4AB8A

Fragments bound to bovine trypsin for the sampl challenge
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CATIONIC TRYPSIN
publication title The Dingo Dataset: A Comprehensive Set of Data for the Sampl Challenge.
pubmed doi rcsb
total genus 56
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ab8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4ab8A02
1HJAC 2FLRH 5TJXA 3SQEE 1C5WB 1DICA 2BD4A 2A31A 1O3DA 4FUFA 1K1IA 1GHBF 3P8GA 1SLXB 1LDTT 1F0RA 3GCTG 1DLKB 1P2NA 5G4BA 1E0FD 1CGJE 7KMEH 1P04A 1SFIA 3DT0H 2Y5HA 4RSPA 1O2VA 3GOVB 1XXDA 1Z8RA 4ISIH 2ZIQH 3MU4A 1CGHA 1NM6A 1C2LA 4YOGA 1P3EA 4Y7AA 1GI6A 1MTUA 1SHHB 5FCRA 2WPLS 3W94A 2WPMS 4K3JA 1O3HA 1HB0B 5DP6A 4I8GA 2ZFSA 3HGPA 4NIYA 3UR6A 3NZIA 3TLOA 1V2RT 2G5NA 3TJNA 3WY8A 3M7TA 4A1VA 4K2YA 1WCZA 2R3UA 1U6QA 1F0TA 3A7YA 3C27B 1GL0E 3SV7A 1K1NA 3P8FA 5ESBA 1MKWH 2C90B 4ABGA 1C5NH 1BBRH 1O2YA 4X6PA 3A89A 3LPRA 4R0IA 1MKXH 1C5YB 1ELTA 1G36A 2V6NA 1FIWA 1HBTH 6CHAB 3OX7U 4KP0A 1QJ6B 1GDQA 1SGIB 1TGCA 1QRWA 3NXPA 3TK5A 1EPTC 1TX8A 1ZR0A 3M5LA 3SNBA 2SGQE 5LH8A 2FI3E 3ITIA 1MCVA 1O2RA 1WSSH 2NU1E 4NSYA 4WMFA 1K22H 2Q6DA 5C1XA 1BHXB 1YPMH 3KQCA 3A8CA 1ABJH 3U8OH 4XOJA 1TLDA 3SUFA 1HAPH 4X2YA 4AX9H 3NPSA 1K2I1 1C5RA 4WH6A 1ANEA 1QB9A 3PM3A 4XSKU 1H1BA 3I77A 2A0QB 1PQAA 1ZTJA 1EOJA 3CP7A 5AFZH 5EW1H 4GVUA 5GWZA 1GHBG 2JH0D 8KME2 1ZJDA 2XC0A 2B7DH 1P03A 2GV6A 4UE7H 3VGCB 4D9QA 1TWXB 3RMMH 1ZLRA 1E35B 2G55A 3MO6A 1ETSH 3UNSA 1L4DA 3UWJH 1V2WT 2WINI 1GDNA 2PKSB 1O0DH 1MTSA 2H5DA 4ZXYH 5ESTE 1W10U 1QB1A 4RKJB 2H9HA 1O3BA 1OPHB 1GI8B 1NFWA 2XC5A 4FVBA 1OXGA 1BJUA 2WV5A 1ELAA 4TY6A 4NA8A 4MQAA 3MNSA 1NS3A 3UREA 5CMXH 1LPZB 4XE4A 3MO3A 5EU8A 4ZHMU 3M5MA 5FCKA 2FWWA 4DJZB 4UFFH 2ESTE 3PLBA 2XNIA 1SLWB 1A5GH 1KXEA 3RC5A 1ARBA 1GHVH 2A7HA 3T27A 4ABBA 4KTUA 1AVXA 2VVUA 3I29A 1XUFA 1MU6B 4ABEA 4ISNA 4OS7A 1S5SA 2BHGA 4ZKSU 1MTNC 1BTYA 2BLVA 4K1TA 2C8YB 3VB7A 1C5PA 2Y80A 3SUDA 1EPTA 3EE0B 4NFEA 4X6NA 5BPEA 3F1SB 4CBNA 4I8HA 1OOKB 2ALPA 1EB1H 1EOLA 5K0HA 1OWIA 3STIA 2BLOA 2ZFFH 2ZTZA 4WXVA 4J2YB 2K1QA 1MBMA 1KLIH 5CE1A 1HAGE 2H5CA 1UTJA 1LTOA 3UNRA 1AZ8A 1SSXA 3K6ZA 1QCPA 2FYQA 1W3CA 3STJA 3VFEA 1C2KA 1KTSB 1P2KA 2SFAA 3PO1C 1GI9B 4NA7A 1CA0B 1HXEH 1ELEE 1BTZA 5EQQA 3UTUH 1O32A 3O8RA 3TGKE 1UTNA 2PTNA 1A3BH 4OS4A 3RXFA 1H9IE 2C3SA 3PTNA 1ESAA 1HAYB 2SGPE 3HKIB 2BB4A 1W8BH 3EA7A 2ZPQA 1UVTH 3GY7A 4ISLA 2XWAA 4OGXA 2P16A 1HFDA 3V12A 5FBIA 2XXLA 4FUHA 3RM0H 3RXPA 3RMLH 1GGDC 3E3TA 3S69A 2XTTB 1C5OH 2UWLA 1HAVA 3CENA 4Y8YA 1VCWA 4YZUA 3KQDA 4NIXA 1BIOA 4IC5A 1SR5C 2QXIA 1QL9A 3PWBA 3SGAE 1DM4B 1O5CB 1GG6C 1O5EH 1AFQB 1KSNA 1ARCA 1O2IA 1V2UT 1UTOA 1TBQH 1G2LA 2PR3A 3SI4H 4MPUA 2XBWA 1Z71A 3F9EA 4D7GA 3OYPA 4B75A 1AWFH 1O3NA 1SQOA 2BVSH 3ZZCA 1QQ4A 4I8KA 5TCAA 3U1IB 1O5AB 1EB2A 1P0SH 3EQ0H 1NU9A 3A7WA 4AFQA 2W3KA 4LZ4B 1GI0A 3A7TA 2Y81A 4U2WA 4ASHA 1ZHMA 2P8OB 4BXWA 3EAJA 2I6QA 4BAOB 1W0ZU 1EAUA 3ATKA 1GJ6A 1KXAA 4BXSA 5EXNA 3ZVAA 1CGIE 1GJAB 1YP9A 1DOJA 1C9PA 3RC4A 3SHAH 3DHKH 4LZ1H 1KXFA 3SV6A 1YCPK 2B9LA 3K2UA 4Z0KA 1BRCE 3Q3KA 4FUJA 2A5IA 2EC9H 4FUGA 5L2ZH 1NFYA 2FPZA 4CR9A 2CXVA 3QO6A 3R0FA 4KTSA 1HAIH 1Y59T 3RXHA 3TNTA 1LVBA 1GBEA 1UCYE 1PPZA 5FX6A 4Q7ZA 1YYY1 1EAWA 2QXJA 1FY4A 1HJ9A 2ZQ1A 1TNJA 2AMDA 1GBLA 1GCDA 1EJAA 4CBOA 3RU4D 1BTHH 3T25A 1YPJH 3F68H 5F03A 1KXCA 2FOHA 2G51A 1HGTH 2ZZUH 5EXLA 3S9AA 1UCYK 2BY9X 1GCTC 1GBHA 1CA8B 3QGNB 3VGCC 1JXPA 4XFQA 1AVWA 3E90B 2BDBA 1QTFA 3ODFA 1VITF 2BDIA 1WV7H 1WQVH 3SNEA 2TBSA 1G2MA 7GCHF 3BEUA 1CT4E 1FY8E 2QGRA 1AQ7A 1SL3A 2W5EA 3FAOA 3UIRA 4X8UH 4NZLA 4LK4A 3RXQA 1KTTB 2OD3B 1C1NA 2ZQ2A 2RG3A 2R0KA 4NCYA 4YO9A 5FPYA 3PMHB 1ZPCA 1HUTH 1TPAE 1T8OA 4X6MA 3ELAH 1GBMA 5C67A 4FU9A 2Z9LA 3EDXB 2PHBA 4X8SH 1C1WH 4B73A 3M3SA 4DG4A 2SGFE 5A2MH 1OSSA 4IMZA 1JRSA 5T6DA 1QBOA 3PTBA 2O8TA 1FDPA 1O3EA 3AW0A 5I46H 1GVLA 1DE7H 3P95A 2VWOA 3Q3XA 1NFUA 1D6RA 1TRMA 3DFJA 1FY5A 1ZSKA 3MNBA 4I32A 2TGTA 1KYNA 1T8NA 5F6MA 1QR3E 4Y7BA 1C2GA 3ZVEA 3TIUA 1YPKH 1EAXA 4B2CA 5GXPA 1DANH 2QY0B 1TRYA 3LGVA 3MU1A 2Z9JA 3QLPH 1BBRE 1GMDF 2WPJS 3RXGA 1KDQA 1C1RA 2GCHG 2WYGA 1D3TB 3A81A 1O3AA 1G3BA 4ABJA 1IQMA 5DP9A 1ANCA 3GYMA 3BG8A 2VINA 4Y8XA 1K1PA 4AN7A 5IDKA 2PSYA 3IG6B 3A87A 1ELFA 1O31A 3A8BA 3SORA 2J2UA 4BANB 1YM0A 3BEFB 1C1OA 1FY1A 1C2IA 1GVZA 2UUFB 2V3HH 1Y3XA 1KXDA 4BTIB 2G52A 4UFDH 5JPMH 2ZHDA 4Y10E 1TMUH 2I6SA 2W7SA 1VITG 2ASUB 2XBXA 2ZU2A 5A0CA 4BAHB 3ATMA 2F9PA 1Y3WA 1N8OC 1SB1H 2SNVA 3RXAA 3F6UH 1XVMA 8ESTE 4TPIZ 2A5KA 1KXBA 4WMEA 5LGOA 3MNXA 3U9AH 2OQ5A 5AHGH 3A84A 4XDEA 3M5NA 1HIAB 2J4IA 1CQQA 1XUHA 1ZMLA 4WH8A 1AKSA 2HRVA 4DIHH 1LKAA 4GSOA 3RXJA 2D2DA 3S9CA 3MWIU 2OUAA 2B8OH 2BVXH 1C5SA 4F4OC 5SGAE 4DT7B 1EXFA 3OU0A 1SOZA 1ZJKA 2XBYA 5E8EH 1O3MA 1BRAA 3LIWA 2J94A 4JYUH 1P06A 4GHTA 2OC8A 4X1PU 2BM2A 4ABDA 5JBBS 2OLGA 1SVPA 3M7UA 1F5RA 2AGGX 3NK8A 4A1TA 1LO6A 1YPEH 5HM2A 5EW2H 1DVAH 1SGTA 3LC3A 1T7CA 1GMDG 3ODDA 1P57B 4ZKOU 1HRTH 5B6OA 2FXRA 1YLCA 3RXVA 4Y79A 1W12U 1Y5BT 3GDUA 4B76A 2P8OC 1P8VC 3L6PA 5E0GA 3B23B 1HNEE 3SU4A 4H42U 1WTHD 1DWBH 