2J92A

3c protease from type a10(61) foot-and-mouth disease virus - crystal packing mutant (k51q)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
201
structure length
201
Chain Sequence
DLQKMVMGNTKPVELILDGKTVAICCATGVFGTAYLVPRHLFAEQYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLHRGNKVRDITKHFRDTARMKKGTPVVGVVNNADVGRLIFSGEALTYKDIVVSMDGDTMPGLFAYKAATRAGYAGGAVLAKDGADTFIVGTHSAGGNGVGYCSCVSRSMLQKMKAHVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PICORNAIN 3C
publication title Structural and Mutagenic Analysis of Foot-and-Mouth Disease Virus 3C Protease Reveals the Role of the {Beta}-Ribbon in Proteolysis.
pubmed doi rcsb
source organism Foot-and-mouth disease virus (strain a10-61)
total genus 48
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00548 Peptidase_C3 3C cysteine protease (picornain 3C)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2j92A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2j92A01
1ARCA 2VIVA 1UTPA 1T31A 1OSSA 1C1VH 1L2EA 2V35A 3IITA 4Q7XA 4ABHA 1WYKA 2EEKA 2XRCA 3W95A 2Z6BD 1C5NH 2BM2A 2XNIA 3GCHC 3VB3A 1KDQB 3MU0A 3F9EA 1KY9A 1UK4A 1P2KA 1O31A 2BY6X 4BNRA 5F8TA 4FUEA 2SNVA 2WYGA 4DG4A 1VGCC 2GMTC 4NIWA 5C1YA 4BXSA 4CRGA 1OOKB 4NSVA 4BTUB 3GISB 1OKXA 1Y3UA 3M36A 3TK6A 2ULLA 1O3LA 5FAHA 1BMLA 3ATKA 1GHBG 1L1GA 1PQ8A 4NIYA 4DY7B 1P2IA 1GMDG 3KQBA 9ESTA 1FPCH 1K9OE 1O3HA 3AW1A 7ESTE 1C2EA 2UUYA 3ESTA 2BB4A 8ESTE 2R9PA 4B2AA 4ZKRU 5CMXH 2W7SA 3RXCA 1SI5H 5LPRA 1HRTH 1UCYK 2BD8A 1HAPH 1SQOA 2J94A 1P03A 5C1UA 4INHA 2C93B 1BIOA 1SLUB 3VB6A 1O2MA 4Y7AA 1EZQA 2GVFA 3P8FA 1C4V2 2XCNA 4ABIA 2AIPA 1CT4E 1WOFA 2ZHWH 4FVDA 4XBCA 3RU4T 4ABFA 3LC5A 2UWLA 3TITA 3GDUA 3L6PA 5C3NA 2VWOA 2UWPA 1QA0A 2VVCA 3PMHB 5E2PA 3A81A 1LPZB 5FBIA 1L4ZA 1B7XB 2V6NA 1TIOA 2W7UA 1CGHA 4X8TH 3GYLB 1RIWB 3NXPA 4OS1A 4JK5A 2D2DA 1RTFB 1BHXB 4BAKB 3TGKE 3MTYA 2XC5A 3BG8A 3M5NA 2O8UA 5T6DA 1BOQA 1KXEA 2BDGA 2A5AA 1WAYB 2C4FH 5E0JA 1C4Y2 2O8WA 3QZRA 4Y10E 2AH4X 2Z9GA 1AVXA 2Q6DA 1TB6H 5JBTA 3BIUH 1GI2A 4XOJA 2G5NA 2ASUB 1UTOA 3NZIA 3RXOA 1S85A 3GCOA 5ETXA 3ATLA 1EOJA 1QA7A 2ODPA 1GWAA 3UWJH 4X8SH 1TX8A 3KL6A 1YPJH 4PROA 1GCTC 1IHTH 3ZVEA 1ZLRA 1L0ZA 4I31A 1GHAG 4AG2A 