4AB8A

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
total genus 56
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ab8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ab8A02
1GJCB 2PTNA 3EYDA 3PWBA 3SU4A 3W95A 2SGDE 1PPGE 1O3PB 4ISIH 4CH8B 4CBNA 1BBRK 1D4PB 2XCNA 3STJA 4HGCA 1TX7A 5A8XA 4ISHH 2BM2A 1KSNA 3RP2A 3UNSA 3ENSB 1D6WA 3S9BA 2VU8E 1DWBH 3MU0A 3M37A 3H5CB 1T7CA 3BTTE 1JRTA 2A4OA 3PM3A 4AGKA 1DSUA 3MWIU 3UOPA 3UUZA 4Q80A 5FPYA 1GI6A 1BMMH 1ARBA 5FXLA 1G2MA 5JBTA 3C1KA 4D7FA 5GCHF 1BBRH 4VGCC 1XUGA 3PMAB 5HM2A 1IQNA 3LH3A 3DT0H 1VJ9U 1L2EA 5ABWA 1TPPA 5I25A 1T4UH 3RXCA 1O2YA 2F9UA 5A8ZA 1V2ST 1V2QT 2XNIA 3GDUA 3PLPA 1IQKA 1TRMA 3E0PB 5BRRE 1NFXA 1QRZA 3T26A 1IAUA 5DG6A 1DWEH 1GI5A 1FY1A 1QFKH 2ANYA 2OC8A 1DE7H 3TH4H 2TGAA 2FTLE 3RXMA 1TPSA 4K5ZA 1WV7H 1ZYOA 3O8RA 5EXLA 3KQDA 1P2IA 5IDKA 1O3HA 1OSSA 2HNTE 1AWFH 1YPLH 4O3UA 3RMLH 1A61H 1ORFA 1UCYH 1ZHMA 3ELAH 2FXRA 1ANEA 1DFPA 1FXYA 2BQWB 2R2MB 2ZHQH 4NIVA 3E1XB 1EAUA 1A0JA 3E90B 1EX3A 5DJ7A 1P2KA 2EI8A 2BDIA 3LU9B 7KMEH 2ZDMA 3K9XB 1HJ8A 1ABIH 1BHXF 2UWOA 3S7HB 4YOJA 2VWLA 4X0WU 1C5LH 3RXQA 1ZRKA 3ODDA 1F0RA 1CO7E 3PO1C 3QUMP 1A4WH 1HAHH 4HFPB 3A87A 4XBBA 1TNGA 1H9HE 1O2PA 3AAUA 3V3MA 2P94A 1OS8A 1MZAA 2A4GA 1ZJKA 1AFEH 1A5IA 2HGTH 5C5OA 1V2KT 3SN8A 3RXTA 4BAQB 1TFXA 1KLJH 3O8DA 4TY6A 1OP2A 1D3DB 1HBTH 1MTWA 2Y7ZA 3AW0A 4NFEA 4Y6DA 2AERH 3MNSA 2FS9A 2HVXA 3RU4T 2O8UA 1UO6A 1EB1H 1GJAB 1SGCA 2ZFRH 1BJUA 3IWMA 1TNKA 1C5XB 3GY4A 2XWAA 1P12E 1C2HA 3IITA 2KAIB 5DP5A 1JRSA 1O3FA 1L1NA 1T8MA 3BEFB 4Y8XA 3PYHA 1VCQA 2XC0A 5AF9H 1GJ4H 3RXJA 4NG9H 5C67A 2ZQ2A 3D65E 3RXVA 5JYIA 1AVWA 4ZH8A 4LZ1H 1UMAH 4NIYA 1GGDB 1G32B 4X6MA 5A09A 3HGNA 1TBRH 3LJJA 3M3VA 3HKJB 1FLEE 4CR5A 5LH8A 2R3YA 2BDAA 4BAHB 2AMQA 2QXJA 1NU9A 4YLUA 1NPMA 3QDZB 2PKSB 1W13U 1W3CA 1ZSLA 1HAVA 1GVZA 3SJ9A 2ESTE 1S82A 1O0DH 1W7GH 1NTPA 1SMFE 1KXBA 3SO3A 3E3TA 2C8XB 1Q31A 1H8IH 4IW4E 1THPB 3VEQB 4BTTB 1O34A 3P92A 4MNVA 1YM0A 2FX6A 2HALA 4RN6A 3OTJE 2FWWA 3MU5A 4Y7BA 1DUAA 2O8LA 2OP9A 3V7TA 6CHAC 1NT1A 3K2UA 4QT8C 2QA9E 3SU5A 4K1EA 2F9VA 4O9VA 1V2PT 3KNXA 3UFAA 4CH2B 8LPRA 1QR3E 1UHBB 2A31A 1XUHA 3EA7A 3ZV8A 1A0LA 1GL1A 2F83A 1V2WT 1PPEE 1V2RT 1X7AC 3U9AH 1L0ZA 1KLTA 2EA3A 4DGJA 3ZVCA 1LCYA 2QIQA 2VJ1A 1V2MT 3NZIA 4GCHG 2FTMA 1WU1A 2PKAB 2STBE 4LOYH 2Y81A 2D8WA 3UQVA 1DVAH 5GWZA 1LVOA 2O8MA 4GAWA 4Z0KA 3B9FH 2AEIH 3BTEE 1LHEH 1Z8RA 1UK4A 5A2MH 5C2ZA 1RD3B 4ZMAH 1NY22 1QL7A 4WH6A 1SQTA 1JIMA 5C1UA 1LDTT 3FVFB 4IS5A 1RTFB 3SNCA 5E2PA 2ZPQA 1Z6JH 1J14A 1LPZB 2ZZUH 1IQEA 3K65B 1TQ7B 5HMAA 3RMMH 3TITA 2TGPZ 1KXCA 1WUNH 1S6FA 4ISLA 1C5PA 2NU4E 3A8DA 4KELA 1OP8A 3MHWU 1BTWA 5JBAS 2GV7A 1S85A 1C5VA 1P8VC 2XYAA 1V2LT 5PTPA 3MH5A 1QCPA 2I6QA 4OS1A 1ARCA 4FUDA 3AVZA 1WTHD 1MQ6A 3MH7A 3OY6U 3BG8A 4BOHA 2SGQE 1YPGH 2AH4X 4GLYA 1B7XB 4K8YA 1BTUA 1J8AA 2ZU4A 6LPRA 4U30A 3DD2H 1P05A 1P2OA 3P8FA 2WPLS 2ZWLH 3LGWA 3SJ8A 3HATH 2P95A 1GCDA 1AWHB 1ELTA 4UFDH 3BSQA 5F8ZA 4NCYA 1CHGA 1C1MA 1D3PB 1TA6A 2BB4A 2XW9A 4MPWA 2BD5A 5K0HA 1GI9B 2SGAA 5EXNA 3TGIE 1YBWA 1SGDE 4A1XA 3U8OH 3VFEA 4AG2A 7GCHG 2GGVB 4WJG2 5EXMA 2A7JA 1A3BH 1O5EH 2P8OB 1OWEA 4MLFB 1FUJA 1O36A 1GWAA 1F2SE 2VGCC 1EPTA 2SNVA 1DANH 2OLGA 1P0SH 2W5EA 2VB0A 3GY7A 4Y76A 1H1BA 2FMJA 4MNWA 3ZVBA 1C1RA 1AY6H 5B6OA 1MBQA 1SGNE 1PPZA 1VITF 3M5OA 3NPSA 1GBIA 1W7XH 2FI5E 3UY9A 2BLOA 1SGFA 1IQHA 5TCCA 2J94A 3MTYA 1O3MA 1FI8A 1MAYA 3A7VA 4UFFH 1EJNA 7ESTE 2G4TA 4AZ2B 1TX8A 1TPAE 2EI7A 4R8TB 1KYNA 1EZUC 2TGTA 2Z9KA 3ZVEA 1PPHE 1YPEH 1V2TT 1FV9A 1O3DA 1F0TA 1QIXB 4MNXA 1C1WH 1DWCH 2ZGXH 1NROH 4DVAU 3NKKA 1SGIB 5L30H 1A5HA 4WXVA 3UWIA 3BF6H 6GCHF 4YO9A 2VWOA 2ZDNA 5FCRA 4Z6AH 2Z3CA 4INKA 2GCTC 4FUFA 3MO9A 4AFZA 3GOVB 1P03A 2W7SA 2PR3A 2TBSA 1HPGA 2SNWA 4IC6A 3S9AA 2O8TA 3MU8A 1CA0C 3OX7U 1EB2A 1V3XA 1HDTH 1PYTD 1O2JA 3LGTA 1QQ4A 1EJMA 1TA2A 2THFB 2GP9B 4AOQA 5IYTA 1N8OC 3KQBA 4XDEA 3LDXH 1HAOH 2ULLA 3NUMA 5AHGH 2H2ZA 5F8XA 2AYWA 2V6NA 3T27A 3PB1E 1P3CA 4CREA 3SGBE 4ABHA 1TWXB 3A7YA 2GT7A 3LGVA 1MKWK 1FN8A 1MCTA 4D9RA 6ESTA 1MU8B 4NSYA 3SBKA 3E16B 1ZGVA 4UFEH 3ZZ5A 3F9GA 5EU8A 2GKVE 1GI0A 4I8HA 1C2GA 1K9OE 1FQ3A 4THNH 1LPKB 4X8UH 1GBCA 1SB1H 4DT7B 1T4VH 1GHAG 3GY6A 4HZHA 1P2NA 1DXPA 2PHBA 1TABE 2XC5A 4I8JA 1P2MA 4UE7H 2SGFE 2JETB 3K6YA 2R0KA 2OC7A 1T8LA 1YF4A 1AZZA 2WINI 3UIRA 1O39A 2FS8A 2HOBA 1GJ5H 2NWNA 3L3TA 2JKHA 2QGRA 3PMJA 5FAHA 1KXDA 3AW1A 3P8OA 1XXDA 4X8VH 4YM9A 2FEQH 3MFJA 1G3EA 1LTOA 1AI8H 3BG4C 4OGYA 2ZGBH 2Z9IA 1HAIH 2FLRH 1SLXB 4JZ1A 1Y3XA 1NRQH 3EA9A 1O3CA 2PGQB 1DXWA 3RXDA 2WV5A 3ZZ4A 1D3QB 3B23B 3ZZ8A 1G36A 2FOFA 1O33A 1CQQA 4FU9A 8KME2 1FAXA 2HPPH 1GHBF 3SGAE 1O2XA 1V2OT 1RFNA 4WXIA 1CHOG 1CA8B 4FUJA 1MD8A 3CENA 5JBCS 3M35A 3GCOA 2W7UA 1C2JA 2OQ5A 1GDUA 4KTUA 1HUTH 3TLOA 4AG1A 2ZFPH 4BAMB 5EODA 2FESH 1WCZA 1O3BA 4GSOA 3SHCH 4X8TH 5ETXA 1OYQA 1CU1A 1DLEA 2FLBH 2G52A 4Y7AA 3JZ2B 1SGYE 3JZ1B 1DITH 3M7QA 1U6QA 4WMFA 5CMXH 1HAYB 2F91A 1A3EH 3ZZBA 2H1UA 1QB9A 3BTHE 1OWKA 1UVTH 1VZQH 1WTGH 2G4UA 3T62A 1BIOA 3CP7A 3GY2A 1C5NH 5TCAA 