2BY8X 1PPFE 1N6XA 1P3CA 2GT7A 1TYNA 2JETB 3KNXA 5GCHF 4VGCB 1YPGH 1DPOA 4DIIH 1QHRB 3KF2A 1SMFE 1QB6A 3SU1A 1AD8H 5DG6A 1AZZA 1Y8TA 1D6WA 3BTDE 1O3KA 1C5VA 1DY8A 3LJJA 3ZZ5A 3PB1E 2XWBI 1O2PA 1VGCC 1WYKA 3LT3A 1TRNA 3GY2A 1H8IH 1GI2A 3MO9A 2VIVA 8GCHF 3VXEH 1UTMA 2OC7A 1QURH 1XKBC 3E8LA 1QA0A 4XBBA 1O39A 3FZZA 1GL1A 4AFZA 1RTLA 3AW1A 1BMAA 5C5OA 2PSXA 1NC6A 5ETXA 1M9UA 3VB5A 2ZWLH 1EZUC 1WBGB 3M35A 7LPRA 4FU8A 2VVVA 3LGWA 1UVOA 5GPIB 3KIDU 1TPSA 1C2DA 3QZRA 3P8NA 1FY3A 3GISB 3SHCH 1BJVA 3E0PB 3FP7E 3ZVCA 1C1SA 3MH4A 3KHVA 4MNYA 4KGAA 4ABAA 1QGFA 1LCYA 3AVZA 1DITH 4WVPE 3RUOA 2W26A 2ZO3H 1EZQA 4AFUA 5E2OA 3PMJA 4IS5A 2HOBA 4INLA 3URDA 1GMHF 1T4VH 4E7NA 1TABE 1ETTH 1GJ4H 1K9OE 1TBZH 4FU7A 1DUAA 3P92A 2ZU4A 3MHWU 2TPIZ 2Q6GA 1C4U2 1UTKA 1TQ7B 5GCHG 1D3DB 4O97A 1G32B 3NCLA 2J38A 1FV9A 2PW8H 3NWUA 1C1UH 3QK1A 1C1TA 4FUBA 2ZFRH 4THNH 4K1SA 1FMGA 1GJ5H 2ZCHP 1P2OA 3MU5A 1IQNA 1LHCH 1LMWB 2SGAA 1A1RA 3A85A 5CHAB 1FAKH 3A8AA 1C5ZB 1O5FH 2FODA 1OYQA 1IQFA 4NZQA 4CRGA 1NRRH 4O03A 5DJ7A 1J8AA 1K1JA 8GCHG 1AUJA 2VIPA 3ZVDA 4K8BA 1UK4A 1L0ZA 2V3OH 3S7KB 4D7FA 2A7CA 1NU7B 5HYOA 1HXFH 2IOTA 4BTTB 3SJ9A 4JCNA 4O9VA 1F5KU 1MCTA 1EAIA 3GCHC 3A7VA 1F7ZA 2ZHWH 1Z7KA 4AB9A 3E1XB 2GDEH 8LPRA 3P70B 4AYVB 2BD7A 1AFEH 2VWLA 4JZFH 2A7JA 1BRUP 1FPHH 3BN9A 2QF3A 2GVFA 3MNCA 2OCVB 4YT6H 2BD8A 3A7ZA 1RTKA 2LPRA 1GMCF 2R2MB 1TNHA 3M3VA 1P2JA 2PKAB 4ZKRU 4HTCH 1SGDE 2F9OA 2ZFTA 2VGCC 4FUEA 3SU2A 1AHTH 3BEIB 2FOBA 2XC4A 4INHA 5A8ZA 3M7QA 2BY7X 1GI1A 2GP9B 1O3CA 2ZPRA 3F9FA 3VB3A 4Q7XA 2ZTXA 1GMHG 1V2NT 3RXTA 2HGTH 1HPGA 4D76A 1C5XB 1EQ9A 1TIOA 2GMTC 5C5NA 1N1LA 2QXGA 1DT2A 1ZSJA 3ZYDA 3TVJB 2GCTB 1MU8B 3KEEA 3SV9A 3GY4A 1O2SA 2BDYA 2BTCE 4MPWA 1G3CA 1DSTA 1GWAA 4NG9H 2GTBA 4CRAA 4X6OA 1GBIA 5HXFA 1EATA 2KAIB 1AIXH 2G00A 3ZVFA 1MH0A 2QV1A 4NIVA 3SV8A 4PROA 4I7YH 1C2FA 1C5QA 2ILNA 3RXBA 2AYWA 2RCEA 1NRSH 1RIWC 4HGCA 5EXMA 2ZEBA 4K5ZA 1AB9B 3TH3H 2EI6A 1O2LA 4O3UA 1CHGA 1NT1A 1GHZA 4NSVA 3SOSA 4SGAE 2GDDA 1GHYH 2G4UA 3ZZ8A 1DFPA 1HAXB 3ZZBA 1AU8A 1BDAA 5F8TA 2QYIA 1FI8A 3K6YA 3O8BA 3U8TH 1L1JA 1VJ9U 1MTWA 1A2CH 2PLXA 4U32A 1NY22 4A1XA 1CBWB 4KKDA 1V6DA 1A5IA 1YBWA 4KTCA 5FBEA 2BD5A 1S81A 1UVUH 2TGPZ 2CGAA 3A86A 1GBBA 1HAZB 1P10A 2Z7FE 3VB6A 3FVFB 3A7XA 2Y5FA 1B0FA 3BF6H 2AIQA 1LHGH 1QNJA 4CHAC 2O8LA 5HMAA 3RXEA 1GMCG 2ZDMA 1UHBA 2CHAB 1Q2WA 1QJ7B 1KLTA 1OYTH 2GV7A 1ZZZA 3ENSB 2Z9IA 1FLEE 1SLUB 3RXIA 1ID5H 1B7XB 2DUCA 3D23A 1TA2A 2JKHA 2ZHFH 1K1OA 3QTOH 2CF8H 2A4QA 1C5MD 4CRBA 1YGCH 4U01A 2ZCKP 2C93B 4FUCA 1JWTA 1W14U 4X2XA 1ESBA 4WJG2 5DO4H 2BQ6B 2XCNA 5E2PA 2ZGXH 1XMNB 3TH4H 1G3EA 2FIRH 2FMJA 3PLPA 1EP6A 3SNCA 3MFJA 2OBOA 2Y7ZA 4RKOB 3BG4B 1INCA 1O5GH 1D4PB 2H9EH 3LOXA 3U8RH 2FLBH 2C4FH 2UWOA 2UUJB 4MG3A 3ZVGA 1UVSH 4AOQA 1C4Y2 1E37B 4FUIA 3UQVA 3Q3YA 4R8TB 1Z1IA 6CHAC 2Z3EA 3SJOA 2FOAA 1IQEA 1Y3VA 2HPQH 1CT0E 5EPNA 1FIZA 5HGGA 4WMDA 1AE5A 5C2ZA 2ZU1A 3U98H 2G8TA 1L1NA 3LC5A 4Q2KA 1D9IA 2G4TA 3Q00A 1PPCE 2Q6FA 3RXOA 3MI4A 3RXRA 4I31A 1O2WA 1VCPA 3QN7A 1OS8A 1TFXA 2GCHF 4YT7H 3A83A 1P9UA 2VVCA 4Y71A 4CH2B 6ESTA 1ESTA 1E38B 2Y7XA 4AG1A 4DGJA 3T26A 4DVAU 3TK6A 2NU0E 4Y0YE 5DPAA 3GY8A 1JBUH 3MMGA 1P02A 1CSOE 1RFNA 5DP7A 1UK2A 2ODPA 1GBJA 3QGJA 3KN2A 1IAUA 5FPTA 3LGIA 1NTPA 3D49H 3O8CA 4GPGA 1SGFA 1HJAB 1F92A 3HK6B 1C5UA 1DDJA 4ISOA 4ZUHA 1PQ8A 1MZAA 1O5DH 4UD9H 4WF8A 1ZPBA 2PKSC 5FHTA 1AE8H 2NU3E 1BRBE 2ZDLA 1HJ8A 4MPXA 4Y76A 4A7IB 1XKAC 2UUYA 2C8WB 1J14A 2F9BH 5F8ZA 1LQDB 1S85A 6LPRA 1AMHA 1LPKB 1FONA 1MD8A 2ZKSA 3ATLA 4TY7A 1LHFH 2BOKA 1LVMA 1V2JT 4FXGH 2D1JA 2ALVA 1SGPE 2XCFA 4NFFA 2ZDKA 4X1SU 2QXHA 1QRXA 1OP8A 1DSUA 2FS9A 5EOKA 1HLTH 3UOPA 4K69A 1E34B 1BCUH 1RRKA 1CO7E 2FESH 1ANDA 1KLJH 1ZYOA 3RXCA 3TITA 1EASA 2FOCA 1O3FA 3K65B 2J95A 1VITH 2FS8A 2ZDNA 4B74A 1JIMA 4SGBE 1ELVA 1IQKA 5EODA 2YNBA 1OP2A 2P95A 3P6ZB 4MNXA 1SQAA 3MTYA 2ANYA 1EPTB 2VH0A 2FX6A 3BIUH 3BTTE 2ZFPH 1TNLA 3RM2H 3A88A 1V2ST 1GHAF 2QAAA 1P9SA 3P17H 4D9RA 1MKWK 2UWPA 3PYHA 2NU2E 5C1UA 1SG8B 1BBRK 3TJOA 2BDGA 1P2MA 4HFPB 1MKXK 3FFGA 2BZAA 3HKJB 1FQ3A 3IWMA 1Q3XA 2TIOA 2QN5T 4ESTE 3QWCH 4JZEH 1EX3A 2A2QH 2GT8A 3UOUA 1A61H 4ZHLU 1GJDB 4BAQB 1Y3UA 5DKMA 1O5BB 1CA0C 3RU4E 1ZRBA 4AORA 1H8DH 3TGJE 2YNAA 4X0WU 2CF9H 2ZGCA 1JOUB 4X1RU 2F3CE 1ELDE 5TCCA 2SGEE 4MLFB 1P11E 1AGJA 2HLCA 3PWCA 1JMOH 1MUEB 1EKBB 4AGJA 1LKBA 1SGQE 5PTPA 5C1YA 1B5GH 2GKVE 1MBQA 1BQYA 3ATIA 2BYAX 1Q31A 3UR9A 1P09A 4FVDA 1ELCA 2F9UA 5HM9A 1NFXA 2A5AA 5JBAS 3E0NB 4GCHF 4E05H 3RMNH 3L3TA 1SPJA 3U69H 3V13A 1HAVB 1A0HB 3TPIZ 2BDAA 4QT8C 4TYDA 2OQUA 3GY6A 1GBFA 1TONA 1VR1H 3AAUA 3TNSA 1SGNE 1MAYA 2A32A 5AF9H 1V3XA 3BTHE 4IGDA 3PLKA 1T4UH 5JDUB 1THPB 2ZU3A 1LQEA 2J92A 4JZIA 1VJAU 1AFQC 2FOEA 4IMQA 3SJ8A 1YPHC 1VCQA 4NA9H 3S9BA 1OP0A 2EA3A 3BIVH 1GJCB 1RJXB 4NGAH 5F8XA 1S84A 3SV2H 2P94A 1T8LA 4UONA 3SZNA 2R3YA 1YCPH 1BZXE 1ZPZA 1TGSZ 1OWJA 3ZZDA 4DCDA 2EEKA 1YPLH 1G3DA 1WU1A 4MPVA 1DXPA 1NN6A 2ZFQH 3RP2A 1DWEH 4JYVH 5LPFA 5J4SA 4K8YA 3V3MA 3ZZ3A 2PUQH 4X8TH 2UUKB 5LPRA 2ZA5A 4TPYA 1XXFA 1GHAG 2Z94A 3GY5A 1GJ8B 3KL6A 3TU7H 3LJOA 