1FN8A

Fusarium oxysporum trypsin at atomic resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase substrate
molecule keywords TRYPSIN
publication title Fusarium oxysporum trypsin at atomic resolution at 100 and 283 K: a study of ligand binding.
pubmed doi rcsb
total genus 59
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fn8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fn8A01
3TJVA 5A8XA 1QJ6B 1PYTD 5DGJA 2GGVB 3SNCA 2VJ1A 1MU6B 3BTME 1K1NA 2VGCC 3TGIE 1GBAA 1KDQB 3ZVGA 1LHGH 3RXIA 1CT2E 5HGGA 4B75A 1IQMA 4ABFA 1OOKB 2TGTA 2Y5GA 4X2YA 1YPHE 3VXFH 2AGEX 4LOYH 1P9UA 1TONA 3BSQA 2FESH 4SGAE 1BHXB 1FUJA 1YF4A 1GBMA 1GBHA 1BIOA 1W7GH 1W0ZU 1XKBC 2G8TA 2TIOA 2XYAA 2ZPRA 4Y11E 3RDZA 2P93A 4UE7H 1HGTH 3WY8A 4B2AA 1NTPA 1AIXH 3IWMA 3LU9B 2A0QB 4D7FA 1KXFA 3SV9A 2SNWA 5I46H 1W0YH 3PB1E 2VIQA 3MH6A 1NRSH 1QA0A 4HZHA 2ZKSA 1N1LA 1VGCB 7ESTE 1ANCA 3M35A 2H9TH 2HPQH 4WMFA 1DICA 3RM2H 2ZGXH 5EPYA 2WPJS 3SNAA 2QA9E 2OD3B 1JIRA 2BTCE 4JYTA 3ZVFA 4ASHA 1HPGA 4MPWA 1WYKA 2Y7ZA 1TNLA 1VZQH 3CENA 9ESTA 1PYTC 2BDGA 1EASA 2XCNA 1EZXC 3KEEA 1ZRBA 4JCNA 1UJ1A 1K1OA 3R3GB 1VJ9U 4X2VA 1TYNA 1TNJA 1GCTB 1ZPZA 2CGAA 2STAE 2C8WB 1TPAE 3AVZA 1DM4B 2PHBA 1O2GH 5FXLA 4FUBA 3T28A 3MO6A 1CE5A 2QN5T 2F9UA 4XE4A 3VEQB 1UTJA 3B8JA 1A46H 2I6QA 1P2MA 1EPTC 3PMJA 1ZOMA 4ISLA 3SU2A 1AZZA 5EOKA 5LPRA 3TITA 4LZ4B 1A3EH 3A83A 1LVYA 4MQAA 2GDDA 1BJUA 1TABE 4DVAU 4XSKU 2ZFTA 2BD3A 2R2WU 2ZDAH 4AFZA 1HLTH 7GCHG 1MBQA 2SGFE 1RS0A 4Y7BA 1OWEA 3OX7U 1KY9A 1S83A 1UCYH 1OXGA 1PPZA 1FY5A 1HNEE 5AHGH 4IN1A 1GJDB 1ZHPA 1SGEE 6GCHF 1YPKH 1W8BH 2AERH 2B7DH 1LPGB 2G5NA 4YT7H 1GGDB 4FUHA 1TNGA 2BLOA 1UVTH 2QGRA 3N7OA 2GCHF 3SN8A 1P11E 1JXPA 4AFQA 3F6UH 4GVUA 3GISB 3RXEA 2H1UA 2CN0H 1KDQA 1DVAH 3FFGA 1FJSA 3FP8E 4D9RA 3FZZA 4BAMB 1GG6C 4K1SA 3MTYA 3QTOH 1C1WH 1A1RA 3JZ1B 2ZWLH 3H5CB 2W5EA 1GI3A 3DD2H 3RMLH 1JRSA 1P57B 2ZHWH 5EG4A 1O2NA 1F0TA 1C4V2 4M7GA 3I29A 2PTNA 4TYDA 3UTUH 1NS3A 1GJ4H 1Z6JH 4YESB 1SHYA 2R2MB 5DP3A 1QCPA 2FI3E 1J15A 3GCOA 2J4IA 1J17T 1LVBA 2BDIA 2C4FH 4CR9A 1L4ZA 4R8TB 3QN7A 3DFLA 3GCNA 1PQAA 1PJPA 1IQJA 1ZJKA 3SUFA 1LMWB 1GPZA 1FAKH 1NM6A 4IW4E 1HJAB 2ZI2H 1P12E 3SU5A 3NWUA 1QIXB 1TGBA 2P8OC 4UEHH 5SGAE 4IBLH 3SJ9A 2ODQA 3NXPA 3SNEA 4F4OC 4MDSA 1TMUH 5GXPA 5DP4A 3E91A 1XM1A 1ZGVA 4BTTB 1CA0C 5FCKA 1YCPH 4X8TH 1MD8A 1WCZA 1O3KA 5DJ7A 1NRRH 3LJOA 3MNSA 1BTYA 1Z71A 4ABGA 3NPSA 2FP7B 1UHBB 4CRGA 1G3BA 5H4IB 1NFYA 2B8OH 2OBQA 1SGFG 2Z9JA 4UFEH 4KP0A 1IQFA 2XC4A 3O8BA 1LVMA 3M3SA 4FU7A 2A7HA 1NFUA 4GSOA 2K1QA 2V35A 1QL7A 4BXSA 1DXPA 1T7CA 2LPRA 2M5TA 1YLDA 2R0LA 4H6TA 5AFZH 5LPFA 1T4UH 3HKJB 1ZSLA 1QFKH 3FAOA 2WUCA 3DT0H 2QC2A 1YGCH 2BOKA 2ZGCA 1FNIA 2H2ZA 1SFIA 4CRAA 1XKAC 4MLFB 3SGAE 3TH3H 5F6MA 1QQUA 3K9XB 3GYMA 2ZDNA 2PR3A 4ABJA 4H4FA 1TWXB 1P03A 1BTWA 1QA7A 1GJ5H 3ZVAA 1F0RA 1F7ZA 1ZPCA 1GJ7B 4ZKRU 2ANMH 1C2IA 1P01A 3RXMA 1C4U2 1Z6EA 1BRCE 3K6ZA 1BMAA 1NESE 1T8MA 5FPTA 1RJXB 5JBAS 1T31A 1AUTC 1MCTA 1BCUH 4D8NA 5L2ZH 1D6RA 1YKTA 2H5CA 1AUJA 2BD5A 3DFJA 1DSTA 1SLWB 5C67A 2SGQE 2HGTH 4WXVA 3ZZ7A 3QWCH 1BBRH 4X1SU 1DXWA 4K8BA 4AB9A 1AFQB 2QCYA 3NZIA 2FOMB 1GG6B 3M36A 2DUCA 1ETSH 1TQ7B 4X0WU 1V3XA 1DOJA 1EP5A 1TPOA 4O97A 3ZZ9A 1RD3B 3SQEE 4BOHA 4K8YA 1AN1E 3ZVEA 1RTKA 1V2WT 2KAIB 5G4BA 1HRTH 3PMAB 3RXOA 1GWAA 1GBLA 1ZHRA 2Y5HA 4XBDA 3ZZAA 3V0XA 3RUOA 1FY1A 3FP7E 2W3KA 2ZTXA 3EA9A 2BY6X 4AFUA 2D2DA 4I8LA 1ZMNA 1NO9H 3UFAA 1GBEA 4H42U 1KTSB 3SOSA 5T6GA 3GCHC 2VWLA 1GVZA 1TAWA 2ZFQH 1C5XB 1LTOA 1YPEH 1A61H 2F9NA 4PROA 3SHCH 4WJG2 1TX6A 2EI8A 3SI3H 1S85A 3OYPA 2D8WA 3FZDA 1SGPE 2PTCE 2FI5E 2P8OB 4MNVA 2AGIX 2H9EH 1AE8H 2VWMA 4ISNA 4ISIH 2W7SA 1TE0A 3RU4T 1EAWA 1L2EA 3LH1A 2SFAA 3RM0H 1AD8H 1AO5A 1BITA 4TPYA 1BTZA 4NFFA 5FBIA 4AYVB 1TBRH 2GV7A 3PLPA 1OWHA 3T2NA 3M61U 1KSNA 4CHAB 4FUIA 1Z8IB 4B2BA 4NFEA 1O37A 1UHBA 1XVOA 2OC7A 1MAXA 2AFQB 4Y8XA 1JIMA 1JWTA 1OWJA 2Y80A 1C9TA 7LPRA 4Y7AA 5L2YH 1ELTA 3VXEH 3SHAH 3ZZ8A 4GUXA 1E37B 1Z8GA 1EATA 1GDNA 1ZJDA 2W3IA 1GBTA 3SNBA 1TNKA 1V2NT 2BVRH 1TMTH 1ARCA 1GI5A 2VIOA 1SSXA 1C2FA 2V3OH 2XXLA 2O9QA 4FUJA 4TPIZ 1W14U 5I25A 2BQ6B 1MTVA 4NSYA 3NUMA 1BRAA 3S7KB 2YNBA 1A0HB 3E90B 1UK3A 1KTTB 3BTWE 1VCWA 3E3TA 4Y0ZE 2ZFPH 3QLPH 1TIOA 3Q00A 1MU8B 2SGDE 1SLUB 1DITH 5B6OA 1CT0E 1OPHB 1THSH 2R3YA 3P6ZB 5J4SA 1EOLA 1YPJH 3ZVDA 1SLVB 1MTSA 4A5TS 1H8IH 2AMQA 1UTKA 1DE7H 1C2HA 2O8TA 3STIA 2UUFB 1C2DA 1G3EA 1A5IA 2RA3A 4MNXA 5GDSH 1XX9A 4Y6DA 2XC5A 4GHQA 1UK2A 1G3CA 5GIBA 2ZHFH 1BTXA 4ZROA 1TFXA 1RTLA 1XMNB 1O5BB 4DY7B 3EGKH 3TJUA 1Y3UA 1V2KT 1C2KA 3MU5A 4E05H 2GT7A 1OP0A 2KAIA 2GCTC 4ZKOU 2OQ5A 2J92A 2Q6GA 2XNIA 4Y8YA 3VGCC 2AIQA 3V3MA 4R0IA 1BTPA 4CBNA 1Y5BT 1ELGA 3A7YA 3A81A 1C5NH 1KLJH 1NPMA 1O2RA 2VINA 3RMOH 1GHVH 1SOTA 1GI4A 4I7YH 2XTTB 1ZPBA 4HTCH 1QJ1B 1EAXA 3LOXA 1XUFA 1ELVA 1TRYA 1AQ7A 2NU4E 4FVDA 1ZLRA 8GCHF 4WH6A 2FEQH 2WPMS 2ANWA 2LNCA 2ZFSA 3BG4C 3GCTF 3QO6A 1DLKB 1YC0A 3L3TA 4GCHF 1HXFH 1Y3YA 4CRCA 2HRVA 5EW1H 1O30A 4X1RU 3QK1A 1EX3A 1ELDE 2GX4A 2FO9A 2P3UB 1EZUC 4D9QA 5DK1A 2O8LA 3BTHE 1EZSC 1BQYA 5EXMA 4FU8A 