4ZHAA 2AIQA 3MH4A 5EODA 2VIPA 1WQVH 1YPHE 4Q2KA 3T29A 4ZKNU 4OGYA 4WJG2 1U6QA 1J14A 1ANBA 2CF9H 2GKVE 1S6HA 1OWJA 3SNAA 3SGAE 3TJOA 3FP6E 3FP7E 1O2UA 4B2BA 1NRRH 2Y81A 1ZMLA 5TCAA 1T7CA 4UDWH 2VIOA 3URDA 1BUIA 3STJA 1FAXA 1OXGA 5LPFA 3AASA 3KCGH 1UTNA 1Z1IA 1O5DH 2ALVA 1C2DA 1PPEE 1ORFA 4R0IA 1C2IA 1OP0A 2J92A 3ZZ5A 2PLXA 4I8LA 3TK9A 3QDZB 1AFQB 4BAQB 1DE7H 3IG6B 1XXDA 3TJNA 4ESTE 3MU8A 3QGJA 1T8NA 2ZGJA 3ZZ6A 1LQEA 1BMAA 1P9SA 3RXFA 4Z6AH 2GX4A 2BOKA 1V2TT 4KGAA 1NRPH 1O2VA 3MHWU 2PUQH 3RXDA 3R3GB 3VFEA 2BOHB 3AAUA 3OYPA 4A92A 2ESTE 1EPTC 1GDNA 3TH4H 3M37A 1DITH 1BTUA 2W3IA 3GYMA 2C8WB 2AYWA 4O9VA 2FX4A 3LGWA 3E8LA 1MTSA 1TMTH 1VCQA 1XKAC 3A88A 1E0FD 1OS8A 3HK3B 3ZZ8A 3P95A 1AVGH 1LHCH 3A7WA 3GCTF 3SGBE 1S84A 2OUAA 1GI3A 1TPOA 5JDUB 1Z1JA 1A2CH 3BTDE 4MPVA 4Y0ZE 1F0SA 4DCDA 2VVVA 2CN0H 1TRNA 2A7JA 4J1YA 3F1SB 2CV3A 3SU1A 1LVOA 1GGDC 4GAWA 1CHOF 4D7FA 1O2JA 2UUKB 2R0KA 4X6NA 3SUFA 3UY9A 4A1TA 1OYTH 1TGBA 4O3TA 4AGKA 3U8RH 1ELTA 2C90B 3SV7A 3D62A 1HYLA 2HPQH 4FUIA 2ZCLP 1MTNB 1DSUA 3IWMA 3PWBA 5C67A 3MOCA 3DFJA 4HTCH 4K5ZA 3M5OA 5C2ZA 1ZTLA 1G37A 1V2PT 1D6WA 5L6NH 2FI4E 3A7YA 4FUBA 4HFPB 3RP2A 2THFB 1RGQA 2BTCE 2TRMA 5K0HA 4OS5A 3SNBA 1G36A 2AERH 5FX6A 4MNVA 1AZZA 4OS7A 4AGJA 3UNRA 5ABWA 2VH0A 2H9HA 4ISIH 3S69A 1SGRE 1BTWA 1FLEE 1C5TA 1SGFA 4K60A 2G00A 1IQMA 2QA9E 3RU4D 1WTGH 1WCZA 2BDHA 5BPEA 3MO6A 1T4UH 3LGVA 1TAWA 1EAXA 1H9HE 4ISLA 4XFQA 1BTHH 6LPRA 3M3TA 2AGEX 2BDYA 3BTWE 5EQRA 2FIRH 2Y80A 2STBE 1GMCF 1IQLA 1GBDA 3PM3A 2ZC9H 2YNBA 2ZPSA 4GUXA 2HNTE 1CGJE 8GCHF 3LIWA 2Q1JA 1N8OC 1A5GH 1O2OA 2O8MA 1TBZH 1F7ZA 5A8XA 1V2RT 4X6OA 3QZQA 4NZLA 1HBTH 3LJOA 3RXBA 3RMOH 5C20A 1V2JT 3LH1A 3BTEE 4SGAE 2PKAA 4LZ1H 3I77A 1F2SE 1BCUH 3EA8A 1ZGIA 1WQSA 1HXFH 3E0NB 1OWKA 1SGNE 1MH0A 2ZQ1A 4CH8B 3Q77A 5GCHG 3BEIB 1PJPA 2RA3A 3BEFB 1TWXB 1GG6B 4NA9H 1O0DH 2RA0A 2FOMB 4K69A 1THPB 4K8BA 2BVSH 1ZMJA 4RKOB 4ZXYH 1HV7A 1CHGA 1SGPE 2GT7A 4GPGA 4X1QU 1ZSKA 1UMAH 1GJ7B 2ANMH 4R8TB 1VITG 1NS3A 2Q6FA 2BD5A 1L1NA 2G81E 2GCTC 3EA9A 5B6OA 2BY7X 1EASA 1V2LT 2EI7A 1PYTD 4Y11E 1O2GH 1MQ5A 4KKDA 1C5RA 3RMMH 1AI8H 2ZFPH 2GZ8A 3V13A 2GDEH 2ZGXH 2WPLS 3Q3XA 1AZ8A 4WF8A 2SFAA 2QV1A 4O3UA 3T5FH 1ARBA 1GVKB 3KQDA 