5FPTA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 2-(1-methyl-1h-indol-3-yl)acetic acid (at3437) in an alternate binding site.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 199
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fptA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fptA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fptA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA03
2ZSFA 1G3QA 2C3SA 1JAHA 3NH9A 1UTJA 1A0JA 2FWRA 4KBGA 2E9SA 4D9QA 2HNTF 4TLEA 1GMDF 1SLXB 2RMKA 4KTCA 2FSGA 4CREA 5HTKA 4LX0A 2RGNA 2OCVB 5B2ZA 1ZRHA 1HA3A 2ORIA 3AVQA 5HKKD 2GJ8A 1N0VC 1XCGB 1OIWA 1QZXA 2NO0A 2FI4E 2PSXA 4OS7A 2R6CA 2N46A 1JOUB 3AVWA 2ZJ5A 5D3MB 3QG5A 3QK1A 5JWHA 2GRJA 2FOMB 3DZ8A 2G1JA 1BMMH 3LONA 3R9IA 2PH1A 3RDZA 1Q2WA 2Y81A 2XTNA 4X0WU 1YZQA 1GI0A 2D1JA 2JIZD 3CRRA 3A88A 3RXOA 2J1LA 1GMCF 3ADCA 1EESA 4ARZA 2AS9A 4GOKA 4C0JA 5I25A 2FPLA 3MWLA 1Z1IA 1E36B 1JEDA 1SVLA 2QSYA 2EWVA 2C95A 2EA3A 2QN6A 2BYAX 1LNZA 3QXSA 1A46H 1S84A 2Z4RA 2PT5A 4CEIA 4US2R 4NWKA 4MNVA 2QUZA 3GJ5A 5F98A 3IQXA 1EB1H 3V00A 3RU4D 1GBAA 2XXAB 4B6FA 1OWJA 3AGQA 2SFAA 1UTQA 2CHQA 4K60A 5DP5A 2JH6D 1IN7A 1P4SA 3QKSA 3PTNA 2BKUA 2VP4A 3Q7PA 3DUXH 2ORWA 9ESTA 1J8AA 1UM8A 2KJQA 1O3CA 1G3RA 1P9NA 3TK5A 5LBIA 1DWDH 1VCOA 3MWKA 2QZ4A 1G7CA 3UWJH 3DZDA 2PHBA 4MPUA 4Q1FA 1P06A 4H6SB 3ADDA 4HB0A 3QIAA 3EXAA 4TMVA 5GNDA 1BB0B 5HM9A 1JXMA 2GCHF 3MH6A 1X1RA 1YZNA 1ORFA 3RDPA 2WWGA 3LX8A 2VIOA 2WWWA 1DE0A 4Q80A 2NO7A 1VKJA 3WP0A 1J15A 3C15C 4G5OA 1AVWA 3THYB 5BWMA 5TARA 3NIBA 2PW8H 3WMGA 1BMLA 1B0EA 1Z0IA 1P9SA 2SGDE 3Q7QA 1KDQA 4FUGA 2O8FA 3KUDA 1Y59T 2A30A 2P65A 2FN4A 1AB9C 2HCJB 1IJFA 2GGVB 4KU4A 3RXEA 1M7GA 3ZZDA 3BIVH 3RYTC 4Z54A 2IYQA 1NY5A 5FHTA 1MRSA 1OWHA 1CA0C 2CNWD 2REOA 3TPIZ 2IUTA 3EG5A 4LPSA 1CS4C 1W5SA 4YLGA 2O0KA 3U8OH 4Z0KA 2PX0A 3W9YA 4B2BA 5GWZA 3SV9A 1N5IA 3KDSE 4G0NA 1B5GH 5DO9A 4X1NU 3K2UA 2FX3A 2EVWX 1P9WA 1LY1A 1PQ8A 1I4LD 4FMBB 1T8OA 1IQEA 5ABWA 5L3QA 3THXA 1XZPA 1C5SA 3G0HA 4Q7YA 4Q7MB 1C9KA 2BTCE 3TQFA 4YOJA 5EG4A 1XXDA 3BG4B 4Y7AA 3BEUA 1G4UR 2VNTA 1EFUA 2FODA 1LVMA 4C30A 1NMXA 4JJZA 3GJ8A 1EZUC 5GJCA 5FOWA 1PFXC 1HAVB 1E98A 1O3BA 4AG5A 2Z3EA 1O3FA 3E91A 2ATVA 2IOTA 2R6FA 1E0FD 1CE5A 2VU8E 4CHAC 3BD9A 4GT1A 3SZRA 1KKLA 2VHTA 1TOMH 4IS5A 2NU1E 5DYIA 1G3MA 3FVQA 2REXB 4B2LA 1SGFA 1KXFA 4KSCA 3IO5A 4BXSA 3VXEH 4JK5A 4RKEA 4L8GA 3QLPH 3IO3A 4DOQA 4MVNA 4Q02A 4B34A 2CGAA 1SXJB 3V4FA 1SBWA 2ZECA 4PO1A 1DPFA 1GJ4H 4A2WA 4RY2A 3T35A 1AM4D 1W36C 3EC2A 2GCOB 2IYVA 4H9GA 2R62A 2GEVA 4QBIA 2OC1A 3ICEA 2PMKA 1JB1A 1BTHH 1MO3A 3NBZC 1ELCA 1EUFA 1NTPA 2FWWA 4I31A 5E7IA 1FN6A 3STIA 1IQIA 1KAOA 1WF3A 2EFDB 1C1RA 2BJWA 4BEJA 4MUAA 2Q3HA 3U1JB 4URVR 2J2UA 4YLUA 4ILEA 4MTBA 4P4SA 1QGFA 1W4AA 1W0ZU 1W2GA 2ANCA 1S81A 3UR9A 1SULA 5AR1A 2GV7A 3F8TA 2CK3D 4A1XA 4I8KA 3THWA 3MFJA 3A83A 2JLWA 4KP0A 4RSGA 2BD2A 1YLDA 1Z47A 1HXFH 4ABDA 3KHVA 1D9ZA 2W6JD 1IQMA 1FMGA 1H4WA 4PZLA 1H8HA 3QGNB 2WSMA 4Y11E 1GRQA 5FBLB 1M34E 5AJVB 2WV9A 1LVGA 1GJ9B 5DPAA 2YOGA 1FAKH 1T8LA 2FFBA 4JMYA 121PA 3E2IA 4NKRA 5K8TA 4FCWA 1A5IA 4RKOB 3SV7A 1O2UA 1TQ0B 1YZUA 3EPKA 4A6XA 4D7FA 2Q6FA 5DI3A 3RMLH 2DE9A 1E2EA 3M61U 2OCYC 4IVRA 2F1IA 5CITA 1TMBH 3ZVBA 2BVSH 1XMIA 4NIVA 1Z6YA 1GBDA 4E22A 1RKBA 1QL7A 2NU4E 4ZKEA 1WOFA 4VGCC 3LC5A 1GBBA 2VLIA 3EPJA 4GMDA 4MGKR 1XZQA 4P4TA 5DIFA 4MGIR 3A8BA 5F3WB 1A61H 3MU0A 2YJTD 2B7CA 5SZHB 4DCSA 4KSBA 3W95A 4CH2B 5JS7A 4ABBA 4B33A 2W3KA 1EX6A 5HKKA 4PHFA 1HY3A 3ND8A 5A2MH 4Q9HA 2XB4A 1T6NA 1CO7E 2ZGXH 3K53A 1BUIA 5LGOA 1NMZA 3OEED 1V2VT 1DAFA 2ZRNA 2WZQA 2TGTA 2FYRA 4A1VA 1KI6B 5TDHA 3BC1A 4WH8A 3CRW1 4MYTA 2D8WA 2JIZA 3RS0A 4AKGA 1HNEE 1W14U 1F2UA 2ASUB 1CU1A 4QFMA 4ZIRB 1MTSA 2QAGB 1V2TT 1GDDA 5KPJA 1XX6A 5EE9A 1PPCE 3SJKA 2C2HA 1HH4A 4MRRA 3PXGA 2A0QB 5EXPA 3LGVA 2V3OH 2GD4B 1P2SA 2FI5E 3JZAA 2XC5A 1R0XA 5KDLA 3WXMA 1ZC3A 3KL4A 1I2DA 2GV6A 1C1PA 4NCKA 1VCWA 2WV4A 4CEHA 1W4CA 4JSYA 3TU7H 4NZQA 1MQ5A 2FOHA 3U6KA 1ZU5A 1O5EH 1E2IA 3A87A 3FMOB 3JZMA 4LJ8A 5J4YA 3ZVFA 1G3CA 1O2NA 3Q77A 3F3YA 4WMDA 2QYIA 3VXFH 4QHYA 5K0HA 5A0CA 2FX4A 2Q3FA 4LY6A 4WBSA 1HAXB 2IXGA 3RWOA 4Q7KA 2ZIQH 2VIDA 1U98A 1Z07A 3MNXA 3WY9A 4DLSA 3KKOA 4DT7B 5GJWC 5HPYB 1GCTC 4PC2A 3BTKE 1FTNA 2XTZA 4CRFA 3LGWA 2GF9A 1IOZA 1M74A 2QY0B 2ZS9A 1UJ2A 4O9VA 2BWJA 1EATA 3SU5A 4YXWD 1KI4A 3H2YA 4JZ1A 1YPGH 5J4KA 2J45A 4WXRA 1K5DA 2NG1A 1O2LA 3W34A 1YPLH 1BKDR 4EQ6A 1TPAE 2REBA 2SGEE 3SO3A 4YTAA 2OT3B 4IEIA 4R0IA 3L0PA 2F9VA 4NYJR 3B60A 4LZZA 5E8EH 1YPJH 1Z8JB 3MU8A 4TMZA 1LCYA 3OESA 1GKIA 1NFYA 4I1VA 4ABGA 1DXPA 4QOSA 1EPTC 3LDAA 5F03A 1PJPA 1Q1ZA 4JT4A 1U81A 3RXLA 4GMXA 2IXEA 2XOKD 1AKSB 1RJ9B 1OWKA 3RNLA 4HI0E 2XEXA 1Z2CA 4A1TA 3NH6A 5FBWB 4A0FA 2WWYA 2BHRA 3VX3A 3SYKA 4K5ZA 4Q00A 2BBOA 4D25A 1WDTA 1P2JA 1EFCA 5AUPB 3DD2H 2FOGA 4JLJA 2AN9A 4QJ5A 3S1AA 1QDEA 1WQ1R 3S69A 4LOAA 3AVPA 3ZVCA 3QXJA 1VCPA 4ISOA 2F7SA 4WMEA 2VP2A 2WOJA 4OI1A 2GJSA 1QRWA 1DG1G 4NFEA 3CF2A 4OHYA 2FESH 2PGQB 1AZZA 1VJAU 4DCTA 1YGCH 5L30H 4MG3A 4NYIR 2EC9H 1K1MA 2QXIA 1GVLA 