2QY0B 2A45B 8ESTE 1OWKA 1CHOF 2BDHA 1G2MA 2ZPQA 2CJIA 3HATH 4NA7A 3URCA 1O2PA 1YM0A 2GZ8A 1O3AA 1KXDA 3QX5H 2FLBH 1UO6A 1F5RA 5T6FA 1GBKA 3RC6A 1NT1A 1OWIA 1PQ8A 2GTBA 1GJBB 3S9BA 1BBRE 3A8DA 1S82A 4TY6A 4U32A 2W26A 4DG4A 4ABAA 2ZHQH 2XC0A 1KYNA 1P05A 1V2TT 1ZMLA 2WV5A 1O2KA 4I31A 2BDYA 2P94A 2OUAA 3PM3A 1T8LA 2VIDA 1C1RA 3SGBE 2Y5FA 1YPMH 1WSSH 2OINA 1GL0E 1CVWH 1O5CB 4WH8A 4ISOA 1ZTKA 1XUIA 2F3CE 1D9IA 1TOMH 3OY5U 3VPKA 1V2PT 3T25A 3QGNB 3ZZDA 1ARBA 1SGYE 1GBJA 4I8GA 1MUEB 4CH8B 3SU3A 3BV9B 1F0SA 1GMHF 2XBWA 5E2PA 3TU7H 4O9VA 3A89A 1E35B 1HAXB 2SGEE 4FXGH 2FWWA 3ZYDA 1C5RA 4AOQA 2Z3DA 2VVCA 5C1UA 1V2UT 1PQ5A 1G32B 3MFJA 1NN6A 2ZHDA 4ABDA 4ABIA 1IAUA 1TGNA 5EXLA 2AMPA 5CMXH 3KQEA 4X1QU 3I77A 4BNRA 3VB3A 3ATIA 3ZV9A 4YLUA 2ZQ1A 1MKWK 1K21H 5DP7A 2C90B 1H8DH 3AAUA 1MMJN 1RIWC 4KGAA 1MZAA 3ENSB 1AVWA 1G3DA 1O2MA 1SVPA 4X8UH 4MPXA 3LGUA 1C5WB 4NIYA 3ZZCA 4XOJA 2HALA 1G36A 1HAGE 1WBGB 2AH4X 2EC9H 1MQ6A 3EAJA 1ABIH 1CBWC 1LHEH 1TB6H 3M5NA 3E0PB 1BOQA 3LONA 3K2UA 1GHYH 1GI0A 3M37A 3MU1A 1IHSH 1K22H 1G2LA 1E0FD 1GMCG 3A86A 1HCGA 3OU0A 1TGSZ 1GJAB 3BTTE 4THNH 2PKSC 2UWOA 1V2JT 3ELAH 1O2SA 1ZTJA 3MHWU 1HAOH 2C93B 2FS9A 5F8ZA 2Q6FA 2C8YB 1KLIH 1GBDA 4JZEH 4DW2U 1HIAB 4NCYA 5BPEA 1H9LB 2QYIA 1HAPH 5GCHG 4DGJA 1QB9A 2JH6D 4B2CA 1UTOA 5EPNA 1AB9C 6LPRA 4BAKB 3M5LA 4X8VH 1OYQA 2D26C 5E0HA 2ALVA 5DPAA 1BRBE 1FY8E 4O03A 3AAVA 4INKA 1DSUA 5C5OA 1DDJA 1G37A 5EW2H 2ZP0H 2XBXA 5CHAC 1HDTH 1C5LH 2GT8A 1MAYA 1G30B 2J9NA 3CP7A 4X8SH 1A5HA 4E7RG 3QZQA 4WMDA 5ESTE 2B9LA 4K5ZA 5DG6A 1HAVB 3E0NB 1C5YB 4B73A 5TCCA 5E0JA 4Y79A 3JZ2B 2ZNKH 1SPJA 1P06A 4UONA 3U69H 2AMDA 3SU0A 3SJ8A 1EAIA 3KCGH 3A80A 1YCPM 5EQQA 2ZC9H 4I8KA 1B7XB 5JPMH 4WWYA 2WPHS 5A09A 4YM9A 2AEIH 2JETB 2TGPZ 1GHAG 3BEIB 3TK5A 1PPEE 1TALA 3UNRA 5DP8A 3Q76A 2VGCB 5BRRE 1N6XA 1GBCA 1J9CH 1GJ6A 1XXDA 2P3FH 1KXEA 1VR1H 1ZZZA 4ZMAH 1GHZA 1ELEE 2QIQA 1O31A 3ODDA 2GDEH 3A7TA 4U2WA 2NWNA 1Z8RA 1RGQA 2RDLA 1DWBH 1GJCB 3RP2A 2BDBA 3GYLB 4B76A 1P0SH 3RXAA 3SUDA 3BN9A 2A7JA 3L6PA 4FUEA 4I32A 4H6SB 2H5DA 4A1XA 1H9HE 1RFNA 3LDXH 3U1JB 2EI7A 3GDVA 4XDEA 3KGPA 2R0KA 1WU1A 1UVPA 3BTQE 3SI4H 4A6LA 4FUFA 2PW8H 4NIXA 1NFXA 1O36A 3K6YA 1C1PA 3U8TH 3OY6U 1J8AA 1B5GH 1QRWA 1ELCA 4LK4A 3H7TA 1WQSA 1O34A 1Y3WA 2G00A 3TVJB 3PMHB 1K1JA 5GPIB 2ZIQH 4JMYA 5F8TA 3Q3YA 3L33A 1EJNA 1HAHH 2ASUB 1SQAA 2TPIZ 1HIAA 4UFGH 4D7GA 1GBFA 1Y3XA 2JH0D 1EP6A 2J34A 4AN7A 3SJOA 1T8OA 1GHBG 1P9SA 1TBQH 3RXDA 4YO9A 1O3MA 1FIZA 2C3SA 1GCDA 1E38B 4ZHAA 1RXPA 3MMGA 1C5ZB 1GMDG 4UDWH 3T29A 3O8RA 4OGXA 5FCRA 5FPSA 2A1DB 1EB2A 3IG6B 1THRH 2QXGA 4XFQA 4YOGA 1EPTB 4ZUHA 1O35A 1C5SA 2VIPA 1VITG 1KXCA 2FTMA 4OS7A 1HAVA 1ID5H 2VH6A 1Y5AT 4YOIA 2PWXA 2XWAA 1A4WH 3LH3A 2FI4E 1W7XH 3PO1C 3EYDA 3MNXA 4HFPB 1GL1A 3ITIA 3E16B 1O3LA 3NKKA 1GI8B 1MTWA 2AYWA 3QZRA 1P2QA 3SV6A 4O3UA 2ESTE 2GD4B 5JB8S 2WUBA 1FONA 1L1NA 1O2JA 5DP9A 1P2IA 1V2LT 1JBUH 4DJZB 1CGJE 2ZQ2A 4MNWA 1FDPA 1AMHA 4OS4A 4ZHMU 2F9PA 1Z1IA 2ZA5A 3SW2B 1L4DA 1OX1A 3HK3B 2BX4A 1RRKA 2F91A 3FP6E 3ZVBA 1ZTLA 1O5EH 2Y82A 3O8DA 4NZLA 3RXLA 1MH0A 1XUJA 3PV4A 1NY22 2BY8X 1GDUA 1O3HA 2ZCKP 1SB1H 1W11U 3UNQA 3MH4A 2FX4A 1W2KH 3P8NA 1UMAH 3A7ZA 2Y6TA 1PPCE 1UCYK 1O3OA 2BLQA 5LPEA 1EUFA 1MTNC 4NWLA 3URDA 1SL3A 1TRNA 4DIHH 4U30A 1B0FA 4I33A 1F2SE 1YPLH 2WPLS 4RKJB 1TPPA 1GMCF 3PYHA 1K2I1 1KXAA 1E34B 3TJNA 2A7CA 4ABEA 3RXBA 4UFFH 1NRNH 1LQEA 3LC5A 1QNJA 1Y8TA 4NG9H 1IQKA 3ATLA 2QAAA 1UK4A 1O2QA 1FAXA 5EQRA 1BHXF 3MI4A 4VGCC 4WXIA 1F92A 1KLTA 2D1JA 1FI8A 3UR9A 2ZDVH 3BTFE 1O5AB 2ZGBH 1CA0B 1S84A 3QUMP 3TH4H 3UY9A 3RXTA 3ZZBA 1OP8A 1ANEA 1XUGA 1T32A 2WYJA 3MU8A 5HM2A 2PSYA 3ZZ3A 1VJAU 1INCA 4I8JA 1WV7H 1V2RT 1LQDB 2ZDMA 3T62A 4X6NA 3UR6A 3F9FA 3HGPA 3T5FH 2EEKA 1P2JA 1MBMA 3GY7A 4MG3A 4AZ2B 4U01A 1WQVH 4Y71A 1TNHA 2BHGA 5FPYA 1BTHH 2IJOB 7GCHF 4CRBA 1C1VH 1EPTA 1O2YA 4IMZA 4NIWA 1HFDA 1UTLM 4B1TA 1OYTH 3LGVA 5K7RA 5DP6A 1A0LA 4AORA 2FOEA 2FOHA 4RSPA 1EXFA 3GY5A 4Q80A 1YCPK 2ALPA 5FHTA 1IQEA 1QRZA 5CE1A 3RXSA 3RXQA 2Y7XA 5A2MH 1OWDA 3SV2H 4ZH8A 2XW9A 1SGDE 2ZCHP 3KL6A 3U8RH 2UUJB 1TGCA 3C1KA 3E8LA 3SO3A 2BD7A 1VITH 5A0AE 3P92A 1FPCH 3NK8A 3D65E 5JYIA 3Q3KA 1ANDA 1Q3XA 1SQOA 2HPPH 4MPUA 2BQWB 1FY3A 2CHAC 3GDSA 1ELBA 2FYQA 4NSVA 1S81A 1L0ZA 2H6MA 3EA7A 1DPOA 1QQ4A 1TX8A 3M5MA 1KXBA 4CREA 2VNTA 4RKOB 4ABHA 5JBTA 2J94A 1HXEH 1B0EA 1Q31A 1UTQA 4Q7ZA 2P3TB 2QXHA 3TGKE 1GDQA 1TA6A 1AWFH 4IMQA 1M9UA 3ZZ6A 1O3GA 1NU9A 4AGJA 3F9GA 2Z9LA 2ZU1A 4WF8A 5T3HA 4TWYA 3ZYEA 1O2ZA 1ESAA 1EJMA 2QF3A 5HYOA 2VVUA 1THPB 2P95A 1AE5A 3KQBA 3C27B 2WPIS 3S9CA 3P8OA 2GCHG 1LCYA 2ZG0H 2VB0A 4CR5A 1QY6A 1O3BA 3U8OH 5AF9H 1PPBH 3GCHB 1Z7KA 1LPZB 2ULLA 4JZ1A 4FUCA 2ZU3A 1V2VT 2QV1A 2XBYA 1BTUA 1UTNA 4X1PU 4XBBA 4X1NU 1GHXH 3QDZB 5L30H 1DY9A 2PLXA 5ABWA 3BIUH 3TK6A 2G55A 1X7AC 2ZZUH 2PUQH 1O3DA 2Z9IA 4XBCA 5C3NA 1Z1JA 2GV6A 1SG8B 1VGCC 3PLKA 2A5KA 1WOFA 2FXRA 1FMGA 1IQLA 2HNTE 2HOBA 1P10A 1O2VA 2FODA 1QB1A 3GICB 2BXUH 1S0QA 3M7QA 4CRDA 1O0DH 1O3NA 4UD9H 2A5IA 5EGMA 1TNIA 1ETTH 4BAOB 5JBBS 2ODYB 4LZ1H 2TGDA 4KELA 3RC4A 1C5PA 