5FPTA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 2-(1-methyl-1h-indol-3-yl)acetic acid (at3437) in an alternate binding site.
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
total genus 199
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fptA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fptA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fptA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fptA03
1U8AA 5EP1A 2K5UA 3NWJA 1OIXA 2A4QA 2J46A 2WIAA 1JR6A 1J8MF 2ZS7A 5JLJA 2A5AA 1TNLA 4ABGA 3MH6A 3FMPB 4G5GA 2H8KA 4KFRA 1OWHA 2Q1JA 1CR1A 4IXMA 3NC1C 4DLXA 1XB2A 1O3NA 1X7AC 3F6UH 1RGQA 2ZQ5A 3T29A 1EAWA 3R20A 4IDHA 5DN6A 4PHTA 3MWJA 3L0OA 2R0KA 3N5CA 1BB0B 1HAZB 3SI7A 4I8LA 5EG4A 4PSAA 1T8OA 1OH7A 5K7RA 2CJWA 2HPQH 5G4BA 3O8CA 4BASA 3S9BA 3GFOA 3GDVA 4IEIA 5FAHA 1XX9A 3U2QA 4LZ1H 2A7QA 2NQ2C 4DOQA 3PJRA 1CA8B 5CLLA 3PEYA 3P27A 1MO5A 1VITF 1NM6A 3C7KA 1PPZA 2Q9AA 3NCLA 2VO1A 1J8YF 3BG4B 1TEVA 3VB6A 1KXDA 3PV5A 4NZQA 1ZUNB 3FHCB 4MDSA 3LQQA 1PLLA 1UK4A 1YGCH 1GRQA 2Z4SA 3R9IA 4BFZA 2ODPA 1ANCA 2IYQA 2PX3A 4US2R 2LPRA 1SVKA 2R6GA 1O2UA 4KHZA 4NFFA 4ZH8A 4JMYA 2BOHB 2QE7D 2DFTA 1EZQA 1JECA 2JH6D 1P2UA 1Y8TA 1FNIA 3K9NA 1IBRA 3UXMA 4Q18A 4QT8C 2FU5C 3QXSA 5BN3A 4I1UA 1E2JA 3ZD6A 1FY3A 3RXJA 3IUYA 1N8OB 3TLXA 1GDDA 3TJUA 2FOGA 3X1DA 2XJ9A 4GI7A 5DISB 4Z1MD 3ONWA 1XWIA 1VG1A 1ZC3A 3BH7A 3OX7U 1O36A 5EPNA 1XPRA 1GJ6A 4O97A 4BFVA 2FESH 2X2EA 1NN6A 2AKYA 2A45B 4U01A 5JHGB 4JZIA 2H17A 3FVFB 3C16C 3SV8A 1HV7A 5K8IA 3SYNA 1NN5A 2J9RA 1U0LA 1LQEA 1RTFB 4E07A 2ZNKH 2FM2A 1GWAA 1TRMA 1V2KT 4LJ6A 1SVWA 5E7IA 3K09A 9LPRA 2GJ9A 1CO7E 4UXIA 1H9IE 4IC5A 2BJVA 2XTNA 2OZEA 3IIKA 4TL7A 4AD8A 1TQ0B 4Q7ZA 4TMVA 4MPUA 4CEIA 1T8LA 2ZG0H 1ZU4A 1GBAA 4BNRA 1TBZH 3EX7C 1O30A 1FNMA 1TABE 2P67A 3D65E 2VHUA 3LH5A 2RG3A 3LGTA 4Y7AA 1RVDA 4D6PA 2ZCHP 1AVGH 1CJUC 4ON9A 2FPLA 5F8XA 3C5HA 3A36A 4YZUA 2SGAA 3HK3B 3D23A 5HR5A 5KOYA 1C5MD 2Z9IA 4WY3A 5A2MH 1Z2CA 4Q2KA 5FOUA 3AKDA 2B9LA 3UOPA 3A7WA 1A5HA 2IYVA 1WQVH 1NRQH 2ZVPX 1EX7A 3SZEA 1NFWA 3NC0C 2ZJOA 2H9EH 4A6XA 3CS0A 4PPGA 2XCFA 1EFRD 5F3WB 1YJ5A 3NH6A 1MKYA 1IY0A 5FPHA 1ZCAA 1KXCA 3T06B 4MNVA 2X19A 4H1VA 3ICQB 4GBMA 4RKOB 2KE5A 3HR8A 2R2AA 2GK6A 3SS8A 4NZLA 4R8TB 3X1XA 1ORFA 1NIJA 3K70C 1V2ST 5J5CA 2BC9A 3P32A 1VDZA 2Z94A 4D4LA 4K81B 1XUKA 5DGXA 3GLGB 1GUAA 2J9NA 5IDVA 2CVHA 2ZRLA 1R5BA 3FKSA 3ZVCA 3RXSA 3TE6A 2B8WA 5AUQA 4E7RG 4ITRC 2WYJA 1C5RA 3BBPA 1PPCE 2BTCE 3KFVA 1OPHB 1W7XH 3BB3A 2QF0A 1O3IA 1AQUA 2WINI 2A5GA 5C4MA 1TUEA 1YCPH 2HALA 5A8YA 2REXB 1DM4B 4JLOA 4D9RA 5KPJA 1KI1A 1D5CA 5TARA 3LD9A 1C5PA 1DE0A 5PTPA 1O35A 5DP8A 3SEAA 3MJHA 3GISB 3RXPA 2ZP0H 1CT4E 4GSOA 3QGNB 3PUVA 4OQMA 1J90A 3Q00A 2DY1A 4C0QC 1YQTA 2CE2X 1ZMNA 1QHGA 3QF4A 4DCVA 1A3BH 3RXMA 1C9KA 1B5GH 4MGYR 4HI3A 4LOYH 5LGOA 4FD2A 3OESA 1WU1A 3PUYA 2GDEH 4A92A 2ZDMA 1AIPA 2G52A 1KMQA 2WPKS 4NDZA 3SNBA 4JJZA 1GMCG 1QHHB 2R44A 2CNWD 5C67A 1THPB 4WXVA 1S6HA 1BBRE 2G9NA 1ESNA 3A1UA 1XUJA 3QOFA 1LO6A 2CK3D 5JJIA 4FWTA 1N6YA 1QBNA 1J2JA 3L43A 3CZQA 3TQFA 2IX3A 4Q4HA 2WWHA 1YCPK 1NBMD 1SVLA 2VWMA 3ZVFA 5JHHB 3A1SA 3VR3A 4URYR 1LB1B 3NHBA 3A7XA 3LY5A 4D7FA 2EFCB 2OFWA 4UJ3A 5E4FA 2XTMA 4UKDA 2BY8X 1QR3E 1CJKC 1RRPA 2WOJA 3TITA 4PZZA 2ASEA 3AF3A 1LPKB 4AI6A 1PPBH 2FMJA 4HLDA 2FOBA 4IN1A 4LYFA 4I31A 4DLVA 1SLVB 1D2MA 5IYTA 3SNHA 1GDNA 1KI8A 1ZGVA 2FA9A 2ZU4A 5FOTA 3RANA 3MH7A 2PZEA 4X1SU 1B7XB 2YWEA 3PMAB 1H65A 3MCAA 1D2EA 3K9XB 1ZM9A 4R0IA 2R6DA 2RAPA 4EAQA 1DADA 1O2LA 2WPJS 1NFYA 2P3FH 2ZAOA 2YVUA 2R2MB 1DOAA 4XH9B 3ND8A 4WH8A 3U6BA 1YRBA 1IAQA 1SZPA 1W4CA 1YLCA 3KX2A 3JZMA 4EIWA 1GI4A 1M1YE 2YC4C 2J0UA 4QHYA 2YWFA 1HURA 5G3ZA 1E1QD 4ZHMU 1XPOA 1FUUA 2FE4A 5CM9C 5DSZA 3F8TA 5KTYA 3SJIA 4JLJA 2JLSA 3HKIB 2OM2A 1DY8A 4PQFA 2YWGA 3QKSA 3GCTG 2OLGA 1KDQB 4R9UC 2VIWA 3P6ZB 2F9OA 1D9ZA 3QDZB 1TGSZ 3P92A 3NBFA 3B8JA 4O3TA 5C20A 1ANEA 1H8EA 4OS4A 2QXGA 1JJ7A 5FBEA 1NSFA 4Q9LA 1HPGA 2AGEX 3TPIZ 3PO1C 2FP7B 2VF7A 4TLAA 5BW8A 2OFXA 5EE0A 4GP7A 1KKMA 4IVPA 4DSUA 1GJ5H 4X2XA 4JZDH 3RUOA 3NIBA 4B3XA 4ISOA 2PH1A 1N5JA 2BD7A 2QI9C 3WNCA 2FSIA 2N1BA 1GI3A 3U60B 1ZAKA 3TK5A 1VKJA 1XTKA 2YOHA 4JL8A 3QI2A 1GG2A 1ZW6A 3QEJA 3MHWU 4EPTA 1SGRE 3OYPA 2ZXUA 4JLKA 4G3XA 3PWCA 1KTVA 2ZRDA 3SGBE 1OYTH 2SGEE 3ASZA 1O2ZA 1FW6A 4PQRA 1BITA 4KFUA 4I7YH 3K0EA 4YMTA 5CHAB 1Y3UA 3W90A 1OB5A 1C2IA 2WSMA 2UKDA 2CLCX 2C8XB 2DB3A 1VJAU 4X2VA 2H5DA 2HLDA 2ZC9H 4Q4AA 3PMJA 1JXPA 3ADDA 3M36A 3VB4A 3DZDA 5CHAC 5T6DA 2IPHA 2TPIZ 2PZFA 3TBKA 3WP1B 1O5AB 4O03A 3A89A 2GDDA 2A3RA 3ZZ7A 1DAMA 5EW2H 1O3LA 4B76A 2V35A 1DWEH 3PCRB 3PIRA 2BDYA 1EFTA 1KDOA 5KYKA 4LZ4B 2FI3E 3FVQA 1ETRH 2ZIQH 4GDFA 4YESB 1Z1IA 3TLOA 4YO9A 1KO1A 3I29A 1GRNA 1K8RA 1L4DA 1AKSA 3IKJA 2I1QA 4DIEA 3TH3H 1EAUA 2IXGA 4X1PU 5JWRA 3GY7A 4JYVH 4HDCA 4TL9A 3FP7E 1AGJA 1AN0A 4Q4JA 1AIXH 3UIEA 1HT1E 1O3DA 1SQAA 3B9FH 3QZQA 2GCPA 1UM8A 4Y8ZA 2FLBH 2R8RA 3MU0A 1P8VC 3NH9A 3ZD7A 3KFXA 2F9UA 2NO1A 3SFVA 1GHAG 1E69A 2YHSA 4URVR 1GI2A 4W5WA 4RSPA 1ZNXA 4ABYA 1EZUC 3BFVA 2R3UA 2FFAA 1CKEA 2DHRA 