5FPTA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 2-(1-methyl-1h-indol-3-yl)acetic acid (at3437) in an alternate binding site.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
molecule tags Hydrolase
source organism Hepatitis c virus (isolate bk)
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
total genus 199
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fptA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fptA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fptA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA03
3ZZ5A 1ZNXA 3OSYA 2GVFA 1ELOA 5BPEA 3SUFA 1TL7C 1XEXB 2TGAA 3A1WA 3P32A 2QN6A 5FPSA 1GHWH 1J7KA 5EGMA 2YV5A 3PMAB 5C4MA 3I78A 1GBHA 1GUAA 4O9VA 4ZKSU 1NFWA 2ZANA 1KJWA 2BXUH 4PPNA 1CBWB 1XEWY 1NVUQ 3A7ZA 4OJKA 5FOUA 1NZQH 2ZJYA 4D0GA 2B9LA 1GFIA 1M9UA 3CNOA 2A2ZA 3P8FA 3QF4A 3L43A 2CEAA 4CR5A 2ZRIA 4F92B 3D3QA 3UWKA 4TQUS 2RH5A 1YE8A 1UHBB 4FUDA 4PPQA 1X8JA 1MU6B 3BTGE 1THRH 1QHIA 1ANEA 4BGDA 1ELGA 4CEIB 1AS2A 2KBEA 2LWIA 3UR6A 1SMFE 2Z0MA 4YMVA 5C1UA 2NO7A 4GUXA 1BITA 3T34A 3MMPA 5L2YH 3WMGA 5CB6A 1X6VA 1GI5A 1S5SA 1A46H 1BTHH 3MNBA 2VIIA 2FA9A 1KI2A 1O87A 1TQDA 5T6FA 2QG6A 1YZTA 3TNTA 4OHWA 1GBCA 4ABAA 2OCYC 3I61A 1OXXK 1UK2A 2OCAA 3SJOA 6CHAB 1QFKH 2VIDA 2HCBA 4PR0A 4HLDA 3Q7PA 2CHGA 2O8CA 3K6YA 3DA9B 4AX9H 4DKXA 4NZLA 3RXBA 3IIMA 3QE0A 2XGJA 3LGYA 1XNJA 1LCYA 4FU7A 3VXEH 1VCOA 4QGFA 4LV6A 4HLCA 2RHMA 4YDSA 1W7AA 3NIBA 2Z6VA 1FL9A 1TABE 1BIOA 4NCNA 3EIQA 3C15C 1U8AA 4N3NA 5F9HA 4PQFA 1P09A 1M2OB 1KDOA 2ZFSA 2ZS7A 1ELDE 4WXVA 2YOGA 3K0AB 2BTCE 1C5VA 3ENSB 3SNBA 2GP9B 2QP9X 4JBYA 1EPTB 1GRRA 3AP2A 1LTQA 8ESTE 1OX1A 2R9PA 5J4HA 2ZM5A 1VHLA 1P60A 2IXEA 3ZQ6A 1VCNA 2GHIA 2R6AA 3AV0B 2AMDA 1PYTC 2FU5C 1E1RD 3N5CA 1V2ST 3LGWA 3MWKA 2H16A 4P4TA 3U6KA 2VP9A 5GJ4B 2C8YB 4TN1A 1EXFA 2P3FH 2ZJ2A 1E9SA 3RC8A 2WYGA 4X1SU 1O35A 2F9UA 2QENA 1K28D 1KY2A 3A7TA 3VR4A 2OLKA 1GL7A 1UBFA 3ND9A 4XVRA 1D9IA 2JATA 3B9QA 3CP7A 3F6UH 2G83A 1IQFA 4B43A 3KQNA 4BUJA 3HGNA 1NBMD 4KU4A 1TTTA 1ZPBA 4ASUD 5GNDA 3CRVA 4ZROA 1GKUB 4XE4A 1E9DA 3RXSA 1HYLA 4BFYA 3L0IB 1INCA 5K7RA 1P2VA 2GVZC 4GCHF 3PIRA 5AF9H 1WU1A 1Z83A 3HU2A 1HJ8A 4LI0A 1FY1A 1H8DH 4CRWB 1ZIOA 1RS0A 4DUGA 1LW7A 2NO0A 1W3CA 1P05A 1L4UA 1CA0C 1QHYA 3SOSA 1HFDA 5J4VA 1ESBA 3SORA 2JDID 3E91A 3A8TA 2ZU1A 4G3XA 1TB6H 2CE7A 3DVLA 3U3KA 2ALPA 1TQ2A 1ID5H 1Q31A 1DS6A 3WP1B 1AZTA 1MQ6A 4QJ5A 3A88A 1ANKA 4A0HA 5CLLA 3UANA 2FXRA 2QMOA 2RGCA 5A8ZA 3VAAA 2HLDA 2G88A 5HZKA 2MMGA 2WSSA 3A80A 5DI3A 1W0KA 1OXVA 1UDWA 5FL7A 2B92A 5FAHA 4BTIB 2PSYA 3DFLA 3MU8A 3ZYEA 4MQAA 3SOPA 1MABB 2BDTA 4URZR 1Z7KA 4BAHB 4A2WA 5CE1A 1ZMJA 3ZVFA 5HTKA 2BM1A 3VKHA 3L3TA 1FLEE 1FUKA 1FJSA 1EFHA 2HEIA 3A6PC 2IYUA 1OYWA 4K5ZA 1XCMA 1CT0E 3T28A 1KK3A 1XTQA 3MI4A 3IQXA 1ANDA 4E22A 2XTMA 1S1MA 1BIFA 1VGCC 1MO3A 4ZXXH 4EFMA 3K70D 1GILA 1A3BH 1W2HA 1TE0A 3M1IA 4D4MA 3D23A 1GMCF 1I4TD 2A4GA 3RAPR 2BBTA 4DLYA 1XD9A 4I7YH 1S8FA 3ZYDA 1AN0A 3JZMA 2BZAA 4C0SA 1TQ0B 3K65B 4M1OA 4I81A 4BQSA 3DL0A 1WV7H 1EAXA 3SUDA 3FHTA 3SU2A 3PCRB 3EA5A 3SC3A 1P12E 3I92A 1YU9A 3SU3A 1XUIA 3QJYA 2D4HA 4XDEA 2DFLA 2R2MB 5E2OA 1ZM7A 4KVAA 5F2EA 3ZZDA 1EP6A 4LBYA 5D3MA 4ISLA 3ETLA 3MH5A 2XXAB 4CRCA 1W0JA 4MKGA 1W47A 2ORIA 3X1DA 1C5TA 2PKSB 2Z94A 5JJIA 3AASA 3NVAA 3LC5A 2QF0A 2XITA 4ZHMU 4ZXYH 1J17T 4B3FX 5FUWA 3NZIA 3FP6E 4AKGA 2SGAA 2J0VA 1QRXA 5FPKA 3OF5A 3AH8A 4B76A 4ILEA 1COWA 3R9WA 3U61B 3LPRA 2VJ1A 4AG2A 2QP4A 1ZPZA 4K69A 1W2GA 1IQEA 1P73A 2ZGJA 2BDHA 2FGJA 2CK3A 3NPSA 1P9SA 2GZ8A 4RSPA 5FXLA 1KDTA 3VFEA 3U6BA 1OW3B 3QKUA 3V00A 3NHBA 4H6SB 1YR6A 2ZDAH 3Q3YA 1O2SA 5FPYA 4I8KA 3TJUA 2VSXA 2C96A 1Q1ZA 1QG4A 5C4GB 1CR2A 1JAIA 2JJ8A 821PA 4LV8B 1K6MA 3QO6A 5BYJA 3SYLA 4HEJA 3X1XA 1E0KA 4HZIA 2P6NA 1OJLA 2C8WB 1MZDA 5IDKA 2AFHE 2ZHEH 4NIWA 1H8ED 4MRVA 5DGXA 5CM8B 1DAMA 2NTYC 3BH6A 4MDEA 1JECA 3AAVA 3HKJB 1UKYA 2Z3DA 2VBCA 4BLQA 4UNQA 1IJFA 3A84A 5TDHA 3A8BA 1K1NA 5BN4A 2AKAB 1VCMA 5CM9C 4QFMA 4AKIA 1ZCAA 3KX2A 4B71A 1NSTA 3HJNA 2PGBB 2BEKA 1XX6A 3UY9A 2AS9A 1GHYH 3UNRA 3EASA 4HAYA 3BTHE 3SGQE 1P9RA 2FOCA 1KI9A 4DHEA 1AS3A 3AK5A 1RRPA 5JFGA 3I8XA 5JI3E 2D26C 1XCPA 4BRWA 5EPYA 2ERYA 4NDZA 4V0NA 4AD8A 2J46A 4UONA 1TUIA 1NVVR 2QL6A 3SV2H 1W4RA 3UREA 4HB3A 1GG6B 4PTLA 4KFRA 2ZEBA 3TNSA 1LF0A 3E90B 2AEIH 1O2UA 2Q6FA 2FOAA 3QEOA 5JI2E 5CITA 1DFPA 2G00A 1ZNWA 1IQNA 2IPHA 1O3BA 2XCNA 3O8BA 1O2PA 5M04A 4NONA 2AFIE 4X1QU 2VH0A 5IHPA 4C7OB 3NEYA 2KB0A 1OP0A 1JI0A 2ZYUX 2ZPSA 3EXAA 1J99A 4KO8A 1Z1IA 2CJIA 4K81B 2A45B 2UUYA 1AFQC 2I3BA 3RSLA 4B48A 1TF2A 5KHOC 1YPMH 2Z9KA 4A36A 2W58A 4YDHB 3RS2A 1XXHE 2ANCA 3ADCA 3LFUA 4DCUA 1N6HA 2P16A 4HATA 4PC1A 2H1UA 1X8LA 4O3TA 1UDXA 2FX3A 1AB9C 1ZR0A 2XC4A 2ZVPX 2QXHA 4KGAA 3SZNA 1SXJC 2CMKA 5J5CA 4DY7B 4NBSA 1EGAA 4X8MA 1CF4A 1O37A 3LDXH 3TVTA 3SQWA 1RRKA 4UFGH 4Y71A 7ESTE 1DBSA 4OGXA 1FZZA 1PQ7A 1HAVA 1XD2B 1DXPA 1GJ5H 5FI0B 1JMOH 2C9OA 2VF7A 4GP6A 3SV8A 1U2RA 4NA7A 4W5WA 3RXDA 1TGCA 1KZ7B 1SOTA 1EXMA 4TLAA 5JWRA 1KGDA 2SHKA 4JZFH 2ZTZA 2VTKA 1HQYE 2SGEE 2ZS9A 1E2EA 1LHDH 3TK1A 1WP9A 