1K1MA 1FQ3A 2ZFRH 1TX7A 1MZDA 2GKVE 3M7UA 1MKXK 5TCAA 2PV9B 3GY4A 3ODFA 3IITA 1ELFA 1O39A 1A5GH 1BRUP 1GCTC 4AG1A 2GMTC 2YOLA 2BMGB 2ZU4A 1K28D 1IQHA 2NU3E 3P70B 4K69A 1QBVH 3EE0B 2ZHEH 1NRQH 3CS7A 1K1LA 3KN2A 2BD8A 3ZZ5A 1EB1H 1IQNA 3QTVH 1O2TA 2BD9A 1F5KU 3ATWA 3PLBA 1SGTA 1GVKB 1K1IA 3W95A 7KMEH 4DCDA 1O2XA 2OC0A 2PKAB 4ZAEA 4INLA 1PFXC 3A8CA 2Z3EA 3PWBA 1AKSB 1D6WA 3P95A 1D3QB 4K60A 1AFEH 4AX9H 2VWOA 3A7WA 4IC5A 1CQQA 4FU9A 1FLEE 1OS8A 3STJA 1YPHC 1JRTA 1O2OA 2FZZA 1N8OC 3D23A 2FM2A 3PTBA 1C2EA 5A0BA 3SUGA 2F83A 3SGQE 3RC5A 1O3JA 5E2OA 1GI2A 1GGDC 1VCPA 1BJVA 2ZF0H 3RXHA 1A2CH 2PGBB 4OGYA 2BDAA 1BMLA 1O33A 1NU7B 1DWCH 2GCTB 2ZO3H 1QR3E 2A32A 1XUKA 2BQ7B 2A4OA 3MO9A 1YPGH 5AFYH 1TBZH 3VGCB 3SBKA 3BTGE 3QGJA 5A0CA 2ANKH 3E6PH 4GLYA 4D76A 1O2IA 1SHHB 3DHKH 4YOJA 4NIVA 2TRMA 1ETRH 2GZ9A 2Q1JA 3TH2H 3FVFB 5A8ZA 2BY9X 2IN2A 3M5OA 2NU2E 1GHWH 3RU4E 1TA2A 3A7VA 3HK6B 3ATKA 3UWIA 3RXGA 2SNVA 1V2QT 1NRPH 3ZZ4A 3MOCA 1ZYOA 5IDKA 1CA8B 1SQTA 3BG4B 1DLEA 1H4WA 4KTUA 1P3CA 2BXTH 3SV8A 2UUKB 1TLDA 1LKAA 1ELAA 5F03A 3KF2A 2CXVA 3TNTA 1DY8A 2BD2A 1YLCA 1C1UH 4OS5A 4IC6A 2A2QH 1JOUB 3S9AA 5DP5A 3MH7A 1HJAC 4JK6A 1O2WA 1GBBA 3M7TA 1C5UA 3I78A 1C1TA 3SNDA 2PSXA 3UQVA 4A7IB 1PQ7A 1C5QA 4YLQH 4Q7YA 1MTUA 1NROH 4X2WA 1FY4A 1QBNA 3U9AH 1HYLA 1DUAA 2F9VA 2IPHA 1LPKB 5HM9A 1A3BH 1C1NA 3P8GA 2UWLA 6CHAC 2F9OA 3SJIA 4NWKA 4ZXYH 3K65B 1DUEA 1P09A 2YNAA 1JMOH 1FN8A 3UUZA 2BY7X 3TK9A 3ZV8A 1ZSKA 1AU8A 3P8FA 3RXUA 4JYVH 3OSYA 1P02A 1O3CA 2GMTB 8LPRA 3LGTA 4Y0YE 3OTJE 2HWLB 1MD7A 1HV7A 1SLXB 3BTDE 1LO6A 1TRMA 1LDTT 3ZVCA 4X6MA 3AW0A 3FANA 3UOPA 2NU1E 3RXPA 1P2OA 3A84A 4IN2A 3SQHE 1C1OA 1SBWA 1O3EA 2WINI 4ZHLU 3V7TA 1W10U 1O5GH 4I8HA 3KHVA 2PKAA 2VH0A 4DIIH 2R9PA 3MU4A 2ZU2A 4E06H 4FUGA 4NA9H 1EOJA 1AKSA 4BTIB 2TGAA 1BT7A 4Q7XA 1C5MD 1CO7E 1Y3VA 2BDCA 3KQDA 4JZIA 1SMFE 1KIGH 1UVOA 4AYYB 1N8OB 2FOCA 1H9IE 3SU1A 2FOGA 4NA8A 1SGIB 4Z0KA 1FIWA 4X2XA 3E1XB 1AVGH 2Z9GA 1WAYB 1RIWB 4YTAA 1DWDH 1AFQC 2J95A 1FZZA 2ZGHA 1W3CA 4DOQA 2G52A 1ZHMA 4DT7B 1FN6A 2Z9KA 2BZ6H 4A1TA 5C1YA 2CF8H 4INHA 3LGWA 1CBWB 1P8VC 2EI6A 1A7SA 1S0RA 1D3TB 3UIRA 1W12U 5F8XA 1L1GA 2AIPA 2Z94A 1AY6H 1BZXE 3TNSA 2A2XH 1GI6A 1YBWA 5TJXA 1D3PB 2FYRA 4MTBA 2O8WA 1F5LA 2SGAA 4JZDH 1EZQA 2VVVA 2THFB 2OP9A 1LHCH 3P17H 5A8YA 1ZSJA 2PKSB 3F1SB 5C20A 1QL9A 2TBSA 4OS1A 4GPGA 2PGQB 3AW1A 2OXSA 1C5VA 2OCVB 2BM2A 1C4Y2 5C2ZA 2ZEBA 1IHTH 3HGNA 3LT3A 1P2NA 2XCFA 2V0BA 1T8NA 3KNXA 3VB4A 3BTKE 1ABJH 1SOZA 2RCEA 4YT6H 1H1BA 1AB9B 3RXFA 1EAUA 3F9EA 2OC1A 3A82A 3NCLA 1RTFB 1O3FA 3T27A 3S7HB 1ANBA 2HVXA 8GCHG 4ZKNU 4UFDH 1C2GA 3MH5A 3GCTG 4CHAC 3MU0A 4GCHG 2ZU5A 4BTUB 4AGKA 6CHAB 2P59A 2FDAA 3LJJA 3O8CA 2XRCA 3UQOA 4CBOA 2ZTYA 1G9IE 1T4VH 5CHAB 3SU4A 3TPIZ 3TGJE 2J2UA 2FX6A 1WTHD 3LKWA 1O3PB 1K9OE 1DX5M 4K1TA 1GVLA 3DUXH 3HKIB 3RXJA 3F68H 1LHFH 3F9HA 4Z6AH 1A0JA 1BMNH 4AG2A 1DT2A 1CHOG 1YYY1 1C2JA 3A87A 2XWBI 1OSSA 3GY6A 3LPRA 2A5AA 2EA3A 5JBCS 1HAZB 3RMNH 4BAHB 1AVXA 3D49H 2O8MA 4QT8C 1OP2A 2OQUA 3A8AA 4TWWA 1C2MA 1O5DH 4X6PA 2PFEA 5E0GA 4Y76A 1ZR0A 1BDAA 3M3TA 4Y8ZA 3GY8A 1EQ9A 3RXKA 2O8UA 3RXRA 2WV4A 3GOVB 1EJAA 3LGYA 2OBOA 1GI1A 2ZFFH 1SGRE 4MNYA 2G51A 3Q77A 4ZKSU 1V2ST 2IOTA 3ESTA 3MNCA 4HI3A 2STBE 2WPKS 3RLWH 1QRXA 2BVSH 2BLWA 2BY5X 3LGIA 2CMYA 1DANH 3R0FA 2P16A 1P04A 1GMHG 1YP9A 1GI7B 2FLRH 2I6SA 1QBOA 1LHDH 1XVMA 1N6YA 1C5TA 3DA9B 1J16A 4CRFA 2HLCA 9LPRA 1AGJA 3G01A 4X6OA 8KME2 3TLOA 4FUDA 3Q3XA 5J4QA 5LGOA 5GJ4B 4RN6A 1AZ8A 1D4PB 3GY3A 1WTGH 2BOHB 2G81E 2UUYA 1CGHA 2FS8A 5DO4H 2BYAX 1TMBH 3H7OA 3LC3A 4K1EA 3A7XA 3U1IB 4BAQB 2FOFA 1UTMA 2ODPA 2QXIA 3D62A 4Q2KA 1V2OT 1C1QA 1IQIA 1SGFA 2FOAA 1QJ7B 1SGNE 3BEFB 1XUHA 2PUXB 2J38A 1TGTA 1OKXA 1CU1A 2GP9B 2ZPSA 2W7UA 1XXFA 3PTNA 1FV9A 5GCHF 4OS2A 4JZFH 4TY7A 4WMEA 1J14A 1UVSH 1HAIH 1QHRB 5ETXA 2BB4A 4A1VA 1ESTA 5ESBA 1ZGIA 1O2LA 3UPEA 1HBTH 1TQ0B 1BUIA 1V2MT 2G4TA 1TPSA 1S6HA 2DE8A 1MKXH 2ZTZA 3MNBA 5EXNA 3BTEE 4KTSA 3UOUA 1MCVA 1MQ5A 1C5OH 5HMAA 2F9BH 2ZECA 1D3DB 4J2YB 1O5FH 3KQCA 1C1MA 2CF9H 2ZCLP 1DS2E 3MO3A 1QGFA 2HNTF 2V6NA 3TJOA 1UCYE 1DFPA 2OTVA 4HGCA 1W13U 5T6DA 2Q6DA 1S5SA 4F49A 3SORA 4A92A 1QL8A 3LIWA 4K3JA 1C2LA 1E36B 3V12A 3UWJH 1SGCA 1CHGA 4AB8A 1UTPA 3VB6A 4MPVA 5K0HA 1F0UA 3SZNA 1BB0B 1QURH 2XBVA 3VB5A 3EDXB 4NZQA 5AVDA 1GHAF 3PO1B 1ACBE 2DE9A 4GAWA 2RA0A 4ESTE 2VWNA 2Y81A 2C8XB 2ANYA 4BXWA 2A31A 1MKWH 5EU8A 2A4QA 1K1PA 1P3EA 1Z8JB 3EQ0H 2ZGJA 3V13A 2V3HH 1GBIA 2BVXH 5L6NH 1L1JA 3MWIU 2BLVA 2OLGA 3VFEA 2R3UA 2Z3CA 4B71A 1IOEA 3RXCA 5PTPA 2WYGA 4ABBA 1ZRKA 3BIVH 4J1YA 4B74A 5HXFA 3SUEA 2AGGX 5LH8A 2BZAA 1O2HA 2ILNA 1EKBB 1ESBA 1AWHB 5FBEA 3GY2A 2SGPE 3SJKA 1HJ9A 2NU0E 4SGBE 6GCHG 1FPHH 3VB7A 4Y10E 2VIWA 1FXYA 1SC8U 3UREA 3ATMA 1HAYB 2H9HA 4IGDA 1TOCB 1MTNB 1DWEH 3EA8A 2RG3A 2BX3A 3BF6H 5FX5A 1LVOA 1GJ9B 3PWCA 1LKBA 1P2KA 3CS0A 5E8EH 4IS5A 2A4GA 4AFSA 1S6FA 5IYTA 4MVNA 3BG8A 1AHTH 3RMMH 4KTCA 1WUNH 1O2UA 1BBRK 2FMJA 2JKHA 2FIRH 3KIDU 1O32A 1U6QA 1SI5H 2G5VA 4NGAH 1AI8H 1CGIE 1GHBF 4VGCB 1Y5UT 2A4RA 4WVPE 3TIUA 2HNTC 3PMBB 3RXVA 2FPZA 3S69A 3U98H 1GMDF 4FVBA 2BD4A 1PPHE 1VCQA 5GWZA 1HB0B 2CV3A 1NZQH 1Q2WA 1SGQE 2OC8A 2FTLE 3GDUA 1GJ8B 1BMMH 4WY3A 3W94A 3UNSA 4ZXXH 1CT4E 6ESTA 1C1SA 3T26A 1SFQB 5C5NA 1GI9B 3MYWA 1BA8B 1VITF 2JH5D 4YZUA 5FX6A 1V6DA 1HJ8A 2FOBA 2UWPA 1NFWA 5EODA 2ZDKA 4GHTA 1Y59T 1HUTH 4JYUH 1PPFE 2C8ZB 4O3TA 2AS9A 3RU4D 2Z6BD 3B9FH 1ORFA 5FAHA 1PPGE 4JK5A 4LXBH 3AASA 1CSOE 5JB9S 3SU6A 2VIVA 4E7NA 1QTFA 3PROA 3A85A 3A8BA 4BANB 1C9PA 1SR5C 4KKDA 4ISHH 2B0FA 2QXJA 5C1XA 2B5TB 3BEUA 4OS6A 3SV7A 1QB6A 2GZ7A 3A88A 1NC6A 1O3IA 4DURA 3HPTB 1ZMJA 3S0NA 2Z7FE 2GVFA 1O38A 2CHAB 5JDUB 5DKMA 2VU8E 1IQGA 3B23B 1UVUH 4CH2B 4K2YA 5EQSA 3M3VA 3RLYH 2QF0A 2ZDLA 2G4UA 2JETC