2GJ8A 1SB1H 6GCHF 4NCJA 4NFEA 1TPOA 2IYWA 1FX0A 1UVTH 1M2OB 2ORWA 4TWYA 4RN6A 1SGDE 5JEDA 1IOZA 1MKXH 1YPLH 1OV4A 3TGPA 3ZZ3A 3RVBA 3ZQJA 5JJLA 5EPYA 1BHXB 1GG6B 3UG7A 3ZZTA 4RD0A 4YMSA 4X1NU 3FANA 4IXNA 4JMPA 4PQYA 2GV6A 3CP7A 2FS8A 3H86A 3HDTA 4M8NE 2ALPA 3PUWA 3TUIC 4C0BA 1M74A 4X8MA 2R6FA 421PA 1WBGB 3BGWA 1HRTH 5DH9A 2JDID 2XWAA 2ONJA 2H5CA 2W58A 2P95A 3CH4B 1IOEA 2OINA 2WV4A 3KJGA 5P21A 5AK0A 1ZRHA 3WMFA 1Z22A 3MNBA 4XVQA 4NIWA 4WH6A 1Q57A 1JIRA 3S0NA 3LFUA 1N0UA 5KDLA 3NUMA 3K9LA 5A5GA 3VX3A 1L2TA 3LGWA 3RU4D 2BMDA 4HI0E 4UJ5A 4BAOB 3NBYC 5GCHG 4Q1BA 2V1XA 2YKGA 3LW7A 4NZYA 1NN1A 5DN6D 1T4GA 2C77A 3WNDA 5JS8A 1R0WA 3EQ0H 4JIMA 5CITA 1R8QA 2QGRA 5ELXA 1T8MA 2QAGA 4Y10E 1US8B 3W34A 1RRFA 1MRNA 1OE0A 1BMNH 2AR7A 2ZRMA 2A78A 3MO3A 3CX7A 2SNWA 1W5TA 2JA1A 4VGCC 3LBNA 4B32A 4LJYA 3RWOA 3W8NA 3BERA 5D3QA 1JR3E 1KSFX 1AB9C 1Z6EA 1P03A 4O0MA 3ND9A 2WPDA 1CXZA 1QHYA 4ASUD 1N6PA 2Z43A 3IHLA 3UTUH 1CJVC 6LPRA 2TGPZ 1S3SA 4FU7A 2WWFA 2CL6X 2OAP1 3SW2B 2XX3A 2C93B 1Z71A 1O2YA 1P2IA 4CR9A 4L9WA 1BTWA 1CP2A 2XTZA 1KHTA 2F9PA 2QBYB 4QGFA 2ZDAH 3SGAE 3BH0A 1C5XB 4MPXA 1G64A 2RGDA 4U2WA 3I32A 3BTFE 3RC6A 1W12U 3ZZ8A 4JZ1A 4MYCA 5AJVB 1A1RA 5G53C 3S1AA 4L9SA 2CDNA 2QRNA 2A7JA 4RD1A 1Q21A 4ACBA 3VEQB 4BE7B 2Z9LA 4NWKA 5HGGA 2DFNA 2ANBA 1P7CA 5JRZA 2CHAC 1GHXH 4ZO4A 2BMGB 3KQCA 3A1WA 4XOJA 5B2ZA 3Q3YA 1W5SA 1E0AA 3PR1A 3AQ4A 3AVXA 1RZ3A 1OHHD 2D2EA 1NLFA 3GJXC 1HJAC 1D3DB 2ZRIA 1GI0A 2FN4A 1W0JA 2R3YA 1FIWA 1G3BA 1SGIB 3BSQA 1E9CA 1UJ2A 5AJYA 5SZHB 4DLTA 4NYMR 2N42A 5AFYH 5FTKA 1GM5A 1ZM7A 4OGYA 1P06A 3L33A 5ANRB 4ABFA 3A81A 2WICA 4JKYA 2ODYB 4XE4A 3K0SA 4IRUB 1WAYB 4FUCA 3KL6A 2Y7XA 1YU9A 2QU8A 3KJIA 1P2VA 1W46A 4KFSA 2ZSAA 3S7HB 2NGRA 2VJ1A 3P26A 2FEMA 3Q3JB 1HIAA 3FMIA 4R2HA 1Q22A 2OCPA 2ZDNA 3RXDA 3HGNA 1M34E 4INKA 4FIDA 2J0SA 2GMTC 5I25A 2RB4A 1THSH 2ZROA 5EP4A 1GVLA 2KAIB 2BZ6H 1GHWH 4ESVA 1XTIA 5FTMA 4NH0A 1P5ZB 4MKGA 2IF0A 1SSXA 2XSZD 5DLQC 3U9AH 1XFAA 5GADl 2ANCA 2ZU1A 1EGAA 1QL7A 5FOSA 5J40A 3Q72A 1O3BA 4ZXXH 1L0ZA 3KJHA 1Z8IB 4UQOA 4BUJA 3MMPA 3BWDD 2CMYA 1YM0A 2TGDA 4JL5A 3LGYA 1BTUA 1W0JD 1CTQA 2ZU3A 1XTJA 4NE2A 1QHIA 5CE1A 1C1TA 1TX7A 4MYTA 4QKQA 4RCZA 1VCNA 1P72A 1G7RA 4XWAA 4BRUA 2IYXA 2QP9X 3P8OA 1US8A 1X1SA 1GNRA 2TRMA 1XUHA 1KMHA 1VG9B 2J0UB 1X6VA 1BMFD 5EP3A 1TL7C 2O8BB 1P6XA 3IEUA 1JXOA 1Q12A 2BJWA 2WKRA 2H9HA 1C5LH 4RVCA 1KY2A 3B5JA 2OLJA 2ZCKP 1GJ7B 1EJMA 1G41A 3D49H 2H92A 1C9PA 4MNWA 1PPGE 4GLYA 3UWIA 4CDGA 1QRXA 4NCHA 2QEQA 5CJ2A 5J4SA 1E36B 1XEWX 3THWB 3H5CB 4PO8A 3ADBA 3GLGA 3QBTA 4OJKA 2VYFA 4NYJR 1DAHA 1KO7A 1QNJA 5KHOC 2Z0MA 3C15C 5L3QB 1YZNA 1QL8A 4LJ9A 5DI9A 1DO2A 4MUBA 4RD6A 3EPJA 1TTTA 4AC9A 1VECA 4DJTA 4KU4A 1IJFA 1WCZA 2WUBA 3HPQA 2WPDD 3ZVGA 3AW1A 2AFIE 2Q9BA 1BOQA 5JBQA 5F9FA 1OOKB 1LKBA 4B2CA 3VFDA 1ZHRA 1W7AA 3WRYC 4XWKA 1PLKA 4V0OA 5A0AE 3FWYA 3Q7QA 3GCHC 2BEJA 3LC5A 4DDWA 3BTME 1SGQE 3RXGA 2F9MA 2P5SA 5M04A 5HM2A 4CHAC 2CL7X 2SGFE 3ZZBA 3PTNA 1W4RA 4FMCB 3RSLA 1FTNA 1Y3YA 4NIXA 3SORA 1T8TA 1TX6A 4HLQB 2PCJA 3EAJA 2EA3A 2UWPA 1ZYUA 1S83A 3OAAD 2DR3A 1YZQA 4M0LA 1F7ZA 1UK2A 1OF1A 4UXJA 4A0HA 2O52A 2LCFA 2OUKA 4HUQA 4QGHA 2IBMA 2F9VA 2IEYA 4F91B 2I4IA 1Y3WA 3SV6A 1VG8A 4CVNA 4TPYA 2OC0A 3W94A 1C1SA 3B13B 1IHUA 4AKGA 1E0SA 1ZZZA 1N25A 4SGBE 3GLIE 2NPFA 1NBMA 2Q6DA 1YR6A 3K70B 1V2TT 2ZETA 1YP9A 4X8UH 4W7SA 1YPGH 2QSZA 2FOFA 1F0TA 1O2IA 3A1TA 4LC1A 3ZZ0A 2WV5A 3UG6A 1Z5ZA 1EATA 3TNFA 1QL9A 2ZFRH 2BWJA 1Q1ZA 2UVQA 4CH8B 4X6OA 3TIUA 3KEEA 3I73A 1P04A 3NBZC 2KSQA 3EZ7A 3UR9A 4BEBA 3MFJA 4IOJA 4D80A 1PYTD 3Q76A 3KB2A 2C2HA 1SLXB 4GFDA 3E3TA 2GZHA 4Q4HB 4WIAA 1QRAA 3BEFB 3AEZA 3DHWC 2IUTA 3ZIAD 2BZAA 2ZPRA 1INCA 1DWDH 2QAGB 1FQ3A 4BTTB 2GCHF 4V0ME 3OY6U 3OTJE 3RXBA 1KZ7B 3DEFA 2GP9B 3A8AA 2FFQA 1VJ9U 5DP6A 1NY6A 2KJQA 2BM1A 3CX6A 4D0GA 2H1LA 5C46F 4F4JA 3EIQA 3I5YA 1Z06A 4R7ZA 5FCRA 1C4U2 1PLJA 1AWHB 3AUYA 3TKLA 1W3CA 1T4VH 5L30H 3UMFA 4HLUC 2F1RA 1BBRH 3C27B 2ODNA 3CB4A 1EJAA 2O0HA 2UZ3A 1YZGA 2C3SA 1GGDC 4O3UA 1YZLA 1C1WH 2Q3FA 4CEJB 5KNCA 4IN2A 4TMZA 1SHHB 5E8EH 1Z6GA 3F9FA 2FI4E 1V5WA 4MKHA 3HU3A 4NA7A 4Y11E 1O32A 2JH0D 4FU9A 2B7BA 3P20A 3ZZUA 4JZKA 2AHOA 3PEUA 3AF2A 3PV2A 1NSTA 1ZRBA 1XUIA 4BAHB 3GLFA 1AE5A 1K1PA 4ACAA 4CRBA 1SVOA 5FPKA 1L2EA 5EXMA 1YCPM 1LHFH 3P8GA 4QL3A 3ZVDA 4YLUA 4LJ5A 1SXJB 3PROA 3QF4B 3IG6B 1RPZA 3P17H 4TYYA 2V7QA 2XBXA 3EWAA 1FPCH 1UADA 1XXHB 4OJQA 4DDVA 2A9KA 1SG8B 1AI8H 1Z6YA 1TBRH 5DP7A 4A6PA 2CXXA 1EB2A 3MH5A 1QA7A 1FY5A 3NXPA 2ZR9A 1A82A 1E79D 2CLDX 1ETSH 2R2WU 1KO4A 1W2GA 4BFTA 3KHVA 3TGIE 2KBEA 1A46H 4ABHA 3EA5A 1O2NA 4G1UC 1I4TD 3L0PA 2Y8EA 5LPEA 4KELA 1A0JA 3LV8A 5DP4A 4HATA 3OF5A 1THRH 3UKDA 4IVRA 1FUJA 1HH4A 3SJBA 2BY9X 3T2NA 1ELCA 1LHDH 4QHTA 4HDQB 3KQEA 4CEHA 3UIRA 3GYLB 1XVMA 4BAKB 4JT2A 3TJVA 2BBTA 1X3SA 3E90B 2FO9A 3A8CA 3I72A 4IEEA 2VIOA 2FZLA 2C8WB 4WW0A 3TUZC 2OSBA 1G4AE 2ZGCA 1G3QA 3TK6A 1L1GA 1CHGA 2P6UA 2A4RA 2PUXB 3A80A 1VZQH 2C5LA 1WE2A 2KAIA 1DE7H 3VXFH 2P2LA 3ZDQA 2BX3A 3RXLA 4LJAA 4D4JA 2UUJB 2XBYA 3WXMA 4RD2A 1DX5M 4F4IA 3L82B 1Z0DA 3EA8A 