6LPRA

Structural basis for broad specificity in alpha-lytic protease mutants
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structural basis for broad specificity in alpha-lytic protease mutants.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 53
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1991-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 6lprA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 6lprA01
1DFPA 3F9FA 1TMTH 2ZHDA 1ZGIA 1YBWA 1W10U 1TPOA 2ZFFH 2F9OA 4DCDA 4BTIB 1TX8A 3BG4B 5FX5A 1OYQA 1VJAU 2RA0A 1ACBE 4Y76A 1XM1A 2G55A 2PV9B 1IHSH 1O3BA 1HJAC 1WTHD 4NA7A 4UFEH 5CE1A 4Y0ZE 2FOAA 1GMCG 2IJOB 1T4VH 1VGCB 1WQVH 1AO5A 4XBDA 1NU7B 1KXAA 4DG4A 3A8DA 2VH0A 5DO4H 1O37A 4GSOA 1ETTH 1GI2A 1GCTC 1KXCA 1LVBA 2H5DA 1XX9A 1BRCE 4DIIH 2V0BA 1L1JA 1KTSB 4Q2KA 1V2UT 1Y3UA 4JYVH 2EA3A 2TPIZ 3UOUA 1K22H 1QRXA 1EOJA 1L4DA 5EXLA 4ASHA 2XCNA 2BOKA 3AVZA 1BTPA 1J8AA 3MU5A 4B71A 1HFDA 2W3IA 1DLEA 2ODYB 2G8TA 5EQRA 4LXBH 1YPLH 1T8NA 1YPHC 2OC0A 1C2LA 1AVXA 2Y5FA 3LGYA 1ZRBA 1DWCH 1S85A 3UNRA 4ZMAH 5DG6A 4ABBA 3RU4T 2UWLA 1SC8U 3E6PH 3VB6A 4R8TB 4Q7XA 4OGXA 5F8XA 2R2MB 2BY9X 3SU6A 4YOJA 1TRYA 3KNXA 2BMGB 2OC1A 3HK6B 2Y81A 2CN0H 4DJZB 4CRDA 3JZ1B 4INKA 3SV8A 4ZXYH 4X2XA 2FLBH 4X2VA 3SHCH 1GJ9B 1HAIH 2Y80A 5JBTA 1B0EA 1Q31A 3ELAH 3PTNA 3E91A 1TNLA 9ESTA 2FX4A 2UUKB 2HNTE 5EG4A 4MNYA 1CA0B 4NG9H 3RXQA 2CJIA 1ELEE 1G2LA 3M5LA 2YOLA 3MO9A 3M5OA 1MCTA 3Q3KA 1O2XA 3GYLB 1U6QA 1AI8H 4RKOB 5JBAS 2OP9A 1G3DA 1TGBA 2QGRA 3U8OH 4LZ1H 1EUFA 3AW0A 1MUEB 4LOYH 1DXWA 3BTQE 2NU1E 2G5NA 2GT7A 3H5CB 4K1EA 3T27A 3ZV9A 2JETC 3A85A 3LONA 1UCYH 2NWNA 3PB1E 2CHAB 1W3CA 3GYMA 3HGPA 1C1SA 3T26A 1IOEA 1WQSA 2GGVB 3LJJA 3T2NA 2F91A 3FZZA 3SNAA 4MNWA 2ODPA 1Z7KA 1O36A 5JBCS 2BB4A 3RXDA 2PUXB 1W12U 2RA3A 1C2JA 4GPGA 4DGJA 2TGAA 1ZMLA 2F3CE 1OPHB 1OKXA 2ZQ2A 6CHAB 5J4QA 5DP8A 2CMYA 4X2WA 1O5AB 1L2EA 4H4FA 5A0CA 4ZXXH 1T8OA 2CXVA 2NU2E 1AQ7A 4AB9A 5T6FA 4K60A 1D4PB 2W7UA 1O3DA 3TJVA 2SNVA 4I7YH 1P2JA 3MNSA 2ZEBA 1KY9A 1EASA 4UEHH 5ESBA 1BBRE 2V3HH 1SGNE 1L1NA 1S0RA 1KTTB 3K6YA 2NU3E 3NWUA 2ZZUH 3BF6H 1SGPE 3RC6A 1QRWA 2QY0B 3STIA 1TA6A 2DE8A 1P05A 1A5HA 1ZHPA 2I6SA 2OQ5A 4I33A 1XUKA 1C1RA 3TLOA 2BDGA 2ULLA 3MNXA 3RXHA 4FU8A 2PGBB 1BMMH 1O5EH 1S81A 3Q00A 2VIPA 4E05H 3VB4A 1CT0E 3GCNA 5E0HA 1TGSZ 3VGCB 1T8MA 1EB1H 2B8OH 5EXMA 1SGCA 1F92A 3NUMA 3EYDA 2VGCB 4NIYA 2ZHEH 4FU7A 4THNH 2GDEH 4RN6A 4TPIZ 2ZO3H 1MTNC 1W14U 1EAWA 1KLJH 2GD4B 2G4TA 3U1JB 3QO6A 2C93B 2XBYA 2WPIS 2GCTB 9LPRA 1JBUH 1KIGH 1NN6A 6LPRA 1O2TA 4YLQH 2FWWA 4AYYB 1XKAC 1GVKB 3FANA 2GDDA 3KQCA 5C5NA 1EZQA 2ODQA 2NU0E 2PKAB 2GP9B 1V2NT 1CBWC 4JMYA 1UO6A 1WBGB 2ZCHP 1GJ7B 3RXEA 1UVOA 3S7HB 2QXHA 3SUGA 2ZPRA 2BLWA 3ZZAA 1GHZA 1LHGH 1EPTB 4O97A 3QUMP 5L2ZH 2AH4X 2O8TA 4A6LA 3VB7A 1LHCH 2HRVA 2BD2A 1PFXC 4INLA 1W0YH 1C4V2 3MFJA 4UONA 2LNCA 3MU8A 1AVWA 2G81E 4NFEA 1LDTT 1RJXB 1MKWH 3O8RA 4HI3A 3OTJE 1RTFB 1WU1A 4A7IB 4WMFA 6GCHF 1WTGH 1L1GA 3B9FH 3GCTF 1BJUA 4NZQA 1SQAA 3LGUA 3QWCH 2M5TA 5T6DA 1O2UA 5A0BA 5HMAA 5FCKA 5C1UA 5A0AE 1GG6B 1Z8RA 1NO9H 3TJNA 1BIOA 1XXFA 3ZVFA 1Q2WA 1C5MD 2I6QA 2ZHQH 3MNBA 4FUDA 1VR1H 2FM2A 5C5OA 3RXCA 2Y82A 4WF8A 2FEQH 2KAIB 2BOHB 3BG8A 1PYTD 4NSYA 2FPZA 1EAIA 3GDVA 4MLFB 1NC6A 1YF4A 1KXEA 2BDHA 1HUTH 4BAKB 1C2MA 2JKHA 4ZH8A 1FN8A 3UQVA 1UTKA 1O5DH 4U30A 1HJAB 3M36A 1FDPA 3I78A 3SU1A 2Y6TA 1J16A 2SGPE 3UQOA 1O2VA 3PMJA 1FV9A 1Y3XA 1V2WT 1SR5C 1NFYA 1XUHA 2UWPA 1SVPA 1AUTC 1XVMA 3F9HA 1O3KA 2BVRH 1W13U 1GCTB 4BNRA 3K6ZA 1LKBA 2AFQB 5TCCA 2ZQ1A 3Q3XA 4NCYA 4ABFA 1Z8IB 3QDZB 2FODA 2TIOA 3MMGA 2ZTZA 2FIRH 3UFAA 3NKKA 3TNSA 3OU0A 3SUFA 1NPMA 4FUJA 3UWIA 1DANH 1QBVH 1BMAA 1ANEA 1K1OA 2AERH 5C1XA 2PSYA 1WYKA 4NIWA 2LPRA 5B6OA 2OLGA 1IQIA 2WPJS 5EW2H 1QQUA 1BUIA 1CE5A 2CV3A 4FUIA 1ZLRA 1ABIH 3ZZ6A 3ATMA 1A2CH 6GCHG 2PWXA 4B74A 1S82A 1C9TA 2FI4E 2Z9LA 1YPMH 1EXFA 3GCTG 4Y71A 2XXLA 3MWIU 1SOZA 3E0NB 5TCAA 1O2NA 2RG3A 1G9IE 2D26C 4I8HA 4CRFA 1A0LA 3M3VA 2ZHWH 2SNWA 3SJ8A 1EJMA 1GJ5H 3UNQA 1DM4B 1ZMJA 3MH7A 2Z3DA 1ESAA 1PPCE 2ZGJA 1O2HA 1LCYA 3UY9A 1P9SA 3A7VA 1QA7A 3KCGH 2P8OC 1O5FH 1V2PT 1YKTA 2XC4A 1ELBA 2PSXA 2BVSH 1QB6A 2DE9A 5ESTE 1O3MA 3LOXA 3A87A 4ZROA 1ZOMA 2FTLE 1QCPA 3SZNA 3TK9A 3ZYEA 1BTYA 2C90B 4KTCA 1A3BH 1TMUH 3KL6A 3RXBA 4CR5A 2IPHA 1JIMA 4XBCA 2Y5GA 1ZTLA 3UOPA 1JOUB 1CSOE 4JK5A 3PV4A 4SGBE 1ANCA 3LU9B 3P8GA 1TGTA 2GKVE 4CH2B 1OXGA 2WPHS 7GCHG 5JB9S 1IHTH 1BTUA 1GBLA 1HGTH 1GBJA 2H2ZA 2WV4A 3BTDE 4A5TS 1C2GA 1YCPK 4CHAC 1QJ6B 1GHAF 1P3EA 1SGDE 1RTKA 2BY7X 2JETB 1IQFA 1ZJKA 1HAVA 3PLPA 3RXFA 1ID5H 1FY5A 3HKJB 1OOKB 1TE0A 3ZZBA 1UVPA 1DWBH 1AVGH 2O8UA 2H9EH 3EA7A 3QN7A 1LTOA 1F0RA 2SGDE 2C8YB 1GBIA 3RMNH 1E35B 1KLIH 2AYWA 2OTVA 1G32B 3ZZ5A 2GZ9A 1F5LA 4JZFH 2FOMB 1AFQB 4XDEA 4Y7AA 3E0PB 7ESTE 4TYDA 3PYHA 2VWLA 3GY4A 1P10A 4ISOA 3VEQB 3BTKE 5GXPA 3SO3A 1O2JA 1LQEA 3LC3A 1S83A 2R0LA 4E06H 3MU4A 2IN2A 3P6ZB 4YM9A 1XUGA 3T28A 4JK6A 1UHBB 1HIAA 3RU4E 1N6XA 1SOTA 3QGJA 4ISNA 1SGTA 3LT3A 4YT6H 4ZKSU 3UR9A 1O3NA 1GL1A 2R3UA 1YCPM 4E7NA 1GJBB 2Y7ZA 2FOFA 