4JZKA 5L2ZH 2NZ8A 1EFTA 3C4JA 4NDZA 4B44A 1Z22A 1GZSA 1Z5ZA 3EARA 4Q1AA 3DM9B 1BRUP 3GY7A 3DOFA 4BTTB 3EPHA 5K8IA 1QRAA 2CVHA 3IILA 4DIHH 3DFJA 2VGCB 1QG2A 2PMDA 4HLUA 4HYYA 2FOBA 2CLDX 4A8JA 1CT0E 2AD5A 1BIOA 4KVAA 3HU1A 3U60B 4IJMA 1AUJA 1ZMLA 1VITF 3L33A 2Z6VA 1DG3A 4DUGD 1AD8H 3NKKA 2BJVA 3OIWA 4JL8A 4P0TA 2O52A 3M36A 3DKVA 4XDEA 1H8DH 3GY3A 2WPJS 4ZHMU 4HTCH 1QTFA 2FS9A 4EPXA 4X8VH 1QB6A 3TK1A 3KN2A 3RMMH 1ZR0A 2Y6TA 4EDHA 3CS7A 1O2MA 3RLWH 1ESMA 2DFNA 2ASEA 5LD2C 1N0WA 5BPEA 4CBOA 1OYYA 3TLXA 4A36A 1SKYE 1OXSC 4PZYA 2BCJQ 4PO9A 2VO1A 1K1NA 3I78A 3DVLA 3NK8A 1BDAA 5KSYA 2E87A 3LVQE 1L4DA 5CHAB 1W12U 4ZV4A 1W8BH 2ZS7A 2IYRA 1HEIA 4JL5A 1E9BA 2HALA 1AWFH 3M5LA 4EJSB 2QF3A 2GT7A 4TT3D 1GL1A 3TJVA 4JL6A 2O8BB 2OBNA 1JXPA 3ZVRA 1F5RA 4FI3C 4AYYB 3QZQA 4NHOA 3ZS9A 2W6JA 4UXJA 5FBVB 3R9WA 4X6OA 2VHUA 1H65A 2D06A 3T5FH 3PV0A 5G3ZA 1Y3WA 5H4IB 4OM9A 2DBYA 2XXAA 4DCNA 1OFTA 1V2UT 1U8AA 4FVDA 3UR6A 1SOTA 4R2HA 2FSIA 1QBKC 2ZRHA 1QJ6B 1IQGA 1NRRH 2HJGA 4IOLA 2F9LA 5GPIB 4BFUA 1P8VC 2OC8A 3P27A 3F9EA 2CL0X 4PC6A 1P9RA 2P3TB 3BG4C 2WJGA 4TN1A 4ERNA 3SJCA 4IDPA 1FY4A 1AS3A 4Y79A 3KF2A 1UTKA 3FB4A 2Z3DA 5LPRA 2C77A 1DLKB 4CGZA 4KCGA 5A0AE 2V35A 2ZDKA 3SNHA 2WWHA 3ZDQA 2HPPH 1C5OH 3GLIA 3VHLB 2G8TA 2XBWA 1LKBA 4X1QU 1N6KA 2FFQA 5EXNA 4IDOA 3K9GA 2OFWA 1ZNWA 2BOHB 1AHTH 2R2AA 1NU9A 3OHMA 4V0KA 4UNRA 4CF7A 3H7TA 4AFQA 3CM0A 2LPRA 1OF1A 4MUBA 1FNIA 2BM2A 1UDXA 4FIDA 1SXJC 3THYA 1UBFA 821PA 4DLRA 3VAAA 1VG1A 3C5HA 4TL6A 1AWHB 1NVWQ 1KLJH 2ZWLH 1F2SE 2O0JA 1QNJA 2QRZA 1CJUC 2H1LA 2OILA 1OV4A 4ZO4A 1SGWA 3RU4E 3IWMA 3RXVA 1YR7A 6ESTA 3VR5A 4BAMB 5EQSA 5G53C 4RD4A 3HK3B 1VG8A 3AF2A 1N2CE 1VMAA 4OI2A 2MSEB 4YMTA 2W2VA 1YPHE 1ZCBA 1H9IE 1Q22A 4LXBH 1ETUA 1TU4A 4MRSA 4ABEA 1OP8A 2A78A 2NMVA 1JAIA 3ZLJA 4NL4H 1WBGB 5B6OA 1LPZB 2Y7ZA 4O3UA 1LTOA 1FX0A 5AK0A 2Q1JA 4FMCB 3MJHA 3ZVLA 1Q3TA 1J90A 4F93B 4MLFB 4JYCA 3A8DA 3TUZC 2V3CC 1VHTA 2J0QA 3U8RH 1YPKH 1II0A 1XXFA 2VP6A 2FDCA 5B64A 4OQFA 4NCIA 3UANA 2JASA 5J4SA 1DITH 1V2NT 4MNXA 1HJ8A 2QSZA 3ADBA 4LI0A 2IS4A 2TBSA 1G3BA 4IFBA 3RS7A 1O2ZA 4KFTA 4ZXYH 5EP4A 4YXWA 4HZUB 1J99A 4RD6A 4C0SA 3HK6B 1HAVA 2XB2A 1OP0A 1XMVA 4UFEH 2XXLA 3QKRB 4TZ6A 4IKEA 1O2IA 1P2VA 2NPFA 2R2MB 1E2DA 1UKYA 4Q19A 2HPQH 3QKUA 3O47A 2Q9BA 1NG9A 1W5TA 3VKWA 1TALA 4O3TA 1HQYE 4BFYA 1O3PB 2ZFPH 3RMNH 4FXGH 1SOZA 1V2KT 2ZEJA 1RTKA 4TLBA 3A7VA 3AUYA 1MD7A 2R44A 4W5WA 3PUZA 1KYIA 2VYFA 1TQ4A 1ZOMA 2STBE 5EJEA 1XTIA 2UUJB 1SSXA 2ILNA 2VVUA 1C1OA 2AK3A 1VG0B 4XWAA 1SHKA 2ZYTX 3EQ0H 3GY5A 4HUQB 3NPSA 3U7EB 4XD7D 1IXSB 3ZVNA 2QEQA 4PPQA 2ZU1A 2QTFA 5FPHA 1C2IA 1C5UA 3UKDA 3ZZ3A 4B35A 1SVKA 1WXRA 3SQEE 4HAZA 2YWHA 1NPMA 2UZ3A 4GAWA 2LCFA 3NHBA 2XC4A 4HEJA 1TPSA 1C1SA 4AC9A 1QQUA 1TNKA 4BLOA 3RRMA 1HAIH 3SS8A 1P05A 1GGDB 5F8ZA 4LHVA 1QHGA 1C2GA 2UKDA 3BFXA 4NIYA 4KI0A 2Z9LA 2BVRH 4NZYA 1E0KA 2PSYA 1LHEH 4WMFA 1OIVA 2DUCA 4KLZA 4HZIA 1O38A 3NEJA 4RFSB 1X6VA 1S82A 1P73A 1ODFA 1W4RA 4RKJB 2QTHA 2C9OA 3A85A 1H1BA 4B32A 2J95A 1NRJB 1ZZZA 4QRHA 1CJTC 1S0QA 3W6OA 2CCGA 3SNDA 1N6IA 1Q12A 3GEEA 4DGJA 3U44B 1E0AA 3HKJB 4BFTA 1OKXA 4TLDA 5JBAS 4CEJB 1NL3A 1XEXB 1TA2A 4JBXA 2GZ9A 2A5IA 2ZFTA 2ZJ8A 1CRQA 4TMWA 3SJIA 1DY9A 4AG2A 3LAWA 4DUGA 4HDQB 2J0UB 2HNTC 1VCNA 1UCYH 2YOHA 3RABA 4DSTA 4NFFA 1O2JA 1BOFA 1HV7A 1D6RA 3B82A 2QG6A 4LBVA 4Q4HB 2CBZA 1GJDB 2IPHA 4B73A 1EOJA 1YBWA 3PB1E 1BYIA 4JLDA 1M7BA 2QI9C 3PR1A 4KHZA 1LB1B 3SNEA 2VJ1A 1Y3UA 2GKVE 5IDVA 2AKAB 1VCQA 1N6OA 4B2IA 1CJKC 4YT6H 3PEVA 2CHAB 3PMBB 1E2NA 2GXSA 2WOOA 1U6QA 4QHTA 1G8FA 4SGBE 5LPNA 5FPSA 3BTWE 2KBEA 3KNXA 1OWIA 5KSOA 2IYZA 1EGAA 5JRZA 1NMYA 2IBMA 4JT2A 1SR5C 3T5DA 4INHA 1O3HA 4M9FA 1JALA 5LH8A 1OXXK 1G8GA 2Z9IA 3KTAB 5CIQA 1XTQA 2JDID 3UPEA 2J7KA 2QAGA 1TNLA 4TT3A 2NTYC 1TGNA 1AA9A 3ASZA 3ONWA 1GI4A 2GKSA 2ZU0C 3HYTA 1A4WH 2EFEB 1CHOF 1OIXA 5AJXA 4X6PA 1YCPH 3CWZA 1SB1H 2F9UA 1CP2A 1TFXA 1W0JD 3R8FA 5IHPA 1AGPA 1D9IA 4DXAA 2SHKA 1TF5A 1YZKA 5JJKA 1DXWA 2K5UA 2XSZD 1G7RA 3WYAA 1TQ2A 3E0NB 4QJ4A 5FPYA 4EAQA 3GLIE 1R8SA 3FFAA 3KKMA 3TVDA 2RGBA 1ELGA 4DURA 4Y0ZE 4UNQA 1P3EA 2TGPZ 3FMIA 5FTMA 1GBIA 1KDOA 3SQHE 1AFQC 1OFIA 3KKPA 3CRMA 2WBLC 2PZEA 3L6PA 4Q1CA 1U8YA 6CHAB 3LOXA 1KJYA 4LHYA 2VGCC 4FU8A 2X77A 2V6IA 2AD1A 2EFGA 3WYGA 2IS6A 4TL9A 2OZEA 4R2IA 1CGJE 1NJFA 5AUNB 3AAUA 5JBBS 3S0NA 4LJ6A 4KV9A 1LQDB 3NDBB 2VSXA 1EB2A 1QHHB 2J3EA 4ZDJA 3BRWD 1AIPA 1KO1A 2ODQA 1AUTC 1EJMA 3QO6A 4A9AA 2OXRA 1PLJA 3IBYA 1W2KH 1NRPH 1N6LA 3TE6A 1UHBB 1M7HA 3QQ5A 2P8OB 3RS5A 7GCHF 1AKSA 4G1UC 1RJ9A 3OU0A 4RD3A 1ZSJA 1MBQA 4W5JA 5FBRB 4M4SA 5T6FA 2ULLA 1UVUH 3IITA 5L8VA 2RGXA 1P2MA 3FE2A 3I29A 1Y3XA 1Y63A 1C4OA 1DWCH 1YYY1 2XC0A 3OTPA 1T3HA 3KZ1E 4FCTA 3ATIA 1D2NA 1UF9A 4EJSC 3KFXA 5PTPA 2CL7X 2UWOA 2OQ5A 4IXNA 3SV6A 1E9DA 1TAGA 4URUR 3O8RA 3U61B 3K0EA 2WYGA 1EJNA 1KSNA 3A6PC 3P8OA 3U69H 1KO7A 1SI5H 4TWZA 4JZDH 2V6JA 1S4QA 4LV8B 1K1JA 1IN5A 4A0HA 1VPLA 5EGMA 5AF9H 1GJ5H 2VA8A 1RPZA 4OQXA 4G01B 4JLNA 1P2IA 3WHKA 4QT8C 2GZDA 1ZUNB 4Q47A 1UTNA 1YZGA 1J8YF 2DE8A 3AVTA 2AXNA 4IN1A 3RS3A 2OBMA 4E7NA 