1C2LA 1HB0B 1FN6A 1J9CH 1S0RA 5F6MA 3RXUA 1AGJA 1UTQA 3TH3H 3RXEA 1TNLA 1TRYA 2PWXA 3BTWE 2FOAA 1K1IA 4HTCH 3NXPA 1RIWB 1DUEA 1P57B 2FYRA 3QO6A 3UOUA 1XKAC 4FVDA 1QHRB 3RMOH 1SBWA 1NM6A 2AS9A 2JH6D 5FCKA 3SV2H 1O3EA 2GT8A 3LPRA 4NFFA 4JZIA 4CBOA 2P16A 3A8CA 3G01A 3RC5A 1GHVH 5L2YH 3TJNA 1UHBA 1AN1E 4FUBA 2ZFTA 1ID5H 3RXKA 3SI4H 1OPHB 2QXHA 2R0LA 4ISOA 4Q7ZA 2FOBA 4WVPE 4TY7A 3UWJH 4CRDA 1EPTB 2HWLB 3LOXA 1SGEE 2HPQH 3A7WA 4XOJA 4ZKRU 1F7ZA 1PPFE 1ELDE 3ZZ9A 5DP3A 3CS7A 3A7XA 5A0BA 1NO9H 1DWDH 4ASHA 4U2WA 1O37A 1CGIE 3BV9B 1PPBH 4YTAA 1O2IA 2PFEA 4J2YB 1MAXA 5GDSH 1O3NA 3DFLA 2M5TA 1QJ6B 4OS6A 4Q7YA 4UONA 1MU6B 3RC6A 1XVMA 2C8WB 4CRBA 4D76A 3LIWA 2ZO3H 1CT2E 2OCVB 1Y3WA 6CHAB 2Y5FA 2A32A 4UEHH 3RU4E 1BRUP 1SOZA 5F03A 1O5AB 2CHAC 5AVDA 4NIXA 4I8LA 4AN7A 4U32A 1RIWC 2FYQA 4YZUA 4FVBA 2Z6BD 2BY9X 4K1TA 4NZLA 1BZXE 1G3BA 1GMHF 1EJAA 2B5TB 3PTBA 2Z9JA 4ZROA 5DO4H 3Q3KA 3TPIZ 2P3FH 3U1JB 3ZVGA 2JH0D 1ELAA 2GZ9A 2ZU1A 3S69A 2ZU5A 1DICA 1XVOA 4FUHA 3LGYA 2ZHEH 3M7TA 1O3LA 3QGNB 1Z1JA 2VNTA 1TQ0B 4H4FA 2PSYA 2UUFB 4IMZA 2WUBA 5J4SA 1UK3A 2C3SA 2F9PA 1AB9C 1C2DA 3A86A 2ZHWH 4NA7A 4B2AA 1F5LA 3Q77A 2GV6A 1TNHA 3OU0A 2WV4A 4D9QA 1AFQC 5FX6A 3VB3A 1Y5UT 2ZG0H 1HRTH 2A45B 3KIDU 5EQQA 4Y71A 3GCHB 1NN6A 2R3UA 3SV8A 2FIRH 4NSVA 2FX4A 4I32A 1GJ6A 3WY8A 1FDPA 1BOQA 3C27B 1WAYB 4OS4A 1CT4E 3K6ZA 1F5KU 2ZI2H 2VVVA 4XBDA 1GBMA 4XSKU 1P06A 1GJ7B 1MZDA 1TMUH 3BTGE 2PLXA 5C3NA 3V13A 4Y0YE 2QAAA 1YCPH 2IOTA 3GCNA 3HK3B 1BB0B 1SGQE 1BMAA 1V2VT 1P3EA 1ZGIA 1A7SA 5GIBA 4Q7XA 1QBNA 4XFQA 1F0UA 3EQ0H 3M5LA 4A1VA 1E0FD 3AASA 5T6DA 1BRBE 5H4IB 3SZNA 3EAJA 3M5NA 2IPHA 1CSOE 1PQ5A 1THRH 1Z8JB 1ETRH 1OYTH 3A7TA 1ZTLA 1QBVH 2ZGJA 3SNEA 1N8OB 1QB6A 2C90B 4IC5A 2QF3A 2QY0B 4ABIA 1SVPA 1AKSA 3KF2A 4MQAA 3U1IB 2Y80A 3SUGA 2ZFFH 4YESB 3ZZ7A 3T25A 1DS2E 1SGPE 4XBCA 3TU7H 5A0AE 1SG8B 1ZJDA 2BD9A 1Y8TA 1SGRE 2QV1A 1HV7A 4X1NU 1C5TA 3A81A 3SNAA 1K1NA 2H5DA 3SW2B 3UTUH 1YC0A 2P3UB 3SU3A 2BDYA 4ABBA 3SQEE 5F8TA 3LGUA 3PO1B 3RDZA 4MPUA 2DE8A 1T31A 1XKBC 1UK2A 2Q6DA 1MTNC 4UD9H 3QZQA 3GYLB 1ZZZA 1G30B 1TNJA 2BY6X 2J4IA 2XC4A 4AORA 4DURA 1GBEA 5SGAE 1DM4B 2B9LA 1NRPH 1P10A 3RXLA 2GCTB 3FP8E 1ESTA 2O8WA 2ZDKA 4TWWA 5HYOA 2NU3E 1RJXB 2Q1JA 3LC5A 4KTCA 4ABGA 1MTVA 2BMGB 2ZU2A 3V12A 3SGQE 1HJAC 4NWLA 3TNSA 2BD7A 2A4QA 5DKMA 1C1SA 2BLWA 2XBVA 1P02A 3QTOH 1E37B 3GCTG 4DCDA 2TPIZ 1GMCF 2V35A 3RXFA 2WPIS 2RA3A 3PTNA 4E7RG 3ZYDA 4H6SB 5EW2H 1W12U 1AB9B 2CF9H 1TGTA 3FFGA 1GDNA 3L6PA 3SU6A 5JPMH 4U01A 1ZSKA 3GDSA 1BMLA 1N1LA 4I8KA 1D6RA 3T29A 1BTZA 4KP0A 3QK1A 3TJVA 1O5DH 4NGAH 3HKIB 1P04A 1FMGA 2ZECA 4OS2A 1VR1H 3A88A 4KGAA 4Y8ZA 4ZHMU 1BRAA 3H7TA 1YKTA 1YGCH 1CGHA 1C1OA 1L1JA 4X1SU 1WQSA 3A89A 1GVLA 4AB8A 1BTXA 1F92A 3LH1A 3RM0H 1C5RA 1K1PA 3ATKA 3E0NB 3UR9A 1BHXB 1FZZA 2R2WU 1CBWC 3RXPA 4A6LA 1GI7B 3VB5A 1WBGB 4O97A 4X6NA 1AVXA 1HIAA 3BTFE 5DP4A 4BNRA 1OX1A 1LVYA 1A1RA 1UTNA 1GBHA 1EOJA 1C1QA 2G51A 4JZFH 4NA8A 3V0XA 2ODYB 1A46H 1AUJA 1MKWH 3KQEA 3GY5A 2FOCA 4Y10E 2QF0A 2Y7XA 2A7HA 5A0CA 3QX5H 3B8JA 3Q76A 5FHTA 1M9UA 3BEUA 4DY7B 1XUIA 2QYIA 3AAVA 3TK9A 4GPGA 2VIQA 1P2QA 2ZDVH 4SGBE 1GI1A 5EW1H 1YPHC 2V3HH 2C8ZB 1MD7A 1KTTB 1AFQB 2J38A 1LHGH 2Z3EA 2FOEA 1CE5A 1MQ5A 1HLTH 3ODFA 2PGBB 5J4QA 5K7RA 1S6HA 1OWIA 3NCLA 2CMYA 1RGQA 2SGPE 5ESTE 2J9NA 1C2KA 2OUAA 5JB9S 1BMNH 1LQEA 1GJ8B 1TGCA 1TE0A 4INHA 3DUXH 3F6UH 2WPKS 5GJ4B 1XM1A 1BQYA 4LK4A 2QN5T 2ZF0H 4K2YA 1K1MA 2PW8H 2ZDAH 4TWYA 4ESTE 1B0FA 3GICB 1CVWH 1GI4A 2ALPA 2BHGA 2AFQB 2ZTZA 3SJIA 3ZVDA 2BDGA 4B74A 3N7OA 1HGTH 2IJOB 3ITIA 2RCEA 3H7OA 1O2SA 2OC1A 1FY8E 1O38A 4AYVB 2ZPSA 3UPEA 3EDXB 1LVBA 1W10U 2QC2A 3M7UA 3SNDA 1AUTC 1HYLA 3M61U 4ABAA 8GCHG 4JYTA 1SLVB 3M5MA 1MKXK 5HGGA 1GHWH 3QWCH 1O30A 5EPYA 1S5SA 1GI8B 1IHSH 1HAGE 2XRCA 1AHTH 1BDAA 3LJOA 1TGBA 1SI5H 4RKJB 1AD8H 2VWMA 3A82A 1GMCG 2BXUH 4WH8A 3FZZA 2ZPRA 1C5UA 3QZRA 2HLCA 1TX6A 3A83A 4LZ4B 1FY3A 1EQ9A 3Q3XA 3ZZAA 3OYPA 4JK6A 2G5NA 4AB9A 1PYTC 2NU1E 1G3CA 1GHXH 1XUKA 2BY8X 1Y3VA 2ZIQH 1OWHA 2AGIX 3RXSA 2XWBI 4WY3A 2ANKH 1Q2WA 1SFQB 3ZZDA 2ZCHP 1G3DA 2UUJB 1AQ7A 4TPIZ 1C5ZB 4VGCB 1V2JT 2Z3DA 1UVOA 2KAIA 2OBOA 2J34A 3I77A 1FPCH 3GY3A 4BXWA 2GX4A 4MDSA 5E0JA 2PTCE 2EI6A 1QGFA 2CJIA 2OD3B 1C1TA 1C4U2 4Y11E 5GXPA 1K1OA 1ZPBA 3UREA 3Q00A 4JZEH 1Z1IA 1ANCA 1VJAU 2VWNA 1MBMA 1C2MA 3SJKA 3P70B 3E6PH 1GMHG 1O5BB 1O2ZA 1H8DH 1TGSZ 2FO9A 3Q3YA 1SLWB 1O2QA 2DUCA 1JIRA 3M3SA 1SGFG 1UCYK 2D1JA 1EAIA 1GGDC 3UNQA 2UWPA 1SOTA 2C93B 1NS3A 1ESBA 3ESTA 1TB6H 3ZV9A 5E2OA 3KN2A 3TK5A 1C2EA 2ASUB 2AGEX 1TAWA 3MO3A 1EXFA 3SV6A 2DE9A 1OWDA 3RXRA 1GBAA 3SUEA 1GMDF 4ZKNU 2XBWA 1WYKA 1QY6A 2VH0A 1MH0A 3MNCA 4B76A 3P17H 1C2FA 4MPXA 1RRKA 4DW2U 2A5IA 2BDBA 2IN2A 2A5AA 2BZ6H 3RU4D 1GHZA 2C4FH 4DG4A 2GZ7A 2GZ8A 2G81E 1E38B 3L33A 1W14U 1GI2A 4CHAB 3F1SB 5EGMA 1TMTH 2ZFSA 4I31A 3BTME 2ANMH 2NU0E 4WMDA 4ZKOU 1Q3XA 1ELEE 1AO5A 2G8TA 1NFUA 2ZCLP 4PROA 1B0EA 1B5GH 1GCTB 5DP9A 3NWUA 2FP7B 4X2VA 2A2XH 1LMWB 1VGCB 3FP7E 1T8OA 3SUDA 1IQLA 1FAKH 1O3AA 3RXAA 1NRNH 1MTSA 1AE8H 1Y59T 2GVFA 3KL6A 