4FXGH 1ZPBA 1SL3A 2Q6DA 1FPHH 3MU1A 1QNJA 2VB0A 4WMEA 5E2OA 1GI1A 5FPSA 1KSNA 4ZHMU 2G51A 2FOGA 2IOTA 2D1JA 1VITF 1DDJA 1GDUA 1C5ZB 5EQSA 3ZZCA 1YPGH 1OS8A 4WH8A 1HXEH 1C1MA 2A45B 1HAXB 2P94A 1RGQA 1MD8A 3A81A 1FONA 1XKBC 2PGQB 3B23B 5DP9A 1K21H 4GUXA 1MTNB 3L33A 1O35A 1Y8TA 1GHAG 3SQHE 1W8BH 1PQ7A 2BYAX 2J9NA 4J1YA 1HAGE 1TQ0B 1LKAA 4IN1A 2STBE 5DGJA 2WINI 3ZZ4A 1IQHA 2Z7FE 2ZU3A 1EP5A 3LDXH 4X8TH 1FIZA 1MMJN 2ZDVH 1FXYA 5L2YH 1DXPA 1CT4E 2ANMH 4AORA 3TK6A 4K8YA 1TPPA 1P0SH 1MKXK 1O39A 1MTWA 1GJ6A 1NZQH 2F9UA 3SNEA 5H4IB 1BITA 5JDUB 1SB1H 4X0WU 3P95A 4UDWH 1SGYE 2XWBI 4NIVA 2AMPA 1Z8JB 3P92A 3KN2A 5E0JA 3TJOA 3ENSB 1DS2E 1O32A 2C8ZB 4TPYA 3TU7H 4ZKOU 2CGAA 2XWAA 3SW2B 2BD9A 3E1XB 2TBSA 5FBEA 2ZGCA 1NS3A 3SGAE 3RXLA 4GHQA 1SGRE 1S5SA 1Z6EA 4RSPA 1FI8A 3G01A 3TJUA 1LPZB 1CGIE 2PHBA 3U9AH 1ZSJA 5BRRE 1TGNA 3GY7A 3I77A 5GCHF 2H6MA 4XOJA 1Z8GA 2H9HA 3A86A 4X1PU 1VITG 3S9AA 3KQBA 4K3JA 4O03A 1MD7A 1YYY1 4B2CA 1MCVA 4DY7B 1ETSH 2ASUB 2ZU4A 4ABHA 4CRCA 1C2HA 2ZDNA 2XRCA 8KME2 1LHFH 2Z9KA 1O2WA 1FLEE 3A7WA 1CA8B 5ETXA 1FY4A 1NFUA 4MNXA 3NPSA 1K28D 3RXOA 1DOJA 1BTZA 4IBLH 1F2SE 1UVUH 3URDA 3KQDA 4OS6A 4Y11E 2FZZA 5JYIA 2AGGX 1O2OA 3EDXB 1MTSA 1ANBA 1TBQH 3S7KB 1BBRH 1RXPA 2ZTXA 5JPMH 3S9CA 3FP8E 1JMOH 2A4RA 4CRGA 3RMLH 2ZU1A 1GHXH 1ZHMA 2FTMA 5I25A 3IITA 3U8TH 1GBCA 5GJ4B 3RDZA 1P03A 2H1UA 3W94A 4HGCA 4K8BA 1O2GH 1TNJA 3E3TA 3BTEE 1TRMA 1O2YA 1AKSB 1TONA 3SV2H 1TX7A 3BEIB 3M7TA 5DKMA 1VCQA 1UK3A 2FOEA 1KYNA 2O8WA 1HYLA 3RMMH 2B9LA 3V7TA 4K1TA 2ZGHA 1A1RA 1O3CA 2CF9H 1O34A 3PM3A 2FOCA 2Q1JA 3K9XB 3ZVCA 1PQAA 2VVVA 1V2OT 3SORA 2VH6A 2P16A 2A32A 1EX3A 3TK5A 1BRBE 1P8VC 3MYWA 4ABEA 4Q7YA 8ESTE 3IG6B 4BOHA 2BLOA 5GCHG 1UTOA 1XUIA 3F9EA 1PPZA 3MH5A 3RMOH 1TALA 3GY2A 3GCOA 2TGPZ 3URCA 1AB9C 1A5IA 1FQ3A 1AWFH 3NZIA 1D6RA 3A8BA 1H1BA 2F9PA 3A7ZA 1BHXF 3L6PA 3RXMA 2BDCA 1XVOA 2ZG0H 1C5RA 3D23A 1GGDC 4KP0A 5E8EH 1P04A 4AN7A 2QC2A 1AN1E 2XW9A 2O9QA 2ZTYA 5T3HA 3BTWE 1CGJE 3NXPA 4X1QU 2A4GA 1O3IA 1Y5AT 3S69A 1GHYH 4O3TA 1RRKA 1SI5H 3RM0H 2GCHF 1SQOA 1HJ8A 1C5VA 4PROA 3EA9A 3M37A 5L6NH 1KLTA 5HM2A 1ELVA 1O2LA 1TB6H 1G3CA 3LGIA 2P95A 1P2KA 2ZKSA 1LMWB 5J4SA 1O2MA 1WV7H 1JIRA 1AU8A 4JZDH 4LK4A 1AZZA 1V2JT 2J94A 2P93A 3TITA 1T7CA 1SG8B 1QBOA 4ZUHA 1SHYA 1O2KA 1GI0A 1YPEH 1MU6B 1SSXA 1GI9B 1W7GH 1B5GH 4OS4A 3SU0A 1CO7E 1O33A 3ZVBA 1EZSC 2Z9JA 3LGVA 1C1WH 3OX7U 3ZVGA 1LVOA 2VIQA 1QQ4A 2ZFTA 3RXAA 4BAQB 2FS8A 2QV1A 4X1NU 4AGJA 1QFKH 5EW1H 3UIRA 1UTJA 2QAAA 4U32A 4I32A 1P2IA 4R0IA 3PO1C 1GCDA 2FOBA 5AFZH 2JH6D 1YM0A 1C5OH 3T5FH 1HJ9A 2ZIQH 1WSSH 4AX9H 2QF3A 2OBOA 3PLKA 1MAXA 2BX3A 4YT7H 2EC9H 1ELCA 1JRTA 3KF2A 1OP2A 4Z0KA 4B2BA 4BXSA 1G3BA 4OGYA 1C5WB 2BQ7B 2OBQA 4UFGH 1ZRKA 5LPEA 1CU1A 2OC8A 1FZZA 1HBTH 1THSH 5FX6A 3DD2H 1C5QA 1EJAA 1Z1JA 2A5IA 1HAPH 3V0XA 1GBFA 2O8LA 3EGKH 1Q3XA 3MOCA 2P3FH 3TNTA 5LGOA 3UTUH 1C5LH 1RTLA 5A8XA 1CT2E 2GZ8A 4B1TA 3A89A 4A1XA 2BD5A 1ZTKA 4F4OC 1E34B 1O3OA 4X6NA 5FXLA 3GOVB 4WY3A 3V3MA 3SU2A 4XSKU 1ESTA 3U98H 2H9TH 2GCHG 1BHXB 2ZFPH 3PTBA 2ALVA 5DP5A 2Z3EA 4MG3A 4FUEA 1Z1IA 1UTLM 3DT0H 1O5GH 5DP4A 1UCYK 3BG4C 1CQQA 4CBOA 4I8LA 1LPKB 3C27B 3ATKA 2BTCE 1OX1A 5HGGA 1PQ5A 1J9CH 4FUHA 2YNAA 4CH8B 1RIWB 5C2ZA 1YPJH 1UVSH 1JXPA 4Q7ZA 4F49A 4MDSA 1C1PA 1L0ZA 3NK8A 2OCVB 1EPTA 2H5CA 3RLWH 1A0JA 2GT8A 3ZZ7A 2TRMA 2OINA 1TYNA 2UWOA 2BDBA 2SGQE 4IS5A 1A0HB 3ATLA 1BRUP 4YZUA 1D6WA 4B73A 1P9UA 1NY22 1E37B 1BB0B 1D9IA 3BEUA 2VIOA 1V2RT 2O8MA 3HKIB 1C5XB 1GJ4H 3FAOA 5JBBS 2XTTB 2GV7A 3DA9B 3L3TA 2SGFE 1EATA 2P59A 4YLUA 5K7RA 1RD3B 1W0ZU 1DX5M 2PTNA 4ZKNU 2Z94A 1GHWH 4JZ1A 1IQKA 3PROA 4IN2A 1PJPA 1S0QA 5C1YA 1D3TB 3SJOA 1TNGA 3QZQA 3FZDA 5DPAA 7GCHF 1QURH 1O2RA 1NROH 2WPKS 3O8BA 3RXVA 4JYUH 4SGAE 4TY6A 4A92A 4BTTB 1Z71A 4K69A 3ATWA 3R0FA 2HLCA 3VB3A 3DHKH 1HNEE 2KAIA 1J17T 3SOSA 1DSUA 1A7SA 1H8DH 2GMTC 2VIWA 3ZZDA 1NFXA 5LPFA 1C5NH 1P3CA 1P2NA 4HZHA 3MH6A 1MZDA 2OC7A 4DT7B 2ZNKH 3TPIZ 2R2WU 4Q80A 4NWLA 1ANDA 2QCYA 1WUNH 3NCLA 3SNCA 1LQDB 2Y7XA 1NRPH 3PLBA 1T4UH 1V6DA 3SHAH 2PTCE 3RC5A 4M7GA 2VU8E 4BAMB 1THRH 4D8NA 3RXRA 2B5TB 3PMBB 1F0SA 1EB2A 3KHVA 1GPZA 1ZMNA 4BTUB 1GI4A 4ISLA 4KELA 4I8GA 1C2IA 1W11U 2ESTE 3M5NA 4D9QA 1AMHA 1EKBB 1TBZH 1OP8A 1GHVH 1TNHA 1O5CB 3B8JA 3BSQA 1LHEH 2XBVA 2ANWA 1N8OC 1TMBH 4XFQA 2TGTA 3T29A 3BTTE 2B7DH 3UWJH 1MKWK 1GDNA 3SUDA 1V2LT 4CBNA 4GHTA 1AIXH 4WMDA 4FUFA 1YLDA 1YPKH 2PUQH 2XBXA 2QXJA 2ZDLA 3GCHC 5A09A 2G00A 2BLVA 3LH3A 1C1QA 2W7SA 4BAOB 1DT2A 2VVCA 5JB8S 1ZPZA 2BD4A 4XE4A 3ESTA 4D7GA 4ZAEA 4FVBA 2BQWB 4WH6A 1TBRH 3D62A 1YGCH 1GBHA 1P11E 2ZDKA 2FO9A 5F6MA 4NWKA 1HCGA 1AGJA 1F0UA 3RXTA 5CMXH 3T25A 1Y3VA 1OP0A 1K1JA 2YNBA 3RLYH 4RKJB 3S9BA 1FY8E 1QR3E 3TH4H 1NRNH 5F03A 4ABIA 1AB9B 1IQNA 3JZ2B 3IWMA 1MTUA 1OSSA 4Y8YA 3MO3A 1VJ9U 4DVAU 1SFQB 4B76A 1EQ9A 1QJ1B 2ZP0H 3DUXH 1F7ZA 1Y5UT 5BPEA 5HXFA 1XMNB 3KQEA 2VNTA 1W2KH 1MBMA 3U1IB 2F9NA 4IGDA 1ELGA 1TLDA 1OWJA 3O8DA 1GBDA 1SGFA 1SLXB 2VGCC 1GL0E 1C5UA 2Z6BD 5FAHA 1GBKA 3GDSA 1K1LA 1QA0A 2ZCLP 4D9RA 3HGNA 3OY6U 1QL8A 3RUOA 2C3SA 3U8RH 1EAXA 5LH8A 1OWKA 2HALA 