5FPTA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 2-(1-methyl-1h-indol-3-yl)acetic acid (at3437) in an alternate binding site.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
total genus 199
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fptA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fptA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fptA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA03
2Y81A 1D6RA 4GMXA 3QVVA 5G53C 2B7BA 4I99A 4YT7H 1KJZA 1ARCA 4XD7D 3EGKH 4D82A 3K53A 1DX5M 1G3CA 2Z6BD 1KY3A 3GLIB 1WQSA 1Z8FA 4I4LA 2F9NA 1UTQA 2WUCA 2FOCA 5FR2A 4ITRC 2J59A 4Q18A 3CRVA 4FMDB 5DYGA 5JMTA 4ZXYH 2JIZA 1OV4A 3PUWA 3P8NA 3CX7A 3QPVA 1FY1A 2VH6A 2C98A 3H4MA 1N8OB 4A0HA 2WJVA 5DE3A 1BDAA 4CEIB 1G17A 1SVOA 3CF0A 4Q7KA 1O2KA 1YR9A 1F92A 2NPIA 3GDSA 2BVXH 3Q5DA 4NTZA 2YINC 2ZETA 4ABGA 4QGGA 3UUZA 3A8DA 2PHBA 2WBLC 1C2DA 1AIPA 1MKYA 2X2FA 2J87A 5JYIA 3U1IB 2HGTH 2QXHA 2ZTZA 2GTPA 3A84A 4FU9A 1M9UA 2WZQA 6GCHG 1DO0A 1UTJA 5GDSH 3EASA 2F3CE 2PR3A 5EP3A 2FEQH 2WPIS 1E9AA 4X1NU 2QC2A 3D62A 3REFA 3UY9A 2ZIQH 3RMLH 3T62A 1RD3B 2ANMH 1ZLRA 2C93B 1GRQA 2QAGB 3SE0A 5K0HA 2WSSD 5JSZA 1C5XB 2B8TA 2TRMA 1EAUA 3LXXA 5TV2A 1G9IE 2VVVA 1GJ8B 3K9XB 4AG2A 3E2IA 1SVMA 4R9UC 1KSNA 3MNSA 1KZGB 2F9VA 1SBWA 4DDVA 5CB8A 121PA 2PEZA 2W3IA 3CS7A 2FLBH 2CF9H 2FOBA 2DWOA 2ORWA 2B0FA 1CJVC 3CF6R 3SNDA 4J2YB 5F8XA 3U9AH 3ADDA 4IMQA 2QA5A 3MJRA 5FAHA 3CNNA 3PWCA 2Q6TA 4MDEA 1P01A 4AD8A 3KQBA 4BNRA 2CF8H 2NZ8A 1ZPZA 5GJCA 2D8WA 3QN7A 1QJ6B 3CR8A 1A82A 2XSZD 3RXVA 1C5TA 1O31A 4RKFA 2ZS9A 4X8HA 4KHZA 3RC6A 5FPYA 4L15A 5KYKA 3DL0A 1II8A 4NU0A 2ZIAA 3B85A 3F9HA 4IVPA 1AI8H 1MQ6A 9LPRA 2BX4A 3SHCH 3GJ5A 3I4LA 2ZR0A 1DOAA 3B1WA 5H70A 3AKDA 2VWMA 2FN4A 5F9HA 4ZIRA 3GYLB 1F2UA 2ASEA 4RY2A 3SI4H 1AS0A 2D7CA 2AD5A 5I25A 1IXSB 4WZ6A 4B3FX 4UNPA 3IPYA 1MO6A 1XPUA 1GI5A 1XKBC 1Z28A 4FUBA 4MNXA 2PSXA 1IQNA 1M1YE 2UUFB 3BWDD 1P09A 2ATXA 4X2WA 2QQEA 1OH6A 2OC0A 1JIMA 2P95A 1V2KT 1O3DA 2W00A 2VEDA 1XVOA 1F3OA 3P8GA 4DW2U 2R9VA 4MKGA 2WPLS 4I8HA 3HGNA 4HUQA 1GCTB 2GXQA 1VG9B 4MPWA 3TR5A 4MQBA 1D9ZA 4WMEA 2HXSA 1DO2A 1TX6A 1UBCA 4FN5A 1U8ZA 2A5JA 4QBHA 7KMEH 1FP7A 5E2OA 1LQEA 1UHBA 4NCHA 4Q00A 5DIFA 2W6ID 2OLKA 1YPKH 2XBYA 2D3WA 1KK1A 3L6PA 2OT3B 1KI3A 3CP7A 2ALVA 2H9TH 2LKCA 4X1QU 4Z6AH 3H2YA 1P04A 3KQCA 1V2RT 2OCYC 3A1UA 1Z22A 1Z6XA 2RGGA 4RZXA 3THYB 2ZU0C 3R9XA 4KBFA 1UVOA 2FX3A 2WAXA 4MRPA 2GCHF 2F91A 1VYVA 3AVVA 2K5UA 1OWIA 2AKAB 4PHHA 3ITIA 1N6YA 3S1AB 1AUTC 4EPWA 5AUPB 1Y59T 5EUQB 2H17A 3Q85A 2R3UA 4JT4A 1QG4A 1NVWQ 2NZJA 4KU4A 4I1SA 4P0TA 2ODQA 5FH9A 1AIXH 2XC5A 4QKQA 3WY9A 3AGQA 2OV2A 4QBGB 4JJKA 4M8NE 1E0AA 4Q7XA 1P4SA 1P3CA 1GRRA 4UXJA 1R5NA 5DN6A 2FPMA 1C5SA 4FINA 3EG5A 2XNDA 5EQTA 1DUAA 4FUEA 3LBNA 2GT8A 4AYYB 2JH6D 4C9BA 2QAAA 2DFKB 3QEOA 1NN3A 2SNVA 1P02A 1CGHA 3SFVA 3Q8XB 1HURA 4B3XA 5DHAA 1TNKA 6ESTA 2QA9E 3VEQB 1W44A 2Z9IA 3BRWD 4F4OC 4DIIH 4BFTA 2IWHA 3BTQE 5GJ4B 2GJ8A 2VJ1A 3RXJA 1U90A 1X8KA 1RJ9B 2CCKA 3BFKA 1BMMH 3BTKE 3EARA 4BPBA 4UKDA 2Y5FA 4POAA 4JLAA 5EXSA 4OS4A 2GCOA 4DT1B 1JR3A 1TB6H 3ZVBA 1KSFX 2NU4E 3LGVA 5DPAA 1T5LA 4DKXA 1NO9H 1RXPA 4TTRA 2ZR7A 4IEEA 2EEKA 1Q20A 4HYYA 2WV4A 1JPJA 1QVRA 2YWGA 2R6DA 4A8JB 4KBGA 1MH1A 2CMYA 1WTGH 2N42A 1HJ9A 5I46H 1R8QA 1OYYA 1V2LT 1RYFA 2BX3A 2STAE 2IYWA 3LDAA 2BHGA 1DXPA 1MZAA 1WQVH 5BN3A 3U7FB 2R9PA 4LC1A 1ZD1A 1E36B 1PUIA 1G6HA 2B6HA 3OHMA 1D6JA 2Q21A 1P2QA 1QRXA 1C5QA 3DMNA 3A58B 1Z0DA 3F0TA 3A7ZA 1WOFA 2W6JA 3LQRA 2VIOA 1TNHA 1AWFH 1LMWB 1MCVA 3L3TA 5HM2A 3JZ2B 5C5OA 1LKBA 1LTQA 3KQEA 2H6MA 4XWOA 4N0DA 2CCJA 2FODA 2AHOA 3BIFA 1U8YA 4LZZA 2XXAA 3B78A 4NCKA 3KXLA 4K3JA 1A4WH 3LGIA 1CF4A 2ZI5A 1E38B 4GPGA 4XD7A 1VIYA 4WA7A 3SJCA 1UCYE 1KIGH 4KO8A 3BK7A 1XXHA 2QF0A 1ZSKA 4AX9H 1TMTH 4AG5A 1N2CE 5GWZA 1P73A 5F9FA 2BDAA 4X6PA 5DNYB 3WHKA 4KP0A 2O8FB 1GNPA 2H16A 1E3MA 1ODFA 1CHOG 1E9DA 1EZXC 2WPMS 1TIOA 1ZM2A 4WXIA 3C5CA 3RS7A 1C5NH 1UJ2A 1Q1BA 3X2SA 3STIA 2ANCA 2ZI2H 2QRNA 2HF9A 1ESTA 3LLUA 3UTUH 2ZI6A 3VB3A 1UK4A 3W5JA 4JLOA 2FF7A 4Y11E 2QAJA 1MKXK 1Z8JB 2VIDA 1IN4A 2FI4E 2CHQA 2QBYA 5SZJA 4V0KA 4OI2A 2XC4A 2OBLA 4LWZA 1MABB 1KKLA 5SZHB 1E1QA 1C9TA 4JBXA 4XH9B 4PANA 1W3CA 2XWAA 1T5IA 1HJ8A 3PUVA 3SJBA 1XUHA 1XXFA 1ZW6A 4FXPA 1S8FA 1KO1A 4ZUHA 4TYDA 4IXMA 2JEOA 4BASA 4KFUA 3RANA 1TOMH 3GCHB 1AN1E 2GCHG 3N70A 2CDNA 1A0LA 4PQYA 1OXUA 2PJZA 2W0SA 3FMIA 1S96A 2ORIA 1ZAKA 4ISLA 2WSSA 3SO3A 3PYHA 4MKHA 4BLOA 2A45B 1BZXE 3T29A 1O2XA 2ZANA 3PM3A 4HAVA 3U7HB 2QY0B 1HY3A 2YVUA 1KXCA 3MI4A 2XAUA 1GPZA 1BRBE 3ATIA 3DDCA 1YKTA 2OCAA 1IY0A 3FHOA 2Z9JA 1D4PB 4A1VA 1ZM9A 1XCGB 1UEIA 2G77B 1ZZZA 3KQHA 2CEAA 5EE0A 1Z63A 4ABAA 5TJXA 4IEIA 1GI2A 3M3VA 2O8WA 3MH6A 5FPTA 4Q9KA 4OI4A 1C9KA 3EA7A 4KYIB 2XSZA 1YZTA 2G1KA 2QPOA 4NKRA 1O3HA 4FWTA 1Z1JA 3V13A 2BDYA 2GDEH 3IDQA 3SJOA 1TGSZ 1Y3WA 4GUXA 2X19A 1RRKA 1Y3AA 4Q21A 1IN8A 2C9OA 4O3UA 3ECCA 1F0RA 4ZHMU 2IW3A 1P0SH 1YLCA 1G32B 2IPHA 2P8OC 3QGJA 2ZHWH 3DZ8A 3ONWA 1NMXA 3QQ5A 4DEXA 5A0AE 3GD7A 3OX7U 1XTIA 1W4RA 3ZZCA 4CRCA 3TH3H 4CEHB 