4FUCA 1C5XB 2OLJA 3T5GA 4M21A 2A7HA 4KBFA 1G3DA 1MO4A 1C5NH 1E2FA 2O8EA 4Y0YE 5DN6D 1O37A 1O5GH 1OB5A 4MQBA 3U2QA 5IT5A 3WMEA 2GCPA 1OLOA 1U0JA 1V2WT 4GZMA 1TADA 5FCRA 3SU4A 3FKQA 2XX3A 8GCHF 5L3RA 5JPMH 1J8MF 3ZZ9A 3IPXA 3T28A 3W6PA 1THSH 5GJVC 3BGWA 2EI7A 3ICQB 4XD7A 2ZRBA 3BTQE 4QHSA 2O8MA 3EDXB 1LO6A 4U32A 1V6DA 1WTHD 3TH5A 2HT1A 4MRVA 4GPGA 3TSZA 5E0HA 2B8TA 1SQAA 3TW8B 2WKPA 4YMUA 3GCTF 2F9NA 3LQQA 1MO6A 4LJAA 3SBDA 2G51A 3GOVB 3MH7A 3TVTA 4PQYA 4D80A 3MYWA 1DVAH 4BOHA 2WPIS 3NWUA 3ZZCA 1UPTA 1TB6H 2FEMA 2F3CE 4Q4LA 3S7KB 2ZI3A 2BMDA 1MR3F 2O8BA 2JLSA 4V0ME 3TJNA 1MO5A 4X6MA 1OH5A 3B1WA 3CWQA 1OS8A 2QQEA 4UFDH 1A2KC 4CH8B 3CKLA 3J81k 4LV5B 4M9SA 3R9XA 4K46A 4HAVA 1Z0DA 2ZI4A 3W90A 2DFLA 2V8OA 3BH6A 4J2YB 3KCGH 1U9IA 2VPPA 5C1YA 1GVKB 3LJJA 3EWAA 4RD0A 1O3YA 2Z0MA 4BRWA 1S9DA 3BFKA 1LPGB 1SFQB 4C0HA 3ETLA 2F9MA 3BSQA 1MZDA 1ZHMA 1NN3A 4X1RU 1GNQA 4OS1A 5CYPA 2BZ6H 2YV5A 1O36A 3NXPA 2IYXA 4H42U 3P8NA 2WTUA 4QM7A 3W3AA 2CHGA 3K70C 3X1ZA 1GMDG 2H8KA 1QJ7B 4ZI2A 1MT0A 1Q44A 3UNSA 2FE4A 3PEYA 2AYWA 4JLMA 4K69A 2OXSA 4D6PA 5E2PA 2FJUA 1SGQE 4A82A 2QGNA 4Q9IA 1EAXA 1XP8A 1ZD9A 1Q1QA 1QCPA 2R8RA 5KDDA 3GYMA 1E99A 1BBRH 1YR6A 1J2JA 5LB4A 5DP7A 1R8QA 3KXLA 4IC5A 1P0SH 1DAIA 4UE7H 2WM9B 3EZ6A 1S8FA 4L4UA 2C9CA 2QP3A 1CVWH 2XYAA 1RIWB 2PT7A 4GCHF 2VWMA 4BEBA 2EI6A 4PHHA 4RZXA 2C8YB 2IYLD 4TTPA 3K9XB 1FP7A 1HAHH 1YJ5A 4MRPA 4B75A 3ODDA 1E6CA 5P21A 2JDIA 1II8A 4DRZA 3HDTA 5A0FA 2HF8A 1MZAA 3LBIA 5EXLA 1EJAA 2GCTB 3BTGE 4OGXA 4FVBA 3BTEE 5DO4H 1PPZA 2GVFA 3IIMA 1IN8A 1GGDC 1W0JA 2W0SA 1WQVH 2XSZA 2AR7A 1IQFA 2XBYA 1G19A 5E3HA 4C2UA 1KXDA 1JEEA 4LZ4B 5GJBA 1KIGH 3TW4A 3P4XA 4BLSA 5CLQA 3GDSA 3RC6A 2I3BA 5HE9A 4K1TA 2NGRA 3OTJE 2CLSA 2WYJA 1UK2A 1TX4B 3D23A 5C20A 1PPFE 1GNPA 2QPOA 4HDOB 3AKCA 4HZUA 1R0ZA 1WAYB 2FP7B 2QU8A 3SJBA 3A4LA 3QKRA 1YR9A 1TQDA 4BFVA 4N3NA 4PPFA 2ZI2H 2WKQA 1FY3A 2AWOA 3QKSB 3N70A 5D3QA 2ALVA 3E0PB 1F0SA 3D65E 3CR7A 3E6PH 5FUXA 6LPRA 5JEDA 3ZIAD 1T9HA 3LBNA 1NLZA 1W11U 3SUEA 2H92A 2F9OA 1S3SA 4GP7A 2H9EH 4GSYA 1ELDE 5FTLA 2WPHS 3GLHA 1XD8A 2BXUH 2CF8H 3P26A 3QXCA 4B3CA 1NN1A 3FGNA 2Q0HA 2P3SA 3U3RA 1G9IE 1BTZA 1DEKA 2GXUA 2CHAC 1GAJA 4DJZB 3VHXA 4O0MA 1T8UA 3LH1A 3QVVA 3U9AH 4MYCA 3L3TA 2ZRCA 1W4BA 4I1SA 3TIFA 1AIXH 1D8TA 4B74A 5LB2A 2ZUBA 5AFZH 4XTRA 4OHVA 4E03A 1L0ZA 2TPIZ 3A81A 2J41A 2FTLE 1O39A 2QC2A 3GISB 4FCVA 2J34A 1KTVA 4TQ9A 4TTQA 5K7RA 3FMFA 3FP6E 4RFSA 1VIYA 1XBTA 3BTDE 2K1QA 1GCDA 4Q48A 2ODBA 4Y0VA 1GI2A 4B3DA 3RXTA 1N6XA 4TQUS 2QXJA 2A5KA 3CF6R 2BBTA 3RC8A 2IYSA 4BUJA 3OIVA 2GNOA 1SVSA 4N0DA 4HLQB 4OJKA 2AKYA 3PM3A 2ZI9A 3KQNA 1KK2A 4D0GA 4DEYA 2FMJA 3BORA 4AYXA 3TBKA 1C2KA 4HZHA 1SHZA 3SHFA 4K8OA 4THNH 4V0OA 1J9CH 2ZPTX 2Z6BD 4OS5A 4JIMA 4ABJA 1JMOH 4YONB 3THXB 3KB1A 4PC7A 5DN6A 3A7ZA 6CHAC 3RXAA 5KTYA 1HPGA 1IQKA 2V3HH 3RVBA 1EFHA 4Q7ZA 2OSBA 1YRBA 2FXRA 2DY1A 2ZE5A 3QF7A 1XF9A 3ZQ6A 5KU1A 3CX7A 2FPKA 3W94A 3PWCA 1GILA 1KI1A 4TY7A 3P20A 2GWHA 2P3FH 1RGQA 2AEIH 3SV2H 3RHFA 2IT1A 4M1OA 3IEUA 4Y71A 2ZCLP 3I72A 1XD9A 1OPHB 1BS1A 3RC5A 4DLVA 1G7SA 1SG8B 1ZM2A 2RKOA 2IW3A 3MRSA 2JJ1A 1WU1A 3LXXA 3ZYEA 1X3SA 4EPTA 1FOEB 4Y8XA 1AKYA 4EPWA 3UMSA 3PG5A 3ZVDA 1DBSA 2YVUA 2R3YA 1TUEA 2B7DH 2ZRJA 1GI3A 1LS6A 2CE2X 1SVOA 1SZPA 3FP7E 1GHYH 2P8OC 5J4VA 1UCYK 1EZXC 1C5VA 4MPWA 3I4LA 5T6DA 1E0JA 1T8TA 3H86A 1OH6A 5EW1H 1MD8A 1MKWH 1NRSH 3MNCA 1JNYA 1T8NA 2JETC 3GFPA 4EPRA 5FI0B 1YRAA 3UREA 1T0JB 2PZFA 2CHVA 4B2CA 3ZYCA 3LDXH 2F1JA 1NFUA 2P93A 2PLRA 1DELA 3CIOA 1UO6A 1A3EH 1YP9A 4IDNA 2FGKA 2NIPA 4JLBA 3QDZB 1SVMA 4D76A 2O8UA 3FHTA 4F7WA 3N2EA 2CMKA 1SKYB 3PVSA 2YINC 1UCYE 3LJOA 2PLFA 1E2MA 1HV8A 2IXFA 1EQ9A 4U00A 3D62A 3BV9B 3KQDA 3VKHA 3FVFB 3P8GA 4Q7XA 1WRBA 2J87A 4LV6A 2PUXB 2BQ7B 2Q9AA 1PQ5A 3TAHA 1O3LA 1N6RA 3AVXA 4GPTA 1IQNA 4YC7A 2H1UA 4H1UA 5AUOB 1OW3B 2F55A 5A8ZA 5KPDA 4INKA 5H1YA 2ZU3A 2ZPSA 5DI3B 4U7DA 3LRPA 5EQQA 3FZDA 3IHWA 5EQRA 1E94E 4X8OA 2KWIA 1QHHA 4BZXA 3AVVA 1G6OA 1RRGA 4DZZA 1E2KA 3PV4A 2B6HA 5DGXA 1C1MA 3BEIB 3UOUA 1G20E 4F49A 1T91A 1YHNA 2ZR9A 1RTLA 1AN1E 1GBEA 3WBJA 3Q3YA 4FWTA 1F0UA 3UNQA 2AGEX 1LDTT 3QTOH 1KAGA 2ONJA 1OXVA 6GCHF 1OJLA 2W6ID 3W8NA 4D0LB 1DFPA 1K1LA 1ELEE 4BNRA 2Y5HA 3N5CA 2FEOA 3U3JA 4MNYA 2AGIX 3ZQJA 2CXXA 4NYJQ 2PL3A 1Z6GA 1UVTH 3SI3H 4QL3A 2BOKA 2NU0E 4A6LA 1FP6A 2CV3A 3SHCH 1C4Y2 3A8AA 1F2UB 3ZZAA 5J5CA 5HZHA 2H2ZA 1YPEH 2BMEA 4B3BA 1GSIA 4Q9LA 2OV2A 3CB4A 1HYQA 3SU1A 2ZVPX 5HYOA 4R9UC 4KGAA 5F8TA 5K8LA 2G0TA 2FNAA 2ZSAA 1DWBH 1LS1A 3I5YA 1US8A 4KJZA 2ZVQX 5M04A 1BTYA 3K0SA 4CEHB 1Y5BT 3T15A 1ZHRA 3X1YA 4OQLA 3K0CA 2BD4A 1Z8GA 2WPMS 1UKZA 1UKEA 3GLHE 2JAQA 3MWJA 1N0UA 3MWYW 4UQOA 2A2ZA 1ZMXA 1O3AA 1NLFA 2CL6X 4CRGA 8LPRA 5FOVA 1ANCA 2AERH 1L2EA 1ZLRA 1DAHA 4NYIQ 2ZRLA 3MJRA 1SC8U 4QGAA 3ZIAA 4O03A 5A5GA 2X19A 4K81B 1D2EA 2JLYA 3T1VA 2GAOA 2QE7D 1FMJA 5TY0A 4C2TA 1DX5M 5BRRE 1OT3A 1RVDA 1E32A 4Q7LA 1UJ1A 1U8ZA 2XJ4A 1MTWA 2BMFA 4YDSA 1HIAA 2Z3CA 4ASUD 2OC0A 3SDZA 4PC3A 4A92A 2PCLA 4BAOB 2BD3A 5TCAA 4CT4B 4NSVA 1O5DH 5ESBA 1S5SA 5TXGA 5DE3A 3QUSA 5AJYA 