chains in the Genus database with same CATH superfamily
3TJVA 5A8XA 1QJ6B 1PYTD 5DGJA 2GGVB 3SNCA 2VJ1A 1MU6B 3BTME 1COWD 1K1NA 1SKYE 2VGCC 3TGIE 1GBAA 1KDQB 3ZVGA 1LHGH 3RXIA 1CT2E 5HGGA 4B75A 1IQMA 4ABFA 1OOKB 2TGTA 2Y5GA 4X2YA 1YPHE 3VXFH 2AGEX 4LOYH 1P9UA 1TONA 3BSQA 2FESH 4SGAE 1BHXB 1FUJA 1YF4A 5FL7D 1GBMA 1GBHA 1BIOA 1W7GH 1W0ZU 1XKBC 2G8TA 2TIOA 2XYAA 2ZPRA 4Y11E 3RDZA 2P93A 4UE7H 1HGTH 3WY8A 2RFKC 4B2AA 1NTPA 2HLDD 4FOUC 1AIXH 3IWMA 3LU9B 2A0QB 4D7FA 1KXFA 3SV9A 2SNWA 5I46H 1W0YH 3PB1E 2VIQA 3MH6A 3MQKC 1NRSH 1QA0A 4HZHA 2ZKSA 1N1LA 1VGCB 3UB0A 7ESTE 1ANCA 3M35A 2H9TH 2HPQH 4WMFA 1DICA 3RM2H 2ZGXH 5EPYA 2WPJS 3SNAA 2QA9E 2OD3B 1JIRA 2BTCE 4JYTA 3ZVFA 4ASHA 1HPGA 4MPWA 1WYKA 2Y7ZA 1TNLA 1VZQH 3CENA 9ESTA 1PYTC 2BDGA 1EASA 2XCNA 1EZXC 3KEEA 1ZRBA 4JCNA 1UJ1A 1K1OA 3R3GB 1VJ9U 4B6FA 4X2VA 1TYNA 1TNJA 1GCTB 1ZPZA 2CGAA 2STAE 3OAAD 2C8WB 2OK5A 1TPAE 3AVZA 1DM4B 3OEHD 2PHBA 1O2GH 3WWFA 5FXLA 4FUBA 3T28A 3MO6A 1CE5A 2QN5T 2F9UA 4XE4A 3VEQB 1UTJA 3B8JA 1A46H 2I6QA 1P2MA 1EPTC 3PMJA 1ZOMA 4ISLA 3SU2A 1AZZA 5EOKA 5LPRA 3TITA 4LZ4B 1A3EH 3A83A 1LVYA 4MQAA 2GDDA 1BJUA 1TABE 3U28C 4DVAU 3NRLA 2IJD1 4XSKU 2ZFTA 2BD3A 2R2WU 2ZDAH 4AFZA 1HLTH 7GCHG 1MBQA 2SGFE 1RS0A 4Y7BA 1OWEA 3OX7U 1KY9A 1S83A 1UCYH 1OXGA 1PPZA 1FY5A 1HNEE 5AHGH 4IN1A 1GJDB 5EJLA 1ZHPA 1SGEE 6GCHF 1YPKH 1W8BH 2AERH 2B7DH 1LPGB 2G5NA 4YT7H 1GGDB 4FUHA 1TNGA 2BLOA 1UVTH 2QGRA 3N7OA 2GCHF 3SN8A 1P11E 1JXPA 4AFQA 3F6UH 4GVUA 3GISB 3RXEA 2H1UA 2CN0H 1KDQA 1DVAH 3FFGA 1FJSA 3FP8E 4D9RA 3FZZA 4BAMB 1GG6C 4K1SA 3MTYA 3QTOH 1C1WH 1A1RA 5CHBA 3JZ1B 2ZWLH 3H5CB 2W5EA 1GI3A 3DD2H 3RMLH 1JRSA 1P57B 1NBME 2ZHWH 5EG4A 1O2NA 1F0TA 1C4V2 4M7GA 3I29A 2PTNA 4TYDA 3UTUH 1NS3A 1GJ4H 1Z6JH 4YESB 1SHYA 2R2MB 5DP3A 1QCPA 2FI3E 1J15A 3GCOA 2J4IA 1J17T 1LVBA 2BDIA 2C4FH 4CR9A 1L4ZA 4R8TB 3QN7A 3DFLA 3GCNA 1PQAA 1PJPA 1IQJA 1ZJKA 3SUFA 1LMWB 2M2AA 1GPZA 1FAKH 1NM6A 4IW4E 1HJAB 2ZI2H 1P12E 3SU5A 3NWUA 1QIXB 1TGBA 2P8OC 4UEHH 5SGAE 1YLNA 2EQNA 4IBLH 3SJ9A 2ODQA 3NXPA 3SNEA 4F4OC 4Q4LA 4MDSA 1TMUH 5GXPA 5DP4A 3E91A 1XM1A 1ZGVA 4BTTB 4FETA 1CA0C 5FCKA 1YCPH 4X8TH 1MD8A 1WCZA 1O3KA 5DJ7A 1NRRH 3LJOA 3MNSA 1BTYA 1Z71A 4ABGA 3NPSA 2FP7B 4ASUD 1UHBB 4CRGA 1G3BA 5H4IB 1NFYA 2B8OH 2OBQA 1SGFG 2Z9JA 4UFEH 4KP0A 1IQFA 2XC4A 3O8BA 1LVMA 3M3SA 4FU7A 2A7HA 1NFUA 4GSOA 2K1QA 2V35A 1QL7A 4BXSA 1DXPA 1T7CA 2LPRA 2M5TA 1YLDA 2R0LA 4H6TA 5AFZH 5LPFA 1T4UH 3HKJB 1ZSLA 1QFKH 3FAOA 2WUCA 3DT0H 2QC2A 1YGCH 2BOKA 2ZGCA 1FNIA 2H2ZA 1SFIA 4CRAA 1XKAC 4MLFB 3SGAE 3TH3H 5F6MA 1QQUA 3K9XB 3GYMA 2ZDNA 2PR3A 3F0OA 4ABJA 4H4FA 3UAIC 3N99A 1TWXB 1P03A 1BTWA 1QA7A 1GJ5H 3ZVAA 1F0RA 1F7ZA 1ZPCA 1GJ7B 4ZKRU 2ANMH 1C2IA 1P01A 3RXMA 1C4U2 1Z6EA 1BRCE 5EJ1A 3K6ZA 1BMAA 1NESE 1H8HD 3F2FA 1T8MA 3SYJA 5FPTA 1RJXB 1WDIA 5JBAS 1T31A 1AUTC 1MCTA 1BCUH 4D8NA 5L2ZH 4F55A 1D6RA 1YKTA 2H5CA 1AUJA 3OEED 2BD5A 3DFJA 1DSTA 1SLWB 5C67A 4Z1MD 2SGQE 2HGTH 4WXVA 3ZZ7A 3QWCH 1BBRH 4X1SU 1DXWA 4K8BA 4AB9A 1AFQB 2QCYA 3NZIA 2FOMB 1GG6B 3M36A 2DUCA 1ETSH 1TQ7B 4X0WU 1V3XA 1K0HA 1DOJA 1EP5A 1TPOA 4O97A 3ZZ9A 1RD3B 3SQEE 4BOHA 4K8YA 1AN1E 3ZVEA 3OE7D 1RTKA 1V2WT 4F48B 2KAIB 5G4BA 1HRTH 3PMAB 3RXOA 1GWAA 1GBLA 1ZHRA 2Y5HA 4XBDA 3ZZAA 3V0XA 3RUOA 1FY1A 3FP7E 2W3KA 1W0KD 2ZTXA 3EA9A 2BY6X 4AFUA 2D2DA 4I8LA 1ZMNA 1NO9H 3UFAA 1GBEA 4H42U 5DN6D 1KTSB 3SOSA 5T6GA 3GCHC 2VWLA 1GVZA 1TAWA 2ZFQH 1C5XB 2F9NA 1LTOA 1YPEH 1A61H 1E1QD 4PROA 3SHCH 4WJG2 3FO8D 1TX6A 2EI8A 3SI3H 1S85A 3OYPA 2D8WA 3FZDA 1SGPE 2PTCE 2FI5E 2P8OB 1W0JD 4MNVA 2AGIX 2H9EH 1E1RD 1QZ8A 1AE8H 2VWMA 4ISNA 4ISIH 2W7SA 1TE0A 3RU4T 1EAWA 1L2EA 3LH1A 2SFAA 3RM0H 1AD8H 1AO5A 1BITA 4TPYA 1BTZA 4NFFA 5FBIA 4AYVB 1TBRH 2GV7A 3PLPA 1OWHA 3T2NA 3M61U 1KSNA 4CHAB 4FUIA 1Z8IB 3PV5A 4B2BA 4NFEA 1O37A 1UHBA 1XVOA 2OC7A 1MAXA 2AFQB 4Y8XA 1JIMA 1JWTA 1OWJA 2Y80A 1C9TA 7LPRA 4Y7AA 5L2YH 1ELTA 3VXEH 3SHAH 3ZZ8A 4GUXA 1E37B 1Z8GA 1EATA 5EJZA 1GDNA 1ZJDA 2W3IA 1GBTA 3SNBA 1TNKA 1V2NT 2BVRH 1TMTH 1ARCA 1GI5A 2VIOA 1SSXA 1C2FA 2V3OH 2XXLA 2O9QA 4FUJA 4TPIZ 1W14U 5I25A 2BQ6B 1MTVA 4NSYA 3NUMA 1BRAA 3S7KB 2YNBA 1A0HB 3E90B 1UK3A 1KTTB 3BTWE 1VCWA 3E3TA 3KYGA 4Y0ZE 2ZFPH 3QLPH 1TIOA 3Q00A 1MU8B 2SGDE 1SLUB 1DITH 5B6OA 1CT0E 1OPHB 1THSH 2R3YA 3P6ZB 5J4SA 4M9FA 1EOLA 1YPJH 3ZVDA 1SLVB 1MTSA 4A5TS 1H8IH 2AMQA 1UTKA 1DE7H 1C2HA 2O8TA 3STIA 2UUFB 1C2DA 1G3EA 1A5IA 2RA3A 4MNXA 5GDSH 1XX9A 