4AG6A 3EZ9A 1KKMA 1VYUA 2FJUA 2GVZC 3M35A 4M9QA 4DIDA 1DLEA 2PBRA 2QY9A 5DHFA 4UNNA 1KZ7B 3MMGA 4M53A 1AGRA 4KVGA 2O9QA 2G1JA 2GDJA 4ILEA 1G3UA 3P32A 2HPQH 3P27A 3TJNA 3CRRA 4W9MC 5FPHA 4BTTB 2F55A 5CYOA 3TJZA 5FOWA 2VU8E 3L82B 1KO5A 5AJXA 5FBIA 1YZKA 4TZ0A 3TNSA 1EAXA 1M2OB 4BE7B 4GHTA 4Q9HA 1XRJA 2PX3A 1C2HA 2CL7X 3EZ7A 2ZHEH 4RD4A 2A31A 1P2IA 2PUXB 2ZU3A 3ODDA 2EYUA 1F6BA 4DSOA 5E7JA 4A1XA 4AKIA 2GJKA 3QLPH 5E0JA 3IEVA 3KQDA 3TVDA 3BIUH 3LWNA 4BAHB 3TVTA 4NIVA 2J38A 4DCUA 1UO6A 4BUJA 4X6MA 2VGCC 3H09A 1OE0A 4B48A 3SYNA 2W6IA 3EYDA 2AFHE 1XPRA 2SFAA 1QF9A 1GHBG 1Z0JA 1SLWB 4D8NA 2TIOA 1E79D 4NYJR 3IG6B 3KB1A 3TMKA 1VDZA 1DWCH 1U98A 3T5FH 2GAAA 1K5GA 4MRRA 5FTJA 1OF1A 3CBQA 5CB6A 1OWHA 4CZ2A 4PPQA 4H1VA 1GHXH 2XRCA 2FG5A 1O2TA 1LCYA 4JMPA 1UF9A 3M5OA 1RIWC 2FPKA 4IC6A 3FZZA 4JLNA 1MBQA 1JALA 5AJYA 1RTFB 2ATVA 1E0JA 4FIDA 2WJJA 2IUTA 2ZM5A 4NCIA 4D6PA 3ZZUA 1TX4B 4RSGA 5GJVC 3M3SA 2OO7A 5B2ZA 1UTMA 3WRYC 1SG8B 2UVQA 3R20A 2I1QA 3KHVA 2Z3DA 4HDCA 3THWB 3ODFA 1O3OA 1BUIA 3QF7A 3V3MA 2ZDKA 3CENA 2KAIB 5JPMH 4QG7A 2KBEA 2AXPA 4V0MA 1PJRA 1GMDG 1WCZA 2ZU5A 4IS5A 3HKIB 2O0JA 1Z7KA 3E1SA 2SGQE 4LPKA 4BFXA 3BG4C 3X1DA 4OHXA 2V3CC 5GNDA 1W46A 3ZZ9A 1U94A 1T3HA 3RRMA 1AVWA 4FU8A 1Y3YA 2YJTD 5JLJA 3IPXA 2H9HA 2ZQ1A 3TJOA 1VMAA 4TWZA 4PC2A 1E2JA 4G01B 2HJGA 2QTVB 3KXIA 1TE0A 2WMNB 3GCTG 1KTVA 3FANA 3BXZA 4NE2A 3LGYA 1T3LA 2EA3A 3A82A 1P2SA 2H7VA 1CR0A 4YMWA 3SHWA 1Q21A 3TKLA 4IW4E 2DWQA 4ESVA 5HE8A 1HIAB 2ANKH 3Q72A 1O2GH 2PLRA 4E07A 2FTMA 1TPAE 3DVLA 4TYWA 4MGIR 1O5AB 3RU4D 1NVVR 2J0UB 3KKPA 1GJ5H 3UFAA 2L0XA 3FP8E 2FP7B 2VQSA 1Y3VA 2C95A 4ERNA 4Q7YA 1J17T 2ZRAA 3QGNB 3QSYA 2VHUA 1EB1H 3IBYA 4NZYA 5B6LA 1YRBA 2FWWA 1UVUH 3PQCA 3K0CC 2XBXA 2OUKA 4IKEA 3GLFB 4LJ7A 2IYSA 1NKTA 3HDTA 1W7GH 3KTAA 1GMHG 3SU5A 2ZJBA 5HGGA 1G8HA 2QTHA 4ACBA 1DARA 4UQOA 3TSOA 2W26A 2ZRDA 1LVMA 2VHJA 4TY6A 5CHAB 1N0WA 2FFBA 821PA 3OAAD 2P6UA 3AP2A 2JGNA 5E7MA 1AUJA 1UK3A 4OHZA 4KODA 3DOFA 5EE5B 3GCGA 4XWKA 2UUJB 1GILA 5F03A 4TYQA 3LH3A 2ZHQH 2J2UA 3BB4A 4Q4HB 3VNVA 1ZVQA 1Y5AT 1DWDH 2VIWA 1FN8A 1QIXB 1OH8A 5FCRA 2ZO3H 1RRCA 2WJHA 2VF7A 1SHHB 4JZEH 1BIOA 1ZBDA 1D3DB 2O0HA 3SBKA 4HAWA 2FH5B 2J0SA 4LYHA 2WOOA 2IBMA 1LF0A 1QZXA 1CRQA 1QY6A 1U0HC 3CR7A 4FVBA 2P65A 2GD4B 1RJXB 3ZYCA 2ODBA 3GY6A 3UKDA 4MPXA 2WWIA 4KITB 1ELAA 4M9XA 3AKEA 3LW7A 4HI0E 3W6NA 5EODA 5BN4A 1U6QA 1HXFH 3OE7D 3QKRB 4PSKA 1YE8A 3TLOA 3PV0A 4TN1A 1BMFD 4A2PA 2RA0A 5JEEA 3AASA 1PVOA 4EPVA 1GWAA 1ETRH 2PT7A 3L8YA 3SNBA 4QFMA 5G3ZA 4FXGH 1XTKA 1K9OE 1GFIA 4A2WA 4EFLA 2RGNA 4PTLA 3SJKA 1SXJD 3A4NA 2E87A 2VPPA 4NYMQ 4XVQA 3KJEA 1MV5A 3ENSB 4JMYA 4ABJA 1T0JB 2I3BA 2YOLA 1PPEE 1GJ7B 3KQKA 1AQUA 2G3YA 2ZDLA 4JBWA 1XZQA 2MMGA 1HPGA 2SGPE 4IHQA 4CRBA 1KI2A 1WA5A 5CYPA 1QG2A 4JVMA 2IN2A 4BZQA 1KIMA 4YMUA 2BDCA 1F7ZA 2SGFE 3QF4A 2AIPA 2CXVA 1KO7A 1S9DA 1AKSA 2AD1A 3Q7PA 3UR9A 4BTUB 3TGKE 2BBSA 1UTOA 1QTFA 1ZINA 4CR5A 4MYCA 3CZPA 1KLIH 4LV5B 2A30A 1KMHA 2HNTC 1NG1A 1P2NA 4RD3A 2FYRA 3QKSB 2IOTA 2OG2A 1D9IA 1A5HA 1J99A 4GSYA 1NM6A 2AS9A 1O0DH 1P9WA 4NSYA 1OWDA 4BFUA 1R7RA 4Q7ZA 2J45A 2BLVA 5KNCA 1MTWA 1SLVB 2BXUH 2F1RA 1P60A 4RZ2A 1NFXA 3CONA 4F4IA 1TRNA 3A7WA 2OCBA 1P2MA 2NWNA 3QK1A 4TSFD 2OXRA 3MLEA 2QGZA 3U8TH 2X8AA 2OK5A 4D7FA 3MUFA 1S3SA 3SQEE 3NEYA 2LPRA 1P12E 2CLCX 3LONA 1L8QA 4R0IA 3SU4A 1E4YA 2BD4A 5F3WB 1GL1A 1LDTT 3JZ1B 2CHGA 1WB9A 1I2MA 1F2TB 3KL4A 1MD8A 2NG1A 2PJRA 1K1LA 1FNNA 2V55B 1IQJA 1GZSA 4ZKOU 4OL0A 1LO6A 1W14U 4HB2A 1TNGA 3NHAA 2VWNA 1AB9B 2P6RA 4YC7A 5EXLA 5HCIA 3RS0A 1SFQB 4QM7A 1T8LA 5SZKB 1O5CB 4S35A 1E2LA 3OZXA 1R0YA 2P3FH 3L0IB 1L7VC 1MBMA 1A3BH 2E1RA 4DCSA 4HB3A 5JBQA 1OWKA 1ZNXA 2DY1A 2C4FH 1KXBA 1GBDA 2MSEB 1MU6B 4UFGH 4EKDA 1MU8B 3VB6A 3RXGA 4AGKA 4D0LB 2HPPH 1HE1C 4E05H 2J92A 1V2UT 1AFQC 3SDZA 3F3YA 2GK6A 2V1UA 4NIYA 4BLSA 4FUGA 2AH4X 1E2PA 3TH2H 3P70B 1SVIA 3DFJA 2VGCB 3TW4A 1BBRE 5L2YH 2QG6A 1TPZA 5C5NA 1GOTA 4IDHA 3SNEA 1T4UH 1IJFA 3FVQA 1OXGA 3CRW1 1C2JA 4Q1BA 3NBFA 4LBZA 1QA7A 2FLRH 4GCHF 1THSH 5IRCD 4J0QA 3B1YA 1J9CH 2BBTA 4QNRA 1WE2A 2XW9A 1MT0A 1XUKA 5TVKA 2FMXA 1FQ3A 1WTHD 3BTHE 1EZSC 1CSOE 3VB4A 1J8YF 1GBEA 3LGTA 4TMVA 3U8OH 621PA 3WY8A 3O8BA 1E79A 1RIWB 3RXQA 5GVRA 4NBSA 4FD2A 1KI4A 4MA4A 2JJ8A 2F9BH 2J94A 4BLRA 1CIPA 2A4GA 1IOEA 2ZE7A 1GHAF 1YF4A 2GA8A 4ZMAH 4ABFA 1XMIA 1NRQH 3TNFA 4AI6A 2ZC9H 5EQQA 5EP1A 1K6MA 4O97A 3SYLA 3K0FB 1G6OA 1CGIE 1ELOA 3UATA 3HJNA 2FE4A 4MH0R 5E0GA 3NPSA 4BAMB 1GM5A 3BJIC 2W58A 4WVFA 2PX0A 4MPUA 1W5SA 1QHXA 3R7WA 3WNDA 1KI6B 1P2VA 3PEUA 5J4SA 1FDPA 3BG4B 1E2EA 1X8JA 1ZRKA 2ODYB 4ISIH 2RDLA 1O3YA 4EPRA 3TQCA 3SUDA 1E99A 3RXDA 4EDHA 1KDRA 3R9WA 3RS4A 3HU3A 5IYTA 1CULC 5EG4A 1NN0A 4B44A 2JA1A 3TPIZ 5FBVB 1E35B 4TYYA 1S1CA 4DSTA 4DOQA 4LZ1H 2Y8EA 4C0HA 4AZ2B 3CKLA 3FHCB 2WUBA 4ZAEA 1SVPA 1JAHA 1E9EA 3E90B 1W36D 3L8ZA 4I1UA 4O03A 1NKSA 5J4YA 1W36C 1XXHE 2SHKA 2A7HA 1VTKA 1OW3B 5AUQA 1DUEA 1I4TD 3A1SA 1YR8A 5KPJA 1AJEA 3NC1C 3GDUA 1RTKA 1CBWB 3LJOA 1UBEA 4UNQA 4GOXA 4NFFA 1RS0A 1OFUX 1P62B 4NHOA 1C1PA 3C27B 2W2VA 3IUYA 2CE7A 2RAPA 