4A5TS 1HXEH 4RJLA 4TMTA 1GM5A 1GVNB 1W0KD 1JRSA 3EIQA 3ZZ6A 1SMFE 1C5YB 2OQUA 2RGNC 1ID5H 4TYNA 4ZCMA 1ZPZA 4NCHA 1PPHE 1Y5AT 3RXIA 1NG1A 2AK2A 1M9UA 4BAHB 3K65B 1Z0FA 1RE0A 2BDCA 4YESB 2IWHA 3K6ZA 1JQLB 4BANB 1S6HA 4BTUB 2GCTC 4CRBA 4X8HA 1K1OA 3AB3A 4Q21A 1H9HE 3B85A 1HAZB 1ZMNA 3U5ZB 1KXAA 3W6NA 2VHCA 1CA8B 4EUNA 2HCBA 2X8AA 2XZOA 1FPCH 3P70B 3V4RA 4AWXA 9LPRA 2IN2A 1QHYA 3T26A 3MOCA 3U8TH 3NBYC 1FPHH 2PWXA 2ORVA 3H09A 1NVUQ 5BN4A 2F9PA 1XXHE 3CO5A 1RRPA 3VGCB 4GSOA 2YWGA 2IYWA 2FZ4A 1QVRA 1KI9A 2C5LA 2ZTZA 1WE2A 2AIQA 1QBNA 4ZKDA 4XWOA 5EUMA 3RC3A 3UIRA 1UDWA 4IDHA 4IOJA 1GRRA 5TCCA 2ZHFH 2CCKA 1F48A 1FJSA 2G6BA 1LKAA 1E9RA 1JR6A 1S0UA 2RGAA 3CNOA 3MTYA 1VJ9U 3ATWA 4MKHA 3NBXX 1MOZA 4CRCA 3K0AB 4D26A 1HFDA 1NFXA 4DWJA 2ZE6A 2A5DA 3H4MA 1CXZA 2W7UA 1HLTH 5FXLA 2XTTB 1AQUA 1Z83A 1V2PT 1JR3E 2SGAA 4I8LA 1KTTB 1FY5A 1DVRA 4K2YA 2NO9A 1EG7A 2IC5A 1TTTA 1CKEA 2BY9X 3I32A 4UXHA 4Y8YA 1O3DA 1GHXH 1E2JA 1II9A 1Z06A 5HE8A 1NI3A 3WNCA 3I92A 1AVXA 1IY0A 2QORA 2ZU6A 5GCHG 1PYTC 1XUJA 2GA8A 2WWFA 2WMNB 3V13A 1SGEE 4FUBA 1AVGH 2YNMA 4XH9B 1XUIA 2HEIA 1HUQA 2JH5D 1V3XA 2WWXA 2ZI7A 4I32A 1TNGA 1P2TA 5JB9S 3RXGA 1BBRK 1OWEA 1Z6TA 3OE7D 4TWYA 5HXFA 1HAPH 3THOA 3TAUA 3B6EA 2P2LA 4B76A 2ZTSA 1Q20A 2C98A 4MKFA 4BZQA 2PFEA 3VR6A 2VEDA 4BAQB 1S3GA 4TPIZ 4YZUA 3FMPB 3TJUA 4PSKA 1GIAA 1TBZH 1A0HB 4FUJA 3SQXA 3IQWA 1QHSA 1GI5A 2XBVA 1IAQA 2ZRAA 1Q57A 2WV5A 3SN8A 4X2VA 3EWSA 1WCZA 1SPJA 4C9BA 1NVXQ 1N5KA 4K1SA 4PZZA 2BLOA 4DEXA 1G2MA 4PANA 3UWIA 1BBRE 2ATXA 2A2QH 3MSXA 4BECA 3CRQA 2ZDNA 5FR2A 2WAYA 1ZRKA 4AY2A 3ND9A 2OBOA 2UUKB 3BXZA 3MMPA 1VITH 3AASA 3FHCB 1KI8A 3TK9A 4BQSA 3C16C 1IAUA 4PX9A 4PR0A 2V9PA 1UKVY 2ZHWH 3MMGA 3QJYA 2Q9CA 2XRCA 1LHDH 1KY3A 1WBBA 4NU0A 2O8DA 4E09A 4OI0A 3GLIB 5EP2A 4LC1A 5DP9A 2ZQ2A 5K8UA 4NIXA 1EAUA 2W6IA 1MAXA 2WPDD 2PTNA 1FXYA 1ZM7A 3VEQB 3X2SA 1T5LA 3BTTE 2WJYA 4UKDA 3RRNA 3VNUA 3ZZ7A 4FUDA 3K9NA 1A82A 2A7CA 1ZJDA 3DM5A 2FX6A 1E2PA 3LW8A 5JBTA 1LVYA 2OFXA 1ZPBA 3F5FA 3AVUA 3GDUA 3FYHA 1GG2A 1HE8B 4O25A 4CRDA 4PAMA 4QGHA 1P3JA 3H0KA 1ZC4A 1V5WA 3IDQA 2FZLA 2XJ9A 2A32A 3AV0B 4ZROA 3UMRA 1A1VA 1G18A 1TU3A 4AI6A 5LPFA 3M5MA 3UQOA 1YE8A 1LF0A 2G1KA 3UUZA 2BIFA 2VQSA 3OY6U 2F9BH 3ZGXA 4DIIH 2WINI 4TMXA 3RXHA 1GJ6A 3UWOA 5SZIA 3TSWA 4TYQA 1O32A 4B3FX 4ESTE 2PV9B 3B1ZA 1M2OB 4M0LA 1GPZA 2HGTH 1KI3A 2RA0A 2OAQ1 3RXBA 1E37B 1WSSH 1FX0B 3IEVA 2ANYA 1N6YA 4M9ZA 5IYTA 4AOQA 3GCHC 4MA4A 4UNSA 2ZSDA 2OESA 1VDZA 1YC0A 4HDCA 1DARA 3LKWA 1P03A 5AJWA 1PPBH 1V2RT 4M9QA 4G5GA 3DMDA 3SNAA 3TGPA 2FU5C 2XNSA 2HNTE 2QE7A 1MCVA 2PKSB 1C9TA 4E06H 4EFNA 1QY6A 4UONA 5EXTA 4CDGA 1TX8A 1AS0A 1UTPA 3BH0A 5IF9A 3W5JA 1DO0A 4OS2A 4ASUA 1CT2E 1TABE 3GLGA 4WA7A 1MKYA 3A89A 1PV4A 2QMHA 3CZPA 1ANBA 1IQHA 2QT1A 1XUKA 5EZ6B 3CP7A 4KLNA 1DAKA 2QP4A 5HR5A 3C5CA 2BEKA 2QV1A 4RD2A 3FWYA 2JLUA 2OHFA 1W0KA 1BMNH 2D4HA 2V54A 1HCGA 2P6UA 1FZZA 5JMTA 5JZVA 1H9LB 5EXMA 4L16A 3A1WA 2BOVA 5JI3E 1UK3A 3AVZA 4ESVA 4U30A 2WWIA 4BLTA 2QP9X 3NXSA 1ONBA 1DE7H 5ELXA 2EQBA 1F3OA 4EPYA 2O8TA 3U4QA 5E4FA 2O5VA 1GHAF 3NVAA 4IBLH 2ZDLA 4CVNA 1DOJA 3U3OA 4Q5IA 3I61A 4AKHA 3OIYA 2G4UA 4B3GA 1VYVA 1KJZA 5JWRA 1P7CA 3VPKA 2QMEA 4LJ4A 4U02A 1KSGA 2C04A 3CENA 2VL7A 2BY5X 2WVJA 3UG7A 1XUGA 1O3KA 3FP8E 3QZRA 2RHDA 1IXZA 3LWNA 1XRJA 4JCNA 1UBCA 1DPOA 4DB2A 1S83A 2OUAA 3C8UA 2E1RA 2OLKA 2BB4A 2QENA 5EOKA 2W3IA 5TMPA 1TMTH 2LNCA 2FOEA 1MKWK 1A5HA 4BGDA 2FPMA 1XCMA 5JCPA 2BEJA 1OYWA 1O87A 2J0VA 4PPNA 1NESE 4YQFA 2GZ7A 4QG7A 4BLQA 1TPOA 4LJ5A 3E90B 4HAUA 4JKYA 3LVRE 2OCBA 2P95A 2JLQA 3UIEA 3SHAH 1FNMA 1YPHC 2OXCA 3RC4A 2ZSEA 1NNEA 4FMCF 3IIJA 2ZITA 1R4AA 3VQTA 4PO8A 3PWBA 2XCNA 1GFIA 3AP2A 5AVDA 3GP8A 1GI9B 1Z71A 4PSAA 1AQ7A 1GL6A 2FZZA 2J92A 2ZYWX 3AW0A 2HDNB 4Y6DA 2QL6A 2GVZC 5E7JA 1LTQA 4AFUA 2MSDB 2P5TB 3GJ6A 3KJGA 4G5SA 5DP3A 4AYVB 1VG9B 3BFVA 4WWYA 5LDDC 1FZQA 1R6BX 5CDFE 4V0NA 5SZKB 2ZRGA 1QHNA 4XVUA 2ESTE 1E9AA 3LXRA 1GDQA 3F1SB 4ABIA 2D3WA 4RCYA 3MD0A 2PR3A 3Q00A 4A2PA 3GPLA 3QSYA 1NM6A 3OE7A 1FV9A 3L82B 4FN5A 1J16A 2WPLS 1J70A 2ZFSA 1F7ZA 2BLWA 2ANWA 4GOXA 4MPXA 2HWLB 5B30A 3HYRA 2XZLA 4X1SU 4TYPA 1E4VA 5BW8A 3UK6A 2TGAA 3K0FB 1NY22 5KUTA 4UJ3A 3TUIC 4EFMA 3ZYDA 4JJKA 2FI3E 4WOPA 4R8TB 3QN7A 5DG6A 4A6PA 4F38A 2OAP1 1ZTLA 2ONKA 1P02A 1C4V2 4JKIA 1S96A 5CB8A 2VP9A 3BS4A 1FL9A 3CRVA 3VGCC 3ZVMA 3LH5A 2A5GA 5HM2A 1U2RA 2FEQH 1P12E 2AFQB 1FNNA 1RTFB 4AGJA 3ZV9A 3RXJA 1YU9A 3EA8A 1VGCB 1TQ6A 1A2BA 4BFSA 3EA0A 2Y8EA 2ZR7A 1NO9H 4KAXA 4NZLA 4PAOA 1MU6B 1FDPA 1QBOA 3SZNA 4ISIH 4HLUC 4C3ZA 4OQNA 7GCHG 4A8JC 1ZNYA 4X8MA 1MBMA 4ZUHA 1EFRD 3LX5A 5EQTA 2A7JA 4PQRA 5DI9A 1Z8FA 1F5LA 3EZ7A 1OH8A 3B8HA 4DT1A 2GDDA 2WPDA 3TUJC 1H8ED 4XOJA 1RFNA 1HGTH 1O5AB 2ZFRH 4XBBA 2F1RA 4O3MA 3VB3A 3NKVA 3MO3A 2L0XA 1J7KA 2GTPA 3TSOA 4AKEA 5FOUA 3ATKA 1BZXE 1ZBDA 2BXTH 3ITIA 2F3TA 2QA5A 4LCBA 3HATH 4J0QA 4TWWA 3UY9A 1W7GH 1A7JA 2HVXA 3P1JA 1C2EA 1V2LT 4ON9A 2A5FA 4DDWA 1ZD1A 3QVUA 2B5TB 3I5XA 1SGNE 1D4PB 3QUMP 2THFB 3VR4A 3GEHA 3ATLA 5LPEA 1NT1A 3C1KA 1D3PB 3A8CA 3V7TA 5HCNA 2YC4C 3SGQE 4C7OB 