2ZQ5A 3A7WA 4LGMA 1YYY1 2QSZA 1HAVB 1O5CB 3H7TA 2F9PA 4BAOB 1JIMA 5EQQA 3EG5A 2OC8A 4B44A 2WAXA 1YPHC 5EUQB 2HYIC 3RP2A 1UKVY 1LO6A 2XYAA 3M3VA 1SLXB 1HURA 1A2BA 1GBEA 1MH0A 1TPOA 1SQOA 4JSTA 1LHCH 1NKSA 2IYRA 1AI8H 1XEXA 2ZRMA 1A2CH 3EA0A 4GPTA 1WDTA 5B30A 1O32A 3REGA 1CA8B 1N8OB 4WXPA 2BM2A 1YJ5A 3OTJE 3E3TA 3U98H 1J8AA 3MRSA 4JYBA 3CZPA 1OB5A 3M7QA 1OIVA 1C5MD 4OBEA 1G3RA 1GBAA 3LT3A 2ZG0H 1SXJE 1ZJKA 2A3RA 3UMSA 1KKMA 4ESVA 1LVMA 2HOBA 3EWAA 2ZGBH 2KAIB 4LUCA 8LPRA 3DM9B 1SLUB 5FOXA 1US8B 2GDDA 5KU1A 4IDOA 3O8RA 3TJOA 4E06H 1V2WT 1UJ1A 1H4WA 5B64A 3LW7A 3VGCB 3GLGA 3E0PB 4K8YA 2IYLD 4HAVA 1E2GA 1CBUA 3S1AA 1AZZA 1BMFD 1VCIA 3SFVA 5A2MH 1RRFA 2C95A 4HLQB 4ZI3A 4FUCA 2ZR7A 3GJ5A 4XD7D 2FX6A 2ASUB 4WJG2 2QBYA 1OIXA 3N70A 1C5YB 1FX0A 2Z9JA 4DIIH 2ANBA 1J14A 2J7KA 2BQ6B 5GDSH 2OAP1 5H68A 5C1YA 2WHXA 4O2LA 3UPUA 5EU8A 1VITG 2C93B 3PLBA 2G0TA 2PW8H 5KYKA 1SFQB 5E0JA 3A37A 2R62A 3FWYA 3VGCC 3GJ8A 3IHLA 3W90A 4L9SA 1ZZZA 4D81A 2P8OC 3SI7A 2AHOA 1VZQH 1VDZA 3U1JB 1D2NA 4PHFA 2ASEA 4WA7A 1R8SA 2O0HA 3OY5U 3LIWA 1AA9A 1Z8GA 4DT1B 1LMWB 4BE7B 1P02A 1D6JA 2VWOA 1E99A 3X1ZA 1GJ9B 3BEIB 2BC9A 4KCGA 2BDCA 3B8JA 5KSYA 2WV5A 3STIA 3EC1A 1PUIA 4TZ6A 4OGYA 4P4UA 1Z22A 1K1LA 4CBOA 2HF8A 1T8OA 2WKRA 5KO2A 4I32A 3UWOA 3GY6A 1YBWA 3FHOA 1II8A 1PLKA 2N46A 1F2UB 2H57A 4D25A 2VVUA 1BTWA 2ZTXA 3BRWD 2CMYA 4WMEA 2Z4SA 3AGPA 5LB2A 1HAZB 3BAFA 4BEJA 2ZNKH 1GI4A 3CW2A 6CHAC 4PO9A 2H17A 2ERXA 4LPSA 1CKEA 4W7SA 3DZDA 1KNXA 2XRCA 3GPLA 2BQWB 3WRXC 5EQRA 2PTCE 2F3RA 3CNLA 3T35A 5G4BA 2ZIQH 1XX9A 2WIAA 3LBIA 3F9HA 2H9EH 5JSZB 3MU5A 2AFQB 1LFDB 2BZ6H 1GBBA 2WIBA 2ZI7A 4GHTA 2BVXH 1OH7A 1YZGA 3NXPA 4JL6A 1W7XH 1Q12A 3HU1A 2BB4A 3I5XA 1AKEA 3LNCA 2PCJA 3KF2A 2ZTYA 4DB4A 3QKRB 2QU8A 4IOLA 4JL8A 3B1WA 5JEEA 4JVMA 5KDOA 1TQ4A 1RGQA 1EZXC 3AP1A 1LHGH 2EI7A 3C14C 2QEQA 4YMWA 1Z0DA 7GCHG 5EQTA 3OEHD 1NMXA 5BN3A 1L1JA 3H86A 2RA0A 3AVUA 1G36A 3SHWA 1UCYK 3U8OH 2R8RA 1E69A 2CVHA 5L8VA 4GT1A 1MQ5A 5AHGH 3UWIA 3CR7A 1T4VH 3S9CA 1WXRA 5C18A 4EQ6B 1DAGA 1WBBA 1C2HA 4KFTA 2Q21A 2DR3A 2FG5A 4DRZA 2XBWA 1KDQA 4WZ6A 1U9IC 2BVNA 3QG5A 3HK6B 4RD3A 3AB3A 4JSYA 2ZO3H 3KQEA 3S7KB 2OFXA 1EAIA 2MMCA 2DCUA 2ZSDA 4G0NA 2C99A 1QG2A 1O5BB 1YKTA 1IQMA 5DISB 1AGRA 4GVUA 3A1UA 4M9ZA 1P7CA 2W00A 2JJ2D 3URDA 2WPIS 3EX7C 1KO5A 4TZ0A 2VHJA 5FPHA 2A0QB 4AB9A 3EZ2A 2X1VA 2H92A 5J4KA 1KNQA 1SULA 2GXSA 1WOFA 1VHTA 3W94A 2W2VA 3H4MA 3VX3A 1J8MF 1NFUA 4MRNA 1W0JD 1EG7A 4Q80A 2GILA 2QQ0A 3KJIA 2ZRFA 1Z6GA 1W1WA 2BHGA 4DIHH 2QA5A 1Z8IB 1O2NA 4LBVA 4BLRA 3SV6A 3TQCA 2WM9B 4MKIA 4JYUH 3RC6A 2OO7A 2CXXA 3EA8A 1OT3A 5AJZA 5FUYA 1R0ZA 1QB1A 4AB8A 2C8VA 1V2OT 1O2MA 1R0WA 1G19A 2WPDD 4OI1A 4Y8ZA 4TYNA 2QGNA 1M7BA 3PV2A 1BUIA 1KZGB 4JMPA 4LWZA 1QHRB 2CJWB 1HAHH 1DG1G 1TBZH 2F43A 3MU4A 5T6GA 3MO3A 1KHTA 3LQRA 4CH8B 5JECA 4IC5A 2BBOA 1IY1A 3L0PA 4B74A 3M0EA 2FOMB 4Q19A 1GHBF 2E87A 3Q3XA 4OS5A 1ZNZA 4DCSA 1BKDR 3NDBB 4NCKA 3WY9A 2ZHQH 2ZI3A 4B35A 2OTVA 5FTJA 1GCTB 3NDPA 1A4WH 2VHTA 4D4JA 4AC9A 1E6CA 5IK2A 5ABWA 3PO1B 2FTLE 2CNWD 1YZUA 3CR8A 3TLOA 2ZHFH 4YO9A 1CJVC 3WRYC 4LOAA 1Z6XA 1HLTH 1QB6A 3RMLH 1FNMA 2ZAMA 3GOVB 3IBYA 4WMFA 1FMJA 1D9XA 5LD2B 3M35A 1T8LA 2NO6A 5DH9A 1HBTH 1NG1A 1QBOA 2CGAA 1G32B 3SNDA 3U8TH 4DVAU 3KL4A 4LSGA 1KTTB 1YCPM 4N0DA 2OESA 4NE2A 1BMLA 2JH6D 5DGJA 1UPTA 1XXHA 5HGGA 1RRGA 1ZC4A 3GY7A 1NY6A 3BFVA 2PEYA 1ZHMA 3LGIA 5A8XA 1MU8B 3GJ7A 1SGDE 2J92A 1NROH 1GL6A 1H9LB 2C78A 4CEIA 2CXVA 3LLMA 1G20E 4CEHB 2V9PA 3RXIA 3QTOH 2RGNA 2J59A 2J7PA 4S35A 1ZD8A 1J8YF 1NC6A 1MRSA 4Y7AA 1C2LA 2QIQA 2F55A 1GMHF 5EP3A 2ZZUH 1O3FA 2BY7X 2ZE8A 1KXDA 1QGFA 3W9YA 1GBTA 1Z6TA 3TRFA 3UK6A 1NL3A 3L82B 1OIWA 1H8EA 3KQLA 4XSHA 1EX6A 4IW4E 4Y76A 3U44A 4LV5B 2V4ZA 1TF7A 4KVGA 1TWXB 1W13U 3T26A 2D2DA 3BEFB 2GCNA 1RFNA 2C98A 1T6NA 2F6RA 4JYVH 2R6FA 4HDOB 1BMAA 4HLUA 3QG1A 2WV9A 1YLCA 4OK3A 4A4DA 4NKRA 3A4NA 4LK4A 2D8WA 7LPRA 3T5DA 2IXFA 1EOJA 3TITA 3QVUA 3GFOA 1G3EA 1JXPA 3CZQA 2VP6A 1DSUA 1C1WH 4B3BA 2AN9A 2VINA 3Q3KA 1E0JA 2A31A 2ONKA 4NWLA 1KI6A 4IS5A 4BLTA 1HAPH 2RGDA 4R0IA 2VHUA 5E8EH 1JRTA 3K53A 5EXXA 3P6ZB 3A7YA 3EZ6A 3ZD7A 4SGAE 1PPHE 1G1MA 4JKIA 1HJAB 1S9HA 1QL7A 2NZ8A 5KSPA 1Z0IA 1W5TA 1ZTJA 1UF9A 1XPOA 1XEFA 1IN5A 1JEEA 5JRZA 3U7HB 2WINI 6Q21A 4X0WU 1F0RA 4M0LA 4WWYA 3TGKE 3B78A 1F60A 2HPPH 1HE1C 3QF7A 4DDTA 3D62A 4G5SA 3BOSA 1N6YA 1CSOE 3CF6R 1N6OA 1GBIA 3ATLA 1OWJA 1CHOF 1IJEA 1P2TA 1F5NA 4CDGA 4X2YA 1AQUA 2YNMA 4ESTE 3PITA 4CRAA 2AGIX 4MNVA 4X8LA 3OIYA 4RN6A 1KJYA 2ZETA 3K1JA 5AR1A 3EA9A 2TGTA 4X1NU 4C9BA 5DKMA 4CEJA 4NA8A 2BJVA 4XBDA 2GETA 1Z5ZA 1ZUNB 4V02A 3ZZBA 5DP3A 2P5SA 2YWHA 4RJLA 2HXSA 1P03A 1ELAA 1X1RA 5A0FA 2D2FA 2RGBA 3M61U 1THPB 4INLA 3UOPA 4LDJA 4QHTA 1S1CA 2CHAB 1C1SA 5F8XA 3TK9A 1OKKA 1TU3A 3BTKE 1PVOA 3ZVGA 1MKXK 4RD4A 1MTNC 3ZVMA 3PJRA 4ISIH 2ZU3A 3ZVEA 3SJIA 1EFRD 5C1XA 2DE8A 4BTUB 4X2VA 5FL3A 2Z9LA 4TMXA 1MUEB 4YMSA 4D6PA 4A0RA 1YC0A 3CPEA 1QBVH 4KHZA 1ZC3A 3ZZ9A 4X1PU 3U9AH 1PQ5A 2GWHA 5FR1A 1D2EA 2DUCA 5DN6D 4Q1FA 2QAGC 3V7TA 4M9XA 3SYNA 2JLWA 3SQEE 3MUFA 4INKA 1BBRK 4K1SA 1A4RA 3E70C 2ORWA 