1AGJA 1IXRC 4KCGA 1T8NA 1IQKA 7ESTE 1A2BA 4TQ9A 2GJ9A 5PTPA 1N6KA 3RRZA 2P5TB 1HH4A 4BAOB 3RRNA 3NWUA 4B73A 2OAQ1 1YGCH 2V35A 3MYWA 2KJQA 4TMTA 2BYAX 1GJ6A 2OFXA 1D5CA 3K0CA 1HUTH 1R0WA 1O32A 1UTNA 4UFDH 2WV5A 2TPIZ 4GFDA 4B1TA 1W47A 4L8GA 1OYTH 2JLZA 1CGJE 1NLYA 2W7UA 3IIMA 4PC1A 2G5NA 1FW6A 1FJSA 4XBBA 4TQUS 1PPGE 1ANKA 2UWOA 2IUSA 4II7A 2J7KA 3SYKA 1ZRHA 3K70D 3ZS8A 1ZIPA 4QHTA 1ZHMA 3PENA 3OAAA 1SVLA 2JCSA 5IDKA 2GNOA 4DSUA 3KEEA 2OINA 4DIEA 2FOGA 1C5PA 2VP5A 4KELA 3ZQ6A 3S7HB 5GIBA 5DG6A 1RGQA 2GCNA 1SMFE 5JJKA 1GI9B 1YZNA 2VP2A 5CM9C 5GXPA 4JK5A 1U8AA 3IO5A 2F9MA 1OT3A 3UQVA 1QHNA 1FXYA 2V6IA 4EQ6A 1C5MD 4DY7B 3K6YA 2BZ6H 4LOAA 1JNYA 1Z06A 3TIFA 3PUXA 3D65E 1HGTH 1DG3A 4XTCS 1P2KA 4HZUA 1GIAA 1B7XB 3SGBE 4GZMA 1NIPA 3N2IA 1YPHC 2GWHA 1LHFH 3QZRA 1E1RD 3NXSA 2IHBA 3U44A 3RM0H 4GCHG 2GCTC 4D7GA 2H5EA 1YPGH 2AMDA 2BB4A 1EESA 4BOHA 3OE7A 3VR4A 1MKXH 3N7OA 1GNRA 4LYJA 4Y76A 1BMFA 4I7YH 1OXTA 2BEJA 1NU7B 1D2MA 1Z83A 4Z1MD 3LXRA 1BJVA 1VECA 2F1IA 4TL7A 1NN1A 2OBNA 3BOSA 3SU6A 1KXFA 5HCNA 1SXJA 3HPTB 4B2BA 3T1TA 5HTKA 3I1FA 4F38A 2R2WU 3ADCA 3DHKH 1PJPA 2PCJA 4HLDA 2ZKSA 3I32A 2XZOA 3KFXA 3CIOA 1HCGA 1V2PT 5L3SB 2V3OH 3VKHA 2P2LA 4FUHA 1NG9A 3A1WA 1GUAA 4K69A 2PEYA 5A8XA 1EK0A 1N6NA 2GV7A 3QY0A 5T6FA 2VO1A 4Q01A 3RMMH 1P06A 3ZVCA 4D4KA 1XP8A 5DP6A 5TXGA 1G3EA 3S69A 2ZVPX 3NWJA 4MPVA 1BOFA 1K5DA 2D2DA 2A5YB 4Y10E 1RE0A 1ARBA 3BB3A 5E8EH 3EZ2A 2BM2A 3PEVA 2VL7A 1ZMJA 2ODWA 4L16A 1U81A 2RB4A 1DSUA 3KJIA 2ZSAA 4RFSA 2HT6A 4N0EA 1EKBB 4UFEH 4KVAA 3EZFA 4DT7B 1HEIA 1HAVA 1SZPA 2ZDVH 2WOJA 5JRZA 2Q9AA 4HB0A 1LS1A 4TSFA 4Q48A 4HDOB 4OJKA 3A7YA 2WHXA 1PV4A 3EC1A 1GBHA 4O25A 3RSLA 3ASYA 1NVUQ 1GL0E 1C4V2 3QKUA 4F92B 2XCNA 3NEJA 5L3VA 5AFYH 3A83A 3M1IA 3BBPA 1V2JT 3ZZ8A 4NWKA 2J0QA 3UREA 2ZGHA 5EXTA 1FTSA 2H1LA 1GI7B 1SQOA 1NN5A 4AB9A 3KXKA 2NIPA 1VR1H 1F5KU 2Z43A 3MCAA 3CB4A 2RGEA 1JQJC 2HLCA 4I81A 3A8CA 1M34E 5DP9A 2PKAB 2O8EB 2ZNKH 3SQHE 4CHAC 2O8DB 5EE3A 3C16C 3VU9A 3GCNA 1QVAA 3CNLA 3VR2A 2OBOA 1G18A 2FGKA 3RS5A 4P32A 5AK0A 1OJLA 3V9PA 2BM0A 3NK8A 3W90A 1ZCAA 3H86A 5ETXA 2FSGA 2FU5C 2VSXA 2HWLB 2XEXA 4IDNA 4LUCA 1UAAA 1EPTB 1PFXC 3VKWA 1GG6C 2WWWA 5TDHA 3GICB 4CRAA 5A8YA 5F8ZA 5GCHF 1EASA 3EA5A 3K9LA 1GBKA 4V0ME 5FUYA 1YYY1 3BH6A 3RXUA 4UONA 1G3MA 3SU8A 3NDBB 2JDID 4JLDA 3H7OA 5GPIB 2W83A 1YZGA 3RAPR 2AMQA 3A87A 4WMDA 2O52A 1Q44A 1AZSC 3CO5A 1INCA 3KUCA 2F43B 1KAGA 2PLXA 4FCVA 1WXQA 1OH7A 1VG0B 1A2KC 1ACBE 2OHFA 1VCOA 1KDQA 2PH1A 3ZVRA 1ELGA 1UBFA 3GLHA 1PYTC 2A2QH 4A15A 3F9EA 1C5ZB 1PQ5A 1S6FA 2WKQA 1GVKB 4R2IA 4IGDA 4NIXA 2EFEB 2ZXUA 1N25A 1IBRA 2JKHA 1HV7A 1YZUA 1TRYA 2B9LA 1ABJH 2G00A 3MRSA 1Y5BT 3FFGA 3A81A 3LBIA 1Z0IA 4DEYA 1IQIA 3U3JA 3GLGA 3ICQB 3PUYA 4A7IB 2XX3A 1NL3A 1XWIA 1QHSA 1EATA 1JAIA 4CH8B 3ZQJA 1VCQA 1SGFG 1GVZA 1B0FA 4UNSA 2XXLA 1XD9A 3I5XA 1A5TA 3SR0A 1GMCF 1TFXA 1HT2E 3MG9A 1HAHH 2PSYA 2OUAA 1W2HA 1ZP6A 4W5HA 4PX9A 3GQBA 3D6TB 2BQ6B 4KLNA 4MNYA 1OPHB 2CV3A 1P61B 2ZRHA 4JT2A 2VP6A 1ANDA 3VPKA 2NGRA 2ZSEA 1BJUA 4M2LA 5LPRA 1O3GA 1KXEA 3K0AB 2FV8A 2YV5A 1P11E 3QBVA 1NZQH 1GI1A 2GJSA 2V1XA 1N6LA 4JLKA 4OQNA 1V2VT 2Z0MA 3Q3YA 2UWLA 4EPTA 3VGCC 2D74A 1C1OA 4TWYA 4FWIB 3QXHA 1TUIA 1KTSB 2AIQA 1HXEH 3M5MA 2P67A 2CJWA 5FX5A 2GMTC 4LJ5A 2GTBA 5FTLA 3MTYA 3FKSD 4HTCH 2OXSA 1TNJA 3JVVA 3AF3A 1AO5A 5B30A 4FMBB 5KDOA 3TNTA 2PUQH 4QRHA 4JYUH 1SLXB 1HQYE 1F0SA 1FAXA 1ESBA 1O2WA 3SU0A 3LGUA 3N5CA 1BYUA 1O5EH 1KO4A 1XUIA 3FDIA 3I77A 2MMCA 2B5TB 3PV5A 1LV7A 5BW8A 3ASZA 5BPEA 421PA 4WJG2 1IHUA 4G0NA 4DBLC 4E09A 1JXPA 4RI0A 2QAGC 4KV9A 2BDHA 1Z0FA 3V12A 2QROA 2GESA 2FDCA 5A4JA 2HYIC 3O8RA 3ZZDA 2F9OA 1OX1A 1D2EA 3GY8A 5EXNA 3W6PA 1G30B 2ZPTX 5FUVA 4DWJA 3E0NB 4D26A 1TUEA 1XU4A 1OPXA 1US8B 4PZLA 1FUJA 1DPFA 3RXFA 1UTKA 3DPUA 2O8BA 2AFIE 1SFIA 3TK6A 5JHGB 2ZFRH 2QRZA 1SOTA 4L4UA 2G81E 4MRVA 4NSVA 4OS5A 1AKYA 1E9FA 3H7TA 3ZYEA 1QHYA 1LHGH 4UEHH 4BRWA 5JI3E 3DO6A 1NS3A 3LU9B 1UEJA 3TITA 2GCTB 2IYYA 4A0FA 2C96A 2ZTXA 1ZU5A 4TLDA 2FS9A 3IWMA 2OAP1 2A3RA 1HDTH 5JFGA 4URZR 2IS6A 3DMDA 1MQ5A 2ZG0H 1E1RA 1BCUH 5DP4A 2BLQA 3PG5A 4IMZA 3SI7A 2MSDB 2DFNA 3NIBA 2DYKA 1C2KA 1GDUA 2G4TA 1E2QA 1E94E 2GEVA 2H5DA 2JH5D 1GHYH 1JWTA 1GBLA 3SHFA 2WPDD 4Z1MA 1XEXA 5SZIA 3QXJA 2VHTA 3AAVA 2F83A 2GBLC 1MKWK 3DA9B 2JJ1D 1DITH 1Z8RA 1COWD 4ABEA 3FWYA 3SZEA 3ZGXA 2NOAA 1JECA 1KI9A 3L0SA 5TB5A 3IEUA 1NRPH 2CE2X 2GEUA 4Y0AA 4B2PA 5IF9A 3NZIA 2DWPA 4G1UC 4ZCMA 5L2ZH 4GP7A 2IXEA 2ZU4A 1PZNA 1FY8E 1GJ4H 4MUAA 3U4QB 3CH4B 2ZFFH 1ELEE 1T9HA 4X6OA 4OK5A 2ZU1A 1N6XA 4R8TB 3BE4A 1G7RA 3M4YA 4LK4A 3A80A 3E6PH 1WQ1R 5AJVB 1GMCG 2Y7XA 4ZKRU 1P05A 1AN0A 5LDDC 4QJ5A 1O3KA 1TA6A 3AF1A 5TCCA 2RGCA 1O5FH 5H8WA 2Q6DA 3GDVA 4D4LA 3EPHA 3T35A 2OESA 3MFYA 1OKKD 4CT4B 8OHMA 2VYFA 4DCTA 5EOKA 4DLWA 3AF2A 3T34A 2XGJA 3VR6A 2IHYA 4PC6A 1P7CA 2O8CB 3MU1A 3RDZA 3FMFA 3BFXA 1P9NA 1QBNA 1R0ZA 4J1YA 1HB0B 1JXOA 1QHHB 2QM8A 1CVWH 2ZP0H 1DXWA 3PTBA 1XVMA 1A5GH 1YZLA 5C4GB 2OCPA 4C0JA 2XCFA 1YCPM 1G36A 3UR6A 4IC5A 5J4KA 2JLVA 1QRWA 3BTWE 1P9UA 4YMSA 2FEMA 4TYPA 2RH5A 1C2IA 3FVFB 