX6A 4D4KA 1EAWA 5DP3A 4C2UA 2Y6TA 1NLYA 5IRCD 3GLGE 2Y5GA 3THWB 5EW1H 5C5NA 1IY2A 2I4IA 2PFEA 1P3CA 4MPWA 4JZEH 4U30A 2BBTA 3BIFA 1GBFA 4ZKNU 1CVWH 1DLEA 1ZCAA 1XMJA 1OX1A 1KLTA 2AMQA 2H5DA 1LHEH 1YQTA 4LRWA 4B33A 1I4DD 1BJUA 4TWYA 4U2WA 3MJHA 4TT3A 5KNBA 1DS2E 4MNVA 4BE7B 4IC5A 3M36A 1L4ZA 3W8NA 1D9XA 5L30H 1H8HA 1Y3VA 4AKIA 3HK6B 2ZC9H 3KUDA 3SI7A 2J92A 1DM4B 2P59A 1XUIA 1RIWB 5DE3A 1W46A 3N70A 2F43A 1BMFD 1EUFA 1AFQB 1U2RA 1GTVA 2CVFA 3GCGA 3H86A 3PMAB 1C5RA 2A2ZA 1LKAA 1NFXA 2Z3CA 1MUEB 1XD8A 2PSXA 2W2XA 3K0FA 1YYY1 1B0EA 2EW1A 4QG7A 3GJ7A 2SGDE 1O35A 3LW8A 1FPCH 1T9HA 3NPSA 1PLJA 2RGAA 1GJ4H 2AHOA 3PUXA 3WYAA 3DKPA 3VR6A 4CRGA 5LD2B 1YCPH 1XUGA 1SVPA 4TTQA 3DFJA 2WAYA 3PO1C 2P3TB 4ISLA 2KJQA 3KF2A 2RHDA 1OFIA 1Z6YA 1DT2A 1UKVY 4V0KA 3RS4A 1CR2A 4TMXA 3UG6A 2ZRLA 1MKXK 5E2PA 1IN6A 4B3BA 2P93A 2H17A 5T6FA 1INCA 4DLUA 4OS2A 2DFLA 3AKCA 1FW6A 2ZTXA 5DO9A 4XVQA 2ZEJA 4MKIA 4D80A 2OC7A 3X1YA 5UKDA 3SOSA 3UUZA 2IYYA 4GT1A 2PR3A 4XTRA 2ZDVH 3ODFA 5DLQC 4ISIH 4HAZA 1SGFA 4LI0A 3A84A 5EODA 1UK3A 4FXPA 2XNDA 5EE9A 1K1OA 1KSFX 4JJZA 4XH9B 4G5QA 2FOFA 4GSYA 5CB6A 3B23B 4U01A 3Q7PA 4J0QA 1LF0A 3K65B 4LHXA 3ND8A 3U8TH 4LBVA 3MNCA 3BTEE 4BTIB 1F5RA 1IN7A 3FWYA 3V12A 2ZFPH 2ZU6A 4NU0A 1KK0A 4ZMAH 3IWMA 3UG7A 3I1FA 1Z0DA 4JMYA 2V4ZA 3GLIB 3CP7A 1ELDE 3TQFA 3FAOA 5DI9A 3JVVA 4PSKA 4DLTA 3D65E 3ITIA 4O97A 2CNWD 3URDA 1SB1H 2QU8A 2ANYA 3KN2A 5LPEA 3THXB 2AGIX 4SGAE 5KSZA 1G3QA 4M1SA 3REFA 5GDSH 1G8GA 5HKKD 3ZZ5A 2QUZA 2W3KA 3ZYDA 1DG3A 5CM9C 2IS2A 1OP2A 5DHFA 4DLSA 4WMDA 1TEVA 4GMXA 2VIOA 1P2KA 1AZTA 1DAFA 1TQ0B 1E2IA 1JEDA 2ZCKP 3TH2H 3KQCA 2ZPSA 3MWYW 3U3RA 3RRNA 4HGCA 1DS6A 5CJ2A 1TQ7B 4B73A 3B1WA 4A7IB 4DWJA 3P8FA 3B85A 3GLGB 2GDJA 1C5ZB 1NN0A 1GVKB 3DA9B 2DWOA 4P4UA 4OYHA 5IDKA 2XXLA 1AN1E 3FKSA 3CNLA 5FR1A 1SL3A 1YU9A 3Q5EA 4HLUC 2WYJA 4JYTA 1ZM3A 3GD7A 4Q21A 3T62A 1E2JA 1NP6A 4DJZB 3GPLA 3GJ5A 2EFEB 5KSPA 3M4YA 4TQAA 1B0UA 1DX5M 3PYHA 4Y6DA 4MYHA 1VDZA 4L4UA 4WY3A 1TOMH 1FNIA 1XXHA 4J1YA 1Z8RA 4F4JA 1QHYA 3VFDA 3HPRA 2P3SA 2CL7X 4NCYA 3KL6A 1AMHA 3ZIAA 2WSSD 1O2XA 1THSH 4WH6A 3FMOB 5FHTA 1A5IA 3P92A 3QKRB 4ZPXA 3LC3A 3PTNA 2ZQ5A 3W3ZB 1BIOA 1XPOA 1V2WT 1H8EA 1V2OT 3TH4H 2ZRDA 1TBRH 2X77A 3W5IA 3TNTA 3L0SA 1Z8JB 2FFQA 3BK7A 3DM9B 4EPXA 4Y7AA 1NRRH 3I29A 3PMBB 2AFQB 3MH4A 4P4TA 3PV2A 3NBXX 4C0SA 1MKXH 4K1TA 6Q21A 4BRWA 1RKBA 3CWQA 1GJ7B 2BVRH 4R7ZA 3SHWA 2QN6A 4NL4H 1W0YH 1B5GH 1UK4A 3RC5A 2CL0X 3NEJA 2WWHA 621PA 3GCTG 1J9CH 5FR2A 4Q7JB 3IDQA 2NPIA 2IW3A 1O3FA 2Z94A 2PBRA 7ESTE 1AZ8A 1Q3TA 3MG9A 2FA9A 4BFSA 2RGEA 1YM0A 1OKKA 4Q7KA 2PX3A 3BD9A 4OS6A 3VB6A 1O5AB 1KGDA 1GZSA 4BUJA 3P17H 4YLQH 1NY22 4U5XA 3DKVA 4BRUA 4X8OA 1IY1A 4MUBA 4RCZA 1TRNA 4B3CA 4NYMQ 4ZKRU 1EXFA 1COWA 2GXUA 4KGAA 2O8EB 1E1RA 2G4UA 4GHQA 1HAXB 2ODNA 4KSCA 2FS8A 4GLYA 4U00A 2MSEB 3LXRA 1KJZA 4MRSA 1U8AA 3K8YA 4X1QU 2PJZA 3RANA 1C5TA 3PUYA 3NKVA 4PFSA 3KFXA 1N5LA 2CVHA 2G5VA 1Y63A 3JVUA 2VGCC 1W49A 2MMGA 1GMHG 2ANKH 1FOEB 3QTOH 3QK1A 4ABBA 5J4SA 1E2GA 2CLDX 2A4OA 2CL6X 1DVRA 1KMHA 1M34E 2EFGA 3A89A 6GCHG 2V3OH 4FVBA 4LK4A 1AUTC 2QXGA 4A2PA 3RVBA 4BPBA 3VU9A 2LKDA 