1PFXC 4WMEA 3MH4A 4JYUH 1AVGH 3KQCA 1O3OA 1SSXA 4TPYA 1TIOA 3T2NA 5CHAC 1L1GA 1O32A 5FPSA 1RXPA 1GI3A 3U69H 3FP6E 1NESE 3MNXA 1KDQA 4B73A 4CR9A 1EZQA 3U98H 2A7CA 5ESBA 1TBZH 3M3TA 5FPTA 1UVSH 4K3JA 5TJXA 2OINA 3D62A 9ESTA 2F9BH 1GHYH 1DY9A 1OXGA 1NRSH 1S83A 3UQOA 4IGDA 3PLKA 4FXGH 1HXFH 3LT3A 1ESAA 1TONA 1AMHA 3M36A 2FOHA 5LGOA 4H6TA 1ELFA 2XBYA 1KLIH 3A8BA 1QA0A 3MYWA 1MTNB 1VITG 1YLCA 2ALVA 5C1YA 1UTOA 4B2BA 1KIGH 4CHAC 1QL9A 2G5VA 2FDAA 1GDQA 5EQRA 2BLQA 2Z7FE 5GPIB 3S0NA 2ZC9H 3VXFH 1XUJA 2ZHFH 3OSYA 1SGTA 2A1DB 1BTPA 2Q6GA 2BYAX 1O2WA 2BDCA 2XBXA 4K8BA 1VGCC 2VINA 5BPEA 3BTKE 1SLUB 1W0YH 3D49H 1V2NT 1SQOA 1C5OH 1VCWA 3CS0A 3SU0A 1GL0E 3DA9B 4JK5A 1C5SA 1HJ9A 1SQAA 4NA9H 1C9TA 4D7GA 1TALA 2BXTH 4MTBA 5FBIA 1O2RA 2ZDLA 1KDQB 2SFAA 1LO6A 1Y5BT 3BTQE 1ZMLA 2ZEBA 3GDVA 3VPKA 5C5NA 4I8GA 4FUEA 2OQUA 2VIDA 1C5WB 3GYMA 2HNTF 1ZTJA 4X2XA 4AFUA 5LPFA 5CE1A 4YT7H 1FIZA 1YP9A 1BT7A 1Z71A 1QURH 1FY4A 2FOMB 1EPTC 2G00A 4A5TS 1ETTH 3R0FA 3P6ZB 2BVXH 1V6DA 2AGGX 1JMOH 3W94A 2A0QB 5DP7A 4IBLH 1P11E 2VIOA 2AMPA 2Q6FA 2VIPA 1Y5AT 4H42U 1ACBE 1DX5M 1HAXB 1A5GH 3A8AA 1O5FH 1TBQH 3ATIA 4RSPA 4A7IB 1JWTA 5C20A 4TYDA 1IHTH 4K1SA 4Y0ZE 2ODQA 2YOLA 1P01A 2WUCA 1J16A 1ZMNA 3SQHE 7LPRA 2P59A 3O8BA 2D26C 1TRNA 2FPZA 2Z9LA 1MUEB 1ZR0A 1KXEA 5L2ZH 4IN1A 4O3TA 3TGJE 1HIAB 1GBFA 1G37A 4K69A 1N6YA 1RS0A 2ZHDA 1NZQH 1GPZA 1EATA 1EKBB 3KEEA 5DP8A 4ZUHA 2BX3A 2EC9H 4ZKSU 2VH6A 4JCNA 4ISNA 1HJAB 1XX9A 2O9QA 1ZHPA 3PMBB 4LXBH 3MMGA 2BX4A 2H6MA 3D23A 3QTVH 4O03A 5I46H 3TJOA 4MG3A 5CHAB 1O2TA 2ANWA 3GY8A 4BAOB 5LPRA 4GUXA 4IN2A 3MNBA 1S81A 1QTFA 2Y5GA 2ODPA 1THSH 2RDLA 3F9EA 1D9IA 2R9PA 3PROA 3RC4A 5AFYH 1PQ8A 1ABJH 1TNIA 4X1RU 1ANBA 1EASA 3SV7A 3RXGA 2FI3E 5JDUB 1GJBB 1EP6A 3SUFA 2CGAA 2BD2A 1ZTKA 2VGCB 3PMHB 1ELGA 3TH2H 1ZPZA 3BN9A 2ZFQH 4WWYA 4ZHLU 2FODA 5FBEA 1S0QA 1EZXC 1UTKA 5EG4A 4FU7A 1QA7A 1AIXH 4Q2KA 2J92A 3RXHA 4Y8YA 1YCPK 1BBRE 2UWLA 1Y3UA 1LVMA 2SGEE 8ESTE 1GHBG 1GJDB 1QL8A 3LGIA 3NK8A 1LHFH 4OS5A 4OS7A 1PQ7A 3A80A 1DOJA 1HXEH 3DFJA 1GCTC 4CRAA 1H4WA 1GBLA 1QRWA 1WOFA 3F68H 3PV4A 1FONA 5JB8S 1CBWB 3EGKH 4ABFA 1EAXA 4Y79A 3URDA 2VIVA 3MOCA 1C9PA 3VB4A 1YPJH 4JZDH 2BDHA 2ZGHA 3QN7A 2GMTC 5EOKA 2Y82A 1BTYA 4NIWA 3UNRA 1O2KA 2LNCA 2PKAA 3SJOA 2XXLA 3BTDE 4E06H 1F5RA 4YT6H 1E36B 3ATWA 1O3GA 2H9HA 1EP5A 1O35A 1PJPA 2GDEH 2QXGA 1LQDB 3PWCA 3KHVA 1O3IA 3MU1A 8GCHF 2A2QH 5T6FA 4X2WA 1RTKA 1O2OA 3VB7A 1DDJA 2F9OA 2YNBA 5E0HA 2UUKB 2BZAA 3EE0B 2HRVA 1YPHE 4XE4A 2C8YB 1QJ7B 6GCHG 4AGJA 4BANB 1WQVH 3I29A 1ELCA 2W3KA 3TIUA 2AMDA 4UFGH 1PPCE 3IG6B 1G2LA 1ZOMA 2ZKSA 5A8YA 1BITA 1C1UH 3A85A 1C5YB 4BAKB 1JBUH 1UTPA 1BUIA 4FU8A 1C4V2 1ZSJA 5HM9A 1GG6B 4CRCA 4X6PA 3HGPA 1YPMH 2GDDA 3BIVH 4FUCA 4MNYA 1G9IE 3SHAH 1LPGB 3URCA 1HAZB 1Z7KA 1FJSA 2PUQH 3MI4A 1F0SA 2GMTB 2F9NA 1P2JA 4WF8A 4A1TA 4F49A 4E05H 1IQGA 3OY5U 3UR6A 4BTUB 4MPVA 4NZQA 1OP0A 2OXSA 2GD4B 2OTVA 2ZA5A 3SI3H 4KKDA 1NU7B 1FNIA 4AYYB 1SHYA 1ANDA 3RUOA 2XCFA 3FZDA 3TJUA 1NRRH 1TOCB 1KY9A 2FI4E 3VGCB 3SOSA 2WYGA 1FPHH 3ZZ3A 1TOMH 3STIA 3TGKE 1J17T 1EOLA 1P9SA 1UVUH 2AIPA 1Z8IB 1C1NA 2GTBA 1O2MA 1TMBH 4D8NA 1UJ1A 1K1LA 4X1PU 2B7DH 3R3GB 2VVCA 3SV9A 1TGNA 3BEIB 4SGAE 1HAVB 4JMYA 1D3TB 4UDWH 3TK6A 1E35B 2GCHF 1IOEA 1BRCE 2BD3A 4ABEA 4K60A 2B8OH 2FZZA 3A84A 3P8GA 3LKWA 2D2DA 2QXIA 1GHAF 5GCHG 1ZRBA 1O2HA 1AZ8A 1Z8GA 4B75A 4GVUA 1QQUA 1WSSH 3ZZCA 4I33A 1IQFA 1LKAA 7GCHF 1JXPA 3QGJA 1FIWA 1ZHRA 2P93A 2BY7X 2Y6TA 1W11U 1SR5C 2VIWA 1K28D 1TLDA 2V3OH 3MO6A 5FX5A 3KGPA 4OGXA 1P9UA 1QBOA 1T32A 3E8LA 2WPHS 4F4OC 1ETSH 2PUXB 2WPJS 3FAOA 1BA8B 9LPRA 2BD4A 2W3IA 3S7KB 2BY5X 1Z6EA 1MKXH 2P8OC 1GVKB 2BQ6B 1TYNA 4A92A 1QJ1B 3VGCC 4DJZB 1PQAA 1O5CB 2Z94A 2RA0A 3F9HA 4YLQH 2F3CE 1NFYA 3RLWH 3SORA 3U8RH 1QRXA 1CT0E 1W0ZU 1IQIA 1C2IA 3GCHC 2BVSH 2WYJA 4YOIA 5DGJA 4X6OA 2GCHG 4ABDA 1UTJA 1IQMA 1O2LA 1INCA 1BCUH 2PKSC 3P8NA 1YYY1 2G55A 1KXFA 2ZCKP 3RXIA 3FANA 5EPNA 3HPTB 3ATMA 3VXEH 1YPKH 4X1QU 2BOKA 2JETC 4ABJA 1HNEE 1SHHB 5DK1A 4KTSA 5C1XA 5DPAA 1LHDH 1GMDG 1KTSB 4GCHF 2BQ7B 3PLBA 1OOKB 1BJVA 2B0FA 2Z9GA 3RMNH 2W26A 1DPOA 1DT2A 1KXAA 4BXSA 1CGJE 2H5CA 4R0IA 1ZLRA 4ZAEA 5HXFA 3GISB 2Y5HA 3O8CA 4IMQA 3RXOA 1L4DA 1NC6A 3T28A 2WPMS 1AE5A 2ZTYA 3ZVAA 2BOHB 3SNBA 1C1VH 1H9IE 4B2CA 1UCYE 2H9TH 2XTTB 5T3HA 3RM2H 5L6NH 1IQJA 1XXFA 4M7GA 5EQSA 4J1YA 2I6SA 1GBTA 3ZYEA 2VVUA 3E91A 1YCPM 1ZPCA 3P95A 2ZQ1A 1C4Y2 2PSXA 1L4ZA 4B1TA 1GJ9B 1BTHH 1T8NA 2TRMA 1A0HB 1GBBA 5AFZH 1TPOA 4AFQA 1O3KA 1GBJA 1SC8U 1ZMJA 2BTCE 1O2VA 2OC0A 1DY8A 2CN0H 1RTLA 5T6GA 1P09A 4AX9H 1Y3YA 1O2NA 1QNJA 5E0GA 1GBDA 2V0BA 3GCTF 4YOGA 1E34B 1UVPA 4ZXYH 1S84A 1JOUB 1K21H 1ELBA 2TIOA 2P3TB 3HK6B 4INLA 1XMNB 1VITH 1C5QA 1EUFA 1UTMA 1O3JA 2QCYA 2BVRH 3RXBA 1W2KH 2ZTXA 2H9EH 1ELVA 2BLVA 1SPJA 2BD8A 1V2UT 3MH6A 5DP6A 1SFIA 1QB1A 2CHAB 1GG6C 1J15A 1H9LB 4FUIA 4E7NA 2A5KA 4CRGA 1LHCH 3DHKH 1MMJN 1K2I1 1LKBA 4DOQA 1YLDA 4GHTA 4RKOB 2AIQA 2RG3A 4ZHAA 4AFSA 3I78A 1AU8A 2NU2E 2J2UA 1FY5A 1HCGA 3RLYH 1GBKA 2PV9B 1HAPH 1OKXA 4NWKA 2CF8H 2K1QA 1CHOF 1DLKB 1W8BH 3T5FH 3SU1A 4MVNA 2CV3A 2A4RA 2ZGCA 3KCGH 1K22H 1A2CH 2J95A 3VB6A 1C1PA 3LC3A 4ZXXH 4B71A 3S9CA 1O5GH 2CXVA 3MU4A 3TNTA 3ZVFA 5E8EH 2JH5D 4GHQA 3U8TH 1K1JA 3LONA 1MTUA 5G4BA 2LPRA 1N6XA 1O31A 2ZNKH 4JYVH 3A7ZA 3ATLA 1VCPA 1EAWA 1HFDA 4FUGA 1OWJA 1C5MD 2UUYA 1NFWA 1UTLM 4X8SH 4X2YA 4CRFA 1AKSB 2ZP0H 4HI3A 3F9FA 3QLPH 2FOGA 1MCVA 3SU2A 5LPEA 3TVJB 2YNAA 3BIUH 3EA8A 4DIHH 2ZU3A 1SL3A 1XUFA 5JBBS 3ZZ6A 2STAE 3BG4B 1O2GH 2ILNA 2HNTC 4I7YH 4BTIB 2FM2A 1O2UA 1DSTA 1CA0B 4DIIH 2EEKA 1EZSC 2TGDA 2OBQA