4AC9A 1NIJA 2O8UA 3BTDE 1K1PA 2BY7X 3OESA 2Q9CA 5EUMA 1KDOA 5KTYA 1OHHD 1T0HB 2ZAOA 4DJZB 3P26A 5IT5A 1D3PB 4O3TA 2XITA 2E9SA 1FUUA 3SV6A 1QB1A 2PL3A 2BKUA 1GG6B 1DE7H 1BITA 3NBYC 4XSHA 3L2OB 3WXMA 4QL3A 5ESBA 4O9VA 5FXLA 2ASUB 5C1UA 1BTUA 3EPJA 2HT1A 1TF5A 5FBRB 3I61A 3THXB 3ZVEA 1K1NA 4OQFA 1HFDA 1Z6YA 3PWBA 4B74A 1MD7A 1H8DH 2Z3CA 3ADBA 1KK2A 2FWRA 1SVWA 1TEXA 2C90B 1Y63A 3S9CA 4NP6A 2VWOA 4GPTA 4TQAA 2ZUDA 2JDIA 4C0LA 5D3MA 1ZCBA 1NU9A 4AOQA 2PWXA 3SJ9A 3QWCH 3AUXA 3URCA 3K1JA 4B34A 2B7CA 3A4LA 2FYQA 2Z7FE 2NU3E 3BG8A 4PO1A 2SGAA 5JBAS 1SGQE 3WRXC 2PGBB 3LNCA 1TONA 1Z8GA 1AGPA 1YJ5A 1D9XA 1YR6A 4NCNA 3TR0A 3MJHA 4DLYA 3MAAC 3EXAA 4BANB 1IN5A 3QPWA 1YPEH 3C4JA 1SB1H 2CBZA 3QUMP 1TLDA 4WMFA 2G4UA 5JHHB 3OIUA 3QBTA 1A2CH 2NTYC 2A2ZA 1SGIB 3RU4E 5B64A 1GL7A 5ESTE 2QQ0A 2FMJA 5ABWA 1HLTH 2BOHB 3MH4A 3A89A 3OY6U 2ZCLP 1GBJA 3ELAH 1S6HA 3V00A 2CHAC 1B0UA 3M36A 5DO4H 3GJ0A 1XUFA 1LW7A 5C46F 3BD9A 2EFCB 3KQNA 5EQSA 1Q1ZA 4K1SA 2ERYA 3O8CA 3VXEH 2NO0A 2WWHA 4F91B 2JLWA 1WBDA 4JJZA 1KI1A 2VP0A 1S5SA 2H9EH 3IIKA 3F9FA 2ZFQH 1QRZA 2Z9GA 8GCHF 1NC6A 4CBNA 1NT1A 2HJVA 2OBQA 4LHXA 1NJGA 4OS2A 5A0FA 2ZRLA 2PMKA 3CW2A 3LY5A 1HYLA 1VCWA 3KL6A 1AD8H 5JRJA 1XTRA 2DBYA 3PEWA 2IK8A 3TW8B 1ZNWA 1X1SA 4UD9H 4KSBA 1GCDA 3K09A 5FUWA 3GLIA 2H18A 3Q3JB 4ARZB 4LBVA 3E16B 1G7SA 3P17H 3TH5A 4AKGA 2AWOA 2WYJA 1C5VA 2ZSBA 2PKSC 2QN5T 1FN6A 1HQCA 1X1RA 2ORVA 3UANA 1XUGA 4C0BA 1CO7E 3UQOA 2GK7A 3VGCB 2QI9C 1N0VC 1VHTA 4P4UA 1RW4A 5EQRA 2GMTB 4NWLA 4Y8XA 4CEIA 1S2MA 5KHOC 1E1QD 1XD2B 4NONA 3SQWA 2Q6GA 1FI8A 3U6BA 3LLMA 3W6OA 1NFUA 4TLEA 4FCTA 2FOFA 2QNRA 4XFQA 3FKSA 4JVLA 4QC2A 3W9YA 2OBMA 3PO1B 4B3BA 4GZLA 4F7WA 2UWPA 3T26A 3MH5A 1A1VA 1C1RA 1DDJA 2CXXA 5LPEA 2P93A 4DLZA 2J41A 2R0KA 1E0KA 3QPUA 4AB8A 1M6NA 5C18A 3STJA 2V3HH 5JDUB 3GCHC 1N0UA 2RGXA 1V2QT 3SNAA 3MU4A 4FU7A 1KSJA 2ZJOA 4A2QA 2QAGA 1SXJE 3AW1A 5FTKA 4K46A 1VITH 1HJAC 1ZOMA 4OYHA 1N3BA 1G4AE 2IT1A 3BAFA 1G41A 4WZBE 2DB3A 2ECKA 3KKQA 1GBAA 2AR7A 4H6TA 2V6NA 4U2WA 1BHXF 1KGDA 4OS6A 4JZDH 5UKDA 1TABE 2ZHDA 3CLVA 4US1R 4CRGA 1O2YA 1QHIA 3NH9A 4RZUA 1VITF 3VMFA 4ZKNU 3T5GA 2QP9X 4LK2A 1VGCC 3RUOA 4AKHA 5DISB 3UMRA 2BMEA 1OIXA 4Q19A 2ZRNA 4Y6DA 3K65B 1YRAA 3LAWA 3SBEA 2CK3D 2QT0A 2ZRFA 3TIUA 1A5IA 2F9PA 3TGJE 3BEFB 1T4GA 1MO3A 4UDWH 5CITA 1CJTC 4OK3A 1AQ7A 2GXAA 3QI2A 4FUJA 3C5HA 4PO9A 4MKFA 1UDWA 1SL3A 3T25A 1DT2A 1HUQA 2F9UA 2WPKS 4BLQA 4IDPA 1R5OA 5G3YA 3C15C 5FI0B 2H92A 2A7QA 2NO9A 2QMOA 3AP1A 1P72A 4TY7A 2HYDA 3GJ6A 1UCYK 3MNCA 3UWJH 3UIEA 2WPDA 3W94A 1GP2A 3RS2A 3D8BA 1T8TA 2JJ1A 3LBHA 1AE5A 2UZ3A 1AZ8A 1JBKA 3M5NA 1COWA 3F6UH 3RU4T 5DI3B 4IOKA 4M4SA 3LDXH 4YXWD 1W49A 4QBIA 3T12A 3W3ZB 3OF5A 3VHXA 1DEKA 1LPGB 5G40A 5C67A 1ZSJA 4EFMA 2WWYA 3MWKA 3CWQA 1JXMA 1CHOF 2BCJQ 1IOZA 3TQFA 1Q22A 1W2KH 5IK2D 5KDDA 1GDQA 4XSGA 1CE5A 1BQYA 3DFLA 1BMLA 8GCHG 2JH0D 1WBGB 1VCNA 2X2EA 1E0SA 4KTCA 3MOCA 2Z4SA 4LHZA 5DP3A 1H1BA 3B1XA 1UBGA 4V0NA 3RM2H 4BEBA 2ONKA 4Q47A 2ZRBA 3WMEA 1T4VH 3PEYA 1DWEH 1RVDA 1E2NA 1DY8A 1HT1E 3VR3A 3WYFA 1RFLA 4EJSC 2BY6X 3SV9A 4X8SH 4US0R 1J14A 1KHTA 5A0CA 2ZEJA 3I92A 1ZUHA 1UFQA 1OKKA 5K8LA 1LPKB 1E9SA 2IF0A 3RP2A 1BRAA 1W8BH 3UIRA 4JYBA 2B7DH 2VNTA 4AYXA 2V4ZA 5FFMA 2P59A 4V03A 2IA5A 2UKDA 1SR5C 2C8WB 3PMBB 1N5JA 2J9RA 4DGJA 5L3RA 1SLUB 1GGDB 4N3NA 1DOJA 1EFUA 3THYA 5BQ5A 1CRPA 3DUXH 4KTUA 5AF9H 5L3QB 3GLHE 3EIHA 3SUGA 1ESMA 2A32A 4GP6A 2ZRPA 3BH7A 3H0KA 1IAQA 1LY1A 2OTVA 3S1AA 5JS8A 1TNLA 4P4SB 1BRCE 4URVR 3B8JA 1OHHA 1NROH 4U30A 4WWYA 4F93B 3AUYA 3PMHB 2FX6A 4IBLH 4AN7A 4MYHA 3U5ZB 2ZS8A 1XEWY 3GLGE 4WH6A 3MNXA 1U9IC 4LGMA 2AKYA 4B6EA 3KN2A 5FBWB 1GI0A 1GL6A 2R6GA 2IYTA 2RKOA 5M04A 4NYMR 1GBIA 2J5XA 1CKEA 5KNDA 4FUFA 1FZQA 1NVXQ 1TQ4A 4GOJA 3RXSA 1C2GA 3K8YA 1KOFA 3FP7E 3SV8A 1G19A 1MMJN 4CRDA 2QGNA 3MWIU 2RGDA 2VWLA 3SGAE 3SYJA 3F8TA 4UFFH 2BVNA 2FOMB 3SW2B 3E5HA 1W0KD 2BCGY 4Z51A 3VXFH 2OQ5A 3S9AA 2J9NA 1CT0E 1SQAA 1QRAA 2BLWA 3PMAB 1VITG 4WXPA 1GDDA 2QUZA 2D26C 1GRNA 1RJ9A 2F1HA 2WJIA 2IWRA 2OCVB 5JCZA 4AYTA 2GKVE 2IYVA 2QF3A 1OFHA 5JZVA 5E3HA 4DT1A 2A5DA 4NH0A 5J4HA 2CVFA 1IQGA 4Q4AB 4V0OA 2C04A 4TTQA 2ZITA 4A8JA 5C1XA 3EA9A 1XUJA 4WY3A 1C1SA 2CHAB 3VX4A 5GVSA 1C1UH 4D9RA 1B0EA 1IN7A 1K1JA 1A7JA 1U99A 3V7TA 4PZYA 3UOUA 1R4AA 2UZIR 2BD5A 4I8JA 2ZTYA 5HMAA 2F4LA 4Q2KA 3T5DA 4Q4JB 3ZZAA 5BYKA 1W11U 5DGJA 2D06A 2HLDD 2A5IA 1L0ZA 3LV8A 1GHWH 4V0LA 1AS2A 4GHQA 3PMJA 1TWXB 4A6LA 1K22H 3TBKA 2OP9A 2C9CA 1JIRA 4HI3A 1YU9A 1XMVA 4XWAA 4TPYA 1O3BA 2XJ4A 4DB4A 4G5SA 3TUJC 3PTNA 4XIGS 4DVGA 5EE9A 2AEIH 5CHAC 5P21A 2PKSB 2JATA 3IHWA 2V8OA 1GHVH 3LRPA 2WICA 1C5WB 2XNIA 2GETA 3GJ8A 1EJNA 4IN1A 2VBCA 3OTJE 1GHBF 1DAEA 1G3IA 3X1WA 1Y3XA 3CZQA 4KAXA 3RXPA 4U32A 2O8FA 2P5SA 1O2MA 1VPLA 3REGA 2Q3MA 1SVSA 2LNCA 1ZPBA 4TT3D 2O0KA 1BTZA 4HZIA 1KO8A 4MYTA 4X1PU 1ZC4A 4QGHA 1OP8A 3I8SA 3WNBA 1ORFA 3LVQE 3J81k 1PPZA 4NCJA 3NCLA 1MTNC 3UMSA 2PMDA 3MWYW 3ZLJA 1LNZA 1B5GH 1O2SA 2DPXA 1A4RA 3S7KB 1MABA 5JS7A 1S82A 2ZS7A 4OI1A 5EP4A 2GAOA 3RXHA 2NO1A 4CEJB 1TGNA 3SZRA 1C2EA 1UPTA 3DKPA 