1C1RA 1IHUA 1V2PT 2XZLA 1C2KA 4Q9IA 4PPGA 4V0MA 3TGIE 1W0ZU 5TV2A 1NLYA 1E2NA 3PQCA 2OQ5A 2EI6A 1P01A 2D62A 1EFRA 2PKAB 3KN2A 1JR3E 2IC5A 4AG6A 1II0A 2PTNA 1NSFA 3RRMA 2PR3A 3TPIZ 3GFPA 1KSJA 4Q1BA 4DOQA 3AF1A 4KYIB 4Q4AB 2NPFA 1GBMA 5EQSA 1ZRKA 2IEYA 1Z71A 2AMPA 1TEVA 4GOXA 2OP9A 4BFUA 2IS1A 4NA9H 2O8WA 2B7BA 5K8LA 1P2UA 2ZHWH 2ZE5A 2G55A 3Q77A 4OS7A 2Y7ZA 4MYHA 3M37A 1E1QA 3ZQJA 3GLIA 4TYDA 1JXMA 1MTVA 3GLFB 3GEIA 5FOWA 2BYAX 3QGJA 5KNDA 1UVOA 3FDIA 4HYYA 2XEXA 5GCHG 2OUKA 1TU4A 1VYVA 1UK3A 2FLRH 2IYQA 2BKEA 1QA7A 3PO1C 2REXB 1FMGA 1O30A 4LHYA 1J2JA 4XD7A 1TPAE 3MH6A 1E1RA 2ULLA 5SZJA 1Q3XA 3LH3A 1TGBA 1QZXA 3W34A 3CKLA 1E94E 1T32A 5JBTA 1GTVA 2VGCB 3T1TA 3GLFA 1O2YA 4BRUA 2W7UA 3CIOA 2ZJZA 2WAYA 2ZE7A 1O0DH 4JMYA 4A1FA 4DUGD 1FXYA 4XWKA 4EAQA 5LPNA 1I2MA 1E9FA 2C04A 3W8NA 3AAUA 1TLDA 2RGNC 2GCTC 2QROA 3SHAH 1Q22A 2OFWA 3NKKA 2GZDA 1C4U2 1KSFX 1CA0B 3SJKA 4R8TB 1LHFH 1VKJA 1O5AB 2PMKA 4GZMA 3PENA 1TBRH 1EAWA 4KBGA 4B33A 2TPIZ 3SZRA 4KTUA 3DUXH 3E6PH 1XUGA 3M6AA 1OLOA 3QN7A 5DIFA 3UPEA 4DB2A 4DG4A 3QPVA 2PJZA 4XIGS 4PHTA 2TRMA 4AFQA 5C5OA 1FI8A 1EFCA 3HWSA 2QY9A 2VWNA 1X7AC 3ZZCA 3GCOA 2GZ9A 4LJ5A 3V4FA 2ZIAA 1YM0A 3IHWA 1SHHB 4NMMA 4Q9KA 1O2LA 4GAWA 1J16A 1RXPA 3EQ0H 4MYTA 1QB9A 1MCVA 1K1PA 3N7OA 1H9IE 1UTKA 3D49H 2C90B 4MKHA 4EFNA 1YQTA 1S3SA 1WA5A 3FTQA 2A7HA 2ZFFH 3A8CA 3OTPA 1X3SA 4NH0A 4BWYA 4LRWA 4CEHA 4ON9A 3BWDD 1R0YA 1MABA 5FBRB 1YRAA 4YLUA 4TLCA 3SN6A 2Z83A 5CK5A 5TCCA 1ACBE 3BTTE 1XB2A 3C4JA 4TL9A 1H8IH 3WYGA 4DLXA 1NN5A 1DWEH 2JJ1D 2NGRA 1UVPA 1Y3YA 2W6JD 3LGTA 1G64A 1ODFA 3IEUA 4R9UC 3AF4A 2WJIA 4URXR 4TMWA 4ABYA 2OZEA 1KI4A 3SJ8A 1Q44A 5JMTA 3S9BA 3GY8A 4QBFA 3H84A 4P4SA 5H8WA 1AVGH 5KSOA 1G5RA 2B6HA 4DXAA 3ZJYA 1AS0A 4L16A 1MKWK 2VIWA 2QQEA 2J4IA 1GMDG 2C03A 3RDZA 4D9QA 4TSFD 5K8TA 2YYZA 1RRCA 3OFND 2GCTB 2ATVA 1KMHB 3RMNH 3B1YA 4GDFA 3TBKA 2WPDA 5C2ZA 4LHVA 4AFSA 4TWZA 2HNTE 4YESB 3FOZA 1X8KA 1UFQA 1VYUA 2ANMH 4IFEA 1V2LT 2WJJA 4WAUA 3KQKA 5EE3A 5E3HA 2VWLA 2RB4A 2ZF0H 4O2RA 1KMHA 2ZYTX 3QBTA 2VH5R 4A6XA 3ZV9A 5K0HA 2O8DA 4JKYA 3LX8A 2QAGA 3MG9A 2GXUA 4I99A 1VPLA 4X1RU 4KFUA 2QSYA 4Q4LA 4BFTA 2BM0A 2AH4X 2C3SA 2VEDA 1QJ1B 1Q1EA 3NC0C 1P2OA 4ABGA 4JS0A 2EI8A 1K5DA 4OM9A 3M7TA 3FP8E 3MWLA 2QN5T 1YCPK 1OWIA 3ZZ3A 3VR1A 2OEPA 1OP8A 4XH9B 5LD2C 5G40A 5CB8A 4Q7KA 4YXWD 2QTHA 6GCHF 2Z6BD 4EFLA 2J5XA 1NO9H 4FMBB 1AKSB 1F2TB 2JJ2A 1HAGE 4HZUB 3QXJA 2J9NA 5CK4A 5JLJA 5JWHA 3QKRA 1UTMA 3RXEA 2R2WU 2Y5HA 1QVAA 1YRBA 2BXTH 1PPZA 1X86B 4IKEA 1Q1BA 4X8OA 4TL7A 3EARA 1A7SA 4XSGA 1DE7H 3QPUA 4Q9JA 3TR0A 2GX4A 4CRGA 2HXYA 4YQFA 5GPIB 1ESTA 2G4TA 5DK1A 4B1TA 3O8DA 1KSHA 3H5CB 1A82A 1Z06A 1HYQA 1UKZA 1WTHD 2A78A 3NHAA 1Z8FA 3NXSA 1AKYA 3TH3H 1NBMA 2ZRLA 4UXIA 3RXKA 2P3SA 3DMNA 1SHYA 4EIWA 4C0KA 5HYOA 1Y5BT 4EQ6A 3RRYA 2CHVA 2W5EA 1EX7A 3SHCH 2J87A 5HZHA 2ZFRH 4YOJA 2KWIA 3M3TA 2OG2A 5L3SA 1VIYA 1GGDC 4ACAA 2THFB 4D7GA 1Q2WA 2IJOB 4JIMA 1Z0AA 2H18A 1WXQA 1GL0E 4BXWA 1V2UT 2I6SA 3TJVA 3H0KA 1N0UA 4ABBA 1W2KH 3RXCA 2Y5GA 1LPGB 4LXBH 1SGEE 1LNZA 1EZSC 2QBYB 2JJ1A 1DICA 1PLJA 5JBQA 1YP9A 4ZMAH 1S0QA 3N2EA 2PJRA 1FZQA 1M8PA 2AX4A 1V2NT 2BBWA 3BTFE 2VIQA 3LH1A 4NYJR 1QIXB 3OIUA 1NRNH 3PLPA 2GMTB 4I33A 1GKIA 3S0NA 1SI5H 1BB0B 3PROA 4URYR 1FY5A 4I8JA 2P59A 5FHTA 5EP1A 4R2IA 1KLIH 4PPFA 3LJOA 3ZVAA 4ZDKA 1XUJA 4TLEA 1G6HA 1G9IE 1XJ0A 4PSVA 4OJQA 4YC7A 2J38A 2R2AA 1A61H 4ZCLA 4II7A 1ZSLA 1IXZA 1G37A 3BV9B 1G8GA 4A1VA 2Y5FA 1GRQA 1H1BA 4MTBA 1KYIA 2CCJA 2GTPA 1GJ6A 4NIVA 2VSFA 5LDDC 5DYGA 3LRPA 4OL0A 1OYQA 3G82C 5KNBA 3RS5A 3T2NA 1FPMA 1E2MA 2JLUA 3QKSB 3A1SA 2DYKA 3E1SA 3A1VA 2BMDA 2OSBA 4V0KA 2VU8E 1W48A 2FSFA 1JIRA 3U69H 1CP2A 2FX4A 4XOIA 2IF0A 4CRFA 3KXKA 2BD8A 4FCTA 2HJGA 1EJMA 2A5YB 1OFIA 3VKGA 3H2YA 2AD5A 1EKBB 4ZDIA 3VR3A 1E3MA 1SGNE 3SBEA 1V2JT 3A89A 4OQMA 1B0EA 1GI6A 4DSOA 3W6PA 2RDLA 4IHQA 4RKEA 1O3KA 4YT6H 3GCHB 3T1QA 3EZ9A 2P6UA 1NN1A 3OU0A 2NU4E 1SKYE 4B3CA 4HFPB 1S6FA 3DDCA 3KKNA 2J0UA 4HAXA 1G30B 4I31A 3B1XA 3VB5A 3B13B 3P8OA 3RS7A 1CS4C 1S9DA 1NLZA 2GD4B 3TNFA 4WMDA 1KOFA 3PMBB 2DHRA 4QNRA 1J70A 1N5IA 8GCHF 3SNEA 3VTKA 4X6NA 1MH1A 4P33A 3ZVRA 5SZIA 3F0TA 2HNTF 3CO5A 1ZPCA 1ZP6A 2BLOA 2VSOA 4QJ4A 4XWOA 2WPKS 2Z43A 3IEVA 3UOUA 5BN5A 2AGGX 2EWWA 5PTPA 1O3NA 4Z8YA 3TAUA 1WUNH 3F8TA 2JLQA 1DDJA 2ZI6A 2A1DB 3UFAA 3UIEA 3P92A 2EYUA 4FVBA 5BQ5A 4PAQA 3QSYA 2WJVA 1TMBH 2ALVA 2Z3EA 4UNSA 5EP4A 1E35B 1L2TA 1C2MA 1ZD9A 5ETXA 1GI0A 3TUZC 1W10U 3S1AB 3X1WA 1VG9B 3GLGE 4DDVA 1FV9A 4IXMA 4DGJA 1BOQA 2CVFA 5CDFE 3RS4A 4ISHH 4A0GA 1X1SA 5AWFC 5B2ZA 1XJQA 2A30A 1UVTH 2W26A 1DX5M 1ZGVA 2D1JA 2IYVA 3RM2H 1A5IA 4IMZA 1WQVH 5D3QA 5KSZA 2I6QA 4BAMB 3IPXA 1MD7A 2O8BA 4LJYA 2XBXA 2OXRA 1P04A 2WTUA 1QA0A 3MJRA 2PFEA 5LH8A 4LX0A 3QOFA 3CRQA 3SJAA 1K1MA 1QHGA 3PMHB 1ZBDA 1LPKB 4X8SH 1T7CA 2OC1A 1C1PA 5E7IA 1Z6JH 4Z1MA 1Z8JB 1W12U 3V13A 2OAQ1 2GKSA 3QZRA 4CH2B 2QTVB 3P95A 4DIEA 3EPKA 2QGRA 2IA5A 2NO9A 3AUYA 5HCIA 1PYTD 1F48A 4MG3A 1RTKA 1E79A 4LYFA 3RU4E 2NMVA 2HRVA 2Y80A 3K09C 3C41J 2WWIA 1C5XB 3HU3A 1XP8A 1Y8TA 2O5VA 2AK3A 2ANKH 1BHXB 3QENA 1Z2CA 