5C20A 1G30B 1A4WH 3LH1A 4IW4E 2BY6X 4NA9H 4ABAA 3N7OA 3LGTA 1QIXB 1G37A 4AFZA 1LHDH 5FPTA 3BTGE 4JCNA 2C8XB 1B0FA 3QTOH 2VWMA 2STAE 3FP6E 1EZXC 1ELTA 3SI3H 2RCEA 1V2MT 3SJKA 1ZGVA 2P3UB 4U2WA 2G5VA 1UTQA 1P09A 4Z6AH 5PTPA 1V2ST 1E36B 3ZVDA 3ODDA 1ZSLA 2EI7A 1MQ6A 3RXSA 3QZRA 1ETRH 1W7XH 2WPLS 2A7JA 3PO1B 1C2FA 1FAKH 3P8FA 5IYTA 3M7UA 3O8CA 2UUFB 2XNIA 1BCUH 1TRNA 1UMAH 1AY6H 2G52A 2UUYA 1A61H 3PMAB 1NFWA 3HPTB 3F1SB 2P3TB 1CBWB 4KGAA 1HAYB 3RXIA 1TX6A 2QIQA 1C1TA 3QX5H 1GI8B 2FYQA 5EQQA 1KDQA 8LPRA 1O3AA 1WAYB 1FPCH 5CHAC 1ZJDA 1THPB 4FVDA 1GHBF 5ABWA 2BY5X 1CHOF 5E0GA 3ATIA 3LPRA 1MU8B 3FVFB 1GG6C 2EI8A 3F9GA 2F83A 3A80A 2W3KA 1M9UA 5TJXA 4Y0YE 3OYPA 2PKSC 1JWTA 1C5TA 1QL9A 1KXDA 1EAUA 3MI4A 1ZHRA 2SGAA 1ORFA 1G3EA 1BMNH 3Q76A 5A8ZA 1UK2A 1BTXA 3QLPH 2HNTC 2V3OH 1A3EH 4GCHF 4NFFA 4H6TA 2XCFA 4AGKA 4IC5A 2QA9E 3SBKA 2PW8H 1FN6A 1Y59T 4FUBA 4ZKRU 4J2YB 1BJVA 3I29A 4UE7H 3LJOA 3SI4H 2BZ6H 5FCRA 3P8OA 1SGEE 1BT7A 1O0DH 2W26A 5EODA 2ZCKP 1C2EA 2ZECA 2FDAA 3H7TA 1TOMH 1PPHE 4LZ4B 1P2MA 3M61U 3K65B 4BXWA 1C5SA 3SGQE 2OUAA 1O3PB 1UK4A 2F9BH 2UUJB 2JH5D 3M35A 3M7QA 4B2AA 1E0FD 4HTCH 1H9LB 1GI6A 2A5AA 3GY6A 2ZU2A 3E16B 2FI5E 5C3NA 3H7OA 1X7AC 1PPFE 2ZI2H 3MO6A 2AGIX 2AIQA 1FIWA 4JYTA 4WVPE 3SUEA 2K1QA 1O2QA 3RXUA 1IQGA 3CS0A 4I31A 3EQ0H 3MTYA 4Y7BA 1O2ZA 2GX4A 4ABDA 1GHBG 4YTAA 1CHOG 2QXGA 1DSTA 2BD7A 2BD3A 1G36A 1T31A 4K5ZA 4IC6A 1SLVB 2Z9GA 5C67A 4MTBA 1V2VT 2DUCA 1BZXE 3A82A 1FJSA 7LPRA 1O2IA 2A4OA 4NIXA 4DIHH 3ITIA 4CRBA 3EA8A 2ALPA 1SBWA 2GMTB 1O5BB 4CR9A 1SLUB 1C4Y2 1EZUC 2ZU5A 2ZDMA 1NT1A 3SJ9A 2BHGA 1YLCA 1AFEH 1TWXB 3BTFE 4IMQA 1PPEE 1HLTH 4AFUA 1WCZA 2ANYA 1DWDH 2AEIH 1S6HA 4YOGA 1OWEA 1LVMA 2VWNA 2BDIA 5G4BA 1CHGA 4GCHG 4VGCC 2WPMS 3TGIE 1IAUA 4NSVA 1TAWA 1AE8H 3FP7E 4MPXA 2WV5A 4WXVA 5T6GA 1J15A 2R3YA 1AHTH 1SHHB 1BTWA 2FS9A 2R0KA 2QYIA 2BQ6B 2AGEX 3PWCA 1K1PA 2W5EA 1FAXA 3VXEH 1YPHE 2FMJA 4D76A 2EEKA 1BTHH 2HVXA 3M5MA 4WXIA 3SQEE 2P8OB 5L30H 1RFNA 1K9OE 2G4UA 1AKSA 2ANKH 2WYGA 3LGWA 1ZZZA 2BLQA 4OS7A 1N8OB 5FBIA 4BAHB 5E2PA 1DPOA 2D8WA 2TGDA 3VXFH 4TY7A 1T8LA 3OSYA 2XYAA 4X1SU 5EGMA 4A1VA 3EE0B 1EJNA 1FNIA 3ZV8A 3GCHB 3UREA 1BA8B 1DWEH 1AFQC 3VPKA 3KIDU 2Y5HA 1QL7A 1GVZA 3SGBE 1YC0A 2AMQA 4MPUA 3BTME 1H9HE 5FHTA 4CHAB 1MTVA 4UD9H 1ARCA 2BDAA 5F8ZA 4H42U 2ZF0H 1TPSA 1E38B 3SV7A 3RXJA 3EAJA 2FESH 5LPRA 1ZYOA 4WWYA 2BM2A 1A46H 3CS7A 4AOQA 2VIVA 4AG1A 3ZVEA 1VCWA 1FUJA 4UFDH 1HAOH 3TH2H 2F9VA 5FPYA 1UTPA 5EPNA 5I46H 5GWZA 1GI7B 2ZFSA 1GJCB 4ZHLU 1RS0A 1K1NA 3CENA 1OWHA 1QTFA 1Z6JH 3KEEA 5GPIB 1SGIB 7KMEH 3BIUH 1C1OA 1Y3YA 2NU4E 3QTVH 1LPGB 3ZVAA 1C4U2 3BEFB 1DY8A 1TIOA 2D2DA 2OQUA 1QJ7B 1TGCA 1HDTH 4AFQA 1V2KT 2ZGBH 1BBRK 4ABGA 5DP3A 2HNTF 1TNIA 2ZWLH 4OS2A 1ELFA 4ESTE 1O3LA 1IQEA 1DITH 3VB5A 3GDUA 4NGAH 2ZC9H 3P8NA 3ZZ3A 1UCYE 3GY3A 1V2QT 2VJ1A 1P01A 1SGQE 1P57B 2FLRH 2WUCA 2FOHA 3D49H 1P2QA 4TWYA 1HXFH 1O3FA 1F5RA 2WYJA 1UVTH 4X8SH 1NM6A 2V6NA 5EXNA 1NU9A 2ZFRH 3AAVA 1DICA 4K2YA 4Y10E 1DY9A 1XXDA 4O3UA 3MNCA 4FUCA 3A88A 4OS1A 5HYOA 3BN9A 1CGHA 3P17H 1TFXA 1O2PA 2XC0A 2Q6FA 1PPBH 1J14A 2WUBA 4MPWA 1FY1A 1WOFA 1VZQH 1O30A 3KGPA 3RXGA 4CRAA 3ZYDA 4WJG2 2A7CA 3TGJE 1QGFA 2PKAA 1IQLA 3Q3YA 1GI3A 3R3GB 3OY5U 4AYVB 1ELAA 2ILNA 1TABE 5A2MH 3RXPA 5AVDA 1GJ8B 1P12E 1VGCC 2BY8X 4MPVA 1QHRB 3UPEA 1TOCB 3SU3A 5DK1A 2BDYA 1QB1A 3E90B 2HOBA 1C9PA 3UNSA 3P70B 3SV6A 2QF0A 1ESBA 1NRQH 4KTSA 4XBBA 3SNBA 5AF9H 5CHAB 1D3QB 3V13A 1KXBA 3TGKE 4Y6DA 4FUGA 2BXUH 3HK3B 1GWAA 3PWBA 1YCPH 1GJDB 2C8WB 3A8AA 1LO6A 3BV9B 2BX4A 3SV9A 1HV7A 1HAHH 2FI3E 1PPGE 3CP7A 4UFFH 1VITH 1N1LA 1BQYA 4QT8C 1GBEA 2Z3CA 3E8LA 2BZAA 4AFSA 3C1KA 1AWHB 4D7FA 2PKSB 3GY8A 3T62A 4AZ2B 3Q77A 3U69H 2GTBA 2ZGXH 3HATH 2FYRA 3DFLA 3GICB 1ELDE 5F8TA 2ZDAH 1QRZA 2ZHFH 2A31A 1K2I1 4INHA 2QXIA 4BANB 3SU5A 1T32A 1C2DA 4MNVA 1UJ1A 2V35A 1AZ8A 2VWOA 1PYTC 5GDSH 1INCA 3MH4A 4H6SB 3K2UA 4B75A 1D3DB 1AE5A 3ODFA 5DP7A 1O3HA 1DVAH 1LVYA 2HGTH 1S84A 5DJ7A 1NRSH 2J38A 3M3TA 4GVUA 4JZEH 1H4WA 2A7HA 3RXKA 2BD8A 3FFGA 3AW1A 3F68H 4AG2A 1ZPCA 1CVWH 1C1VH 1FY3A 1CA0C 4X8VH 1JRSA 1GDQA 3LC5A 4X2YA 4X6PA 1O38A 3V12A 1HB0B 4AB8A 1OYTH 4KTUA 3A8CA 1GJAB 1TNKA 5A8YA 2GV6A 4Y8ZA 1O3EA 4A1TA 1P06A 3GY5A 1HAZB 1F0TA 1P2OA 3LKWA 3RP2A 2A4QA 2GZ7A 4KKDA 2OXSA 8GCHF 1MBQA 1BOQA 3RU4D 1UTNA 1SQTA 3AAUA 2JH0D 1C1NA 1GBAA 2AMDA 2CHAC 3WY8A 1K1MA 3STJA 1IQJA 1OWDA 1GVLA 2Q6GA 1C2KA 3QK1A 1D3PB 3BIVH 1O3JA 4NA8A 1KXFA 3ZZ9A 1IQMA 1GMDF 3UR6A 1HAVB 2VIDA 2A1DB 2VINA 2A0QB 3A7TA 4X6MA 2BXTH 2OD3B 4Y8XA 1C5YB 1S6FA 6CHAC 4YESB 1V2TT 1P02A 5DP6A 1DUAA 1C5PA 3UUZA 3RC4A 1GBMA 1MKXH 5AHGH 5SGAE 1AD8H 2XC5A 5GIBA 4VGCB 4K1SA 1SGFG 1L4ZA 3W95A 2HPQH 3F6UH 1PQ8A 4O9VA 4FU9A 4MVNA 3TIUA 2SGEE 2RDLA 4E7RG 2VVUA 3BTHE 2J34A 2GVFA 3AASA 2PLXA 1BRAA 2HPPH 5K0HA 1ARBA 4YO9A 1NESE 3DFJA 3QGNB 3A84A 1VCPA 1Y3WA 3TH3H 1QBNA 2BVXH 3PMHB 1B7XB 1BDAA 1QY6A 1HIAB 2A5KA 4GAWA 5AFYH 2ZFQH 1MH0A 1ZR0A 1EP6A 1MZAA 4ZHAA 1GMHF 1GGDB 1MQ5A 1O31A 4X1RU 3MU0A 3A7YA 5EPYA 1SLWB 3VGCC 2AS9A 2FX6A 1DE7H 4NZLA 2B0FA 3A7XA 3SN8A 3TVJB 2HWLB 4X8UH 1GI5A 1YP9A 3GISB 6ESTA 4ISHH 3A83A 4JZIA 1V3XA 1SPJA 2R9PA 2J2UA 2GCTC 1DUEA 2A2XH 2FP7B 3RM2H 8GCHG 1HPGA 1ZSKA 4OS5A 2PFEA 1XUFA 3SU4A 4X6OA 3S0NA 1OWIA 5HM9A 4DOQA 4DW2U 2THFB 1Y5BT 1GMCF 4I8KA 1AUJA 4ISIH 4GLYA 1H9IE 3LIWA 1DLKB 2CF8H 2C4FH 3SNDA 1GMDG 1F5KU 1HRTH 3VFEA 2ZPSA 2XBWA 2EI6A 3D65E 4YOIA 4MQAA 5EU8A 2A2QH 4HFPB 1EOLA 1H8IH 1EPTC 1NRRH 1ABJH 2Z9IA 4CREA 4Y79A 4U01A 1SMFE 2J4IA 1KDQB 2FXRA 1QB9A 2PR3A 3ZZ8A 1XUJA 1UHBA 1TA2A 1G2MA 2ZA5A 4ABJA 1SFIA 1N6YA 4I8JA 1A5GH 1GBBA 3MHWU 2ZPQA 1MAYA 1TQ7B 4IMZA 2J95A 4DURA 1GBTA 1TPAE 5EOKA 2QN5T 3M3SA 5IDKA 1O2SA 1RIWC 2J92A 1FMGA 1ZTJA 2AIPA 4TWWA 1C1UH 1O3GA 2SFAA 1UTMA 1BMLA 1GMHG 3SJIA 1K1IA 1NTPA