2D1JA 3FAOA 2IPHA 1EOLA 1GI0A 2GT8A 4B1TA 1EP5A 1GJBB 4B71A 1GBBA 1BJVA 1NFXA 1DVAH 2GP9B 3MO9A 1VR1H 5HM9A 1GI6A 4FXGH 4JZFH 1OWEA 3VEQB 1G3EA 1DWEH 2JH0D 1WV7H 1UVSH 3PWCA 1Y5AT 2Y7ZA 1P3CA 1YPEH 3E6PH 3ZZAA 3KF2A 1K1OA 1MTVA 3BTME 3RM2H 2G55A 3ZVFA 1C2LA 1QRXA 3BEUA 3RXLA 1XUKA 1ZHPA 2ZNKH 1SGIB 3M7TA 4LXBH 4XBDA 2PWXA 5EPYA 1BBRE 2VIWA 1BTZA 3EYDA 1HJAC 2FX6A 1S82A 1A3EH 1P0SH 2HLCA 4WXVA 1NN6A 1LHEH 1ANEA 1GHZA 4FU8A 3U1JB 3SW2B 1OP8A 2CMYA 4Y7BA 1PPHE 1GMHG 4TY6A 1P9UA 2OC1A 5CE1A 3EQ0H 4JYUH 4YOGA 4K1TA 2AMDA 1LO6A 1O3DA 5DP6A 5GJ4B 1FV9A 5T6FA 1E38B 1QRZA 1EXFA 2ZPQA 2F9NA 1OPHB 2ZU5A 1HJ8A 4UONA 1NRNH 3ZZDA 1O30A 2ZIQH 3KIDU 4NSYA 4YLQH 1IQIA 2VJ1A 1GJ8B 1H9LB 2QAAA 1ZSJA 2PTNA 1SHHB 2WV5A 2A7HA 2Z9JA 4AYYB 1XM1A 5DP8A 1Y5BT 2FI5E 1CBWC 1MD7A 2SGFE 3MYWA 4ZH8A 3VXEH 2O8TA 1GHBF 1VCPA 2B5TB 2ZQ2A 1E36B 3LGIA 3TH3H 1GMDF 4M7GA 1V2ST 2Q6GA 4FUDA 5AF9H 3RMNH 4BOHA 2XTTB 4MPUA 3A84A 1ZJDA 1QBNA 1HAOH 3GY8A 1BJUA 2P3FH 2IOTA 1YCPK 2I6QA 1C1QA 3SI4H 2C8YB 1HAXB 4B73A 3KNXA 2QF0A 3S0NA 1XUIA 1AO5A 1NFYA 1BRBE 1S0RA 2BLOA 3T2NA 3RDZA 1GPZA 1TNLA 3MFJA 2PKAB 2F9OA 3LONA 4JYTA 1P06A 3RMLH 1YPKH 2FOCA 3T28A 3LGUA 1NU7B 2BVRH 1ACBE 1TBRH 2WUBA 3M61U 2CJIA 4IS5A 2J38A 1C2KA 2PKSC 1NZQH 1MQ6A 1KXAA 1SGFG 1GI8B 1YCPM 1TOCB 1GDQA 1ZPCA 4YLUA 5DP7A 3SU6A 2AFQB 5TJXA 1FY3A 1MTWA 4BTIB 1NFWA 4NIXA 1INCA 1FY1A 2BDBA 1GJ9B 1S83A 3ZVCA 4K2YA 2PTCE 3ZV8A 4FUCA 1YGCH 3UQVA 3PB1E 1Y5UT 4KELA 1YPLH 4TPIZ 2ZHFH 1ZPBA 1O3OA 1ZMNA 4CR9A 4NWLA 2ZFSA 5FPTA 1Q2WA 3MWIU 4X8UH 3RC4A 1MZDA 1GI7B 1FDPA 4ABGA 3U9AH 2EI8A 1EB2A 3QUMP 3L33A 1V2KT 1V2VT 4D9QA 2PSXA 3SOSA 4JMYA 3RC6A 3E3TA 1MKXK 2WPKS 1WU1A 1ELEE 3RXTA 3Q00A 4I32A 4GCHG 1Y3VA 1PPGE 1UO6A 3URCA 1K28D 3F9GA 5LGOA 4X2XA 1DPOA 2G4UA 2M5TA 2XWAA 1C9TA 3A86A 3U8OH 2R2WU 2SGPE 1O2ZA 4I8JA 1DS2E 5CHAC 1O5GH 3Q3YA 3V0XA 1SC8U 2OC7A 1SMFE 4D9RA 5DPAA 1FY5A 5PTPA 1ZPZA 2F9UA 5T3HA 1UK2A 3DD2H 2CHAB 5EXNA 4NZQA 2VWNA 3MNSA 1MKWH 2OLGA 5GIBA 3SJ8A 3UQOA 5HMAA 1YF4A 2GGVB 1TPSA 1BRUP 4IMZA 1KTSB 1DSTA 1P2JA 1HB0B 3OTJE 4E06H 4JZ1A 2OQUA 4B76A 4H4FA 3PLKA 2W26A 1SLWB 5J4QA 4AFQA 1TQ0B 5JBAS 1TALA 1XUGA 3E16B 4DW2U 1FAKH 1S6FA 3A8BA 3BSQA 5FBEA 5GWZA 2R0LA 3NWUA 