3BTQE 1SULA 4LJ4A 1TPSA 3V3MA 1QJ6B 4WMFA 4CW7A 4OI1A 3VKGA 5CIWA 1NT1A 3SJCA 1IHSH 2IHBA 1SGWA 1OKKD 1A4WH 2BY7X 3IDQA 1GCTC 3GCGA 4EPXA 1GP2A 2VIPA 1YHNA 4AYXA 2D74A 2WMNB 1XVOA 3TGKE 1CRPA 3D6TB 1SXJA 1ELFA 1C2MA 3U4QB 1CBUA 1KMHB 1G291 3SBEA 2GD4B 2STBE 4I8JA 5DP5A 4MNYA 4B2AA 4YLQH 1HQYE 4D76A 1P57B 4Y79A 4JBWA 3P70B 1H8DH 4A5TS 5H1YA 1E6CA 1SXJD 4LV5B 1GDUA 2FFBA 1R0ZA 2F83A 2QMOA 3LWNA 4DWJA 4LBZA 4DT7B 3UWKA 3ZVMA 1GBCA 3MLEA 4I1OA 2AMDA 3KQKA 1QZXA 4YT6H 1QQ4A 3SOSA 3FMOB 3T1QA 4RZUA 2ZDLA 3L6PA 1E9BA 3OTPA 4XVUA 1O2PA 3SU0A 4FMCF 2GJKA 1IXRC 1C4V2 1JXMA 1IM2A 3VAAA 4YOIA 1F2UB 4BZPA 4DT1B 1F92A 3SUEA 1FX0B 3S9AA 4N0DA 2FI5E 1LHEH 1OWJA 3KQDA 2GVDC 2IK8A 4EPVA 2ORVA 3ZLJA 3B1YA 3PV0A 5CJPA 5TB5A 4C9BA 3MNSA 1AN1E 3VB3A 1E98A 4K1EA 3LOXA 1O3AA 1O2KA 3KTAA 1W2KH 1TRNA 4H6SB 4HAZA 2ZR7A 4FUEA 3GJ7A 3PLKA 3URDA 3CO5A 4IJMA 3ZZ5A 1WRBA 2IEZA 3Q9LA 1K6MA 2B7CA 2W7SA 2F1JA 3BN9A 2P65A 2J0QA 1T5LA 2JEOA 4TQ9A 2YC2C 5BYJA 3AV0B 3CNOA 2WUCA 1KDQA 1HA3A 2FOAA 2GEUA 2R9PA 4EFLA 1W4BA 3AVPA 5AF9H 1GRRA 5EXTA 1EUFA 1NC6A 2AEIH 4SGAE 4MA4A 2CGAA 2QP3A 5DHAA 1A3EH 3TK9A 2J45A 1AFQB 1EZXC 1BTYA 2XXLA 2VP5A 4B73A 1GL7A 2AIPA 2AWNA 3M4YA 1E4YA 3QPWA 3RXVA 1XD2A 5GPIB 2PT7A 4ZDIA 1M7HA 2OLKA 2DYKA 1BIFA 3VB7A 3H2YA 1NKSA 2EWVA 4WA7A 2XRCA 5F6MA 4DGJA 4B75A 2WPHS 3AM1A 4OL0A 3E16B 3CUEF 3DHKH 2VHTA 3ADKA 4LXBH 3SJ9A 4AKEA 1TAGA 5IDKA 1IN8A 2CVFA 2ERXA 1K1OA 1Z7KA 3LJJA 4AG5A 3SQWA 1E2EA 4MGKR 4ZIRA 1O2HA 4B71A 1VYTA 4JBXA 4NCNA 4TWWA 1YRAA 3K6YA 2GT7A 3TSWA 3ZQ6A 4B3CA 1TPZA 1SGFG 3QKTA 5FOWA 5HCNA 2KBFA 4DRZA 4O2RA 2V0BA 3KKQA 4KBGA 4L8GA 4TMXA 3NBXX 4A2QA 1G3IA 4MDFA 4TYQA 1E2HA 1ZR0A 3ASYA 4NHOA 3BXZA 4M9ZA 4JLMA 2VP6A 4KXFB 3LDXH 4P4UA 1FJSA 1ACBE 1OKXA 3BJIC 2ZI4A 5IF9A 3ETLA 3HR7A 3LQRA 2HDNB 3TAHA 1KIMA 3CKLA 3MD0A 1OP2A 2IUUA 3H7OA 2XSZA 1S3GA 1DWBH 2VIQA 1Z8FA 1GBHA 1DSUA 3HP1A 1P11E 2WPIS 1PPEE 1UTKA 1JOUB 4JK6A 1NMYA 3QUSA 1DITH 3LVQE 3M7QA 1K5GA 5C3NA 4OHXA 1KXBA 1P10A 1TWXB 1NLZA 3R3GB 1FUKA 5KNDA 8GCHG 3OEHA 3AKYA 3FYHA 1O3JA 3RYTC 2W3IA 2P5TB 2ZGJA 2QTFA 1HEIA 1GVKB 1IQLA 1J9CH 4M1KA 4Q7YA 2ZF0H 3OZXA 1AKEA 1NFUA 2Q6TA 3RC5A 4PC6A 5ESBA 3TJOA 2QM7A 4ZKEA 4HTCH 3TU7H 4UFGH 1N6XA 4E06H 4E05H 1FP7A 3RMLH 3VU9A 5DP9A 4B3BA 2GK7A 3AP2A 1D2NA 1WB9A 2F7SA 2L0XA 2RHMA 4ZKSU 3RXKA 2C9YA 2ZJ5A 3FHTA 4JJKA 4ZKRU 1N0VC 2RA0A 3KNXA 4KO8A 4XWOA 1IONA 1UTNA 2XBVA 4PTLA 1RRCA 1F3OA 2XC0A 3QEOA 4RKEA 3C4JA 2FLRH 5BXQC 2IL1A 1BRUP 2VA8A 1G5TA 2RGCA 2F3CE 2VPPA 1LVBA 4AX9H 1H8HA 1MH0A 4S2EA 4KJZA 3W5IA 3EDXB 5G3YA 4IBLH 3LXXA 4MLFB 4EPYA 1O37A 3QWCH 3VR4A 2WOOA 4ZI3A 1V2QT 3QF7A 2QBYA 4UXHA 3TVTA 5DGJA 2ODWA 1ESAA 5EXXA 2ZRCA 1EG7A 3RNLA 1FDPA 1N5IA 5KPDA 2G3YA 3VNUA 3GCOA 1HIAB 3BEIB 2ZE5A 4TQAA 4X2YA 4LPKA 1FY4A 1G19A 1TNIA 1MTNC 3R8CA 4JK5A 1DXPA 1Y3AA 1N6OA 1V2OT 2ATXA 2FF7A 2OCBA 1TA6A 4BANB 3RRMA 3T27A 3F9HA 5T3HA 5H4IB 3JZ1B 4XFQA 1J16A 1ZJ6A 1QBKC 3T15A 4TL6A 1D3PB 3LXRA 5EQQA 2NZJA 5FBWB 2OTVA 4URUR 4TSFD 3ZVNA 5GWZA 2AFQB 3LLMA 1Z0AA 3EPKA 1X8JA 5L6NH 1WYKA 1T31A 1NJFA 2QENA 2ZO3H 521PA 4OI4A 2QF3A 1W1WA 2HLCA 1TQ6A 2HJVA 3U3MA 2V7QD 1S4QA 3B82A 2BV3A 3B1ZA 1JEEA 1NRRH 2QP4A 2IS6A 3MMGA 1LS1A 2GGVB 4XBCA 3T5DA 2O8FB 2B21A 3E5HA 3QTOH 3FGNA 5EE1A 4YONB 1TE0A 3W6OA 4OQLA 2AK3A 1BH2A 1HJ8A 3EWSA 3GLHA 4IDNA 2GF0A 4I81A 1CIPA 3OU0A 1S96A 4KCGA 2IW3A 1QF9A 5H8WA 1YR7A 4TY7A 3SJOA 4U7DA 5TMPA 5J4QA 5KSZA 1V2WT 1FZZA 4GOJA 4OHYA 1OH8A 4ZXYH 3QXXA 3CS7A 2JKHA 2V1UA 4RSGA 5K8TA 4Q00A 4KV9A 1F60A 3Q7PA 4JYTA 1GCDA 2ANKH 4CR5A 1H4WA 1GAJA 2HV8A 4U02A 2BMJA 1I4DD 4RKFA 2QQEA 2SGPE 3BFKA 3SDZA 1JQLB 3QJYA 4IMZA 2SGQE 3KTAB 1P2SA 1GL1A 1GHYH 2MMGA 3SV7A 2GA8A 4MDEA 1ESMA 5T6FA 2QXIA 4QBIA 4ISHH 1V2LT 4AB8A 1YVDA 4DIHH 3H09A 3HK6B 1IQJA 4O2LA 1AFQC 2Q21A 3GDUA 1BYIA 3KKOA 3U3KA 3W9YA 1E2QA 1KIGH 3FFGA 4HAWA 4JZFH 2ZU5A 2CEAA 4IOLA 5TXGA 4PC1A 4DG4A 1RIWB 2IXEA 3DMDA 1OIWA 4JYCA 2QRZA 4P33A 3V0XA 3QZRA 1VMAA 2VRWA 1C1RA 5LDDC 1AWFH 2OC8A 2NIPA 2HCJB 4L15A 4JCNA 2NU1E 1FMJA 1E1RD 1CS4C 4RI0A 1YC0A 4ABDA 4Q4LA 4OQFA 2A31A 4Q9KA 3H1TA 3DMNA 1OWEA 3NK8A 1PPFE 1KO8A 3DA9B 3IQXA 2NG1A 2Z3DA 2V8OA 4YXWA 4TN1A 4LBWA 3B1VA 2RKOA 1GG6C 4PHHA 2IYSA 2A5KA 4ABIA 4DLZA 2GZDA 4RZ2A 1SVSA 1XZPA 2JLQA 4JLBA 1E2FA 3I61A 2P3TB 1ZMXA 3SYKA 2QN6A 5JMTA 3UPEA 1C4Y2 4A8JA 3V13A 3B9PA 4ZKNU 2MSEB 2Z9JA 2GRJA 3BV9B 3GLFE 1S1CA 721PA 4E7NA 4K8OA 6CHAC 3LRPA 1HBTH 1Z6JH 3GLHE 2QE7A 1M8PA 3KQNA 2G4TA 1MO4A 1KSNA 3SN6A 1ZC4A 1MTUA 1P60A 3OIYA 4F92B 2ASUB 4C0JA 4MGZR 3QY0A 4GHTA 3X1YA 3UQOA 2DWQA 5GJVC 3T1VA 1AGRA 4M2LA 3NZIA 1KI4A 2QMEA 4HZUB 3PTBA 1KK0A 4FCVA 2B8TA 3PG5A 1K5DA 2O8FA 2O8CA 2A2XH 2OO7A 1Z07A 2P6NA 2QN5T 1G6OA 2JETB 2QY9A 4QC2A 1L8QA 5EZ6B 2P94A 3UUZA 5LH8A 3AKEA 4BLQA 3I92A 3SJZA 5JZVA 2ZSEA 1U8ZA 3UWOA 1ZM2A 4IHQA 5GDSH 2I1VB 1G3DA 5HPYB 1UVSH 1UFQA 1Z0KA 1E34B 1GVZA 2PSXA 3QUMP 1GJ9B 4CRWB 1ZMLA 3WNBA 4MTBA 5DG6A 1BUIA 1L4YA 3FKQA 3TR5A 4LYJA 1OSNA 2W6JA 4HAYA 1KO5A 4K5ZA 5CYPA 1VGCC 3LGIA 1YPKH 3VHLB 4A6LA 1OYYA 3HU2A 2PSYA 3UMSA 3WP0A 