chains in the Genus database with same CATH superfamily
1DFPA 3F9FA 1TMTH 2ZHDA 1ZGIA 1YBWA 2EY4C 1W10U 3SYJA 2KX4A 1TPOA 2ZFFH 2F9OA 4DCDA 4BTIB 1TX8A 3BG4B 5FX5A 1OYQA 1VJAU 2KCYA 2RA0A 1ACBE 4Y76A 1XM1A 2RFKC 5KECA 2G55A 2PV9B 4B6FA 1IHSH 1O3BA 1HJAC 1WTHD 4NA7A 4UFEH 5CE1A 4Y0ZE 2FOAA 1GMCG 2IJOB 1T4VH 1VGCB 1WQVH 1AO5A 4XBDA 1NU7B 1KXAA 4DG4A 3A8DA 2VH0A 5DO4H 1O37A 4GSOA 1ETTH 1GI2A 1GCTC 1KXCA 1LVBA 2H5DA 2V3MA 1XX9A 1BRCE 4DIIH 2V0BA 1L1JA 1KTSB 4Q2KA 1V2UT 1Y3UA 4JYVH 3N99A 2EA3A 2TPIZ 3UOUA 1K22H 1QRXA 1EOJA 1L4DA 5EXLA 4ASHA 2XCNA 2BOKA 3AVZA 1BTPA 1J8AA 3MU5A 4B71A 1HFDA 2W3IA 1DLEA 2ODYB 2G8TA 3FO8D 5EQRA 4LXBH 1YPLH 1T8NA 1YPHC 2OC0A 1C2LA 1AVXA 2Y5FA 3LGYA 1ZRBA 1DWCH 1S85A 3UNRA 4ZMAH 5DG6A 4ABBA 3RU4T 2UWLA 1SC8U 3E6PH 3VB6A 4R8TB 4Q7XA 4OGXA 5F8XA 3ZIAD 2R2MB 2BY9X 3SU6A 4YOJA 1TRYA 3KNXA 2BMGB 2OC1A 3HK6B 2Y81A 2CN0H 4DJZB 4CRDA 3JZ1B 4INKA 3SV8A 4ZXYH 4X2XA 2FLBH 4X2VA 3SHCH 1GJ9B 1HAIH 2Y80A 4ACAA 5JBTA 1B0EA 1Q31A 3ELAH 3PTNA 3E91A 3F2FA 1TNLA 9ESTA 2FX4A 2UUKB 2HNTE 5EG4A 4MNYA 1CA0B 4NG9H 3RXQA 2CJIA 1ELEE 1G2LA 3M5LA 2YOLA 3MO9A 2JJ1D 3M5OA 1MCTA 3Q3KA 1O2XA 3GYLB 1U6QA 1AI8H 4RKOB 5JBAS 2OP9A 1G3DA 1TGBA 2QGRA 3U8OH 4LZ1H 1EUFA 3AW0A 1MUEB 4LOYH 1DXWA 3BTQE 2NU1E 2G5NA 2GT7A 3H5CB 4K1EA 1NBMD 3T27A 3ZV9A 2JETC 3A85A 3LONA 1UCYH 3OE7D 2NWNA 3PB1E 2CHAB 1W3CA 3GYMA 3HGPA 1C1SA 2PP6A 3T26A 1IOEA 1WQSA 2GGVB 3LJJA 3T2NA 2F91A 3FZZA 3SNAA 2XOKD 4MNWA 2ODPA 1Z7KA 1O36A 5JBCS 2BB4A 3RXDA 2PUXB 1W12U 2RA3A 1C2JA 4GPGA 4DGJA 2TGAA 1ZMLA 2F3CE 1OPHB 1OKXA 2ZQ2A 6CHAB 5J4QA 5DP8A 2CMYA 4X2WA 1O5AB 1L2EA 3N7DA 4H4FA 5A0CA 4ZXXH 1T8OA 2CXVA 2NU2E 1AQ7A 4AB9A 5T6FA 4K60A 1D4PB 2W7UA 1O3DA 3TJVA 2SNVA 4I7YH 5FL7D 1P2JA 3MNSA 2ZEBA 1KY9A 1EASA 4UEHH 5ESBA 1BBRE 2V3HH 1SGNE 1L1NA 1S0RA 1KTTB 3K6YA 2NU3E 3NWUA 2ZZUH 3BF6H 1SGPE 3OEHD 3RC6A 1QRWA 2QY0B 1W0JD 3STIA 5IK2D 1TA6A 2DE8A 1WXRA 1P05A 1A5HA 3F0PA 1ZHPA 2I6SA 2OQ5A 5EIYA 4I33A 2L74A 1XUKA 1C1RA 3TLOA 2BDGA 2EQNA 2ULLA 3MNXA 3RXHA 4FU8A 2PGBB 1BMMH 1O5EH 1S81A 3Q00A 2VIPA 4E05H 3VB4A 1CT0E 3GCNA 5E0HA 1TGSZ 3VGCB 1T8MA 1EB1H 2B8OH 5EXMA 1SGCA 1F92A 3NUMA 3EYDA 2VGCB 4NIYA 2ZHEH 4FU7A 2F43B 4THNH 2GDEH 4RN6A 4TPIZ 2ZO3H 1MTNC 1W14U 1EAWA 1KLJH 2GD4B 2G4TA 3U1JB 3QO6A 2C93B 2XBYA 2WPIS 2GCTB 9LPRA 1JBUH 1KIGH 1NN6A 6LPRA 1O2TA 1QZ8A 4YLQH 2FWWA 4AYYB 1XKAC 1GVKB 3FANA 2GDDA 3KQCA 2CK3D 5C5NA 1EZQA 2ODQA 2NU0E 2PKAB 2GP9B 1V2NT 1CBWC 4JMYA 1UO6A 1WBGB 2ZCHP 3OFND 3OTPA 1GJ7B 3RXEA 1UVOA 3S7HB 2QXHA 3DSGA 3SUGA 2ZPRA 2BLWA 3ZZAA 1GHZA 1LHGH 1EPTB 4O97A 3QUMP 5L2ZH 2AH4X 2O8TA 4A6LA 2YMSB 3VB7A 1LHCH 2HRVA 2BD2A 1PFXC 4INLA 1W0YH 1C4V2 3MFJA 4UONA 2LNCA 3MU8A 1AVWA 2G81E 1EFRD 3EE7A 4NFEA 1LDTT 1RJXB 1MKWH 3O8RA 4HI3A 3OTJE 1RTFB 1WU1A 4A7IB 4WMFA 6GCHF 1WTGH 1L1GA 3B9FH 3GCTF 1BJUA 4NZQA 1SQAA 3LGUA 3QWCH 2M5TA 5T6DA 1O2UA 5A0BA 5HMAA 5FCKA 5C1UA 5A0AE 1GG6B 1Z8RA 1NO9H 3UB0A 3TJNA 1BIOA 1XXFA 3ZVFA 1Q2WA 1C5MD 2I6QA 2ZHQH 3MNBA 4FUDA 1VR1H 2FM2A 5C5OA 3RXCA 2Y82A 4WF8A 2FEQH 2KAIB 2BOHB 3BG8A 1PYTD 4NSYA 2FPZA 1EAIA 3GDVA 4MLFB 1NC6A 1YF4A 1KXEA 2BDHA 1HUTH 4BAKB 1C2MA 2JKHA 4ZH8A 1FN8A 3UQVA 1UTKA 1O5DH 4U30A 1HJAB 3M36A 1FDPA 3I78A 3H09A 3SU1A 2Y6TA 1J16A 3F0OA 2SGPE 3UQOA 1O2VA 3PMJA 1FV9A 1Y3XA 1V2WT 1SR5C 1NFYA 1XUHA 2UWPA 1SVPA 1AUTC 1XVMA 3F9HA 1O3KA 2BVRH 1W13U 1GCTB 4BNRA 3K6ZA 1LKBA 2AFQB 5TCCA 2ZQ1A 3Q3XA 4NCYA 4ABFA 1Z8IB 3QDZB 2FODA 2TIOA 3MMGA 2ZTZA 2FIRH 3UFAA 3NKKA 3TNSA 3OU0A 2W6JD 3N7EA 3SUFA 1NPMA 4FUJA 3UWIA 1DANH 1QBVH 1BMAA 1ANEA 1K1OA 2AERH 3PV2A 2PSYA 5C1XA 1WYKA 4NIWA 2LPRA 5B6OA 2OLGA 1IQIA 2WPJS 5EW2H 1QQUA 1BUIA 1CE5A 2CV3A 4FUIA 1ZLRA 1ABIH 3ZZ6A 3ATMA 1A2CH 6GCHG 2PWXA 4B74A 1S82A 1C9TA 1YLNA 2FI4E 2Z9LA 1YPMH 1EXFA 3GCTG 4Y71A 2XXLA 3MWIU 1SOZA 3E0NB 5TCAA 1O2NA 2RG3A 1G9IE 2D26C 4I8HA 4CRFA 1A0LA 3M3VA 2ZHWH 2SNWA 3SJ8A 1EJMA 2LP6A 1GJ5H 3UNQA 1DM4B 1ZMJA 3MH7A 2Z3DA 1ESAA 1PPCE 2ZGJA 1O2HA 1LCYA 3UY9A 1P9SA 3A7VA 1QA7A 3KCGH 2P8OC 1O5FH 1V2PT 1YKTA 2XC4A 1ELBA 2PSXA 2BVSH 1QB6A 2DE9A 5ESTE 3KQ5A 1O3MA 3LOXA 3A87A 4ZROA 1ZOMA 2FTLE 1QCPA 3SZNA 3TK9A 3ZYEA 1BTYA 2C90B 4KTCA 1A3BH 1TMUH 3KL6A 3RXBA 4CR5A 2IPHA 1JIMA 4XBCA 2Y5GA 1ZTLA 3UOPA 1JOUB 1CSOE 4JK5A 3PV4A 4SGBE 1ANCA 3LU9B 3P8GA 1TGTA 2GKVE 4CH2B 1OXGA 2WPHS 7GCHG 5JB9S 1IHTH 1BTUA 1GBLA 1HGTH 1GBJA 2H2ZA 2WV4A 