2JLVA 1JPNA 1C9PA 2ZQ1A 4O3UA 2ECKA 1O34A 2HNTC 1TX4B 3PLKA 3A8DA 3AKDA 2ZREA 4X6MA 2FODA 1P2JA 3UMFA 5HR5A 4NSVA 1GL9B 3UQVA 3L2OB 2RCNA 1RJ9B 2C2HA 2ZWLH 1T8UA 2IYYA 2QXIA 2F43B 4LJ9A 3PTBA 3QBVA 2C4FH 3RXOA 1EFUA 4BOHA 3VB4A 4B73A 2BLQA 3SQHE 5IK2D 1G3QA 2YNAA 3WY8A 1NRPH 4XFQA 1UTNA 4JZEH 1H65A 4M53A 2F1JA 1KXFA 2O8FB 1ZIPA 2LPRA 3I32A 4Q47A 1C4OA 2FOFA 2XWBI 3RM0H 1LPZB 4GP7A 1G3IA 1KKLA 1A1RA 2EFGA 1IHTH 3K70B 4ZCMA 1U6QA 4LC0A 2RA3A 3Q9LA 2Z3CA 4NL4H 2XTZA 4B3GA 5C5NA 1FN8A 1YR8A 4TMVA 8OHMA 3BEUA 3UQOA 1BMFA 3A1TA 5F8ZA 1MV5A 4IVRA 1N8OC 4VGCC 3HR8A 2YWFA 2IS2A 2FDCA 3I5YA 4CW7A 3Q85A 4ZHAA 3B60A 1XXHB 2YOHA 2XAUA 3IO5A 1HQCA 4B32A 5FUVA 3DHKH 2Q9BA 2NPIA 4E05H 2Q1JA 3NTUA 4F4OC 2OILA 1AMHA 3MHWU 4Y8YA 1BH2A 4C0HA 5GXPA 5I25A 3NH9A 2FYRA 4WVPE 2BDBA 1ZSKA 2O8MA 3IG6B 4P3YA 1NU7B 3G0HA 4QL3A 1BOFA 1F92A 1O2GH 5LGOA 4ERNA 2ZC9H 2XC0A 1AIXH 1DVRA 4ASHA 1IY2A 2NO1A 3B85A 3EGKH 4IJMA 1EB2A 1ZM4A 2GEDA 3TUJC 5JHHB 3VFDA 2AK2A 1M7GA 2XJ4A 4OQNA 4NPHA 3M5NA 3LWNA 1ELEE 4NCJA 5F9FA 1TYNA 3T12A 2ZJ5A 4BTTB 4UJ5A 4MNXA 2RAPA 1VCPA 2XX3A 3QZQA 3RMOH 4C0AC 3OX7U 2J9RA 2UWOA 3K0FA 1VR1H 2GK6A 1T91A 1YZLA 3A85A 1F0UA 2F1RA 1TGSZ 2GJ8A 3L0OA 4A8JC 1TQ7B 3I4LA 1DG3A 1VG8A 3R7WA 1KSNA 2PEZA 4B6EA 1HXEH 2JH0D 1KI6B 1G41A 3IIJA 1ONBA 1ZUHA 4G5QA 3BERA 3RNLA 5JB9S 1KO1A 1D4PB 2OC7A 2BCGY 4A1XA 1T3HA 2VP5A 2EYQA 5KNCA 4B2LA 4LBWA 4BLSA 1NRSH 1F2UA 1GI8B 1NY22 3Q72A 1KO8A 2Q9CA 4ZO4A 1UBEA 4JJKA 1L4ZA 4ISNA 5CDFA 1ZSJA 2WBLC 4DLVA 1JBKA 1XJCA 1C5OH 1MTSA 1TAWA 2WMOB 4LYJA 1GNQA 2HT6A 4TL8A 5DP4A 4LJAA 2IHBA 3THXA 3B2EA 4DSTA 2FF7A 1FW6A 1B0FA 1N6LA 3M5LA 2QT0A 1UTLM 1SGYE 1Q0UA 4LCBA 2FPZA 3GDSA 4OI2A 4UEHH 3ICQB 4FN5A 4BZXA 2DWOA 2XTNA 1CBWC 3I3SR 3QEJA 1S83A 1D3DB 4BFZA 1CT2E 2AWOA 4ZIRA 2ZI4A 4TYWA 1O3PB 1MO5A 2WJHA 4UNPA 4QM6A 2R0KA 5JCZA 1EQ9A 2OC0A 1DUEA 3KZ1E 1RFLA 3VR2A 3ATMA 5TXGA 2BX4A 2YVUA 3NBFA 1NPMA 1L4DA 2IK8A 3LD9A 4E03A 1G18A 2C77A 2WPMS 1ZTKA 4ARZB 2XB4A 1RE0A 1CULC 1EATA 1S2MA 2L0XA 4KV9A 2EVWX 4AORA 3ADDA 4QKQA 1S3GA 3GDUA 1SQTA 1UHBA 4GL2A 1EJNA 3DT0H 1NIJA 3KHVA 3A8AA 2CLDX 3ZZ4A 3CS0A 5DI3B 1QF9A 3BE4A 3TMKA 4TSFA 1UJ2A 3BH7A 2GJSA 2QZ4A 2Q3HA 2AIPA 4RFVA 1P2MA 2XSZD 1AIPA 4MYUA 1MMJN 1NVVQ 4Y10E 5LPRA 2SFAA 3ZIAD 2O8CB 3B23B 4A7IB 1XMIA 2CBZA 3B5JA 1BT7A 2QYIA 5AFYH 2BD3A 1JQLB 4B47A 3K09A 1ZNYA 4X6OA 5HXFA 1AE8H 3KKOA 2QMEA 2W6ID 2ZECA 3HK3B 4GNKA 1FQKA 1EPTC 3GLHE 1OWEA 3WYFA 2EW1A 3DKVA 3U3OA 2QPOA 4HAWA 1AN1E 4TTQA 4RFSB 2SNVA 1SQ5A 5EW1H 4FMCB 1GIAA 1W49A 4RD2A 4LHXA 1C5QA 1NS3A 3C27B 1N6NA 2P8OB 5F3WB 4P4SB 1TMTH 4Q9LA 2XZPA 1O2RA 1GG2A 5C3NA 1GBKA 5HM2A 4RCZA 3MWYW 1GBDA 2PT7A 4R98A 1RKBA 1OFTA 2BD2A 3AF0A 4B6FA 4WXRA 2OBNA 3KNXA 1QHHA 2WWYA 3VB3A 2J0SA 5KTYA 4NYIR 3IUYA 3LJJA 3EDXB 2IW3A 1NJGA 5AUNB 6GCHG 2GAAA 2PHBA 3EYDA 1S0RA 3BG8A 3T25A 5IRCD 3TAHA 3LDAA 5T3HA 2FS9A 1SC8U 1LTOA 5TMPA 4BECA 1O3EA 1KK2A 3V3MA 4JYCA 1BBRE 2WJGA 1C2IA 3D7MA 3QIAA 3ICEA 3LOXA 1TPSA 2QRZA 3QKTA 2G6BA 9ESTA 3TR5A 1VGCB 3EE0B 1NVXQ 4CIDA 3GCHC 2WSMA 1GVLA 1TMKA 3L0SA 1SR5C 2BY9X 2ATXA 5FBQB 2O8UA 2FOLA 2F9NA 1E32A 4PC2A 4W5JA 3ZV8A 2FI5E 2W2XA 4H1UA 1E0SA 4TLBA 1XXFA 4IOJA 4MUBA 1KTVA 1S84A 5ESTE 3GCNA 2V35A 4O3MA 4QJ3A 1DPFA 4D26A 5I46H 4HGCA 1Y59T 2O8FA 5JJKA 3VXFH 3L6PA 1WRBA 2KI5A 4WY3A 3ESTA 3F9EA 3NWJA 5DLQC 3SV9A 4TWWA 1SGCA 3FMFA 1G8PA 1TRMA 2H1LA 3RRZA 1HAYB 4ZCIA 1SSXA 1XEWX 3X1YA 3GY3A 2QM7A 1YKSA 2A2XH 2VH6A 1SGFG 1ZMNA 4CRDA 4XWAA 1IBRA 4Y11E 4Q03A 4K60A 3BH0A 1S81A 3T15A 5GWZA 2OE2A 1OWDA 4Q7MB 2IUUA 1L4YA 1SVLA 4RY2A 5J4LA 1AD8H 3QX5H 1HJ9A 3A7VA 1JR6A 4OQFA 1JALA 1FIWA 3ZGXA 4P32A 3MWIU 1E2FA 1DEKA 2PH1A 5DP6A 4NGAH 2ZRKA 3BF6H 2DFNA 1WAYB 2FGKA 3BTDE 1I2DA 3AVVA 3R3GB 4CHAC 5AUOB 1CU1A 3QGNB 5C2JB 5FPTA 1KDQB 4FD2A 4MQBA 2GXQA 1IAQA 4E7RG 4URUR 2DWQA 3MOCA 1GI1A 1Q3TA 1JXOA 2PGQB 5JS8A 3TKLA 3Q5EA 1GI3A 2XTTB 2ZGCA 1C1YA 4QGHA 1ZRBA 1IHSH 2AD1A 1W36C 3GICB 1IQGA 2CCGA 5FX5A 3OAAD 1L0ZA 4BFVA 4F4CA 2F1HA 1XXDA 1OXUA 1XPRA 3P4YA 2XCFA 1UCYH 1GJCB 2GBLC 4ZUHA 2JKHA 1HT1E 5KPDA 2BY5X 1MO4A 4JT4A 3ZIAA 2PBRA 5AJYA 2VVVA 3U4QB 4PC7A 3C8UA 1EJAA 1ESNA 4RI0A 1YPHE 3BS4A 5K8IA 2OBQA 2PLXA 4A9AA 1AK2A 1IOZA 1Z0JA 1ABIH 1N6XA 4DT7B 1G7SA 2TIOA 3HPRA 1HB0B 1P3CA 5EXNA 1XD2A 3ZZ6A 1A1VA 1JOUB 4IMQA 3UG6A 2ZRHA 1K2I1 3LVRE 3QVVA 3RDPA 1C9KA 1BRAA 3O8CA 3GCTG 1O5DH 1VIAA 2JDIA 2HDNB 4QHYA 1EWRA 2XZOA 3FFGA 2RGAA 4R71A 4Y0VA 2NU3E 3RXAA 5A5GA 1E9RA 3VR6A 2RGXA 1G3DA 4W5HA 3RXHA 1TF5A 4K3JA 4D8NA 2IYZA 2W2TA 2YOLA 3LA6A 4V0OA 4BFWA 1PQAA 5T6DA 4B75A 2F3CE 3LQQA 3LY5A 4LZZA 1Q21A 5FBLB 3QQ5A 2D7DA 1G8FA 2R9VA 1SXJA 2ZU5A 2QT1A 4PHHA 1IXSB 4K8BA 4MRPA 2YZ2A 5H4IB 3FAOA 1GBLA 3PMJA 1A5GH 1GP2A 1FPHH 1F6BA 4Q1EA 1JPJA 1Z0FA 1AQ7A 1GJ7B 3QI2A 2RMKA 1M7HA 1RD3B 1DS2E 4GBMA 2B8WA 4OS2A 3FZDA 3HATH 2CDNA 4Q4HB 4DCDA 4CRBA 2R44A 2ZPRA 3BSQA 3NEJA 1UBCA 3RXLA 4G5GA 1TRNA 4GOKA 1EZUC 2E9SA 4HZUA 4MRRA 2ORVA 4XVUA 2AR7A 1C5LH 1A7JA 2ZFPH 1IQPA 1NKTA 1KXEA 3TSWA 4GLYA 4JVSB 4NFFA 1FP7A 3KB2A 2J34A 3BBPA 4WH6A 2IN2A 1WMSA 4DLSA 3FFBA 3X2SA 