1ELDE 5I46H 1ID5H 4K1EA 3M5LA 1NPMA 1PPZA 1ZRBA 4H6SB 1AB9C 1RS0A 2FTMA 3A87A 5GXPA 1YPMH 4FU7A 1C5SA 1AQ7A 1ZSLA 5DO4H 1NM6A 1CA0C 2J2UA 1A0JA 1O3PB 1K21H 3TU7H 2NU2E 1YYY1 2GD4B 1TNKA 4X1SU 1TA6A 1O3KA 2OBQA 3RXRA 3A80A 1W7GH 4IN2A 1RXPA 3SJOA 1H1BA 2BXUH 1HPGA 1OWDA 2FLRH 1QJ1B 1LHFH 2DE8A 3H7TA 1EZXC 1T32A 1ETTH 4K3JA 3PYHA 1GI5A 4WWYA 4YESB 1Y59T 1DDJA 3TJVA 2PUXB 2B7DH 4MLFB 3EA7A 2F9PA 3F9HA 3ODDA 1TFXA 2BHGA 2QXJA 1QTFA 2VGCB 3MO3A 1THSH 4I8GA 1N6YA 2FOFA 2FYQA 1HUTH 3DA9B 5DG6A 1ZOMA 5I25A 5AHGH 3E90B 2BY9X 3S9BA 4K1SA 4CBNA 2H9TH 1LKAA 2FZZA 3O8RA 1BITA 1QBOA 2G4TA 5GPIB 3RXPA 2PGBB 1MZAA 3QWCH 2HVXA 1ETRH 4YT6H 3M7QA 3W94A 3HPTB 1UTMA 3K6ZA 1DICA 5FXLA 1OX1A 1UK3A 3PTNA 3KGPA 4MQAA 1ZTKA 2ZWLH 1SGEE 2FS8A 4Q80A 1G3BA 1HXEH 4NIVA 3BV9B 4X6MA 2WINI 3GY2A 1CT2E 1CA8B 4XSKU 4Y8ZA 4ISHH 3QX5H 2Z7FE 3TGIE 2DUCA 2OTVA 2WPJS 2HPPH 2AEIH 2ALPA 1CVWH 5EQQA 1L4DA 1SHYA 1O34A 4LK4A 2Z3DA 2A32A 1QFKH 2DE9A 3H5CB 2ZTYA 1HAZB 1KXCA 2NWNA 1GBLA 1Y8TA 3RU4E 1O2YA 4B75A 1A5IA 2ANWA 2WUCA 5AFZH 1KIGH 2ZECA 3UNQA 2K1QA 2OXSA 3SV2H 2SNWA 2HRVA 1O3AA 1PPFE 5C5OA 2JETB 1TRYA 4MNXA 1K22H 1W14U 1ZGVA 2ZU3A 1O5EH 1A1RA 4BAHB 1UTKA 1SB1H 3SUGA 4NA7A 3DFLA 1V2WT 1XX9A 1O2IA 1QJ7B 1MUEB 5H4IB 1FUJA 2ZDVH 4WMDA 3SU2A 3TJUA 1VJAU 3SV9A 1ABIH 3SJ9A 4DJZB 1N1LA 2ZHDA 3KN2A 2OP9A 1YLCA 3ENSB 2QY0B 4FUGA 4D76A 3RXEA 1TMUH 1A61H 3HKIB 1LVBA 1NY22 2V3OH 3BF6H 3UOPA 2AMQA 2RG3A 1QCPA 1PPCE 1SLVB 1DWBH 3P8GA 4HGCA 3HK6B 4ZMAH 2F91A 1EZSC 2D8WA 3BTHE 3TNSA 1QL8A 3ZZ9A 1AMHA 1GBKA 3NCLA 1NC6A 4I8KA 1YPHC 2ZF0H 1TYNA 4AFUA 4TWWA 1K1IA 2ZDMA 1TNJA 5GCHF 2EA3A 1PQ5A 3T26A 1UCYE 7GCHG 3V3MA 1HAYB 4Y8YA 4DOQA 1PFXC 1SPJA 2F9BH 2CF8H 1VJ9U 2Y7XA 1O32A 1UTLM 3M3SA 2VH6A 1P8VC 1JRSA 3PTBA 2WPIS 1D9IA 3S7KB 4IN1A 3A8DA 1D6RA 1RJXB 3UFAA 1FXYA 3PMAB 4I7YH 1MAYA 1P09A 1O3JA 3O8DA 3ATMA 1SGYE 1HAHH 5L2ZH 2GV6A 2BLWA 4CHAB 1B0FA 5E2OA 1P2QA 3BTGE 1GI1A 3LOXA 4UD9H 2JH5D 3DT0H 1EZUC 5C5NA 1TLDA 3EAJA 2P8OB 1PQAA 5JB9S 2BYAX 2A45B 2XBVA 1TOMH 1C1UH 6GCHG 2A4RA 4ZROA 5JB8S 3U69H 1FPHH 3UIRA 1YP9A 1SGCA 1Z7KA 1O5CB 5E8EH 3LC3A 1C5OH 1HCGA 1O2PA 5F8ZA 4IW4E 1AN1E 2ZU4A 1IQNA 1TBQH 5DJ7A 3RXKA 3PMBB 3VGCB 4JZDH 1DXPA 1DY9A 