3BTDE 4A5TS 1C2GA 1YCPK 4CHAC 1QJ6B 1GHAF 1P3EA 1SGDE 1RTKA 2BY7X 2JETB 1IQFA 1ZJKA 1HAVA 4Z1MD 3PLPA 3RXFA 1ID5H 1FY5A 3HKJB 1OOKB 1TE0A 3ZZBA 1UVPA 1DWBH 1AVGH 2O8UA 2H9EH 3EA7A 3QN7A 1LTOA 1F0RA 2SGDE 2C8YB 1GBIA 3RMNH 1E35B 1KLIH 2AYWA 4TT3D 2J97A 2OTVA 1G32B 3ZZ5A 2GZ9A 1F5LA 4JZFH 2FOMB 1AFQB 4XDEA 4Y7AA 3E0PB 7ESTE 4TYDA 3PYHA 2VWLA 3GY4A 1P10A 4ISOA 3VEQB 3BTKE 5GXPA 3SO3A 1O2JA 1LQEA 3LC3A 1S83A 2R0LA 4E06H 3MU4A 2IN2A 3P6ZB 4YM9A 1XUGA 3KYFA 3T28A 4JK6A 1UHBB 1HIAA 3RU4E 1N6XA 1SOTA 3QGJA 4ISNA 1SGTA 3LT3A 4YT6H 4ZKSU 3UR9A 1O3NA 1GL1A 2R3UA 1YCPM 4E7NA 1GJBB 2Y7ZA 2FOFA 3OEED 4FXGH 5B6LA 1ZPBA 1SL3A 2Q6DA 1FPHH 3MU1A 1QNJA 2VB0A 4WMEA 5E2OA 1GI1A 5FPSA 1KSNA 4ZHMU 2G51A 2FOGA 2IOTA 2D1JA 1VITF 1DDJA 1GDUA 1C5ZB 5EQSA 3ZZCA 1YPGH 3VG8A 1OS8A 4WH8A 1HXEH 1C1MA 2A45B 1HAXB 2P94A 1RGQA 1MD8A 3A81A 1FONA 1XKBC 2PGQB 3B23B 5DP9A 1K21H 4GUXA 1MTNB 3L33A 1O35A 1Y8TA 1GHAG 3SQHE 1W8BH 5C17A 1PQ7A 2BYAX 2J9NA 4J1YA 1HAGE 3FN8A 1TQ0B 3DCLA 1LKAA 4IN1A 2STBE 5DGJA 2WINI 3ZZ4A 1IQHA 2Z7FE 2ZU3A 1EP5A 3LDXH 4X8TH 1FIZA 1MMJN 2ZDVH 1FXYA 5L2YH 1DXPA 1CT4E 2ANMH 4AORA 3TK6A 4K8YA 1TPPA 1P0SH 1MKXK 1O39A 1MTWA 1GJ6A 1NZQH 2F9UA 5CDFE 3SNEA 5H4IB 1BITA 5JDUB 1SB1H 4X0WU 3P95A 4UDWH 1SGYE 2XWBI 2JJ2D 4NIVA 5T1VA 2AMPA 1Z8JB 3P92A 3KN2A 5E0JA 3TJOA 3ENSB 1DS2E 1O32A 2C8ZB 2WHXA 4TPYA 3TU7H 4ZKOU 2CGAA 2XWAA 3SW2B 2BD9A 3E1XB 2TBSA 5FBEA 2ZGCA 1NS3A 3SGAE 3RXLA 5C94A 5HKKD 4GHQA 1SGRE 1S5SA 1Z6EA 4RSPA 1FI8A 3G01A 2KCOA 3TJUA 1LPZB 3KYGA 1CGIE 2PHBA 3U9AH 1ZSJA 5BRRE 1TGNA 3GY7A 3I77A 5GCHF 2H6MA 4XOJA 1Z8GA 2H9HA 3A86A 3W1EA 4X1PU 1VITG 3S9AA 3KQBA 4K3JA 4O03A 1MD7A 1YYY1 5DSFA 4B2CA 1MCVA 4DY7B 1ETSH 2ASUB 2ZU4A 4ABHA 4CRCA 1C2HA 3FOAA 2ZDNA 2XRCA 8KME2 1LHFH 2Z9KA 1O2WA 1FLEE 3A7WA 1CA8B 5ETXA 1FY4A 1NFUA 4MNXA 3NPSA 1K28D 3RXOA 1DOJA 1BTZA 4RT1A 4IBLH 1F2SE 1UVUH 3URDA 3KQDA 4OS6A 4Y11E 2FZZA 5JYIA 2AGGX 2K0QA 1O2OA 3EDXB 1MTSA 1ANBA 1TBQH 3S7KB 1BBRH 1RXPA 2ZTXA 5JPMH 3S9CA 3FP8E 1JMOH 2A4RA 1KMHB 4CRGA 3RMLH 2ZU1A 1GHXH 1ZHMA 2FTMA 5I25A 3IITA 3U8TH 1GBCA 5GJ4B 1YY3A 3RDZA 1P03A 2H1UA 3W94A 4HGCA 4K8BA 1O2GH 2V7QD 3DSOA 1TNJA 3E3TA 3BTEE 1TRMA 1O2YA 1AKSB 1TONA 3SV2H 1TX7A 3BEIB 2IJD1 3M7TA 5DKMA 1VCQA 1UK3A 2FOEA 3CNRA 1KYNA 2O8WA 1HYLA 3RMMH 2B9LA 3V7TA 5EJZA 4K1TA 2ZGHA 1A1RA 1O3CA 2CF9H 1O34A 4I86A 3PM3A 2FOCA 2Q1JA 3K9XB 3ZVCA 1PQAA 2VVVA 1V2OT 3SORA 2VH6A 2P16A 2A32A 1EX3A 3TK5A 1BRBE 1P8VC 3MYWA 4ABEA 4Q7YA 8ESTE 5GNDA 3IG6B 4BOHA 2BLOA 5GCHG 1UTOA 5F53A 1XUIA 3F9EA 1PPZA 3MH5A 3RMOH 1TALA 3GY2A 3GCOA 2TGPZ 3URCA 1AB9C 1A5IA 1FQ3A 2J98A 1AWFH 3NZIA 1D6RA 3A8BA 1H1BA 2F9PA 3A7ZA 1BHXF 3L6PA 5HIYA 3RXMA 2BDCA 1XVOA 2ZG0H 1C5RA 2M2AA 3D23A 1GGDC 4KP0A 5E8EH 1P04A 4AN7A 2QC2A 1AN1E 2XW9A 2O9QA 2ZTYA 5T3HA 3BTWE 1CGJE 3NXPA 4X1QU 2A4GA 1O3IA 1Y5AT 1COWD 3S69A 1GHYH 4O3TA 1RRKA 1SI5H 3RM0H 2GCHF 1SQOA 1HJ8A 1C5VA 4PROA 3EA9A 3M37A 5L6NH 1KLTA 5HM2A 1ELVA 1O2LA 1TB6H 1G3CA 3LGIA 2P95A 1P2KA 2ZKSA 1LMWB 5J4SA 1O2MA 1WV7H 5C0UA 1JIRA 2KR7A 1AU8A 4JZDH 4LK4A 1AZZA 1V2JT 2J94A 2P93A 3TITA 1T7CA 1SG8B 1QBOA 4ZUHA 1SHYA 1O2KA 1GI0A 1YPEH 1MU6B 1SSXA 1GI9B 1W7GH 1B5GH 4OS4A 3SU0A 1CO7E 1O33A 3ZVBA 1EZSC 2Z9JA 3LGVA 1C1WH 3OX7U 3ZVGA 1LVOA 2VIQA 1QQ4A 2ZFTA 3RXAA 4BAQB 2FS8A 2QV1A 4X1NU 4AGJA 1QFKH 5EW1H 3UIRA 4F48B 1UTJA 2QAAA 5C0TA 4U32A 4I32A 1P2IA 4R0IA 3PO1C 2AHME 1GCDA 2FOBA 5AFZH 2JH6D 1YM0A 1C5OH 3T5FH 1HJ9A 2ZIQH 1WSSH 4AX9H 2QF3A 2OBOA 3PLKA 1MAXA 2GJGA 2BX3A 4YT7H 2EC9H 2JIZD 1ELCA 1JRTA 3AK5A 2HLDD 3KF2A 1OP2A 4Z0KA 4B2BA 4BXSA 1G3BA 4OGYA 1C5WB 2BQ7B 2OBQA 4UFGH 1ZRKA 5LPEA 1CU1A 2OC8A 4ASUD 1FZZA 1HBTH 1THSH 5FX6A 3DD2H 1C5QA 1EJAA 3GS9A 1Z1JA 2A5IA 1HAPH 3V0XA 1GBFA 2O8LA 3EGKH 1Q3XA 3MOCA 2P3FH 4M9FA 3TNTA 3UTUH 5LGOA 1C5LH 1RTLA 5A8XA 1CT2E 2GZ8A 4B1TA 3A89A 4A1XA 2BD5A 1ZTKA 4F4OC 1E34B 1O3OA 4X6NA 5FXLA 3GOVB 4WY3A 5CHBA 3V3MA 3SU2A 4XSKU 1ESTA 3U98H 2H9TH 2GCHG 1BHXB 2ZFPH 3PTBA 2ALVA 5DP5A 4YXWD 2Z3EA 4MG3A 4FUEA 1Z1IA 1UTLM 3DT0H 1O5GH 5DP4A 1UCYK 3BG4C 1CQQA 4CBOA 4I8LA 1LPKB 3C27B 1FX0B 3ATKA 2BTCE 1OX1A 5HGGA 1PQ5A 1J9CH 1S6LA 4FUHA 2YNAA 4CH8B 1RIWB 5C2ZA 5EJ1A 1MABB 1YPJH 1UVSH 1JXPA 4Q7ZA 3MQKC 4F49A 4MDSA 1C1PA 1L0ZA 3NK8A 2OCVB 1EPTA 2H5CA 3RLWH 1A0JA 2GT8A 3ZZ7A 2TRMA 2OINA 1TYNA 2UWOA 2BDBA 2SGQE 4IS5A 1A0HB 3ATLA 1BRUP 1SKYE 4YZUA 1D6WA 4B73A 1P9UA 1NY22 1E37B 1BB0B 1D9IA 3BEUA 2VIOA 1V2RT 2O8MA 3HKIB 1C5XB 1GJ4H 3FAOA 5JBBS 2XTTB 2GV7A 3DA9B 3L3TA 2SGFE 1EATA 2P59A 4YLUA 5K7RA 1RD3B 1W0ZU 1DX5M 2PTNA 4ZKNU 2Z94A 1GHWH 4JZ1A 1IQKA 3PROA 4IN2A 1PJPA 1S0QA 5C1YA 1D3TB 3SJOA 1TNGA 3QZQA 3FZDA 5DPAA 7GCHF 1QURH 1O2RA 1NROH 1WDIA 2WPKS 3O8BA 3RXVA 3PV5A 4JYUH 4SGAE 4TY6A 4A92A 4BTTB 1Z71A 4K69A 3ATWA 3R0FA 2HLCA 3VB3A 3DHKH 1HNEE 2KAIA 1J17T 3SOSA 1DSUA 1A7SA 1H8DH 2GMTC 2RDEA 2VIWA 3ZZDA 1NFXA 5LPFA 1C5NH 1P3CA 1P2NA 4HZHA 3MH6A 1MZDA 2OC7A 4DT7B 2F4LA 2ZNKH 3TPIZ 2R2WU 4Q80A 4NWLA 1ANDA 2QCYA 1WUNH 3WW7A 3NCLA 3SNCA 1LQDB 2Y7XA 1NRPH 3PLBA 1T4UH 1V6DA 3SHAH 2PTCE 3RC5A 4M7GA 2VU8E 4BAMB 1THRH 2WZQA 4D8NA 