1G6HA 2VBCA 1DLKB 3ATIA 3PLBA 2CHAB 2GAOA 2NPIA 2PKAB 1JWTA 1CBWB 2SHKA 4LJ7A 1ZPZA 3EZ2A 2G77B 4Y0VA 1ZTJA 2CHGA 4FCWA 2ULLA 5SZJA 1GBLA 4I4LA 2QY0B 1PPHE 3EG5A 4X8OA 1O5EH 4XSGA 5DNYB 2WPMS 5KDOA 2W3KA 1Y5BT 2D26C 3CBQA 2GTPA 2Z6BD 4POAA 6ESTA 2XTTB 3SJKA 2ZHWH 2ZI9A 4DIDA 4XD7A 4DKXA 1G8YA 4DVGA 2HLDD 1DOJA 1SHZA 3GJ0A 2HT1A 4OK6A 1UHBB 1MBMA 4F38A 1MBQA 1GBTA 1C5NH 2C96A 4P32A 3RS2A 2FYQA 2RA3A 1E79A 1P02A 1QHHA 1MKWH 3HWSA 1YZUA 5BN4A 2ZRGA 3TRFA 3HPTB 5LD2B 2W00A 3LVRE 3M6AA 3K0CA 4Q1FA 1UVOA 3DD2H 1Z8RA 3QGJA 2GMTB 3RAPR 5D3MA 3A85A 4R98A 4TYNA 3A86A 2RGNA 1C5OH 1W7GH 1MAXA 2HF9A 2W26A 4FINA 1Q0UA 4UEHH 3BORA 1C5ZB 4ZCMA 2XEXA 3NEJA 3FFAA 4FXGH 2CMKA 1FV9A 1Z8JB 2AH4X 1VYUA 1UDWA 3B1WA 4M53A 5DHFA 2JGNA 2GXAA 2IYUA 3BE4A 4CGZA 1DICA 4B3GA 4OBEA 5L3VA 1BJUA 5JFGA 4GPTA 3QIAA 4BEJA 1NI3A 5B6OA 2ZTYA 5DKMA 2QG6A 3TNSA 4IGDA 1E2PA 4HZUA 4S35A 3SHFA 2ZPSA 5K8LA 1SGNE 4CBOA 1GBFA 1T91A 3DL0A 2OD3B 1XX6A 1EPTA 1S0UA 2Q3HA 3HATH 2WIBA 1E9RA 4P3YA 1IQIA 1TADA 2XNDD 3BTDE 1G18A 2CK3A 3IILA 1DY9A 4HB3A 2AD1A 1V2MT 3DOFA 3KXIA 5ABWA 1ZINA 4BFWA 2BD8A 5J4VA 5CDFE 1AA9A 5DP3A 2ERYA 4INLA 5FPSA 5C18A 3SZNA 2FFHA 4C2TA 1O33A 1TB6H 1FNNA 4AWXA 2BIFA 3L8ZA 2WJYA 1GJ4H 2ZDVH 1WOFA 2G5NA 4GHQA 1NF3A 1YPHE 5A8XA 1GNPA 2GTBA 2ZS9A 1IQFA 4JLAA 1RIFA 1V6DA 1U99A 3T12A 5JECA 1V43A 5FPYA 3LDAA 2OC7A 3RMNH 2F9NA 1BIOA 4Q7MB 5FHTA 1WP9A 4K46A 1XEXB 4CRFA 5LB4A 1UBCA 5AUNB 5AUPB 2HYDA 3RDPA 4KGAA 1XMJA 3PMBB 5C1XA 2ZGBH 2ODBA 3TH4H 3S1AB 3JZ2B 2G81E 2O8DA 4CIDA 3SNAA 4EJSB 4MRRA 3H84A 2W2TA 3F9EA 3QVVA 4MRPA 1HDTH 3B8HA 3CNLA 1II8B 3EAQA 3QX5H 3A58B 1FN6A 1G3RA 3UOUA 4LUCA 3U3OA 1QHXA 1OX1A 3Q8XB 2GVFA 1Q20A 4Q4AB 4DURA 1CJTC 2JJ1A 3A4NA 4BLSA 1N5KA 1CBWC 2IXFA 1DO0A 1KSHA 2ZE7A 4XD7D 1Q2WA 1E9SA 4EPWA 1W0KD 4BTUB 1KXEA 4GNKA 3E91A 2VGCC 1GJ8B 2AFHE 4AORA 2V3OH 2QYIA 1EFUA 3K9GA 2ZSBA 2R9VA 2R0LA 3KN2A 4C7OB 3G5UA 5FH9A 3K2UA 4Q7XA 2OUAA 3ZVLA 3ZZ4A 4KTSA 1OH6A 2D2FA 2IA5A 2ILNA 4DY7B 1GL9B 2O8DB 3AAUA 2ANWA 2C8YB 2G00A 3BF6H 3SJ8A 4WAUA 1GI6A 1VIAA 2XAUA 3GOVB 3D3QA 4YMUA 4ZIRB 4B2BA 3I77A 3STIA 1XDBA 4NIVA 1HXFH 1Y5UT 2HNTE 2ZRNA 1O3CA 1EESA 4Y76A 4B34A 1KDTA 4TT3A 2XW9A 4A8JC 3GJ8A 5E0HA 1DPOA 1P09A 1E38B 2GILA 4DIIH 3MFYA 4MYHA 4RD4A 4Q66C 1AZ8A 3AVYA 1BTHH 4ISNA 3ZJYA 2PMKA 2WMOB 2D3WA 2GDJA 2MMCA 3GLIA 3MOCA 1OS8A 2WM9B 1KTSB 2HNTF 3ZV9A 3RRYA 1TPPA 5FOVA 2C9OA 3BK7A 2FEQH 2G8TA 1KI2A 3B7GA 2OXSA 2VQSA 1EK0A 2P93A 1V2PT 1A5GH 1XJQA 1HAVA 3EE0B 5JDUB 2B6HA 1SPJA 4Q01A 3EZ6A 3BIVH 3LNCA 1HAHH 3IITA 1NBME 1S84A 1FMLA 1S9HA 2PCLA 1NG9A 1C2KA 4A82A 2PGBB 4HGCA 1KK3A 1G7TA 4BLPA 1TBQH 2IN2A 1SFQB 3NKKA 2BVXH 4OM9A 3SR0A 4ESHA 2DE9A 1RS0A 4OS2A 4F4OC 5DIFA 3LH1A 3BTKE 3NVAA 2O8CB 4IDPA 5A0FA 1O3HA 4OHWA 2AMQA 2XJ4A 3GY8A 2P3SA 1GHBG 1BBRK 2ZEBA 3MU1A 2WJVA 5AHGH 3K8YA 4IVQA 4PC2A 2GX4A 2RMKA 5KU1A 3VTKA 1T3SA 2TBSA 2BY5X 2F4LA 3LGUA 2GF9A 5C1UA 1O38A 221PA 3IWMA 1Z08A 2X8AA 5FTJA 4A0FA 3SV2H 4LK4A 3STJA 1KI6B 2GEDA 3ATKA 3AVQA 5J4LA 5FUWA 2J38A 4D7GA 1DAGA 2CNWA 4UFDH 2AL7A 3ODDA 2Q3MA 3TAUA 3DFLA 4LBYA 3EXAA 1ZP6A 3PEWA 1W36B 1TMTH 4P4TA 4ZI2A 4TLDA 2IYZA 4CRAA 4DLSA 3OEHD 2QCYA 5CK4A 5C5OA 1RD3B 3FZDA 2AK2A 1U0HC 2V6IA 4MNXA 3L2OB 1KNQA 4JYUH 2UZIR 2WJJA 2O5VA 1TF7A 1U81A 2ZFTA 1F48A 1EQ9A 2FEOA 1GVNB 4RFSB 3P4YA 3JVVA 1Y3XA 1L4UA 4ABAA 1GILA 2GT8A 1XMNB 1MQ5A 4GCHG 4CT4B 2DPXA 4BWYA 2AERH 5BYKA 3R9XA 5IRCD 1RW4A 4M7GA 1TALA 1DG1G 3KDSE 3NDBB 3UNRA 3ELAH 1TF5A 3V7TA 3PEVA 3SE0A 4WXPA 2ZI2H 2J2UA 1NG1A 2IHYA 4NYIR 1SLUB 3OY5U 4OS7A 1U9IA 1OXVA 3DKVA 3K6ZA 1BQYA 1WQSA 3Q85A 1IQEA 3CNNA 1ARBA 1KSGA 3BC1A 1LDTT 3AVOA 5FUYA 1FPMA 5D3MB 4HSEA 1P3CA 1C1YA 2XC5A 3THWA 1GMDF 1KOFA 4LY6A 1JRTA 2GZ8A 2WWXA 1GPZA 1EOLA 3JZAA 1BA8B 3MSXA 4DB4A 1JBUH 5L3QA 3NWUA 1XF9A 4DDUA 3LU9B 4NGAH 4MG3A 1TIOA 1J70A 1R10A 4PPQA 5AJZA 3T5FH 3C5CA 4P4SB 1H9LB 1CVWH 2FV8A 2QPAA 2OEPA 1MCVA 1TF2A 1MTWA 2WJHA 1W2HA 2J3EA 5B64A 3B85A 1Z0FA 1E2DA 1GTVA 3KQHA 1E94E 3CENA 2VL7A 8ESTE 3DVLA 4OK3A 4B48A 1ZNZA 4ESTE 1O2RA 3FHOA 4A7IB 3MJRA 3WHLA 1ZCBA 3M3SA 2KB0A 2HNTC 1F5RA 4AOQA 4FUDA 1G2LA 3MWYW 5AR1A 4CRDA 3CPJB 2AX4A 4A0GA 4O3MA 4AG6A 4WXRA 1R0XA 4BZQA 3U61B 2Y5HA 1DXWA 1G3UA 5EUQB 4QJ4A 1CEEA 2DE8A 4OS1A 4AZ2B 2BBSA 4BXWA 4KBFA 1SKQA 2VWOA 4V02A 1HAGE 3RLFA 2GESA 1MCTA 1TGBA 4K8BA 3LBHA 4NP6A 3SHWA 1R6BX 4HUQB 4TTPA 1ZBDA 5HYOA 4CH2B 1OWDA 4Y71A 1SXJE 1W4AA 4LSGA 2VU8E 1GMCF 4HAVA 2OE2A 3CH5A 3RXUA 1OW3B 1MRSA 3TVJB 5AJXA 4OHZA 1BHXF 3EARA 1OXSC 3H0KA 1XCPA 2VVCA 3N2EA 4DSNA 1XEXA 3TJZA 5BRRE 1XTSA 4PO9A 2JLUA 3AVWA 1SQTA 2ZHQH 1T4UH 3UPUA 1SMFE 4F49A 4BQSA 1GI8B 4BAMB 1ZUHA 1KK1A 4B35A 4E09A 2D62A 1NNEA 2ZYVX 4JS0A 5JWOA 1G36A 1E1QA 3P95A 2PTNA 3CONA 1NESE 1UAAA 4WZ6A 2P3UB 2XBWA 3MWLA 621PA 3CLVA 4NCIA 1Y3VA 1O31A 4WBSA 1O5CB 1LY1A 1OPXA 4PPNA 3SC3A 1C2LA 1D6WA 4ZKOU 3S7KB 1B0EA 1E4VA 4AGKA 4PAQA 2FSGA 2ZUBA 2ZWLH 1G8HA 4GOXA 3X2SA 2BBOA 4OHVA 3RS0A 3MI4A 1ABIH 1CR0A 3W95A 1XU4A 2OQ5A 3PYHA 2PBRA 4X0WU 5F8ZA 5L3SB 1LQDB 1VCIA 1HV8A 1B23P 3VX4A 2A2QH 1SGEE 2B0FA 