3OY5U 3SU5A 1MTNB 1UTQA 1BITA 2O8WA 3B9FH 2BQ7B 4ZMAH 4UEHH 4YM9A 2OBQA 2BY6X 3JZ2B 2XW9A 1PPBH 1MQ5A 2VIOA 3LGYA 1ZMNA 3W95A 1DX5M 1P2IA 4AYYB 4JK5A 2FOMB 4RN6A 3SO3A 2SNWA 2ZG0H 3EYDA 2BLWA 4I8LA 1UJ1A 2Z3DA 2H1UA 2CJIA 1AVGH 1UCYH 2BDCA 1V2QT 2IPHA 3TJVA 5DP8A 3H7TA 3QZQA 4BAKB 1ANBA 1PYTD 3QX5H 4YLUA 3GCNA 4IW4E 1SHYA 3FP6E 2VH6A 1NPMA 1MZDA 3PO1B 1UTLM 1ZGIA 3BTGE 3NUMA 1ELBA 5DP4A 1TX6A 3DUXH 2FDAA 1A4WH 4OS1A 1G9IE 4ABIA 4GCHG 3OSYA 1ZRKA 2AMPA 1NRNH 2ZDAH 4KELA 3T29A 2QIQA 3E16B 1O2KA 1YC0A 1Z6JH 1PJPA 3BSQA 1W7XH 2FX4A 1PYTC 3UFAA 1ORFA 1BHXF 1O35A 1ETRH 2P93A 1BUIA 2RA0A 3RLWH 1GGDB 1O2ZA 1GI3A 5AVDA 4JMYA 1YPHE 3M61U 2A1DB 3P8OA 1C2JA 3TJUA 2P59A 4CRDA 1BTXA 1BMNH 1SGFG 4IN2A 4ZROA 3ZZ7A 3L33A 3N7OA 5IYTA 1GG6B 1GBCA 1O36A 4BNRA 3V0XA 1V2VT 2H9TH 3GDSA 1CHOF 4HZHA 2GZ7A 2BD3A 4Y6DA 1XUIA 3O8DA 1OWKA 3LGTA 4CR5A 3B8JA 3F9HA 2AMQA 3LONA 4X1NU 1QY6A 2O8UA 1GI7B 1O33A 2VNTA 4GHQA 1J16A 1IOEA 3GDVA 1OX1A 3S7HB 3ZZ9A 4DW2U 1ACBE 4GUXA 4B1TA 2V0BA 3D62A 3HK3B 1KIGH 3MH7A 3RDZA 3SGBE 1KDQB 2ZU5A 2ZI2H 3Q77A 2PGQB 2R0LA 2WPHS 4TWWA 3LU9B 1XUKA 4Y0ZE 1K28D 2BMGB 1WOFA 1O2TA 1O3OA 2SGDE 5L6NH 3U1JB 4GAWA 1F5LA 2QA9E 1K1LA 1PPEE 3SUEA 2TGDA 1BTPA 1GJBB 1NESE 1UTPA 1W2KH 2NWNA 1UO6A 2QC2A 1Z6EA 2Y82A 1TX7A 5J4QA 3SGQE 1YCPM 1KY9A 2BXTH 2STAE 1O3PB 2R2WU 1YKTA 2BXUH 5T6FA 1TNGA 1AO5A 5A8XA 1LPGB 5EQSA 1O2GH 1SI5H 2BDHA 2H6MA 1FZZA 1QJ1B 5EG4A 1OKXA 3BTQE 1AN1E 1O38A 3I78A 1RGQA 2GZ9A 1A3EH 2AERH 4LOYH 2HWLB 2G81E 2WPIS 1MMJN 1GCTB 3QTVH 4MVNA 3RLYH 3TGIE 1PPHE 3UQOA 1SBWA 2FO9A 1DXWA 3SI3H 2M5TA 1J9CH 2ODQA 3SJKA 3NKKA 2OP9A 1NZQH 3SU0A 2Y6TA 3ZVBA 3G01A 1L2EA 1NRPH 1O2QA 2TRMA 1WUNH 1AKSB 1TB6H 1GI5A 3M5OA 4M7GA 4A92A 2WUCA 1IQHA 2PUXB 4JYTA 1JRTA 1QBNA 1MAXA 4MDSA 4E7RG 1QFKH 2B5TB 2EI8A 1LVOA 4MNWA 1CHOG 4BTUB 1EZSC 1ZGVA 2F9VA 4DURA 4OS6A 5FX5A 7ESTE 2FI4E 2BOHB 1ZMJA 4Y11E 4UFEH 4WY3A 2ZTYA 2ZGJA 5L30H 1CT2E 3RU4T 3UY9A 1SQTA 2BD9A 2BVRH 2Y5GA 5L2YH 3EA8A 1JIRA 1J15A 2Z9KA 1Z1JA 2W7UA 3R3GB 1O34A 4H6SB 4WWYA 1ZHPA 3D65E 1A0JA 1GBKA 2XBVA 1A46H 2FEQH 4I8JA 3PMAB 5A09A 2FTLE 1BT7A 2VJ1A 2FZZA 2ZP0H 1C1MA 2PTCE 2ULLA 1EJMA 1W0YH 2H2ZA 4OS5A 3FANA 1BB0B 1V2LT 4DOQA 2R9PA 4X1QU 1V2OT 2AGIX 3QDZB 2LNCA 1HAOH 1CE5A 1SGEE 1S83A 5H4IB 1G30B 1FXYA 3ZZAA 2CN0H 2ZHEH 2VIQA 5EQRA 1H4WA 2JETC 4IN1A 1W13U 4VGCC 4XBCA 2JH6D 4CREA 4OS2A 4O3TA 4U30A 1X7AC 5A0AE 1C9TA 2F91A 4DY7B 3VXFH 4Z6AH 1QRZA 1XX9A 1ZOMA 1O3IA 1B0EA 1P01A 3RMOH 1VZQH 2OINA 1T31A 4NWKA 4H6TA 2PV9B 1IQGA 3HATH 3A82A 1HCGA 2HNTC 5DGJA 1GBTA 1THRH 4CRFA 1OWDA 6GCHF 1TE0A 1IHSH 2HALA 1TALA 1EP5A 1UK3A 3MH6A 4UDWH 1TMBH 3BTME 2VIWA 1GHXH 1TOMH 4INKA 3A80A 5GDSH 2OXSA 3BTEE 4NIWA 2PWXA 4FUDA 2F83A 1N8OB 2YOLA 1FN8A 2VU8E 5DP5A 4OGYA 1C2HA 3VEQB 1J17T 1WAYB 1NO9H 1PQ7A 4GLYA 1DS2E 1SGYE 2NU4E 5AFYH 1TOCB 3HGNA 4K60A 1QL8A 1SFQB 2CMYA 4CH8B 5JBTA 3BV9B 1V2TT 1S0RA 1HIAA 2ANWA 2D26C 3Q76A 4AZ2B 4BOHA 1G37A 1FN6A 4ZHAA 4JZ1A 4ZXXH 3ZYEA 1FUJA 3LDXH 1OWEA 4I33A 2BD2A 2P3UB 1SGRE 3AAVA 3SU6A 1PFXC 2ZHQH 1T32A 1UMAH 1ELGA 3LH1A 3S0NA 3PV4A 1MQ6A 3LH3A 1OWHA 2ZECA 3H7OA 1V2PT 1TNKA 1A0LA 3SNDA 1V2MT 1C1VH 1P05A 2OTVA 1ZTLA 4UFGH 3LGUA 1O2JA 2ODYB 2ZCLP 3SJIA 4X8VH 2GGVB 1RD3B 2BY5X 3GCOA 1C2EA 1L1GA 2C8XB 3MU0A 3SNAA 4Y8ZA 5A8YA 5JYIA 2QCYA 1GJ9B 1O2MA 1W7GH 4YLQH 1EJNA 2A4OA 1IHTH 4J1YA 1BA8B 2J34A 2RDLA 3MU8A 1SLVB 3VB4A 1GBAA 1YLDA 1H9HE 1FPCH 3MOCA 1BMLA 2HNTE 3T5FH 1EUFA 2TGAA 2OC1A 1F0SA 1TAWA 5CHAC 4B71A 6GCHG 1LHEH 1V2KT 5JB9S 1AI8H 4YTAA 5C3NA 3A8DA 9LPRA 1XM1A 3QUMP 4Q80A 4XBDA 1GPZA 1GVKB 3M36A 3RXLA 2CV3A 1GHWH 1BOQA 1O2OA 1VGCB 2XYAA 3JZ1B 4IC6A 4ABHA 4CRCA 1EZXC 1ZSLA 2WV4A 1O2NA 1Z8IB 3ZZ4A 2W3IA 3BTKE 5EGMA 1N6YA 1O30A 1TPOA 2PGBB 4IBLH 1WTGH 3UPEA 2B0FA 2IN2A 2THFB 2RA3A 2WYJA 4Q7YA 2AIPA 3MH5A 4AB8A 3RXMA 4ABFA 1PQ5A 1DY9A 4ZH8A 1HV7A 1O3GA 2BLQA 1DWDH 4HI3A 1A7SA 5EPYA 3K9XB 1HDTH 1XUGA 4X2VA 2XRCA 2VB0A 3RXSA 1H9LB 1IQIA 1GDUA 2FP7B 2DE8A 1S0QA 3RXKA 1Y3YA 1IQJA 1W11U 2WPKS 3HPTB 2WUBA 1TPPA 1TA6A 2IJOB 3OTJE 2FM2A 2A4RA 2GCTC 4ZKNU 1HYLA 2AEIH 1GJ7B 1O2UA 5GIBA 4MNVA 1TBRH 1CVWH 1O3LA 1FAXA 3MYWA 4YOIA 3ATWA 5BRRE 1DWCH 1FNIA 3UWIA 2FYRA 2VWMA 2ZPSA 1TGBA 5DK1A 1SC8U 3EGKH 2VIDA 3PROA 2O8MA 4YESB 2HVXA 2ZF0H 1A5HA 3GICB 1TGTA 1Y5AT 3E6PH 3RC6A 2F9NA 3EA9A 1P12E 1QA7A 3E91A 1C1PA 1HAHH 1TMTH 3H5CB 3ZZ6A 1TNIA 3BTFE 3M37A 4X2WA 1LVYA 1AB9C 1O37A 1Y5UT 1Z8GA 3ESTA 4AG2A 1ZTKA 1S82A 2AH4X 1QL7A 5FXLA 1T8MA 3SQHE 3ZV9A 3SU3A 1C4V2 2ZGHA 3T2NA 4JZDH 1CU1A 5T3HA 3SN8A 4BAMB 5FAHA 2BX4A 2Z3CA 1C5TA 1C1QA 2Z6BD 2DE9A 5ABWA 1K1MA 5K7RA 1RTFB 3FZDA 1TGNA 1CBWC 1D3PB 1S6FA 2Z9GA 3F9GA 4F49A 1LHDH 3KQBA 1IQLA 4AFSA 5A0BA 3GY3A 3KGPA 1UHBB 2FI5E 2JH5D 1DUEA 1BTWA 2QF0A 2AFQB 4H4FA 3GCHB 4WXIA 1E36B 1GBDA 2ZGBH 3CS0A 2CHAC 1C2MA 5JB8S 3FP8E 1SOTA 2VWNA 7GCHG 1BMMH 1PPGE 4MTBA 2PFEA 5FPSA 5I25A 1DLEA 1AWHB 5DP3A 1ABIH 4NWLA 4TWYA 1D3QB 1S6HA 4E06H 4JK6A 3VPKA 3ZV8A 4A6LA 3SUGA 3C1KA 4K1EA 2VGCB 3RXUA 3M3TA 1XVOA 2PKAA 3GCTF 3SBKA 4YOJA 1RXPA 1C5LH 2BZ6H 1QBVH 9ESTA 2A45B 2HNTF 3DD2H 1F0UA 3CS7A 3KQEA 2BX3A 4B2BA 2A4GA 1UVPA 2GMTB 4ZAEA 1AY6H 1P2QA 5T6GA 2O9QA 1MD7A 3BG4C 2ZDVH 3IITA 3PMBB 3GYLB 1AUTC 1K21H 1NROH 2V35A 3TK9A 2BQWB 3T28A 3UNQA 3RXDA 2FTMA 4AGKA 5LPEA 3SW2B 3OY6U 3T62A 3TH2H 2AS9A 2KAIA 1THSH 2D8WA 1SGCA 3V7TA 1FJSA 1RIWB 5E0HA 1O3JA 5C20A 5GJ4B 1ZHRA 4D8NA 2GX4A 2HPPH 1MTVA 2J9NA 1QIXB 1L4ZA 1WQSA 2ZC9H 1NRQH 2FOGA 4B2AA 2G5VA 3AASA 1O2XA 1GI4A 1QQUA 3BTWE 4LXBH 2ANMH 2GZ8A 2STBE 4A5TS 2Q1JA 4ISHH 5E0JA 1XUJA 1RS0A 2A2XH 1F2SE 1Z8JB 2GD4B 1O2HA 1BTUA 2ANKH 2EI7A 3KCGH 3UUZA 2C8ZB 2FOFA 2ZNKH 3DA9B 2P3TB 2P3FH 3URCA 2AGEX 3LKWA 3DFLA 1TQ0B 2OC0A 4CHAB 5JBCS 1YF4A