1E9FA 1KSJA 1UVOA 1P61B 6LPRA 3A1SA 1O3LA 1VG8A 1A2KC 3SYNA 4B1TA 1TU4A 3IKJA 4V02A 5HCIA 2W6JA 2RMKA 4TL8A 1WA5A 1YZKA 4INHA 1MKYA 1GJ6A 2YYZA 4ABYA 1Q3HA 3LXXA 4TQUS 1FIZA 1CKEA 8GCHG 2CN0H 1TABE 1CT2E 7GCHF 3UMRA 2GAOA 1CO7E 4HI3A 5DISB 4IOJA 5C20A 2VVVA 4MGZR 2W6JD 4R2IA 4CGZA 2YV5A 3EX7C 1NIJA 2G4TA 1KI7A 3PMJA 3A7YA 2QMHA 1O2NA 3AEZA 2CK3A 2ZP0H 3AF4A 1SG8B 1XBTA 3ZLJA 1HXEH 2B5TB 4B43A 1YCPM 1ELGA 1ZM4A 4GAWA 1IY0A 2IYLD 3NH9A 4K8BA 4Z54A 3AH8A 3EZ2A 1D3DB 1W7GH 2AIPA 4NCIA 2B7CA 2FSFA 4W7SA 1YBWA 1IQMA 3VXFH 4US1R 1TTTA 2BHRA 4THNH 1AS0A 3SNHA 4DLVA 1P2SA 1ETRH 5J4LA 1KYNA 1NJFA 4ZDIA 1KDRA 5GVRA 1XMNB 4BFZA 3HU3A 2ZVPX 1KY3A 2HUPA 121PA 2UKDA 4S2EA 1XEFA 2VWOA 4YQFA 1CT0E 1IJEA 3W5JA 2ZYTX 4YZUA 2HLDA 1T8NA 4O0MA 1BH2A 1UDXA 2VH5R 3HKJB 3U3KA 2UUKB 4Q4AB 2OO7A 4RCYA 1J90A 5FBVB 1SXJA 2O0HA 4AIIA 5IF9A 2D4HA 3Q72A 1GJ9B 4M1YA 3Q9LA 1P4SA 3K6ZA 3SO3A 2NO1A 2C9YA 5TB5A 3WYFA 2DFNA 1AQYA 5JS7A 2PH1A 1W8BH 2ZSFA 1NLFA 1YE8A 2H5CA 2O0KA 2F1JA 2ZU4A 4NYIQ 2F4LA 1BTHH 2D06A 1OW3B 3QKUA 1F0SA 1ZD8A 3ODDA 3OIVA 1C1MA 1JAIA 1YRAA 3K0CA 1KYIA 3IHWA 2F83A 3T28A 2STAE 2D2DA 4Z1MA 4LBYA 1VCMA 3CB4A 1X3SA 7LPRA 1Z6TA 2BM1A 4CRWB 1ZZZA 1GWAA 4WXPA 2A45B 5EZ5A 4D6PA 1E2FA 3U7HB 4MDSA 1QBNA 1RRCA 2GCTB 1BA8B 1QVAA 1DELA 3T27A 3QX5H 3SV6A 1ELOA 2ZU5A 1YPEH 1Z2AA 5JWOA 2HPPH 1Z1IA 1SOZA 2FEQH 3RM0H 3A81A 2P65A 4PZLA 2OLJA 3A4LA 2AKAB 2FX3A 4LJ7A 1CE5A 4WZAE 3Q76A 1T8UA 1KNQA 1XKBC 2VHUA 2C9CA 3RXBA 5FOSA 4OI1A 5A4JA 4NZLA 3HR7A 3MU4A 2W7UA 3DMDA 3TE6A 5FL3A 2XZPA 1ZNYA 4INKA 4AX9H 2FE4A 4OHWA 2JH0D 3FFAA 4ZKDA 1TYNA 3ZIAD 1KZ7B 3UNQA 4NYJR 4YOIA 1O2KA 1H9HE 4B44A 5GNDA 4GCHG 1M74A 1GCTB 1PPFE 4DEXA 3BTME 1NROH 4AKHA 2ATXA 3CZPA 1GJ8B 1OB2A 4IFBA 1KSHA 2QG6A 3QTVH 1WDTA 3GLHA 3RSLA 2SHKA 3TMKA 1O2QA 2R65A 1AKSA 4V0NA 4KTCA 4D7FA 3AW1A 5KNDA 3TJOA 4DLYA 1O2LA 2LPRA 2CV3A 1FUJA 2ZWLH 3LRPA 3ZDQA 1GDNA 4WMFA 3HK3B 1KI6A 1JPNA 3BFVA 1II8B 2ZPQA 2Z9GA 2ZRBA 4JYVH 4ZI3A 3W8RA 1F7ZA 1L0ZA 1PFXC 2FZLA 3CENA 2OE2A 1KXAA 3A8AA 1UK2A 1UBFA 1EFHA 5BN3A 4D82A 3AUYA 1AIPA 1BOFA 4OQLA 5I25A 4LYHA 5KNCA 2G9NA 2GCTC 1QJ1B 1MKWH 5FL7D 1KK2A 2PSYA 5FH9A 2MSDB 1S96A 2RGGA 3I8XA 1O5CB 1QHGA 2AMPA 4PROA 1NMYA 1KOFA 5EE1A 2AH4X 1DWEH 2R0KA 1Z7KA 5A0AE 4ZH8A 4W5HA 3BXZA 1GL0E 3LGVA 3VX3A 1CIPA 4QBGB 3QXSA 5AJVB 4LUCA 3U2QA 5KDDA 2VVUA 4D26A 4BZXA 1R0YA 1XTRA 1EJMA 1D3PB 1ELEE 1PLLA 1MRNA 3K9XB 2C99A 1YR8A 4Q1CA 3JZ1B 2VYFA 4XBCA 3TVDA 3P95A 1ETSH 3QXCA 5LB2A 4LHWA 4PC2A 4HI0E 4KLZA 1O0DH 3L8ZA 2ZJYA 5F9FA 2JAQA 3ATKA 5JS8A 2H6MA 1TADA 2IWRA 3TITA 4LBZA 1UAAA 5EQTA 4DIIH 1EJNA 1G36A 2OLGA 4A1FA 3QJYA 3SI3H 4OJQA 3C8UA 3H4MA 4TMTA 2R44A 5EUQB 1P60A 2ZE6A 2H1UA 2WHXA 1PPZA 4RD3A 2YC2C 4X6MA 4LZZA 3WP1B 3RXUA 2RDLA 1GI7B 4BAQB 1P05A 2HXYA 1W0ZU 4CT4B 4PSAA 4LV5B 3BTFE 1B23P 2SGQE 1NBMA 4A8JA 2OQ5A 4BGDA 5B6LA 2BV3A 1N6HA 4BFVA 2C93B 3ONWA 3TPIZ 2ZIQH 1O3YA 2A5KA 3IILA 3R9XA 4Q1BA 4RZUA 1RIWC 4EJSB 3TUJC 3K53A 4EJSC 2QN5T 4Q18A 1M2OB 4PPQA 2ZR0A 3ZZDA 1E2EA 1Z6XA 4URVR 3GLHB 4HATA 5JJKA 2GX4A 2FWWA 2GTBA 2F1RA 4Q7XA 5EUMA 2QSZA 1EWRA 3AVTA 1L4UA 1X7AC 2ZE7A 