3SYJA 4AYVB 2DUCA 4BGDA 3QVUA 2CE7A 3TNTA 1KJYA 1FPHH 1ELEE 4XSKU 1L1JA 3SQEE 3PVSA 4DCSA 4B3DA 1JPNA 3I78A 1VTKA 3WYGA 4B44A 4D2IA 2BLQA 1TYNA 1YR8A 4ISLA 4V03A 3SV9A 2GV7A 3EC1A 2JLZA 4LI0A 2ZGHA 4Z8XA 5H68A 4Q19A 1A4RA 2FODA 3PUZA 1F5KU 2XB2A 2VHJA 2VNTA 3OE7A 1E32A 2JLYA 2ZYUX 2P16A 5A0BA 2A7CA 3THXA 5AUOB 1V2NT 4L16A 5IHPA 4L5BA 5A8ZA 4BTIB 5FUXA 4NKRA 2JCSA 3FZZA 1EP6A 1G7CA 3GFTA 1BO6A 1JRSA 3GPLA 4DCTA 5J47A 3NTUA 1ZJKA 4IW3B 1FY8E 1O2SA 821PA 4DCNA 1E0FD 3BTEE 4GCHF 1GBBA 1S5SA 2STAE 2XNSA 3UANA 3SNDA 4N0EA 1HGTH 1Z63A 4M1YA 3E2IA 1EX6A 2PX0A 3V4FA 4NTZA 3QN7A 1Z47A 4NMMA 3EZ9A 1IN5A 3E70C 1VHTA 2B8OH 4OQNA 1T8NA 4LHXA 1QTFA 3ZZAA 2XITA 1GBDA 5J4HA 3GY4A 8GCHF 2GKVE 3QTVH 1RRKA 2PUQH 2VSOA 4X8HA 4FUBA 4BLRA 5CB6A 2BMFA 1IQGA 3SU6A 3QG5A 3R9WA 1XUFA 3SYLA 4WMDA 2FYRA 1M6NA 4DHEA 2BDBA 3MRSA 1EFHA 4UNQA 2I6SA 1ELOA 3BG8A 2QPTA 4LK2A 4UONA 1ZTLA 3M5NA 4Y6DA 1HJAB 1BMFA 4DT1A 1JNYA 1KTTB 5B57C 1HLTH 3F1SB 4A1TA 2GHIA 5HE9A 1ZJDA 3NPSA 5TY0A 3BB1A 1GHBF 1FONA 2A5FA 2GKSA 1TNHA 2OCAA 5EU8A 1QJ1B 1N3BA 1GJDB 3FP8E 2GVZC 4E22A 3RU4T 4QGAA 3TQCA 2QGNA 4NU0A 3CM0A 4ABJA 1K1JA 4D81A 4AYWA 3QXJA 3LO5A 2D06A 2GCTC 1UTQA 3Q5DA 5JEEA 1O2XA 1ZVQA 3AF0A 5LD2C 2FG5A 1ZM3A 4ZV4A 1O5FH 3A87A 4M4SA 4KVAA 4GVUA 1KGDA 2E1RA 1I2MA 2OHFA 3A83A 3O8BA 1NS3A 4FVBA 2WWWA 2ALVA 1F0RA 2VHCA 3UWJH 1TGNA 4WXIA 1UKZA 1GOTA 3ZGXA 3ZZ6A 4QXAA 3U7GA 1YZKA 3MAAC 1RTKA 2ZRJA 2WHXA 2ZTZA 2NU3E 5C2ZA 3GJ4A 2YNAA 4Q9HA 1O5BB 5CLQA 4FUFA 4G5SA 1JEDA 4D0LB 2QM8A 1QQUA 3CPEA 1ESTA 2IWRA 2ZI7A 5CYOA 1CA0C 3QKRB 4FMBB 4H6TA 1UCYK 3MU5A 4PXAA 1BDAA 3RS3A 2OAQ1 1ELVA 1NRJB 2RGXA 3R7WA 1D9XA 2OC1A 2ZSFA 2CF9H 1BRCE 5CDFA 5JCPA 2XYAA 4A36A 1SQOA 1UJ1A 1EJNA 3TGJE 2Y81A 1QG2A 1ZIOA 4US0R 1OXXK 2PLXA 3OHMA 1AS2A 1IN4A 1ARCA 2HOBA 1C1MA 1G32B 4A1XA 4DVAU 2XXAB 1KXFA 4UNRA 2RCEA 5EOKA 2Y82A 4K8YA 3RDZA 3RU4E 1PJRA 3THYB 1C4OA 3MGCA 3L8YA 3ZYDA 2GJSA 1P2JA 1LHGH 2PLFA 2Z3CA 3AGPA 3B60A 1J17T 4D0NA 1GL6A 1T3HA 3T35A 1U0JA 7ESTE 1G8FA 5KSPA 1EKBB 5TV2A 1NVWQ 4GOKA 3IEVA 3AASA 2XGJA 3M7TA 1OSSA 3NDPA 1II0A 1VYVA 1EASA 3CWZA 1EFCA 1OFHA 2YNMA 1ZNYA 3RWMB 2F43B 5E2PA 1QDEA 2C98A 3AKCA 1DPFA 2ZIAA 1MAYA 4ZROA 4B33A 1P75A 2CBZA 4KTUA 1BOFA 4JVLA 2OG2A 1GSIA 2QMHA 2GCOB 4BLOA 4M21A 3WY9A 1GHZA 2NOAA 2C03A 2UUFB 4INHA 2WV9A 1ZGIA 3SU3A 2PEYA 1NL3A 3NEYA 1LKAA 4GUXA 2YOGA 1GI1A 1E0JA 4EUNA 3QXCA 3CZPA 1BTXA 3PUXA 1ZUIA 1KYNA 3JVUA 1KY9A 1P2MA 2ZSDA 1EAIA 5TCAA 3RXHA 1IY1A 1CGHA 4CZ2A 3UR6A 3AF1A 1ZSKA 3FOZA 3S9CA 3RXQA 4TLEA 3A84A 3MO6A 3PM3A 2F1HA 1QA0A 3THOA 4ZHAA 2BD3A 2O8LA 5FX6A 1LF5A 4TYWA 4OGXA 1UTJA 1S9DA 4M1SA 1YF4A 1SC8U 4PAMA 3QPVA 2BX4A 1GJAB 1F0UA 1V2UT 3MTYA 4F7WA 1WBBA 1D6JA 1E96A 2EYUA 2R65A 1JPJA 2DWPA 4F4CA 1DT2A 2BKEA 4DLRA 2GEVA 3RLYH 3DZ8A 1T0HB 4F93B 2REBA 1Y63A 1H9HE 1E2KA 3RMOH 1OWKA 3GJ5A 1BJVA 2BMEA 3UNSA 2KI5A 2VIVA 3GQBA 2PKSB 1G7SA 2BBWA 2VF8A 2HUPA 4A9AA 3OSYA 1TUIA 4I8HA 4QJ3A 5I46H 1NRPH 2OV2A 4FMDF 1DS6A 2IT1A 1NU7B 4GP6A 4Z8YA 1PUJA 4TT3D 3AW0A 3QQ5A 2ZDKA 5J4KA 4RZXA 2RCNA 1T0JB 3VB5A 3K9HA 5DI3B 1CRQA 1NZQH 2FDCA 4Q1DA 1KLJH 2IF2A 4J1YA 3SU5A 1Q1QA 4TL8A 1LVYA 5DK1A 4JKIA 1AB9B 4ILEA 2IYYA 1FL9A 4M9SA 1C5WB 3N2IA 1G3CA 4II7A 1XCMA 2FOHA 1JR3D 1DTSA 4UFEH 3CRW1 2IJD1 4Q1CA 1E37B 2EVWX 4KITB 2J7PD 4WOPA 1DELA 2ECKA 5EQSA 2RDLA 3U8TH 5EXLA 1Z0IA 2QV1A 1K28D 2BQ6B 3VQTA 3UMRA 4QJ5A 2A2ZA 1RE0A 4Q7JB 4B2LA 1U90A 5B30A 1DDJA 3P1JA 1GMHF 1QB1A 4LC0A 2FNAA 3U7FB 2XZPA 4DSOA 3LAWA 1P2NA 1UTMA 4NIYA 4BFYA 1CT2E 1UKVY 3LW8A 1C1VH 2XNDA 2F55A 1GBIA 1C1QA 2VGCB 1C2JA 3U1JB 1NU9A 2JLWA 4CT5A 1S82A 5T6GA 4GZMA 1ZSJA 4ZDWA 3UATA 3TSZA 2RGGA 2VVUA 4XDEA 2ZZUH 3T61A 1D8TA 3KF2A 1EXFA 3TJNA 2ZUCA 1IJEA 4KP0A 5JSZA 1U9IC 2FPMA 4UD9H 4GZLA 1JR3A 4ZAEA 1HB0B 3CIOA 1DAIA 3ITIA 1XD2B 1ELAA 2Y7ZA 3RXOA 3DDCA 1ZRKA 2VSXA 3I1FA 4CBNA 1U6QA 5ETXA 3AP1A 1SVMA 5GVRA 4M9XA 2P59A 5FBIA 4PPFA 2C8ZB 3QKSB 1MKXK 2Z6VA 1G1MA 3EIEA 5GVSA 1JQJC 3MG9A 3FP6E 3SUFA 4NA8A 2H2ZA 1AVWA 2HRVA 3ZVBA 2B92A 3BG4C 2R6CA 3VKWA 1KYIA 2GCTB 4MRVA 3U3JA 1IXSB 4QOSA 3AAVA 1QIXB 3D62A 5DJ7A 2GBLC 3QKUA 4NBSA 3RRZA 4HUTA 3DFJA 1J14A 5GIBA 4JSTA 4RFSA 2IS2A 2BEKA 3ZZ9A 1WF3A 1NRSH 1A2KC 2J34A 3REGA 4MQAA 2Q6GA 4LHWA 5CM8B 1UVPA 1OFUX 3FE2A 4TYDA 1A5TA 2WAYA 4J2YB 4Q4JB 5FL7A 1S6FA 3D31A 1SGPE 2NO7A 3R7WB 4IDQA 2WJIA 1YZTA 1CLUA 3DM5A 3A6PC 3RXRA 3WYAA 1EX3A 1IAUA 3QPUA 5L3RA 4NYMQ 2H5EA 5HMAA 3CR7A 2UWLA 1A5IA 4KLNA 2AYWA 4FUGA 1AJEA 3QKRA 1TNDA 2HPPH 1EOJA 1TFXA 1GI5A 4RKJB 4X1QU 2RGNC 1UCYH 5AFZH 5FUVA 4Y8XA 3VNVA 4GL2A 3ZVAA 4M1TA 4QBFA 3EYDA 2ZTXA 1WA5A 1M7BA 4CRCA 4OQXA 1G9XA 1QVRA 2D7CA 5HKKD 3SFZA 4Q5IA 1SGCA 2ZA5A 1W13U 2QAAA 1UTOA 1F0SA 2OCYC 3UFAA 1CULC 2AS9A 3RXEA 2C4FH 4EJSC 5EODA 3QNUA 1IQNA 3FDIA 4LV8B 2BCJQ 4HLUA 3Q5EA 5CIQA 1GZSA 1VCMA 2AIQA 1ZMJA 2QA5A 1TQ2A 4C0KA 4BFSA 1O5DH 4IMQA 3GD7A 3U6KA 2BD5A 3VHXA 1W47A 3W5JA 2V55B 1CE5A 3CRQA 4K1SA 2XNIA 1SVIA 2OBLA 3QXHA 2MSDB 5C1BA 2VINA 1XXHE 4CEHB 1UEIA 2PFEA 1W8BH 1I2DA 3UK6A 1YPJH 1VCPA 1FQKA 4I1VA 2VH0A 2YYZA 1ZHMA 5JBCS 