1DE0A 1GMDF 2R44A 1R0XA 2XTMA 4ZCLA 4A1TA 1U0LA 3AAUA 221PA 3KGPA 1E37B 4Q1FA 3DOEA 4GLYA 4M1TA 3KKMA 1HJAB 2OSBA 1C1QA 5EW2H 2ODEA 1MTSA 1D3QB 2QGRA 4BZPA 1O3AA 3NG1A 1T7CA 3LJJA 2FIRH 5H1YA 2WKPA 1SC8U 4AK9A 5EU8A 1YCPH 1O2RA 4X8MA 4GNKA 4JYCA 1O2VA 1HTWA 4ABIA 4ZV4A 3GCTF 1E4VA 2ZRIA 5AWFC 2TGPZ 2QXIA 3U7GA 3PLBA 1GJBB 2EFDB 5AUNB 5E95A 1J2JA 1VGCB 4DCVA 2PGQB 4AYWA 1A7SA 1YLDA 4PPFA 3B1VA 4A82A 3RDPA 2BXTH 4RCYA 2R2MB 4NDZA 5JWOA 2FPZA 1PQAA 4LYFA 3ZD6A 1VKJA 2R3YA 3GY7A 2VP9A 1OXVA 5JWHA 4AGJA 1G2MA 1Y5UT 3I3SR 5EE1A 3LPRA 1S0RA 4AYVB 1GBCA 2WKRA 1QR3E 4L9SA 1X8LA 2QEQA 5EZ5A 2BD3A 5FOVA 3D7MA 2CK3A 3DKVA 1QURH 3T1QA 1N5LA 1U2RA 1Z08A 2THFB 1W1WA 5E2PA 1GI3A 6CHAC 1GKYA 2YNAA 3CUEF 2RHMA 4PZZA 4BWYA 3P4XA 1XTSA 2ODPA 1G5PA 3LX8A 3Q3XA 3A85A 2QSZA 1GMHF 1RIFA 5BXQC 4N1AA 3KIDU 5A8ZA 4SGAE 4B32A 2ZYTX 2R62A 2CGAA 4LI0A 3UMFA 1TNDA 4IOJA 3W5IA 2ZU6A 3PCRB 1K1MA 1QL8A 5SGAE 1SGDE 2QIQA 4HAXA 4JLMA 4CEHA 3NUMA 4JLPA 4Y8ZA 1M7HA 4Z54A 1GSIA 1FX0B 3TJUA 1KI7A 2X1VA 1QDEA 1AB9C 2H8KA 2OFOA 1EXFA 3MH7A 4YXWA 4U5XA 4G5QA 2ZYWX 1LTOA 4IFBA 1MKWH 3IQWA 2FI5E 3OU0A 2AFQB 4DURA 5G4BA 1KY2A 4FMDF 5AHGH 1G1MA 5EGMA 1OLOA 4DG4A 3T15A 1NY22 4NA7A 1N6RA 3P20A 4HZHA 4MNVA 1CTQA 1UDXA 2F3RA 5IK2A 1ESNA 4OI0A 2OLJA 3OSYA 1KJYA 1O2OA 4A6XA 4EJSB 2F9LA 1V2MT 2RGAA 3SORA 3AB3A 1TNIA 2Q6FA 3FZDA 4H1UA 2BMJA 4M1YA 4CRWB 3OEHD 1SGWA 4I8KA 1FMGA 1NRNH 1YC0A 5LB2A 4YMTA 3CRQA 1Q1QA 1G3RA 721PA 1MRSA 1K28D 2KWIA 1G2LA 2Y6TA 3PFIA 4NGAH 1OYQA 1N6HA 2BTCE 3KZ1E 2KE5A 2PLFA 2GCPA 1G16A 4XOJA 3FMPB 1Y3UA 4Y0ZE 3RC5A 2YC2C 3AM1A 3T2NA 4QNMA 1R6BX 2ZE8A 3ICEA 2Y5GA 3ZVFA 1WYKA 3B5JA 4PC7A 2D7DA 2QSYA 2G6BA 4ZHLU 1TU4A 2BJVA 6Q21A 4PPGA 4ZDWA 1E2KA 2EW1A 3GEIA 2FFQA 3A8AA 4SGBE 1XZPA 3EDXB 4TTPA 4AFUA 1E9RA 3M37A 1DFPA 2D2FA 1FZZA 2VTKA 3FFAA 1NFWA 2D1JA 4PQFA 3LVRE 1UKZA 1HAXB 1TQ0B 1TBQH 4DJTA 1DAKA 4DC9A 1MAYA 4WBSA 4EPXA 1S0UA 5CDFA 2OD3B 3I8XA 3N2EA 1N5KA 1C1WH 4JVSB 3ZVAA 2ZJZA 4PHTA 3RC4A 3D31A 2BMGB 1SGFA 2ZRGA 1R10A 5J47A 4EAQA 5T3HA 1BTYA 1AS3A 1JPNA 2HEIA 3LC5A 4GT1A 3THWA 4BFZA 4HDQB 4TL9A 4C7OB 2D62A 1G64A 1EAWA 2KAIA 3I62A 2M5TA 3ZZTA 1OFIA 3SHAH 1SGYE 3SI3H 1XNJA 3GISB 1O2ZA 1XX6A 3BS4A 1N6IA 2PW8H 4O0MA 3LGWA 1GHZA 4ZH8A 2JLUA 4HAZA 1S1MA 1CXZA 5TCAA 5FOTA 2BQWB 3MHWU 2GV6A 2VIQA 1JBUH 1W0KA 3GLIE 2ZRJA 2C3SA 3UNSA 2XOKA 1OXSC 3A86A 1Z5ZA 1MRNA 3RXOA 1A46H 4ESHA 1ZTLA 2AX4A 2I1VB 2EI8A 2V9PA 8LPRA 2ZDAH 1C5RA 1CBWC 2ZF0H 4RJLA 2BEKA 1Z2CA 3DM9B 3VR5A 1HIAA 1DBSA 4A36A 3ATWA 3CM0A 2HDNB 2N46A 4YONB 1KLTA 2OC7A 5JBCS 2J0UA 2FFHA 5J4LA 1DS2E 1AE8H 2BY9X 4PSAA 1O2LA 4VGCC 1Z0AA 2TBSA 1TQ7B 2ZGXH 1UVSH 3QG5A 1EP5A 2LCFA 5B6OA 2FOEA 1HRTH 2VSOA 4DSNA 1CQQA 5IHPA 1BBRK 2ZREA 1TYNA 2BY8X 1O5GH 2ZU2A 1L4DA 2OXCA 3RABA 1E2MA 1XD8A 2HLDA 1RZ3A 1T3SA 1V2OT 5KO2A 2RMKA 3GLFA 4P31A 3LC3A 2ALPA 3SJ8A 4XBDA 1SPJA 1YKSA 3HR8A 3HU1A 2N1BA 3AVOA 1O2IA 3G01A 2QYIA 4KFRA 1W4AA 4JL8A 3ZZ3A 2A5GA 1RKBA 4IVRA 1QL9A 1NY5A 3W8NA 1O33A 3KX2A 3C14C 1CLUA 5JSZB 1PQ7A 4B6FA 3TK9A 3AGPA 4X8OA 1KSHA 4QHYA 3D3QA 5BN5A 2Z4RA 1O2UA 3SN8A 1SHKA 4Q4HA 1FMLA 2Y80A 2CL6X 1KYIA 4U7DA 3TU7H 4CVNA 3RXIA 2P0EA 3PROA 1BS1A 4CRFA 1U0JA 4JZKA 1I4LD 1BO6A 2J1LA 4A5TS 4JYVH 3ZJYA 1TAWA 1ELVA 1MTNB 1VIAA 2REXB 2BD7A 1EFHA 4F49A 3SS8A 1XJCA 1BA8B 1ZYOA 4A6PA 4TT3A 1CT4E 1KSGA 2DR3A 1Q31A 3RMNH 2BBWA 4TPIZ 1DAFA 1HV8A 1XMNB 3V4RA 4I31A 4HB4A 2G5VA 5ANRB 1W7XH 4FI3C 1C4U2 2OC8A 4YMVA 3A1VA 1J7KA 3KQLA 4BRUA 1MZDA 3CWZA 2WYGA 5A2MH 2FEOA 3QKRA 5GJWC 3MU8A 2BKEA 3OIYA 3BC1A 3EAQA 5KSYA 5JJLA 4M1KA 4M1MA 1II8B 5JECA 5KPDA 1E9BA 1QB9A 4DCDA 2H1UA 3SNCA 1YZQA 3T27A 4CGZA 2GEDA 5FL7D 2GZAA 1G21E 4IDQA 3KJGA 3IIJA 4UNRA 2XB2A 4MYUA 4ZROA 4IXNA 2WSMA 3A37A 1QNJA 2FESH 1ZTJA 4NFEA 1RFNA 5DP8A 1NSTA 1PUJA 1TQDA 1O38A 4ZIRB 1X6VA 1ZM4A 1F2UB 1XCMA 5GADl 9ESTA 1QJ7B 2A9KA 3ATMA 2VVUA 2ZAMA 4BXWA 3MO3A 4EFNA 1PPHE 1NN6A 1WUNH 4K2YA 1MTVA 3B1ZA 5CE1A 3EC2A 3UG7A 1O3CA 2Z3EA 1ANBA 5K8IA 1G8FA 3QKSA 3BTEE 3DM5A 4LBYA 3LFUA 3OTPA 2IUUA 1Q3TA 3VAAA 1HAYB 5CM8B 6CHAB 3ZVLA 4IDOA 4HUQB 3RRYA 1O2PA 1FPMA 1LVGA 3M7TA 1IM2A 3FFBA 3ATLA 3VB7A 3E70C 2ZDMA 2G83A 3WP1B 1ZHRA 2PZEA 4BFWA 4K1TA 4XTRA 1O3NA 2BD2A 5KOYA 1E2HA 4IOMA 1RPZA 3H5CB 1R8SA 1UHBB 3RYTC 1O2JA 1FV9A 3PV2A 1A0HB 3TK5A 4U01A 4AFQA 1XX9A 4M1WA 2PZGA 1G4UR 2A5KA 1KK0A 2NU2E 1BTWA 1W0JD 1FOEB 3X1XA 2BQ7B 1FP6A 1TALA 1JB1A 4YTAA 1II9A 1FONA 1DVRA 1F2TA 2ANBA 2GZHA 2ZYVX 4CR9A 1JMOH 2ESTE 1XTQA 1H9HE 3E8LA 1V3XA 2ZGCA 1EUFA 3BTFE 1LVOA 1L1NA 1O3FA 1QA0A 5LPNA 3UNQA 2GDDA 4H42U 2Q3HA 3VB5A 2I6QA 5DO9A 2HALA 2G0NA 1O36A 1UK2A 2REBA 1UCYH 4X6NA 4M22A 5CLQA 2BMDA 3UOPA 4MG3A 1XBTA 1JJVA 4OGYA 3UG6A 2GVFA 4JZ1A 4E22A 3GJ4A 2ONJA 1WRBA 2JASA 1C1MA 1V2TT 4URYR 3QZQA 1YQTA 4HLQB 2FSHA 3NVAA 1LB1B 1W48A 2G51A 1EPTC 1BRUP 2Q1JA 2C03A 3GY5A 1TQ6A 1T31A 4PPNA 2QCYA 1G5TA 1OSNA 2IS1A 1K8RA 3KF2A 5EW1H 1N6OA 1C5OH 3OEHA 3NC0C 4X8UH 1WP9A 4GDFA 1J70A 1TBZH 4M0LA 3KNXA 3P6ZB 3ADKA 7GCHF 1DG1G 4B3GA 1IHTH 4D76A 1HAZB 1NLZA 2QZ4A 2GJAA 1P03A 1G9XA 3PJRA 4IRUB 