4Y6DA 2XC5A 4GHQA 1UK2A 1G3CA 5GIBA 2ZHFH 1BTXA 4ZROA 1TFXA 1RTLA 1XMNB 1O5BB 4DY7B 3EGKH 3TJUA 1Y3UA 1V2KT 1C2KA 3MU5A 4E05H 2GT7A 1OP0A 2KAIA 2GCTC 4ZKOU 2OQ5A 2J92A 2Q6GA 2XNIA 4Y8YA 3VGCC 2AIQA 3V3MA 4R0IA 1BTPA 4CBNA 1Y5BT 1ELGA 3A7YA 3N7EA 3A81A 1C5NH 1KLJH 1NPMA 1O2RA 2VINA 3RMOH 1GHVH 1SOTA 1GI4A 4I7YH 2XTTB 1ZPBA 4HTCH 1QJ1B 1EAXA 3LOXA 1XUFA 1ELVA 1TRYA 1AQ7A 2NU4E 4FVDA 1ZLRA 8GCHF 4WH6A 2FEQH 2WPMS 2ANWA 2LNCA 2ZFSA 3BG4C 3GCTF 3QO6A 1DLKB 1YC0A 3L3TA 4GCHF 1HXFH 1Y3YA 4CRCA 2YMSD 2HRVA 5EW1H 1O30A 4X1RU 3QK1A 1EX3A 1ELDE 2GX4A 2FO9A 2P3UB 1EZUC 4D9QA 5DK1A 2O8LA 3BTHE 5HIZA 1EZSC 1BQYA 5EXMA 4FU8A 1VKYA 2QY0B 2A45B 8ESTE 1OWKA 1CHOF 2BDHA 1G2MA 2ZPQA 2CJIA 3HATH 4NA7A 3URCA 3EE7A 1O2PA 1YM0A 2GZ8A 1O3AA 1KXDA 3DSPA 3QX5H 2FLBH 1UO6A 1F5RA 5T6FA 1S6LA 1GBKA 3RC6A 1NT1A 1OWIA 1PQ8A 2GTBA 1GJBB 3S9BA 1BBRE 3A8DA 1S82A 4TY6A 4U32A 2W26A 4DG4A 4ABAA 2ZHQH 2XC0A 1KYNA 1P05A 1V2TT 1ZMLA 2WV5A 1O2KA 4I31A 2BDYA 2P94A 5DSFA 2OUAA 3PM3A 1T8LA 4ACBA 3DCLA 2VIDA 1C1RA 2WZQA 2Y5FA 1YPMH 3SGBE 1WSSH 2OINA 1GL0E 4I86A 1CVWH 1O5CB 4WH8A 4ISOA 1ZTKA 1XUIA 2F3CE 1D9IA 1TOMH 3OY5U 3VPKA 1V2PT 3T25A 3QGNB 3ZZDA 1ARBA 1SGYE 1GBJA 4I8GA 1MUEB 4CH8B 2W6JD 3BV9B 3SU3A 1F0SA 1GMHF 2XBWA 5E2PA 3TU7H 4ACAA 4O9VA 3A89A 1E35B 1HAXB 2SGEE 2YMSC 4FXGH 2FWWA 3ZYDA 1C5RA 4AOQA 2Z3DA 2VVCA 3FOAA 5C1UA 1V2UT 1PQ5A 1G32B 3MFJA 1NN6A 2ZHDA 4ABDA 4ABIA 1IAUA 1TGNA 5EXLA 2AMPA 5CMXH 3KQEA 4X1QU 2WHXA 3I77A 4BNRA 3VB3A 3ATIA 3ZV9A 4YLUA 2QE7D 2ZQ1A 1MKWK 1K21H 5DP7A 2C90B 1H8DH 3AAUA 1MMJN 1RIWC 4KGAA 1MZAA 3ENSB 1AVWA 1G3DA 1O2MA 1SVPA 4X8UH 4MPXA 3LGUA 1C5WB 4NIYA 3ZZCA 4XOJA 2HALA 1G36A 1HAGE 1WBGB 2AH4X 2EC9H 1MQ6A 3EAJA 1ABIH 1CBWC 1LHEH 1TB6H 3M5NA 3E0PB 1BOQA 3LONA 2L6OA 2XNDD 3PV2A 3K2UA 1GHYH 1GI0A 3M37A 3MU1A 1IHSH 1K22H 1G2LA 1E0FD 1GMCG 3A86A 1HCGA 3OU0A 1TGSZ 1GJAB 3BTTE 4THNH 2PKSC 2UWOA 1V2JT 3ELAH 1O2SA 1ZTJA 3MHWU 1HAOH 2C93B 2FS9A 5F8ZA 2Q6FA 2C8YB 1KLIH 1GBDA 4JZEH 4DW2U 1HIAB 1H8ED 4NCYA 5BPEA 3PRDA 1H9LB 2QYIA 1HAPH 5GCHG 4DGJA 1QB9A 2JH6D 4B2CA 1UTOA 5EPNA 1AB9C 6LPRA 4BAKB 3M5LA 4X8VH 1OYQA 1EFRD 2D26C 3DSOA 5E0HA 2ALVA 5DPAA 1BRBE 2HVYB 1FY8E 4O03A 3AAVA 4INKA 1DSUA 1NBMD 4P00A 5C5OA 1DDJA 1G37A 5EW2H 2ZP0H 2XBXA 5CHAC 1HDTH 1C5LH 2GT8A 1MAYA 1G30B 2J9NA 3CP7A 4X8SH 1A5HA 4E7RG 3QZQA 4WMDA 5ESTE 2B9LA 4K5ZA 5DG6A 1HAVB 3E0NB 1C5YB 4B73A 5TCCA 5E0JA 4Y79A 3JZ2B 2ZNKH 1SPJA 1P06A 4UONA 2KM0A 2AMDA 5F53A 3SU0A 3U69H 3SJ8A 1EAIA 3KCGH 3A80A 1YCPM 5EQQA 2ZC9H 4I8KA 1B7XB 5JPMH 4WWYA 2WPHS 5A09A 4YM9A 2AEIH 2JETB 2TGPZ 1GHAG 3BEIB 3TK5A 1PPEE 2KZ4A 1TALA 3UNRA 5DP8A 3Q76A 2VGCB 5BRRE 1N6XA 1GBCA 1J9CH 1GJ6A 1XXDA 2P3FH 1KXEA 1VR1H 2IPQX 1ZZZA 4ZMAH 1GHZA 1ELEE 2QIQA 1O31A 3ODDA 2GDEH 3A7TA 4U2WA 2NWNA 1Z8RA 1RGQA 2RDLA 1DWBH 1GJCB 3RP2A 2BDBA 3W1EA 5IK2D 3GYLB 4B76A 1P0SH 3RXAA 3SUDA 3BN9A 2A7JA 3L6PA 4FUEA 4I32A 4H6SB 2H5DA 4A1XA 1H9HE 1RFNA 3LDXH 3U1JB 2EI7A 3GDVA 4XDEA 2K8IA 3KGPA 2R0KA 3KQ5A 1WU1A 1UVPA 3BTQE 3SI4H 4A6LA 4FUFA 2PW8H 4NIXA 1NFXA 4HG6A 1O36A 3K6YA 1C1PA 3U8TH 3OY6U 1J8AA 1B5GH 1QRWA 1ELCA 4LK4A 3H7TA 1WQSA 1O34A 1Y3WA 2G00A 3TVJB 3PMHB 1K1JA 5GPIB 2ZIQH 4JMYA 3PRBA 5F8TA 3Q3YA 3L33A 2KX4A 1EJNA 1HAHH 2ASUB 2KFWA 1SQAA 2TPIZ 1HIAA 4UFGH 4D7GA 1GBFA 1Y3XA 2JH0D 1EP6A 2J34A 4AN7A 3SJOA 1T8OA 1GHBG 1P9SA 4YXWD 1TBQH 3RXDA 5EIYA 4YO9A 4P02A 1O3MA 1FIZA 2C3SA 1GCDA 1E38B 4ZHAA 1RXPA 3MMGA 1C5ZB 1GMDG 4UDWH 3T29A 3O8RA 4OGXA 5FCRA 5FPSA 2A1DB 1EB2A 3IG6B 1THRH 2QXGA 4XFQA 4YOGA 1EPTB 4ZUHA 1O35A 1C5SA 2VIPA 1VITG 1KXCA 2FTMA 4OS7A 1HAVA 1ID5H 2VH6A 1Y5AT 4YOIA 2PWXA 2XWAA 1A4WH 3LH3A 4B6EA 2FI4E 1W7XH 4RI0A 3PO1C 3EYDA 3MNXA 4HFPB 1GL1A 3ITIA 3E16B 1O3LA 3NKKA 1GI8B 1MTWA 2AYWA 3QZRA 1P2QA 3SV6A 4O3UA 2ESTE 2GD4B 5JB8S 2WUBA 1FONA 5CDFE 1L1NA 1O2JA 5DP9A 1P2IA 1V2LT 3H09A 1JBUH 4DJZB 1CGJE 2ZQ2A 4MNWA 1FDPA 1AMHA 4OS4A 4ZHMU 2F9PA 1Z1IA 2ZA5A 3SW2B 1L4DA 1OX1A 3HK3B 2BX4A 1RRKA 2F91A 3FP6E 3ZVBA 1ZTLA 1O5EH 2Y82A 3O8DA 4NZLA 3RXLA 1MH0A 1XUJA 3PV4A 1NY22 2BY8X 1GDUA 3KYFA 1O3HA 2ZCKP 1SB1H 1W11U 3UNQA 3MH4A 5T1VA 2FX4A 1W2KH 3P8NA 1UMAH 3A7ZA 2KCOA 2Y6TA 1PPCE 1UCYK 1O3OA 2BLQA 5LPEA 1EUFA 1MTNC 4NWLA 3URDA 1SL3A 1TRNA 4DIHH 4U30A 1B0FA 4I33A 1F2SE 1YPLH 2WPLS 4RKJB 1TPPA 1GMCF 3PYHA 1K2I1 1KXAA 1E34B 3TJNA 2A7CA 4ABEA 3RXBA 4UFFH 1NRNH 1LQEA 3LC5A 1QNJA 1Y8TA 4NG9H 1IQKA 3ATLA 2QAAA 1UK4A 1O2QA 1FAXA 5EQRA 1BHXF 3MI4A 4VGCC 4WXIA 1F92A 1KLTA 2D1JA 1FI8A 3UR9A 2ZDVH 3BTFE 1O5AB 2ZGBH 1CA0B 2JDID 1S84A 3QUMP 3TH4H 3UY9A 3RXTA 3ZZBA 1OP8A 1ANEA 1XUGA 1T32A 2WYJA 5B6LA 3MU8A 5HM2A 2PSYA 3ZZ3A 1VJAU 1INCA 4I8JA 1WV7H 1V2RT 1LQDB 2ZDMA 3T62A 4X6NA 3UR6A 3F9FA 3HGPA 3T5FH 2EEKA 1P2JA 1MBMA 3GY7A 4MG3A 4AZ2B 4U01A 1WQVH 4Y71A 1TNHA 2BHGA 5FPYA 1BTHH 2IJOB 7GCHF 4CRBA 1C1VH 1EPTA 1O2YA 4IMZA 4NIWA 1HFDA 1UTLM 4B1TA 1OYTH 3LGVA 5K7RA 5DP6A 1A0LA 4AORA 2FOEA 2FOHA 4RSPA 1EXFA 3GY5A 4Q80A 1YCPK 2ALPA 5FHTA 1IQEA 1QRZA 5CE1A 3RXSA 3RXQA 2Y7XA 5A2MH 1OWDA 3SV2H 4ZH8A 2XW9A 1SGDE 2ZCHP 3KL6A 3U8RH 2UUJB 1TGCA 3C1KA 3E8LA 3SO3A 