1BRBE 4A4DA 1T9HA 3V00A 3VPKA 1GBEA 2F91A 4RFVA 1UDXA 4YC7A 2BDCA 1QHRB 4TMTA 1MU6B 1YR9A 1S8FA 1ETUA 1RRGA 1E9EA 2V3CC 5C2JB 4QG7A 4D8NA 2EI8A 3M37A 4ARZB 4XBBA 1E9AA 3DPUA 2Q6FA 2FOCA 1ETTH 1GFIA 3AGQA 4ZDKA 1TMKA 2CCJA 1B0FA 2GCOA 5JBTA 3RM0H 1W36C 5F2EA 2G55A 1YBWA 2ZEJA 2TGAA 4FWIB 4D4MA 1UBEA 4P4SA 5G40A 4KODA 2A4GA 5LPNA 1D4PB 4A8JB 1WBDA 1FAKH 4US1R 1L4ZA 5DPAA 1AZTA 2GZ7A 3NG1A 4M1WA 3EA9A 1QBVH 4OI2A 4EQ6A 4UNSA 3IHWA 1A7JA 1OXGA 5B6LA 1G8PA 3SHCH 3IPXA 4D82A 4ZUHA 3UQVA 2JAQA 4V0MA 1AS3A 2H57A 1G3EA 1ZIPA 1MO6A 1WUNH 1ZTKA 1P3JA 4LV6A 4OS6A 3AK5A 1SL3A 1KJWA 2Z4RA 2XXAA 2FGJA 1N5LA 3QG1A 1GITA 4RZ3A 2JLRA 1O2MA 2NO6A 4AFQA 1TOCB 5GJWC 5LB2A 3OEED 1HAVB 5JBBS 3ZH9B 3K1JA 4G01B 3T26A 4HB2A 2Z9GA 4FMDB 1WXQA 4ABEA 1COWD 4KFTA 5EUMA 5EGMA 1XD9A 1AHTH 4FU8A 4Z54A 4P31A 3B6EA 1E3MA 1O2OA 4NWLA 2QAGC 3GLIB 3DT0H 2BHGA 2BVSH 1G37A 4DUGA 2EQBA 4LCBA 3VR1A 2BDGA 3MU4A 1IXZA 3T34A 1RYFA 2C99A 2Y5GA 1HE1C 2MSCB 1Q3XA 2IOTA 2ZJ2A 4UFFH 5L8VA 5TJXA 3HPRA 5F98A 4MQBA 2DFLA 4HB0A 2CF8H 3OAAA 5FTNA 4MKFA 4PO1A 2VSFA 1AO5A 3PITA 4LBVA 3H4MA 1G21E 5CK5A 3RM2H 1SHKA 5EXNA 2VP9A 1LTQA 2JATA 4C0AC 3ESTA 2ZFSA 3BTGE 2O8EB 1CR2A 1Q3TA 3PB1E 1FTSA 1A61H 4MYUA 1KZGB 1DVRA 2CN0H 2WSSA 2QUZA 1UTPA 1ZHPA 4PSKA 2ANYA 4LRWA 4YDSA 5A4JA 2D8WA 2WBLC 3U7HB 1P9UA 4WF8A 3SN8A 1R2QA 1SVPA 4ABBA 3LA6A 3OIVA 4AFUA 1XMIA 5TVKA 2C9CA 3HGPA 1UEJA 3M61U 3EZFA 1PFXC 2WKPA 1QHNA 1ANKA 1KY3A 5ESTE 2PTCE 1Z8GA 3TH2H 1KI9A 3W3ZB 2PWXA 4TSFA 1IQHA 2FX3A 1F5NA 2J7KA 1N1LA 2Y5FA 2M5TA 3VKHA 1ZD8A 3SHAH 1EXMA 2ZRPA 2O9QA 2W0SA 2XOKD 1O3PB 5J4YA 4AB9A 2A5JA 4Q9JA 1FN8A 3W6NA 4LJ8A 2ZVQX 1JBKA 1XCGB 5FXLA 4D26A 3NXSA 1NTPA 4AURA 3KKNA 4URXR 3AVTA 1ZOMA 2PZGA 3P4XA 4PROA 1BKDR 1Z6TA 5JB8S 2V9PA 2OBMA 3B2EA 5JSZB 1H1BA 1AKSB 1QBOA 2GNOA 4TQUS 2WSSD 3OIUA 1EAXA 1S0RA 2FOLA 5DYGA 5HZKA 1MH1A 4EQ6B 2ZPQA 1NMXA 1GWNA 4JVNA 2O8BA 3R8FA 1NN3A 2RGAA 1S85A 3W8RA 1XTQA 4DSTA 1IQMA 1BT7A 4X6NA 1GI9B 2OP9A 2JJ1D 2GZAA 4AK9A 2QXHA 4CEJA 1ELBA 4DB2A 3IGFA 4A2WA 3SU1A 1T5IA 3GEEA 4UE7H 2YOLA 1C1PA 4ZCIA 2OFOA 3CR8A 2HXSA 1K2I1 2BOVA 4M9QA 3J81k 1A0LA 4I99A 1LCYA 2ZYWX 1OLOA 2VIIA 5HZHA 4MUAA 2CJWB 2DFKB 4Q21A 1TLDA 2H7VA 3K0AB 3KKMA 3SUDA 4XOIA 5EE9A 3ATLA 3ZIAA 4QHSA 3PWBA 1X8KA 1YE8A 3GJ3A 5DE3A 2K1QA 4H1UA 2QORA 2ZE6A 2GCNA 4C0SA 2BQ7B 2W7UA 1XEWY 2RHDA 1G8GA 5FI1B 1ZD1A 1CA0B 4LGMA 2BDTA 3M1IA 1FAXA 3M5MA 1OXUA 1EB1H 1XRJA 3FFBA 1K1IA 5H70A 5FX5A 2H1UA 3P8FA 3BIFA 2PEZA 4LPSA 2WYGA 1SHYA 1C5QA 5LPFA 2EI7A 2QNRA 2ORIA 1KNXA 1PQ5A 3PMHB 3QSYA 1VCWA 3IIJA 2B5TB 4A15A 1DAKA 2FMXA 3DM9B 4B1TA 5FFMA 4ISIH 2QQ0A 1O2TA 1W0ZU 1HUTH 3A8DA 5E3HA 1ELDE 1S2MA 4DLUA 3TW8B 4V0NA 3AVVA 2Y6TA 2G4UA 1GIAA 1UCYE 1P0SH 3RS5A 2XCNA 4OKSA 3C14C 2QPOA 1SLWB 1FFHA 1WQ1R 4G5OA 4B3FX 3O47A 2IWHA 1NJGA 1NMZA 2ZE8A 1HAXB 5C4GB 1SBWA 2ZPTX 2JJ2D 1TQDA 4PSVA 3IBYA 2NMVA 5L2YH 2NWNA 1E2NA 3GY3A 1OHHA 3EIHA 1E35B 4M1MA 3MU8A 1MTSA 2FSFA 3F5FA 2OT3B 4EFMA 1DS2E 3WBKA 4YQFA 1QGFA 3GCTF 2FS9A 2AWOA 4NPHA 3RP2A 4IW4E 1OIVA 4FVDA 1XKAC 4BOHA 3CWQA 4JVMA 1DUEA 1DG3A 3BD9A 2IYTA 3SJAA 5KSYA 2CHQA 2FX4A 2V3HH 2NZ8A 3M0EA 4UNNA 3A8BA 2ZTSA 1B0UA 3ZS9A 5LPRA 1KI6A 4K1TA 4CREA 2EI6A 3D7MA 3RLWH 3MWKA 2ZFFH 3A8TA 1LPGB 1DWCH 4B43A 2LNCA 4L4UA 1O39A 1Z2AA 3CF2A 2ZQ1A 1Y59T 3VR5A 1GJBB 2FDAA 1ZD9A 1H8ED 1OFTA 5L3SA 1NIPA 1C5VA 4J0QA 4HZIA 4HLCA 3WHKA 4D25A 1Q3HA 4URWR 1GJCB 3U98H 2AXPA 1TRYA 1QY6A 3AP3A 1AD8H 4ARZA 1CU1A 1SXJC 1JI0A 5EP2A 1IHTH 5SZKB 3M7UA 3PQCA 3TH5A 2O0JA 3OFND 4NONA 3GICB 2AGIX 4I8GA 2ZHDA 1XEFA 1HAIH 1W44A 1NPMA 1EWRA 3EC2A 4JT4A 4W5JA 1G2MA 4W9MC 2O8MA 2J41A 4VGCB 4AFZA 1P2TA 2PKSC 1P01A 4TLBA 1U2RA 4NCKA 4QBGB 5BQ5A 2Q9CA 5EXPA 3LONA 4PFSA 3RXAA 4O25A 1KJZA 2ZJ8A 1L7VC 2LKCA 2XB4A 3VGCC 1F2UA 3SNCA 1UKYA 2YZ2A 3IBGA 4CHAB 1HCGA 4WVFA 1H8HD 3EPLA 1MO3A 3TVDA 1M9UA 4R2IA 4WJG2 2JLXA 2RGEA 3SI4H 3U69H 1NVUQ 4URZR 1KAOA 3WMEA 4DUGD 3GLFB 1AZZA 3LKWA 3K0AA 4HFPB 1AGPA 2O8UA 4LYHA 2VP4A 2DBYA 1YKTA 2OXCA 3IO5A 5KUTA 1C2GA 4G5RA 2IC5A 5FBRB 3SU4A 2W6ID 1O2QA 2HXYA 2OBQA 2A32A 5HE8A 1IY2A 1HE8B 4EKDA 4YOJA 2FJUA 4B47A 4FCTA 2DCUA 4DCUA 2PMDA 4XBDA 3U8RH 1BRAA 1XNJA 1IN7A 3SBDA 3GLGE 1XP8A 5IK2A 2ZHFH 2O8WA 2EFEB 5SGAE 1HYQA 5IT5A 2BLOA 1AUJA 2W2XA 3DOEA 2FOMB 1JALA 3LLUA 1TU3A 1JMOH 2P8OC 4AKIA 3RXIA 2VLIA 4PAOA 1XM1A 2EFGA 4DXAA 5FTLA 1V3XA 2BYAX 2G51A 3WY8A 2NU0E 1TNJA 1Z3IX 1CT0E 2ESTE 1WSSH 1XZQA 1GMDG 4YOGA 1E2IA 1G17A 2J5XA 1PJPA 3F68H 2GETA 5E7MA 2ZI5A 2BD2A 1T3LA 4GAWA 1X8LA 2A0QB 2ZI3A 1IQKA 1A0HB 1EPTC 3ATWA 1P9SA 5GCHF 1S0QA 4XVRA 3CRRA 2JJ8A 2BM0A 2EC9H 4PC3A 1C5UA 4YXWD 1GKUB 2IYRA 1MD7A 2VEDA 1O3YA 4ZKDA 2CCKA 3A7VA 3UY9A 1MOZA 2NO0A 2OILA 2C78A 3GYMA 4OI0A 1PQ7A 1UKEA 1F2TB 4CYMA 3C8UA 1CHOG 1I4LD 1XJ0A 2ZCLP 3BB4A 1MTNB 1XXHA 2JIZD 1ABJH 3SO3A 4IS5A 1DSTA 2J7PA 4OYHA 3M3TA 4ZMAH 7GCHF 2ZGXH 3I5XA 3U4QA 1N6IA 1YPEH 1TX8A 2I3BA 1YYY1 3B23B 1SKYE 4B6EA 3THYA 4TLCA 3PO1B 1EFRA 2KWIA 4Q1AA 3L3TA 4JBYA 1NP6A 2GCHG 3DUXH 3UREA 3P8NA 3OFNA 5C5NA 5FOXA 4TYPA 1MUEB 3N7OA 2VVVA 2CHVA 2R62A 