3RXRA 2B5TB 3PMBB 1F0SA 1EB2A 3KHVA 1GPZA 1ZMNA 3OAAD 4BTUB 1GI4A 4ISLA 4KELA 4I8GA 1C2IA 1W11U 2ESTE 3M5NA 4D9QA 1AMHA 1EKBB 1TBZH 1OP8A 1GHVH 1TNHA 1O5CB 3B8JA 3BSQA 1LHEH 2XBVA 3F2HA 2ANWA 1N8OC 1TMBH 4XFQA 2TGTA 3T29A 3BTTE 2B7DH 3UWJH 1MKWK 5KGOA 1GDNA 3SUDA 1V2LT 4CBNA 4GHTA 1AIXH 4WMDA 4FUFA 1YLDA 1YPKH 2PUQH 2XBXA 2QXJA 2ZDLA 3GCHC 5A09A 2G00A 3PRBA 2BLVA 3LH3A 2JDID 1C1QA 2W7SA 4BAOB 1DT2A 2VVCA 5JB8S 1ZPZA 2BD4A 3NRLA 4XE4A 3ESTA 4D7GA 4ZAEA 4FVBA 2BQWB 4WH6A 1TBRH 3D62A 1YGCH 1GBHA 1P11E 2ZDKA 2FO9A 5DN6D 5F6MA 4NWKA 1HCGA 1AGJA 1F0UA 3RXTA 5CMXH 1H8HD 3T25A 1Y3VA 1OP0A 1K1JA 2YNBA 3RLYH 4RKJB 3S9BA 1FY8E 1QR3E 3TH4H 2VBCA 1BMFD 1NRNH 5F03A 4ABIA 1AB9B 1IQNA 3JZ2B 3IWMA 1MTUA 1OSSA 4Y8YA 3MO3A 1VJ9U 4DVAU 1SFQB 3SZEA 4B76A 1EQ9A 1QJ1B 2ZP0H 3DUXH 1F7ZA 1Y5UT 5BPEA 5HXFA 1XMNB 3KQEA 2VNTA 1W2KH 1MBMA 3U1IB 2F9NA 4IGDA 1ELGA 1TLDA 1OWJA 3O8DA 1E1RD 1GBDA 1SGFA 1SLXB 2VGCC 1GL0E 1C5UA 2Z6BD 5FAHA 1GBKA 3GDSA 1K1LA 1QA0A 2ZCLP 4D9RA 3HGNA 3OY6U 1QL8A 3RUOA 2C3SA 3U8RH 1EAXA 2K8IA 5LH8A 1OWKA 2HALA 5C20A 1G30B 2WSSD 4OM9A 1A4WH 3LH1A 4IW4E 2BY6X 4NA9H 1OHHD 4ABAA 3N7OA 3LGTA 1QIXB 1G37A 4AFZA 1LHDH 5FPTA 3BTGE 4JCNA 2C8XB 1B0FA 3QTOH 2VWMA 2STAE 3FP6E 1EZXC 1ELTA 3SI3H 2RCEA 1V2MT 3SJKA 1ZGVA 2P3UB 4U2WA 2G5VA 1UTQA 1P09A 4Z6AH 5PTPA 1V2ST 1E36B 3ZVDA 3ODDA 1ZSLA 2EI7A 1MQ6A 3RXSA 3QZRA 1ETRH 1W7XH 2WPLS 2A7JA 3PO1B 1C2FA 1FAKH 3P8FA 5IYTA 3M7UA 3O8CA 2UUFB 2XNIA 1BCUH 1TRNA 1UMAH 1AY6H 2G52A 2UUYA 1A61H 3PMAB 1UW7A 1NFWA 3HPTB 3F1SB 2P3TB 1CBWB 4KGAA 1HAYB 3RXIA 1TX6A 2QIQA 1C1TA 3QX5H 1GI8B 2FYQA 5EQQA 1KDQA 8LPRA 1O3AA 1WAYB 1FPCH 5CHAC 1ZJDA 1THPB 4FVDA 1GHBF 5ABWA 2BY5X 1CHOF 2KM0A 3ATIA 5E0GA 3LPRA 1MU8B 3FVFB 1GG6C 2EI8A 3F9GA 2F83A 3A80A 2W3KA 1M9UA 5TJXA 4Y0YE 3OYPA 2PKSC 1JWTA 1C5TA 1QL9A 1KXDA 1EAUA 3MI4A 4RT0A 1ZHRA 2SGAA 1ORFA 1G3EA 1BMNH 3Q76A 5A8ZA 1UK2A 1BTXA 4FOUC 2HNTC 3QLPH 2V3OH 1A3EH 4GCHF 4NFFA 4H6TA 2XCFA 4AGKA 4IC5A 2QA9E 3SBKA 2PW8H 1FN6A 1Y59T 4FUBA 4ZKRU 4J2YB 1BJVA 3I29A 4UE7H 3LJOA 3SI4H 2BZ6H 5FCRA 3P8OA 1SGEE 1BT7A 4B6EA 1O0DH 2W26A 5EODA 2ZCKP 1YWUA 1C2EA 2ZECA 2FDAA 3H7TA 1TOMH 1PPHE 4LZ4B 1P2MA 3M61U 3K65B 4BXWA 1C5SA 3SGQE 2OUAA 2KFWA 1O3PB 1UK4A 2F9BH 2UUJB 2JH5D 3M35A 3M7QA 4B2AA 1E0FD 4HTCH 1H9LB 1E1QD 1GI6A 2A5AA 3GY6A 2ZU2A 3E16B 2FI5E 5C3NA 3H7OA 1X7AC 1PPFE 2ZI2H 3MO6A 2AGIX 2AIQA 1FIWA 2L6OA 4JYTA 4WVPE 3SUEA 2K1QA 1O2QA 4HG6A 3RXUA 1IQGA 3CS0A 4I31A 3EQ0H 3MTYA 4Y7BA 1O2ZA 2GX4A 4ABDA 1GHBG 4YTAA 1CHOG 2QXGA 1DSTA 2BD7A 2BD3A 1G36A 1T31A 4K5ZA 4IC6A 1SLVB 2Z9GA 5C67A 4MTBA 1V2VT 2DUCA 1BZXE 3A82A 1FJSA 7LPRA 1O2IA 2A4OA 4NIXA 4DIHH 2W6ID 3ITIA 4CRBA 3EA8A 2ALPA 1SBWA 2GMTB 1O5BB 4CR9A 1SLUB 1C4Y2 1EZUC 2ZU5A 2ZDMA 1NT1A 3SJ9A 2BHGA 1YLCA 1AFEH 1TWXB 3BTFE 4IMQA 1PPEE 1HLTH 2KCAA 4AFUA 1WCZA 2ANYA 1DWDH 2AEIH 1S6HA 4YOGA 1OWEA 1LVMA 2J98B 2VWNA 2BDIA 5G4BA 1CHGA 4GCHG 4VGCC 2WPMS 3TGIE 1IAUA 4NSVA 1TAWA 1AE8H 3FP7E 2QF4A 4MPXA 2WV5A 4WXVA 5T6GA 1J15A 2R3YA 4XRNA 1AHTH 1SHHB 1BTWA 2FS9A 2R0KA 2QYIA 2BQ6B 2AGEX 3PWCA 1K1PA 2W5EA 1FAXA 3VXEH 1YPHE 2FMJA 4D76A 2EEKA 1BTHH 2HVXA 3M5MA 4WXIA 3SQEE 2P8OB 5L30H 1RFNA 1K9OE 2G4UA 1AKSA 2ANKH 2WYGA 3LGWA 1ZZZA 2BLQA 4OS7A 1N8OB 5FBIA 4BAHB 5E2PA 1DPOA 2D8WA 2TGDA 3WWFA 3VXFH 4TY7A 1T8LA 3OSYA 2XYAA 4X1SU 5EGMA 4A1VA 3EE0B 1EJNA 1FNIA 3ZV8A 3GCHB 4ACBA 3UREA 1BA8B 1DWEH 3U28C 1AFQC 3VPKA 3KIDU 2Y5HA 1QL7A 1GVZA 3SGBE 1YC0A 2AMQA 4MPUA 3BTME 1H9HE 5FHTA 4CHAB 1MTVA 4UD9H 1ARCA 3DSPA 2BDAA 5F8ZA 4H42U 2ZF0H 1TPSA 1E38B 3SV7A 3RXJA 3EAJA 2FESH 5LPRA 1ZYOA 4WWYA 2BM2A 1A46H 3CS7A 4AOQA 2VIVA 4AG1A 4ZCNA 4P02A 3ZVEA 2QE7D 1VCWA 1FUJA 4UFDH 1HAOH 3TH2H 2F9VA 5FPYA 1UTPA 5EPNA 5I46H 5GWZA 1GI7B 2ZFSA 1GJCB 4ZHLU 1RS0A 1K1NA 3CENA 1OWHA 1QTFA 1Z6JH 3KEEA 5GPIB 1SGIB 7KMEH 3BIUH 1C1OA 1Y3YA 2NU4E 3QTVH 1LPGB 3ZVAA 1C4U2 3BEFB 1DY8A 1TIOA 2D2DA 2XNDD 2OQUA 1QJ7B 1TGCA 1HDTH 4AFQA 1V2KT 2ZGBH 1BBRK 4ABGA 5DP3A 2HNTF 1TNIA 2ZWLH 4OS2A 1ELFA 4ESTE 1O3LA 1IQEA 1DITH 4F55A 3VB5A 3GDUA 1NBME 4NGAH 2ZC9H 3P8NA 3ZZ3A 1UCYE 3GY3A 1V2QT 2VJ1A 1P01A 1SGQE 1P57B 2FLRH 2WUCA 5EJLA 2FOHA 3D49H 1P2QA 4TWYA 1HXFH 1O3FA 1F5RA 2WYJA 1UVTH 4X8SH 1NM6A 2V6NA 5EXNA 1NU9A 2ZFRH 3AAVA 1DICA 4K2YA 4Y10E 1DY9A 1XXDA 4O3UA 3MNCA 4FUCA 3A88A 4OS1A 5HYOA 3BN9A 1CGHA 3P17H 2QF5A 1TFXA 5KEDA 1O2PA 2XC0A 2Q6FA 1PPBH 1J14A 2WUBA 4MPWA 1FY1A 1WOFA 1VZQH 1O30A 3KGPA 3RXGA 4CRAA 3ZYDA 4WJG2 2A7CA 3TGJE 1QGFA 2PKAA 1IQLA 3Q3YA 1GI3A 3R3GB 3OY5U 4AYVB 1ELAA 2ILNA 1TABE 5A2MH 3RXPA 5AVDA 1GJ8B 1P12E 1VGCC 2BY8X 4MPVA 1QHRB 3UPEA 1TOCB 3SU3A 5DK1A 2BDYA 1QB1A 3E90B 2HOBA 1C9PA 3UNSA 3P70B 3SV6A 2QF0A 1ESBA 1NRQH 4KTSA 4XBBA 3SNBA 5AF9H 5CHAB 1D3QB 3V13A 1KXBA 1E79D 3TGKE 4Y6DA 4FUGA 2BXUH 3HK3B 1GWAA 3PWBA 1YCPH 1GJDB 2C8WB 3A8AA 1LO6A 3BV9B 2BX4A 3SV9A 1HV7A 1HAHH 2FI3E 1PPGE 3CP7A 4UFFH 1VITH 1N1LA 1BQYA 4QT8C 1GBEA 1H8ED 2Z3CA 3E8LA 2BZAA 4TSFD 4AFSA 1VKYA 1AWHB 3C1KA 3FKSD 4D7FA 2PKSB 3GY8A 3T62A 4AZ2B 3Q77A 2HVYB 3U69H 2GTBA 2ZGXH 3HATH 2FYRA 3DFLA 3GICB 1ELDE 5F8TA 2ZDAH 