chains in the Genus database with same CATH superfamily
1GJCB 2PTNA 3EYDA 3PWBA 3SU4A 3W95A 2SGDE 1PPGE 1O3PB 4ISIH 4FETA 4CH8B 4CBNA 1BBRK 1D4PB 2XCNA 3STJA 4HGCA 1TX7A 5A8XA 4ISHH 2BM2A 1KSNA 3RP2A 5T1VA 3UNSA 3ENSB 1D6WA 3S9BA 2VU8E 1DWBH 3MU0A 2L6OA 3M37A 3H5CB 1T7CA 3BTTE 1JRTA 2A4OA 3PM3A 4AGKA 3F2GA 1DSUA 3MWIU 3UOPA 3UUZA 4Q80A 5FPYA 3DCLA 1GI6A 1BMMH 1ARBA 5FXLA 1G2MA 5JBTA 3C1KA 4D7FA 5GCHF 1BBRH 4VGCC 1XUGA 3PMAB 5HM2A 1IQNA 3LH3A 3DT0H 1VJ9U 5DN6D 1L2EA 5ABWA 1TPPA 5I25A 1T4UH 3RXCA 1O2YA 2F9UA 5A8ZA 1V2ST 1SKYE 1V2QT 2XNIA 3GDUA 3PLPA 1IQKA 1TRMA 3E0PB 5BRRE 1NFXA 1QRZA 3T26A 2WSSD 1IAUA 5DG6A 1DWEH 1GI5A 1FY1A 1QFKH 2ANYA 2OC8A 1DE7H 3TH4H 2TGAA 2FTLE 3RXMA 1TPSA 4K5ZA 1WV7H 1ZYOA 3O8RA 5EXLA 3KQDA 1P2IA 5IDKA 1O3HA 4F48B 1OSSA 2HNTE 1AWFH 1YPLH 4O3UA 3RMLH 1A61H 1ORFA 1UCYH 1ZHMA 3ELAH 2FXRA 1ANEA 1DFPA 1FXYA 2BQWB 2R2MB 2ZHQH 4NIVA 3E1XB 1EAUA 1A0JA 3E90B 1EX3A 5DJ7A 1P2KA 2EI8A 2BDIA 3LU9B 7KMEH 2ZDMA 3K9XB 1HJ8A 1ABIH 1BHXF 2UWOA 3S7HB 4YOJA 2VWLA 4X0WU 1C5LH 3RXQA 1ZRKA 3ODDA 1F0RA 1CO7E 3PO1C 3QUMP 1A4WH 1HAHH 4HFPB 3A87A 4XBBA 1TNGA 1H9HE 1O2PA 3AAUA 3V3MA 2P94A 1OS8A 1MZAA 2A4GA 1ZJKA 1AFEH 1A5IA 2HGTH 5C5OA 1V2KT 3SN8A 2WPDD 3RXTA 4BAQB 1TFXA 1KLJH 3O8DA 4TY6A 1WDIA 1W0JD 1OP2A 1D3DB 1HBTH 1MTWA 2Y7ZA 3AW0A 4NFEA 4Y6DA 2AERH 5EJLA 5HIYA 3MNSA 2FS9A 2HVXA 3RU4T 2O8UA 1UO6A 1EB1H 1GJAB 1SGCA 2ZFRH 1BJUA 3IWMA 1TNKA 1C5XB 4ACAA 3GY4A 2XWAA 1P12E 1C2HA 3IITA 2KAIB 5DP5A 1JRSA 1O3FA 1L1NA 1T8MA 3BEFB 4Y8XA 3PYHA 1NBME 1VCQA 2XC0A 5KGOA 5AF9H 1GJ4H 3RXJA 4NG9H 5C67A 2ZQ2A 3D65E 2QF4A 3RXVA 5JYIA 1AVWA 4ZH8A 4LZ1H 1UMAH 4NIYA 1GGDB 1G32B 4X6MA 5A09A 3HGNA 1TBRH 3LJJA 3M3VA 3HKJB 1SQRA 1FLEE 4CR5A 5LH8A 2R3YA 2BDAA 4BAHB 2AMQA 2QXJA 1NU9A 4YLUA 1NPMA 3QDZB 2PKSB 1W13U 1W3CA 1ZSLA 1HAVA 1GVZA 3SJ9A 2ESTE 1S82A 1O0DH 2KZ4A 1W7GH 1NTPA 1SMFE 1KXBA 3SO3A 3E3TA 2C8XB 1Q31A 1H8IH 4IW4E 1THPB 3UB0A 1UW7A 3VEQB 1O34A 4BTTB 3P92A 4MNVA 1YM0A 2FX6A 2HALA 4RN6A 3OTJE 2FWWA 3MU5A 4Y7BA 1DUAA 2O8LA 2OP9A 3V7TA 6CHAC 2CK3D 3F0PA 1NT1A 3K2UA 4QT8C 2QA9E 3SU5A 4K1EA 3PV2A 2F9VA 4O9VA 1V2PT 3KNXA 3UFAA 4CH2B 8LPRA 1QR3E 1UHBB 2A31A 1XUHA 3EA7A 3ZV8A 1A0LA 1GL1A 2F83A 1V2WT 2IJD1 1PPEE 1V2RT 1X7AC 5CHBA 3U9AH 1L0ZA 1KLTA 2EA3A 4DGJA 3ZVCA 1LCYA 2QIQA 2VJ1A 1V2MT 3NZIA 4GCHG 2FTMA 1WU1A 2PKAB 2STBE 4HG6A 4LOYH 2Y81A 2D8WA 3UQVA 1DVAH 5GWZA 1LVOA 2O8MA 4GAWA 4Z0KA 4ZCNA 3B9FH 2AEIH 3BTEE 1LHEH 1Z8RA 1UK4A 5A2MH 5C2ZA 2WV9A 1RD3B 4ZMAH 1NY22 1W0KD 1QL7A 4WH6A 1SQTA 1JIMA 3PRBA 5C1UA 1LDTT 3FVFB 4IS5A 1RTFB 3SNCA 5E2PA 2ZPQA 1Z6JH 1J14A 2W6ID 1LPZB 2ZZUH 1IQEA 3K65B 1TQ7B 5HMAA 3RMMH 3TITA 2TGPZ 1KXCA 1WUNH 1S6FA 4ISLA 1C5PA 2NU4E 3A8DA 4KELA 1OP8A 3MHWU 1BTWA 5JBAS 2GV7A 1S85A 1C5VA 1P8VC 2XYAA 1V2LT 5PTPA 3MH5A 1QCPA 2I6QA 4OS1A 1ARCA 4FUDA 3AVZA 1WTHD 1MQ6A 3MH7A 3OY6U 3BG8A 4BOHA 1QZ8A 2SGQE 1YPGH 2AH4X 4GLYA 1B7XB 4K8YA 1BTUA 1J8AA 2ZU4A 6LPRA 4U30A 3CNRA 3DD2H 1P05A 1P2OA 3P8FA 2WPLS 2ZWLH 3LGWA 3SJ8A 3HATH 2P95A 1GCDA 1AWHB 1ELTA 4UFDH 3BSQA 5F8ZA 4NCYA 1CHGA 1C1MA 1D3PB 2RFKC 1TA6A 2BB4A 2KCOA 2XW9A 2BD5A 4MPWA 5K0HA 1GI9B 2SGAA 5EXNA 3TGIE 1YBWA 1SGDE 4A1XA 3U8OH 3VFEA 4AG2A 7GCHG 2GGVB 4WJG2 3WW7A 5EXMA 2A7JA 1A3BH 1O5EH 2P8OB 1OWEA 4MLFB 1FUJA 1O36A 1GWAA 4P00A 1F2SE 2VGCC 1EPTA 2SNVA 1DANH 2OLGA 1P0SH 2W5EA 2VB0A 3GY7A 4Y76A 1H1BA 2FMJA 4MNWA 5IK2D 3ZVBA 1C1RA 1AY6H 5B6OA 3SZEA 1MBQA 1SGNE 1PPZA 1YLNA 1VITF 3M5OA 3NPSA 1GBIA 2RDEA 1W7XH 2FI5E 3UY9A 2BLOA 1SGFA 1IQHA 5TCCA 2J94A 3MTYA 1O3MA 1FI8A 1MAYA 3A7VA 4XRNA 4UFFH 1EJNA 7ESTE 2G4TA 4AZ2B 1TX8A 1TPAE 2LELA 2EI7A 3OE7D 4R8TB 1KYNA 1EZUC 2TGTA 2Z9KA 3ZVEA 1PPHE 1YPEH 1V2TT 1FV9A 1O3DA 1F0TA 1QIXB 4MNXA 1C1WH 1DWCH 2ZGXH 1NROH 4DVAU 3NKKA 1SGIB 5L30H 1A5HA 4WXVA 3UWIA 3BF6H 6GCHF 4YO9A 2VWOA 2ZDNA 5FCRA 4Z6AH 2Z3CA 4INKA 2GCTC 4FUFA 3MO9A 4AFZA 3GOVB 5C0UA 1P03A 2W7SA 2PR3A 2KM0A 2TBSA 1HPGA 2SNWA 4IC6A 3S9AA 2O8TA 3MU8A 1CA0C 3OX7U 1EB2A 1V3XA 1HDTH 1PYTD 2XOKD 1O2JA 3LGTA 1QQ4A 1EJMA 1TA2A 2THFB 2GP9B 4AOQA 5IYTA 1N8OC 3KQBA 4XDEA 3LDXH 1HAOH 2ULLA 3NUMA 5AHGH 2KX4A 2H2ZA 5F8XA 2AYWA 2V6NA 3T27A 3PB1E 1P3CA 4CREA 3SGBE 4ABHA 1TWXB 3A7YA 2GT7A 3LGVA 1MKWK 1FN8A 1MCTA 3ZIAD 4D9RA 6ESTA 1MU8B 4NSYA 3SBKA 3E16B 3MQKC 1ZGVA 4UFEH 3ZZ5A 3F9GA 5EU8A 2GKVE 1GI0A 4I8HA 1C2GA 1K9OE 2HVYB 1FQ3A 4THNH 1LPKB 4X8UH 1GBCA 1SB1H 4DT7B 1T4VH 1GHAG 3GY6A 4HZHA 1P2NA 1DXPA 2PHBA 1TABE 2XC5A 4I8JA 1P2MA 4UE7H 2SGFE 2JETB 3K6YA 2R0KA 2OC7A 1T8LA 1YF4A 4ASUD 