chains in the Genus database with same CATH superfamily
1HJAC 2FLRH 5TJXA 3SQEE 1C5WB 1DICA 2BD4A 2A31A 2KR7A 1O3DA 4FUFA 1K1IA 1GHBF 3P8GA 1SLXB 1LDTT 1F0RA 3GCTG 1DLKB 1P2NA 5G4BA 1E0FD 1CGJE 7KMEH 1P04A 1SFIA 3DT0H 2Y5HA 4RSPA 1O2VA 3GOVB 1XXDA 1Z8RA 4ISIH 5C17A 2ZIQH 3MU4A 1CGHA 1NM6A 1C2LA 4YOGA 1P3EA 4Y7AA 1GI6A 1MTUA 1SHHB 5FCRA 2WPLS 3W94A 2WPMS 4K3JA 1O3HA 5KEDA 1HB0B 5DP6A 1KMHB 4I8GA 2ZFSA 3HGPA 3KYGA 4NIYA 3UR6A 3NZIA 3TLOA 1V2RT 2G5NA 2F4LA 1NBME 3TJNA 3WY8A 3M7TA 3DSPA 4A1VA 4K2YA 1WCZA 2HVYB 2R3UA 1U6QA 1F0TA 3A7YA 3C27B 1GL0E 3SV7A 1K1NA 3P8FA 5ESBA 1MKWH 2C90B 4ABGA 1C5NH 1BBRH 1O2YA 4X6PA 3A89A 3LPRA 4R0IA 1MKXH 1C5YB 1ELTA 1G36A 2V6NA 1FIWA 1HBTH 6CHAB 3OX7U 4KP0A 1QJ6B 1GDQA 1SGIB 1TGCA 1QRWA 3NXPA 3TK5A 1EPTC 1TX8A 1ZR0A 3M5LA 3SNBA 2SGQE 5LH8A 2FI3E 3ITIA 1MCVA 1O2RA 1WSSH 2NU1E 4NSYA 4WMFA 1K22H 2Q6DA 5C1XA 1BHXB 1YPMH 3KQCA 3A8CA 1ABJH 3U8OH 4XOJA 1TLDA 3SUFA 1HAPH 4X2YA 4AX9H 4Z1MD 3NPSA 1K2I1 1C5RA 4WH6A 1ANEA 1QB9A 3PM3A 4XSKU 1H1BA 4AC9A 3I77A 2A0QB 1PQAA 1ZTJA 1EOJA 3CP7A 5AFZH 5EW1H 4GVUA 5GWZA 1GHBG 2JJ1D 2JH0D 8KME2 1ZJDA 2XC0A 2B7DH 1P03A 2GV6A 4UE7H 3VGCB 4FOUC 4D9QA 1TWXB 3RMMH 1ZLRA 1E35B 2G55A 3MO6A 1ETSH 3UNSA 1L4DA 3UWJH 1V2WT 2WINI 1GDNA 2PKSB 1O0DH 1MTSA 2H5DA 4ZXYH 4ZCNA 5ESTE 1W10U 1QB1A 4RKJB 2H9HA 1O3BA 1OPHB 1GI8B 1NFWA 2XC5A 4FVBA 4OM9A 1OXGA 1BJUA 2WV5A 1ELAA 4TY6A 4NA8A 4MQAA 3MNSA 1NS3A 3UREA 5CMXH 1LPZB 4XE4A 3MO3A 5EU8A 4ZHMU 3M5MA 3ZIAD 2FWWA 4DJZB 5FCKA 4UFFH 2ESTE 3PLBA 2XNIA 1SLWB 1A5GH 1KXEA 3RC5A 1ARBA 1GHVH 2A7HA 3T27A 4ABBA 4KTUA 1AVXA 2VVUA 3I29A 1XUFA 1MU6B 4ABEA 4ISNA 4OS7A 1S5SA 2BHGA 4ZKSU 1SKYE 1MTNC 1BTYA 2BLVA 4K1TA 2C8YB 3PV5A 2KCAA 3VB7A 1C5PA 2Y80A 3SUDA 5C0TA 1EPTA 3EE0B 4NFEA 4X6NA 5BPEA 3F1SB 4CBNA 4I8HA 1OOKB 2ALPA 1EB1H 1EOLA 5KGOA 5K0HA 1OWIA 3STIA 2BLOA 2ZFFH 2ZTZA 4WXVA 4J2YB 2K1QA 1MBMA 1KLIH 5CE1A 3GS9A 1HAGE 2H5CA 1UTJA 3CNRA 1LTOA 3UNRA 1AZ8A 1SSXA 3K6ZA 1QCPA 2FYQA 1W3CA 3STJA 3VFEA 1C2KA 1KTSB 1P2KA 2SFAA 3PO1C 1GI9B 2JJ2D 4NA7A 1CA0B 1HXEH 1ELEE 1BTZA 5EQQA 3N99A 3UTUH 1O32A 3O8RA 3TGKE 1UTNA 2PTNA 1A3BH 4OS4A 3RXFA 1H9IE 2C3SA 3PTNA 1ESAA 1HAYB 1YY3A 2SGPE 3HKIB 2BB4A 1W8BH 3EA7A 2ZPQA 1UVTH 3GY7A 4ISLA 2XWAA 4OGXA 2P16A 1HFDA 3V12A 5FBIA 2XXLA 4FUHA 3RM0H 3RXPA 3RMLH 1GGDC 3E3TA 3S69A 3KYFA 2XTTB 1C5OH 2UWLA 1HAVA 3CENA 4Y8YA 1VCWA 4YZUA 3KQDA 4NIXA 1BIOA 4IC5A 1SR5C 2QXIA 1QL9A 3PWBA 3SGAE 1DM4B 1O5CB 1GG6C 1O5EH 1AFQB 1KSNA 1ARCA 1O2IA 1V2UT 1UTOA 1TBQH 1G2LA 2F43B 2PR3A 3SI4H 4MPUA 2XBWA 1Z71A 3F9EA 4D7GA 3OYPA 4B75A 1AWFH 1O3NA 1SQOA 2BVSH 3ZZCA 1QQ4A 4I8KA 5TCAA 3U1IB 1O5AB 1EB2A 1P0SH 3EQ0H 1NU9A 3A7WA 4AFQA 2W3KA 4LZ4B 1GI0A 3A7TA 2Y81A 4U2WA 4ASHA 1ZHMA 2P8OB 4BXWA 3EAJA 2I6QA 4BAOB 1W0ZU 1EAUA 3ATKA 1GJ6A 1KXAA 4BXSA 5EXNA 3ZVAA 1CGIE 1GJAB 1YP9A 1DOJA 1C9PA 3RC4A 3SHAH 3DHKH 4LZ1H 1KXFA 3SV6A 1YCPK 2B9LA 3K2UA 4Z0KA 1BRCE 3Q3KA 4FUJA 2A5IA 2EC9H 4FUGA 5L2ZH 1NFYA 2FPZA 4CR9A 2CXVA 3QO6A 3R0FA 4KTSA 1HAIH 1Y59T 3RXHA 3TNTA 1LVBA 1GBEA 1UCYE 1PPZA 5FX6A 4Q7ZA 2JIZD 1YYY1 3OE7D 1EAWA 2QXJA 1FY4A 1HJ9A 2ZQ1A 1TNJA 2AMDA 1GBLA 1GCDA 1EJAA 2KCOA 4CBOA 3RU4D 1BTHH 3T25A 1YPJH 2LP6A 3F68H 5F03A 1KXCA 2FOHA 1WXRA 1W0KD 2G51A 1HGTH 2ZZUH 5EXLA 3S9AA 1UCYK 2BY9X 1GCTC 1GBHA 1CA8B 3QGNB 4P00A 3VGCC 1JXPA 4XFQA 1AVWA 3E90B 2BDBA 1QTFA 3ODFA 1VITF 2BDIA 1WV7H 2QF5A 1WQVH 3SNEA 2TBSA 1G2MA 7GCHF 3BEUA 2KM0A 1CT4E 1FY8E 3UB0A 2QGRA 1AQ7A 1SL3A 2W5EA 3FAOA 3UIRA 4X8UH 4NZLA 4LK4A 3RXQA 1KTTB 2OD3B 1C1NA 2ZQ2A 2RG3A 5EJ1A 2R0KA 4NCYA 4YO9A 5FPYA 3PMHB 1ZPCA 1HUTH 1TPAE 3EE7A 1T8OA 4I86A 3ELAH 4X6MA 1GBMA 5C67A 4FU9A 2Z9LA 3EDXB 2PHBA 4TSFD 1C1WH 4X8SH 4B73A 3M3SA 4DG4A 2SGFE 5A2MH 1OSSA 4IMZA 1JRSA 5T6DA 1QBOA 3PTBA 2O8TA 1FDPA 1O3EA 3AW0A 5I46H 1GVLA 1DE7H 3P95A 2VWOA 3Q3XA 1NFUA 1D6RA 1TRMA 3DFJA 1FY5A 1ZSKA 3MNBA 2W6ID 4I32A 2TGTA 1KYNA 1T8NA 3PRDA 3FKSD 1QR3E 1W0JD 4Y7BA 5F6MA 1C2GA 3ZVEA 3TIUA 1YPKH 1EAXA 4B2CA 5GXPA 1DANH 2QY0B 1TRYA 3LGVA 3MU1A 2Z9JA 3QLPH 1BBRE 1GMDF 2WPJS 4ACAA 3RXGA 1KDQA 1C1RA 2GCHG 2WYGA 1D3TB 3A81A 1O3AA 1G3BA 4ABJA 1IQMA 5DP9A 1ANCA 3GYMA 3BG8A 2VINA 4Y8XA 1K1PA 4AN7A 5IDKA 2PSYA 3IG6B 3A87A 1ELFA 1O31A 3A8BA 3SORA 2J2UA 4BANB 1YM0A 3BEFB 5HIZA 1C1OA 2RDEA 1FY1A 5CDFE 1C2IA 1GVZA 2UUFB 2V3HH 1Y3XA 1KXDA 4BTIB 2G52A 4UFDH 5JPMH 2ZHDA 2EQNA 4Y10E 1TMUH 2I6SA 2W7SA 1VITG 2ASUB 2XBXA 2ZU2A 5A0CA 