1QHRB 1WYKA 3X1XA 2A5AA 2IYUA 3CZQA 3H84A 5DISB 1GHVH 3OFND 2RGEA 1DSUA 2IJD1 2CNWA 3GYLB 2Z94A 2O8LA 2G0NA 5KSZA 1XPUA 4I99A 5A4JA 3WP1B 4LSGA 3LQRA 1P57B 4UFFH 1EWQA 3JZ1B 1ZSKA 1O0DH 3VB4A 2WUCA 1W36B 1GMHG 2FSFA 3B2EA 4JZFH 2VF7A 5AFYH 4CZ2A 3A82A 4I33A 1FMLA 2PEYA 3BAFA 5I46H 5T1VA 2GILA 1A7SA 4MYUA 3R3GB 4OS6A 3GLGE 4LBWA 1K9OE 3JVVA 3P17H 4GDFA 1OE0A 8GCHG 3LIWA 1GBJA 1TBRH 2VTKA 3U7GA 3BOSA 3G01A 2ZANA 4DCUA 4DHEA 4W9MC 3UG6A 2ZA5A 1E96A 1QHIA 3ZZ4A 4DC9A 2BV3A 1RFLA 1RZ3A 1UAAA 1W44A 2YNAA 3P32A 2FOAA 1R7RA 1C9PA 4LZ1H 2IHBA 3RAPR 2VVVA 3JZ2B 3D31A 1E2HA 3QF4B 3ASYA 4MDSA 1ELVA 3K0AA 3BTFE 1KZ7B 3RXDA 4OGYA 1Q3HA 2C8WB 2ZYUX 2O8EB 2HLDD 1UVPA 1TRNA 1U90A 2DHRA 4LGMA 2Y82A 1OKKD 3GCTG 2MMGA 1N8OB 2ZI5A 1GL7A 5AUQA 1Z6EA 4CT5A 3TLOA 1CHGA 3ELAH 5EODA 2I1QA 1T3SA 2JH0D 1D9XA 2SGFE 1N6PA 2XNDD 4HATA 3F9HA 1TEVA 4DSOA 4XIGS 1GBHA 3PLKA 2RGGA 1O3GA 3OYPA 4AG1A 1PLLA 2BDTA 3CX6A 4TQAA 1GNRA 3M3SA 2ZQ1A 2FFAA 2J59A 5JSZB 4AB8A 3OY5U 1U94A 1WP9A 2R9PA 3IPYA 2QGRA 2VHJA 3SUGA 5A09A 1BTUA 5IDKA 2A3RA 5F8XA 1N5LA 1L1JA 1XJ0A 1TNJA 4M53A 4AGKA 4VGCB 3I3SR 4Q1BA 1GP2A 4U01A 3U7HB 3K9LA 1G291 1KO5A 4BAKB 1JECA 4US0R 4ZKOU 3PYHA 3U3KA 2CJIA 2A7QA 1MUEB 2F91A 2CK3A 4KTSA 1U0LA 3SJ9A 1P2QA 1QL9A 2GJAA 2EEKA 1K21H 1ELTA 2F3RA 4NA8A 2IUUA 1KNXA 2W7SA 4TL8A 2G88A 1E2QA 4Y76A 3I77A 3IBGA 2UUYA 3AM1A 4D4LA 4ZHLU 1O3EA 1T32A 1X86B 3KJEA 2GP9B 4JLAA 2VIIA 2VP0A 1ARBA 3N7OA 3GCOA 2OD3B 1Q1BA 1TA6A 4NYMR 5FH9A 3CH4B 1DS2E 3M7UA 3A7TA 4EPVA 3PLBA 3STJA 2H5CA 3T62A 3PMHB 3RM2H 5HMAA 1LF5A 1MTVA 4ZKRU 1KDRA 4M1WA 1A0LA 5FUVA 4DSUA 1BIFA 3I73A 4GCHG 2JA1A 3NZIA 4LBZA 3B13B 2J38A 3MU4A 1AQYA 3GLFA 1ZGIA 1UADA 3K09A 4AYWA 1EASA 3KQBA 1CLUA 2GAAA 1MMJN 5TVKA 2Z5FA 3P8FA 1ZYUA 4B3XA 4DSNA 1HDTH 3UTUH 1GITA 3ZV8A 3HKIB 1QR3E 4OYHA 1ZJKA 2I1VB 4DCVA 1D5CA 1W48A 3R0FA 1TNDA 1TX6A 4X2YA 3PUWA 2ZJZA 3TGKE 1BCUH 3LLUA 3CPHA 3D6TB 4UFGH 3KQKA 4IMQA 2V4ZA 3D7MA 2YHSA 3OEEA 4JVNA 4MDFA 3QG1A 1DAEA 3KKQA 3B23B 1MKXH 4GI7A 1ZU4A 3T34A 1EX7A 1TEXA 2FG5A 3FTQA 3AP1A 4RCZA 2WICA 2AHOA 2RGCA 1CJVC 5FPKA 1KLTA 3KQLA 4NPHA 5EE3A 2KBFA 2A31A 3V12A 3KQEA 3HPTB 1BMFD 1II8B 2UZIR 3SI4H 3KXIA 1GJ8B 3WRYC 3TH4H 3WY8A 4Q1EA 5JCZA 1OPXA 4Z8XA 2QPTA 5B6LA 5JDUB 1ZIOA 4X8SH 3T27A 1RYHA 5FL7D 3VR3A 4UD9H 5EXXA 1EPTB 3QWCH 2ZPQA 4KFSA 3SV8A 3KKNA 1V2ST 1W13U 1ESAA 2G4TA 4ZDWA 2FSHA 4WZ6A 1W36D 2ZEBA 3NUMA 2CCJA 4AIIA 3E5HA 1P10A 1RC8A 4GRAA 2ZI6A 4XJXA 3LLMA 1F5NA 1VECA 1FI8A 4AYTA 3RRZA 1AJEA 4CR9A 3KQUA 3LGIA 4WZAE 2IS2A 2YNBA 1GL9B 5JHGB 1ANEA 2FS8A 4Q66C 1O2RA 2OO7A 1L4YA 2FO9A 5DK1A 5HCIA 1NVVQ 1PZNA 1G2LA 2VH5R 2FOLA 5L6NH 1NSFA 4C0KA 1EFRA 3SU3A 2BDYA 2FA9A 2VIWA 4ZCLA 1TNHA 2GVDC 1H8IH 3T1TA 3O8BA 1AO5A 1B0UA 4FUIA 1H8EA 2W26A 5GDSH 1N25A 3KFVA 1SGDE 1BHXB 4FUEA 1G7TA 2Z43A 1BTWA 3SQWA 3BIFA 2WAXA 1NRQH 1NJGA 1WV7H 1UEIA 1O2OA 5JBQA 3SORA 1S85A 1FLEE 1KMHB 1VIAA 4AD8A 3GLHB 2ZHQH 2MSCB 4LOYH 2G9NA 1YCPM 3RS4A 2B8OH 1RYFA 1G4AE 3MG9A 8ESTE 2QGZA 3BBPA 2W0MA 4H1VA 1KK1A 3GY2A 4JS0A 3CONA 2XOKA 1C1UH 3C41J 2PZGA 1XTJA 3A1SA 3VU9A 4OS4A 3OFNA 4BWYA 4RZ2A 3EW9A 3BB3A 5F6MA 3K9HA 3NCLA 5GXPA 2ZRFA 4KELA 3PITA 1HT2E 3B1YA 1KDTA 2QAGC 4LYHA 3X1DA 4ZAEA 3GJ0A 5EW2H 2QROA 3JVUA 5JRJA 4DLZA 5LD2B 1NN6A 1RD3B 3QOFA 2IEZA 3CPJB 2ZAMA 5CM8B 1FUJA 8KME2 3KIDU 1IQLA 1O2HA 2QBYA 2J46A 1OXUA 1QA7A 2JEOA 3SW2B 3PEUA 2BX4A 4FINA 1JJVA 4FXPA 1U99A 3M0EA 3BTHE 2FOCA 3AK5A 1R0YA 1G1MA 2TIOA 3P92A 3SE0A 2A1DB 2HXSA 2HYIC 1MTNB 4NA9H 3Q5EA 1M8PA 4PAQA 1C2FA 1JWTA 3QKTA 3TGIE 4V0MA 3HGNA 1VGCC 1GVZA 1C5WB 1OSNA 1ZMJA 3T06B 2ODYB 2ZROA 2HLDA 2KSQA 1EAWA 1F6BA 3UNRA 3QEOA 3SHWA 1BQYA 1OKKA 1DUEA 2ZIAA 5FBEA 3X1WA 2D7DA 1P2KA 2PJZA 2XNDA 1XXHB 1G3EA 2V7QD 1AN0A 5E0JA 4UDWH 1XD2B 3PLPA 3E70C 1YF4A 5CE1A 1DO2A 3EA7A 4AG6A 1IJEA 2P94A 1BJUA 3DHWC 3PTBA 1W49A 3L8ZA 1T5IA 3L2OB 1CR4A 1RS0A 1YPMH 1DWEH 1AFEH 3GFOA 4CIDA 3QXXA 4FUHA 4IMZA 3T12A 2NO6A 4QGGA 4B1TA 3RXPA 2BD5A 3U6BA 2AMDA 5GIBA 3I62A 1HJ9A 3PMAB 1GJ7B 4OBEA 5EE1A 3Q8XB 1OX1A 4W5HA 4IOKA 5B58C 2O8CB 3AF4A 5DHFA 1O3IA 2B7BA 1XEFA 4D81A 5C5OA 4PHGA 3CUEF 4EFLA 3K0FA 3VMFA 1PJRA 4I1UA 4A0GA 5C3NA 5FTJA 5FTKA 1AU8A 4RFVA 2WJJA 4F91B 1XTSA 2V1XA 1C5PA 2GHIA 3SNCA 4X1PU 1XEWX 1P5ZB 4ZKSU 3F0TA 1GWAA 1MABA 5CJ2A 3IHLA 1C2HA 5J4QA 4OK3A 2F4LA 1T4GA 2DWQA 4Q9JA 3EZ2A 3GLFE 2RCEA 7ESTE 4TY6A 4Q4AB 3L0IB 4TTRA 3F9FA 5AJZA 2HJVA 4LPKA 4WIAA 3S9CA 2GZHA 2NU2E 2AX4A 5EP3A 1W47A 1EKBB 4M1TA 1GI7B 4YMSA 4OKSA 4XSHA 4LJ9A 2PUQH 1IHUA 3KEEA 3BE4A 3S9AA 1OXTA 2D2FA 2ZNKH 4EKDA 1TWXB 1JPNA 3R7WB 1LHFH 2Y80A 2D62A 4M8NE 1L1NA 4POAA 3QPWA 1G30B 1XUFA 1OFHA 2KAIB 2OCPA 2Z9KA 1ZTJA 4M1SA 1FN8A 1T8MA 2DWOA 3FFBA 3OEHD 2H17A 6GCHG 3LY5A 4DJTA 4WF8A 5GVRA 1COWD 3PENA 4I81A 1QJ1B 1C1QA 2BD9A 1J17T 4TMKA 1C5MD 3L8YA 1O2VA 4KTUA 4V0LA 2ZGHA 4MKIA 1N8OC 621PA 2OCAA 1TF2A 1ZCAA 3SBEA 3QNUA 3DA9B 3LGUA 3HR7A 4D4JA 1G36A 2H6MA 1P60A 4WW0A 1XEWY 1AK2A 5FX5A 4ESHA 2D26C 3M6AA 2JCSA 4JLOA 2LKCA 1ZPCA 4KXFB 1KK3A 3BH7A 3GDVA 2GJ9A 1NLYA 3GEIA 2QAJA 4D7GA 4HB2A 5EXSA 