1AZZA 2WINI 3UIRA 1O39A 2FS8A 2HOBA 1GJ5H 2NWNA 3L3TA 2JKHA 2QGRA 3PMJA 5FAHA 1KXDA 3AW1A 3P8OA 1XXDA 4X8VH 4YM9A 3OTPA 2FEQH 3MFJA 1G3EA 1LTOA 1AI8H 3BG4C 4OGYA 2ZGBH 2Z9IA 1HAIH 2FLRH 1SLXB 4JZ1A 1Y3XA 1NRQH 3EA9A 1O3CA 2PGQB 1DXWA 2F4LA 2J97A 3RXDA 2WV5A 3ZZ4A 1D3QB 3B23B 3ZZ8A 1G36A 2FOFA 1O33A 1CQQA 4FU9A 8KME2 4OM9A 1FAXA 2HPPH 1GHBF 3SGAE 1O2XA 1V2OT 1RFNA 4WXIA 1CHOG 1CA8B 4FUJA 1MD8A 3CENA 5JBCS 3M35A 3GCOA 2W7UA 1C2JA 2OQ5A 1GDUA 4KTUA 1HUTH 3TLOA 4AG1A 2ZFPH 4BAMB 5EODA 2FESH 1WCZA 1O3BA 4GSOA 3SHCH 4X8TH 5ETXA 1OYQA 1CU1A 1DLEA 2FLBH 2G52A 4Y7AA 3JZ2B 1SGYE 3JZ1B 1DITH 3M7QA 1U6QA 4WMFA 5CMXH 1HAYB 2F91A 1A3EH 3ZZBA 2H1UA 1QB9A 3BTHE 1OWKA 1UVTH 1VZQH 1WTGH 2G4UA 3T62A 1BIOA 3CP7A 3GY2A 1C5NH 5TCAA 3KYFA 1C2LA 1HB0B 1FN6A 1J9CH 1S0RA 5F6MA 3RXUA 1AGJA 1UTQA 3TH3H 3RXEA 1TNLA 1TRYA 2PWXA 3BTWE 2FOAA 1K1IA 4HTCH 3NXPA 1RIWB 1DUEA 1P57B 2FYRA 3QO6A 3UOUA 1XKAC 4FVDA 1QHRB 3RMOH 1SBWA 1YWUA 1H8HD 1NM6A 2AS9A 2JH6D 1S6LA 5FCKA 3SV2H 1O3EA 2GT8A 3LPRA 4NFFA 4JZIA 4CBOA 3F0OA 2P16A 3A8CA 3G01A 3RC5A 1GHVH 5L2YH 3TJNA 1UHBA 1AN1E 4FUBA 2ZFTA 1ID5H 3RXKA 3SI4H 1OPHB 2QXHA 2R0LA 4ISOA 4Q7ZA 2FOBA 4WVPE 4TY7A 3UWJH 4CRDA 1EPTB 2HWLB 3LOXA 1SGEE 2HPQH 3A7WA 4XOJA 4ZKRU 1F7ZA 1PPFE 1ELDE 3ZZ9A 5DP3A 3CS7A 3A7XA 5A0BA 1NO9H 1DWDH 4ASHA 4U2WA 2V7QD 1O37A 1CGIE 3BV9B 1PPBH 4YTAA 1O2IA 2PFEA 4J2YB 1MAXA 5GDSH 1O3NA 3DFLA 2M5TA 1QJ6B 4OS6A 4Q7YA 4UONA 1MU6B 3RC6A 1XVMA 3F2FA 2C8WB 4CRBA 4D76A 3LIWA 2ZO3H 1CT2E 2OCVB 2KCPA 3UAIC 1Y3WA 6CHAB 2A32A 2Y5FA 4UEHH 3RU4E 1BRUP 1SOZA 5F03A 1O5AB 2CHAC 5HKKD 5AVDA 4NIXA 4I8LA 4AN7A 4U32A 1RIWC 2FYQA 4YZUA 4FVBA 2Z6BD 2BY9X 4K1TA 2YMSB 4NZLA 1BZXE 1G3BA 1GMHF 1EJAA 2B5TB 3PTBA 2Z9JA 4ZROA 5DO4H 3Q3KA 3TPIZ 2P3FH 3U1JB 3ZVGA 2JH0D 1ELAA 2GZ9A 2ZU1A 3S69A 2ZU5A 1DICA 1XVOA 4FUHA 3LGYA 2ZHEH 3M7TA 1O3LA 3QGNB 1Z1JA 2VNTA 1TQ0B 4H4FA 2PSYA 2UUFB 4IMZA 2WUBA 5J4SA 1UK3A 2C3SA 2F9PA 1AB9C 1C2DA 3A86A 2ZHWH 4NA7A 4B2AA 1F5LA 3Q77A 2GV6A 1TNHA 3OU0A 2WV4A 4D9QA 1AFQC 5FX6A 3VB3A 1Y5UT 2ZG0H 1HRTH 2A45B 3KIDU 5EQQA 4Y71A 3GCHB 1NN6A 2R3UA 3SV8A 2FIRH 2KCYA 4NSVA 2FX4A 4I32A 1GJ6A 3WY8A 1FDPA 1BOQA 3C27B 1WAYB 1E1RD 4OS4A 1CT4E 3K6ZA 3H09A 1F5KU 2ZI2H 2VVVA 4XBDA 1GBMA 4AC9A 4XSKU 1P06A 1GJ7B 1MZDA 1TMUH 3BTGE 2PLXA 5C3NA 3V13A 4Y0YE 2QAAA 1YCPH 2IOTA 5HIZA 3GCNA 3HK3B 1BB0B 1NBMD 1BMAA 1SGQE 1V2VT 1P3EA 1ZGIA 1A7SA 5GIBA 4Q7XA 1QBNA 4XFQA 1F0UA 3EQ0H 3M5LA 4A1VA 1E0FD 3AASA 5T6DA 1BRBE 5H4IB 3SZNA 3EAJA 3M5NA 2IPHA 1CSOE 1PQ5A 1THRH 2J5UA 1Z8JB 2KCAA 1ETRH 2WZQA 1OYTH 3A7TA 1K0HA 1ZTLA 1QBVH 2ZGJA 3SNEA 1N8OB 1QB6A 2C90B 4IC5A 2QF3A 2QY0B 4ABIA 1SVPA 1AKSA 3KF2A 4MQAA 3U1IB 2Y80A 5C17A 3SUGA 2ZFFH 4YESB 3ZZ7A 3W1EA 3T25A 1DS2E 1SGPE 4XBCA 2K0QA 3TU7H 5A0AE 1SG8B 1ZJDA 2BD9A 1Y8TA 1SGRE 2QV1A 1HV7A 4X1NU 1C5TA 3A81A 3SNAA 1K1NA 2H5DA 3SW2B 3UTUH 1YC0A 2P3UB 3SU3A 2BDYA 4ABBA 3SQEE 5F8TA 3LGUA 3PO1B 3RDZA 4MPUA 2DE8A 1T31A 1XKBC 1UK2A 2Q6DA 1MTNC 4UD9H 3QZQA 3GYLB 1ZZZA 1G30B 1TNJA 2BY6X 2J4IA 2XC4A 4AORA 4DURA 1GBEA 5SGAE 1DM4B 2B9LA 1NRPH 1P10A 3RXLA 2GCTB 3FP8E 5B6LA 1ESTA 2O8WA 2ZDKA 4TWWA 5HYOA 2NU3E 1RJXB 2JDID 2Q1JA 3LC5A 4KTCA 4ABGA 1MTVA 2BMGB 2ZU2A 3V12A 3SGQE 1HJAC 4NWLA 3TNSA 2BD7A 2A4QA 5DKMA 1C1SA 2BLWA 2XBVA 1P02A 3QTOH 1E37B 3GCTG 4RT1A 4DCDA 2TPIZ 1GMCF 2AHME 2V35A 3RXFA 2WPIS 2RA3A 2V3MA 3PTNA 4E7RG 3KYGA 3ZYDA 4H6SB 5EW2H 1W12U 1AB9B 2CF9H 1TGTA 3FFGA 1GDNA 3L6PA 3SU6A 5JPMH 4U01A 1ZSKA 3GDSA 1BMLA 3DSGA 1N1LA 4I8KA 4Q63A 1D6RA 3T29A 1BTZA 4KP0A 3QK1A 3TJVA 1O5DH 4NGAH 3HKIB 1P04A 1FMGA 2ZECA 4OS2A 1VR1H 2KFWA 3A88A 4KGAA 4Y8ZA 4ZHMU 1BRAA 3H7TA 1YKTA 1YGCH 1CGHA 1C1OA 1L1JA 4X1SU 1WQSA 3A89A 1GVLA 4AB8A 1BTXA 1F92A 3LH1A 3RM0H 1C5RA 1K1PA 3ATKA 3E0NB 3UR9A 1BHXB 1FZZA 2R2WU 1CBWC 3RXPA 4A6LA 1GI7B 3AK5A 3VB5A 1WBGB 4O97A 4X6NA 1AVXA 1HIAA 3BTFE 5DP4A 4BNRA 2M2AA 1OX1A 1LVYA 1H8ED 1A1RA 3F3BA 1UTNA 1GBHA 1EOJA 1C1QA 2G51A 4JZFH 4NA8A 3V0XA 2ODYB 1A46H 1AUJA 1MKWH 3KQEA 3GY5A 2FOCA 4Y10E 2QF0A 2Y7XA 2A7HA 5A0CA 3QX5H 3B8JA 2VBCA 3Q76A 5FHTA 1M9UA 3BEUA 4DY7B 1XUIA 2QYIA 3AAVA 3TK9A 4GPGA 2VIQA 1P2QA 2ZDVH 4SGBE 1GI1A 5EW1H 1YPHC 2V3HH 2C8ZB 1MD7A 1KTTB 1AFQB 2J38A 1LHGH 2Z3EA 2FOEA 1CE5A 1MQ5A 1HLTH 3ODFA 2PGBB 5J4QA 5K7RA 1S6HA 1OWIA 3NCLA 2CMYA 1RGQA 2SGPE 5ESTE 2J9NA 1C2KA 2OUAA 5JB9S 1BMNH 1LQEA 1GJ8B 1TGCA 1TE0A 4INHA 3DUXH 4B6FA 3F6UH 2WPKS 5GJ4B 1XM1A 1BQYA 4LK4A 2QN5T 2ZF0H 4K2YA 1K1MA 2PW8H 2ZDAH 4TWYA 2JJ2D 4ESTE 3GS9A 1B0FA 3GICB 1CVWH 1GI4A 2ALPA 2BHGA 2AFQB 2ZTZA 3SJIA 3ZVDA 2BDGA 4B74A 3N7OA 1HGTH 2IJOB 3ITIA 2RCEA 3H7OA 1O2SA 2OC1A 1FY8E 1O38A 2GJGA 4AYVB 2ZPSA 3F2HA 3UPEA 3EDXB 1LVBA 1W10U 2QC2A 3M7UA 2EQNA 3SNDA 1AUTC 1HYLA 3M61U 1COWD 4ABAA 8GCHG 4JYTA 1SLVB 3M5MA 1MKXK 5HGGA 1GHWH 3QWCH 1O30A 5EPYA 1S5SA 1GI8B 1IHSH 1HAGE 2XRCA 1AHTH 1BDAA 3LJOA 1TGBA 1SI5H 4RKJB 1AD8H 2VWMA 3A82A 1GMCG 2BXUH 4WH8A 3FZZA 2ZPRA 1C5UA 3KQ5A 3QZRA 2HLCA 1TX6A 3A83A 4LZ4B 1FY3A 1EQ9A 3Q3XA 3ZZAA 3OYPA 4JK6A 2G5NA 4AB9A 1PYTC 2NU1E 1G3CA 1GHXH 1XUKA 5C94A 