4BAHB 3ATMA 2F9PA 1Y3WA 1N8OC 1SB1H 2SNVA 3RXAA 3F6UH 1XVMA 8ESTE 4TPIZ 2A5KA 1KXBA 4WMEA 5LGOA 3MNXA 3U9AH 2KZ4A 2OQ5A 5AHGH 3A84A 5DN6D 5KECA 4XDEA 3M5NA 1HIAB 2J4IA 1CQQA 1XUHA 1ZMLA 4WH8A 1AKSA 2HRVA 4DIHH 1LKAA 4GSOA 3RXJA 2D2DA 3S9CA 3MWIU 2OUAA 2B8OH 2BVXH 1C5SA 4F4OC 5SGAE 4DT7B 1EXFA 3OU0A 1SOZA 1ZJKA 2XBYA 5E8EH 1O3MA 1BRAA 3LIWA 2J94A 4JYUH 1P06A 4GHTA 3W1EA 2OC8A 4X1PU 2BM2A 4ABDA 5JBBS 2OLGA 1SVPA 3M7UA 1F5RA 2AGGX 3NK8A 4A1TA 1LO6A 1YPEH 5HM2A 5EW2H 1DVAH 1SGTA 3LC3A 1T7CA 1GMDG 3ODDA 5B6LA 1P57B 4ZKOU 3WWBA 1HRTH 5B6OA 2FXRA 1YLCA 3RXVA 4Y79A 1W12U 1Y5BT 3GDUA 4B76A 2P8OC 1P8VC 3L6PA 5E0GA 3B23B 1HNEE 3SU4A 4H42U 1WTHD 2KCYA 1DWBH 2BY8X 1PPFE 1N6XA 1P3CA 2GT7A 1TYNA 2JETB 3KNXA 5GCHF 4VGCB 1YPGH 1DPOA 4DIIH 1QHRB 3KF2A 1SMFE 3F2HA 1QB6A 3SU1A 1AD8H 2J98B 5DG6A 1AZZA 1Y8TA 3UAIC 1D6WA 3BTDE 1O3KA 1C5VA 2YMSB 1DY8A 3LJJA 3ZZ5A 3PB1E 1H8HD 2M2AA 2XWBI 1O2PA 1VGCC 1WYKA 3PV2A 3LT3A 1TRNA 3GY2A 1H8IH 1GI2A 3MO9A 2VIVA 8GCHF 3VXEH 1UTMA 2OC7A 1QURH 1XKBC 3E8LA 1QA0A 4XBBA 1O39A 3OEED 3FZZA 1GL1A 4AFZA 1RTLA 3AW1A 2J97A 1BMAA 5C5OA 2PSXA 1NC6A 5ETXA 1M9UA 3VB5A 2ZWLH 1EZUC 1WBGB 3M35A 7LPRA 4FU8A 2VVVA 3LGWA 1UVOA 5GPIB 3KIDU 1TPSA 1C2DA 3QZRA 3P8NA 1FY3A 3GISB 3SHCH 2LELA 1BJVA 3E0PB 3FP7E 3ZVCA 1C1SA 3MH4A 3KHVA 4MNYA 4KGAA 4ABAA 1QGFA 1LCYA 3AVZA 1DITH 4WVPE 3RUOA 2W26A 2ZO3H 1EZQA 4AFUA 5E2OA 3PMJA 4IS5A 2HOBA 4INLA 3URDA 1GMHF 1T4VH 1COWD 4E7NA 1TABE 1ETTH 4B6EA 1GJ4H 1K9OE 1TBZH 4FU7A 1DUAA 3P92A 2ZU4A 3MHWU 3F0OA 2QE7D 2TPIZ 2Q6GA 1YLNA 1C4U2 1UTKA 1TQ7B 5GCHG 1D3DB 4O97A 1G32B 3NCLA 2J38A 1FV9A 2PW8H 3DSOA 3NWUA 1C1UH 3QK1A 1C1TA 4FUBA 2ZFRH 4THNH 4K1SA 2PP6A 1FMGA 1GJ5H 2ZCHP 1P2OA 3MU5A 1IQNA 3PRBA 1LHCH 1LMWB 2SGAA 1A1RA 3A85A 5CHAB 1FAKH 3A8AA 4RT0A 1C5ZB 1O5FH 2FODA 1OYQA 1IQFA 4NZQA 4CRGA 1NRRH 4O03A 5DJ7A 1J8AA 1K1JA 8GCHG 1AUJA 2VIPA 3ZVDA 4K8BA 1UK4A 1L0ZA 2V3OH 3S7KB 4D7FA 2A7CA 1NU7B 5HYOA 1HXFH 2IOTA 4BTTB 3SJ9A 4JCNA 4O9VA 1F5KU 1MCTA 1EAIA 3GCHC 3A7VA 1F7ZA 2AHME 2ZHWH 1Z7KA 4AB9A 3E1XB 2GDEH 8LPRA 3P70B 4AYVB 2BD7A 1AFEH 2VWLA 4JZFH 2A7JA 1BRUP 1FPHH 3BN9A 2QF3A 2GVFA 3MNCA 2OCVB 4YT6H 2BD8A 3A7ZA 1RTKA 2LPRA 1GMCF 2R2MB 1TNHA 3M3VA 1P2JA 2PKAB 4ZKRU 4HTCH 1SGDE 2F9OA 2ZFTA 2VGCC 4FUEA 3SU2A 1AHTH 3BEIB 2FOBA 2XC4A 4INHA 5A8ZA 3M7QA 2BY7X 1GI1A 2GP9B 1O3CA 2ZPRA 3F9FA 3VB3A 4Q7XA 2ZTXA 1GMHG 1V2NT 3RXTA 4B6FA 2HGTH 2VBCA 1HPGA 4D76A 1C5XB 1EQ9A 1TIOA 2GMTC 5C5NA 1N1LA 2QXGA 1DT2A 1ZSJA 3ZYDA 3TVJB 3VG8A 2GCTB 1MU8B 3KEEA 3SV9A 3GY4A 1O2SA 2BTCE 2BDYA 4MPWA 1G3CA 1DSTA 1GWAA 4NG9H 2GTBA 4CRAA 4X6OA 1GBIA 5HXFA 1EATA 2KAIB 1AIXH 2G00A 3ZVFA 1MH0A 2QV1A 4NIVA 3SV8A 4PROA 4I7YH 1K0HA 1C2FA 1C5QA 2ILNA 3RXBA 2AYWA 2RCEA 1NRSH 1RIWC 4HGCA 5EXMA 2ZEBA 4K5ZA 1AB9B 3TH3H 2EI6A 1O2LA 2YMSD 4O3UA 1CHGA 1NT1A 3H09A 1GHZA 4NSVA 3SOSA 4SGAE 2GDDA 1GHYH 2G4UA 3ZZ8A 1DFPA 1HAXB 3ZZBA 1AU8A 1BDAA 1BMFD 5F8TA 2QYIA 1FI8A 3K6YA 3O8BA 3U8TH 1L1JA 1VJ9U 1MTWA 1A2CH 2PLXA 4U32A 1NY22 4A1XA 1CBWB 4KKDA 1V6DA 1A5IA 1YBWA 4KTCA 5FBEA 2BD5A 1S81A 1UVUH 2TGPZ 2CGAA 2YMSC 3A86A 1GBBA 1HAZB 1P10A 2Z7FE 3VB6A 3FVFB 3A7XA 2Y5FA 1B0FA 3BF6H 2AIQA 1LHGH 1QNJA 4CHAC 2O8LA 5HMAA 3RXEA 1GMCG 2ZDMA 1UHBA 2CHAB 1Q2WA 1QJ7B 1KLTA 1OYTH 2GV7A 1ZZZA 3ENSB 2JDID 1FLEE 2Z9IA 1SLUB 3RXIA 1E1RD 1B7XB 1ID5H 1E79D 2DUCA 3D23A 1TA2A 2JKHA 2ZHFH 1K1OA 3QTOH 4F48B 2CF8H 2A4QA 1C5MD 4CRBA 1YGCH 4U01A 2ZCKP 2C93B 4FUCA 2WV9A 1JWTA 1W14U 4X2XA 1ESBA 4WJG2 5DO4H 2BQ6B 2XCNA 5E2PA 2ZGXH 1XMNB 3TH4H 1G3EA 2FIRH 2FMJA 3PLPA 1EP6A 3SNCA 3MFJA 2OBOA 2Y7ZA 4RKOB 5C94A 3BG4B 1INCA 1O5GH 1D4PB 2K8IA 3WWFA 2H9EH 3LOXA 3U8RH 2FLBH 2C4FH 2UWOA 2UUJB 4MG3A 3ZVGA 1UVSH 4AOQA 1C4Y2 1E37B 4FUIA 3UQVA 3KQ5A 3Q3YA 4R8TB 1Z1IA 6CHAC 2V7QD 2Z3EA 3SJOA 2FOAA 1IQEA 1Y3VA 2HPQH 1CT0E 5EPNA 1FIZA 5HGGA 4WMDA 1AE5A 5C2ZA 2ZU1A 3MQKC 3U98H 2G8TA 1L1NA 3LC5A 4Q2KA 1D9IA 2G4TA 3Q00A 1PPCE 2Q6FA 3RXOA 3MI4A 3RXRA 4I31A 1O2WA 1VCPA 3QN7A 1OS8A 1TFXA 3DCLA 2GCHF 4YT7H 3A83A 1P9UA 2VVCA 4Y71A 4CH2B 6ESTA 1ESTA 4Q4LA 1E38B 2Y7XA 4AG1A 4DGJA 3T26A 4DVAU 3F3BA 3TK6A 2NU0E 4Y0YE 5DPAA 3GY8A 4YXWD 5C0UA 1JBUH 3MMGA 1P02A 1CSOE 1RFNA 5DP7A 1UK2A 3NRLA 2ODPA 1GBJA 3QGJA 3KN2A 1IAUA 5FPTA 2XOKD 3LGIA 1NTPA 3D49H 4DT4A 3O8CA 5GNDA 4GPGA 1SGFA 1HJAB 1F92A 3HK6B 1C5UA 4M9FA 1DDJA 1OHHD 4ISOA 4ZUHA 1PQ8A 1MZAA 1O5DH 4UD9H 4WF8A 2OK5A 1ZPBA 2PKSC 5FHTA 1AE8H 2NU3E 1BRBE 2ZDLA 1HJ8A 4MPXA 4Y76A 4A7IB 1XKAC 2WPDD 2UUYA 2C8WB 1J14A 2F9BH 5F8ZA 1LQDB 1S85A 6LPRA 1AMHA 1LPKB 1FONA 1MD8A 2ZKSA 3ATLA 4TY7A 2L74A 1LHFH 2BOKA 1LVMA 1V2JT 4FXGH 2D1JA 2ALVA 1SGPE 2XCFA 4NFFA 2ZDKA 4X1SU 2QXHA 1QRXA 1OP8A 1DSUA 2FS9A 5EOKA 1HLTH 3UOPA 4K69A 1E34B 1BCUH 1RRKA 1CO7E 2FESH 1ANDA 1KLJH 1ZYOA 3RXCA 3TITA 1EASA 2FOCA 1O3FA 3K65B 2J95A 1VITH 2FS8A 2ZDNA 4B74A 1JIMA 4SGBE 1ELVA 1IQKA 5EODA 2YNBA 2WZQA 1OP2A 2P95A 3P6ZB 4MNXA 1SQAA 3MTYA 2ANYA 1EPTB 2VH0A 2FX6A 3BIUH 3BTTE 2ZFPH 1TNLA 3RM2H 3A88A 1V2ST 1SQRA 1GHAF 2QAAA 1P9SA 3P17H 2K0QA 1MKWK 2UWPA 3PYHA 4D9RA 2NU2E 5C1UA 1SG8B 1BBRK 3TJOA 2BDGA 