2BD7A 1VITH 5A0AE 3P92A 1FPCH 3NK8A 3D65E 5JYIA 3Q3KA 1ANDA 1Q3XA 1SQOA 2HPPH 3FN8A 2BQWB 4MPUA 1FY3A 2CHAC 3GDSA 1ELBA 2FYQA 4NSVA 1S81A 1L0ZA 2H6MA 3EA7A 1DPOA 1QQ4A 1TX8A 3M5MA 1KXBA 4CREA 2VNTA 4RKOB 4ABHA 5JBTA 2J94A 1HXEH 1B0EA 1Q31A 1UTQA 4Q7ZA 2P3TB 2QXHA 3TGKE 1GDQA 1TA6A 1AWFH 2VBCA 1M9UA 4IMQA 3ZZ6A 1E79D 1O3GA 1NU9A 4AGJA 3F9GA 2Z9LA 2ZU1A 4WF8A 5T3HA 4TWYA 3ZYEA 1O2ZA 1ESAA 1EJMA 2QF3A 5HYOA 2VVUA 1THPB 2P95A 1AE5A 3KQBA 3C27B 2WPIS 3S9CA 3F2GA 3P8OA 2GCHG 1LCYA 2ZG0H 2VB0A 4CR5A 1QY6A 1O3BA 3U8OH 5AF9H 1PPBH 3GCHB 1Z7KA 2KCYA 1LPZB 2ULLA 4JZ1A 4FUCA 2ZU3A 1V2VT 2QV1A 2XBYA 1BTUA 1UTNA 4X1PU 4XBBA 4X1NU 1GHXH 3QDZB 4RT1A 5L30H 1DY9A 2PLXA 5ABWA 3BIUH 3TK6A 2G55A 1X7AC 2ZZUH 2PUQH 1O3DA 2Z9IA 4XBCA 5C3NA 1Z1JA 2GV6A 1SG8B 1VGCC 3PLKA 2A5KA 1WOFA 2FXRA 2L74A 1FMGA 1IQLA 2HNTE 2HOBA 1P10A 1O2VA 2FODA 1QB1A 3GICB 2BXUH 1S0QA 2CK3D 3M7QA 4CRDA 1O0DH 1O3NA 4UD9H 2A5IA 5EGMA 1TNIA 1ETTH 4BAOB 5JBBS 2ODYB 4LZ1H 2TGDA 4KELA 3GS9A 2W6ID 3RC4A 1C5PA 1K1MA 1FQ3A 2ZFRH 1TX7A 1MZDA 2GKVE 3M7UA 1MKXK 5TCAA 2PV9B 3GY4A 3ODFA 3IITA 1ELFA 1O39A 1A5GH 1BRUP 1GCTC 4AG1A 2GMTC 2YOLA 2BMGB 2ZU4A 1K28D 3F3BA 1IQHA 2NU3E 3P70B 4K69A 1QBVH 3EE0B 2ZHEH 1NRQH 3CS7A 1K1LA 3KN2A 2BD8A 3ZZ5A 1EB1H 1IQNA 3QTVH 4RT0A 1O2TA 2BD9A 1F5KU 3ATWA 5C0UA 3PLBA 1SGTA 1GVKB 1K1IA 3W95A 7KMEH 4DCDA 1O2XA 2OC0A 2PKAB 4ZAEA 4INLA 1PFXC 3A8CA 3SZEA 2Z3EA 3PWBA 1AKSB 1D6WA 3P95A 1D3QB 4K60A 1AFEH 4AX9H 2VWOA 3A7WA 4IC5A 1CQQA 4FU9A 1FLEE 1OS8A 3STJA 2JIZD 1YPHC 1JRTA 1O2OA 2FZZA 1N8OC 3D23A 2FM2A 3PTBA 1C2EA 4TT3D 5A0BA 2K0QA 3SUGA 2F83A 3SGQE 3RC5A 1O3JA 5E2OA 1GI2A 1GGDC 1VCPA 1BJVA 2ZF0H 3RXHA 1A2CH 2PGBB 4OGYA 2BDAA 1BMLA 1O33A 1NU7B 1DWCH 2GCTB 2ZO3H 1QR3E 2A32A 1XUKA 2BQ7B 2A4OA 3MO9A 1YPGH 5AFYH 1TBZH 3VGCB 3SBKA 3BTGE 3QGJA 5A0CA 2ANKH 3E6PH 4GLYA 4D76A 1O2IA 1SHHB 3DHKH 4YOJA 4NIVA 4XRNA 2TRMA 1ETRH 2GZ9A 2Q1JA 3TH2H 3FVFB 5A8ZA 2BY9X 5C17A 2IN2A 3M5OA 2NU2E 1GHWH 3RU4E 5HKKD 1TA2A 3A7VA 3HK6B 3ATKA 3UWIA 3RXGA 2SNVA 1V2QT 1NRPH 3ZZ4A 2XOKD 3MOCA 1ZYOA 5IDKA 1CA8B 1SQTA 3BG4B 1DLEA 1H4WA 4KTUA 1P3CA 2BXTH 2WV9A 3SV8A 2UUKB 1TLDA 1LKAA 1ELAA 5F03A 3KF2A 2CXVA 3TNTA 1DY8A 2BD2A 1YLCA 3DSGA 1C1UH 4OS5A 4IC6A 2A2QH 1JOUB 2LP6A 3S9AA 5DP5A 3MH7A 1HJAC 4JK6A 1O2WA 1GBBA 3M7TA 1C5UA 3I78A 1C1TA 3SNDA 2PSXA 3UQVA 4A7IB 1PQ7A 2KCPA 1C5QA 4YLQH 4Q7YA 1MTUA 1NROH 4X2WA 1FY4A 1QBNA 3U9AH 1HYLA 1DUAA 2F9VA 2IPHA 1LPKB 5HM9A 1A3BH 1C1NA 1YWUA 3F2HA 3P8GA 2UWLA 6CHAC 2F9OA 3SJIA 4NWKA 4ZXYH 3K65B 1DUEA 1P09A 2YNAA 1JMOH 1FN8A 3UUZA 2BY7X 3TK9A 3ZV8A 1ZSKA 1AU8A 3P8FA 3RXUA 2EY4C 4JYVH 3OSYA 1P02A 1O3CA 2GMTB 8LPRA 3LGTA 4Y0YE 4TSFD 3OTJE 1YY3A 2HWLB 1MD7A 1HV7A 1SLXB 3BTDE 1LO6A 1TRMA 1LDTT 3ZVCA 4X6MA 3AW0A 3FANA 3UOPA 2NU1E 3RXPA 5KECA 1P2OA 3A84A 4IN2A 3SQHE 1UW7A 1C1OA 1SBWA 1O3EA 2WINI 4ZHLU 3V7TA 1W10U 1O5GH 4I8HA 3KHVA 2YMSB 2PKAA 2VH0A 4DIIH 2R9PA 3MU4A 2ZU2A 4E06H 4FUGA 4NA9H 1EOJA 1AKSA 4BTIB 2TGAA 1BT7A 4AC9A 4Q7XA 1C5MD 1CO7E 1Y3VA 2BDCA 3KQDA 4JZIA 1SMFE 1KIGH 1UVOA 4AYYB 1N8OB 2FOCA 1H9IE 3SU1A 2V7QD 2FOGA 4NA8A 1SGIB 4Z0KA 1FIWA 4X2XA 3E1XB 1AVGH 2Z9GA 1WAYB 3WW7A 1RIWB 4YTAA 1DWDH 1AFQC 2J95A 1FZZA 2ZGHA 1W3CA 4DOQA 2G52A 1ZHMA 2KCAA 4DT7B 1FN6A 2Z9KA 2BZ6H 4A1TA 5C1YA 2CF8H 4INHA 3LGWA 1CBWB 1P8VC 2EI6A 1A7SA 1S0RA 1D3TB 3UIRA 1W12U 5F8XA 1L1GA 2AIPA 3AK5A 2Z94A 1AY6H 1BZXE 3TNSA 2A2XH 1GI6A 1YBWA 5TJXA 1D3PB 2FYRA 4MTBA 2O8WA 1F5LA 2SGAA 4JZDH 1EZQA 2VVVA 2THFB 2OP9A 1LHCH 3P17H 4Q63A 5A8YA 1ZSJA 2PKSB 3F1SB 5C20A 1QL9A 2TBSA 2V3MA 4GPGA 4OS1A 2PGQB 3AW1A 5HIYA 2OXSA 1C5VA 2OCVB 2BM2A 1C4Y2 2WPDD 2ZEBA 5C2ZA 1IHTH 3HGNA 3LT3A 1P2NA 2XCFA 2V0BA 1T8NA 3KNXA 3VB4A 3BTKE 1ABJH 1SOZA 2RCEA 4YT6H 1H1BA 1AB9B 3RXFA 1EAUA 3F9EA 2OC1A 2J5UA 3A82A 1RTFB 1O3FA 1OHHD 3NCLA 3T27A 3S7HB 1ANBA 2HVXA 8GCHG 4ZKNU 4UFDH 1C2GA 3MH5A 3GCTG 4CHAC 3N7DA 3MU0A 4GCHG 2ZU5A 4BTUB 4AGKA 6CHAB 2P59A 2FDAA 3LJJA 3O8CA 2XRCA 3UQOA 4CBOA 2ZTYA 1G9IE 1T4VH 5CHAB 3SU4A 3TPIZ 3TGJE 2J2UA 2FX6A 1WTHD 3LKWA 1O3PB 1K9OE 1DX5M 4K1TA 1GVLA 3DUXH 3HKIB 3RXJA 3F68H 1LHFH 3F9HA 4Z6AH 1A0JA 1BMNH 4AG2A 1DT2A 1CHOG 1YYY1 1C2JA 3A87A 2XWBI 1OSSA 3GY6A 3LPRA 2A5AA 2EA3A 5JBCS 1HAZB 3RMNH 4BAHB 1AVXA 3D49H 2O8MA 4QT8C 1OP2A 2OQUA 3A8AA 4TWWA 5C94A 4DT4A 1C2MA 1O5DH 4X6PA 2PFEA 5E0GA 4Y76A 2JJ1D 1ZR0A 1BDAA 3M3TA 4Y8ZA 3GY8A 1EQ9A 3RXKA 2O8UA 3RXRA 2WV4A 3GOVB 1EJAA 3LGYA 2OBOA 1GI1A 2ZFFH 1SGRE 4MNYA 2F43B 2G51A 3Q77A 4ZKSU 1V2ST 1SQRA 2IOTA 3ESTA 3MNCA 4HI3A 2STBE 2WPKS 3RLWH 1QRXA 2BVSH 2BLWA 2BY5X 3LGIA 2CMYA 1DANH 3R0FA 2P16A 1P04A 1GMHG 1YP9A 1GI7B 2FLRH 2I6SA 1QBOA 1LHDH 1XVMA 1N6YA 1C5TA 3DA9B 1J16A 4CRFA 2HLCA 9LPRA 1AGJA 3G01A 4X6OA 8KME2 3TLOA 4FUDA 3Q3XA 5J4QA 5LGOA 5GJ4B 2PP6A 4RN6A 1AZ8A 1D4PB 3GY3A 1WTGH 2BOHB 2G81E 2UUYA 1CGHA 2FS8A 5DO4H 2BYAX 1TMBH 3H7OA 3LC3A 4K1EA 3A7XA 3U1IB 4BAQB 2FOFA 1UTMA 2ODPA 2QXIA 3D62A 3F0PA 4Q2KA 1V2OT 1C1QA 1IQIA 1SGFA 2FOAA 1QJ7B 3WWBA 1SGNE 3BEFB 1XUHA 2PUXB 2J38A 1TGTA 1OKXA 1CU1A 2GP9B 2ZPSA 2W7UA 1XXFA 3PTNA 1FV9A 5GCHF 4OS2A 4JZFH 