2BY8X 3FOAA 5FL7D 1Y3VA 2ZIQH 1OWHA 2AGIX 3RXSA 3OEED 2XWBI 4WY3A 2ANKH 1Q2WA 1SFQB 3ZZDA 2ZCHP 1G3DA 2UUJB 1AQ7A 4TPIZ 1C5ZB 4VGCB 1V2JT 2Z3DA 1UVOA 2KAIA 2OBOA 2J34A 3I77A 1FPCH 3GY3A 4BXWA 2GX4A 4MDSA 5E0JA 2PTCE 2EI6A 1QGFA 2CJIA 2OD3B 1C1TA 1C4U2 1OHHD 4Y11E 5GXPA 1K1OA 1KMHB 1ZPBA 3UREA 3Q00A 4JZEH 1Z1IA 1ANCA 1VJAU 2VWNA 1MBMA 1C2MA 3SJKA 3P70B 3E6PH 1GMHG 1O5BB 1O2ZA 4P02A 1H8DH 1TGSZ 2FO9A 3Q3YA 1SLWB 1O2QA 2DUCA 1JIRA 2L74A 3M3SA 1SGFG 1UCYK 2D1JA 1EAIA 1GGDC 3UNQA 2UWPA 1SOTA 2C93B 1NS3A 1ESBA 3ESTA 1TB6H 3ZV9A 5E2OA 3KN2A 3TK5A 5DSFA 1C2EA 2ASUB 2W6JD 2AGEX 1TAWA 3MO3A 1EXFA 3SV6A 2DE9A 1OWDA 3RXRA 1GBAA 3SUEA 1GMDF 4Z1MD 4ZKNU 2XBWA 1WYKA 1QY6A 2VH0A 1MH0A 3MNCA 4B76A 3P17H 1C2FA 4MPXA 1RRKA 4DW2U 2A5IA 2BDBA 2IN2A 2A5AA 2BZ6H 3RU4D 1GHZA 2C4FH 4DG4A 2GZ7A 2GZ8A 2G81E 1E38B 2WHXA 3L33A 1W14U 1GI2A 4CHAB 3F1SB 5EGMA 1TMTH 2ZFSA 5C0TA 4I31A 3BTME 2ANMH 2NU0E 4WMDA 5EJZA 4ZKOU 1Q3XA 1ELEE 1AO5A 2G8TA 1NFUA 2ZCLP 4PROA 1B0EA 1B5GH 1GCTB 5DP9A 3NWUA 2FP7B 4X2VA 2A2XH 1LMWB 1VGCB 3FP7E 1T8OA 3SUDA 1IQLA 1FAKH 2YMSD 1O3AA 3RXAA 1NRNH 3OAAD 1MTSA 1AE8H 1Y59T 2GVFA 3KL6A 1PFXC 4WMEA 3MH4A 4JYUH 1AVGH 3KQCA 1O3OA 1SSXA 4TPYA 1TIOA 3T2NA 5CHAC 1L1GA 1O32A 5FPSA 1RXPA 1GI3A 3U69H 3FP6E 1NESE 3MNXA 1KDQA 4B73A 4CR9A 1EZQA 3U98H 3WWBA 2A7CA 5ESBA 1TBZH 3M3TA 5FPTA 1UVSH 4K3JA 5TJXA 2OINA 3D62A 9ESTA 5F53A 2F9BH 4YXWD 1GHYH 1DY9A 1OXGA 1NRSH 1S83A 3UQOA 4IGDA 3PLKA 3N7DA 4FXGH 1HXFH 3LT3A 1ESAA 1TONA 1AMHA 3M36A 3U28C 2FOHA 5LGOA 4H6TA 1ELFA 2XBYA 1KLIH 3A8BA 1QA0A 3MYWA 1MTNB 1VITG 1YLCA 2ALVA 5C1YA 1UTOA 5CDFE 4B2BA 1KIGH 2QF5A 1QL9A 4CHAC 2G5VA 2FDAA 1GDQA 5EQRA 2BLQA 2Z7FE 5GPIB 3S0NA 2ZC9H 3VXFH 1XUJA 2ZHFH 3OSYA 1SGTA 2A1DB 1BTPA 2Q6GA 2KR7A 2J98B 2BYAX 1O2WA 2BDCA 2XBXA 4K8BA 1VGCC 2VINA 5BPEA 3BTKE 1SLUB 1W0YH 3D49H 1V2NT 1SQOA 1C5OH 1VCWA 3CS0A 3SU0A 1GL0E 3DA9B 4JK5A 1C5SA 1HJ9A 1SQAA 4NA9H 1C9TA 4D7GA 1TALA 2BXTH 4MTBA 3FN8A 5FBIA 1O2RA 2ZDLA 1KDQB 2SFAA 1LO6A 1Y5BT 3BTQE 1ZMLA 2ZEBA 3GDVA 3VPKA 5C5NA 4I8GA 4FUEA 2OQUA 2VIDA 5KEDA 1C5WB 3GYMA 2HNTF 1ZTJA 4X2XA 4AFUA 5LPFA 5CE1A 4YT7H 1FIZA 1YP9A 1BT7A 1Z71A 1QURH 1FY4A 2FOMB 1EPTC 4TSFD 2G00A 4A5TS 1ETTH 3R0FA 3P6ZB 2BVXH 1V6DA 2AGGX 1JMOH 3W94A 2A0QB 5DP7A 4IBLH 1P11E 2VIOA 2AMPA 2Q6FA 2VIPA 1Y5AT 4H42U 1ACBE 1DX5M 1HAXB 1A5GH 3A8AA 1O5FH 1TBQH 3ATIA 4RSPA 4A7IB 1JWTA 5C20A 4TYDA 1IHTH 4K1SA 4Y0ZE 2ODQA 2YOLA 1P01A 2WUCA 1J16A 1ZMNA 3SQHE 7LPRA 2P59A 3O8BA 2D26C 1TRNA 2FPZA 2Z9LA 1MUEB 1ZR0A 1KXEA 5L2ZH 4IN1A 4O3TA 3TGJE 1HIAB 1VKYA 1GBFA 1G37A 4K69A 1N6YA 2HLDD 1RS0A 2ZHDA 1NZQH 1GPZA 1EATA 1EKBB 3KEEA 5DP8A 4ZUHA 2BX3A 2EC9H 3VG8A 4ZKSU 2VH6A 4JCNA 4ISNA 1HJAB 1XX9A 2O9QA 1ZHPA 3PMBB 4LXBH 3MMGA 2BX4A 2H6MA 3D23A 3QTVH 4O03A 5I46H 3TJOA 4MG3A 5CHAB 1O2TA 2ANWA 3GY8A 4BAOB 5LPRA 4GUXA 4IN2A 3MNBA 1S81A 1QTFA 2Y5GA 2ODPA 2RDLA 1THSH 3F9EA 1D9IA 2R9PA 3PROA 3RC4A 5AFYH 1PQ8A 1ABJH 1TNIA 4X1RU 2QE7D 1ANBA 1EASA 3SV7A 3RXGA 2FI3E 5JDUB 1GJBB 1EP6A 2J98A 3DSPA 3SUFA 2CGAA 2BD2A 1ZTKA 2VGCB 3PMHB 3OEHD 1ELGA 3TH2H 1ZPZA 3BN9A 2ZFQH 4WWYA 4ZHLU 3EE7A 2FODA 5FBEA 1S0QA 1EZXC 1UTKA 5EG4A 3OFND 4FU7A 1QA7A 1AIXH 4Q2KA 2J92A 3RXHA 4Y8YA 1YCPK 1BBRE 2UWLA 1Y3UA 1LVMA 2LP6A 2SGEE 8ESTE 1GHBG 1GJDB 1QL8A 3LGIA 3NK8A 1LHFH 4OS5A 4OS7A 1PQ7A 3A80A 1DOJA 1HXEH 3DFJA 3FO8D 1GCTC 4CRAA 1H4WA 1GBLA 1QRWA 1WOFA 3F68H 3PV4A 1FONA 5JB8S 1CBWB 3EGKH 4ABFA 1EAXA 4Y79A 3URDA 2VIVA 3MOCA 1C9PA 3VB4A 5GNDA 1YPJH 4JZDH 2BDHA 2ZGHA 3QN7A 2XNDD 2GMTC 5EOKA 3NRLA 2Y82A 1BTYA 2JJ1D 4NIWA 3UNRA 1O2KA 2LNCA 2PKAA 3SJOA 2XXLA 3N7EA 3BTDE 4E06H 1F5RA 4YT6H 1E36B 2OK5A 3ATWA 1O3GA 2H9HA 1EP5A 1O35A 1PJPA 2GDEH 2QXGA 1LQDB 3PWCA 3KHVA 1O3IA 3MU1A 8GCHF 2A2QH 5T6FA 4X2WA 1RTKA 1O2OA 3VB7A 1DDJA 2F9OA 2YNBA 5E0HA 2UUKB 2BZAA 3EE0B 2HRVA 1YPHE 4XE4A 2C8YB 1QJ7B 6GCHG 2EY4C 4AGJA 4BANB 1WQVH 3I29A 1ELCA 2W3KA 3TIUA 2AMDA 4UFGH 1PPCE 3IG6B 1G2LA 1ZOMA 2ZKSA 5A8YA 1BITA 1C1UH 1FX0B 3A85A 1C5YB 4BAKB 1JBUH 1UTPA 1BUIA 2K8IA 4FU8A 1C4V2 1ZSJA 5HM9A 1GG6B 4CRCA 4X6PA 3HGPA 1YPMH 2GDDA 3BIVH 4FUCA 4MNYA 1G9IE 3SHAH 1LPGB 4RT0A 3URCA 1HAZB 1Z7KA 1FJSA 2PUQH 3MI4A 1F0SA 2GMTB 2F9NA 1P2JA 4WF8A 4A1TA 4F49A 4ACBA 4E05H 1IQGA 3OY5U 3UR6A 4BTUB 4MPVA 4NZQA 1OP0A 2OXSA 2GD4B 2OTVA 2ZA5A 3SI3H 4KKDA 1NU7B 1FNIA 4AYYB 1SHYA 4DT4A 1ANDA 3RUOA 4F55A 2XCFA 3FZDA 3TJUA 1NRRH 1TOCB 3DSOA 1KY9A 2FI4E 3VGCB 3SOSA 2WYGA 1FPHH 3ZZ3A 1TOMH 3STIA 1E1QD 3TGKE 1J17T 1EOLA 1P9SA 1UVUH 2AIPA 1Z8IB 1C1NA 2GTBA 1O2MA 1TMBH 4D8NA 1UJ1A 1K1LA 4X1PU 2B7DH 3R3GB 3PRDA 2VVCA 3SV9A 1TGNA 3BEIB 4SGAE 1HAVB 4JMYA 1D3TB 4UDWH 3TK6A 3FKSD 1E35B 2GCHF 5KECA 1IOEA 1BRCE 2BD3A 4ABEA 4K60A 2B8OH 2FZZA 3A84A 3P8GA 1MABB 3LKWA 4FOUC 2D2DA 2QXIA 1GHAF 5GCHG 1ZRBA 1O2HA 3N99A 1AZ8A 1Z8GA 4B75A 4GVUA 1QQUA 1WSSH 3ZZCA 4I33A 1IQFA 1LKAA 7GCHF 1JXPA 4RI0A 3QGJA 1FIWA 1ZHRA 2P93A 2BY7X 2Y6TA 1W11U 1SR5C 2VIWA 1K28D 1TLDA 2V3OH 3MO6A 5FX5A 3KGPA 4OGXA 1P9UA 1QBOA 1T32A 3E8LA 2IPQX 2WPHS 4F4OC 1ETSH 2F43B 2PUXB 2WPJS 1BA8B 