4DT4A 2IPQX 1QRZA 2ZHFH 4RI0A 2A31A 1K2I1 4INHA 2QXIA 2WV9A 4BANB 3SU5A 1T32A 1C2DA 4MNVA 1UJ1A 2V35A 1AZ8A 2VWOA 1PYTC 5GDSH 1INCA 2LELA 3MH4A 4H6SB 3K2UA 4B75A 1D3DB 1AE5A 3ODFA 5DP7A 1O3HA 1DVAH 1LVYA 2HGTH 3F3BA 1S84A 5DJ7A 1NRSH 2J38A 3M3TA 4GVUA 4JZEH 1H4WA 2J5UA 2A7HA 3RXKA 2BD8A 3FFGA 3AW1A 3F68H 4AG2A 1ZPCA 1CVWH 1C1VH 1FY3A 1CA0C 4X8VH 1SQRA 5HIZA 1K0HA 1JRSA 1GDQA 3LC5A 4X2YA 4X6PA 1O38A 3V12A 1HB0B 4AB8A 1OYTH 4KTUA 3A8CA 1GJAB 1TNKA 5A8YA 2GV6A 4Y8ZA 1O3EA 4A1TA 1P06A 3GY5A 1HAZB 4AC9A 1F0TA 1P2OA 3LKWA 3RP2A 2A4QA 2GZ7A 4KKDA 2OXSA 8GCHF 1MBQA 1BOQA 3RU4D 1UTNA 1SQTA 3AAUA 2JH0D 1C1NA 1GBAA 2AMDA 2CHAC 3WY8A 1K1MA 3STJA 1IQJA 1OWDA 1GVLA 2Q6GA 1C2KA 3QK1A 1D3PB 3BIVH 1O3JA 4NA8A 1KXFA 3ZZ9A 1IQMA 1GMDF 3UR6A 2KCPA 3PRDA 1HAVB 2VIDA 2A1DB 4P00A 2VINA 2A0QB 3A7TA 4X6MA 2BXTH 2OD3B 4Y8XA 1C5YB 1S6FA 6CHAC 4YESB 1V2TT 1P02A 5DP6A 1DUAA 1C5PA 3UUZA 3RC4A 1GBMA 1MKXH 5AHGH 5SGAE 1AD8H 2XC5A 5GIBA 4VGCB 4K1SA 2KZ4A 1SGFG 1L4ZA 3W95A 2HPQH 3F6UH 1PQ8A 4O9VA 4FU9A 4MVNA 3TIUA 2SGEE 2RDLA 4E7RG 2VVUA 3BTHE 2J34A 2GVFA 3AASA 2PLXA 1BRAA 2HPPH 5K0HA 1ARBA 4YO9A 1NESE 3DFJA 3QGNB 3A84A 1VCPA 1Y3WA 4XD7D 3TH3H 1QBNA 2BVXH 3PMHB 1B7XB 1BDAA 1QY6A 1HIAB 2A5KA 4GAWA 5AFYH 2ZFQH 3UAIC 1MH0A 1ZR0A 1EP6A 1MZAA 4ZHAA 1GMHF 1GGDB 1MQ5A 1O31A 4X1RU 3MU0A 3A7YA 5EPYA 1SLWB 3VGCC 2AS9A 2FX6A 3F2GA 1DE7H 4NZLA 2B0FA 3A7XA 3SN8A 3TVJB 2HWLB 4X8UH 1GI5A 1YP9A 3GISB 6ESTA 4ISHH 3A83A 4JZIA 2WPDD 1V3XA 1SPJA 2R9PA 2J2UA 2GCTC 1DUEA 2A2XH 2FP7B 3RM2H 8GCHG 1HPGA 1ZSKA 4OS5A 2PFEA 4Q4LA 1XUFA 3SU4A 4X6OA 3S0NA 1OWIA 5HM9A 4DOQA 4DW2U 2THFB 1Y5BT 1GMCF 4I8KA 1AUJA 2YMSD 4ISIH 4GLYA 1H9IE 3LIWA 1DLKB 2CF8H 1W0KD 2C4FH 3SNDA 1GMDG 1F5KU 1HRTH 3VFEA 2ZPSA 2XBWA 2EI6A 3D65E 4FETA 4YOIA 4MQAA 5EU8A 2A2QH 4HFPB 1EOLA 1H8IH 1EPTC 1NRRH 1ABJH 2Z9IA 4CREA 4Y79A 4U01A 1SMFE 2J4IA 2YMSC 1KDQB 2FXRA 1QB9A 2PR3A 3ZZ8A 1XUJA 1UHBA 1TA2A 1G2MA 2ZA5A 3WWBA 4ABJA 1SFIA 1N6YA 4I8JA 1A5GH 1GBBA 3MHWU 4Q63A 2ZPQA 2OK5A 1MAYA 1TQ7B 4IMZA 2J95A 4DURA 1GBTA 1TPAE 5EOKA 2QN5T 3M3SA 5IDKA 1O2SA 1RIWC 2J92A 1FMGA 1ZTJA 2AIPA 4TWWA 1C1UH 1O3GA 2SFAA 1UTMA 1BMLA 1GMHG 3SJIA 1K1IA 1NTPA
chains in the Genus database with same CATH topology
1DFPA 3F9FA 1TMTH 2ZHDA 1ZGIA 1YBWA 1W10U 1TPOA 2ZFFH 2F9OA 4DCDA 4BTIB 1TX8A 3BG4B 5FX5A 1OYQA 1VJAU 2RA0A 1ACBE 4Y76A 1XM1A 2G55A 2PV9B 1IHSH 1O3BA 1HJAC 1WTHD 4NA7A 4UFEH 5CE1A 4Y0ZE 2FOAA 1GMCG 2IJOB 1T4VH 1VGCB 1WQVH 1AO5A 4XBDA 1NU7B 1KXAA 4DG4A 3A8DA 2VH0A 5DO4H 1O37A 4GSOA 1ETTH 1GI2A 1GCTC 1KXCA 1LVBA 2H5DA 1XX9A 1BRCE 4DIIH 2V0BA 1L1JA 1KTSB 4Q2KA 1V2UT 1Y3UA 4JYVH 2EA3A 2TPIZ 3UOUA 1K22H 1QRXA 1EOJA 1L4DA 5EXLA 4ASHA 2XCNA 2BOKA 3AVZA 1BTPA 1J8AA 3MU5A 4B71A 1HFDA 2W3IA 1DLEA 2ODYB 2G8TA 5EQRA 4LXBH 1YPLH 1T8NA 1YPHC 2OC0A 1C2LA 1AVXA 2Y5FA 3LGYA 1ZRBA 1DWCH 1S85A 3UNRA 4ZMAH 5DG6A 4ABBA 3RU4T 2UWLA 1SC8U 3E6PH 3VB6A 4R8TB 4Q7XA 4OGXA 5F8XA 2R2MB 2BY9X 3SU6A 4YOJA 1TRYA 3KNXA 2BMGB 2OC1A 3HK6B 2Y81A 2CN0H 4DJZB 4CRDA 3JZ1B 4INKA 3SV8A 4ZXYH 4X2XA 2FLBH 4X2VA 3SHCH 1GJ9B 1HAIH 2Y80A 5JBTA 1B0EA 1Q31A 3ELAH 3PTNA 3E91A 1TNLA 9ESTA 2FX4A 2UUKB 2HNTE 5EG4A 4MNYA 1CA0B 4NG9H 3RXQA 2CJIA 1ELEE 1G2LA 3M5LA 2YOLA 3MO9A 3M5OA 1MCTA 3Q3KA 1O2XA 3GYLB 1U6QA 1AI8H 4RKOB 5JBAS 2OP9A 1G3DA 1TGBA 2QGRA 3U8OH 4LZ1H 1EUFA 3AW0A 1MUEB 4LOYH 1DXWA 3BTQE 2NU1E 2G5NA 2GT7A 3H5CB 4K1EA 3T27A 3ZV9A 2JETC 3A85A 3LONA 1UCYH 2NWNA 3PB1E 2CHAB 1W3CA 3GYMA 3HGPA 1C1SA 3T26A 1IOEA 1WQSA 2GGVB 3LJJA 3T2NA 2F91A 3FZZA 3SNAA 4MNWA 2ODPA 1Z7KA 1O36A 5JBCS 2BB4A 3RXDA 2PUXB 1W12U 2RA3A 1C2JA 4GPGA 4DGJA 2TGAA 1ZMLA 2F3CE 1OPHB 1OKXA 2ZQ2A 6CHAB 5J4QA 5DP8A 2CMYA 4X2WA 1O5AB 1L2EA 4H4FA 5A0CA 4ZXXH 1T8OA 2CXVA 2NU2E 1AQ7A 4AB9A 5T6FA 4K60A 1D4PB 2W7UA 1O3DA 3TJVA 2SNVA 4I7YH 1P2JA 3MNSA 2ZEBA 1KY9A 1EASA 4UEHH 5ESBA 1BBRE 2V3HH 1SGNE 1L1NA 1S0RA 1KTTB 3K6YA 2NU3E 3NWUA 2ZZUH 3BF6H 1SGPE 3RC6A 1QRWA 2QY0B 3STIA 1TA6A 2DE8A 1P05A 1A5HA 1ZHPA 2I6SA 2OQ5A 4I33A 1XUKA 1C1RA 3TLOA 2BDGA 2ULLA 3MNXA 3RXHA 4FU8A 2PGBB 1BMMH 1O5EH 1S81A 3Q00A 2VIPA 4E05H 3VB4A 1CT0E 3GCNA 5E0HA 1TGSZ 3VGCB 1T8MA 1EB1H 2B8OH 5EXMA 1SGCA 1F92A 3NUMA 3EYDA 2VGCB 4NIYA 2ZHEH 4FU7A 4THNH 2GDEH 4RN6A 4TPIZ 2ZO3H 1MTNC 1W14U 1EAWA 1KLJH 2GD4B 2G4TA 3U1JB 3QO6A 2C93B 2XBYA 2WPIS 2GCTB 9LPRA 1JBUH 1KIGH 1NN6A 6LPRA 1O2TA 4YLQH 2FWWA 4AYYB 1XKAC 1GVKB 3FANA 2GDDA 3KQCA 5C5NA 1EZQA 2ODQA 2NU0E 2PKAB 2GP9B 1V2NT 1CBWC 4JMYA 1UO6A 1WBGB 2ZCHP 1GJ7B 3RXEA 1UVOA 3S7HB 2QXHA 3SUGA 2ZPRA 2BLWA 3ZZAA 1GHZA 1LHGH 1EPTB 4O97A 3QUMP 5L2ZH 2AH4X 2O8TA 4A6LA 3VB7A 1LHCH 2HRVA 2BD2A 1PFXC 4INLA 1W0YH 1C4V2 3MFJA 4UONA 2LNCA 3MU8A 1AVWA 2G81E 4NFEA 1LDTT 1RJXB 1MKWH 3O8RA 4HI3A 3OTJE 1RTFB 1WU1A 4A7IB 4WMFA 6GCHF 1WTGH 1L1GA 3B9FH 3GCTF 1BJUA 4NZQA 1SQAA 3LGUA 3QWCH 2M5TA 5T6DA 1O2UA 5A0BA 5HMAA 5FCKA 5C1UA 5A0AE 1GG6B 1Z8RA 1NO9H 3TJNA 1BIOA 1XXFA 3ZVFA 1Q2WA 1C5MD 2I6QA 2ZHQH 3MNBA 4FUDA 1VR1H 2FM2A 5C5OA 3RXCA 2Y82A 4WF8A 2FEQH 2KAIB 2BOHB 3BG8A 1PYTD 4NSYA 2FPZA 1EAIA 3GDVA 4MLFB 1NC6A 1YF4A 1KXEA 