1SGQE 1CO7E 4FUEA 1RJXB 2AGEX 4KTCA 5GJBA 3D6TB 4AYTA 1NP6A 1WE2A 3C5HA 3C7KA 2PX0A 3R8CA 5HKKA 3CX7A 5JJLA 1ZRHA 1PJRA 3F9GA 3WP0A 1PPBH 5DSZA 2ZP0H 1G5TA 5H70A 2WOJA 4OHVA 1F5RA 2XNDD 2A5JA 1YPGH 1JWTA 2W3KA 1MTWA 3WNCA 5FOTA 1GITA 2GEUA 3AF2A 1DWBH 1XWIA 4JZDH 2W83A 1B0UA 2VVCA 4C0BA 2UVQA 2ZI5A 2XSZA 3QK1A 3ZVDA 4AYXA 1O3AA 1QY6A 1OS8A 1SGIB 3SE0A 2WYJA 4US2R 4D76A 1GDUA 4URVR 1YZNA 3AVZA 3BGWA 3SI4H 1VYTA 3KEEA 4V0LA 2HV8A 2G5NA 4MLFB 1QVRA 3F1SB 2CCKA 5JCPA 3AVWA 4YLGA 2PSXA 3LGUA 4C0LA 1Y5AT 1IOEA 4FUJA 1M1YE 2BDYA 1XTJA 1DO2A 1KI1A 4XOJA 3KKMA 2V8OA 2X2EA 1UK4A 1YR9A 5EZ6B 2E1RA 2WPHS 1N5LA 1E36B 4US1R 2F4LA 1WQSA 3E2IA 3FYHA 3HPQA 3V0XA 1DPOA 4MPWA 4EJSB 4A15A 3NBZC 3AKEA 4UFFH 1DAKA 2FNAA 421PA 4ASUA 2AL7A 4K1EA 1GI9B 2QA9E 1FNNA 1PFXC 5BRRE 1E2PA 3RU4D 2IS6A 1QRWA 1G9XA 2PZEA 1NU9A 2ZITA 4JVLA 1GHBG 4I1VA 4LJ8A 1LHEH 1O3DA 1TAGA 2YWGA 1EASA 3O47A 2ODQA 1H9HE 4I1OA 1BYUA 3WBJA 1NN0A 3LC3A 4Y6DA 1R4AA 3TJZA 4B2IA 2WKPA 4MPXA 3FPAA 3ELAH 2IYSA 1XTIA 3W3ZB 5FOSA 4AN7A 1FNIA 2B5TB 3Q3JB 1P61B 2P94A 3IILA 2GVDC 4FU9A 2O0KA 3J81k 1UTPA 3ZZUA 1AUJA 2CF9H 3D8BA 3AF3A 1D3QB 4R2HA 5KUTA 1YPJH 3GY2A 4RKJB 3W6NA 2VIVA 3A82A 2YWEA 3UATA 3GQBA 3NC1C 2VL7A 2BOKA 1MT0A 1N2CE 1L1GA 1N0VC 2QM8A 2PZFA 3SS8A 1JQJC 4CBNA 2O52A 1MD8A 4A8JA 4QGAA 1Z29A 3Q00A 1F0TA 3E5HA 1C1VH 2MSEB 1KXCA 2J95A 1V5WA 1E34B 1HV7A 3MD0A 1IY0A 1WTGH 1WYKA 2IUSA 3PV0A 2QV1A 4DCVA 1LDTT 4M2LA 2H6MA 2HYDA 1YF4A 1BBRH 2V6IA 4XVQA 4MPVA 1P8VC 4V03A 3FANA 3ECCA 2KJQA 4CR9A 1VJ9U 3RXJA 1QR3E 2O8TA 1SOZA 3MNCA 1E0AA 1YHNA 4GMXA 4LOYH 3GEEA 4D0NA 1SGRE 2EWVA 3VR5A 4ZKDA 2FN4A 2A2QH 1TONA 4AOQA 5L3SB 2WVJA 2A9KA 1G17A 4DT1A 4U30A 3FKSD 3UMRA 2ZRNA 1V2VT 2FDAA 1C1TA 3CWQA 1W8BH 4J0QA 1COWD 4UNRA 2JAQA 4RFSA 1GVZA 2OD3B 3MCAA 2ZSAA 5LPFA 4D80A 3MWJA 2P65A 3ZS9A 2YKGA 5GCHF 4BXSA 2DE9A 4Q00A 2VP4A 2GK7A 4Q66C 2V55B 2ZJ8A 4PFSA 3SYKA 1MZAA 3KQHA 3RXTA 2X2FA 3T61A 5E7JA 1N5JA 4J2YB 3QNUA 1T3LA 5BWMA 1TIOA 3QXCA 2Y6TA 4UXJA 4MDSA 3RWOA 5CMXH 2ZFQH 1AM4D 3OAAA 4FMCF 2Z7FE 2QPTA 4HB4A 2G77B 2YHSA 4F7WA 1FUJA 1A2KC 2QGZA 4U7DA 1ZMLA 3RU4T 3VNUA 1OSSA 1RYHA 4Q1CA 3CS7A 1NNEA 1T4GA 4AWXA 1EZQA 1P4SA 5L30H 3K0EA 2QMUA 1G291 1C1NA 4PO1A 2O8EA 3QXSA 3FVQA 3PVSA 3RXVA 3QY0A 3K0SA 3EAJA 1L7VC 2WWXA 2RGGA 5FBWB 3RMMH 1FTSA 4KELA 5J4SA 1GBFA 5CHAC 3RVBA 3LONA 4A1TA 4OHXA 2OQUA 4W9MC 4N1AA 4L5BA 4TMKA 2AXPA 1K21H 1QTFA 3ZYCA 5J47A 5GJCA 1IQJA 1UM8A 1DLKB 3FMOB 3FGNA 1DOJA 1MOZA 1C1OA 2YJTD 3RHFA 3SU5A 2IYWA 1Q20A 4AKEA 2XOKD 3Q5DA 1RIWB 2UUKB 3D65E 2FPMA 2ZR9A 5FBIA 1ETRH 2QMHA 3EIEA 3W6OA 3H1TA 2AERH 1XTSA 2V1UA 2IWRA 3U3RA 2ZU6A 3BFXA 3LXXA 2QCYA 3HKIB 2REBA 1EOLA 1SLWB 2QAAA 4WZAE 2OCBA 4RZ3A 1NRJB 3TE6A 1W0KD 2ONJA 1Z07A 4X8HA 2N42A 4NIYA 5B6LA 2Z9IA 2CLSA 3I73A 2ZSEA 3V9PA 1RTLA 1O2ZA 1TA6A 1GHAG 2R65A 3H09A 2CL6X 3L8YA 1GNRA 1OKXA 2GZHA 4MH0R 4OHYA 2QF3A 2VP0A 3T62A 3BIUH 2IL1A 5HCNA 1EAUA 1AVWA 1MTUA 1E2HA 2FFAA 1SGPE 4WF8A 4OYHA 1HJAC 3ITIA 3TVJB 5EE5B 5FOVA 1HNEE 2ZRPA 1QJ7B 2XWAA 1YCPH 4Z54A 5CHAB 3DM5A 4M1MA 4ISOA 5GVSA 4Y8XA 1K1IA 2X19A 2KBFA 1O3IA 3ZZ8A 3SDZA 1OH6A 2ZRJA 4CVNA 5A0CA 3HGPA 3PR1A 1SKQA 4FU8A 1KAOA 4TQ9A 3QWCH 1Z3IX 3UWJH 3KXLA 1QURH 5C20A 1AQYA 2DFKB 1H8HD 2IT1A 4A92A 2PMDA 3U7GA 1P10A 2VRWA 1E9EA 1XD8A 5B57C 5E4FA 1YLDA 4DVGA 2V3CC 1FP6A 3GDVA 3DOEA 2P2LA 2JH5D 4EPVA 2OCPA 2IS4A 3URCA 4ABIA 3WHLA 4B2AA 1N6RA 3W8RA 1PUJA 4FXPA 3QUSA 3MYWA 2CJWA 3QXHA 4M22A 1VCWA 1C1QA 2FO9A 3RXPA 3WMFA 5UKDA 3T06B 5JEDA 3CM0A 4HTCH 3Q8XB 1NFXA 2V1XA 4FWTA 3KQCA 3EAQA 1TEXA 1Q3HA 4IEEA 4M9QA 4IVPA 4LY6A 1BDAA 1C5ZB 4EJSA 1FQJA 5FR2A 2DY1A 2LKDA 1G8HA 3CPHA 1UTQA 4WH8A 1A0JA 2ZGHA 5HE8A 3TW8B 1XUHA 1NN6A 3C1KA 2UUJB 1O2TA 2WV4A 2VYFA 1ZJDA 2WMNB 3SU8A 4IN2A 4YOIA 4TWYA 1LB1B 4A6LA 3ADBA 2G1JA 3RWMB 4GRAA 3BIFA 1OP2A 4OI4A 1NY5A 4ZIRB 4C2UA 1G16A 3B6EA 2VWMA 1HDTH 3AM1A 1RIWC 1HY3A 2DFTA 2CLCX 3KQDA 2G0NA 5KPJA 1O5GH 1CVWH 1OHHA 1LVGA 2ODPA 4PXAA 1O3YA 4I4LA 3ODFA 1V2MT 2NG1A 1B23P 4NYIQ 2ODNA 3IWMA 5GJWC 1P57B 1AVXA 4WIAA 3MJHA 3WNDA 1LF5A 2V3HH 1U8YA 1M6NA 4Q21A 4RKFA 2KE5A 3LU9B 1TPZA 1C5NH 1IQLA 2VB0A 2A5DA 2GZ7A 4Q4JA 2J45A 5J40A 3UKDA 3VX4A 2ZS8A 3I72A 4K8OA 3GISB 1UTOA 2ZTSA 1C9TA 1ZYOA 3ZVBA 1FIZA 2JASA 1KXAA 3SN8A 5T1VA 3UXMA 1WF3A 1TPPA 1YGCH 5A09A 3RC3A 1DY8A 3VB6A 4E5UA 1QBNA 4GCHG 1MKYA 5LB4A 2BCJQ 1R7RA 1O3JA 2MSDB 5CYPA 1OFUX 4LJ4A 2HALA 2J2UA 2WKQA 2FI3E 1GJBB 2O8LA 3M4YA 3EZFA 4D4KA 3V12A 3H7OA 3KQBA 1AO5A 4LJ6A 1MBQA 2JIZD 1GOTA 2FM2A 2BLVA 4Q7LA 4P31A 1FDPA 4GSYA 1CJUC 1T3SA 1CRPA 3PUWA 1O3LA 4GZLA 3DMDA 3KDSE 3KUDA 4Q4AA 1WSSH 2QE7A 2XOKA 2G52A 5EE0A 4O03A 2G5VA 2B7CA 1NRQH 4HLUC 1E4VA 4A2QA 3AVOA 1CR4A 2JCSA 1PPGE 4OKSA 1UAAA 2TGDA 4PSKA 2O8BB 3AVTA 1VCQA 2OFOA 4DDUA 4TMTA 8KME2 3GLIB 1V2KT 4TMZA 1FX0B 1KK0A 1JRSA 4HAZA 1C4V2 5GVRA 1XTKA 4X6PA 4RD6A 2NQ2C 2FSGA 3KB1A 2ESTE 1TUEA 1ESAA 3STJA 4GI7A 3PV4A 1P2KA 3PG5A 1U0HC 1P11E 1PQ8A 2D7CA 3SJCA 3OYPA 4QT8C 3MH4A 1SLVB 1Z47A 4EJSC 1OH8A 2GDJA 4MRSA 3HYTA 4F91B 3AP3A 5SZKB 1YPKH 2W3IA 1C5SA 2BDAA 3CB4A 3DPUA 