3FAOA 9LPRA 2BD4A 2W3IA 3S7KB 2BY5X 1Z6EA 1MKXH 2P8OC 1GVKB 2BQ6B 1TYNA 4A92A 1QJ1B 3VGCC 4DJZB 1PQAA 1O5CB 2Z94A 2RA0A 3F9HA 4YLQH 2F3CE 1NFYA 3RLWH 3SORA 3U8RH 1QRXA 1CT0E 1W0ZU 1IQIA 1C2IA 3GCHC 2BVSH 2WYJA 4YOIA 5DGJA 4X6OA 2GCHG 4ABDA 1UTJA 1IQMA 1O2LA 1INCA 1BCUH 2PKSC 3P8NA 1YYY1 2G55A 1KXFA 2ZCKP 4Q4LA 3RXIA 3FANA 5EPNA 3HPTB 3ATMA 3VXEH 1YPKH 4X1QU 2BOKA 2JETC 4ABJA 1HNEE 1SHHB 5DK1A 4KTSA 5C1XA 5DPAA 1LHDH 3WWFA 1GMDG 1KTSB 4GCHF 2BQ7B 3PLBA 1OOKB 1BJVA 2B0FA 2Z9GA 3RMNH 2W26A 1DPOA 1DT2A 1KXAA 4BXSA 1CGJE 2H5CA 4R0IA 1ZLRA 4ZAEA 5HXFA 3GISB 2Y5HA 3O8CA 4IMQA 3RXOA 1L4DA 1NC6A 3T28A 1EFRD 2WPMS 1AE5A 2ZTYA 3ZVAA 2BOHB 3SNBA 1C1VH 1H9IE 4B2CA 1UCYE 2H9TH 2XTTB 5T3HA 3RM2H 5L6NH 1IQJA 1XXFA 4M7GA 5EQSA 4J1YA 2I6SA 1GBTA 5EJ1A 2YMSC 3ZYEA 2VVUA 3E91A 1YCPM 1ZPCA 3P95A 2ZQ1A 1C4Y2 2PSXA 1L4ZA 4B1TA 3SYJA 1GJ9B 1BTHH 1T8NA 2TRMA 1A0HB 1GBBA 5AFZH 1TPOA 4AFQA 1O3KA 1GBJA 1SC8U 1ZMJA 2BTCE 1O2VA 2OC0A 1DY8A 2CN0H 1RTLA 5T6GA 2PP6A 1P09A 4AX9H 1Y3YA 1O2NA 1QNJA 5E0GA 1GBDA 2V0BA 3GCTF 4YOGA 1E34B 1BMFD 1UVPA 5EIYA 4ZXYH 1S84A 1JOUB 1K21H 1ELBA 2TIOA 2P3TB 3HK6B 4INLA 1XMNB 1VITH 1C5QA 1EUFA 1UTMA 1O3JA 2QCYA 2BVRH 3RXBA 1W2KH 2ZTXA 2H9EH 1ELVA 2BLVA 1SPJA 2BD8A 1V2UT 3MH6A 5DP6A 1SFIA 1QB1A 2CHAB 1GG6C 1J15A 1H9LB 3PV5A 4FUIA 4E7NA 1WXRA 2A5KA 4CRGA 1LHCH 3DHKH 1MMJN 1K2I1 1LKBA 4DOQA 1YLDA 4GHTA 4RKOB 2AIQA 2RG3A 4ZHAA 4AFSA 3I78A 1YY3A 1AU8A 2NU2E 4TT3D 2J2UA 1FY5A 1HCGA 3RLYH 1GBKA 2PV9B 1HAPH 1OKXA 4I86A 4NWKA 2CF8H 2K1QA 1CHOF 1DLKB 1W8BH 3T5FH 3SU1A 4MVNA 2CV3A 2A4RA 2ZGCA 4XD7D 3KCGH 1K22H 1A2CH 2J95A 3VB6A 1C1PA 3LC3A 4ZXXH 4B71A 3S9CA 1O5GH 2CXVA 3MU4A 3TNTA 3ZVFA 5E8EH 2JH5D 4GHQA 3U8TH 1K1JA 3LONA 2JIZD 1MTUA 5G4BA 2LPRA 1N6XA 1O31A 2ZNKH 4JYVH 1E79D 3A7ZA 3ATLA 1VCPA 1EAWA 1HFDA 4FUGA 1OWJA 1C5MD 2UUYA 1NFWA 1UTLM 4X8SH 4X2YA 4CRFA 1AKSB 2ZP0H 4B6EA 4HI3A 3F9FA 3QLPH 2FOGA 1MCVA 3SU2A 5LPEA 3TVJB 2YNAA 3BIUH 3EA8A 4DIHH 4M9FA 2ZU3A 1SL3A 1XUFA 5JBBS 3ZZ6A 2STAE 3BG4B 1O2GH 2ILNA 2HNTC 4I7YH 4BTIB 2FM2A 1O2UA 1DSTA 1CA0B 4DIIH 2EEKA 1EZSC 2TGDA 2OBQA
chains in the Genus database with same CATH topology
1GJCB 2PTNA 3EYDA 3PWBA 3SU4A 3W95A 2SGDE 1PPGE 1O3PB 4ISIH 4CH8B 4CBNA 1BBRK 1D4PB 2XCNA 3STJA 4HGCA 1TX7A 5A8XA 4ISHH 2BM2A 1KSNA 3RP2A 3UNSA 3ENSB 1D6WA 3S9BA 2VU8E 1DWBH 3MU0A 3M37A 3H5CB 1T7CA 3BTTE 1JRTA 2A4OA 3PM3A 4AGKA 1DSUA 3MWIU 3UOPA 3UUZA 4Q80A 5FPYA 1GI6A 1BMMH 1ARBA 5FXLA 1G2MA 5JBTA 3C1KA 4D7FA 5GCHF 1BBRH 4VGCC 1XUGA 3PMAB 5HM2A 1IQNA 3LH3A 3DT0H 1VJ9U 1L2EA 5ABWA 1TPPA 5I25A 1T4UH 3RXCA 1O2YA 2F9UA 5A8ZA 1V2ST 1V2QT 2XNIA 3GDUA 3PLPA 1IQKA 1TRMA 3E0PB 5BRRE 1NFXA 1QRZA 3T26A 1IAUA 5DG6A 1DWEH 1GI5A 1FY1A 1QFKH 2ANYA 2OC8A 1DE7H 3TH4H 2TGAA 2FTLE 3RXMA 1TPSA 4K5ZA 1WV7H 1ZYOA 3O8RA 5EXLA 3KQDA 1P2IA 5IDKA 1O3HA 1OSSA 2HNTE 1AWFH 1YPLH 4O3UA 3RMLH 1A61H 1ORFA 1UCYH 1ZHMA 3ELAH 2FXRA 1ANEA 1DFPA 1FXYA 2BQWB 2R2MB 2ZHQH 4NIVA 3E1XB 1EAUA 1A0JA 3E90B 1EX3A 5DJ7A 1P2KA 2EI8A 2BDIA 3LU9B 7KMEH 2ZDMA 3K9XB 1HJ8A 1ABIH 1BHXF 2UWOA 3S7HB 4YOJA 2VWLA 4X0WU 1C5LH 3RXQA 1ZRKA 3ODDA 1F0RA 1CO7E 3PO1C 3QUMP 1A4WH 1HAHH 4HFPB 3A87A 4XBBA 1TNGA 1H9HE 1O2PA 3AAUA 3V3MA 2P94A 1OS8A 1MZAA 2A4GA 1ZJKA 1AFEH 1A5IA 2HGTH 5C5OA 1V2KT 3SN8A 3RXTA 4BAQB 1TFXA 1KLJH 3O8DA 4TY6A 1OP2A 1D3DB 1HBTH 1MTWA 2Y7ZA 3AW0A 4NFEA 4Y6DA 2AERH 3MNSA 2FS9A 2HVXA 3RU4T 2O8UA 1UO6A 1EB1H 1GJAB 1SGCA 2ZFRH 1BJUA 3IWMA 1TNKA 1C5XB 3GY4A 2XWAA 1P12E 1C2HA 3IITA 2KAIB 5DP5A 1JRSA 1O3FA 1L1NA 1T8MA 3BEFB 4Y8XA 3PYHA 1VCQA 2XC0A 5AF9H 1GJ4H 3RXJA 4NG9H 5C67A 2ZQ2A 3D65E 3RXVA 5JYIA 1AVWA 4ZH8A 4LZ1H 1UMAH 4NIYA 1GGDB 1G32B 4X6MA 5A09A 3HGNA 1TBRH 3LJJA 3M3VA 3HKJB 1FLEE 4CR5A 5LH8A 2R3YA 2BDAA 4BAHB 2AMQA 2QXJA 1NU9A 4YLUA 1NPMA 3QDZB 2PKSB 1W13U 1W3CA 1ZSLA 1HAVA 1GVZA 3SJ9A 2ESTE 1S82A 1O0DH 1W7GH 1NTPA 1SMFE 1KXBA 3SO3A 3E3TA 2C8XB 1Q31A 1H8IH 4IW4E 1THPB 3VEQB 4BTTB 1O34A 3P92A 4MNVA 1YM0A 2FX6A 2HALA 4RN6A 3OTJE 2FWWA 3MU5A 4Y7BA 1DUAA 2O8LA 2OP9A 3V7TA 6CHAC 1NT1A 3K2UA 4QT8C 2QA9E 3SU5A 4K1EA 2F9VA 4O9VA 1V2PT 3KNXA 3UFAA 4CH2B 8LPRA 1QR3E 1UHBB 2A31A 1XUHA 3EA7A 3ZV8A 1A0LA 1GL1A 2F83A 1V2WT 1PPEE 1V2RT 1X7AC 3U9AH 1L0ZA 1KLTA 2EA3A 4DGJA 3ZVCA 1LCYA 2QIQA 2VJ1A 1V2MT 3NZIA 4GCHG 2FTMA 1WU1A 2PKAB 2STBE 4LOYH 2Y81A 2D8WA 3UQVA 1DVAH 5GWZA 1LVOA 2O8MA 4GAWA 4Z0KA 3B9FH 2AEIH 3BTEE 1LHEH 1Z8RA 1UK4A 5A2MH 5C2ZA 1RD3B 4ZMAH 1NY22 1QL7A 4WH6A 1SQTA 1JIMA 5C1UA 1LDTT 3FVFB 4IS5A 1RTFB 3SNCA 5E2PA 2ZPQA 1Z6JH 1J14A 1LPZB 2ZZUH 1IQEA 3K65B 1TQ7B 5HMAA 3RMMH 3TITA 2TGPZ 1KXCA 1WUNH 1S6FA 4ISLA 1C5PA 2NU4E 3A8DA 4KELA 1OP8A 3MHWU 1BTWA 5JBAS 2GV7A 1S85A 1C5VA 1P8VC 2XYAA 1V2LT 5PTPA 3MH5A 1QCPA 2I6QA 4OS1A 1ARCA 4FUDA 3AVZA 1WTHD 1MQ6A 3MH7A 3OY6U 3BG8A 4BOHA 2SGQE 1YPGH 2AH4X 4GLYA 1B7XB 4K8YA 1BTUA 1J8AA 2ZU4A 6LPRA 4U30A 3DD2H 1P05A 1P2OA 3P8FA 2WPLS 2ZWLH 3LGWA 3SJ8A 3HATH 2P95A 1GCDA 1AWHB 1ELTA 4UFDH 3BSQA 5F8ZA 4NCYA 1CHGA 1C1MA 1D3PB 1TA6A 2BB4A 2XW9A 4MPWA 2BD5A 5K0HA 1GI9B 2SGAA 5EXNA 3TGIE 1YBWA 1SGDE 