1LPKB 2AK3A 1UBEA 4TY6A 1G3UA 1P75A 1Z29A 1K8RA 4OQNA 4NMMA 2BYAX 1GHWH 4MG3A 3UKDA 2OESA 4OJKA 1KSNA 1CQQA 2HLDD 3ETLA 4B2IA 2NMVA 4LYFA 2ANCA 1SMFE 1OH8A 1AWFH 4OS1A 4QJ3A 4N0DA 2CF9H 3QF4A 3M3SA 1YR9A 1IQIA 3CRVA 3PMHB 2DBYA 2NU2E 1R2QA 2ZS8A 1YPHE 3SGQE 1IN4A 1EB1H 2BBOA 4A0HA 3Q5DA 1AN0A 3NKKA 4PTLA 1V2KT 2VWMA 3SNCA 5FX6A 1V2VT 5FTKA 1JALA 3I32A 4UXIA 1QHHB 1E3MA 1O2GH 4JMPA 1A0LA 1XEWY 4Q4HB 4B71A 2Q6GA 1NI3A 2VWLA 1KJWA 3E90B 3BIUH 3NXPA 2JLWA 5C3NA 3OEEA 5G3ZA 1K5DA 3LU9B 1GHXH 1S9HA 4KU4A 2BBSA 2YWGA 3KL4A 3CM0A 4IDOA 1OKKD 3EASA 1ZSKA 1Z6JH 4ZI2A 4WZ6A 3T15A 1ZINA 3J81k 1E2PA 4IN2A 1OT3A 1VJAU 2XCNA 4RZ3A 3G5UA 2DWQA 1SOTA 5TCCA 2NQ2C 1S0UA 4FUHA 1A5TA 4UNRA 2V3HH 1NS3A 1II8A 1OPHB 1C1YA 3KJHA 3PR1A 4TMKA 5JWHA 5K8LA 1XPRA 4LJ8A 3LLUA 3QPVA 3ZZ8A 4UXJA 1OYYA 3MNSA 2A78A 5JECA 2QP4A 2A5AA 1OKXA 3R7WB 2HRVA 5E95A 3GFOA 3CIOA 4OI4A 1K1NA 1GBLA 1C1WH 5C1YA 1QQUA 1TNHA 1LVOA 4Y79A 2EYUA 1NTPA 2V54A 1E0FD 2MMCA 1EAXA 2DCUA 1CLUA 4AGKA 4KODA 2IL1A 2WPKS 3A7ZA 2FYRA 4A6PA 3A82A 4RD2A 3TR0A 1DSUA 4NYMR 3FZDA 2IJOB 1VCQA 1TF7A 1VIYA 4KVAA 2PWXA 4BOHA 4NFFA 5E0JA 2JGNA 4ABGA 1ZHPA 2WPDA 1HE1C 2A5DA 3E5HA 2R6GA 1FIWA 2QQEA 3SNDA 3IIMA 4FUJA 5FAHA 1O3HA 5GJCA 3SU8A 2ZRNA 3DHKH 2DE9A 1XUJA 3BB4A 3C4JA 4H1VA 5EP1A 3B7GA 3TH5A 3AVXA 2P5SA 4AI6A 1I2MA 3A4MA 1E9EA 1Q1QA 2OXRA 3IIJA 4FUIA 1P3JA 2RH5A 3U44B 4RI0A 4E03A 1Y3UA 4BQSA 4WAUA 3ADBA 3CS0A 5BPEA 1OIVA 1YZGA 5ESBA 2OBLA 1YCPK 1YLCA 2J0SA 5A09A 5FBWB 4F7WA 1O2YA 2H9HA 2AFHE 3SJZA 2WICA 1P9UA 1ESAA 3EA9A 5FOXA 5EE5B 1ZHRA 3MUFA 1AM4D 1E36B 1NFWA 5AJWA 1DXPA 3UQOA 4MGKR 1F2TA 1NESE 1FTNA 4ZCMA 2ORIA 4PPGA 1HAGE 2BX4A 1OWHA 2J46A 2OFOA 2ZS9A 5HCNA 4NHOA 1WF3A 5C67A 1OLOA 3AP2A 1OWDA 3SJ9A 4D76A 4TLEA 1PPBH 2B7DH 1SFQB 1GNQA 4HAWA 4NKRA 3NWJA 3THOA 4ZKSU 4C2TA 4NCKA 4Q4JA 2OXSA 1GILA 1E1RD 1G20E 2BOVA 3T2NA 3AVZA 2BDBA 4CRCA 1YZUA 3SJAA 3ZVLA 3KGPA 1VITF 3VHLB 3ZZAA 1W2HA 4ZHLU 4Z6AH 3CPEA 2VJ1A 1LMWB 4Q9LA 2FPKA 3VQTA 1N6KA 4W5WA 2ZROA 2XNDD 2VB0A 4B6FA 2A4RA 2VSOA 3VKHA 3OX7U 3ZVEA 2Z43A 3FKSD 1CT4E 1O3OA 1ZGVA 4JZDH 1TALA 4FWIB 3QVUA 1WXQA 4JLNA 3FP8E 1FZZA 3QF7A 3UANA 3MOCA 3LH5A 1C2JA 2QTHA 2GILA 4PQFA 4DSTA 3PLKA 4B3DA 2FI3E 1II9A 4AB9A 1SHZA 2ZECA 2WOJA 2CJIA 1BYIA 2Z0MA 2FEOA 1Z2CA 3QI2A 1A7JA 4LV8B 1AU8A 2BDAA 5DP4A 5FTNA 5A2MH 5JI3E 4Q4JB 1NRPH 4IVRA 1O3JA 2GDDA 1FNMA 3NC0C 2XJ4A 1OF1A 4JYCA 2J0QA 3BG8A 1TOCB 3AQ4A 1ZM2A 3AGPA 1XPUA 4IN1A 1GDDA 1CA0C 2IS4A 1Z8GA 4JS0A 2XW9A 2ZQ1A 3PVSA 3OIWA 2QT0A 5F2EA 3KNXA 5EXXA 1XB2A 4OK6A 1DO0A 2DE8A 1NT1A 2C8XB 4HAUA 3STIA 4NWKA 3TUIC 2WMNB 2IHYA 4YMVA 1QHIA 3SW2B 1C2HA 5EXTA 4DB2A 1EZQA 5EJEA 3LJOA 2OHFA 3WYGA 2UUFB 3ZVAA 1KI8A 4E7RG 1HJ9A 2GVDC 2VIVA 4TQ9A 3M0EA 2B8WA 2ZJBA 1D4PB 2IWHA 1US8B 1MABB 2JIZA 4AG6A 3RU4T 2ZRFA 1F2UB 1UKYA 2R0LA 3K2UA 1ANEA 3AGQA 4PPNA 4XFQA 3HGPA 4EUNA 1E96A 2H7VA 2GCHG 4TSFD 5BN4A 5JZVA 3A87A 2W0SA 3DVLA 3LDAA 1AVXA 3AB3A 4CVNA 4X0WU 1C9KA 2ZHWH 4QFMA 1VIAA 2FXRA 5JFGA 4I1OA 1DARA 3TK1A 3VEQB 1JRSA 3PO1B 1XVOA 3FZZA 2E87A 1T8TA 4Q4HA 1ELAA 4KELA 3KQUA 4C7OA 2HWLB 3N5CA 4D0LB 4Q4LA 4KYIB 1HLTH 