3LDXH 1WUNH 1O2WA 1EAUA 1UJ1A 1XVOA 1SG8B 1DOJA 3OU0A 1BMNH 3CS7A 1G2LA 5LH8A 4F4OC 1RIWC 1O3EA 3SZNA 4CREA 3A7ZA 1LHDH 1IQGA 1FN8A 1CO7E 1GL1A 4FUJA 3RLWH 1FY8E 1A46H 3MNXA 1IQKA 1ELBA 1H4WA 2ZA5A 1EX3A 2ZI2H 3BTQE 3AW0A 1PYTC 3QTOH 4BANB 5IDKA 3GCNA 2A1DB 1GBHA 1K1MA 1L1JA 3BG4B 2ODQA 4DIHH 1G2MA 1D4PB 2V3HH 3S9CA 1E34B 2ANYA 1GMHF 4B74A 4H6TA 2P59A 1GI9B 4AG1A 1GBFA 2XCFA 1HIAA 3SHAH 1H9IE 2OCVB 1O3NA 1TNGA 5EPNA 5EU8A 1KLJH 1HGTH 3GCHB 1O33A 4INKA 3A7XA 1RTKA 2ZU2A 1O2QA 3JZ2B 3SO3A 3ODFA 1TABE 1ZYOA 3GCTG 2FEQH 2ZCHP 1QB9A 1T8MA 1G3DA 1YKTA 2P93A 3I29A 2KAIA 3QO6A 1LVYA 4DIIH 4X1RU 4AFSA 3VXFH 1S5SA 2O8LA 5J4SA 3EDXB 1VGCB 2GMTB 1GBEA 4AFZA 2AGGX 1ZHMA 3RXUA 4WMEA 5EG4A 5DP3A 5EGMA 1AE8H 2SGDE 4KTUA 3V12A 1J16A 4JCNA 1P57B 1J15A 2GV7A 3TGJE 1FMGA 2ZDLA 7KMEH 4X1NU 1HFDA 1ELGA 1ABJH 3C1KA 4UFDH 4QT8C 1ESAA 4JK6A 2A7CA 2ZG0H 1SR5C 5F03A 4UFGH 3M3VA 1W8BH 3AAVA 1AFQC 4XE4A 1C1WH 2AGIX 1QHRB 2HOBA 2IJOB 1TPPA 2VWMA 4JYVH 4Y0YE 2IN2A 2TGTA 4X0WU 4WH6A 2QF3A 3O8CA 3C27B 1O37A 2G51A 1O3GA 2HNTC 1C1MA 1DM4B 4U30A 3L3TA 1C2JA 1DUEA 1O2RA 2F9VA 5DP4A 4YO9A 1RRKA 4MDSA 5JPMH 1J8AA 3BTKE 4DVAU 3ZVDA 3LH3A 1XUFA 4HI3A 1QQUA 3B23B 3PLBA 1AWFH 1JXPA 2BQ6B 1GHXH 2HALA 2ZP0H 2QC2A 2NU3E 3UWIA 2FTLE 1DX5M 3ZZ3A 1F0RA 3Q76A 2SGEE 2AMPA 2ZDNA 1T8OA 1G30B 4D7GA 1F0UA 3SU5A 3DUXH 1F5KU 1QB6A 1W10U 5ESBA 8GCHG 3U98H 3O8BA 4YTAA 4GCHF 2ZTZA 3RXVA 1QRWA 3SI3H 1D3DB 1Z8GA 1C2MA 1YC0A 2CXVA 2WPMS 4ABAA 1C4U2 2XXLA 1JIMA 4O97A 4OS6A 4U01A 1C5XB 2PHBA 1KLIH 5AFYH 4MNYA 2BQ7B 2ZO3H 1SGDE 2C8XB 3M7UA 5E0HA 5DKMA 1W0YH 1K1PA 1GBTA 2R3UA 2FI3E 4Y6DA 4ASHA 1HNEE 1SGTA 3A7TA 1HAVA 2BQWB 1MTNC 2XC0A 1P2OA 1V2NT 1W11U 1EKBB 1GL0E 4ABEA 1ELFA 1GCTB 4RSPA 3U1IB 4AN7A 3GICB 1TA2A 3NKKA 4CHAC 4U2WA 3TNTA 4MVNA 1MD8A 1GDUA 3GY5A 1GJDB 1HDTH 5HGGA 1K1LA 1C1SA 1NRSH 1P10A 2BD2A 1UHBA 2PV9B 2ZGHA 2A2QH 1SLXB 1IQEA 3D23A 2WV4A 1C2FA 3D65E 1Y3YA 3PV4A 1GBAA 5FHTA 3UR6A 3ZVAA 2FP7B 5EXMA 1F92A 1DLEA 2TBSA 1HIAB 1O2TA 1TGTA 3VGCC 2FXRA 4UE7H 1OWHA 1JOUB 4AORA 1KLTA 1AUJA 3B9FH 3QN7A 1GHVH 5A2MH 2KAIB 1ZRKA 1ETSH 1EP6A 2H9EH 3SN8A 1TX7A 2NU4E 4MNWA 4NFFA 5HYOA 2ODYB 1DT2A 4UEHH 2D26C 2QXIA 2Y82A 1MCVA 1O2NA 2BDCA 3A8CA 