1S9HA 3HGPA 1LHCH 1GBTA 5FOSA 1TMUH 1O3LA 3BTTE 1F0UA 1Z71A 4WZAE 521PA 1UTPA 4OJQA 3UWOA 4C2UA 1K1IA 2ZI4A 1JR3E 3G82C 2WIBA 2BOKA 2ZRMA 1ELTA 2R65A 3Q9LA 1G3BA 1DADA 3EZ6A 1P9SA 4WOPA 1TU3A 1DAIA 1TPPA 1L2EA 2FTLE 2W7SA 4CH2B 4ON9A 2GCOB 1IAUA 2GRJA 4INHA 4XE4A 1T8OA 3ATKA 2ODNA 1O3EA 2A4QA 3E0PB 3ND9A 5C1BA 3K0FA 5DH9A 2VINA 3FKQA 2ZGJA 1E69A 1GI6A 3AVPA 1NESE 3DHWC 1TX8A 4LJ6A 3U98H 4FUDA 1IQMA 4HAUA 3HK3B 3RXAA 1NRJB 1CA0B 3D23A 3A1TA 1YPJH 1V43A 1H65A 3SOPA 1KI6A 4KXFB 4ZKEA 5HZKA 1TL7C 2IYRA 1TOCB 4BXSA 4YOGA 1QB6A 3HPQA 3B9FH 3QUSA 1F0TA 1HAPH 1EZQA 4C30A 2B8OH 1AWHB 1GI8B 1YBWA 2SGDE 3OEEA 3F1SB 1RRGA 2A4OA 1EFCA 2NU0E 4JBYA 2Y82A 1P9RA 1P2TA 2QPAA 2FOLA 4CF7A 2WMOB 1P2UA 1UKYA 4RD6A 5HYOA 4YDHB 1V6DA 3EX7C 3GEEA 1PPCE 3WP0A 4K81B 3V0XA 4B3DA 3KB2A 4NYIQ 2XXAB 4HAYA 3KUDA 4LJYA 3NXPA 4DLRA 2XNSA 1XXHB 5TARA 1ZJDA 4DLVA 4Q1DA 1Z07A 1B23P 4G5GA 1K1OA 1EQ9A 4VGCB 2NPFA 1W12U 5F6MA 1JRTA 2A5AA 2IJD1 2KI5A 1KMQA 1W0YH 2RA3A 2WWXA 3C1KA 5DKMA 2XTZA 3PB1E 2FZLA 1L2TA 4URWR 3FP6E 2JLSA 1G37A 1S81A 1H4WA 2ZZUH 2FOAA 2FA9A 2SGEE 1EFTA 4CDGA 3P8OA 3TJVA 1S85A 4MGKR 3QVUA 1ETSH 1WBBA 2QBYB 2ZCHP 4XVUA 2LKDA 3NBZC 1MCTA 1AK2A 4JSTA 2FDAA 2V54A 5C4MA 2QE7D 4OQLA 3ZD7A 1Z0KA 4DIHH 3QEJA 2W3KA 3EIEA 2J34A 5C1YA 2ZSFA 4MTBA 2QTFA 4BLTA 2FM2A 2GILA 7LPRA 1YVDA 2YKGA 3RWOA 3K2UA 1NF3A 5DP7A 2XC0A 1SHYA 3AF4A 3ZVNA 2ZPRA 5DK1A 1BT7A 1XTJA 4NZLA 2G0TA 1LF5A 2QN6A 1CJMA 4X1SU 4D0GA 4M1SA 4QXAA 4BFYA 4KJZA 3SJZA 1GVLA 2CCGA 4A9AA 2EFGA 4BECA 2RGNC 2OLGA 4RD1A 2BLOA 3RSOA 2ZGBH 4AORA 4Y8YA 3K6ZA 2O8TA 4XOIA 2HCBA 3CPEA 3ZZ5A 1UJ1A 4B71A 4GBMA 2EFHB 2V0BA 2YNMA 1IJEA 3TE6A 2WWFA 3BH0A 2OC1A 1N5IA 3BTGE 2BJWA 2TGTA 3TAHA 3KFVA 4Q1AA 1D8TA 2J7PD 2GP9B 2C77A 3QENA 1LHDH 1NBMD 1N1LA 1MR3F 1E2DA 3JVUA 2TGAA 1ZMNA 4LPSA 1GG2A 5KDLA 1QQUA 7GCHG 3A8TA 3QX5H 2W2TA 3MWLA 4IOLA 1GI4A 1F2SE 3MGCA 2ZFPH 3GFOA 3WBKA 5CMXH 1TF7A 4UE7H 1NRSH 4ZI2A 3Q76A 5FBQB 1EFRD 4PHFA 3FGNA 4B3CA 1P2JA 3I5YA 5ELXA 3MWJA 4D9QA 1SQTA 5K8TA 1E2GA 1OP0A 4DRZA 1F48A 3ND8A 3ZS9A 1H8ED 1R2QA 3MD0A 4JIMA 2VH0A 3X1YA 3WNCA 1FPHH 2ZJ2A 3BFVA 5FL7A 4URUR 3LKWA 4DCNA 1DVAH 5HPYB 2KB0A 2ZDNA 4P3YA 4JL6A 3PV4A 2C8VA 4I1OA 1PPFE 4LHWA 5DP5A 5EJEA 1ZD9A 3MMPA 1VYTA 3OYPA 2BBOA 4LC0A 5HZHA 4MRNA 5L3SA 1X7AC 3QIAA 1SOZA 5HKKD 2QORA 2DCUA 1AFEH 1QHRB 5AJWA 2YOGA 1HBTH 2AWNA 1F5NA 4IVQA 3B82A 2G55A 1EP6A 3Q77A 3UXMA 3F68H 4Q66C 4ESTE 1P3JA 2J46A 1THRH 2IC5A 3ZDQA 2QV1A 3A7XA 4LY6A 4Y0YE 3DD2H 1Y8TA 4B47A 1ZPCA 5FBLB 2QU8A 3AVWA 3H1TA 5FX6A 3KCGH 5DJ7A 1Z29A 4Q5IA 2RHDA 4DLUA 2ZHFH 3P4YA 4WH8A 1ZMXA 4XJXA 5FTNA 3GJ7A 1C1YA 1ZUIA 2CL0X 4MVNA 3HYTA 2NO6A 4KFSA 1HYQA 4Q9JA 1P10A 1ID5H 2GT7A 5FR1A 2GX4A 4AY2A 3VFDA 2JAQA 3HK6B 4I33A 4Y71A 2BWJA 3S0NA 3TSWA 3E1XB 3EAJA 2D2EA 3DEFA 2KSQA 4WF8A 1SGEE 2ZCKP 4HGCA 1W0JA 2FPLA 1FQKA 4BZXA 2IEYA 2NO7A 4E7NA 2IJOB 3QTVH 2PKAA 3HU2A 2O8EA 1OWJA 3IITA 2O8DA 2ILNA 2JJ2D 1YHNA 4LYAA 1IQFA 4PAOA 4L9WA 3AP3A 1XDBA 3KQUA 1OYWA 1G7TA 2DFTA 3MNBA 2V7QD 4OS1A 5CDFE 3FPAA 1FLEE 3SUEA 4OS7A 4BQSA 2IS2A 4G5OA 1EPTA 3I73A 1WMSA 2A5FA 4HLCA 4B35A 3BB1A 1K2I1 5B57C 4PHGA 1GVNB 2C5LA 1R5BA 2CNWD 1PQ8A 4Q02A 1FY4A 4NIWA 4ISNA 4YDSA 3LO5A 3X1ZA 2BC9A 1XM1A 3PUZA 3TAUA 2IYLD 5BRRE 1DTSA 3EA0A 4ZPXA 4Q7LA 2EI6A 2ZJYA 3RXRA 3BTME 2IXFA 4TYNA 1PYTD 3T06B 4JLBA 2F43A 2WIAA 4B75A 2F6RA 3AH8A 4ZDJA 3B13B 1AM4D 4MUBA 4BLPA 1X3SA 2ZA5A 1NLFA 3U61B 1O87A 4ZCIA 1PLJA 1FNIA 3C41J 2JLYA 2ZI7A 3JZAA 1G7CA 1AHTH 3TGPA 2XB4A 4TLBA 5EP2A 3L43A 4OHVA 4D4MA 3ETLA 1BTPA 2F1JA 5JB9S 2XBVA 1H8IH 4G5RA 2WPJS 1T91A 2YC4C 4CBOA 4MRSA 2AMPA 4Q9IA 2BVRH 1ANEA 5LH8A 4NA8A 2CN0H 2VA8A 2EVWX 2Z5FA 4M7GA 1W0ZU 3RC3A 3WYAA 1XPOA 3RLWH 1ZJ6A 2P3UB 2CLSA 1VZQH 3GLFE 5LD2C 1H9IE 4Q80A 4GOKA 1IQHA 6LPRA 4F4CA 1TTTA 1JR6A 3GFTA 1TGCA 3KTAB 2YOHA 2RCNA 4IW3B 1OKXA 1BMAA 1OB2A 5B58C 1E96A 1QGFA 2X77A 4A92A 1XJQA 1CA8B 1Q3XA 3WYGA 1Q0UA 1NI3A 2PFEA 1L1GA 2NQ2C 2QPTA 5F2EA 1G8PA 3SOSA 1C1NA 3BSQA 1J16A 4YO9A 3ZZ6A 3K9HA 4XDEA 1XCPA 2FSIA 1KDTA 4LV8B 1BTXA 2O5VA 1WAYB 2VIIA 2V6JA 4IFEA 1EG7A 4OKSA 1TMBH 3K0AA 1K21H 3UK6A 2GVDC 3L33A 1L4YA 2UUKB 1QQ4A 2AL7A 4Y7BA 1F5RA 5G41A 5E0HA 3RC8A 3CX6A 4KYUA 3URDA 5EZ6B 1ELDE 4ZO4A 3I29A 4FCWA 1NMYA 4QGAA 4GSOA 4FVDA 3VNUA 4I32A 3HKJB 5KSPA 1DY9A 4BEJA 1LKAA 2PCLA 4R2HA 4CREA 5KUTA 2KBFA 4Y79A 3H84A 5GJBA 5F8TA 3GY2A 2XBWA 1YCPK 4TMZA 2VLIA 2CHVA 3PO1C 1VCMA 1HAOH 1SKQA 4CW7A 2YYZA 4LRWA 3GMTA 1UKVY 2QE7A 3RXLA 4X1RU 1ZC3A 2W5EA 1P3EA 2DE9A 4TMWA 1RYHA 1IQLA 4FUIA 2TGDA 1OSSA 4R98A 1O2QA 2TMKA 1QBKC 2BV3A 1BBRH 1YR7A 4OHWA 5JCPA 4LJAA 3D49H 1E6CA 2FGJA 1L1JA 4U02A 3TLXA 3AV0B 2O8MA 4TWWA 1BH2A 1EX6A 2YWFA 4YM9A 4JKIA 2QXGA 1FQJA 4B43A 1NJFA 2PT5A 1NPMA 5BWMA 1ZNZA 4ACAA 4MKIA 1SVKA 1L4UA 1SXJC 4JK6A 1US8A 3LT3A 1O5BB 4YLGA 3MU5A 4DDTA 1NMZA 1AVGH 5LB4A 2CVHA 4C0KA 1CU1A 3QF4B 1XEWX 2VH5R 1AKSB 3PVSA 5EPYA 1S0QA 3W34A 3A6PC 5D3QA 4RD0A 1G3QA 3ZVMA 2O8LA 2C78A 1HE8B 1KMHB 3U60B 1ESAA 2DHRA 2J7PA 3LIWA 3FB4A 1NBMA 3TGIE 1NP6A 1ONBA 4OQXA 4C0QC 4H4FA 3E91A 3LD9A 