2R6GA 5AVDA 4GFDA 4KXFB 2GXAA 1XUKA 4KYUA 4TL6A 2PWXA 2Y8EA 1ZINA 2H9HA 2VLIA 2OUAA 3AVQA 5JSZA 1C2JA 1GJDB 2O0JA 2HLCA 1KY9A 1RJ9A 1ETTH 4AK9A 1AWHB 1N5KA 1EB1H 2DPXA 2GCPA 2GA8A 4ABHA 1DOAA 1II8B 2XXLA 3DHWC 4MGZR 5DNYB 1N6KA 4FINA 1HA3A 2VF8A 3HR7A 5E95A 4U32A 2ODEA 1SHZA 3K0CC 1C5UA 3FB4A 4Q02A 5JYIA 4CT4B 4EPTA 3WMEA 4MGKR 3BJIC 4RZUA 1GVKB 2EFDB 3BTQE 2VO1A 3MFJA 4BLPA 3CRW1 2P3TB 4HI0E 1LQEA 2H5EA 3GY5A 3M7UA 3RABA 3OESA 4DLRA 3LGVA 4IXNA 1XM1A 1GI7B 3OHMA 4EUNA 5EE9A 4ABDA 3GLHA 1YZKA 4KSBA 2HLDD 2Q3FA 4SGBE 1VECA 1D6RA 4Q7JB 3AEZA 1QHNA 4PSAA 3LKWA 2P95A 1A0LA 4LHZA 5F6MA 4RD0A 1BMMH 1NJFA 1XFAA 3THYB 3WBKA 5DP9A 4TLDA 2B0FA 1W14U 1O2HA 1NI3A 2QI9C 2V54A 4TYYA 1QQ4A 1HIAA 2OK5A 2A5FA 4UJ3A 3DKPA 6ESTA 2F83A 1CGHA 3ZD6A 1ETUA 1GWNA 4B2BA 1DXWA 1TALA 3KKPA 1GCDA 3IO3A 5AJXA 1GG6C 3OEEA 5G3ZA 2W6IA 1GDQA 4NIXA 5AK0A 5GJVC 1MKWH 1O38A 3DD2H 2ZEJA 4BZQA 3ASZA 1HV8A 2RHDA 1AGPA 1SGWA 4M9SA 1E9BA 4X8VH 1ZMXA 1O2XA 2QXGA 3A58B 1D3PB 5E2PA 1CEEA 3ZH9B 1LVOA 1UBGA 4MUAA 2A4QA 2XNSA 2GT8A 1OXTA 3SI3H 2G8TA 1SKYB 1CTQA 5IT5A 1J15A 1ELBA 1ARCA 4DZZA 4C3ZA 1OFHA 3M5MA 4ZKRU 3MGCA 4L15A 5B6OA 3SW2B 4AKHA 2CHAC 3OE7A 4A5TS 1D9ZA 1BTXA 2IEZA 3VU9A 3SJBA 2JLSA 5EP2A 1BO6A 4YOGA 4I1SA 1GHXH 1RC8A 4ZI2A 1ZM9A 3MO9A 4C30A 2FSIA 1AU8A 2R0LA 1C4Y2 1GM5A 3RLWH 1GJ8B 3W3AA 1SVWA 5FBEA 2JEOA 1E9AA 3ZZ0A 1SZPA 1GDDA 3TIFA 3SZEA 4MGYR 1DELA 4PZLA 5HE9A 5KDDA 2NU1E 1AFQB 1PPCE 3PB1E 3P26A 2GF0A 2FOHA 1EESA 2IYTA 2ZDMA 1XUFA 1EP5A 1YVDA 1F2SE 2TMKA 4OQLA 3T1VA 1ESMA 2AIQA 1U99A 1NF3A 5FBVB 4OS1A 1D8TA 1TQ6A 2FWRA 3VKWA 4QNMA 1SXJB 1TADA 2ZRGA 2SNWA 1QBKC 1Z28A 3AVYA 5SGAE 1EFTA 2NU2E 4JLAA 4YLQH 3LV8A 2BKUA 2ZRDA 1AWFH 1XMVA 1GKYA 5TJXA 2ZDLA 3RXMA 2GDEH 4FUGA 2QORA 1F0SA 3SJ9A 4KAXA 3RC4A 2FOBA 1KO7A 1D2MA 1TOCB 2ZAOA 2LNCA 1K5GA 4YXWA 4L9WA 2WICA 5CIWA 4X2XA 1N6IA 2JIZA 2LCFA 2BMEA 1Z63A 4KLNA 4ZPXA 2OLGA 1V2RT 8GCHG 4MVNA 1DTSA 5FUXA 1DT2A 3E1XB 2BBSA 2BY8X 1OH5A 1FFHA 5DE3A 1K22H 2BOVA 4IN1A 1JAHA 3IDQA 1AJEA 1RPZA 1C2GA 2FPKA 3B9PA 1IONA 4K46A 1KLTA 3CENA 3PFIA 4FUBA 1GMCG 3IIKA 4AG5A 2OBOA 2G4UA 1E98A 1UTJA 3MO6A 4FW9A 5F8TA 4YM9A 2GF9A 5L6NH 2A5IA 2A5KA 4LZ1H 3KL6A 3C16C 4HZHA 3EW9A 5ELXA 3PWCA 2X77A 1G3UA 5J4QA 4MNWA 5EZ5A 2GCOA 1W44A 2FE4A 4TY7A 2PV9B 1CR1A 3OY6U 2ZCKP 4BFSA 2B7DH 5AJVB 3LBHA 4QXAA 1W36D 5DI9A 2BEJA 4JZKA 2ZYVX 2WPJS 5F98A 1DAFA 2WSSD 2ZKSA 5JDUB 4E7NA 2F9LA 4Y0ZE 1UO6A 5A8YA 3T5GA 1FY3A 2JLYA 3RC5A 3DEFA 4AIIA 3BK7A 4ZKNU 1G3CA 5L2ZH 2CV3A 2ZUDA 1P9UA 5CYOA 5DP8A 1CXZA 4JLMA 4BFXA 5DG6A 3WHKA 1JNYA 1HXFH 4PAOA 1Z1JA 4JLPA 3R7WB 2QE7D 1QHXA 1ZHRA 4QBIA 4BNRA 3GEHA 1F5LA 4NTZA 4TTRA 2SGPE 4HUQA 1DAEA 4DJTA 1KI7A 3L33A 1HGTH 3KFVA 3A86A 4GPGA 1DWCH 5EW2H 1BJUA 2OHFA 1TNIA 2RGEA 3U4QA 1AY6H 4P0TA 1NN3A 4ABEA 4AG1A 1D3TB 1S96A 3PWBA 1O33A 4IEIA 3E16B 2ZHDA 3JVUA 2WWWA 2QP3A 4RZ2A 4CF7A 1C1UH 3EC2A 2FMJA 2HCJB 2ODWA 1R0XA 3A81A 2FJUA 5FX6A 3U1IB 2A7QA 1WCZA 2DB3A 1Z6AA 2H7VA 1KO4A 3FFAA 4JK5A 4ZAEA 5FCRA 1CHOG 4M9FA 3G01A 1TX6A 5A0BA 3S7HB 2PZGA 4RZXA 2GJAA 3VHLB 1E37B 1F5KU 4CEJB 4PQYA 4Q9HA 3VHXA 4Q48A 1W7GH 1LY1A 1W4AA 1AKSA 1F2TA 1LVYA 5DJ7A 1JR3A 3F68H 1FY4A 2ZPTX 1ZM3A 1DANH 2FFBA 4H42U 1OHHD 3ZZ7A 1EUFA 1OYYA 1P62B 3RXGA 2Z5FA 5EG4A 3R9XA 3CRMA 2WUBA 4DC9A 3UR9A 4Z1MD 2C9CA 1OB2A 3A36A 5HPYB 4S2EA 5TVKA 3OIWA 5C67A 2EFCB 1Z08A 4Q4HA 2AWNA 1CQQA 1BMNH 3ZS8A 3THOA 1ZOMA 3VMFA 3WNBA 2A7JA 1SB1H 2BD4A 2X8AA 2OCVB 1OF1A 4HUTA 3BC1A 4M1KA 3A4MA 1KI8A 2ZSFA 1F7ZA 2BLWA 4HDCA 4A0FA 4HB0A 1T9HA 4Q4JB 1SVMA 2NU0E 7KMEH 3W5IA 5L3QB 2BY6X 3MNXA 5DP7A 4NYJQ 2PLFA 2HWLB 1DITH 3SGBE 1K9OE 4UFEH 3ATKA 1S4QA 4TTPA 1LVBA 2OLJA 3KXIA 2D2EA 3PYHA 3SJZA 1S82A 1C2DA 3V4RA 1P9NA 4UE7H 4Q7XA 1O36A 4LPKA 4OHZA 1GCTC 1DWDH 1F3OA 2FEMA 3VNVA 3JZAA 3TU7H 2QRNA 2TBSA 4IVQA 1XVOA 2EFEB 1Y3XA 3SV7A 3A87A 3FZZA 1MAYA 3A4LA 4QBHA 1KIMA 5G3YA 4DWJA 5CJPA 3ZDQA 1GAJA 4DLWA 3U60B 1CT4E 3LBNA 5TARA 4DEYA 2JLRA 1ZW6A 3E0NB 4NYMR 2VHQA 5GIBA 3GYMA 1E1QD 3LLUA 4XTCS 4O0MA 1FN6A 2CL7X 1NVWQ 4PO8A 2JETB 3GD7A 2V6JA 2PUXB 3LH5A 1OPHB 3CUEF 5FTNA 1CIPA 2H9TH 3I62A 4UDWH 2F1IA 3I8SA 1P2NA 1G6OA 2ZRCA 3CX8A 4AFZA 3F5FA 3UUZA 1O3CA 3DZ8A 2XXAA 1CLUA 1NMZA 1WCV1 1Y3WA 3KUCA 4IDPA 1Z2AA 1DARA 4OK5A 1Z6YA 3HDTA 5L3VA 5P21A 3RXQA 3PUVA 1ELCA 1H8HA 1KMQA 1RVDA 5G53C 2ZFTA 1SPJA 4EPXA 1UVSH 4M4SA 2RG3A 1Q57A 3NG1A 4D82A 1XZQA 3B82A 1TNDA 2TGPZ 2PUQH 1BTYA 1ZUIA 3QKSA 2ZVQX 2M5TA 1O5FH 1JB1A 1U8ZA 1XZPA 1E2JA 1NLFA 1U94A 2NWNA 1T8TA 1ABJH 2EC9H 3LXRA 1PPEE 1V6DA 2BQ7B 2XC5A 2ZU2A 1AFEH 4QC2A 4KBFA 3RXFA 5JWOA 1NT1A 5EXTA 1O3GA 3QUMP 2GCHG 4AZ2B 1G4UR 3MAAC 2ZSBA 3MMGA 1HUTH 2I4IA 1TA2A 3K9NA 4E09A 4EPYA 4PANA 1GMDF 3TUIC 4XBBA 1D5CA 1P2QA 2BD7A 3M5OA 1VTKA 1ZLRA 1GNPA 2FIRH 3QDZB 1G7RA 2ZR0A 2AKYA 4QHSA 3UG7A 5HKKD 3P70B 4NG9H 3P20A 1ELVA 1B7XB 1SHKA 4MDFA 2FWWA 4DEXA 2AXNA 3ASYA 3OZXA 2HVXA 4WOPA 1GBJA 1N6PA 2F91A 3BTME 3T29A 4DLTA 4WBSA 1VITF 2ZXUA 1E2DA 2Z4RA 1UVUH 4A82A 2Q6DA 3R8FA 1E2LA 3HP1A 1QL9A 3BXZA 1JJ7A 1KAGA 2XNDA 4AYVB 621PA 1GRNA 2W6JA 2HT1A 2G1KA 4BASA 1DADA 