1LTOA 1C5YB 1CGIE 3S9AA 1DXWA 2WPHS 1LPKB 1C2HA 1CE5A 1BA8B 1JBUH 2PSYA 3RXAA 4NWKA 1AY6H 1GG6C 3U8TH 1HAGE 4X1PU 2EC9H 4CRAA 1EJMA 1X7AC 4OS4A 1AUTC 2Z3CA 1SVPA 2PGQB 1J9CH 2BX3A 4HZHA 8LPRA 1O5AB 1GHAF 4ZKOU 1QQ4A 1S81A 4GSOA 2H5CA 1Z8JB 1K1NA 1FJSA 1W3CA 2H6MA 1BZXE 3RLYH 3ATWA 1GGDB 3UREA 3LPRA 2Y5HA 3SU3A 1BHXF 1MBQA 2Z9IA 1GI4A 2HGTH 4A7IB 1A4WH 4E7RG 1EAIA 1V2QT 1AHTH 2Y5FA 4NCYA 1FQ3A 2A4QA 3ZZ4A 5EW1H 1F0TA 3G01A 3MNCA 3ZYEA 1DANH 3ZZCA 2GCHG 1SQTA 2WYJA 1LPGB 2YOLA 3E1XB 3PLPA 1WTHD 1K1JA 1UVPA 2F83A 4BXWA 1DY8A 1FY4A 4VGCB 5K7RA 2FDAA 4IGDA 3GDVA 1THRH 2FOGA 1O3MA 1W12U 3N7OA 3RXHA 1SQAA 1AKSB 1GCDA 2BY8X 3PO1B 1G32B 4AYVB 4OS2A 1Z6JH 1NT1A 2TGDA 4DT7B 5DP9A 3HGPA 2XC4A 5A0AE 1DLKB 4ZKSU 3BIVH 4WVPE 3LJJA 3P70B 3MU4A 3T25A 3GDSA 1A0LA 5DGJA 3RXIA 1Z8RA 1BBRH 1QBVH 2H2ZA 3P8OA 2BLVA 1VITH 4CRDA 1BQYA 1H8IH 2JKHA 1HAVB 1D3QB 4JZIA 3B8JA 2QGRA 4GHQA 1JRTA 1ZZZA 2ZEBA 1E37B 1ELCA 4WY3A 5LPEA 1MAXA 4Y79A 1T4VH 2BDAA 2BXTH 2ZTXA 1ESTA 2Z94A 1GVLA 1QR3E 3SJKA 1Q3XA 2XWBI 5F6MA 2STAE 4Y71A 1GBCA 4E7NA 2QYIA 1EB1H 1N8OB 1ZHRA 2RCEA 3Q3KA 7GCHF 4I8HA 1EAWA 4YM9A 3QTVH 1UHBB 4E05H 1EJNA 1A7SA 2HNTF 1UTQA 1ANCA 2BDIA 3BTFE 3SBKA 1XVMA 1IHSH 1O2SA 1ZTJA 1P02A 4IC6A 2GDDA 5JBBS 4WH8A 4TPYA 3CP7A 3K2UA 4ABJA 2B0FA 1IQHA 3LU9B 3NK8A 3ZZBA 1HAIH 2W3KA 4B2CA 3VB7A 4CRCA 8KME2 2NU1E 2EI6A 4Q7ZA 1IOEA 4SGBE 3OX7U 4AX9H 1Q31A 4YOIA 2Y6TA 1V2OT 2VVUA 1C5UA 3EE0B 1AGJA 1BT7A 2GCTB 3VB5A 1AE5A 3RXQA 5F8XA 1AFEH 3RXSA 1NTPA 1P3EA 1NRQH 3ELAH 3OY6U 4LZ4B 3KQCA 1FIZA 4Y76A 6GCHF 2TGPZ 3NPSA 1AWHB 3PROA 1C5QA 2TIOA 1XUJA 3P92A 4X8VH 1VZQH 1GJ5H 1YPGH 1JIRA 1TGNA 3TH2H 3QLPH 1Z6EA 1BB0B 4FVBA 1UVTH 1LVMA 2J9NA 4IC5A 1GVZA 4INLA 1B0EA 4A1VA 2ZFTA 1LKBA 1NROH 3LGYA 3EGKH 3A85A 2BY5X 1MBMA 1VCWA 1P01A 1GHYH 2J95A 3GY3A 4THNH 4X2WA 5IYTA 1WBGB 1O5FH 4AB8A 2BX4A 2HWLB 1KXFA 2QN5T 1W13U 3TLOA 1KTTB 3UOUA 1PPBH 1O3IA 1GBIA 2XBWA 6CHAB 2FO9A 1LMWB 1E35B 3LT3A 1MKWK 2QCYA 4CRBA 1SFIA 2VIQA 1C5WB 1W7XH 1QGFA 1O38A 4MPXA 1QB1A 2ZCKP 2QXHA 5A09A 3R0FA 5EW2H 2BVXH 3STIA 1ESBA 3BTTE 4D8NA 1RD3B 2ZDAH 5DK1A 1HJAB 1QNJA 2B9LA 1SOZA 2FMJA 5FCRA 2LNCA 1SFQB 2Z9KA 4IMQA 1TPAE 4ISNA 2ZGBH 4O03A 4AZ2B 4ABBA 1P12E 