1P2MA 3N7DA 1MKXK 4HFPB 3FFGA 3OAAD 2BZAA 3HKJB 1FQ3A 3IWMA 4P02A 1Q3XA 2TIOA 2QN5T 4ESTE 3QWCH 4JZEH 1EX3A 2A2QH 2GT8A 3UOUA 1A61H 4ZHLU 1GJDB 4BAQB 1Y3UA 5DKMA 1O5BB 1CA0C 3N7EA 1ZRBA 3RU4E 1H8DH 4AORA 3FO8D 3TGJE 2YNAA 4X0WU 2CF9H 5EJLA 2ZGCA 1JOUB 4X1RU 2F3CE 1ELDE 5TCCA 2SGEE 4MLFB 1P11E 1AGJA 2HLCA 3PWCA 1JMOH 1MUEB 1EKBB 4AGJA 1LKBA 1SGQE 5PTPA 5C1YA 1B5GH 2GKVE 1MBQA 1BQYA 3ATIA 2BYAX 1Q31A 3UR9A 1P09A 4FVDA 1ELCA 2F9UA 5HM9A 1NFXA 2A5AA 5JBAS 1QZ8A 3E0NB 4GCHF 4E05H 3RMNH 3L3TA 1SPJA 3U69H 3V13A 1HAVB 1A0HB 3TPIZ 2BDAA 4F55A 4QT8C 4TYDA 2OQUA 3GY6A 1GBFA 1TONA 1VR1H 3AAUA 3TNSA 1SGNE 1MAYA 2A32A 5AF9H 1V3XA 3BTHE 4IGDA 3PLKA 1T4UH 5JDUB 1THPB 2ZU3A 1LQEA 2J92A 4JZIA 1VJAU 1AFQC 2FOEA 4IMQA 3SJ8A 1YPHC 1VCQA 4NA9H 3S9BA 1OP0A 2EA3A 3BIVH 1GJCB 1RJXB 4NGAH 5F8XA 2GJGA 1S84A 3SV2H 2P94A 1T8LA 4UONA 3SZNA 2R3YA 1YCPH 1BZXE 1ZPZA 1TGSZ 1OWJA 3ZZDA 4DCDA 2EEKA 1YPLH 1G3DA 1WU1A 4MPVA 1DXPA 1NN6A 2ZFQH 3RP2A 1DWEH 4JYVH 5LPFA 5J4SA 4K8YA 3V3MA 3ZZ3A 4ASUD 2PUQH 4X8TH 2UUKB 5LPRA 2ZA5A 4TPYA 1XXFA 1GHAG 2Z94A 3GY5A 1GJ8B 3KL6A 3TU7H 3LJOA 3OY5U 3SZEA 3SU5A 1MTNB 1UTQA 1BITA 2O8WA 3B9FH 2BQ7B 4ZMAH 4UEHH 4YM9A 2OBQA 2BY6X 3JZ2B 2XW9A 1FX0B 1PPBH 1MQ5A 2VIOA 3LGYA 1ZMNA 3W95A 1DX5M 1P2IA 4AYYB 4JK5A 2FOMB 4RN6A 3SO3A 2SNWA 2ZG0H 3EYDA 2BLWA 4I8LA 1UJ1A 2Z3DA 2H1UA 2CJIA 1AVGH 1UCYH 2BDCA 1V2QT 2IPHA 3TJVA 5DP8A 3H7TA 3QZQA 2W6JD 4BAKB 1ANBA 1PYTD 3QX5H 4YLUA 3GCNA 4IW4E 1SHYA 3FP6E 5HKKD 2VH6A 1NPMA 3DSGA 1MZDA 3PO1B 3WW7A 1UTLM 4FETA 1ZGIA 3BTGE 3NUMA 1ELBA 5DP4A 1TX6A 3DUXH 2FDAA 1A4WH 4OS1A 1G9IE 4ABIA 4GCHG 3OSYA 1ZRKA 2AMPA 1NRNH 2ZDAH 4KELA 3T29A 2QIQA 3E16B 1O2KA 1YC0A 1Z6JH 1PJPA 3BSQA 1W7XH 2FX4A 1PYTC 3UFAA 4Q63A 1ORFA 1BHXF 1O35A 1ETRH 2P93A 1BUIA 2RA0A 1MABB 3RLWH 1GGDB 1O2ZA 1GI3A 5AVDA 4JMYA 1YPHE 3M61U 2A1DB 3P8OA 1C2JA 3TJUA 2P59A 4CRDA 1BTXA 1BMNH 1SGFG 4IN2A 4ZROA 3ZZ7A 3L33A 3N7OA 5IYTA 1GG6B 1GBCA 1O36A 4BNRA 3V0XA 1V2VT 2H9TH 3GDSA 2KX4A 1CHOF 4HZHA 2GZ7A 2BD3A 4Y6DA 1XUIA 3O8DA 1OWKA 3LGTA 5F53A 4CR5A 3B8JA 3F9HA 2AMQA 3LONA 4X1NU 3FOAA 1QY6A 2O8UA 1GI7B 1O33A 2VNTA 4GHQA 1J16A 1IOEA 3GDVA 1OX1A 3S7HB 3ZZ9A 4DW2U 1ACBE 4GUXA 4B1TA 2V0BA 3D62A 3HK3B 1KIGH 3MH7A 3RDZA 3SGBE 1KDQB 2ZU5A 2ZI2H 3Q77A 4RI0A 2PGQB 2R0LA 2WPHS 4TWWA 3LU9B 1XUKA 4Y0ZE 1K28D 2BMGB 1WOFA 1O2TA 1O3OA 2SGDE 3U28C 5L6NH 3U1JB 4GAWA 1F5LA 2QA9E 1K1LA 1PPEE 3SUEA 2TGDA 1BTPA 1GJBB 1NESE 1UTPA 1W2KH 2NWNA 1UO6A 2QC2A 1Z6EA 2Y82A 1TX7A 5J4QA 3SGQE 1YCPM 1KY9A 2BXTH 2STAE 1O3PB 2R2WU 1YKTA 2BXUH 5T6FA 1TNGA 1AO5A 5A8XA 1LPGB 5EQSA 1O2GH 1SI5H 2BDHA 2H6MA 1FZZA 3SYJA 1QJ1B 5EG4A 1OKXA 3BTQE 1AN1E 1O38A 3I78A 1RGQA 2GZ9A 1A3EH 2AERH 4LOYH 2HWLB 2G81E 2WPIS 1MMJN 1GCTB 3QTVH 4MVNA 3RLYH 3TGIE 1PPHE 3UQOA 1SBWA 2FO9A 1DXWA 3SI3H 2M5TA 1J9CH 2ODQA 3SJKA 3NKKA 2OP9A 1NZQH 3SU0A 2Y6TA 3ZVBA 3F2GA 3G01A 1L2EA 1NRPH 1O2QA 2TRMA 1WUNH 1AKSB 1TB6H 1GI5A 3M5OA 4M7GA 4A92A 2WUCA 1IQHA 2PUXB 4JYTA 1JRTA 1QBNA 1MAXA 4MDSA 4E7RG 1E1QD 1QFKH 2B5TB 2EI8A 1LVOA 4MNWA 1CHOG 4BTUB 1EZSC 1ZGVA 2F9VA 4DURA 4OS6A 5FX5A 7ESTE 2FI4E 2BOHB 1ZMJA 4Y11E 4UFEH 4WY3A 1VKYA 2ZTYA 2ZGJA 5L30H 1CT2E 3RU4T 3UY9A 1SQTA 2BD9A 2BVRH 2Y5GA 5L2YH 3EA8A 1JIRA 1J15A 2Z9KA 4HG6A 1Z1JA 2W7UA 3R3GB 1O34A 4H6SB 4WWYA 1ZHPA 3D65E 1A0JA 1GBKA 2XBVA 1A46H 2FEQH 4I8JA 3PMAB 5A09A 2FTLE 1BT7A 2VJ1A 2FZZA 2ZP0H 1C1MA 2PTCE 2ULLA 1EJMA 1W0YH 2H2ZA 4OS5A 3FANA 1BB0B 1V2LT 4DOQA 2R9PA 4X1QU 1V2OT 2AGIX 3QDZB 2LNCA 1HAOH 1CE5A 1SGEE 1S83A 5H4IB 1G30B 1FXYA 5EJZA 4TT3D 3ZZAA 2CN0H 2ZHEH 2VIQA 5EQRA 1H4WA 2JETC 4IN1A 1W13U 4VGCC 4XBCA 2JH6D 4CREA 4OS2A 4O3TA 4U30A 1X7AC 5A0AE 1C9TA 5HIYA 2F91A 4DY7B 3VXFH 4Z6AH 1QRZA 1XX9A 1ZOMA 1O3IA 1B0EA 1P01A 3RMOH 1VZQH 2OINA 1T31A 4NWKA 4H6TA 2PV9B 1IQGA 3HATH 3A82A 1HCGA 2HNTC 5DGJA 1GBTA 1THRH 4CRFA 1OWDA 6GCHF 1TE0A 1IHSH 4ACBA 2HALA 1TALA 1EP5A 1UK3A 3MH6A 4UDWH 1TMBH 3BTME 2VIWA 1GHXH 1TOMH 2HLDD 4INKA 3A80A 5GDSH 2OXSA 3BTEE 4NIWA 2PWXA 4FUDA 2F83A 1N8OB 2YOLA 1FN8A 2VU8E 5DP5A 4OGYA 1C2HA 3VEQB 1J17T 1WAYB 1NO9H 1PQ7A 4GLYA 5FL7D 1DS2E 1SGYE 2NU4E 5AFYH 1TOCB 2L6OA 3HGNA 4K60A 1QL8A 1SFQB 2CMYA 4CH8B 5JBTA 3BV9B 1V2TT 1S0RA 1HIAA 2ANWA 2D26C 3Q76A 4AZ2B 4BOHA 1G37A 1FN6A 5CHBA 4ZHAA 4JZ1A 4ZXXH 3ZYEA 1FUJA 4XRNA 2IJD1 2KFWA 3LDXH 1OWEA 3OEHD 4I33A 2BD2A 2P3UB 1SGRE 3AAVA 3SU6A 1PFXC 2ZHQH 1T32A 1UMAH 1ELGA 1EFRD 3LH1A 3PV4A 1MQ6A 3LH3A 3S0NA 1OWHA 2ZECA 3H7OA 1V2PT 1UW7A 1TNKA 1A0LA 3SNDA 1V2MT 1C1VH 1P05A 2OTVA 1ZTLA 4UFGH 3LGUA 1O2JA 2ODYB 2ZCLP 2RFKC 3SJIA 4X8VH 2GGVB 1RD3B 2BY5X 3GCOA 1C2EA 1L1GA 2C8XB 3MU0A 3SNAA 4Y8ZA 5A8YA 5JYIA 2QCYA 1GJ9B 1O2MA 1W7GH 4YLQH 1EJNA 2A4OA 1IHTH 4J1YA 1BA8B 2J34A 2RDLA 3MU8A 3F2FA 1SLVB 5EIYA 3VB4A 1GBAA 1YLDA 1H9HE 1FPCH 3MOCA 1BMLA 2HNTE 3T5FH 1EUFA 2TGAA 2OC1A 1F0SA 1TAWA 5CHAC 4B71A 6GCHG 1LHEH 1V2KT 2V3MA 5JB9S 1AI8H 4XD7D 4YTAA 5C3NA 3A8DA 9LPRA 2J98A 1XM1A 3QUMP 4Q80A 4XBDA 1GPZA 2CK3D 1GVKB 3M36A 3RXLA 2CV3A 1GHWH 1BOQA 1O2OA 1VGCB 2XYAA 3JZ1B 4IC6A 4ABHA 4CRCA 1EZXC 1ZSLA 2WV4A 1O2NA 1Z8IB 3ZZ4A 