4OQMA 1LMWB 2QIQA 2NZJA 1BMFA 5EZ5A 1V2QT 4DLYA 3P6ZB 2ANBA 1K1PA 4C7OA 3K6YA 1KXBA 3GD7A 2ZJAA 2QAAA 2A45B 2ODNA 1P62B 5KYKA 1SVIA 5FL7A 1IY1A 5CHAC 3KXKA 1Y5UT 4AZ2B 5JJIA 5A8YA 4JBWA 2V1UA 1HE1C 1RIFA 3PUVA 4DDTA 1KDPA 5JHHB 4GHTA 1ZNZA 1DTSA 1R0WA 1P72A 2G77B 2IF0A 2ZGCA 1DANH 4IGDA 2PX3A 4AFZA 2OINA 1KK0A 1XJQA 2VSFA 4DBLC 1US8B 2QM8A 3FPAA 2YKGA 4I8JA 4DLXA 3C7KA 3A4NA 1JJ7A 1U9IC 3CH5A 2WMOB 2DFTA 1DLEA 4O2LA 5G4BA 1ZSLA 1VCIA 2OFOA 1Z63A 1WCV1 1MU8B 4HGCA 3KB2A 2AMQA 2VBCA 3QF4A 2PJRA 3W3ZB 3VR2A 1Z6AA 4X8TH 3ZZ8A 2UWPA 1FUUA 2PLXA 4QXAA 1ANKA 2N1BA 4XE4A 2FLBH 3LA6A 2DR3A 1BTXA 3B78A 3IUYA 1O2QA 2HYDA 2J7PD 2FGJA 2V55B 4NA7A 3NTUA 3RSOA 3Q3JB 5C4MA 3DEFA 2JLVA 1MRNA 2ZSBA 3T25A 4YO9A 5J47A 2VIQA 3GMTA 3DO6A 3PO1B 4NSYA 3GQBA 2Q3MA 1QB1A 1HIAB 3GJ3A 1RRKA 1T0HB 4IC6A 3DOEA 5JJLA 1HAOH 4LHWA 1UFQA 4KO8A 1A2CH 4FU7A 2YOLA 5IRCD 1T4UH 3BEFB 4K1EA 4QJ3A 5JSZA 1UK4A 1QFKH 3E1SA 4LBYA 2QTVB 1E1QD 3CF0A 1P2NA 2A9KA 4QKQA 2C8XB 1KZGB 2ODEA 5G3YA 4WJG2 2FFHA 1DS6A 2XW9A 2ZC9H 4Q4JB 5CK4A 1E34B 3EE0B 2UUFB 2UVQA 4BLPA 1TF7A 1EX3A 3URDA 1EK0A 1A5GH 2QA9E 4H6TA 2J5XA 1O31A 2W58A 4RKFA 3M5NA 3ZZTA 2G52A 2VWLA 1ZM9A 2BKEA 2IWRA 1TGCA 2VSOA 1OHHD 5BYJA 4Y8ZA 2WHXA 1JR3D 1SXJD 4OI4A 4A0RA 2QMUA 4GUXA 2FV8A 1HAYB 2FIRH 1YQTA 3A1TA 1ABIH 1C5QA 3TNTA 2Z9GA 3FZZA 1DY8A 4NTZA 3EZ9A 3RU4T 2Z4SA 1LHGH 2P0EA 1PQAA 1XFAA 3TK6A 4IFEA 3I1FA 2ZCKP 1NSTA 1LVOA 1TIOA 2O0HA 2BD8A 2LKDA 3VR1A 1CT4E 1GI6A 3B1VA 2AGGX 1TMKA 3A7XA 2W2XA 5EU8A 2Q6TA 4N1AA 4F92B 4NH0A 2ZU2A 4URWR 5CJPA 4ABFA 4DVGA 1P3CA 4E07A 4JVSB 1AE5A 3QBVA 3VX4A 2CN0H 1TL7C 1TRYA 2AMPA 1VR1H 3Q3XA 4K8BA 4QBGB 5C5NA 1Y8TA 3M7QA 2HT6A 1INCA 4WY3A 2QQ0A 2V7QA 1YKTA 4QNRA 1YM0A 3OIUA 1QRXA 3DHKH 4DKXA 1N6HA 2FOFA 1FQJA 4B2PA 2BDAA 1WMSA 2N42A 1NKSA 1Q31A 1AFQB 3T1QA 1QF9A 2EYUA 4R71A 2R6AA 4M1KA 2GTBA 3MHWU 3Q3KA 1E9EA 4EIWA 1ZGVA 4PSVA 1GMCG 3GY8A 5G41A 3SZEA 1E4YA 1SL3A 5FAHA 3F9GA 1OFUX 3CX8A 3SJOA 4GVUA 4ISLA 3RANA 3EYDA 4ZMAH 4B43A 4IHQA 3SUDA 2QCYA 1TGTA 2ZHEH 4OK5A 1AKEA 1G21E 3DL0A 3VB5A 2ZF0H 3U3MA 3T29A 2HV8A 1GHBF 3A1VA 2ZGJA 1NY6A 2NWNA 2ODWA 3C27B 3RXUA 4X6NA 2C90B 3OZXA 1EPTA 1CULC 4LJYA 1K6MA 4DB4A 2SGQE 2W83A 1MKXK 2VP5A 4GHQA 2XAUA 2H18A 3CW2A 1E35B 5D3MA 1RJXB 1FQKA 4WVFA 4FWIB 2C8VA 3AF0A 3LW7A 1PPGE 2HUPA 2Y7XA 1GHWH 4PPGA 4S2EA 5JYIA 1O3JA 1MTNC 3MLEA 5GJ4B 2OK5A 1EXMA 1AI8H 4JZIA 3OEHA 3FOZA 4ABYA 1AGRA 2GCHG 2ZE8A 1COWA 2GK6A 3A37A 5GCHF 4PXAA 5CIWA 4G5RA 1BMAA 5J40A 3AF1A 3AH8A 1F92A 2ZDMA 2WSSD 1OSSA 2FPZA 4Q03A 3GCNA 1ESTA 1CBUA 1P2UA 4V02A 4BFWA 2H9HA 1GWNA 4AB9A 4F4JA 4JVMA 1OYQA 3LH3A 3ZVEA 5J4LA 2H5EA 5GADl 3URCA 1T3LA 2FF7A 4WXPA 2V6NA 2OM2A 3RXMA 1A3BH 1KMHA 1JQJC 1TUIA 3VB7A 5KNBA 2O8DB 3QBTA 1FY8E 4V03A 2IX3A 4JLVA 3M37A 4CRAA 2P67A 4GFDA 3PIRA 2BVXH 3Q9LA 2DCUA 3HP1A 2BDGA 3Q85A 5GVSA 4Q7JB 1ELAA 3SGBE 1SGPE 5C67A 3SU2A 3MO9A 3ODFA 1FFHA 1LPKB 2EYQA 4OK6A 1C2DA 5DJ7A 4C4PA 1KY2A 4G5QA 1DT2A 1CR2A 2BM0A 1KSJA 4MH0R 4M1YA 4CR5A 4DY7B 3NBFA 2Z9JA 3WBKA 4B2AA 5JEEA 3KUCA 2GDEH 3MO6A 1ZP6A 3WHLA 1C2MA 4LWZA 3LO5A 3U98H 1V2OT 1KJWA 2R3UA 3G82C 2C8ZB 2JKHA 1JPJA 1K28D 2J9NA 1GHZA 1IXRC 2VWOA 5DH9A 4DCDA 1EZQA 4NCNA 3M3VA 4UJ5A 1O33A 3LGTA 4HSEA 4TZ0A 2DWPA 2BQWB 1E2LA 3BK7A 4QNMA 4OL0A 1GI1A 2BMJA 2OUKA 1E79D 2ZFFH 1HTWA 3NDPA 4LYAA 4XBCA 1V2MT 1NVVR 3FANA 1G41A 1Z0JA 4MGZR 3FAOA 3E8LA 1TBQH 2IEYA 1CF4A 4SGAE 4R98A 2JATA 2G83A 3ZZUA 3AVYA 1TRMA 2ZUDA 1YVDA 1Z8IB 2ZDVH 4O97A 1DAMA 2ERXA 2H5DA 2JJ8A 1UTLM 1Y3VA 1QQ4A 5C1XA 2DB3A 2X2EA 4CBNA 1NRNH 1CSOE 3TJOA 4U5XA 5CLLA 3MH5A 7LPRA 3RXFA 4OJQA 4AX9H 3T2NA 3BJIC 3MNSA 2CF9H 2J7PA 1HB0B 1G5TA 2GETA 2EFCB 1D3TB 4ZI3A 2NQ2C 1SGCA 4XBDA 2P6RA 3HPQA 1XXHA 1KSHA 2HOBA 5TV2A 1O3NA 3MGCA 3M4YA 4P33A 1P61B 1EZSC 3MCAA 3NHAA 1XD2A 4C0AC 1E1RD 3P4YA 3GLGB 1NF3A 2Z7FE 4LYJA 1GHAG 1Z0KA 2EU8A 2BZAA 2CJWB 4TLAA 1E1QA 1OH7A 3K70B 3VB6A 3SEAA 1JIRA 3BIUH 3DFLA 1I4DD 1O2SA 1O2PA 4MNWA 2D7CA 1SQ5A 2JLXA 2O8CA 3LFUA 1EOLA 7KMEH 1UEJA 2CLCX 3NWJA 2GDJA 1Y3AA 5TB5A 5E95A 5EPNA 1BH2A 1M1YE 4R7ZA 1O3MA 1GKYA 3MH4A 1VYUA 3E3TA 1OHHA 1XJCA 4ZPXA 3ZZBA 2H16A 2GT8A 3CR8A 3LBHA 4JLPA 3U4QB 1JR3A 1YR8A 1SXJA 1ELBA 1AY6H 2MMCA 5UKDA 1KXEA 1KXCA 5C46F 3HGPA 4G3XA 2GCOA 2EFHB 2W5EA 1F2TB 4U2WA 4Q4AA 3T61A 5L3SB 1CGIE 3SOPA 2G5NA 2PKAB 1YLCA 3ZVGA 2RDLA 1S0RA 5KDOA 2KE5A 3NC1C 1S9HA 4MGYR 4QM6A 1TMUH 3BF6H 2IJOB 5DHAA 4PHTA 2FDAA 4CYMA 4Y0AA 1EAIA 4WAUA 2X1VA 3TNSA 1ETTH 2AH4X 1GKUB 3R7WA 2R9VA 5C1BA 2R6DA 1MV5A 4B71A 3LGYA 4LJ7A 3WRXC 2QM7A 2KAIA 2ZUCA 3D3QA 3E1XB 3K0CC 3F6UH 4Y7BA 4C0QC 1Q1EA 1NN5A 3B1XA 3FDIA 1J14A 4BLRA 1X8LA 1Z8RA 2I6QA 1XKBC 4HUTA 1FY1A 3MI4A 1JI0A 1P04A 2ZHDA 2GZAA 1CIPA 3MFYA 4TSFD 3O8DA 1MCTA 4S35A 2OP9A 4GZLA 2A5JA 4DG4A 1G6HA 3LV8A 1OP2A 2P6NA 2Y5FA 2G00A 3D8BA 1SHHB 4LRWA 1GBCA 3PUYA 2C9YA 3BWDD 4DVAU 5DP4A 3PO1C 3IKJA 3CBQA 1NBMD 2NOAA 2CE7A 2TMKA 1XMSA 2I6SA 1GJCB 3GJ4A 4Z6AH 3QEJA 3HJNA 2GEDA 3CPEA 2VH6A 2D2EA 3ATMA 1GBMA 1TAWA 4QBHA 3G5UA 1QB9A 1ESBA 5KNDA 4JBYA 4JYVH 4KYUA 1G3IA 1THRH 1S1CA 