2ANKH 1NFUA 1H8DH 2VU8E 3HGNA 2A5KA 1QIXB 1CSOE 4CRFA 1GBMA 4CBOA 1VITF 4CH2B 1GJ4H 3ZYDA 3UNSA 3A8AA 4IBLH 3TVJB 2FLBH 3A7VA 4KTSA 2CHAC 5E0GA 2A4GA 4TYDA 1HLTH 1TNHA 2XBXA 3F9FA 1QURH 1NO9H 1OP2A 2VWLA 3RUOA 1CT0E 5FX5A 1C1OA 3F68H 2NU0E 4KP0A 4A6LA 3H7OA 1TONA 1HJ9A 3SNCA 2A4OA 1FZZA 3FZDA 1UTJA 4MG3A 2FOAA 1BBRK 3ZV9A 1CBWB 4UFFH 2ZGCA 3D49H 1AVWA 2G52A 3E91A 1Z8IB 3SORA 4ISOA 1V3XA 3SUEA 6ESTA 2OC8A 4YT7H 3QK1A 3SHCH 1Y3XA 4FUHA 2P94A 1MMJN 1RFNA 2TPIZ 2P16A 1UVOA 4VGCC 1G3CA 1MU8B 1F5RA 1IQFA 2VB0A 5EOKA 4F49A 1V6DA 1D3TB 2ZU1A 3OSYA 4Q7YA 2FPZA 4KTCA 4J2YB 4A5TS 3PO1C 3VB4A 2ZHEH 4H42U 4WMFA 4I33A 2RDLA 2OD3B 1O36A 1EJAA 1C5VA 1ANDA 2P3UB 1FIWA 3RC5A 3SUDA 1V2MT 2XBYA 3M5MA 2J4IA 4YOJA 1QJ6B 1K2I1 3SNDA 2G8TA 2V0BA 2SGQE 1P2NA 4LOYH 4GLYA 1O2HA 1DWDH 3SQHE 1IQJA 1ZR0A 2PKSB 2ZHQH 2GTBA 3FVFB 1QL9A 2ZKSA 2OINA 3RXGA 4MTBA 2VGCC 2BD4A 4X2YA 2BD7A 2ZFRH 2ZFFH 5DP5A 3ZVBA 1EUFA 1P2MA 1F5LA 1KXDA 2A2XH 3K65B 5FPYA 3GY6A 5L2YH 3KQEA 2OQ5A 1YCPH 5HM2A 1C2GA 3F6UH 4NG9H 4ZHMU 1UVUH 1GBJA 5T6GA 1J17T 3GY7A 3CS0A 3SU4A 4GHTA 1C1TA 1MU6B 1BDAA 2QIQA 3V7TA 1M9UA 1TRMA 3SQEE 2YNAA 2LPRA 1TGSZ 1C5PA 2FOBA 3TK5A 4A1XA 1C5LH 1IAUA 4DGJA 1JMOH 1O35A 2J34A 5EXLA 4FUFA 3UR9A 3LKWA 2F3CE 2ZDKA 1CHOG 2FOHA 5CHAB 1AIXH 2GZ7A 1EPTA 5A0CA 1FONA 3FFGA 1JWTA 1YBWA 3QGNB 2QXGA 2P95A 3S7HB 3K9XB 1P05A 4BAOB 7LPRA 1KXBA 2C8ZB 3T27A 1D3PB 1O2XA 2FODA 3SJIA 1O2LA 1EATA 3SV6A 4NA8A 2BZ6H 2XYAA 2VNTA 5JBCS 3BN9A 3HATH 1Y3WA 4CR5A 4ZUHA 1KDQA 1SSXA 2OBOA 1LHGH 1ZJKA 1NESE 1MKXH 2JETC 1W2KH 2BMGB 2A0QB 2ZFQH 4Y8XA 1XUHA 2Z9LA 3E0PB 3K6YA 3RXMA 1QY6A 1AD8H 2VINA 3RM0H 3P8NA 3MI4A 5C1XA 5A8ZA 3NUMA 2OC0A 2BLQA 4ZXXH 3M35A 1TNIA 4XDEA 3MU1A 1AB9B 2A5IA 1O39A 1SBWA 2VIDA 1BTYA 3ZZ7A 4ZHLU 4WXIA 1CA0B 2AS9A 1W0ZU 3SGQE 1SGQE 1XXFA 1KYNA 4OGXA 2A31A 6CHAC 3KHVA 3HKJB 3RXJA 3SV8A 2PFEA 2GZ9A 3ITIA 5FCKA 1G9IE 1P11E 1A5HA 1C9PA 1C1PA 1EQ9A 4JZEH 1LQDB 4ABDA 2BZAA 1BMMH 1XMNB 2P3TB 2PR3A 2SGAA 3JZ1B 1GMCG 3SNEA 2CGAA 1OWIA 4ZAEA 1UCYH 1AKSA 3MMGA 1V2UT 3TIUA 2O9QA 1AU8A 4RKJB 2UUFB 4RN6A 3SU0A 1RTLA 2UUJB 3MH5A 1O5BB 5G4BA 2BD9A 1DUAA 1C5MD 1O3CA 1C1RA 1TX6A 2W5EA 2C3SA 4XBBA 2FESH 4X6PA 4U32A 1WSSH 1PQ7A 2ILNA 