2BDHA 1HUTH 4BAKB 1C2MA 2JKHA 4ZH8A 1FN8A 3UQVA 1UTKA 1O5DH 4U30A 1HJAB 3M36A 1FDPA 3I78A 3SU1A 2Y6TA 1J16A 2SGPE 3UQOA 1O2VA 3PMJA 1FV9A 1Y3XA 1V2WT 1SR5C 1NFYA 1XUHA 2UWPA 1SVPA 1AUTC 1XVMA 3F9HA 1O3KA 2BVRH 1W13U 1GCTB 4BNRA 3K6ZA 1LKBA 2AFQB 5TCCA 2ZQ1A 3Q3XA 4NCYA 4ABFA 1Z8IB 3QDZB 2FODA 2TIOA 3MMGA 2ZTZA 2FIRH 3UFAA 3NKKA 3TNSA 3OU0A 3SUFA 1NPMA 4FUJA 3UWIA 1DANH 1QBVH 1BMAA 1ANEA 1K1OA 2AERH 5C1XA 2PSYA 1WYKA 4NIWA 2LPRA 5B6OA 2OLGA 1IQIA 2WPJS 5EW2H 1QQUA 1BUIA 1CE5A 2CV3A 4FUIA 1ZLRA 1ABIH 3ZZ6A 3ATMA 1A2CH 6GCHG 2PWXA 4B74A 1S82A 1C9TA 2FI4E 2Z9LA 1YPMH 1EXFA 3GCTG 4Y71A 2XXLA 3MWIU 1SOZA 3E0NB 5TCAA 1O2NA 2RG3A 1G9IE 2D26C 4I8HA 4CRFA 1A0LA 3M3VA 2ZHWH 2SNWA 3SJ8A 1EJMA 1GJ5H 3UNQA 1DM4B 1ZMJA 3MH7A 2Z3DA 1ESAA 1PPCE 2ZGJA 1O2HA 1LCYA 3UY9A 1P9SA 3A7VA 1QA7A 3KCGH 2P8OC 1O5FH 1V2PT 1YKTA 2XC4A 1ELBA 2PSXA 2BVSH 1QB6A 2DE9A 5ESTE 1O3MA 3LOXA 3A87A 4ZROA 1ZOMA 2FTLE 1QCPA 3SZNA 3TK9A 3ZYEA 1BTYA 2C90B 4KTCA 1A3BH 1TMUH 3KL6A 3RXBA 4CR5A 2IPHA 1JIMA 4XBCA 2Y5GA 1ZTLA 3UOPA 1JOUB 1CSOE 4JK5A 3PV4A 4SGBE 1ANCA 3LU9B 3P8GA 1TGTA 2GKVE 4CH2B 1OXGA 2WPHS 7GCHG 5JB9S 1IHTH 1BTUA 1GBLA 1HGTH 1GBJA 2H2ZA 2WV4A 3BTDE 4A5TS 1C2GA 1YCPK 4CHAC 1QJ6B 1GHAF 1P3EA 1SGDE 1RTKA 2BY7X 2JETB 1IQFA 1ZJKA 1HAVA 3PLPA 3RXFA 1ID5H 1FY5A 3HKJB 1OOKB 1TE0A 3ZZBA 1UVPA 1DWBH 1AVGH 2O8UA 2H9EH 3EA7A 3QN7A 1LTOA 1F0RA 2SGDE 2C8YB 1GBIA 3RMNH 1E35B 1KLIH 2AYWA 2OTVA 1G32B 3ZZ5A 2GZ9A 1F5LA 4JZFH 2FOMB 1AFQB 4XDEA 4Y7AA 3E0PB 7ESTE 4TYDA 3PYHA 2VWLA 3GY4A 1P10A 4ISOA 3VEQB 3BTKE 5GXPA 3SO3A 1O2JA 1LQEA 3LC3A 1S83A 2R0LA 4E06H 3MU4A 2IN2A 3P6ZB 4YM9A 1XUGA 3T28A 4JK6A 1UHBB 1HIAA 3RU4E 1N6XA 1SOTA 3QGJA 4ISNA 1SGTA 3LT3A 4YT6H 4ZKSU 3UR9A 1O3NA 1GL1A 2R3UA 1YCPM 4E7NA 1GJBB 2Y7ZA 2FOFA 4FXGH 1ZPBA 1SL3A 2Q6DA 1FPHH 3MU1A 1QNJA 2VB0A 4WMEA 5E2OA 1GI1A 5FPSA 1KSNA 4ZHMU 2G51A 2FOGA 2IOTA 2D1JA 1VITF 1DDJA 1GDUA 1C5ZB 5EQSA 3ZZCA 1YPGH 1OS8A 4WH8A 1HXEH 1C1MA 2A45B 1HAXB 2P94A 1RGQA 1MD8A 3A81A 1FONA 1XKBC 2PGQB 3B23B 5DP9A 1K21H 4GUXA 1MTNB 3L33A 1O35A 1Y8TA 1GHAG 3SQHE 1W8BH 1PQ7A 2BYAX 2J9NA 4J1YA 1HAGE 1TQ0B 1LKAA 4IN1A 2STBE 5DGJA 2WINI 3ZZ4A 1IQHA 2Z7FE 2ZU3A 1EP5A 3LDXH 4X8TH 1FIZA 1MMJN 2ZDVH 1FXYA 5L2YH 1DXPA 1CT4E 2ANMH 4AORA 3TK6A 4K8YA 1TPPA 1P0SH 1MKXK 1O39A 1MTWA 1GJ6A 1NZQH 2F9UA 3SNEA 5H4IB 1BITA 5JDUB 1SB1H 4X0WU 3P95A 4UDWH 1SGYE 2XWBI 4NIVA 2AMPA 1Z8JB 3P92A 3KN2A 5E0JA 3TJOA 3ENSB 1DS2E 1O32A 2C8ZB 4TPYA 3TU7H 4ZKOU 2CGAA 2XWAA 3SW2B 2BD9A 3E1XB 2TBSA 5FBEA 2ZGCA 1NS3A 3SGAE 3RXLA 4GHQA 1SGRE 1S5SA 1Z6EA 4RSPA 1FI8A 3G01A 3TJUA 1LPZB 1CGIE 2PHBA 3U9AH 1ZSJA 5BRRE 1TGNA 3GY7A 3I77A 5GCHF 2H6MA 4XOJA 1Z8GA 2H9HA 3A86A 4X1PU 1VITG 3S9AA 3KQBA 4K3JA 4O03A 1MD7A 1YYY1 4B2CA 1MCVA 4DY7B 1ETSH 2ASUB 2ZU4A 4ABHA 4CRCA 1C2HA 2ZDNA 2XRCA 8KME2 1LHFH 2Z9KA 1O2WA 1FLEE 3A7WA 1CA8B 5ETXA 1FY4A 1NFUA 4MNXA 3NPSA 1K28D 3RXOA 1DOJA 1BTZA 4IBLH 1F2SE 1UVUH 3URDA 3KQDA 4OS6A 4Y11E 2FZZA 5JYIA 2AGGX 1O2OA 3EDXB 1MTSA 1ANBA 1TBQH 3S7KB 1BBRH 1RXPA 2ZTXA 5JPMH 3S9CA 3FP8E 1JMOH 2A4RA 4CRGA 3RMLH 2ZU1A 1GHXH 1ZHMA 2FTMA 5I25A 3IITA 3U8TH 1GBCA 5GJ4B 3RDZA 1P03A 2H1UA 3W94A 4HGCA 4K8BA 1O2GH 1TNJA 3E3TA 3BTEE 1TRMA 1O2YA 1AKSB 1TONA 3SV2H 1TX7A 3BEIB 3M7TA 5DKMA 1VCQA 1UK3A 2FOEA 1KYNA 2O8WA 1HYLA 3RMMH 2B9LA 3V7TA 4K1TA 2ZGHA 1A1RA 1O3CA 2CF9H 1O34A 3PM3A 2FOCA 2Q1JA 3K9XB 3ZVCA 1PQAA 2VVVA 1V2OT 3SORA 2VH6A 2P16A 2A32A 1EX3A 3TK5A 1BRBE 1P8VC 3MYWA 4ABEA 4Q7YA 8ESTE 3IG6B 4BOHA 2BLOA 5GCHG 1UTOA 1XUIA 3F9EA 1PPZA 3MH5A 3RMOH 1TALA 3GY2A 3GCOA 2TGPZ 3URCA 1AB9C 1A5IA 1FQ3A 1AWFH 3NZIA 1D6RA 3A8BA 1H1BA 2F9PA 3A7ZA 1BHXF 3L6PA 3RXMA 2BDCA 1XVOA 2ZG0H 1C5RA 3D23A 1GGDC 4KP0A 5E8EH 1P04A 4AN7A 2QC2A 1AN1E 2XW9A 2O9QA 2ZTYA 5T3HA 3BTWE 1CGJE 3NXPA 4X1QU 2A4GA 1O3IA 1Y5AT 3S69A 1GHYH 4O3TA 1RRKA 1SI5H 3RM0H 2GCHF 1SQOA 1HJ8A 1C5VA 4PROA 3EA9A 3M37A 5L6NH 1KLTA 5HM2A 1ELVA 1O2LA 1TB6H 1G3CA 3LGIA 2P95A 1P2KA 2ZKSA 1LMWB 5J4SA 1O2MA 1WV7H 1JIRA 1AU8A 4JZDH 4LK4A 1AZZA 1V2JT 2J94A 2P93A 3TITA 1T7CA 1SG8B 1QBOA 4ZUHA 1SHYA 1O2KA 1GI0A 1YPEH 1MU6B 1SSXA 1GI9B 1W7GH 1B5GH 4OS4A 3SU0A 1CO7E 1O33A 3ZVBA 1EZSC 2Z9JA 3LGVA 1C1WH 3OX7U 3ZVGA 1LVOA 2VIQA 1QQ4A 2ZFTA 3RXAA 4BAQB 2FS8A 2QV1A 4X1NU 4AGJA 1QFKH 5EW1H 3UIRA 1UTJA 2QAAA 4U32A 4I32A 1P2IA 4R0IA 3PO1C 1GCDA 2FOBA 5AFZH 2JH6D 1YM0A 1C5OH 3T5FH 1HJ9A 2ZIQH 1WSSH 4AX9H 2QF3A 2OBOA 3PLKA 1MAXA 2BX3A 4YT7H 2EC9H 1ELCA 1JRTA 3KF2A 1OP2A 4Z0KA 4B2BA 4BXSA 1G3BA 4OGYA 1C5WB 2BQ7B 2OBQA 4UFGH 1ZRKA 5LPEA 1CU1A 2OC8A 1FZZA 1HBTH 1THSH 5FX6A 3DD2H 1C5QA 1EJAA 1Z1JA 2A5IA 1HAPH 3V0XA 1GBFA 2O8LA 3EGKH 1Q3XA 3MOCA 2P3FH 3TNTA 5LGOA 3UTUH 1C5LH 1RTLA 5A8XA 1CT2E 2GZ8A 4B1TA 3A89A 4A1XA 2BD5A 1ZTKA 4F4OC 1E34B 1O3OA 4X6NA 5FXLA 3GOVB 4WY3A 3V3MA 3SU2A 4XSKU 1ESTA 3U98H 2H9TH 2GCHG 1BHXB 2ZFPH 3PTBA 2ALVA 5DP5A 2Z3EA 4MG3A 4FUEA 1Z1IA 1UTLM 3DT0H 1O5GH 5DP4A 1UCYK 3BG4C 1CQQA 4CBOA 4I8LA 1LPKB 3C27B 3ATKA 2BTCE 1OX1A 5HGGA 1PQ5A 1J9CH 4FUHA 2YNAA 4CH8B 1RIWB 5C2ZA 1YPJH 1UVSH 1JXPA 4Q7ZA 4F49A 4MDSA 1C1PA 1L0ZA 3NK8A 2OCVB