4TY7A 4WMEA 1J14A 1UVSH 1HAIH 1QHRB 5ETXA 2AHME 2BB4A 4A1VA 1ESTA 5ESBA 1ZGIA 1O2LA 3UPEA 1HBTH 1TQ0B 1BUIA 1V2MT 2G4TA 1TPSA 1S6HA 2DE8A 1MKXH 2ZTZA 3MNBA 5EXNA 3BTEE 4KTSA 3UOUA 1MCVA 1MQ5A 1C5OH 5HMAA 2F9BH 2ZECA 1D3DB 4J2YB 1O5FH 3KQCA 1C1MA 2CF9H 5C0TA 2ZCLP 1DS2E 3MO3A 1QGFA 2HNTF 2V6NA 3TJOA 1UCYE 1DFPA 2OTVA 4HGCA 1W13U 5T6DA 2Q6DA 1S5SA 3OFND 4F49A 3SORA 4A92A 1QL8A 3LIWA 4K3JA 1C2LA 1E36B 3V12A 3UWJH 1SGCA 1CHGA 4AB8A 1UTPA 3VB6A 4MPVA 5K0HA 1F0UA 1WXRA 3SZNA 1BB0B 1QURH 3VG8A 2XBVA 3VB5A 3EDXB 4NZQA 5AVDA 1GHAF 3PO1B 1ACBE 2DE9A 4GAWA 2RA0A 4ESTE 2VWNA 2Y81A 2C8XB 2ANYA 4BXWA 2A31A 1MKWH 5EU8A 2A4QA 1K1PA 1P3EA 1Z8JB 3EQ0H 2ZGJA 3V13A 2V3HH 1GBIA 2WSSD 2BVXH 5L6NH 1L1JA 3MWIU 2BLVA 2OLGA 3VFEA 2R3UA 2Z3CA 4B71A 1IOEA 3RXCA 5PTPA 2WYGA 2J98B 4ABBA 1ZRKA 3BIVH 4J1YA 4B74A 2JJ2D 5HXFA 3SUEA 2AGGX 4ZCNA 5LH8A 2BZAA 1O2HA 2ILNA 2QF5A 1EKBB 1ESBA 1AWHB 5FBEA 3GY2A 2SGPE 3SJKA 1HJ9A 2NU0E 4SGBE 6GCHG 1FPHH 2LELA 3VB7A 4Y10E 2VIWA 1FXYA 1SC8U 3UREA 3ATMA 1HAYB 2H9HA 4IGDA 1TOCB 1MTNB 1DWEH 3EA8A 2RG3A 2BX3A 3BF6H 5FX5A 5GNDA 1LVOA 1GJ9B 1FX0B 3PWCA 4XD7D 1LKBA 1P2KA 3CS0A 5E8EH 3CNRA 4IS5A 2A4GA 4AFSA 1S6FA 2KR7A 5IYTA 4MVNA 3BG8A 1AHTH 3RMMH 2F4LA 4KTCA 1WUNH 1O2UA 1BBRK 2FMJA 2JKHA 2FIRH 3KIDU 1O32A 1U6QA 1SI5H 2G5VA 4NGAH 1AI8H 3ZIAD 1CGIE 1GHBF 4VGCB 1Y5UT 2A4RA 4WVPE 3TIUA 2HNTC 3PMBB 3RXVA 3OTPA 2QF4A 2FPZA 3S69A 3U98H 1GMDF 4FVBA 2BD4A 1PPHE 1VCQA 5GWZA 1HB0B 2CV3A 1NZQH 1Q2WA 1SGQE 2OC8A 1BMFD 2FTLE 3GDUA 1GJ8B 1BMMH 4WY3A 3W94A 3UNSA 4ZXXH 1CT4E 6ESTA 1C1SA 3T26A 1SFQB 5C5NA 1GI9B 3MYWA 1BA8B 1VITF 2JH5D 4YZUA 5FX6A 1V6DA 1HJ8A 2FOBA 2UWPA 1NFWA 5EODA 2ZDKA 4GHTA 1Y59T 4OM9A 1HUTH 4JYUH 1PPFE 2C8ZB 1KMHB 4O3TA 2AS9A 5KGOA 3RU4D 2Z6BD 3B9FH 1ORFA 5FAHA 1PPGE 4JK5A 4LXBH 5KEDA 3AASA 1CSOE 5JB9S 3SU6A 2VIVA 4E7NA 2GJGA 1QTFA 3PROA 3A85A 3A8BA 4BANB 1C9PA 1SR5C 4KKDA 4ISHH 2B0FA 2QXJA 5C1XA 2B5TB 3BEUA 4OS6A 3SV7A 1QB6A 2GZ7A 3A88A 1NC6A 1O3IA 4DURA 3HPTB 1ZMJA 3S0NA 2Z7FE 2GVFA 1O38A 2CHAB 5JDUB 5DKMA 2VU8E 3FKSD 1IQGA 2J97A 3B23B 1UVUH 2RDEA 2J98A 1MABB 4CH2B 4K2YA 5EQSA 3M3VA 3RLYH 2QF0A 2ZDLA 2G4UA 2JETC
chains in the Genus database with same CATH topology
3TJVA 5A8XA 1QJ6B 1PYTD 5DGJA 2GGVB 3SNCA 2VJ1A 1MU6B 3BTME 1K1NA 2VGCC 3TGIE 1GBAA 1KDQB 3ZVGA 1LHGH 3RXIA 1CT2E 5HGGA 4B75A 1IQMA 4ABFA 1OOKB 2TGTA 2Y5GA 4X2YA 1YPHE 3VXFH 2AGEX 4LOYH 1P9UA 1TONA 3BSQA 2FESH 4SGAE 1BHXB 1FUJA 1YF4A 1GBMA 1GBHA 1BIOA 1W7GH 1W0ZU 1XKBC 2G8TA 2TIOA 2XYAA 2ZPRA 4Y11E 3RDZA 2P93A 4UE7H 1HGTH 3WY8A 4B2AA 1NTPA 1AIXH 3IWMA 3LU9B 2A0QB 4D7FA 1KXFA 3SV9A 2SNWA 5I46H 1W0YH 3PB1E 2VIQA 3MH6A 1NRSH 1QA0A 4HZHA 2ZKSA 1N1LA 1VGCB 7ESTE 1ANCA 3M35A 2H9TH 2HPQH 4WMFA 1DICA 3RM2H 2ZGXH 5EPYA 2WPJS 3SNAA 2QA9E 2OD3B 1JIRA 2BTCE 4JYTA 3ZVFA 4ASHA 1HPGA 4MPWA 1WYKA 2Y7ZA 1TNLA 1VZQH 3CENA 9ESTA 1PYTC 2BDGA 1EASA 2XCNA 1EZXC 3KEEA 1ZRBA 4JCNA 1UJ1A 1K1OA 3R3GB 1VJ9U 4X2VA 1TYNA 1TNJA 1GCTB 1ZPZA 2CGAA 2STAE 2C8WB 1TPAE 3AVZA 1DM4B 2PHBA 1O2GH 5FXLA 4FUBA 3T28A 3MO6A 1CE5A 2QN5T 2F9UA 4XE4A 3VEQB 1UTJA 3B8JA 1A46H 2I6QA 1P2MA 1EPTC 3PMJA 1ZOMA 4ISLA 3SU2A 1AZZA 5EOKA 5LPRA 3TITA 4LZ4B 1A3EH 3A83A 1LVYA 4MQAA 2GDDA 1BJUA 1TABE 4DVAU 4XSKU 2ZFTA 2BD3A 2R2WU 2ZDAH 4AFZA 1HLTH 7GCHG 1MBQA 2SGFE 1RS0A 4Y7BA 1OWEA 3OX7U 1KY9A 1S83A 1UCYH 1OXGA 1PPZA 1FY5A 1HNEE 5AHGH 4IN1A 1GJDB 1ZHPA 1SGEE 6GCHF 1YPKH 1W8BH 2AERH 2B7DH 1LPGB 2G5NA 4YT7H 1GGDB 4FUHA 1TNGA 2BLOA 1UVTH 2QGRA 3N7OA 2GCHF 3SN8A 1P11E 1JXPA 4AFQA 3F6UH 4GVUA 3GISB 3RXEA 2H1UA 2CN0H 1KDQA 1DVAH 3FFGA 1FJSA 3FP8E 4D9RA 3FZZA 4BAMB 1GG6C 4K1SA 3MTYA 3QTOH 1C1WH 1A1RA 3JZ1B 2ZWLH 3H5CB 2W5EA 1GI3A 3DD2H 3RMLH 1JRSA 1P57B 2ZHWH 5EG4A 1O2NA 1F0TA 1C4V2 4M7GA 3I29A 2PTNA 4TYDA 3UTUH 1NS3A 1GJ4H 1Z6JH 4YESB 1SHYA 2R2MB 5DP3A 1QCPA 2FI3E 1J15A 3GCOA 2J4IA 1J17T 1LVBA 2BDIA 2C4FH 4CR9A 1L4ZA 4R8TB 3QN7A 3DFLA 3GCNA 1PQAA 1PJPA 1IQJA 1ZJKA 3SUFA 1LMWB 1GPZA 1FAKH 1NM6A 4IW4E 1HJAB 2ZI2H 1P12E 3SU5A 3NWUA 1QIXB 1TGBA 2P8OC 4UEHH 5SGAE 4IBLH 3SJ9A 2ODQA 3NXPA 3SNEA 4F4OC 4MDSA 1TMUH 5GXPA 5DP4A 3E91A 1XM1A 1ZGVA 4BTTB 1CA0C 5FCKA 1YCPH 4X8TH 1MD8A 1WCZA 1O3KA 5DJ7A 1NRRH 3LJOA 3MNSA 1BTYA 1Z71A 4ABGA 3NPSA 2FP7B 1UHBB 4CRGA 1G3BA 5H4IB 1NFYA 2B8OH 2OBQA 1SGFG 2Z9JA 4UFEH 4KP0A 1IQFA 2XC4A 3O8BA 1LVMA 3M3SA 4FU7A 2A7HA 1NFUA 4GSOA 2K1QA 2V35A 1QL7A 4BXSA 1DXPA 1T7CA 2LPRA 2M5TA 1YLDA 2R0LA 4H6TA 5AFZH 5LPFA 1T4UH 3HKJB 1ZSLA 1QFKH 3FAOA 2WUCA 3DT0H 2QC2A 1YGCH 2BOKA 2ZGCA 1FNIA 2H2ZA 1SFIA 4CRAA 1XKAC 4MLFB 3SGAE 3TH3H 5F6MA 1QQUA 3K9XB 3GYMA 2ZDNA 2PR3A 4ABJA 4H4FA 1TWXB 1P03A 1BTWA 1QA7A 1GJ5H 3ZVAA 1F0RA 1F7ZA 1ZPCA 1GJ7B 4ZKRU 2ANMH 1C2IA 1P01A 3RXMA 1C4U2 1Z6EA 1BRCE 3K6ZA 1BMAA 1NESE 1T8MA 5FPTA 1RJXB 5JBAS 1T31A 1AUTC 1MCTA 1BCUH 4D8NA 5L2ZH 1D6RA 1YKTA 2H5CA 1AUJA 2BD5A 3DFJA 1DSTA 1SLWB 5C67A 2SGQE 2HGTH 4WXVA 3ZZ7A 3QWCH 1BBRH 4X1SU 1DXWA 4K8BA 4AB9A 1AFQB 2QCYA 3NZIA 2FOMB 1GG6B 3M36A 2DUCA 1ETSH 1TQ7B 4X0WU 1V3XA 1DOJA 1EP5A 1TPOA 4O97A 3ZZ9A 1RD3B 3SQEE 4BOHA 4K8YA 1AN1E 3ZVEA 1RTKA 