2W3IA 3BTKE 5EGMA 1N6YA 1O30A 1TPOA 2PGBB 4IBLH 1WTGH 3UPEA 2B0FA 2IN2A 2THFB 2RA3A 2WYJA 4Q7YA 2WSSD 2AIPA 3MH5A 4AB8A 3RXMA 4ABFA 1PQ5A 1DY9A 3AK5A 4ZH8A 1HV7A 1O3GA 2BLQA 1DWDH 4HI3A 1A7SA 5EPYA 3K9XB 1HDTH 1XUGA 4X2VA 2XRCA 2VB0A 5T1VA 3RXSA 1H9LB 1IQIA 2KCPA 1GDUA 2FP7B 2DE8A 1S0QA 3RXKA 1Y3YA 1IQJA 1W11U 2WPKS 3HPTB 2WUBA 3OFND 1TPPA 1TA6A 2IJOB 3F0PA 3OTJE 2FM2A 2A4RA 2GCTC 4ZKNU 1HYLA 2AEIH 1GJ7B 1O2UA 5GIBA 4MNVA 1TBRH 1CVWH 1O3LA 1FAXA 3MYWA 4YOIA 3ATWA 5BRRE 1DWCH 2IPQX 1FNIA 3UWIA 2FYRA 2VWMA 2ZPSA 1TGBA 5DK1A 1SC8U 3EGKH 2VIDA 2WHXA 2O8MA 3PROA 4YESB 2HVXA 2ZF0H 1A5HA 3GICB 1TGTA 1Y5AT 3E6PH 3RC6A 2F9NA 3EA9A 1P12E 1QA7A 3E91A 1C1PA 1HAHH 1TMTH 3H5CB 3ZZ6A 1TNIA 3BTFE 3M37A 4X2WA 1LVYA 1AB9C 1O37A 1Y5UT 1Z8GA 3ESTA 4AG2A 1ZTKA 1S82A 2AH4X 1QL7A 5FXLA 1T8MA 3SQHE 3ZV9A 3SU3A 1C4V2 2ZGHA 3T2NA 4JZDH 1CU1A 5T3HA 3SN8A 1S6LA 4BAMB 5FAHA 2BX4A 1H8ED 2Z3CA 1C5TA 1C1QA 2Z6BD 2DE9A 5ABWA 1K1MA 5K7RA 1RTFB 3FZDA 1TGNA 1CBWC 1D3PB 1S6FA 2Z9GA 3F9GA 4F49A 1LHDH 3KQBA 2J5UA 1IQLA 4AFSA 5A0BA 3GY3A 3KGPA 1UHBB 2FI5E 2JH5D 1DUEA 1BTWA 2QF0A 2AFQB 4H4FA 3GCHB 4WXIA 1E36B 1GBDA 2ZGBH 3CS0A 2CHAC 1C2MA 5JB8S 3FP8E 1SOTA 2VWNA 7GCHG 1BMMH 1PPGE 4MTBA 2PFEA 5FPSA 5I25A 1DLEA 1AWHB 5DP3A 1ABIH 4NWLA 4TWYA 1D3QB 1S6HA 4E06H 4JK6A 3VPKA 3ZV8A 4A6LA 3SUGA 3C1KA 3FN8A 4K1EA 2VGCB 1WDIA 3RXUA 3M3TA 1XVOA 2PKAA 3GCTF 3SBKA 4YOJA 2EY4C 1RXPA 1C5LH 2BZ6H 1QBVH 9ESTA 2A45B 1NBMD 2HNTF 3DD2H 1F0UA 3CS7A 3KQEA 2BX3A 4B2BA 2A4GA 1UVPA 2GMTB 4ZAEA 1AY6H 1P2QA 5T6GA 2O9QA 1MD7A 3BG4C 2ZDVH 3IITA 3PMBB 3GYLB 1AUTC 1K21H 1NROH 2V35A 3TK9A 2BQWB 3T28A 3UNQA 3RXDA 4RT1A 2FTMA 4AGKA 5LPEA 3SW2B 3OY6U 3T62A 3TH2H 2AS9A 2KAIA 1THSH 2D8WA 1YWUA 1SGCA 3V7TA 1FJSA 1RIWB 5E0HA 1O3JA 5C20A 5DSFA 5GJ4B 1ZHRA 5IK2D 4D8NA 2GX4A 2HPPH 1MTVA 2J9NA 1QIXB 1L4ZA 1WQSA 2ZC9H 1NRQH 2XNDD 2FOGA 4B2AA 2G5VA 3AASA 1O2XA 1GI4A 1QQUA 3BTWE 4LXBH 2ANMH 2GZ8A 3OTPA 2STBE 4A5TS 2Q1JA 4ISHH 5E0JA 1XUJA 1RS0A 2A2XH 1F2SE 1Z8JB 2GD4B 1O2HA 1BTUA 2ANKH 2EI7A 3KCGH 3UUZA 2C8ZB 2FOFA 2ZNKH 3DA9B 2P3TB 2P3FH 3URCA 2AGEX 3LKWA 3DFLA 1TQ0B 2OC0A 4CHAB 2QF4A 5JBCS 1YF4A
chains in the Genus database with same CATH topology
1HJAC 2FLRH 5TJXA 3SQEE 1C5WB 1DICA 2BD4A 2A31A 1O3DA 4FUFA 1K1IA 1GHBF 3P8GA 1SLXB 1LDTT 1F0RA 3GCTG 1DLKB 1P2NA 5G4BA 1E0FD 1CGJE 7KMEH 1P04A 1SFIA 3DT0H 2Y5HA 4RSPA 1O2VA 3GOVB 1XXDA 1Z8RA 4ISIH 2ZIQH 3MU4A 1CGHA 1NM6A 1C2LA 4YOGA 1P3EA 4Y7AA 1GI6A 1MTUA 1SHHB 5FCRA 2WPLS 3W94A 2WPMS 4K3JA 1O3HA 1HB0B 5DP6A 4I8GA 2ZFSA 3HGPA 4NIYA 3UR6A 3NZIA 3TLOA 1V2RT 2G5NA 3TJNA 3WY8A 3M7TA 4A1VA 4K2YA 1WCZA 2R3UA 1U6QA 1F0TA 3A7YA 3C27B 1GL0E 3SV7A 1K1NA 3P8FA 5ESBA 1MKWH 2C90B 4ABGA 1C5NH 1BBRH 1O2YA 4X6PA 3A89A 3LPRA 4R0IA 1MKXH 1C5YB 1ELTA 1G36A 2V6NA 1FIWA 1HBTH 6CHAB 3OX7U 4KP0A 1QJ6B 1GDQA 1SGIB 1TGCA 1QRWA 3NXPA 3TK5A 1EPTC 1TX8A 1ZR0A 3M5LA 3SNBA 2SGQE 5LH8A 2FI3E 3ITIA 1MCVA 1O2RA 1WSSH 2NU1E 4NSYA 4WMFA 1K22H 2Q6DA 5C1XA 1BHXB 1YPMH 3KQCA 3A8CA 1ABJH 3U8OH 4XOJA 1TLDA 3SUFA 1HAPH 4X2YA 4AX9H 3NPSA 1K2I1 1C5RA 4WH6A 1ANEA 1QB9A 3PM3A 4XSKU 1H1BA 3I77A 2A0QB 1PQAA 1ZTJA 1EOJA 3CP7A 5AFZH 5EW1H 4GVUA 5GWZA 1GHBG 2JH0D 8KME2 1ZJDA 2XC0A 2B7DH 1P03A 2GV6A 4UE7H 3VGCB 4D9QA 1TWXB 3RMMH 1ZLRA 1E35B 2G55A 3MO6A 1ETSH 3UNSA 1L4DA 3UWJH 1V2WT 2WINI 1GDNA 2PKSB 1O0DH 1MTSA 2H5DA 4ZXYH 5ESTE 1W10U 1QB1A 4RKJB 2H9HA 1O3BA 1OPHB 1GI8B 1NFWA 2XC5A 4FVBA 1OXGA 1BJUA 2WV5A 1ELAA 4TY6A 4NA8A 4MQAA 3MNSA 1NS3A 3UREA 5CMXH 1LPZB 4XE4A 3MO3A 5EU8A 4ZHMU 3M5MA 5FCKA 2FWWA 4DJZB 4UFFH 2ESTE 3PLBA 2XNIA 1SLWB 1A5GH 1KXEA 3RC5A 1ARBA 1GHVH 2A7HA 3T27A 4ABBA 4KTUA 1AVXA 2VVUA 3I29A 1XUFA 1MU6B 4ABEA 4ISNA 4OS7A 1S5SA 2BHGA 4ZKSU 1MTNC 1BTYA 2BLVA 4K1TA 2C8YB 3VB7A 1C5PA 2Y80A 3SUDA 1EPTA 3EE0B 4NFEA 4X6NA 5BPEA 3F1SB 4CBNA 4I8HA 1OOKB 2ALPA 1EB1H 1EOLA 5K0HA 1OWIA 3STIA 2BLOA 2ZFFH 2ZTZA 4WXVA 4J2YB 2K1QA 1MBMA 1KLIH 5CE1A 1HAGE 2H5CA 1UTJA 1LTOA 3UNRA 1AZ8A 1SSXA 3K6ZA 1QCPA 2FYQA 1W3CA 3STJA 3VFEA 1C2KA 1KTSB 1P2KA 2SFAA 3PO1C 1GI9B 4NA7A 1CA0B 1HXEH 1ELEE 1BTZA 5EQQA 3UTUH 1O32A 3O8RA 3TGKE 1UTNA 2PTNA 1A3BH 4OS4A 3RXFA 1H9IE 2C3SA 3PTNA 1ESAA 1HAYB 2SGPE 3HKIB 2BB4A 1W8BH 3EA7A 2ZPQA 1UVTH 3GY7A 4ISLA 2XWAA 4OGXA 2P16A 1HFDA 3V12A 5FBIA 2XXLA 4FUHA 3RM0H 3RXPA 3RMLH 1GGDC 3E3TA 3S69A 2XTTB 1C5OH 2UWLA 1HAVA 3CENA 4Y8YA 1VCWA 4YZUA 3KQDA 4NIXA 1BIOA 4IC5A 1SR5C 2QXIA 1QL9A 3PWBA 3SGAE 1DM4B 1O5CB 1GG6C 1O5EH 1AFQB 1KSNA 1ARCA 1O2IA 1V2UT 1UTOA 1TBQH 1G2LA 2PR3A 3SI4H 4MPUA 2XBWA 1Z71A 3F9EA 4D7GA 3OYPA 4B75A 1AWFH 1O3NA 1SQOA 2BVSH 3ZZCA 1QQ4A 4I8KA 5TCAA 3U1IB 1O5AB 1EB2A 1P0SH 3EQ0H 1NU9A 3A7WA 4AFQA 2W3KA 4LZ4B 1GI0A 3A7TA 2Y81A 4U2WA 4ASHA 1ZHMA 2P8OB 4BXWA 3EAJA 2I6QA 4BAOB 1W0ZU 1EAUA 3ATKA 1GJ6A 1KXAA 4BXSA 5EXNA 3ZVAA 1CGIE 1GJAB 1YP9A 1DOJA 1C9PA 3RC4A 3SHAH 3DHKH 4LZ1H 1KXFA 3SV6A 1YCPK 2B9LA 3K2UA 4Z0KA 1BRCE 3Q3KA 4FUJA 2A5IA 2EC9H 4FUGA 5L2ZH 1NFYA 2FPZA 4CR9A 2CXVA 3QO6A 3R0FA 4KTSA 1HAIH 1Y59T 3RXHA 3TNTA 1LVBA 1GBEA 1UCYE 1PPZA 5FX6A 4Q7ZA 1YYY1 1EAWA 2QXJA 