4A1XA 3U8OH 3VFEA 4AG2A 7GCHG 2GGVB 4WJG2 5EXMA 2A7JA 1A3BH 1O5EH 2P8OB 1OWEA 4MLFB 1FUJA 1O36A 1GWAA 1F2SE 2VGCC 1EPTA 2SNVA 1DANH 2OLGA 1P0SH 2W5EA 2VB0A 3GY7A 4Y76A 1H1BA 2FMJA 4MNWA 3ZVBA 1C1RA 1AY6H 5B6OA 1MBQA 1SGNE 1PPZA 1VITF 3M5OA 3NPSA 1GBIA 1W7XH 2FI5E 3UY9A 2BLOA 1SGFA 1IQHA 5TCCA 2J94A 3MTYA 1O3MA 1FI8A 1MAYA 3A7VA 4UFFH 1EJNA 7ESTE 2G4TA 4AZ2B 1TX8A 1TPAE 2EI7A 4R8TB 1KYNA 1EZUC 2TGTA 2Z9KA 3ZVEA 1PPHE 1YPEH 1V2TT 1FV9A 1O3DA 1F0TA 1QIXB 4MNXA 1C1WH 1DWCH 2ZGXH 1NROH 4DVAU 3NKKA 1SGIB 5L30H 1A5HA 4WXVA 3UWIA 3BF6H 6GCHF 4YO9A 2VWOA 2ZDNA 5FCRA 4Z6AH 2Z3CA 4INKA 2GCTC 4FUFA 3MO9A 4AFZA 3GOVB 1P03A 2W7SA 2PR3A 2TBSA 1HPGA 2SNWA 4IC6A 3S9AA 2O8TA 3MU8A 1CA0C 3OX7U 1EB2A 1V3XA 1HDTH 1PYTD 1O2JA 3LGTA 1QQ4A 1EJMA 1TA2A 2THFB 2GP9B 4AOQA 5IYTA 1N8OC 3KQBA 4XDEA 3LDXH 1HAOH 2ULLA 3NUMA 5AHGH 2H2ZA 5F8XA 2AYWA 2V6NA 3T27A 3PB1E 1P3CA 4CREA 3SGBE 4ABHA 1TWXB 3A7YA 2GT7A 3LGVA 1MKWK 1FN8A 1MCTA 4D9RA 6ESTA 1MU8B 4NSYA 3SBKA 3E16B 1ZGVA 4UFEH 3ZZ5A 3F9GA 5EU8A 2GKVE 1GI0A 4I8HA 1C2GA 1K9OE 1FQ3A 4THNH 1LPKB 4X8UH 1GBCA 1SB1H 4DT7B 1T4VH 1GHAG 3GY6A 4HZHA 1P2NA 1DXPA 2PHBA 1TABE 2XC5A 4I8JA 1P2MA 4UE7H 2SGFE 2JETB 3K6YA 2R0KA 2OC7A 1T8LA 1YF4A 1AZZA 2WINI 3UIRA 1O39A 2FS8A 2HOBA 1GJ5H 2NWNA 3L3TA 2JKHA 2QGRA 3PMJA 5FAHA 1KXDA 3AW1A 3P8OA 1XXDA 4X8VH 4YM9A 2FEQH 3MFJA 1G3EA 1LTOA 1AI8H 3BG4C 4OGYA 2ZGBH 2Z9IA 1HAIH 2FLRH 1SLXB 4JZ1A 1Y3XA 1NRQH 3EA9A 1O3CA 2PGQB 1DXWA 3RXDA 2WV5A 3ZZ4A 1D3QB 3B23B 3ZZ8A 1G36A 2FOFA 1O33A 1CQQA 4FU9A 8KME2 1FAXA 2HPPH 1GHBF 3SGAE 1O2XA 1V2OT 1RFNA 4WXIA 1CHOG 1CA8B 4FUJA 1MD8A 3CENA 5JBCS 3M35A 3GCOA 2W7UA 1C2JA 2OQ5A 1GDUA 4KTUA 1HUTH 3TLOA 4AG1A 2ZFPH 4BAMB 5EODA 2FESH 1WCZA 1O3BA 4GSOA 3SHCH 4X8TH 5ETXA 1OYQA 1CU1A 1DLEA 2FLBH 2G52A 4Y7AA 3JZ2B 1SGYE 3JZ1B 1DITH 3M7QA 1U6QA 4WMFA 5CMXH 1HAYB 2F91A 1A3EH 3ZZBA 2H1UA 1QB9A 3BTHE 1OWKA 1UVTH 1VZQH 1WTGH 2G4UA 3T62A 1BIOA 3CP7A 3GY2A 1C5NH 5TCAA 1C2LA 1HB0B 1FN6A 1J9CH 1S0RA 5F6MA 3RXUA 1AGJA 1UTQA 3TH3H 3RXEA 1TNLA 1TRYA 2PWXA 3BTWE 2FOAA 1K1IA 4HTCH 3NXPA 1RIWB 1DUEA 1P57B 2FYRA 3QO6A 3UOUA 1XKAC 4FVDA 1QHRB 3RMOH 1SBWA 1NM6A 2AS9A 2JH6D 5FCKA 3SV2H 1O3EA 2GT8A 3LPRA 4NFFA 4JZIA 4CBOA 2P16A 3A8CA 3G01A 3RC5A 1GHVH 5L2YH 3TJNA 1UHBA 1AN1E 4FUBA 2ZFTA 1ID5H 3RXKA 3SI4H 1OPHB 2QXHA 2R0LA 4ISOA 4Q7ZA 2FOBA 4WVPE 4TY7A 3UWJH 4CRDA 1EPTB 2HWLB 3LOXA 1SGEE 2HPQH 3A7WA 4XOJA 4ZKRU 1F7ZA 1PPFE 1ELDE 3ZZ9A 5DP3A 3CS7A 3A7XA 5A0BA 1NO9H 1DWDH 4ASHA 4U2WA 1O37A 1CGIE 3BV9B 1PPBH 4YTAA 1O2IA 2PFEA 4J2YB 1MAXA 5GDSH 1O3NA 3DFLA 2M5TA 1QJ6B 4OS6A 4Q7YA 4UONA 1MU6B 3RC6A 1XVMA 2C8WB 4CRBA 4D76A 3LIWA 2ZO3H 1CT2E 2OCVB 1Y3WA 6CHAB 2Y5FA 2A32A 4UEHH 3RU4E 1BRUP 1SOZA 5F03A 1O5AB 2CHAC 5AVDA 4NIXA 4I8LA 4AN7A 4U32A 1RIWC 2FYQA 4YZUA 4FVBA 2Z6BD 2BY9X 4K1TA 4NZLA 1BZXE 1G3BA 1GMHF 1EJAA 2B5TB 3PTBA 2Z9JA 4ZROA 5DO4H 3Q3KA 3TPIZ 2P3FH 3U1JB 3ZVGA 2JH0D 1ELAA 2GZ9A 2ZU1A 3S69A 2ZU5A 1DICA 1XVOA 4FUHA 3LGYA 2ZHEH 3M7TA 1O3LA 3QGNB 1Z1JA 2VNTA 1TQ0B 4H4FA 2PSYA 2UUFB 4IMZA 2WUBA 5J4SA 1UK3A 2C3SA 2F9PA 1AB9C 1C2DA 3A86A 2ZHWH 4NA7A 4B2AA 1F5LA 3Q77A 2GV6A 1TNHA 3OU0A 2WV4A 4D9QA 1AFQC 5FX6A 3VB3A 1Y5UT 2ZG0H 1HRTH 2A45B 3KIDU 5EQQA 4Y71A 3GCHB 1NN6A 2R3UA 3SV8A 2FIRH 4NSVA 2FX4A 4I32A 1GJ6A 3WY8A 1FDPA 1BOQA 3C27B 1WAYB 4OS4A 1CT4E 3K6ZA 1F5KU 2ZI2H 2VVVA 4XBDA 1GBMA 4XSKU 1P06A 1GJ7B 1MZDA 1TMUH 3BTGE 2PLXA 5C3NA 3V13A 4Y0YE 2QAAA 1YCPH 2IOTA 3GCNA 3HK3B 1BB0B 1SGQE 1BMAA 1V2VT 1P3EA 1ZGIA 1A7SA 5GIBA 4Q7XA 1QBNA 4XFQA 1F0UA 3EQ0H 3M5LA 4A1VA 1E0FD 3AASA 5T6DA 1BRBE 5H4IB 3SZNA 3EAJA 3M5NA 2IPHA 1CSOE 1PQ5A 1THRH 1Z8JB 1ETRH 1OYTH 3A7TA 1ZTLA 1QBVH 2ZGJA 3SNEA 1N8OB 1QB6A 2C90B 4IC5A 2QF3A 2QY0B 4ABIA 1SVPA 1AKSA 3KF2A 4MQAA 3U1IB 2Y80A 3SUGA 2ZFFH 4YESB 3ZZ7A 3T25A 1DS2E 1SGPE 4XBCA 3TU7H 5A0AE 1SG8B 1ZJDA 2BD9A 1Y8TA 1SGRE 2QV1A 1HV7A 4X1NU 1C5TA 3A81A 3SNAA 1K1NA 2H5DA 3SW2B 3UTUH 1YC0A 2P3UB 3SU3A 2BDYA 4ABBA 3SQEE 5F8TA 3LGUA 3PO1B 3RDZA 4MPUA 2DE8A 1T31A 1XKBC 1UK2A 2Q6DA 1MTNC 4UD9H 3QZQA 3GYLB 1ZZZA 1G30B 1TNJA 2BY6X 2J4IA 2XC4A 4AORA 4DURA 1GBEA 5SGAE 1DM4B 2B9LA 1NRPH 1P10A 3RXLA 2GCTB 3FP8E 1ESTA 2O8WA 2ZDKA 4TWWA 5HYOA 2NU3E 1RJXB 2Q1JA 3LC5A 4KTCA 4ABGA 1MTVA 2BMGB 2ZU2A 3V12A 3SGQE 1HJAC 4NWLA 3TNSA 2BD7A 2A4QA 5DKMA 1C1SA 2BLWA 2XBVA 1P02A 3QTOH 1E37B 3GCTG 4DCDA 2TPIZ 1GMCF 2V35A 3RXFA 2WPIS 2RA3A 3PTNA 4E7RG 3ZYDA 4H6SB 5EW2H 1W12U 1AB9B 2CF9H 1TGTA 3FFGA 1GDNA 3L6PA 3SU6A 5JPMH 4U01A 1ZSKA 3GDSA 1BMLA 1N1LA 4I8KA 1D6RA 3T29A 1BTZA 4KP0A 3QK1A 3TJVA 1O5DH 4NGAH 3HKIB 1P04A 1FMGA 2ZECA 4OS2A 1VR1H 3A88A 4KGAA 4Y8ZA 4ZHMU 1BRAA 3H7TA 1YKTA 1YGCH 1CGHA 1C1OA 1L1JA 4X1SU 1WQSA 3A89A 1GVLA 4AB8A 1BTXA 1F92A 3LH1A 3RM0H 1C5RA 1K1PA 3ATKA 3E0NB 3UR9A 1BHXB 1FZZA 2R2WU 1CBWC 3RXPA 4A6LA 1GI7B 3VB5A 1WBGB 4O97A 4X6NA 1AVXA 1HIAA 3BTFE 5DP4A 4BNRA 1OX1A 1LVYA 1A1RA 1UTNA 1GBHA 1EOJA 1C1QA 2G51A 4JZFH 4NA8A 3V0XA 2ODYB 1A46H 1AUJA 1MKWH 3KQEA 3GY5A 2FOCA 4Y10E 2QF0A 2Y7XA 2A7HA 5A0CA 3QX5H 3B8JA 3Q76A 5FHTA 1M9UA 3BEUA 4DY7B<