1V2WT 2KAIB 5G4BA 1HRTH 3PMAB 3RXOA 1GWAA 1GBLA 1ZHRA 2Y5HA 4XBDA 3ZZAA 3V0XA 3RUOA 1FY1A 3FP7E 2W3KA 2ZTXA 3EA9A 2BY6X 4AFUA 2D2DA 4I8LA 1ZMNA 1NO9H 3UFAA 1GBEA 4H42U 1KTSB 3SOSA 5T6GA 3GCHC 2VWLA 1GVZA 1TAWA 2ZFQH 1C5XB 1LTOA 1YPEH 1A61H 2F9NA 4PROA 3SHCH 4WJG2 1TX6A 2EI8A 3SI3H 1S85A 3OYPA 2D8WA 3FZDA 1SGPE 2PTCE 2FI5E 2P8OB 4MNVA 2AGIX 2H9EH 1AE8H 2VWMA 4ISNA 4ISIH 2W7SA 1TE0A 3RU4T 1EAWA 1L2EA 3LH1A 2SFAA 3RM0H 1AD8H 1AO5A 1BITA 4TPYA 1BTZA 4NFFA 5FBIA 4AYVB 1TBRH 2GV7A 3PLPA 1OWHA 3T2NA 3M61U 1KSNA 4CHAB 4FUIA 1Z8IB 4B2BA 4NFEA 1O37A 1UHBA 1XVOA 2OC7A 1MAXA 2AFQB 4Y8XA 1JIMA 1JWTA 1OWJA 2Y80A 1C9TA 7LPRA 4Y7AA 5L2YH 1ELTA 3VXEH 3SHAH 3ZZ8A 4GUXA 1E37B 1Z8GA 1EATA 1GDNA 1ZJDA 2W3IA 1GBTA 3SNBA 1TNKA 1V2NT 2BVRH 1TMTH 1ARCA 1GI5A 2VIOA 1SSXA 1C2FA 2V3OH 2XXLA 2O9QA 4FUJA 4TPIZ 1W14U 5I25A 2BQ6B 1MTVA 4NSYA 3NUMA 1BRAA 3S7KB 2YNBA 1A0HB 3E90B 1UK3A 1KTTB 3BTWE 1VCWA 3E3TA 4Y0ZE 2ZFPH 3QLPH 1TIOA 3Q00A 1MU8B 2SGDE 1SLUB 1DITH 5B6OA 1CT0E 1OPHB 1THSH 2R3YA 3P6ZB 5J4SA 1EOLA 1YPJH 3ZVDA 1SLVB 1MTSA 4A5TS 1H8IH 2AMQA 1UTKA 1DE7H 1C2HA 2O8TA 3STIA 2UUFB 1C2DA 1G3EA 1A5IA 2RA3A 4MNXA 5GDSH 1XX9A 4Y6DA 2XC5A 4GHQA 1UK2A 1G3CA 5GIBA 2ZHFH 1BTXA 4ZROA 1TFXA 1RTLA 1XMNB 1O5BB 4DY7B 3EGKH 3TJUA 1Y3UA 1V2KT 1C2KA 3MU5A 4E05H 2GT7A 1OP0A 2KAIA 2GCTC 4ZKOU 2OQ5A 2J92A 2Q6GA 2XNIA 4Y8YA 3VGCC 2AIQA 3V3MA 4R0IA 1BTPA 4CBNA 1Y5BT 1ELGA 3A7YA 3A81A 1C5NH 1KLJH 1NPMA 1O2RA 2VINA 3RMOH 1GHVH 1SOTA 1GI4A 4I7YH 2XTTB 1ZPBA 4HTCH 1QJ1B 1EAXA 3LOXA 1XUFA 1ELVA 1TRYA 1AQ7A 2NU4E 4FVDA 1ZLRA 8GCHF 4WH6A 2FEQH 2WPMS 2ANWA 2LNCA 2ZFSA 3BG4C 3GCTF 3QO6A 1DLKB 1YC0A 3L3TA 4GCHF 1HXFH 1Y3YA 4CRCA 2HRVA 5EW1H 1O30A 4X1RU 3QK1A 1EX3A 1ELDE 2GX4A 2FO9A 2P3UB 1EZUC 4D9QA 5DK1A 2O8LA 3BTHE 1EZSC 1BQYA 5EXMA 4FU8A 2QY0B 2A45B 8ESTE 1OWKA 1CHOF 2BDHA 1G2MA 2ZPQA 2CJIA 3HATH 4NA7A 3URCA 1O2PA 1YM0A 2GZ8A 1O3AA 1KXDA 3QX5H 2FLBH 1UO6A 1F5RA 5T6FA 1GBKA 3RC6A 1NT1A 1OWIA 1PQ8A 2GTBA 1GJBB 3S9BA 1BBRE 3A8DA 1S82A 4TY6A 4U32A 2W26A 4DG4A 4ABAA 2ZHQH 2XC0A 1KYNA 1P05A 1V2TT 1ZMLA 2WV5A 1O2KA 4I31A 2BDYA 2P94A 2OUAA 3PM3A 1T8LA 2VIDA 1C1RA 3SGBE 2Y5FA 1YPMH 1WSSH 2OINA 1GL0E 1CVWH 1O5CB 4WH8A 4ISOA 1ZTKA 1XUIA 2F3CE 1D9IA 1TOMH 3OY5U 3VPKA 1V2PT 3T25A 3QGNB 3ZZDA 1ARBA 1SGYE 1GBJA 4I8GA 1MUEB 4CH8B 3SU3A 3BV9B 1F0SA 1GMHF 2XBWA 5E2PA 3TU7H 4O9VA 3A89A 1E35B 1HAXB 2SGEE 4FXGH 2FWWA 3ZYDA 1C5RA 4AOQA 2Z3DA 2VVCA 5C1UA 1V2UT 1PQ5A 1G32B 3MFJA 1NN6A 2ZHDA 4ABDA 4ABIA 1IAUA 1TGNA 5EXLA 2AMPA 5CMXH 3KQEA 4X1QU 3I77A 4BNRA 3VB3A 3ATIA 3ZV9A 4YLUA 2ZQ1A 1MKWK 1K21H 5DP7A 2C90B 1H8DH 3AAUA 1MMJN 1RIWC 4KGAA 1MZAA 3ENSB 1AVWA 1G3DA 1O2MA 1SVPA 4X8UH 4MPXA 3LGUA 1C5WB 4NIYA 3ZZCA 4XOJA 2HALA 1G36A 1HAGE 1WBGB 2AH4X 2EC9H 1MQ6A 3EAJA 1ABIH 1CBWC 1LHEH 1TB6H 3M5NA 3E0PB 1BOQA 3LONA 3K2UA 1GHYH 1GI0A 3M37A 3MU1A 1IHSH 1K22H 1G2LA 1E0FD 1GMCG 3A86A 1HCGA 3OU0A 1TGSZ 1GJAB 3BTTE 4THNH 2PKSC 2UWOA 1V2JT 3ELAH 1O2SA 1ZTJA 3MHWU 1HAOH 2C93B 2FS9A 5F8ZA 2Q6FA 2C8YB 1KLIH 1GBDA 4JZEH 4DW2U 1HIAB 4NCYA 5BPEA 1H9LB 2QYIA 1HAPH 5GCHG 4DGJA 1QB9A 2JH6D 4B2CA 1UTOA 5EPNA 1AB9C 6LPRA 4BAKB 3M5LA 4X8VH 1OYQA 2D26C 5E0HA 2ALVA 5DPAA 1BRBE 1FY8E 4O03A 3AAVA 4INKA 1DSUA 5C5OA 1DDJA 1G37A 5EW2H 2ZP0H 2XBXA 5CHAC 1HDTH 1C5LH 2GT8A 1MAYA 1G30B 2J9NA 3CP7A 4X8SH 1A5HA 4E7RG 3QZQA 4WMDA 5ESTE 2B9LA 4K5ZA 5DG6A 1HAVB 3E0NB 1C5YB 4B73A 5TCCA 5E0JA 4Y79A 3JZ2B 2ZNKH 1SPJA 1P06A 4UONA 3U69H 2AMDA 3SU0A 3SJ8A 1EAIA 3KCGH 3A80A 1YCPM 5EQQA 2ZC9H 4I8KA 1B7XB 5JPMH 4WWYA 2WPHS 5A09A 4YM9A 2AEIH 2JETB 2TGPZ 1GHAG 3BEIB 3TK5A 1PPEE 1TALA 3UNRA 5DP8A 3Q76A 2VGCB 5BRRE 1N6XA 1GBCA 1J9CH 1GJ6A 1XXDA 2P3FH 1KXEA 1VR1H 1ZZZA 4ZMAH 1GHZA 1ELEE 2QIQA 1O31A 3ODDA 2GDEH 3A7TA 4U2WA 2NWNA 1Z8RA 1RGQA 2RDLA 1DWBH 1GJCB 3RP2A 2BDBA 3GYLB 4B76A 1P0SH 3RXAA 3SUDA 3BN9A 2A7JA 3L6PA 4FUEA 4I32A 4H6SB 2H5DA 4A1XA 1H9HE 1RFNA 3LDXH 3U1JB 2EI7A 3GDVA 4XDEA 3KGPA 2R0KA 1WU1A 1UVPA 3BTQE 3SI4H 4A6LA 4FUFA 2PW8H 4NIXA 1NFXA 1O36A 3K6YA 1C1PA 3U8TH 3OY6U 1J8AA 1B5GH 1QRWA 1ELCA 4LK4A 3H7TA 1WQSA 1O34A 1Y3WA 2G00A 3TVJB 3PMHB 1K1JA 5GPIB 2ZIQH 4JMYA 5F8TA 3Q3YA 3L33A 1EJNA 1HAHH 2ASUB 1SQAA 2TPIZ 1HIAA 4UFGH 4D7GA 1GBFA 1Y3XA 2JH0D 1EP6A 2J34A 4AN7A 3SJOA 1T8OA 1GHBG 1P9SA 1TBQH 3RXDA 4YO9A 1O3MA 1FIZA 2C3SA 1GCDA 1E38B 4ZHAA 1RXPA 3MMGA 1C5ZB 1GMDG 4UDWH 3T29A 3O8RA 4OGXA 5FCRA 5FPSA 2A1DB 1EB2A 3IG6B 1THRH 2QXGA 4XFQA 4YOGA 1EPTB 4ZUHA 1O35A 1C5SA 2VIPA 1VITG 1KXCA 2FTMA 4OS7A 1HAVA 1ID5H 2VH6A 1Y5AT 4YOIA 2PWXA 2XWAA 1A4WH 3LH3A 2FI4E 1W7XH 3PO1C 3EYDA 3MNXA 4HFPB 1GL1A 3ITIA 3E16B 1O3LA 3NKKA 1GI8B 1MTWA 2AYWA 3QZRA 1P2QA 3SV6A 4O3UA 2ESTE 2GD4B 5JB8S 2WUBA 1FONA 1L1NA 1O2JA 5DP9A 1P2IA 1V2LT 1JBUH 4DJZB 1CGJE 2ZQ2A 4MNWA 1FDPA 1AMHA 4OS4A 4ZHMU 2F9PA 1Z1IA 2ZA5A 3SW2B 1L4DA 1OX1A 3HK3B 2BX4A 1RRKA 2F91A 3FP6E 3ZVBA 1ZTLA 1O5EH 2Y82A 3O8DA 4NZLA 3RXLA 1MH0A 1XUJA 3PV4A 1NY22 2BY8X 1GDUA 1O3HA 2ZCKP 1SB1H 1W11U 3UNQA 3MH4A 2FX4A 1W2KH 3P8NA 1UMAH 3A7ZA 2Y6TA 1PPCE 1UCYK 1O3OA 2BLQA 5LPEA 1EUFA 1MTNC 4NWLA 3URDA 1SL3A 1TRNA