1FY4A 1HJ9A 2ZQ1A 1TNJA 2AMDA 1GBLA 1GCDA 1EJAA 4CBOA 3RU4D 1BTHH 3T25A 1YPJH 3F68H 5F03A 1KXCA 2FOHA 2G51A 1HGTH 2ZZUH 5EXLA 3S9AA 1UCYK 2BY9X 1GCTC 1GBHA 1CA8B 3QGNB 3VGCC 1JXPA 4XFQA 1AVWA 3E90B 2BDBA 1QTFA 3ODFA 1VITF 2BDIA 1WV7H 1WQVH 3SNEA 2TBSA 1G2MA 7GCHF 3BEUA 1CT4E 1FY8E 2QGRA 1AQ7A 1SL3A 2W5EA 3FAOA 3UIRA 4X8UH 4NZLA 4LK4A 3RXQA 1KTTB 2OD3B 1C1NA 2ZQ2A 2RG3A 2R0KA 4NCYA 4YO9A 5FPYA 3PMHB 1ZPCA 1HUTH 1TPAE 1T8OA 4X6MA 3ELAH 1GBMA 5C67A 4FU9A 2Z9LA 3EDXB 2PHBA 4X8SH 1C1WH 4B73A 3M3SA 4DG4A 2SGFE 5A2MH 1OSSA 4IMZA 1JRSA 5T6DA 1QBOA 3PTBA 2O8TA 1FDPA 1O3EA 3AW0A 5I46H 1GVLA 1DE7H 3P95A 2VWOA 3Q3XA 1NFUA 1D6RA 1TRMA 3DFJA 1FY5A 1ZSKA 3MNBA 4I32A 2TGTA 1KYNA 1T8NA 5F6MA 1QR3E 4Y7BA 1C2GA 3ZVEA 3TIUA 1YPKH 1EAXA 4B2CA 5GXPA 1DANH 2QY0B 1TRYA 3LGVA 3MU1A 2Z9JA 3QLPH 1BBRE 1GMDF 2WPJS 3RXGA 1KDQA 1C1RA 2GCHG 2WYGA 1D3TB 3A81A 1O3AA 1G3BA 4ABJA 1IQMA 5DP9A 1ANCA 3GYMA 3BG8A 2VINA 4Y8XA 1K1PA 4AN7A 5IDKA 2PSYA 3IG6B 3A87A 1ELFA 1O31A 3A8BA 3SORA 2J2UA 4BANB 1YM0A 3BEFB 1C1OA 1FY1A 1C2IA 1GVZA 2UUFB 2V3HH 1Y3XA 1KXDA 4BTIB 2G52A 4UFDH 5JPMH 2ZHDA 4Y10E 1TMUH 2I6SA 2W7SA 1VITG 2ASUB 2XBXA 2ZU2A 5A0CA 4BAHB 3ATMA 2F9PA 1Y3WA 1N8OC 1SB1H 2SNVA 3RXAA 3F6UH 1XVMA 8ESTE 4TPIZ 2A5KA 1KXBA 4WMEA 5LGOA 3MNXA 3U9AH 2OQ5A 5AHGH 3A84A 4XDEA 3M5NA 1HIAB 2J4IA 1CQQA 1XUHA 1ZMLA 4WH8A 1AKSA 2HRVA 4DIHH 1LKAA 4GSOA 3RXJA 2D2DA 3S9CA 3MWIU 2OUAA 2B8OH 2BVXH 1C5SA 4F4OC 5SGAE 4DT7B 1EXFA 3OU0A 1SOZA 1ZJKA 2XBYA 5E8EH 1O3MA 1BRAA 3LIWA 2J94A 4JYUH 1P06A 4GHTA 2OC8A 4X1PU 2BM2A 4ABDA 5JBBS 2OLGA 1SVPA 3M7UA 1F5RA 2AGGX 3NK8A 4A1TA 1LO6A 1YPEH 5HM2A 5EW2H 1DVAH 1SGTA 3LC3A 1T7CA 1GMDG 3ODDA 1P57B 4ZKOU 1HRTH 5B6OA 2FXRA 1YLCA 3RXVA 4Y79A 1W12U 1Y5BT 3GDUA 4B76A 2P8OC 1P8VC 3L6PA 5E0GA 3B23B 1HNEE 3SU4A 4H42U 1WTHD 1DWBH 2BY8X 1PPFE 1N6XA 1P3CA 2GT7A 1TYNA 2JETB 3KNXA 5GCHF 4VGCB 1YPGH 1DPOA 4DIIH 1QHRB 3KF2A 1SMFE 1QB6A 3SU1A 1AD8H 5DG6A 1AZZA 1Y8TA 1D6WA 3BTDE 1O3KA 1C5VA 1DY8A 3LJJA 3ZZ5A 3PB1E 2XWBI 1O2PA 1VGCC 1WYKA 3LT3A 1TRNA 3GY2A 1H8IH 1GI2A 3MO9A 2VIVA 8GCHF 3VXEH 1UTMA 2OC7A 1QURH 1XKBC 3E8LA 1QA0A 4XBBA 1O39A 3FZZA 1GL1A 4AFZA 1RTLA 3AW1A 1BMAA 5C5OA 2PSXA 1NC6A 5ETXA 1M9UA 3VB5A 2ZWLH 1EZUC 1WBGB 3M35A 7LPRA 4FU8A 2VVVA 3LGWA 1UVOA 5GPIB 3KIDU 1TPSA 1C2DA 3QZRA 3P8NA 1FY3A 3GISB 3SHCH 1BJVA 3E0PB 3FP7E 3ZVCA 1C1SA 3MH4A 3KHVA 4MNYA 4KGAA 4ABAA 1QGFA 1LCYA 3AVZA 1DITH 4WVPE 3RUOA 2W26A 2ZO3H 1EZQA 4AFUA 5E2OA 3PMJA 4IS5A 2HOBA 4INLA 3URDA 1GMHF 1T4VH 4E7NA 1TABE 1ETTH 1GJ4H 1K9OE 1TBZH 4FU7A 1DUAA 3P92A 2ZU4A 3MHWU 2TPIZ 2Q6GA 1C4U2 1UTKA 1TQ7B 5GCHG 1D3DB 4O97A 1G32B 3NCLA 2J38A 1FV9A 2PW8H 3NWUA 1C1UH 3QK1A 1C1TA 4FUBA 2ZFRH 4THNH 4K1SA 1FMGA 1GJ5H 2ZCHP 1P2OA 3MU5A 1IQNA 1LHCH 1LMWB 2SGAA 1A1RA 3A85A 5CHAB 1FAKH 3A8AA 1C5ZB 1O5FH 2FODA 1OYQA 1IQFA 4NZQA 4CRGA 1NRRH 4O03A 5DJ7A 1J8AA 1K1JA 8GCHG 1AUJA 2VIPA 3ZVDA 4K8BA 1UK4A 1L0ZA 2V3OH 3S7KB 4D7FA 2A7CA 1NU7B 5HYOA 1HXFH 2IOTA 4BTTB 3SJ9A 4JCNA 4O9VA 1F5KU 1MCTA 1EAIA 3GCHC 3A7VA 1F7ZA 2ZHWH 1Z7KA 4AB9A 3E1XB 2GDEH 8LPRA 3P70B 4AYVB 2BD7A 1AFEH 2VWLA 4JZFH 2A7JA 1BRUP 1FPHH 3BN9A 2QF3A 2GVFA 3MNCA 2OCVB 4YT6H 2BD8A 3A7ZA 1RTKA 2LPRA 1GMCF 2R2MB 1TNHA 3M3VA 1P2JA 2PKAB 4ZKRU 4HTCH 1SGDE 2F9OA 2ZFTA 2VGCC 4FUEA 3SU2A 1AHTH 3BEIB 2FOBA 2XC4A 4INHA 5A8ZA 3M7QA 2BY7X 1GI1A 2GP9B 1O3CA 2ZPRA 3F9FA 3VB3A 4Q7XA 2ZTXA 1GMHG 1V2NT 3RXTA 2HGTH 1HPGA 4D76A 1C5XB 1EQ9A 1TIOA 2GMTC 5C5NA 1N1LA 2QXGA 1DT2A 1ZSJA 3ZYDA 3TVJB 2GCTB 1MU8B 3KEEA 3SV9A 3GY4A 1O2SA 2BDYA 2BTCE 4MPWA 1G3CA 1DSTA 1GWAA 4NG9H 2GTBA 4CRAA 4X6OA 1GBIA 5HXFA 1EATA 2KAIB 1AIXH 2G00A 3ZVFA 1MH0A 2QV1A 4NIVA 3SV8A 4PROA 4I7YH 1C2FA 1C5QA 2ILNA 3RXBA 2AYWA 2RCEA 1NRSH 1RIWC 4HGCA 5EXMA 2ZEBA 4K5ZA 1AB9B 3TH3H 2EI6A 1O2LA 4O3UA 1CHGA 1NT1A 1GHZA 4NSVA 3SOSA 4SGAE 2GDDA 1GHYH 2G4UA 3ZZ8A 1DFPA 1HAXB 3ZZBA 1AU8A 1BDAA 5F8TA 2QYIA 1FI8A 3K6YA 3O8BA 3U8TH 1L1JA 1VJ9U 1MTWA 1A2CH 2PLXA 4U32A 1NY22 4A1XA 1CBWB 4KKDA 1V6DA 1A5IA 1YBWA 4KTCA 5FBEA 2BD5A 1S81A 1UVUH 2TGPZ 2CGAA 3A86A 1GBBA 1HAZB 1P10A 2Z7FE 3VB6A 3FVFB 3A7XA 2Y5FA 1B0FA 3BF6H 2AIQA 1LHGH 1QNJA 4CHAC 2O8LA 5HMAA 3RXEA 1GMCG 2ZDMA 1UHBA 2CHAB 1Q2WA 1QJ7B 1KLTA 1OYTH 2GV7A 1ZZZA 3ENSB 2Z9IA 1FLEE 1SLUB 3RXIA 1ID5H 1B7XB 2DUCA 3D23A 1TA2A 2JKHA 2ZHFH 1K1OA 3QTOH 2CF8H 2A4QA 1C5MD 4CRBA 1YGCH 4U01A 2ZCKP 2C93B 4FUCA 1JWTA 1W14U 4X2XA 1ESBA 4WJG2 5DO4H 2BQ6B 2XCNA 5E2PA 2ZGXH 1XMNB 3TH4H 1G3EA 2FIRH 2FMJA 3PLPA 1EP6A 3SNCA 3MFJA 2OBOA 2Y7ZA 4RKOB 3BG4B 1INCA 1O5GH 1D4PB 2H9EH 3LOXA 3U8RH 2FLBH 2C4FH 2UWOA 2UUJB 4MG3A 3ZVGA 1UVSH 4AOQA 1C4Y2 1E37B 4FUIA 3UQVA 3Q3YA 4R8TB 1Z1IA 6CHAC 2Z3EA 3SJOA 2FOAA 1IQEA 1Y3VA 2HPQH 1CT0E 5EPNA 1FIZA 5HGGA 4WMDA 1AE5A 5C2ZA 2ZU1A 3U98H 2G8TA 1L1NA 3LC5A 4Q2KA 1D9IA 2G4TA 3Q00A 1PPCE 2Q6FA 3RXOA 3MI4A 3RXRA 4I31A 1O2WA 1VCPA 3QN7A 1OS8A 1TFXA 2GCHF 4YT7H 3A83A 1P9UA 2VVCA 4Y71A 4CH2B 6ESTA 1ESTA 1E38B 2Y7XA 4AG1A 4DGJA 3T26A 4DVAU 3TK6A 2NU0E 4Y0YE 5DPAA 3GY8A 1JBUH 3MMGA 1P02A 1CSOE 1RFNA 5DP7A 1UK2A 2ODPA 1GBJA 3QGJA 3KN2A 1IAUA 5FPTA