2PW8H 3QLPH 1YPMH 4D9QA 3I4LA 1UTLM 1GBMA 4ASUA 1W0YH 1G30B 7GCHG 1LPZB 2J92A 4KI0A 1WTGH 3MH4A 3A7YA 3LIWA 3V12A 3U8OH 2NO9A 1G5RA 1HNEE 3M5OA 2HEIA 4C30A 4Y0YE 1EWQA 1O3GA 4FUHA 2OCVB 1AS0A 3K53A 4E5UA 1ZYOA 9ESTA 3RS7A 1HT2E 1DAFA 1PV4A 2D4HA 3QO6A 2ZS8A 3I62A 2N46A 3AVUA 4FXPA 4Q02A 2V6NA 4AG2A 5F03A 3VMFA 1KI7A 4X1RU 4Q7LA 3B9QA 1ZLRA 4Q80A 2WZQA 2WWYA 1QFKH 2BM2A 1LVOA 3O8RA 1EZSC 1VG0B 4KSCA 5E0JA 5FPTA 4X8TH 2G5VA 3VU9B 3AVZA 2XOKA 4TTRA 3ZZDA 3RS4A 4C7OA 1DBSA 4IFEA 1W49A 4U5XA 4C3ZA 4X6PA 2A4OA 1N8OC 3SUGA 3L0SA 1UVUH 2A1DB 4B2PA 3IO3A 5G41A 2JJ2A 1U94A 1TX4B 2ZYTX 2ANMH 1C1NA 3GP8A 1Y5AT 2JETC 1R5OA 1QG4A 2WPLS 1COWA 2QMUA 1VITG 4OS5A 2AGGX 1UHBA 5HXFA 4Z1MA 4BFUA 3T25A 3TIFA 4XIGS 1KLIH 3ZS8A 1V2RT 2A5DA 2QROA 2THFB 4THNH 4RY2A 4K69A 5KNBA 1K1NA 2Z83A 1GGDB 1XTRA 2PT5A 3LX8A 2PGQB 4TWZA 1VITH 2H16A 1TQ7B 2V6JA 2G83A 4PX9A 1GCTB 4ZHLU 2FPKA 4Z6AH 1QRZA 5DYIA 2V54A 3WMGA 3KUDA 2J95A 1VCQA 2BXUH 4HDOB 4LX0A 4ZPXA 4R71A 5KDDA 1GKYA 4NYIQ 2RH5A 4BRWA 1XUGA 3UNQA 3KKPA 2OBOA 1F2SE 4PR0A 4IC6A 3Q77A 1WV7H 2EWWA 2VH5R 4G0NA 3VR6A 2ZJZA 5F8TA 1BTPA 4MPWA 1OYWA 1RFLA 4TY6A 1UF9A 4QM6A 1HFDA 1UO6A 3KUCA 3HYRA 4JVSB 3CPHA 4QBHA 3LJOA 2VH6A 2QA9E 5TDHA 4KSBA 1HYLA 3BS4A 2D2DA 3E1XB 3S69A 3KXLA 2JLVA 2EFHB 1N6HA 2Y80A 3GLHB 3SI3H 4I1SA 2O8TA 3KCGH 1E9FA 5DI3A 3B1XA 1OYQA 3V9PA 2QIQA 2SNVA 2ZITA 1KDRA 1YPHC 4LHVA 1RXPA 1KSJA 4MPVA 1WMSA 1XXFA 4M9FA 4GSYA 3ZYEA 1Z6XA 1PYTC 4QM7A 4Y8YA 3FB4A 1U98A 1ODFA 4EJSA 1QURH 1LV7A 3KIDU 4KYUA 1P2OA 4Y0AA 5SZIA 2PJZA 1T32A 2CL0X 4H4FA 4PC7A 5FBQB 2ZRBA 1GI7B 4BFXA 3EGKH 1RJ9B 1OKKA 4QNRA 3R0FA 1MABA 5EQTA 3IPYA 2H6MA 3KQBA 1II9A 4ASHA 5BWMA 1ELTA 1MTVA 2BCGY 1XJCA 2JASA 1SOTA 2YOFA 7KMEH 1ZPBA 3CW2A 2F43A 1BCUH 3GJ6A 3GY5A 3QENA 3KL4A 2V4ZA 2WKQA 4QGGA 1HAPH 2J59A 2FWRA 4YTAA 3FKSD 4IOMA 4MH0R 4DDTA 1CJMA 1II8A 1AQYA 3N70A 1ELGA 4HB4A 2QZ4A 2E9SA 2ZECA 3EA7A 1R0YA 4BPBA 1P05A 1MU8B 3EW9A 3ATMA 1C2EA 1HY3A 1RYHA 4YMVA 2QC2A 1MV5A 2IS4A 2TIOA 1QHSA 2B7DH 1R7RA 4AYTA 5FBVB 1LS6A 2GBLA 1NN0A 1BTZA 3BAFA 4MRSA 4I8KA 2HVXA 3A37A 1K9OE 4NA9H 1PZNA 5KSOA 3BOSA 2W83A 2WWIA 1HUQA 4V0KA 3RXCA 2J0VA 3E1SA 2PLRA 4PHGA 3X1ZA 3MNCA 1G20E 4TPIZ 1O3KA 2TMKA 2YINC 3SU8A 1MZAA 2CLSA 1OWIA 3LX5A 4V0LA 2ZANA 1OH5A 1RC8A 4C2UA 3WYFA 1NKTA 3SNEA 1QCPA 1X1RA 2BY6X 5F9HA 1E0KA 1KI3A 4MVNA 3HU1A 4XJXA 4QRHA 4FI3C 1DVAH 3ADCA 1NFXA 2Z5FA 1YKSA 5JS7A 1OFIA 2HYIC 5HKKA 5JCZA 2ODQA 4TZ6A 1ZNWA 1G5PA 1P61B 1XPUA 2OK5A 1AZSC 1SI5H 1TPAE 2BDAA 1R8SA 3CF0A 1LHCH 1O34A 1OXTA 2FOEA 1NVXQ 4N3NA 2G1KA 5JI3E 1IN6A 1Z28A 1U8YA 4KVGA 4YDHB 1GBJA 2Z3EA 5A09A 2TGTA 3LPRA 2A7HA 1OP0A 5E0GA 3AH8A 3SQXA 2YWHA 1W0KA 1K22H 2G6BA 2JIZA 2IS1A 1NVVR 4Q48A 2GAAA 4RCYA 2EYQA 1K1MA 3T1OA 1F6BA 3OE7D 4WZBE 1HQCA 2NU4E 3E0PB 1LF0A 2VWNA 1ONBA 2GXQA 1FP6A 3ENSB 5GJ4B 4QNMA 2E87A 3X1WA 2QTVB 1SR5C 2X1VA 3SOPA 5JYIA 2RGBA 1A1VA 1BMAA 1HAOH 2ZRFA 1QB6A 1HTWA 3PENA 3RRNA 2QAJA 1OJLA 1J99A 4DJZB 1ESBA 1RJ9A 4BLTA 2FXRA 3CRVA 4KLZA 3RC4A 4TZ0A 1P2QA 2OESA 3RXTA 1LVMA 2D1JA 2ZJYA 1N6LA 2SFAA 1T6NA 2F6RA 4WMEA 5C1YA 1AK2A 1FMGA 3Q3KA 5GJCA 4ERNA 5JJKA 2ZKSA 4A1VA 1TU4A 1RFNA 1LMWB 1TNGA 2YV5A 1C5YB 3MYWA 2C95A 3W3AA 3BRWD 4JYBA 1Q31A 2GWHA 2IUSA 4XTRA 1N6NA 1R4AA 4B6FA 1IQPA 1AKYA 2BQWB 3EA0A 1A7SA 3CF6R 3FAOA 3URCA 1VGCB 2P8OB 1Q1BA 2C90B 3I8SA 1MABB 1TOMH 3SU2A 2Q0HA 1N2CE 5E95A 2F3RA 2FH5B 4H9GA 4I33A 3I3SR 1DLEA 4ZDJA 2ZM5A 3U7EB 6Q21A 1DUAA 2PL3A 4DLWA 2ODEA 3NKVA 1AU8A 3MWIU 1QB9A 5EXSA 2UUYA 3E8LA 2EFDB 3BTTE 1J7KA 5EW1H 2A5IA 1XMSA 2EW1A 4H42U 4TMWA 2Z7FE 4GMXA 1DFPA 1W11U 1NO9H 2H18A 3W6PA 3G0HA 3F3YA 4BAQB 1O2GH 1M7GA 1MT0A 1VCOA 5UKDA 1CHOF 2FX6A 2XC4A 1L1NA 5BPEA 4D4KA 1FXYA 1O3OA 1JAIA 2O8EA 1KDPA 3FTQA 1NROH 3GDSA 1LVGA 5GXPA 1D3QB 1SQ5A 5JPMH 4Q7KA 2BVNA 4CEIB 4O9VA 5FBLB 4C0HA 4AYYB 3U44A 4K2YA 1Q44A 1P2KA 3K65B 1C1OA 3SGQE 1J15A 1AM4D 3BTWE 3E0NB 4BECA 2AMPA 2QSYA 3RC3A 1EPTB 2EEKA 1RIWC 5JB9S 2CXVA 1MKWK 2EU8A 3IIMA 2XZOA 4A1FA 2NU2E 5A0CA 2J1LA 4NCYA 2AN9A 2PV9B 1KXAA 2C8VA 2BXTH 3TMKA 1O2WA 1D6RA 2VWLA 1NLYA 4MITA 2ZR0A 4K3JA 1BS1A 3T5GA 4YM9A 1ANBA 2CCGA 1GNQA 3IQWA 1HXEH 1MMJN 2X77A 1DEKA 2ZRAA 5BN5A 5B58C 3RSOA 4ZCLA 5HCIA 4DEXA 1XKBC 1C5TA 4PZLA 1TQ4A 1GKIA 4GRAA 3ZVEA 4UNPA 1G9IE 1VPLA 3QBVA 2DWOA 1O87A 5LBIA 2R6AA 1PUIA 2ONKA 3LT3A 3ZZCA 3CRMA 5L2ZH 3CX8A 3OEEA 3PLPA 4TTQA 1ZSLA 1P73A 5DO9A 2PHBA 3RC8A 5FL7D 1E2MA 1MZDA 3M35A 1KK2A 1RTLA 3KZ1E 4BZXA 2FTLE 2VP2A 3BIUH 4LHYA 3KQLA 1K21H 5FR1A 4EFNA 2J87A 2SGDE 4KYIB 4NSYA 3ICEA 2XZLA 2ZRHA 1KKLA 2CJIA 2FZ4A 3PV4A 4PZYA 1NY5A 2ZU6A 3TK1A 1BMMH 4LDJA 3SZRA 1Z83A 1SKYB 3VXEH 5TCCA 1Q1EA 3H7TA 5AVDA 2LKDA 3I8XA 4B2IA 4QFMA 2ZUDA 1P3EA 1ZPCA 1MR3F 3K0FB 2BLWA 3HKJB 1VR1H 2FZZA 2AD5A 2HCBA 3A4MA 3REFA 1RKBA 5EZ5A 2FIRH 5HM9A 2ZI6A 4MGIR 1O3FA 2HF8A 4FUIA 1UMAH 3M5LA 8LPRA 2LWIA 4JL6A 4X2WA 1UBFA 1SOZA 2W5EA 4DBLC 3OIWA 1R5NA 1W14U 1O2VA 1ID5H 1DARA 1BMLA 5DO4H 1TAWA 1C2FA 5T1VA 3AF4A 1KLTA 4LYAA 3KB1A 3ZVRA 1W10U 1A2CH 4N1AA 1E99A 1G16A 3HJNA 1TEXA 3Q3XA 2W2VA 2ATVA 