4JYTA 4GRAA 3CPJB 4R71A 1W2GA 2R6AA 2EWVA 3IKJA 3FHTA 1XJ0A 2W0MA 1C9PA 2UUYA 1EFRA 3B9PA 2IS4A 4US2R 4HSEA 3BEUA 4Q1CA 1EAIA 3ZYDA 1EOJA 2QP4A 1QFKH 4YOJA 4BAKB 3PLKA 3P92A 3M6AA 4K8BA 1SSXA 1MOZA 3LOXA 3M3TA 1H8EA 1ABIH 4K60A 2A4RA 2HUPA 4JSYA 4MITA 3K9GA 2P3SA 5LPFA 3QNUA 2HF8A 2P8OB 1DAMA 2D4HA 2ERXA 2REOA 1SKYE 1KNQA 3B23B 3MO9A 3P8FA 5CK4A 4JLVA 3L0PA 3R8FA 3BN9A 1TEVA 1RRPA 2ZUCA 4YOIA 1HNEE 1VCIA 4MGYR 5HKKA 1SKYB 4CT5A 2ZFSA 5H68A 1C4Y2 3U4QA 2AK2A 2GGVB 1Z6AA 1KY9A 4X2YA 5IDVA 2YZ2A 4B2IA 1TX7A 4D25A 1OB5A 2OFWA 3Q3KA 2EI7A 2R0LA 4C0AC 4YLUA 1IY2A 1D2NA 3HPRA 3RHFA 4LV6A 2W2XA 3FTQA 2ZECA 2IXGA 4Q9LA 4WVPE 2GF0A 4X8LA 2I4IA 1T32A 1G3DA 3EPLA 1BOQA 5L8VA 2WTUA 2XZLA 4I1VA 1S83A 1O3IA 2B8WA 1BMNH 1SULA 1D6WA 1GITA 2PV9B 1CJKC 3TSZA 1GJAB 3LH5A 2AERH 2XYAA 3BIVH 4D80A 2O8CA 1JRSA 3QXSA 3SN6A 1MAXA 3U1JB 1LVBA 1QHHA 4E5UA 4A4DA 2BDIA 4KGAA 4DVAU 5FHTA 5C2JB 2Z9KA 1GGDC 2QMUA 4BFSA 5J5CA 1W4CA 3FOZA 4C3ZA 1RTLA 4Y7AA 3CRMA 1C2LA 3RVBA 3R9IA 2QMHA 4ZDIA 3QO6A 3I78A 4PAMA 1LQDB 3VR1A 1W4BA 2QL6A 2JJ2A 2F3TA 3ZVDA 3P1JA 1GKUB 4LHYA 4BTIB 1TBRH 1E9CA 2QT1A 1UADA 3TVJB 1GWNA 1OIVA 2V7QA 5CJ2A 4E7RG 4RKEA 4MDSA 1WF3A 4RZ3A 2GXSA 2DE8A 3AVTA 5CIWA 1NRRH 4D4JA 2WV9A 3THXA 5L6NH 3CPHA 4A0RA 1ZU4A 2YWHA 4W5WA 3R7WB 3OFND 1BTHH 1W10U 3RLYH 1VHLA 1RC8A 1YP9A 2P3TB 3WHLA 1CBUA 3SU2A 2CNWA 1RRFA 3SJAA 2PZFA 3CH5A 4ASUD 4QJ3A 3T1VA 1CS4C 3GJXC 2ZJ8A 1XB2A 4EIWA 1EXMA 2BY5X 4L5BA 2EWWA 1YPMH 4I8GA 4ABDA 1WDTA 3PXGA 1P8VC 1G20E 3VX3A 2BD9A 3QDZB 3VFEA 5AVDA 3V4FA 3BF6H 1WXRA 5AJZA 1T8UA 2JLXA 1VJ9U 4RKOB 1C2MA 1O35A 2GXUA 4HFPB 4K8YA 4LSGA 1UVTH 2P94A 1OWEA 1W5TA 3B60A 3AVXA 1WSSH 5DGXA 5F98A 4TMKA 1CT2E 1V2WT 1LS6A 4TL6A 5C2ZA 5FTMA 4CIDA 1O34A 2HV8A 2SNWA 2XTTB 4GAWA 1LPZB 5E7IA 1EJMA 2HNTF 2FZZA 4NG9H 1TPOA 4FMCB 4O3MA 1TQ2A 1CJUC 1GL9B 3BGWA 1AZZA 1Q1EA 1ZIOA 1EGAA 5LD2B 1II0A 4C0SA 4NL4H 5J40A 2CJIA 3T28A 5FPSA 4D0NA 1A3EH 2EYQA 1O37A 2ANWA 1E98A 2QM7A 2CLDX 3AVQA 1C1TA 4K5ZA 4FUCA 2ZEBA 4ASHA 2B21A 3JZMA 2BVSH 3SGQE 3QJYA 2ZPQA 2BD8A 4AG1A 2IEZA 1ELCA 3A7TA 2GZDA 2GZ9A 4AWXA 4LXBH 3EPKA 1A61H 4M9SA 4B2LA 2G8TA 2AYWA 1Z1IA 1EX7A 3W95A 2IYQA 5EXXA 4ARZA 4HLUC 4P4TA 1EWQA 3A7VA 3SUFA 4Z0KA 1LHEH 2OE2A 3K9NA 1TPSA 2G88A 4QHSA 1NY6A 3ZZ7A 1BIFA 1GNQA 3GEHA 1UKEA 5H4IB 3HR7A 3ZV9A 1EWRA 3LW8A 4NMMA 3K70C 5EXPA 4Q7MB 4X2VA 3B8HA 1Z6GA 1OFTA 4LX0A 4DDUA 2FI3E 1OOKB 1XXDA 3FE2A 4DUGD 4MGZR 4NYJQ 2BDTA 4EQ6B 4XBCA 1XD2A 2LWIA 2EC9H 4XSKU 4FW9A 3F5FA 4Y0VA 1CEEA 3EQ0H 2C8YB 2VSFA 4HZUB 3NHBA 3M7QA 3SV2H 5A5GA 1SGTA 3T1OA 2GF9A 3U44B 4URXR 4PFSA 1MH0A 3F9GA 2A7JA 5J4QA 3MFJA 1GJCB 3RXTA 2WINI 1MTUA 4X8TH 3UWIA 3PLPA 1ZM3A 2QENA 1TMKA 3K0EA 5KSOA 2XTNA 1P2OA 2P16A 4H6SB 5DI9A 1Z6TA 1FAKH 1Z47A 3U7EB 4ABYA 3SQXA 3IGFA 1CR2A 2IYXA 3I72A 1SXJB 1GKIA 4HEJA 1Z6JH 1M7GA 1XMJA 4X0WU 1FL9A 2Z94A 4Z8YA 5KSZA 5HXFA 3DZDA 2ANYA 2CMKA 2ZJAA 3O8DA 1GHAG 3KDSE 1VCPA 4QOSA 4INKA 2AN9A 2HNTE 1O30A 1LFDB 2WM9B 2NU1E 1Z2AA 5E4FA 3MO6A 1CR1A 3VTKA 4P33A 3M7UA 4WIAA 2J3EA 3RS3A 3BERA 2J4IA 3Q00A 5HM9A 2GKSA 2IYUA 4OK6A 4B2AA 5JB8S 3U3KA 1N6PA 1FFHA 1EJAA 4LBWA 2JETC 3DT0H 2HXYA 2WAYA 2QXJA 5TY0A 1V2ST 3EWAA 1DAGA 3RXMA 1J8MF 4ISHH 4TZ6A 1ZM7A 3WMFA 4PSVA 5DSZA 3SJIA 1KLJH 3A88A 1DAHA 3BV9B 1NVVQ 3HYRA 4OBEA 4RFSB 4LZ4B 4LJ8A 3TK1A 3UWKA 1NFYA 4PR0A 2YOFA 3PIRA 4MDFA 4G3XA 1HAVB 2FFAA 2AXNA 1AA9A 1IN6A 3RWMB 1H8HD 4V02A 5FBEA 2GBLA 3R3GB 4D2IA 4DLTA 1FY3A 1KAOA 3B2EA 2DUCA 1DWBH 3ZH9B 2ZE6A 1QHGA 1OIWA 5JBTA 4YT6H 3VQTA 2ZRCA 3G0HA 4PAQA 3QTOH 4Q1EA 1BB0B 2BDGA 1SGPE 4QM6A 1FY5A 1F60A 4LOYH 5DI3A 2A2XH 2HOBA 5T6GA 1TGTA 1NTPA 2IL1A 3NTUA 1J15A 2AK3A 1SQ5A 4WW0A 3GY4A 1T6NA 4OM9A 1AQYA 4THNH 3ZVGA 4GVUA 4QGFA 3VU9B 1BKDR 3A4MA 3RXEA 4DXAA 5A09A 1P5ZB 2FSFA 5AUOB 4KI0A 2VHQA 3GY3A 1IXZA 2OM2A 1P6XA 2WPHS 4M9FA 1JOUB 4Q4LA 4DZZA 4MLFB 1GJ9B 5BYJA 2PTCE 2RGBA 2VIVA 1KI8A 3ESTA 5LBIA 2HVXA 3EWSA 2HCJB 2ZROA 4X2XA 1ZSLA 2FOHA 1TGBA 4F4JA 1AFQB 4LHVA 5LGOA 4RCZA 3L0OA 3A36A 4DDWA 3ZIAD 3QE0A 3T61A 4QJ4A 4B2CA 3S9BA 3TUIC 1SGCA 5CK5A 5K8UA 4B33A 2OILA 4S2EA 1QBVH 2FO9A 1DS6A 1E2FA 1G8GA 3NBXX 2P6NA 3SEAA 4ABHA 3CS0A 4QT8C 1PLKA 2WVJA 1FIZA 3R8CA 3NKVA 3AVUA 1BHXB 4U00A 1NSFA 2FNAA 1AVXA 1KDQB 2ZVQX 5L3QA 1ZNYA 2VB0A 3SU1A 2HRVA 8ESTE 1ZMLA 1S4QA 3QG1A 3GLHB 5FL3A 4EUNA 1LVYA 1SHZA 4TMXA 1QCPA 1JJ7A 3Q7QA 1F5LA 1KXDA 2G52A 5FUXA 2ZWLH 4P4SA 5CIQA 2BDBA 4NA9H 3AW0A 1VJAU 3ZZ0A 4NZQA 2J0VA 3RXKA 1XKAC 4JKYA 2A0QB 4KKDA 2FZ4A 2J95A 4UJ5A 3AVZA 1KNXA 2A1DB 3M5LA 5JWRA 3GLGB 2FS8A 2OQUA 3VHLB 1AU8A 4B76A 3PR1A 4GI7A 5FCKA 4YQFA 1ZTKA 3CX8A 1X86B 1V2NT 3E3TA 3RXCA 4AURA 2NMVA 3IILA 3OFNA 3AQ4A 3UPUA 2ZJ5A 2XOKD 3AF0A 3QXXA 1WCV1 1DPOA 4JVNA 3IHLA 3SC3A 2JLRA 1TAGA 2ZQ5A 3NDPA 4ASUA 1DICA 5EPNA 3GP8A 1Z6EA 1ELFA 4C4PA 2Z83A 4TLAA 5C3NA 4H9GA 4JLJA 1IHSH 4PROA 1SGNE 1DSTA 2MSCB 3AKCA 2Z9LA 2VF8A 3TRFA 1T8MA 3GFPA 1THPB 1XMSA 3TH4H 2Q0HA 1QBOA 2Y5HA 1KK3A 2OZEA 2C8ZB 2JIZD 1W36B 3AVYA 2BOVA 1ZRBA 1G8YA 3PITA 4OGXA 3K09C 3SZNA 4HUTA 2ZYUX 3CNOA 4DLSA 5JEDA 1C5YB 