1U90A 2R6DA 3QPWA 1TGTA 3RS3A 2IWHA 1TX8A 2VPPA 4DCNA 1B5GH 3P1JA 5JB8S 1KDPA 1DM4B 1T5IA 2KSQA 1E96A 4DW2U 2OT3B 3K2UA 1E4YA 1KYNA 3CH4B 3BG4B 3N2IA 1E38B 5AJWA 4LJ7A 4A2PA 5E0GA 1HPGA 1SGTA 121PA 3KIDU 3RYTC 1QJ6B 1Y63A 1EK0A 5IDVA 4MGIR 2IOTA 2CHQA 1ORFA 1CR0A 4BANB 4ZKEA 3D31A 1CJKC 4URWR 1TMUH 3PM3A 1AZ8A 3CBQA 2BDIA 4YONB 1G8YA 1W4BA 1A5TA 3P4XA 3SUEA 1SL3A 3SEAA 4C7OA 1ETSH 1EPTA 1QHHB 3KJEA 3RXUA 4WW0A 1ZTLA 3TSOA 2A5AA 5EXMA 2QTFA 3PV5A 1HAIH 2BD9A 4NCHA 2QAGB 2J3EA 1UADA 3AVPA 4DLZA 1FPCH 1GSIA 2MSCB 1XMNB 1FOEB 4NZYA 4HDQB 2R3UA 4UD9H 1SVKA 3THXB 2XNIA 5EODA 2OINA 1S6HA 3KJGA 2F9BH 1W0YH 1KLJH 4U02A 1IXRC 5JPMH 3AVXA 2FOGA 4ZV4A 2I1QA 4O97A 2STAE 2FS8A 1VG1A 4TQAA 1GJ4H 4ZDWA 1YPEH 1DE0A 4ZKOU 2UZ3A 2F9VA 2YOFA 5TB5A 2FTMA 4KFSA 2BV3A 1DVAH 3GJ3A 3TLXA 1P0SH 3W5JA 5DHAA 1ELTA 4C2TA 3K9XB 4RKOB 2GKVE 4XJXA 2HPQH 1P6XA 1ZM2A 2IYXA 5IYTA 4JZIA 4MA4A 1O2JA 5SZHB 5FTLA 2SGDE 2WUCA 2ZJBA 3SNHA 3VB7A 4JYTA 1BS1A 4JVNA 1KK1A 3UNQA 3QF4B 5DPAA 4U5XA 5EXLA 3K9LA 3CONA 3SU1A 2Y81A 4NWKA 1O2QA 4KODA 4K1TA 1BZXE 3PUZA 3THWA 1XTRA 3HYRA 1ZVQA 4AY2A 1GHZA 2PT5A 1US8A 3SHFA 4RSGA 4IW3B 1XU4A 4PZZA 1FMLA 3CPJB 3P17H 4G5OA 2J94A 2ZU4A 1J9CH 3FMIA 4ZHLU 2BX3A 1Z0KA 3BG4C 2ZE6A 5AUPB 4QOSA 2ZDVH 2KAIA 1BTUA 2V0BA 1KJZA 3THWB 1OKKD 1BJVA 1OSNA 1HUQA 3ATWA 1HRTH 5L3QA 3PTNA 1TNHA 1Z6EA 2GRJA 5ESBA 1TRYA 2GMTC 5DN6A 4NU0A 1TX7A 1O39A 1ZD1A 4A6PA 3U3MA 1O2IA 2ZGXH 4ACBA 1QL8A 2Q6GA 1TOMH 3P8NA 2CN0H 4BAQB 1QNJA 4DSNA 1FTNA 1PJPA 3EZ7A 4PQRA 1UKEA 5BYKA 3NBXX 521PA 1W36B 4WZBE 1OE0A 3TK5A 1SG8B 4OS6A 4CZ2A 3K0AA 2CE2X 2A4RA 3I29A 4OQXA 3AKYA 2WOOA 1NTPA 2G51A 3PXGA 1VJAU 1GZSA 1ZCBA 4ABJA 2FOEA 1O2WA 3QLPH 2ZRAA 1CHGA 2H2ZA 2FP7B 4MNYA 4Y79A 3QXXA 2Q0HA 4NCIA 1U0LA 1GGDB 1MKXH 4EPWA 4GMDA 1IAUA 2HF9A 4J1YA 2IBMA 2AMQA 1DY9A 2EEKA 1O2OA 4HUQB 4AYWA 4FUIA 4BAKB 4F4IA 1KXBA 2PCLA 1LKBA 3BTEE 4Q1DA 1GJAB 2ANYA 3RXRA 1MBMA 1C5PA 4UFDH 1A0HB 2I1VB 3EA7A 1XKAC 3K70C 4XSKU 4Z8XA 3NUMA 3IQWA 3HPTB 4FWIB 1QCPA 4X8TH 4IOKA 2A4OA 1V3XA 3JVVA 1O3OA 4FCWA 1G3BA 1I4DD 1IN7A 4Q5IA 3KKQA 3UNSA 1GMHG 4C0JA 3TGPA 2HGTH 2VQSA 4K2YA 2OXSA 5CJ2A 1GHVH 4PC3A 1K8RA 3ZVCA 2FPLA 2OXCA 2G9NA 4DIDA 2XBVA 1CJMA 1BRBE 4AGJA 4JCNA 3TIUA 4OS4A 3W95A 1DAHA 2DBYA 2ZCLP 4JLDA 1MTNB 4B34A 1O2VA 3R20A 1XVMA 4IBLH 2ZU0C 3RS0A 4IGDA 3B9FH 3KGPA 4UNNA 1JEDA 2IJD1 5ANRB 3KFXA 4JLNA 2EQBA 2V6NA 3L8ZA 4MKFA 3T27A 4GHQA 3NH6A 4UQOA 1JBUH 3KJHA 2FZ4A 1M74A 4JJZA 1KSGA 4M21A 3M36A 3GLHB 3R9IA 2JA1A 3KTAA 5B58C 4UKDA 4DDWA 1W46A 4JK6A 1NFYA 2YC4C 2J0UB 1SFIA 3SFZA 1V2QT 1MO6A 2GCHF 3PEWA 4BZPA 2GESA 5E0HA 2GJ9A 2HJVA 4KSCA 4NCYA 2Y82A 3TH2H 1SGFA 2JGNA 2CK3D 1TFXA 3KQUA 4F38A 1A3EH 1N3BA 2OBLA 3PEUA 1G2LA 5J4YA 3THYA 4RCYA 4B2PA 2F7SA 1HCGA 4E07A 4LZ4B 2UZIR 1R2QA 2QXJA 1KI3A 4QGGA 4D0LB 1J90A 1P2SA 2BMGB 3PEVA 4GOJA 4NP6A 5JHGB 5FL7D 3GLGB 4JLOA 1SVSA 1LKAA 4EPRA 1Q1QA 2ZUBA 2VNTA 2WWHA 4MYCA 3GJ6A 1QHSA 4G01B 1Y5UT 1UEIA 3LAWA 4PC6A 2ZUCA 1MRNA 2W7SA 2FYQA 2C5LA 5KOYA 5HM9A 3MU0A 2FSHA 3TVDA 3FP7E 3SU6A 4Q18A 3SU0A 4FMDB 2QNRA 3A7XA 3PEYA 1U9IA 1BTZA 2ODBA 4MITA 2K5UA 4RD1A 1PZNA 2FH5B 2GAOA 3TSZA 1IQIA 3WXMA 2BMFA 1R10A 2P67A 2WWGA 1IN4A 4U2WA 2P93A 4IDQA 2EA3A 3VEQB 1NIPA 2LKCA 5FTKA 2B21A 5F03A 3GMTA 1O3MA 4KI0A 2J1LA 3VU9B 1LV7A 4HAUA 3EPLA 4D9RA 4M1TA 1C5RA 2OM2A 4CYMA 4YMUA 3RUOA 5IF9A 4XTRA 4C4PA 4KITB 4Y0AA 1ZAKA 4BEBA 2DWPA 2C9YA 1HAXB 3FKQA 1R5BA 2PL3A 1HTWA 4MPUA 4B3DA 3K6ZA 3SR0A 3BN9A 3ATIA 2J0QA 3IITA 4R7ZA 5C46F 3DOFA 5K8UA 1N1LA 1IN8A 4F93B 3NWUA 4DSUA 1Y3AA 4PZYA 1Z8RA 4G5RA 1N25A 3PUYA 3CH5A 3K0CA 1S0UA 1AHTH 2BWJA 3BTWE 3IKJA 1W5SA 2F9MA 1O31A 2D06A 2P3UB 1IN6A 7GCHF 4D2IA 3MU1A 3U8RH 2BMJA 4FUFA 2EU8A 1BRUP 5EXPA 3ODDA 1HH4A 5FFMA 4JZ1A 1Y3UA 2D74A 2F9OA 2YNBA 1OXSC 2FLBH 1OXGA 1AUTC 1GDNA 1JJVA 2FI4E 1P9WA 2FEOA 2ZRBA 4JT2A 1ANCA 3K9HA 2BJWA 1T5LA 3SNAA 3VQTA 3OEHA 3F9FA 2J41A 1GHAF 2VGCC 1W4CA 3ZVLA 3BIVH 1G4AE 3GY4A 4HI3A 4NSYA 5AUQA 4LK2A 4G1UC 1R5OA 2ZA5A 1BQYA 4QG7A 1OWHA 4NHOA 3EIHA 1TNJA 1G7CA 4JLJA 3SNCA 1L8QA 3FKSA 1O5EH 1NBME 1GI2A 4H9GA 3IPYA 2RCEA 3AW0A 721PA 3CRRA 3OE7D 4EKDA 2UWLA 2GCOB 3AW1A 1AZSC 4XBCA 4INHA 2ZQ2A 3DFJA 4YT7H 1FAXA 3TH5A 2GZAA 1BA8B 2ZDKA 4B2CA 4Q1AA 1L1NA 2FMXA 4POAA 1E0FD 5FI1B 2YC2C 2PKAA 1E2QA 5JZVA 4AFUA 2WPLS 4HSEA 4QRHA 4JLBA 5JBAS 1CRQA 1A5HA 4DURA 1NMYA 2BHRA 4FXGH 2R6CA 1G2MA 3IGFA 3BB4A 3SBDA 4F49A 2ZI2H 2CNWA 2V3OH 4KJZA 2QAJA 4ZDJA 1XPUA 1K1OA 5JS7A 1P5ZB 1U0JA 2B8OH 1FONA 1YPLH 2VIPA 1PV4A 1YZQA 1UCYE 2ZCHP 4NYMQ 2BVRH 1OV4A 2CL0X 5LBIA 1T4UH 1V43A 3LVQE 1C2FA 1G7TA 3B8HA 2BVSH 2C8ZB 2QC2A 3IBGA 1MCTA 1SVPA 3AKCA 1QRZA 1FQ3A 2GNOA 3KCGH 2WJYA 3U3JA 3MNSA 4AYYB 4IFBA 1OWKA 4DLUA 1RZ3A 1DSTA 1G21E 4M1WA 4M8NE 1NG9A 3BD9A 4X8UH 2FZZA 5BXQC 1CE5A 4B3XA 1U98A 1HEIA 1KTSB 4Y0YE 4AGKA 4Q7ZA 3VPKA 1VMAA 4IOMA 1RYFA 1FAKH 1ZU4A 2G81E 2JLXA 4M1YA 1BHXF 4YMTA 2BOHB 3BB1A 4YZUA 4CHAB 2GT7A 4X2WA 4Y7BA 1FUUA 2EFHB 5EXSA 4Q7YA 2XBYA 3C5CA 1VITH 4CREA 4I1UA 2ANWA 3PUXA 4JLVA 3GJ4A 5LPEA 5CIQA 2N1BA 2IXGA 1TBQH 3S9AA 1DAIA 1LS1A 