1ANDA 1C2DA 4AFSA 2P0EA 3GY2A 1SGTA 4I32A 1O0DH 3RABA 1CR4A 2Z9KA 3MO9A 2VTKA 2BD9A 1PQAA 2PR3A 1LTOA 1NRNH 5GJBA 1OB2A 2FTMA 2PKAA 3F9GA 1F5LA 2WWGA 3A88A 4M1OA 1Z0JA 3GMTA 1SFIA 3BTHE 5K0HA 4NL4H 3GCHB 4AKHA 3KGPA 3BFXA 1W48A 3U3RA 4GPGA 121PA 4FUJA 4C4PA 2W0MA 1O3MA 1RJXB 1N6KA 1P9NA 2F9BH 2A5YB 2FGKA 5FL3A 5JWHA 1AY6H 3U44B 4P0TA 2X2FA 1QVAA 2BB4A 1UK3A 3D8BA 4KKDA 2A30A 5FR2A 2QL6A 2QT1A 1ZU5A 4Y0ZE 3V4RA 4RJLA 2G88A 1D3TB 3A1VA 1JB1A 4KAXA 3FMFA 2F9LA 3KXKA 1F2TA 4YLGA 2G1JA 1LNZA 2JH5D 4XTCS 1LFDB 3THXB 1DAEA 2CV3A 1P9RA 5EQRA 4CF7A 2G0NA 4TMKA 3ECCA 4GT1A 4OK5A 1P62B 3VFEA 4YMWA 2QGZA 2FWWA 3LBIA 1WCV1 1HJ9A 4A0RA 1O2JA 1FLEE 4Z51A 2W6JD 5CMXH 4RD3A 2ZU2A 3U5ZB 4LZZA 2J94A 3GFPA 3TR0A 4X8SH 4K60A 4MKIA 6GCHG 1OT3A 1CQQA 1P9WA 2ZRKA 2FPZA 3EASA 3ODFA 4U32A 3RXFA 1FZQA 3L0IB 2OQUA 1A2BA 2JDIA 1GHAF 3O8DA 2ZJAA 2VHQA 1G3MA 5AWFC 2QTHA 3KJEA 2ZU0C 8KME2 1VIYA 2QT0A 2ZFPH 4NSVA 4B74A 1CGIE 1O3EA 3E6PH 2ZJBA 1T7CA 2GJAA 4XSHA 4BXSA 6CHAB 1MQ6A 2YNBA 4IDOA 1JAHA 2REOA 3EPHA 2PJRA 2WVJA 2HWLB 3G01A 3RMMH 4WZAE 4EPRA 2BD4A 2VIDA 8OHMA 1D9IA 4DEYA 3A4LA 5FCKA 2G0TA 4IOKA 1XXDA 1CGJE 4X8LA 2BKUA 2ZQ2A 3BH6A 3SBKA 1P12E 5E2OA 2HJGA 2ZHEH 3LC3A 1GMHG 2I6QA 2GXUA 4LHZA 5FI0B 3U1IB 3A7ZA 4AGJA 3M3VA 3KQUA 1G4UR 2WAXA 4LOAA 5EE5B 1FI8A 4X6MA 1C9TA 4DC9A 3HYTA 5K8UA 1JJVA 3GCNA 3QE0A 4JLVA 2IYLD 4NG9H 4EDHA 3T62A 1FOEB 4GMDA 5JI2E 1WDTA 1X86B 4Q03A 5GNDA 4YT7H 4HAUA 3K70D 1W36D 2UUKB 1TGCA 2HT6A 3GEHA 3FPAA 4FW9A 3G82C 2O0KA 2AKAB 1TA2A 1TGTA 4HZHA 5IK2D 5JRJA 3WBJA 4PHFA 4DZZA 1O5GH 1GDQA 1KAGA 4A2PA 3ZV8A 1PVOA 1E2GA 3GEIA 4JLNA 1V2VT 3QK1A 2J4IA 4HEJA 3C41J 3MUFA 3PFIA 4MRNA 2NTYC 2W6IA 2VP0A 2GXSA 4UDWH 4HAXA 2BDHA 1BYUA 4DW2U 2QXJA 4Q9IA 4CRGA 1NVVQ 2FSHA 3DO6A 4Q47A 2WJGA 3MNXA 2HGTH 4AG1A 1AMHA 4IFBA 5AJWA 4U30A 1XD8A 4NYJQ 4JLPA 1FQJA 1E2LA 2BVRH 4DCDA 3GY6A 4LWZA 3SQHE 4X8VH 3AUXA 1WTHD 1H8IH 2ZFQH 2C04A 7LPRA 1Z29A 1XBTA 1TMUH 1WXRA 2OXRA 5HTKA 1CSOE 1AE8H 1N0WA 1E9DA 4Y7BA 3NHAA 1J8AA 2UWOA 2GZ9A 1E1RA 1P4SA 4W5HA 4M22A 3WRXC 1DANH 3DKPA 3TSOA 2BLVA 4Q1EA 3TUJC 1LW7A 3LH3A 4E03A 2F3TA 1UPTA 1SGFA 5E7JA 3K0CC 3K09C 2D7DA 1XMVA 1EP5A 4AIIA 1C1UH 1AVXA 1C2HA 1FY1A 1N6RA 1QRWA 1VHLA 5EJEA 2AXNA 1GHVH 4AY2A 1K1LA 2YJTD 3ZYCA 5EE3A 2IJOB 1PQ8A 3VGCB 4Z0KA 4JSYA 1MD8A 3BEUA 1ZM4A 4JLDA 1TMBH 5KO2A 2BOKA 5CB8A 2P6RA 4C0LA 1UBGA 1JIMA 3B78A 4HYYA 2ZAMA 4PANA 2H9TH 3T1TA 1V2JT 1SGYE 1BZXE 2F1IA 3AB3A 4G5QA 1AQ7A 2BHRA 3RHFA 1YLDA 4WVPE 1AFEH 3C1KA 3LGVA 4JZEH 1QJ7B 2XWBI 2OBNA 5JBAS 1FIZA 2BDIA 4AN7A 1CF4A 1GBKA 3TW4A 1Z1JA 2WTUA 3A82A 1Z6AA 4DLYA 3PXGA 1S81A 3F0TA 1TNKA 1T8UA 4WWYA 3VR2A 1TONA 1GL0E 4FN5A 1S1MA 1OP8A 1HAYB 2VB0A 3A7TA 1AUTC 1NY22 3K0FA 3T28A 4U00A 4KTCA 2ZREA 4IKEA 1C5SA
chains in the Genus database with same CATH superfamily
1LU9A 2J32A 2DBRA 3FNQA 4HRVA 3W2GA 8ABPA 2XKBA 1U8AA 2OLEA 5EP1A 2K5UA 4DM7A 3NBQA 5J2UB 1HT0A 3WGOA 3NWJA 5A02A 1OIXA 5AIBA 2PY6A 2A4QA 4UCQA 2QOEA 2J46A 3NHLA 1F0KA 3ZWDA 4CHGA 3JASA 1CRLA 2WIAA 4NECA 1JR6A 1J8MF 1GQSA 2ZS7A 3GV0A 3D5QA 3H99A 4BO3A 2A5AA 1TNLA 4YO8A 2OWEA 1C1HA 4D74A 5LDHA 3R5SA 1SN7A 4DN6A 5EJAA 4N3GA 2V5UA 2FUKA 2QU7A 3N8NA 3PGXA 4MJLA 4U7GA 4AJ2A 4B82A 4ABGA 2CUNA 2FP3A 3Q0IA 1QQAA 3M4XA 3MH6A 1ZR2A 3D0KA 3QYJA 1J9GA 1GUFA 3HEBA 4NABA 3FMPB 3PGVA 4ZVSA 3OPYA 4G5GA 2H8KA 5KNCD 4ESEA 5DJ5A 2VF5X 4J29A 1I3KA 5DEIA 4B7ZA 4KFRA 1O89A 3VH1A 3DHVA 1OWHA 2Q1JA 1LLFA 1CR1A 2I6GA 2WMDA 1LC3A 3NC1C 2C4VA 3H9GA 1XB2A 2EARA 4IXMA 4DLXA 1O3NA 1X7AC 3F6UH 3E4CA 5CP8A 1RGQA 1N2XA 2ZQ5A 3T29A 1EAWA 3R20A 1LVUA 4IDHA 1ECLA 3MPUA 5DN6A 3LUPA 4PHTA 3MMNA 4ENTA 2HR1A 3UN1A 2I87A 3MWJA 3L0OA 1SZCA 3AUAA 3PHHA 5HJ7A 1FRVA 2R0KA 1L5VA 2V59A 4BQQA 3T9AA 4TXJA 1EQUA 1UJ5A 3N5CA 3OECA 1IUOA 1VLVA 1BB0B 1HAZB 1RJDA 1WXFA 3W8EA 2ZT6A 2OO3A 3ZGVA 3UT0A 2B20A 5BOVA 1TJPB 3SI7A 4I8LA 5EG4A 4PSAA 4EY4A 1T8OA 1RT9A 3D2BA 4BX2A 3TD6A 1OH7A 4B3SB 5K7RA 5EIBC 3O3OB 3FMGA 2CJWA 4YN3A 1CZRA 1B1AA 5K3BA 5IHXA 2HPQH 5CHBA 5G4BA 4JODA 3DNFA 1RAIA 4QUHA 4W6QA 3RSFA 3O8CA 4BASA 4U63A 2NW6A 3VI3B 5TMPA 2FWBA 3HBJA 1WXIA 4EVQA 3S9BA 3GFOA 4ZANA 2CF6A 4NK5A 2XF8A 4OLAA 3GDVA 3IA7A 4BMNA 4NPAA 1L7QA 3DZIA 5EIWA 3TTVA 2G5TA 5D87A 3K4HA 2Q3LA 4ND8B 2EF0A 4IEIA 5FAHA 2YMSD 1XX9A 3U2QA 1D6NA 1SWVA 3SX0A 1ABBA 2FE1A 5KZMB 3FTFA 4LF4B 1SIBE 4AO6A 1NXPA 5GZ1A 4QGBA 3MLBA 2INGX 1SG9A 3IVGA 4LZ1H 3KZCA 4TRRA 1JQEA 2A7QA 2NQ2C 4MDHA 5BWOA 4PYKA 4RVOA 3LI2A 5HRCA 5FV7A 5KQMA 2ONYA 4DOQA 1E3WA 2IOFK 2JS7A 3OSZA 3OOJA 1M1NB 3BICA 5IM5A 4U7PB 1CA8B 4AX4A 5CLLA 3F9IA 3PEYA 4MUJA 3P27A 5EPUA 4MWEA 4WTOA 4HAIA 1MO5A 1VITF 1U0NA 1NM6A 2M6RA 3C7KA 4FYJA 2R79A 1PPZA 3D3JA 3WK4A 4BNYA 2Q9AA 3NCLA 3F1KA 4L6IA 3KDPA 2YX1A 2VO1A 2OP0A 3K2BA 1D1QA 1J8YF 1L1RA 3BG4B 1I30A 1NFQA 2QL9A 4Q9NA 5HFJA 4DW8A 4CTKA 1TYEB 1QP7A 4CUKA 4OH7A 1LH0A 5KTTA 2DWCA 2FR8C 1TEVA 4JLWA 3O9ZA 4FYYA 5PGMA 3VB6A 1KXDA 1H2EA 3L0DA 5HBGA 1GYPA 3JQFC 3I0ZA 3SC4A 4CQLA 3WC4A 3PV5A 4NZQA 1YB7A 1ZUNB 4MDSA 2C4UA 2G17A 1TPYA 3A0RB 3FHCB 3LQQA 4MV9A 4QDOA 2W71A