1E9DA 1P10A 1OXVA 3B9QA 2SGPE 1Q1BA 2IYSA 2BLQA 2IYQA 1U94A 1S82A 3BG4C 4YT6H 3B8HA 4RKFA 1QNJA 3IO5A 2AGEX 2J59A 2QM7A 1U6QA 1MZDA 3U6BA 4IMQA 2ASEA 4MGYR 1T7CA 1HH4A 2WV5A 3ICQB 2CE2X 1G3EA 4DLWA 2FIRH 3T1TA 1BTZA 5CHAB 1DWDH 2ESTE 1BTXA 4ZO4A 1ANDA 2QZ4A 3E0NB 3W34A 4OI0A 2QP3A 4LYJA 4AGJA 4I81A 1W5SA 2JLRA 4CHAC 2YINC 4LJAA 2AKYA 5HPYB 1Z63A 4YMSA 2XB2A 1O5EH 3GLFE 1BMLA 1GL6A 3QQ5A 2SGAA 2C3SA 3F6UH 2F3RA 4U02A 4XWOA 1YP9A 1JR3E 1HXFH 3TKLA 3PV5A 4GOJA 4C30A 2IHBA 2O8MA 1K1JA 4C0BA 1MCTA 5G40A 5DK1A 5AK0A 2O8FA 4YXWD 3L82B 1W3CA 2GESA 3RC8A 1JR3D 2GXSA 4I8GA 3FANA 3TSZA 3B5JA 3VAAA 4UONA 2PV9B 1MOZA 3RXAA 2OAQ1 3L0IB 1EAUA 3RRMA 3AF1A 3H2YA 4IEIA 1BMMH 1JXMA 3TVTA 4HB0A 1JJVA 2QV1A 1NVWQ 3AW0A 1T91A 3ZVCA 3E91A 2Q6DA 3PITA 1HTWA 3EIHA 3K9HA 4AWXA 1EASA 2VIWA 1ZW6A 1DLKB 2ZDLA 2J0UB 3G01A 3U7GA 1EFTA 3NC1C 1GDUA 5P21A 2OM2A 4YT7H 5EXLA 3MWLA 1SVIA 1XX9A 3F9EA 2H9EH 3CX8A 3FMPB 1WE2A 1NMXA 3FDIA 1E4VA 1MV5A 3SZRA 4BLPA 1MTSA 2IXGA 3U8OH 1RYHA 4PZZA 1W36C 3BJIC 1KO8A 4G5GA 1UFQA 4WVFA 5D3QA 2ODPA 1T6NA 1XP8A 4Y76A 1DY9A 1BRAA 1UDWA 3DUXH 1NF3A 4EPVA 4PHTA 1P7CA 4X6NA 1NM6A 2ZCLP 1H8IH 1O5DH 1TB6H 5KUTA 5JB9S 3SC3A 1S84A 1UTKA 5TVKA 1P6XA 2A4GA 2AYWA 4IDQA 2UVQA 4RFSB 5EQSA 4NPHA 1UEJA 3ZZ4A 1YPMH 3P1JA 3IQWA 1E2HA 4MRRA 1QB1A 1RRPA 4BTUB 1VCNA 5JJLA 1IOZA 1Y3AA 4I1UA 4QNRA 1WCZA 2R6DA 3R3GB 1JXOA 4YLUA 1UBGA 4DDUA 1OB5A 1MU6B 3BTKE 2HALA 2FNAA 4M9QA 1NSFA 821PA 3CLVA 4QJ5A 2CK3D 4Q7MB 1G17A 1C1VH 3CONA 1K5GA 2GCPA 1NN1A 5KDLA 4JLBA 4B75A 3GY5A 5EXMA 3G0HA 3IHLA 4C7OB 2YWEA 1JJ7A 1O2PA 3UY9A 4TT3D 3LQQA 1CP2A 4HB4A 2GCNA 3CNOA 5A8XA 4A1XA 1L7VC 4M22A 1HRTH 4ZHAA 1BDAA 2ANBA 2RGXA 4ISOA 2N1BA 3ZD6A 3KTAA 2A5YB 2XGJA 4FINA 3SQWA 3Q77A 1HUTH 1RZ3A 2IYUA 2YNBA 3N7OA 3K9GA 1P01A 2FPZA 2BB4A 4QC2A 2Q6TA 1J16A 1ZUHA 5KSOA 5FBIA 4TYWA 2QORA 4L9SA 4PC6A 8ESTE 4NBSA 3AF3A 1XUFA 4TY7A 2JKHA 2WPMS 1E32A 3GY4A 5HTKA 3SQEE 1XXDA 4U32A 2BMDA 3LDXH 1CJKC 3EZ9A 5DO4H 5DNYB 3K1JA 1D3TB 2ODWA 5T6DA 2OG2A 1D3QB 1CU1A 1AA9A 4MKHA 4KCGA 3FFGA 4D0GA 1TMKA 3SU2A 4Q02A 1PQAA 3I4LA 3CX6A 3SOPA 5CJPA 4ZROA 4IDPA 1O36A 1EKBB 5CMXH 4X1PU 3MH7A 4Z1MD 1WQSA 3KCGH 1E2KA 2XYAA 1JR3A 1ZMLA 4KITB 5LGOA 3ZZTA 3TGIE 1NU7B 4JZ1A 2FEMA 5H8WA 5LDDC 4PC7A 1TMUH 3TJNA 2OINA 3RDPA 2Q9AA 3M5OA 4LX0A 1QY6A 3RC4A 3GLFA 2JJ2A 1FAKH 1NU9A 2GVZC 2YOGA 1J99A 3VMFA 3M3VA 3UTUH 4YC7A 3T25A 4M4SA 4BECA 4PAOA 1XWIA 1WCV1 2PZFA 2KWIA 1LQDB 4DIHH 3LLMA 1MBMA 1CR1A 4MKGA 2NO6A 4DHEA 3RMNH 2D26C 3EG5A 3MWKA 5KDOA 3FGNA 4TYPA 1RRFA 2BD4A 3QXXA 2AFIE 2QCYA 2J3EA 2GV6A 3OU0A 1DDJA 3SUEA 4V0LA 3RLWH 2J4IA 4K81B 3MD0A 2EVWX 3DD2H 4JZFH 4MVNA 1C5QA 2XBWA 4MKFA 4Q1EA 3HDTA 1P2IA 4CEIA 2WJHA 4ZCIA 3T5FH 4NCHA 3BTTE 1H1BA 3IITA 1MH1A 1FL9A 3CRRA 4Q9IA 3GDVA 3W6NA 1W4CA 5HZHA 4BEBA 4URZR 4TYQA 5FBRB 3X1WA 4LK2A 1XRJA 3AAVA 2CMYA 2YJTD 3LC5A 3QZRA 3R0FA 3SNBA 2X8AA 4ABDA 4G5SA 4XJXA 4VGCB 2BEKA 1C2EA 4A2QA 1IQHA 2P6UA 3FHCB 3DL0A 2DPXA 5CLQA 2XNSA 1C1NA 1BTPA 4WVPE 2Y8EA 4I8LA 3A86A 2GCOB 2F3TA 2PTNA 3EXAA 3Q8XB 4NYJQ 2UUYA 1OXSC 1IQPA 1DAGA 4JIMA 2AMDA 3RU4E 2FFAA 2FOCA 1KAGA 2WJYA 221PA 