2FXRA 1Q57A 2F7SA 2B92A 3FAOA 4Q4AA 2ZTSA 3U3MA 3KKOA 1SGRE 4W7SA 1G5RA 3AKYA 1J90A 1N8OC 3MSXA 3B7GA 2CJWB 3MU0A 1ELBA 1O39A 4Q4JA 2WWGA 2EQBA 1ZHPA 1JI0A 1AY6H 2YNBA 2RG3A 4JL5A 2A7CA 4WXRA 4RFVA 1VG8A 2WJGA 1KYNA 2R6FA 3UNRA 1MO5A 4DB2A 3LH1A 1C4OA 2BMFA 5AR1A 3LQQA 1UTLM 3EA8A 5CLLA 4WXVA 3IO3A 1DELA 1FIWA 4NPHA 1BYIA 1Q12A 1A0JA 3GPLA 1JQLB 1VG1A 5DLQC 1GTVA 1QL7A 4O2RA 2GHIA 1O3JA 1HAGE 3R0FA 1UMAH 1ZR0A 4W5JA 3VKGA 2ZI3A 4HLUA 1FMJA 3W3AA 1GJDB 3K70B 4ZI3A 2VVCA 3BEIB 3OIVA 2GZ7A 4CYMA 4HATA 5DYIA 3RLFA 1S3GA 1W7AA 3B9QA 1ETTH 4RSPA 2O8BB 4KFTA 2Y7ZA 2QMEA 3OIWA 3P95A 2BM1A 5FOXA 4A1FA 1GBMA 1HA3A 1YPHE 1GDNA 2VRWA 2FX4A 4DUGA 4AKEA 3M61U 1NBME 3FMOB 3W8RA 1C5LH 1NNEA 1IQEA 2ZPSA 1ZGVA 3IBGA 2ZFTA 2AGEX 3U6KA 1QJ1B 5GCHG 5FI1B 1ZYUA 3M0EA 3Q5EA 3UPEA 4CEJA 4UJ3A 4A0GA 5K7RA 1XEFA 1CR4A 5HR5A 2BZAA 3LX5A 1CP2A 1OP2A 3SBDA 4ZXXH 3HP1A 3B6EA 2IX3A 4E03A 1OS8A 3C7KA 2VP4A 4JS0A 2Z6VA 1XEXB 4O2LA 1EB2A 5C20A 4IN2A 3BORA 4LDJA 1KXAA 1GBFA 4DLXA 1W13U 2ZSDA 2C2HA 2EU8A 1EOLA 3EIQA 4TLCA 2C9YA 3AEZA 3G5UA 3GJ3A 2YWEA 1OXXK 5J4VA 4KTSA 2Q3FA 1A1RA 4LJ4A 4ZDKA 1GAJA 3U3RA 2I6SA 4DHEA 4GL2A 1TF2A 1ANCA 2R6CA 2IF2A 1ZGIA 1V5WA 4PQRA 1IONA 4PXAA 2JETB 3U3OA 4UXHA 3HATH 4JZFH 1O5DH 1Z8IB 3RNLA 3RXBA 1AKEA 5FPKA 1I4DD 3GYMA 1P57B 4Z8XA 4ZKDA 3TUZC 5KNBA 4LJ9A 1KTTB 3FYHA 4RN6A 4JCNA 5HE9A 4AIIA 4E06H 2BHRA 3QKTA 2ZQ2A 1PLLA 1WV7H 2G9NA 4QBFA 1O2HA 1OH5A 4NYIR 4M1OA 1ZJKA 2ZI9A 2R2AA 1JEEA 1Q3HA 4K1EA 1G291 1GCTC 2QP3A 1TA2A 4BGDA 1EZUC 4BAQB 1HAIH 3HWSA 1Z3IX 5A0BA 2VIPA 1H8HA 1YM0A 3ZV8A 4FMCF 4KLZA 4D81A 4Q7JB 2OEPA 1MO4A 6GCHF 1UM8A 4ZHAA 2C8XB 3SNHA 3U8RH 1MUEB 1FUKA 1TADA 1DANH 1DLKB 4PO8A 1WU1A 2AGIX 2VHCA 4M21A 1FX0A 4UXIA 1FNMA 3RMOH 1ETUA 1YPLH 3KKNA 5L30H 1C1VH 3SU3A 3ZZ4A 1AMHA 4CHAB 1E2IA 2XZPA 4INLA 3O47A 3KJHA 2RCEA 2PTNA 5JI2E 2STBE 1C2FA 1XFAA 4TL8A 3QOFA 3CF2A 2WJYA 4PC3A 3NH6A 4ZKSU 4YLQH 1I2DA 3NKKA 2AGGX 3K0SA 3LA6A 1O3PB 1JEDA 1E0FD 4MQAA 2ZUBA 4YZUA 4EJSA 2XWBI 5DN6D 5KU1A 1PPBH 4RVCA 8KME2 3GOVB 4K8OA 1O3MA 4BFVA 2XNDD 2ZR9A 3SV7A 3THOA 1Q2WA 1E34B 5AFZH 1UVPA 2C99A 3U2QA 4LCBA 3ZIAA 1M7BA 4WAUA 2ZE5A 2XJ9A 1FPCH 1H9LB 1GBBA 2JLQA 5T1VA 4R7ZA 1C5UA 2R8RA 3EW9A 5FOUA 1IY1A 1AZTA 3ZZBA 5D3MB 5TMPA 4GMDA 2ZRKA 4AFSA 5JJIA 1M74A 2A78A 5T6DA 1KDPA 3IQXA 2GZ8A 1IQPA 1KJWA 1J8AA 1ZD8A 4JZIA 4AFZA 1JR3D 3WBJA 1L4ZA 4X8VH 2Q9BA 3WMGA 2H2ZA 3AK5A 4ABBA 4Q03A 3EE0B 4YESB 1S84A 4OHYA 1E32A 3GCOA 1M8PA 5JBBS 2DFLA 1TRMA 1U9IA 2K1QA 2H57A 4XVRA 4IJMA 4KSCA 3SFZA 4RKJB 5CJPA 4M9ZA 1DM4B 3U69H 3QXCA 1O2NA 3OEED 4A8JC 1P75A 2ULLA 4RD2A 2YHSA 4MNWA 1CA0C 2BIFA 4NCYA 2W6JD 1CHGA 1EX3A 3C8UA 1XF9A 4OQMA 4ISOA 4I8LA 4C7OA 5EXMA 1ZUNB 1SI5H 3OY5U 2IYZA 4EPYA 1D3TB 1FTNA 4C2TA 3A8BA 2H5CA
chains in the Genus database with same CATH superfamily
3LBFA 2H2DA 3P97A 3QU4A 4GMXA 2Y0DA 3OLVA 1KJZA 1XLVA 1ARCA 5KX5B 1DX5M 2Z6BD 2F3UA 3H13A 1WQSA 5BVHA 4OP2A 4WKCA 5F52A 2FOCA 4ITRC 4Q18A 2OC4A 1W0CA 4G1BA 4NQZA 1XKQA 1OV4A 3PUWA 3CX7A 3BD7A 1XQVA 2C98A 1QCDA 1RMYA 2E2WA 1VL5A 1PJQA 4RT0A 1SVOA 4AXXA 5FBHA 1YR9A 2NPIA 3Q5DA 2YINC 2ZETA 5K3CA 1O0BA 4ABGA 1C2DA 1MKYA 3UFXB 1I5EA 2J87A 5JYIA 4LJKA 2HGTH 2FW6A 3UMYA 3MD9A 3JD3A 1XQ9A 3HADA 4PG6A 4FNAA 3KU4A 2B20A 1OZAA 3OKCA 3EASA 4ZO9A 1HEYA 5HDBB 3UAYA 4GE0A 1YS4A 4M0EA 1SXGA 2FKNA 2VNSA 3D62A 1XDSA 3K1YA 1VMKA 5M5BA 1ZLRA 1K7XB 1A04A 4D45A 2QAGB 1ZJ5A 2ZIZA 4CKWB 2HWWA 2HA0A 2B8TA 3LXXA 4LTMA 3OCZA 3HG7A 3LZCA 3E2IA 4EJ2A 1SVMA 3QEAZ 4I50A 1SBWA 4FSHA 2PT9A 2W3IA 3UAZA 4F7DA 2DWOA 3EQ8A 4CWAA 1K27A 4DS3A 5GV7A 5EINA 3KR2A 4CQMA 7YASA 4J2YB 2Q6VA 3ADDA 4IMQA 3RD5A 3TAXA 3DNMA 4Y9SA 1UK7A 1YB2A 2Q6TA 1P01A 5BSTA 4AD8A 3KQBA 2DY0A 4BNRA 1P29A 1WDKA 1PYGA 4M46A 4JK3A 5I7FA 1IZ7A 4GM1A 1MH9A 4RKFA 2ZS9A 4KHZA 1BNCA 5D87A 4E88A 2XOXA 5CVTA 3BGIA 5KYKA 1HYEA 1TA4A 3DL0A 4NU0A 3B85A 4GVPA 1X39A 2CYBA 2G04A 3MQ4A 2BX4A 3GJ5A 2ZR0A 1HSOA 1DOAA 2P3QA 3B1WA 1QPBA 4QEZA 3O4HA 3E15A 2MCFA 3F2IA 5H70A 5I51A 4JLWA 3VH1A 2FN4A 5F9HA 4ZIRA 1Y6FA 1F2UA 2ASEA 4RY2A 4UM7A 4OLAA 1AS0A 3DUFA 3D3NA 2YIMA 4ZYTA 4KXYA 2Z9BA 3IPYA 4XYEA 5DZSA 2QXUA 1MO6A 4FOLA 4MQFB 4W5NA 4IY1A 2CFIA 3HNRA 1Z28A 2BLLA 3FLAA 4FUBA 4LYGA 3HLYA 3P9YA 2CXSA 2J3LA 4X2WA 2HDHA 2BZSA 1D0IA 2QKYA 2OC0A 3GEGA 4OQQA 3ZE2B 4RPHA 2W00A 1A3CA 4CTKA 1IH8A 1XVOA 3RCBA 2PS0A 1LUAA 4DW2U 2R9VA 4YMIA 1Z5NA 2YYYA 2HA3A 1FYXA 2JFHA 3ODGA 1NKVA 3DMHA 2UYQA 5TQ2B 1Y1LA 3O3MB 4QXMA 4RANA 1VBNA 4D3YA 2BGTA 2NU8B 2X8BA 4R40A 5E2OA 3V42A 4ZT3A 4Q00A 4PNZA 5DIFA 2W6ID 4H7EA 1YE3A 1YPKH 2JNWA 2XBYA 2PQ0A 1WNFA 2J5QA 4FFNA 1LPOA 1DFHA 1P04A 5DCYA 1Z6XA 3THYB 3R9XA 2P2YA 3FN8A 2FX3A 3L4KA 2GZMA 2WAXA 1H2BA 2Q45A 4F45A 2F91A 1VYVA 1BXGB 4N7JA 3QU2A 2W6MA 2K5UA 2NYVA 3KTDA 3PXCX 3NZEA 4EPWA 2HK8A 5DYWA 3QOYA 4MJXA 4NXNB 3IIEA 3OOEA 2NZJA 4IVNA 4RY8A 2WA1A 3IAEA 5CA1A 2CWWA 4NI5A 3VSCA 2G1UA 4NOLA 4RETA 5ESWA 2QLTA 1MTOA 1D09A 3ZHQA 4Q7XA 2GOYA 3COVA 2QTTA 1P4SA 1GRRA 4UXJA 1R5NA 5DN6A 1QYCA 3DT9A 4JGBA 1MP0A 5EQTA 5JXJA 1UPFA 3TNDA 2JH6D 4C9BA 1GFZA 2QAAA