3U7FB 1SVIA 4F4JA 3TH4H 1XKBC 5EE1A 1T0HB 4A8JB 1WQ1R 4NZQA 1NESE 3CLVA 5C1BA 3ADKA 1C5WB 4BPBA 5EUMA 3ZZAA 4FI3C 1MR3F 2K1QA 2UWPA 1P75A 4DBLC 4QM7A 1II9A 2STBE 4KTSA 3T5FH 2GBLA 1Y3VA 1NRRH 4ARZA 1P3EA 1TNKA 4NFEA 5DO4H 3ND8A 4N0EA 3LX5A 4IRUB 3EPHA 4KLZA 5DO9A 1AGJA 2GV7A 1XCGB 1OYTH 1I4LD 3P27A 3GP8A 2P5TB 3I1FA 1C2EA 3SO3A 3KTAB 4IDNA 1XRJA 1W11U 3LO5A 2ZJOA 3I77A 4AI6A 3P8GA 5FCKA 4BLOA 3A83A 5EOKA 4PX9A 4KKDA 2AYWA 2ZI9A 4H6TA 3MTYA 2D3WA 2ZROA 5G41A 3RLYH 4PHGA 3TK6A 3QTVH 3M3SA 2ILNA 3GYLB 3B7GA 1ELFA 4L8GA 1KDRA 1YR7A 3SUGA 1XF9A 3TJNA 4I8GA 1BCUH 1P2IA 2A5GA 3ZLJA 1CGJE 3FHCB 4LC1A 2Z9GA 4JL5A 1D6WA 3RANA 2V7QA 4OK6A 3JZ1B 3MFYA 2J7PD 2ZYWX 2Y7XA 2R3YA 3SGAE 4HB2A 4THNH 3OIVA 1C1MA 1U81A 2OBMA 2GJKA 4H4FA 4AURA 3K9GA 3B1VA 4QBGB 3REFA 3RLFA 1E9CA 5JRJA 2HUPA 1HT2E 1QRAA 1CGIE 4WXIA 3DO6A 2GTBA 2Q6TA 3CF0A 2QY0B 3SU4A 2RKOA 5DP5A 3Q7QA 4D4LA 2QUZA 2WZQA 4C0QC 3LW8A 9LPRA 1GPZA 2IHYA 4TT3A 4ITRC 1S85A 4IC6A 1DO0A 3AQ4A 1T8NA 1R8QA 2FV8A 2NIPA 2FESH 2JETC 3FE2A 2VIOA 1OOKB 2GEVA 4DCTA 2FEQH 3OFNA 3MSXA 1ZGIA 2YINC 2PKSC 3F3YA 2GGVB 3B1ZA 3OEED 1E2IA 1NM6A 4TYPA 5A4JA 2IF2A 2UKDA 2H5CA 1AB9B 2OV2A 1QDEA 1SXJD 2FZLA 1R6BX 5EJEA 1BRCE 2BDGA 3SBKA 3AGQA 1WB9A 3MH7A 1TNLA 3ZZTA 3NK8A 2XJ9A 3S69A 4JBWA 2CF8H 2P0EA 3JZ2B 1V2TT 1XDBA 1O2KA 1P72A 3SQXA 3TQFA 4PAMA 3U5ZB 1HE8B 1CJTC 1QQUA 1IQHA 5JBBS 2ZJAA 4L4UA 2FFHA 3TGJE 1BTPA 1XBTA 3AUXA 1MAXA 2H5DA 3CNNA 4DJZB 1GL1A 4GSOA 1GWAA 4Z0KA 5TCAA 6LPRA 1P06A 4TT3D 2Q3MA 4LYHA 5JBCS 2F3TA 3CWZA 1E79D 4ABFA 1ZJ6A 3GLIE 3UIRA 4H1VA 4D7FA 4IDHA 1XMSA 1RIFA 1ZU5A 3UTUH 3BB3A 5FH9A 4V0ME 2BIFA 2ZDNA 1TGNA 2NOAA 4LYAA 2NZJA 3GJ0A 4M1SA 3GJXC 1HIAB 4Q01A 4O25A 2P6RA 1G3MA 2XW9A 1PLLA 2FFQA 3GLFE 4U00A 1DUAA 4LBZA 1KY3A 1RW4A 3BFKA 2UUFB 4TY6A 2QPAA 1EWQA 1N0WA 4FVDA 2IX3A 1DLEA 4FCVA 2JLZA 2XB2A 4I8LA 1XMJA 3K8YA 4Z6AH 4LHWA 2Q9AA 1K1JA 1T0JB 4TYQA 3ZVNA 1O3HA 4I8HA 3RSOA 4KP0A 2PX3A 3GFTA 4WVFA 3CX6A 4VGCB 1BYIA 2V7QD 1PPFE 4ZH8A 3NKVA 3WYAA 4M7GA 1OPXA 1T8MA 5CLQA 1G5PA 2SGFE 1IM2A 1LQDB 3EPJA 2IUTA 3U2QA 3U44B 5L3RA 1FY8E 1ZYUA 1ARBA 2W0SA 4JLKA 3T1OA 2BD5A 1TNGA 3E8LA 1VG0B 2C8XB 3MLEA 1ANBA 1EX3A 1RTFB 2G3YA 1SBWA 4FIDA 4U01A 5D3MB 5AFZH 3NBYC 4RVCA 4TPYA 5KDLA 3FVFB 4JBXA 4PROA 5DHFA 1P3JA 4Q2KA 2GV6A 1KIGH 2VHCA 5A0AE 3ONWA 1ZHPA 3SYJA 4US0R 221PA 2B8TA 4YTAA 3Q76A 3GCTF 1UMAH 1WBGB 2O9QA 5TY0A 2A32A 1SQAA 5HMAA 2H8KA 2PLRA 3GCGA 4FMDF 1T31A 1THSH 3CF2A 2ODYB 3R0FA 2REOA 5EPNA 5BW8A 1M34E 3NCLA 3RRNA 1AE5A 2VP2A 3FMPB 3K0FB 1UEJA 3G5UA 2SGQE 2ZPQA 4FUHA 1WBDA 2A7CA 1IQKA 2O8EB 2O8DB 2WWFA 5E7MA 1SVOA 1JR3D 5H1YA 4Z51A 4TPIZ 4ESHA 5DYIA 4EDHA 1HAOH 3TW4A 3BORA 4CGZA 4CT5A 5FTMA 2VA8A 4UXHA 5GADl 1E2KA 1R5NA 1L2EA 4OI0A 1GVNB 3EWSA 1LS6A 2W0MA 3U7EB
chains in the Genus database with same CATH superfamily
4TUYA 3HUUA 3ZZ5A 4N12A 1TYAE 1YBVA 2NZVG 4IH9A 4Z86A 2XQVA 1TVCA 1ZNXA 1EM8B 1OI3A 3OSYA 2GVFA 1ELOA 2HCFA 2Q5JA 3VUFA 2QF5A 3ECSA 3U17A 5AW4A 4MINA 1JIVA 3QFHA 5F5NA 3ET5A 5BPEA 4CTJA 5BVHA 3SUFA 3FFXA 3PNMA 4NJEB 4OV6B 4H1TA 1KH3A 5CLIA 5KWJA 1KZ4A 1JJFA 1TL7C 1XEXB 5EJ5A 2TGAA 1JA9A 2AOUB 3BRCA 4RUKA 4IDDA 3OLXA 1MO2A 3A1WA 3P32A 3ZCRA 5AHRA 5G0TA 2X0FA 2QN6A 4R2MA 1HMPA 3W2TA 5FPSA 1GHWH 1J7KA 5EGMA 1Q91A 2QJOA 2YV5A 4UOQA 3PMAB 3ZDEA 4K26A 3R9XB 2HM7A 1QRRA 2J3IA 4F8EA 3HEBA 1NBAA 5C4MA 4Z4QA 3I78A 3LGAA 4NOMA 3WIVA 2TECE 2P9TA 3PFKA 4YPVA 1GBHA 2OVBA 4DPLA 1GUAA 1Y98A 5TX7A 4DIOA 1IRIA 4EGSA 4O9VA 4ISCA 4OQQA 4ZKSU 1NFWA 2ZANA 1KJWA 1K8ZB 2BXUH 2AS0A 4G56A 3ITEA 3PRJA 4IZHA 1U1IA 1USUA 2AZDA 2J4CA 3FFTA 3OQVA 4PPNA 1CBWB 1XEWY 1YA8A 1X1EA 1NVUQ 3A7ZA 2ZTMA 4OJKA 5DBEX 1HG0A 4K8RB 1M75A 5FOUA 3VYWA 1NZQH 1SVUA 3PQDA 2ZJYA 4D0GA 4CT0A 4L95C 2B9LA 5B3AA 1GFIA 3HJHA 4FXOA 5F1PA 4JR0A 1M9UA 3CNOA 3TEMA 2A2ZA 3P8FA 2FMFA 3QF4A 2QSJA 3QPBA 4FDTA 4JI2B 1ESZA 3L43A 4MW0A 2CEAA 2CNDA 3CCFA 3WIOA 4CR5A 2C0PA 2ZRIA 3OOHA 2DJIA 2IYNA 1PQWA 3D3QA 1JR4A 3L8GA 4TQUS 2RH5A 1YE8A 3PHIA 1P33A 3UWKA 4AO8A 1ODIA 1YZHA 1UHBB 3KXDA 3FZQA 4FUDA 4PPQA 4EHKA 5SYMA 1F0YA 3EOZA 2FQXA 1RD4A 4JUCA 3FTEA 2O7NA 3C1OA 1X8JA 2W2KB 1XDSA 4MS3A 1M8KA 2B2NA 3BT7A 1MU6B 3W06A 4ZZ1A 2Y0DA 3BTGE 4ZOLA 3WGOA 1THRH 4AKTA 4S05A 2B1GA 1GUBA 1QHIA 4JJAA 1DJOA 3EDMA 5JH7F 1KQGA 3U56A 1ANEA 4BGDA 4NOJA 1ELGA 4HMQA 1R88A 2PLNA 3HA5A 4CEIB 2Z58A 5JXGA 1AS2A 2AA3A 1OTHA 1MTZA 2KBEA 3UR6A 2LWIA 3IOCA 5EVCA 3ZWWA 3B2QA 4ZC8A 3OM1A 2XMRA 3QUBA 3V2HA 4CTOA 3IOBA 2XYVA 1SMFE 2Z0MA 5IEBA 1O97C 1VI6A 1GPYA 2O8NA 2EX1A 3DDUA 1THTA 3KUUA 4FU0A 1RZVA 3EGOA 4S1TA 4YMVA 5C1UA 2JGRA 5LQMA 2NO7A 4GUXA 2PL1A 1BITA 2W6PA 3K05A 2OORC 4JR1A 1OAAA 4U0KA 3T34A 2FOXA 2P4EA 1GD1O 3E3LA 2P0YA 3MMPA 5L2YH 5L40A 5CVEA 3IULA 4OAOA 3K0KA 3WMGA 3CQ9A 3RODA 4LSZA 1X6VA 4YNBA 5HA5A 5CB6A 3HJBA 1GI5A 1UXGA 5C9ZA 1A9TA 1S5SA 3FAKA 1A46H 3OPNA 4WERA 1BTHH 3MNBA 1AG9A 2VIIA 5AK5A 2HIGA 2FA9A 1OXBB 1N0HA 5TQ2A 4F6LA 1KI2A 1MVNA 3GT3A 4FDVA 3IVMA 3T0IA 5KYYA 4Z53A 1SD5A 2WYOA 1O87A 5J2TF 3R5FA 1DFGA 1Y9DA 1TQDA 3HYNA 5T6FA 2QZZA 1DOZA 3L5OA 3OZEA 2XY4A 4PIMA