2ZU1A 3K0AB 4IMZA 2VP6A 3T12A 3MO9A 1O2VA 2OQUA 3UWJH 4NE2A 4OKSA 1CJVC 3S7KB 3RAPR 4V0MA 3ZZCA 2ATVA 3SYLA 3KFVA 1T4UH 1P2MA 3VB3A 2F9PA 2XC0A 2EFDB 4A4DA 2PKSB 1ZM9A 1YGCH 1KTSB 2F91A 1YPHC 2BD5A 1GRQA 1X8LA 3W95A 3CRW1 4VGCC 2CHAB 2JLVA 1A46H 4X8HA 3GLHE 3NBZC 2QPTA 1V2NT 3HKIB 4XDEA 4JYBA 4ABAA 3QKSB 1O2RA 3BIVH 1GVZA 3A6PC 3KEEA 1W4AA 1EX7A 4KFTA 4EPTA 4E22A 3H7OA 3OIYA 1L8QA 4M9ZA 2XJ9A 3QKSA 1AVGH 4IVPA 1WBDA 2O9QA 1OSSA 1G3DA 1LHGH 1TA6A 4WMEA 1E79D 4TWZA 1KXCA 3PROA 3O8RA 1Z0AA 3W3AA 1OWEA 2N46A 3VXEH 4X8TH 4LDJA 5JCPA 5EE3A 1VKJA 3VNVA 1YZLA 1UBCA 1ZYUA 4C4PA 1O5BB 3ZV9A 3GISB 2XBXA 5L3SA 2PCJA 4F38A 2WJVA 2G55A 4I4LA 4YMWA 3I3SR 1R5OA 3ESTA 3QGJA 1E79A 4UNNA 3PWBA 1P5ZB 2J0VA 4WXRA 3CZQA 4AN7A 2CJWA 3TSWA 3NHAA 1N0WA 4U7DA 4G1UC 1S9DA 2PL3A 2ZG0H 5B64A 4C0AC 4URWR 5GADl 4IS5A 4TMZA 1V2PT 1F60A 2GDEH 4Q7YA 4KXFB 4ABFA 1E9BA 2GF0A 2IYTA 1YPLH 2AN9A 2JLSA 2FPLA 2ZKSA 4N1AA 5IK2D 2BD2A 5DIFA 1TX7A 5GVSA 1DXWA 3HR8A 4WA7A 2CXXA 3QDZB 2J5XA 4LV6A 2Z5FA 2OD3B 5EU8A 5J4KA 3KJGA 3AKYA 1EPTA 1GJCB 721PA 1S5SA 1TF2A 1US8A 1F5LA 4A1TA 4TLBA 1G32B 5IK2A 4IXNA 3BOSA 2LKCA 3AVUA 5L2YH 3RXGA 2R2WU 1XTQA 3ASYA 4BFUA 3EA7A 4D9RA 3CKLA 5CYPA 1BB0B 1GNRA 2KI5A 3JZMA 2BQWB 5H70A 1G3CA 3BV9B 4URUR 4MQBA 1G2LA 1ZC4A 2F9OA 1S3SA 2XSZD 3Q3XA 1X8KA 3SU4A 1O2ZA 1M6NA 1TA2A 1GI9B 2GTPA 2GK7A 1FAXA 4Z51A 3LJJA 1QHNA 5E7IA 3AUXA 4HAYA 4DLXA 1IHUA 2OFXA 2ZJAA 2BXTH 2BZ6H 1VCIA 2B9LA 4XSHA 4OGYA 1ESNA 1BRUP 4GBMA 2QE7A 3IUYA 4ERNA 3L2OB 1AVWA 4FUFA 2TGAA 3VB5A 2IF0A 3SBKA 2B8OH 1SQTA 3Q00A 1W36B 3VU9B 1UHBA 1VGCC 3RXDA 4CR5A 3GJ8A 3B2EA 2XTMA 3EIEA 5AR1A 3ZQ6A 1V6DA 2ALPA 2XTTB 3LGWA 1Z8FA 5J4HA 3P8OA 3B1XA 5D3MB 4CEJB 1E98A 1G7CA 4XOJA 4P32A 1FNNA 4CEHA 4HEJA 1MTVA 4KTSA 3U3OA 5AHGH 3FFBA 1GG6B 1G5RA 1TQ6A 3S69A 3FVQA 1MKWK 5A5GA 1TMTH 4RD1A 4NCJA 3HJNA 5EPYA 1AY6H 1AFQC 1EAIA 2O8FB 3B6EA 3RWOA 1HB0B 4KVGA 1GWNA 2X2FA 2WPDD 3TQCA 2O8BB 1QCPA 2P95A 3SJIA 3T5GA 3SV9A 3M7TA 4GZMA 3U4QA 3T35A 3IO3A 3KQEA 4R9UC 5C4MA 2P0EA 1JEEA 2BVNA 4GPGA 5CK4A 2WINI 1CR4A 1OWKA 1S83A 2WTUA 2VSFA 2AGGX 1SSXA 4ZIRA 4HB3A 1AJEA 1N8OB 5LH8A 1AD8H 4BFXA 1D2NA 2V55B 3C5CA 1WBGB 4G3XA 2GCOA 1RW4A 1CA0B 1GBBA 1PQ5A 4BAOB 1TFXA 2AWOA 1OYTH 1ZPCA 2TMKA 2WKQA 2GCHF 2P8OB 1KAOA 4LHVA 3DMNA 3H09A 1ZOMA 5DP8A 3ATMA 1EOJA 3MFJA 2HCBA 4EQ6B 4CRBA 4XD7D 2FU5C 2B6HA 5F03A 1E2LA 2GNOA 3BFKA 2IJD1 4WIAA 4BZQA 4GCHF 3F0TA 4DVGA 1ZRBA 1QG4A 1OYQA 1LVMA 4RSPA 4CEJA 2BQ6B 1N6LA 1PUJA 4B2PA 3KKPA 1SC8U 3GJ6A 3ZVRA 1IONA 1OJLA 4X2XA 1XEWX 1VITH 1NG1A 2P67A 2Q3FA 3AVWA 2WVJA 1TGTA 2A5IA 1PUIA 1GM5A 4Q1AA 4QGGA 1NRNH 3GCNA 2P2LA 3P4YA 2ZDNA 1C2MA 3OE7A 2QA9E 4RFSA 1TPZA 4IGDA 4CW7A 1QRWA 521PA 1XKAC 2ZFQH 1QL7A 4E5UA 1C2LA 4JVNA 1GHVH 1W7XH 5GCHF 2FOEA 3PEWA 4B47A 3NDBB 4R2HA 1XM1A 1UADA 1MO5A 3I5YA 4RFVA 3KHVA 1XXHB 1NJGA 3HPTB 1E35B 4A6LA 2WBLC 1U90A 3M3TA 2BWJA 4X6OA 1CR0A 1HAVB 2F9UA 1O2SA 3RP2A 3SNAA 4XVRA 1SLVB 1R0WA 3V0XA 1A1RA 2BKUA 4MLFB 2NU3E 4JYUH 3AVVA 1C1SA 5AWFC 4X8SH 1YJ5A 4AG5A 3M7QA 1X86B 3SQHE 4ZXXH 1KSGA 1LQEA 2GJSA 4PO1A 1UKEA 1W1WA 2A5FA 4NG9H 1GFIA 3TGKE 1KDPA 