2ECKA 1PVOA 1HAGE 1RRCA 1C1NA 4JSTA 2AXPA 2XITA 1G16A 1HRTH 2D74A 1Z1JA 3EGKH 3EAQA 4GBMA 1TNIA 5F9HA 2YWEA 1W1WA 5FOXA 4UEHH 4PROA 2HLCA 5C1UA 1HT1E 1LVBA 2ZXUA 1SVWA 1Y3YA 3LD9A 2VH0A 5L2YH 3IGFA 3TMKA 1DAGA 3B7GA 1SFIA 4YT7H 5EE5B 5BN5A 2ZREA 5JI2E 5JS8A 1A1RA 5KHOC 1KI6A 3DKPA 2KB0A 2QXGA 3KJHA 5FR1A 1QHXA 2GXQA 1DM4B 2CDNA 2RHMA 1XM1A 1ETSH 1U0HC 4BZPA 1C2LA 4XOIA 3EPLA 5DLQC 1W7AA 2VHQA 5EUQB 1IHTH 4ZIRA 2XTMA 1G9XA 4Q01A 4HAXA 1XB2A 1P75A 2C93B 1YKSA 1HYLA 4IOMA 4O2RA 3REGA 3AKEA 4M1MA 4HLDA 1V2JT 3FFGA 4X8LA 4TYWA 3B9QA 4F4IA 1ZYOA 5DSZA 4DIDA 2WSSA 2RCNA 3AVOA 1SGIB 1LFDB 1B0FA 2J94A 2G55A 6Q21A 2XGJA 2QXHA 2F6RA 2ZZUH 2HXYA 3RP2A 3UQVA 1BITA 4UXIA 1JXOA 2AL7A 4US1R 4D8NA 3GCGA 4A2QA 4IDQA 4MYHA 3U1IB 4DT1B 1XKAC 2RG3A 3OX7U 4WXVA 1IN4A 1JIMA 4CRWB 4URZR 1VCMA 4RN6A 1GBFA 1GJAB 1QURH 3V3MA 1F0TA 3MU5A 1RIWC 3K70D 5KNCA 3NG1A 1BRCE 3AEZA 1KTSB 1LV7A 1TPPA 2GBLC 1UBEA 2ZU5A 2BQ6B 2W2TA 4NCYA 2IYYA 4Q4JA 1O5FH 4I8GA 3SUFA 2ZP0H 4KVGA 1L7VC 2AWNA 2PCJA 1E9CA 3QI2A 2B0FA 3SGAE 2CEAA 1OXGA 3QPVA 1Q0UA 3ZH9B 4Y10E 2Q21A 1XDBA 1E9FA 3V9PA 1GRNA 4LHXA 1CR1A 2P16A 1C5RA 3SBKA 3A1UA 4YOGA 1GBTA 5FTNA 4BASA 1E79A 2BY8X 3UWKA 1D3DB 4ZDKA 1WA5A 2G3YA 3TGJE 2VF8A 5B57C 1Z0AA 4IVQA 1C1TA 2BM1A 1FIWA 3BERA 5FL3A 2GK7A 2BDHA 1SVPA 1X7AC 4TYYA 4PC1A 4DLTA 2FM2A 4A15A 5KSPA 1VITG 3TKLA 3SN6A 1KIMA 1Z08A 2JETB 2BLQA 2WUBA 5FUYA 4TL7A 4URYR 2KI5A 1D6JA 1SLWB 4NONA 3FKSD 1G3UA 3QX5H 3EIEA 1W46A 4C0BA 2H7VA 3MWIU 1N1LA 2VWNA 1W0YH 2GMTB 2XZPA 5C2ZA 1LQEA 3M1IA 4QGFA 2SNWA 3KQCA 1X8JA 1YZLA 4LK2A 1TONA 3DMNA 3GICB 3TR5A 3RRYA 1QBVH 1VHLA 2FTMA 2M5TA 4E05H 3A36A 1E1RA 2VIVA 3TNFA 4BFXA 3GFTA 1M6NA 3OAAD 2ZE7A 3RXQA 2AFHE 3QTVH 4NYMQ 1E69A 1C5LH 4X8UH 4QBFA 3NEYA 2XWBI 1HQCA 1V43A 1TLDA 3PCRB 1SGRE 3L43A 4IVPA 4K8YA 2RH5A 3A7YA 2JLRA 4B6EA 5BN3A 3SJAA 1SXJE 1ELFA 3EA5A 1GG6B 4HAWA 3K8YA 1F5KU 3RMOH 3PFIA 4HAYA 2OTVA 2GBLA 1GMHF 4NCJA 1E9SA 2ZJOA 3SYJA 1N6NA 4LC0A 3EA9A 2JLZA 3WNBA 2C78A 3HU3A 2FYQA 5DP6A 1R2QA 1TYNA 1Z29A 3BG8A 1F0RA 2HRVA 1SKQA 3SFVA 2GESA 4FMDF 4L9WA 3M7TA 4XWKA 1KYNA 2A4OA 4OHZA 2QMOA 1C1VH 1ABJH 3L0OA 5CDFA 2IHYA 1PQ7A 4RD1A 4AKIA 2JJ1D 1KI2A 1EP6A 1K22H 3SNBA 4XSGA 4HLCA 3GY6A 4DDUA 3MAAC 4MRNA 4UNPA 4BFZA 2XWAA 4BPBA 1PPEE 3AW1A 3ZJYA 2HF9A 4BXWA 4AN7A 4LYFA 4NMMA 2XBXA 2NPIA 2OBQA 4UNNA 2O9QA 4I1OA 3ECCA 4GLYA 5FX6A 1P2OA 3RSLA 1NFWA 4IRUB 4EJSA 2ZKSA 1AZ8A 2BHGA 8OHMA 3SFZA 1KOFA 4TSFA 1KO4A 3AKDA 2WIBA 3TVJB 3H1TA 4RZUA 5DP8A 1CEEA 3Q5DA 2QY9A 1KGDA 3LPRA 2IF2A 3PMJA 1O34A 5FBQB 1FIZA 4ABAA 5CK5A 1PUJA 1XMJA 2JJ2D 3GLFB 2IK8A 1ZHPA 2I4IA 4D9RA 3AUXA 5H68A 1NBMA 1CBWB 1JBKA 3U7FB 1FTSA 1AZSC 1G8HA 1EP5A 3SYLA 2QPAA 3H7OA 2ZPRA 3RUOA 1HJAB 3H5CB 1X8KA 2SGPE 1IONA 3RWMB 1Z2AA 3MNBA 2R0LA 2C4FH 3C14C 5JWOA 5FI1B 4IXMA 3ZD6A 1L4UA 2ZR0A 1Z7KA 4XVQA 1L8QA 2ZQ5A 1BRAA 2YWFA 5DNYB 2B21A 4NIWA 1WXQA 2R0KA 4HB3A 3QPUA 4BRUA 2VB0A 3KX2A 3CNNA 3RXKA 1F60A 1XVMA 2YZ2A 1O30A 2CXVA 4L5BA 3CS0A 1ESNA 2F43B 4GP6A 4YMVA 2WKRA 2BMGB 4Q2KA 5SZJA 3F68H 2A5YB 3UMFA 4Z51A 4D0NA 2Q6DA 4Z1MD 3EC1A 5F9FA 2P59A 1NKTA 4DLWA 5FOTA 1I2MA 2OEPA 2A4GA 2OE2A 4GNKA 1L4ZA 1QIXB 2BD7A 2DPXA 4M9XA 3TITA 1CTQA 1N3BA 3SJ8A 1TPZA 3A84A 3OSYA 3QY0A 4YLQH 1GOTA 2NO1A 1P01A 2OG2A 1XPRA 4PFSA 2RA3A 1ZUIA 3AAVA 3V0XA 2ZTXA 1P6XA 4RI0A 3S7HB 1ZJ6A 2YOFA 1ZW6A 5ESTE 4FUFA 2Z83A 1FW6A 1GTVA 2A4RA 3PROA 1S1MA 2GF0A 5A0BA 1ZAKA 3A7WA 3QENA 3WNDA 3IG6B 5FFMA 1O2YA 3P95A 3EZFA 3GJ7A 1OWDA 2WPKS 1K1IA 1LW7A 1S2MA 1JRTA 4L15A 2ZJYA 2AFIE 3R20A 4ARZB 2ZGBH 4URXR 5ANRB 1XWIA 1WBDA 2D2DA 2YC2C 3BB4A 1KMQA 4D4MA 1T4VH 4I8HA 1A5TA 3VKGA 1ZIPA 5DGJA 2C99A 4ABHA 4ZKNU 3BB1A 1GUAA 4ASHA 2OC7A 2GJKA 2ZAOA 3OF5A 4GL2A 2BC9A 3N2IA 1TOCB 2ZO3H 1UBGA 1OOKB 4AFSA 4TPYA 2ZFQH 2QT0A 2TRMA 1K5GA 5JLJA 4CEIB 3B9FH 3UOPA 2CJWA 1TGSZ 2IL1A 1G8PA 1UVSH 1P09A 4NGAH 3VFEA 2OBLA 4NG9H 1WUNH 1MAYA 2YYZA 2PEZA 1DDJA 2GEUA 4IEEA 2P3UB 2X2FA 4B48A 3DDCA 1MTUA 1R10A 1N5JA 1HURA 4B47A 4NWLA 4K3JA 3M5OA 5AWFC 5E2OA 1K8RA 1IOEA 1T7CA 1XU4A 1ARCA 3HWSA 3A80A 1ZM3A 4A4DA 4A1FA 3VNVA 2A4QA 3VU9B 3RM0H 5KO2A 3PUXA 4YMWA 1TQ7B 4P31A 3UATA 4IN2A 4HUQA 1BRBE 3SU6A 1NN0A 2TGDA 2WJIA 4LK4A 1XNJA 1XTRA 5JECA 3CLVA 2GZ8A 1F2TA 2ZS8A 3PQCA 1UMAH 5L3SA 3Q76A 421PA 3ZZ5A 2PKAA 5BXQC 4JYUH 5FOSA 2GCNA 5IK2D 5HGGA 3SU0A 1IN6A 2QBYB 1O2TA 5KOYA 4WXIA 1IM2A 3PJRA 3E16B 2P5SA 4FW9A 1NS3A 4NBSA 1KDQB 2O8FB 3FKSA 4RVCA 1O2KA 3AKYA 1SHYA 5H8WA 3KGPA 5EP1A 1GI8B 3B9PA 1FQ3A 4LDJA 4HFPB 4ACAA 1MH1A 2IUSA 1RXPA 2ZTYA 1DOAA 4WVPE 2W00A 1BA8B 1XTKA 1JBUH 1ZD8A 3OAAA 5E0GA 2FLRH 2A2XH 2R65A 3SYNA 1R5NA 4D82A 4DIEA 1R5BA 3U44A 1W10U 2BDIA 3UFAA 4GOJA 1WB9A 1O2WA 1CRPA 1W2HA 2FMXA 4E7RG 721PA 5SGAE 2GX4A 4XTCS 4P4UA 1Q3XA 1G37A 1E0SA 3TH2H 4CEJA 1XEXA 2Y5GA 3S9BA 1P9UA 4M2LA 2IYTA 5FPTA 2BX3A 3Q72A 5L3QB 3CNLA 3LT3A 4FU9A 4ZHAA 3QXHA 1O35A 1E38B 1SGTA 4X2XA 2J0UA 4D2IA 4AURA 1CHOG 1TX7A 1BHXF 1X1SA 3EIHA 1P11E 4Q4HA 3RLFA 1UTOA 4AORA 2CMYA 1RW4A 1BTPA 3WYFA 4P3YA 1S6FA 5C2JB 3ZVAA 2ZETA 1NROH 1G32B 1GDUA 1ZM4A 521PA 