4KFUA 2HNTF 1DOAA 1A1VA 1A7SA 1KTTB 1E2DA 1ZM7A 3WNDA 1ESBA 1ZNWA 4JT2A 1R10A 2ZJ5A 3FPAA 4RKEA 2KBFA 2WJIA 3W94A 3KTAB 1PPGE 2WUCA 1TUIA 2PCLA 2C8YB 1AHTH 3I92A 3SZEA 1T5LA 1Y59T 3SORA 3T06B 3QUMP 1M8PA 4LSGA 4LC0A 3CX7A 2AERH 1L2EA 4GOKA 4ZHMU 2AIQA 4CDGA 1CHOG 2Z9KA 3GCTF 3C15C 2W3IA 3LFUA 3RMOH 2NIPA 1COWD 2A5GA 2GEVA 1B0FA 2WV4A 3ZGXA 2ZSDA 4HFPB 1Y8TA 3OAAD 2FN4A 4X8MA 1NN6A 1C5NH 5JRJA 1DG1G 4TL9A 1V2LT 4M9XA 2ZHQH 1HAVA 1C1RA 3UNSA 4NTZA 5ANRB 3ND9A 3RHFA 3WNCA 5FTLA 2IS1A 5EXSA 1ZP6A 3ZJYA 4JT4A 4V0OA 1LHCH 2ZSAA 3T1QA 2RA0A 1O33A 1PVOA 1S6FA 1QRAA 1Y5UT 1DBSA 1E2QA 4OL0A 5JBQA 4LJYA 3N2IA 4LPKA 3AKEA 3ZVBA 2ZVQX 4DC9A 2ZAMA 4FW9A 1OYWA 2WWIA 5HGGA 3BH7A 3OEED 1DE7H 1HQCA 1P8VC 2ZUCA 4UFFH 1T3HA 3PEUA 3CUEF 3PM3A 4YDSA 1K1PA 2ZIAA 2I6QA 3SUDA 3KQBA 2BCJQ 5FOUA 2XWBI 1KXEA 4MPXA 1BUIA 2FG5A 3GY2A 3JZ2B 3HPQA 1HBTH 1N6NA 1AE5A 4H6SB 1NN5A 3SU0A 2FM2A 2R3UA 1HCGA 1G7RA 2W00A 1GBDA 4Y0ZE 4DSNA 1OOKB 1O3PB 1Q22A 3SJ8A 3A83A 1N3BA 9LPRA 3PG5A 4KLNA 1E0JA 5J4YA 4CREA 1TMBH 4JBXA 1BTUA 2Y7XA 4A8JB 3LPRA 4DCDA 1NIPA 2PUQH 5TMPA 4WH8A 3C1KA 2HT6A 1JECA 2IA5A 2JLZA 1HEIA 1XF9A 1QHSA 1MU8B 2QA5A 1MQ5A 1O2MA 1JBKA 5AUQA 5LB4A 2Q1JA 3D23A 4YONB 2GJAA 1IJFA 2FOMB 1FTSA 1CGHA 2P5TB 1DAHA 4QL3A 1C2GA 1AKEA 2XC4A 2D7CA 2KSQA 1EZXC 1BRBE 3GJ0A 3A7TA 4P31A 1F6BA 1QL8A 3A7VA 2IBMA 3GICB 4FUEA 3SUFA 3VKWA 1IQNA 4PX9A 2G1KA 3AF2A 2VPPA 2RA3A 2Y7ZA 3A58B 4X8LA 3S1AB 5F8XA 3A8DA 1QA0A 4BLSA 1WP9A 5C2JB 3DT0H 3QO6A 1Q44A 4QBHA 2KBEA 1ZU4A 2B21A 3QLPH 1ZBDA 5JEEA 5F8TA 2VP4A 5EP2A 1G3RA 5EE0A 4FVDA 2PGBB 1OH7A 2HGTH 4M1OA 4R71A 4ARZB 1U8ZA 2B8TA 2H8KA 2V35A 2OBOA 1FPMA 4A9AA 3GLIA 1E94E 2QL6A 5AJXA 3T1VA 3IEUA 1IQKA 5LPNA 4K2YA 2IT1A 1OV4A 1FY3A 1WMSA 3OY5U 5GWZA 1AGJA 2QGZA 3RXHA 2NO0A 1LFDB 1QDEA 3KB2A 2YNMA 4L8GA 4DDTA 2D3WA 4ILEA 1TPSA 2YNAA 4M1WA 3D49H 3F9GA 4A8JC 3CF6R 1EXMA 3GQBA 4PO9A 1V2ST 1DO2A 3M5LA 1MTNB 2OC0A 5F8ZA 2JCSA 3AKDA 4C0LA 4AYXA 3NVAA 1G16A 4EAQA 2VEDA 1OWJA 1UJ1A 3TGPA 2B7BA 3TW8B 4L15A 4WJG2 1GHAF 1KXBA 4Y0VA 2WMOB 1EPTB 4B2AA 1R0ZA 3C14C 2V7QD 1GBAA 4PC1A 5FBEA 1WYKA 3KZ1E 3FMIA 4IOMA 2F6RA 3S0NA 4UNPA 2BTCE 4EFMA 4K3JA 1C1QA 1DPOA 4BXWA 3MNXA 1JIRA 4DG4A 2R9VA 4JKYA 5I46H 3IG6B 1ZTLA 1S2MA 1THPB 1E69A 2GHIA 4FN5A 3F9HA 2R2AA 2IPHA 1TQ4A 1G9XA 1FXYA 2FFHA 4M1TA 3OSYA 2GXAA 2WPHS 3RLFA 3AASA 3LWNA 1C2DA 1S6HA 2OBQA 1Z8IB 3LD9A 2PMDA 1Z06A 1TQDA 2OUKA 5L3SB 2QBYA 2KB0A 2YC4C 5TDHA 4C0JA 1AKSB 5F3WB 2ZTSA 3SN8A 1AIXH 1Y5AT 2AXPA 4JVLA 1BJVA 2FYQA 3GYMA 3BFXA 1AS3A 5TV2A 1Y3WA 4IDNA 4K60A 4D25A 4Y11E 5J5CA 3SJCA 2JJ2D 4ESTE 1OFHA 4P4SA 1AUJA 2ODYB 4XVUA 4JL5A 3F5FA 1T8LA 4Z0KA 4EJSA 1WAYB 4HZIA 3RRZA 3OEHD 2VBCA 1IQGA 1AZSC 1LCYA 1ZSJA 3BS4A 4D4MA 4Z8YA 1P2TA 6CHAB 4L5BA 2V6IA 2HNTE 2QEQA 3TRFA 3MH5A 1F5KU 4X2YA 2ZRAA 4N3NA 1GBIA 4NZQA 1BTYA 5GJ4B 5FPHA 3RU4D 2CHVA 3WNBA 4IW3B 2GEDA 2H57A 3K70C 3GLIE 1O39A 4IJMA 5JLJA 4RZXA 2J2UA 3MU1A 2BOKA 4DDVA 1DEKA 2F1HA 4NA7A 4X2WA 1E2NA 2C4FH 1T5IA 1RS0A 4FU8A 2FH5B 3Q3YA 2HJGA 3MAAC 3MWIU 2IYWA 3U98H 3GJ3A 3THXA 2J1LA 2Z6BD 1SGFG 1E0AA 1CRPA 4B48A 2THFB 5EZ6B 1T4GA 1CXZA 3MU5A 5AJZA 4EDHA 1KJYA 2CXVA 2GBLA 5FOVA 3KXKA 1TGNA 3CF0A 4D81A 1P57B 3EWSA 5C1BA 3GP8A 5AUPB 2YWHA 4F4OC 1W0JD 1ZTJA 1EP6A 2YZ2A 4JLAA 2GZ9A 1XNJA 2Y5HA 1FY1A 1XCPA 4GPTA 3SBDA 3H84A 3K0AA 2TGTA 4AURA 2E9SA 4HLCA 3EPJA 3E16B 3RSOA 4Q03A 2QAGA 4DZZA 2GRJA 4GMDA 4DXAA 3NBYC 5DP6A 4GP6A 2PT5A 5HYOA 2ZPTX 1Z3IX 1HV7A 1R7RA 1V43A 2ZTYA 3SJOA 5DJ7A 3VR3A 4HUQB 2GK6A 4NP6A 4TYNA 1R8QA 2OAP1 1Z0FA 1SGPE 2QMEA 2WJJA 4LBWA 4URXR 3L33A 2V6NA 2A31A 4BLTA 1SI5H 5BN5A 2VINA 1U9IA 1G19A 1EFCA 3UR6A 1WB9A 3QBVA 2CMKA 4ACAA 4A0RA 3TNFA 4XBDA 4M0LA 1XD9A 4A2WA 5JRZA 4GHTA 1J7KA 4FMCF 3EAQA 2EI6A 3BH6A 3E8LA 2ZJ2A 1P9NA 1W4BA 1Z28A 4DIEA 3QKTA 2Z3DA 4AORA 1SXJC 1RFLA 5E2OA 5TJXA 4A36A 3SGAE 1RYFA 2J0UA 2VP9A 1HT1E 2YVUA 5CB8A 1OPXA 5DN6A 4ABIA 2HV8A 4PSVA 2WUBA 3LY5A 1QZXA 4PPFA 2DFTA 1MO6A 4PZYA 4OS4A 3UIRA 5CIQA 4CH2B 3V13A 1Q2WA 1TNLA 1XTJA 3WRYC 4QXAA 3DDCA 3LOXA 4HLUA 5FPSA 1UPTA 5KPJA 3RXLA 3RS0A 1TBZH 1ARBA 4UKDA 3OYPA 2FDAA 1SVWA 2ZU3A 2CF8H 3E70C 4FI3C 2C98A 1K2I1 1U0LA 1O3DA 4TLDA 3DPUA 4I32A 2WOOA 3T5DA 1P04A 2C8WB 1O3KA 2A1DB 1SGQE 3P8NA 5HE8A 3KJEA 1L1NA 1NVVR 4KO8A 1TNGA 1TF5A 1VYUA 1GG2A 3BB1A 1HNEE 2IYRA 3EC1A 1GOTA 3EPLA 2ZHEH 4ASUD 3MFYA 2BXUH 3VKGA 2FJUA 3BAFA 4RD4A 2YOLA 1N6OA 3WBKA 5F6MA 3AVQA 2G77B 3A8CA 1XTIA 1A2BA 1C2KA 4CYMA 1TPPA 4HSEA 1UO6A 2F9MA 1G8HA 5HXFA 3MU8A 2P3FH 5EQQA 3BEIB 3OAAA 2UWPA 1VHLA 3ADKA 3CBQA 3TGJE 1E0KA 5EXNA 3PEYA 1L4YA 1ZNXA 2NGRA 4LPSA 4DCUA 1C4OA 4X2VA 4DBLC 4DUGD 2OCAA 4H1UA 4QM7A 4YMUA 1UVPA 4AYWA 2OBNA 5TY0A 4K1SA 4MDEA 2ZUDA 3P8GA 3D8BA 5JBBS 1O3EA 2FX6A 2RAPA 3WY9A 2ECKA 3T29A 2WWGA 3PQCA 3OFNA 4OM9A 4Q2KA 4NIWA 3CW2A 3HP1A 5G4BA 3HATH 1DFPA 2BMJA 1UHBB 1ZJKA 2QC2A 1OH6A 3ZV8A 3OTJE 3GEIA 1UM8A 5FX5A 4O03A 4X8VH 5H1YA 3IPYA 1J8MF 1L2TA 4AG1A 1TPAE 1WRBA 4AD8A 1OS8A 2RG3A 1Y3YA 3R9WA 4K8YA 1OFTA 3LKWA 3SU1A 3EAJA 2JH5D 1O2TA 1CGIE 3A85A 1NBME 4O2LA 4Q9KA 2F43B 4QHYA 2BLOA 1TEXA 2AR7A 4XIGS 1FY5A 1G30B 1O87A 2F9NA 3KKOA 3H5CB 1SGWA 1GHYH 2VH0A 4F49A 4LJ5A 3QXHA 2ZGCA 1Z0KA 4QBIA 1W12U 1LTQA 4AB8A 4S35A 1GBHA 4Q48A 3SEAA 1Z08A 1MBQA 1TBQH 2ZSEA 4JLOA 3RS3A 3HYRA 3A80A 3P27A 4DSOA 1QBKC 3GLFB 2F1IA 4FUGA 1GHZA 1TE0A 1EZUC 1G4UR 1PYTD 1G6HA 2C96A 3P70B 1SPJA 1YZNA 2W0MA 1U9IC 3EGKH 4BEJA 1CEEA 2ZI9A 2ANWA 2H2ZA 3GCHC 3LA6A 3NHBA 3EDXB 3SHCH 2C90B 4FUBA 3S9BA 4ESVA 2GZDA 4EPWA 1FQKA 1O2WA 3QBTA 2HVXA 1RRKA 4LY6A 4JK6A 1ZR0A 2FSGA 5BYJA 1GJBB 2NU4E 3SU3A 2ORVA 1GKYA 1ZMJA 1SKQA 3MRSA 1GJDB 2NZJA 2VTKA 1BT7A 1GI6A 1FUUA 2M5TA 3ZYEA 3FHOA 4UFGH 2TGDA 3S1AA 1SQ5A 1P2UA 3WXMA 1KO4A 1U99A 1AGRA 1Q21A 2QAGC 1SGYE 2FSIA 2A7CA 2OTVA 4MH0R 1FUKA 4H42U 2CHAC 1BHXF 2ZYWX 3ZH9B 4MYTA 4W9MC 4GP7A 3TK5A 1CGJE 3R20A 4UDWH 1G4AE 2GV7A 1N5KA 2I3BA 1NG9A 3GCHB 1E38B 3THYA 2C2HA 2F55A 3PUZA 3ZZ0A 1SGDE 1FN6A 4Z8XA 1DUEA 4DVAU 2JASA 1CJUC 1R0XA 4RD6A 1TNIA 3RXKA 2TGPZ 3U8RH 1BS1A 1PQ8A 4DT1A 1KKMA 1GL9B 1N2CE 1T8OA 1J14A 2BBWA 2ZGJA 1KI3A 2G8TA 4QGFA 1K28D 5IHPA 1PZNA 3VNUA 3FHTA 2ZHDA 2XXAA 4GOXA 5DPAA 1M7BA 4UJ5A 5K0HA 1D6JA 3EARA 3CH5A 1TUEA 1G8FA 1BBRE 1P2NA 1GBTA 4NFEA 2OSBA 2ZFRH 2QF3A 5DN6D 4WWYA 1KLIH 