4RZ3A 2BVNA 2J0SA 2B9LA 1Z28A 2PBRA 1DSTA 4JZEH 2CVFA 4W7SA 1XMNB 1IQPA 3M3TA 1GBKA 2OLGA 4DW2U 5AHGH 1MABB 4ZH8A 1AZTA 1C2JA 1C5TA 4A7IB 1QA0A 4LUCA 4FD2A 3O8CA 3ZS8A 3IIKA 3TRFA 3KTAA 4KODA 1SQTA 2WJVA 3SR0A 1UTMA 5JBCS 1AB9B 4TLCA 1OYTH 1NBME 2QF0A 5HZKA 3LU9B 4I4LA 3SOSA 2QN5T 3DPUA 4F4CA 1DADA 1NIJA 4I7YH 2BCGY 5CB6A 2ZCHP 1CA0B 4KYIB 2GMTC 1FPMA 4P4SB 1CR0A 3PV5A 3ESTA 1XCPA 2JJ2A 4IW4E 4D4KA 2GXAA 4INLA 1KHTA 1NU7B 3THWB 4JLKA 4XFQA 1KKMA 4F4OC 1WTGH 1W7XH 4JYBA 3GCHB 3RXRA 1FUKA 1B23P 1AGJA 3HPRA 4JVLA 1SGFG 4LHZA 4DLUA 4NP6A 2IA5A 3I8XA 1HBTH 3A58B 5T3HA 1IBRA 2DFKB 3RXSA 1G8YA 3EX7C 2SNVA 2ZRMA 5CM9C 3EASA 5JFGA 4FMDB 1TE0A 1GG6C 1C1YA 5A8XA 1QL8A 2ZM5A 3L0SA 3HR8A 1DUAA 5ETXA 2XNIA 3NC0C 4PQFA 2O8WA 1YCPK 5DYGA 2VIPA 4ISHH 4L9SA 2ZDAH 1C4U2 2VVCA 5T6GA 1YZTA 4AK9A 4CHAB 3M35A 2ZRPA 3AF3A 1VTKA 1SLVB 4J1YA 1I4TD 1QG4A 1HUTH 3ZZ0A 4Z1MA 2UWLA 2WJHA 1TGBA 1KSFX 1SQOA 2ZJ2A 5EPYA 2STAE 2NU3E 1ANDA 3QE0A 1CGHA 1W3CA 2ZG0H 2ZRDA 4XVRA 5H70A 1O2XA 5C18A 4HB4A 2F1HA 2H9TH 1UHBA 3D49H 5BYKA 3PEWA 4MDEA 3QGJA 5F2EA 1Z3IX 1PYTD 3MU1A 3VTKA 3LC3A 1E2GA 4KFUA 2Q6GA 1ZUHA 5FUWA 1SGYE 1O3OA 3K1JA 1VYTA 4M7GA 3A86A 1Z6XA 3KQHA 4MQAA 1G5PA 221PA 1GDNA 2ODPA 1T31A 4OHWA 1ACBE 4QC2A 2DYKA 2ERYA 2ALPA 1KNQA 4JMPA 4ISNA 1KI7A 1ZINA 1D6WA 1G17A 4DDVA 3UXMA 3BTME 1G64A 1C1WH 1PUIA 4ITRC 1ZTKA 2ZJBA 3TJZA 1L1GA 3UPUA 4IW3B 2ZU4A 3K09C 1O5CB 1R5OA 1NC6A 1CBWC 3TH3H 2EI8A 1NP6A 1L2TA 3AP3A 2ZRIA 2LWIA 3SU8A 2VINA 2J4IA 4WH6A 5JB8S 3AGPA 1HJAC 1NZQH 4WZBE 4YOIA 2IS1A 1VZQH 4P32A 3WMFA 1O2GH 3PV2A 1Z6JH 1MQ6A 3REFA 2G5VA 2RGDA 4OHXA 1UVOA 1KY9A 3KL6A 2EW1A 2ANKH 4BTIB 1OB2A 1BOQA 1E3MA 1A4RA 1XPOA 4X2WA 4PTLA 5CMXH 3EAJA 1Q21A 4ZXXH 1IY2A 3RLYH 1BT7A 3ZD7A 3FHOA 1QVAA 2EWWA 4E5UA 1AMHA 3DT0H 5EE0A 4EQ6B 4MPVA 1EWRA 1G5RA 3TQCA 2H57A 2G81E 4BE7B 1BYUA 4KKDA 5IK2A 3KJIA 1KLIH 2C03A 2J9RA 3A8TA 4II7A 1EXFA 1AE8H 3MUFA 2R6GA 1XVOA 4MKGA 1FAXA 1GBLA 1XUHA 4HI3A 2BDBA 4KFRA 1FONA 2F83A 1XX9A 2B8WA 3VFDA 5FCKA 2ZRKA 4C0LA 3SJZA 3TR0A 4Z8YA 1CQQA 2RB4A 3T1OA 1IHSH 3LNCA 2R2WU 3TIUA 5G40A 1D2MA 2XCFA 2V0BA 4JYTA 1D3QB 1ZVQA 2JGNA 1MH0A 4KITB 3S1AB 3RS2A 3SC3A 3BN9A 4N0EA 1LHCH 1THPB 4RSPA 2PKSC 4MITA 2BBSA 4NE2A 2QRNA 4M22A 2ANMH 3W5IA 2ZYVX 2BY7X 2RAPA 5BQ5A 5L3VA 5FBIA 1BJVA 2BY6X 3GJXC 3B8JA 1PLKA 3W8RA 1GJBB 3GY4A 1O5BB 4JK6A 3R8CA 1ZNXA 1SLUB 2BBWA 4H4FA 1GHBG 2AIPA 5CYOA 2VRWA 3B5JA 1H8HD 2WIAA 2PTCE 1AS2A 4YM9A 4TYDA 5DKMA 5C4GB 1GL0E 1B7XB 3RXCA 3SI7A 2QNRA 5TJXA 1GCTB 4ZCIA 1IQJA 2C96A 1CJMA 1QRZA 3A4MA 3ENSB 1BO6A 4ZDIA 5E7MA 2BLVA 4XSKU 1C5ZB 5J4HA 3I8SA 4Q9KA 4Q18A 4A8JB 3HU2A 1K2I1 1DICA 2B92A 1ZRBA 2F43A 1WQSA 1ETRH 1RRFA 2FH5B 2PGBB 3AQ4A 3ADKA 1ELOA 1KO8A 4Q1DA 4YDHB 1NIPA 4CW7A 4ACBA
chains in the Genus database with same CATH superfamily
4ND4A 1JAHA 4KIFA 5JZOA 5KVCA 1KOGA 2GT1A 2E9SA 4A8TA 3EF0A 1GMDF 4CREA 4MWEA 4H77A 5HTKA 3PD0A 4I8XA 1HA3A 2BZ0A 1XMXA 3AVQA 1U1DA 5LM3A 3TQTA 1X7ZB 1OIWA 2NO0A 2R6CA 4NJEB 3AVWA 1DJLA 5D3MB 3FCAA 3QG5A 4DYVA 5LXTF 3CPSA 3DZ8A 4E31A 2G1JA 3IMFA 1OBOA 2G7ZA 2GD0A 1ENZA 2D1JA 2JIZD 3AFIA 1GMCF 3ADCA 3GNTA 4ARZA 2AS9A 2VA9A 3EFOB 5A7HA 1CUBA 4C0JA 3MWLA 1BMDA 1Z1IA 4A5OA 1N9GB 2C95A 2EA3A 1T8RA 2BYAX 4IIUA 3U19A 2X13A 1A46H 1JLKA 3S55A 4CEIA 5HJ5A 3WLPA 3IQXA 1EB1H 4O2AA 3V00A 3GGGA 4XEUA 3V8VA 2OM6A 4B80A 2DLNA 2CHQA 3HNOA 5EUCA 5DP5A 2JH6D 1ML4A 1TKBA 2G67A 2FDXA 2H3EA 1NU6A 4DQKA 4IIEA 3N07A 4MV7A 1U1CA 1PGJA 1COZA 3ILYA 4TYMA 3QKWA 2JJMA 2PL9A 1EJ0A 3ZDZB 4MPUA 3G0BA 4H6SB 4YT2A 1ZRNA 4HB0A 3FVTA 2ONCA 3A7DA 3H9UA 4PHCA 1NAHA 3QIAA 2J85A 4Q9NA 3WMRA 5HM9A 3TSCA 5BXYA 1X1RA 4QBKA 3QOYA 3WAGA 2WWGA 5IEBA 1SN7A 3LX8A 2PK3A 4F2DA 3TRIA 3V8QA 2FWPA 4YLEA 1J15A 2H52A 5I6DA 2JCYA 1XL0A 3NCHA 3NIBA 3JV7A 4D57A 1JQ3A 1BMLA 3NBKA 2M6KA 3DNFA 3L1VA 4MVJD 3QNMA 1T8PA 2A30A 4KVZA 3E81A 1B43A 3PC3A 2GGVB 1SHJA 3RXEA 1B1AA 4JBLA 1Y7TA 2G7MC 1ARZA 1ORHA 4Z54A 2ODTX 1OWHA 3EAFA 3HXPA 4R83A 1CA0C 4BP8A 1NVEA 2BKAA 4WMLA 4LPSA 2EATA 2CLHB 5ARDA 2O0KA 1WSBA 3U8OH 2P2NA 1WUTA 2PX0A 3Q7TA 2HSGA 3N8GA 4NXMB 1SQRA 2CDRA 3KDSE 4KXLA 5DO9A 2AA3A 2YCBA 2PXAA 3RD5A 2FX3A 2CZGA 4RADA 4FMBB 1P44A 3F7NA 3THXA 1XZPA 2GBGA 3G0HA 4LQLA 1Z88A 4W9NA 2JVKA 1Y1TA 1C9KA 5EG4A 3BG4B 4RDCA 4Y7AA 3BEUA 3MMXA 3GI1A 4XGKA 1EFUA 1YI1A 1DQZA 3DXXA 1HM5A 2GX6A 2RBKA 4JJZA 3PNQA 5FOWA 1PFXC 3Q1KA 4D8UA 1E98A 1O3BA 4ZYTA 4RLHA 2ATVA 2IOTA 1K2WA 2XYVA 1L1FA 3HY4A 2AFHB 1M1XB 3T9EA 2NU1E 2IYEA 3A6DA 5CRIA 4BAGA 4B2LA 2IHUA 1LEHA 4RTLA 4RKEA 3VXEH 4L8GA 1AU9A 2PSHA 3WYNA 4H6VA 1LNSA 3ZV5A 5E1OA 5BNTA 1SXJB 3HBNA 1JHMA 1SBWA 4O02B 3A6EA 4P53A 3H2HA 2ZECA 1DPFA 4EF4A 4EHBA 5E9AA 3N74A 5MN5A 5I4IA 3MJEA 1W36C 4ER7A 1VLVA 2UXBB 2IV2X 2P4HX 2XNJA 1BWSA 4JHXA 1JB1A 1BTHH 1MO3A 4J4TA 2FWWA 4I31A 2WTNA 4FEGA 3F74A 4NQRA 1KAOA 3WKBA 4Y8VA 3DMFA 4EW2A 1EX9A 1C1RA 2ILVA 2FCRA 4IHJF 2Q3HA 2OV6A 4XB1A 3KEFA 1QGFA 2ZR8A 1W4AA 1W0ZU 2B25A 1DQSA 2D0PB 3UR9A 2BFOA 4KOEC 4RHTA 1SXHA 2RCYA 3BF7A 4R8VA 1OVMA 2JLWA 2DC1A 2BD2A 4H6PA 4YCLA 1Z47A 2QRQA