1E0SA 2GKVE 4AFQA 4FMCB 1O3MA 1LF5A 1EJAA 1XJQA 1DTSA 2F9VA 3L8YA 5KO2A 4OBEA 2IXEA 1YC0A 3BTDE 4YDHB 2SNWA 4YOGA 1NN3A 3VFEA 2BLVA 1VGCB 1BOQA 4Y8XA 2PLFA 5BWMA 4Q4AA 1AS2A 2ZYVX 1FP7A 2QTFA 1N6IA 2ZPRA 1L1GA 4RY2A 4IRUB 1GVNB 4XBBA 3SYJA 1J70A 1NSTA 1GI3A 1F5NA 3M61U 2XAUA 1VZQH 2YHSA 1UTNA 3T34A 4UJ3A 2P6NA 1C9PA 5E7MA 1OP0A 2NPFA 1CBWC 2A7HA 1TL7C 1ZUNB 3MU0A 3RS2A 4IDHA 3FMFA 2QXJA 4LZ1H 3QVVA 1KIGH 3MH6A 4Q5IA 2LWIA 2PEZA 4D0NA 5FI0B 4C0QC 3CR8A 1XUKA 4Q7ZA 1ZJDA 1YPGH 5B6OA 2ZDMA 4OK5A 3QUSA 1QA7A 4RN6A 1OXGA 4AZ2B 2NU1E 4UNSA 2L0XA 3U3JA 1XMVA 4Q01A 3SN6A 2C5LA 2PKAB 1G3BA 2JH6D 2OLKA 3GFTA 1N25A 4LHZA 4KTUA 1MO4A 4FD2A 3PWCA 1E6CA 2EYQA 1T3LA 3ZQJA 5IT5A 1P73A 2OCPA 1SVOA 3SUGA 5GJWC 3OFND 1P72A 4HZHA 5H4IB 3IGFA 4M21A 2GJKA 2F9LA 3DM5A 1J8YF 1N5IA 1G6OA 4GVUA 2FO9A 2RKOA 5F9HA
chains in the Genus database with same CATH superfamily
3SE0A 4NWLA 4WZAA 1E9RA 2Q4EA 3RV3A 1T9AA 1SHJA 3PFGA 5ALKA 1YZFA 5JYCA 1U8YA 1IZ7A 3NZEA 2G71A 3HGQA 5DMXA 1PTKA 3LX5A 4XTCS 5H68A 4A8PA 4F91B 2NSHA 2GWHA 5KTNA 4FR0A 4M99A 2CCJA 1G8KA 1Z6GA 4P7KA 3TGLA 4BY9E 4HMPA 1Z7YA 2PIAA 1LB1B 3LBNA 4WW0A 2PLWA 1XUHA 4FR5A 2BQ7B 3EPHA 4C0HA 1KZGB 3IBYA 1IY9A 3L6RA 1QF9A 1W44A 2ALJA 1GMDG 2R25B 1CUXA 5CA1F 3F68H 1EB2A 3BEUA 1CY6A 1H66A 2D1JA 2CCGA 1XVAA 3MLAA 1T1EA 4BJ1A 2YNMC 2Y80A 4WKGA 4YRQA 3R3JA 4CE6A 4XRGA 3HU5A 3EPKA 1TJ4A 1K9OE 1CB0A 3UC9A 5FWXB 1SR5C 1U0EA 3EAGA 2C77A 2QN8A 2FESH 3OP4A 1NW4A 3QU2A 4MNYA 1ETTH 2X1MA 2BDHA 4CRFA 4A1OA 3GMTA 3CUKA 4LMPA 3G9QA 2BY7X 1JBEA 2PVCA 3NASA 3R9IA 4GGPA 5IASA 2PMKA 2W6IA 4AY2A 4V2UA 1WSSH 1MLDA 1SEPA 2J6IA 1JOUB 1BHQ1 3LOPA 3W8FA 3KOZA 4Q00A 2QSYA 5CNMA 1K6XA 2X7JA 1KY9A 1RC1A 1P06A 2J5UA 1YV9A 4M37A 2X13A 3MPUA 4L51A 3WY8A 1P39A 4TMFA 4WZBE 4YMIA 5KYUA 4MO9A 2XMSA 2R5FA 1CEXA 1LRJA 1QVZA 4KO1S 3ZCTA 5JMOA 5KAMA 1YLDA 3LBIA 3OCZA 4BFTA 7KMEH 2J5BA 2XCUA 4R1MA 5JSHA 1Z07A 4KV9A 2X9LA 4JLWA 4F9FA 3BWXA 1T1JA 1E1QA 4WXYB 5CFPA 2QAJA 1CERA 2QTBA 5F2NA 1HGTH 3Q8WA 1GGDB 1CYEA 3I6IA 1Q3XA 5T6GA 2I6SA 1JQLB 2GAJA 1K27A 3L7CA 5GIBA 4FHCA 2AX4A 4PAWA 2VVTA 1SLWB 4BLRA 5DBOA 1QORA 3LYUA 3L3TA 1EX9A 1SZDA 1SLXB 1E37B 3K4QA 4QNMA 1JFLA 4PE5B 5A9TA 1H2RS 4C6SA 2YXNA 4MQ5A 5T4FA 2CMDA 2R8EA 1S8AA 2X19A 3QOXA 1A9XB 4Q6BA 4RACA 1EGQA 4KVFA 2G00A 3SV7A 3IODA 2HDOA 4QGAA 3QZQA 1LV7A 3T9EA 4CHTA 1SKMA 1MX3A 3CEHA 3EH1A 4NMWA 1R4ZA 3GRRA 3EDYA 3ZDAA 1FFSA 1OBVA 1FQ3A 1XKLA 2IOQA 2RI1A 2XA9A 3AFNA 3NVKI 1OSNA 1MB9A 5HUQA 4FHGA 3SLRA 4BASA 4Y2RA 1ADGA 2WYIA 4RY0A 1D6SA 1NI5A 1W48A 2DQSA 2PX6A 3A7XA 3SZNA 1X1AA 2P1DA 1S2IA 2Q6OA 3ANXA 3EGDB 4X54A 1AKMA 3CRNA 5INTA 1QP0A 3TTTA 5JG7A 3HP4A 3MQ4A 4KXXA 3O8BA 1DBRA 1WQ3A 4JEIA 4QECA 4ZC1A 3SZLA 5TPZD 2BY6X 3KVNA 1UZNA 3WGOA 2A9KA 1VIMA 3QWCH 5FTWA 4O59O 1OLSA 1D2EA 4ZCTA 3REGA 1P44A 2O8CA 2VDRB 5JCJD 2I1VB 2W7SA 3D2LA 5JSKA 2G52A 2DFDA 2F3CE 2V1XA 3DTYA 3V8VA 3U81A 4L0DA 3EIQA 3WIVA 3B5IA 4REMA 3BB3A 4B17A 1CY7A 1U0NA 3GF4A 1SVMA 2NUPB 1E7SA 2V7UA 4PQRA 4Z4GA 5EJLA 4Q9AA 3G8AA 4O08A 3A31A 3QVTA 1UTOA 4F1KA 3ZBQA 1N3LA 3F7OA 5YASA 1GNVA 1DC3A 1ZVQA 4EYGA 2H7YA 4LGMA 5A1JA