5FPSA 4YZUA 3LGTA 1Z71A 4DURA 1C5ZB 4K8YA 4NFEA 1NU9A 3PMJA 4AOQA 1FNIA 1GHWH 1O3BA 1C1NA 1QL7A 2H5DA 2I6SA 4X2VA 1XKBC 3ZVGA 3MH7A 3P17H 2Z3EA 4BTTB 1FN6A 1DWCH 3MU5A 4Z0KA 2UWOA 1TE0A 1TQ7B 4UFEH 1LCYA 3FZZA 2FOEA 1B5GH 5ESTE 1T8LA 1GJ6A 3CENA 3WY8A 5L30H 1O3FA 2P8OC 4MPWA 3VPKA 2GCHF 1BRAA 4GVUA 1ELAA 1OYQA 4TWYA 4AB9A 2FM2A 2R2MB 1MCTA 2FWWA 4TY7A 1YM0A 2G5VA 3UTUH 1KSNA 3A83A 5TCCA 2R3YA 1S0QA 5HXFA 1BRCE 3AVZA 3TPIZ 3OY5U 5A8YA 2BD3A 3GY4A 1TMBH 5JYIA 3A82A 3MNBA 1CQQA 2XW9A 4NGAH 5AVDA 2TGAA 3FP8E 2FS9A 5EQSA 1MTUA 2B8OH 5BRRE 3I78A 4BAMB 1A0HB 1P04A 2JH6D 1SOTA 1O2KA 2ZPRA 9LPRA 2PW8H 1FI8A 3DHKH 1GJCB 3GOVB 3T62A 3FANA 1N6XA 3UUZA 5A0BA 3A89A 1LDTT 1BTPA 1SL3A 1ELVA 1YLDA 2Y5GA 3MH6A 3KEEA 3ATIA 1GJAB 1EPTB 3P6ZB 2FYRA 1A3BH 3UPEA 1DFPA 2ZZUH 1TGCA 3BG4C 1BTXA 1CU1A 4FU9A 2H1UA 5SGAE 5GDSH
chains in the Genus database with same CATH superfamily
1ARCA 2VIVA 1UTPA 1T31A 1OSSA 1C1VH 1L2EA 2V35A 3IITA 4Q7XA 4ABHA 1WYKA 5DN6D 2EEKA 2XRCA 3W95A 2Z6BD 1C5NH 2BM2A 3FO8D 2XNIA 3GCHC 3VB3A 1KDQB 3MU0A 3F9EA 1KY9A 1UK4A 1P2KA 1O31A 4FETA 2BY6X 4BNRA 5F8TA 4FUEA 2SNVA 2WYGA 4DG4A 1VGCC 2GMTC 2JIZD 4NIWA 5C1YA 4BXSA 4CRGA 1OOKB 4NSVA 4BTUB 3GISB 3SZEA 1OKXA 1Y3UA 3M36A 3TK6A 2ULLA 1O3LA 5FAHA 1BMLA 3ATKA 1GHBG 1L1GA 1PQ8A 4NIYA 2KR7A 4DY7B 1P2IA 1GMDG 3KQBA 9ESTA 1FPCH 1K9OE 1O3HA 3AW1A 7ESTE 1C2EA 2UUYA 2JJ2D 2BB4A 3ESTA 8ESTE 2R9PA 4B2AA 4ZKRU 1E79D 5CMXH 2W7SA 1FX0B 3RXCA 1SI5H 5LPRA 1HRTH 1UCYK 2BD8A 1HAPH 1SQOA 2J94A 1P03A 5HIZA 5C1UA 4INHA 2C93B 1BIOA 1SLUB 3VB6A 1O2MA 4Y7AA 1EZQA 2GVFA 3P8FA 1C4V2 2XCNA 4ABIA 2AIPA 1CT4E 1WOFA 2ZHWH 4FVDA 4XBCA 3RU4T 4ABFA 3LC5A 2UWLA 2XOKD 3TITA 3GDUA 3L6PA 5C3NA 1E1QD 2VWOA 2UWPA 1QA0A 2VVCA 3PMHB 5E2PA 3A81A 1LPZB 5FBIA 1L4ZA 1B7XB 2V6NA 1TIOA 2W7UA 1CGHA 4X8TH 3GYLB 2KCAA 1RIWB 3NXPA 4OS1A 4JK5A 2D2DA 1RTFB 1BHXB 4BAKB 3TGKE 3MTYA 2XC5A 3BG8A 3M5NA 2O8UA 5T6DA 1BOQA 1KXEA 2BDGA 3GS9A 2A5AA 1WAYB 2C4FH 5E0JA 1C4Y2 2O8WA 3QZRA 4Y10E 2AH4X 2Z9GA 1AVXA 2Q6DA 1TB6H 5JBTA 3BIUH 1GI2A 4XOJA 2G5NA 2ASUB 1UTOA 3NZIA 3RXOA 1S85A 3GCOA 5ETXA 3ATLA 1EOJA 1QA7A 2ODPA 1GWAA 3UWJH 4X8SH 1TX8A 3KL6A 1YPJH 4PROA 1GCTC 1IHTH 3ZVEA 1S6LA 1ZLRA 1L0ZA 4I31A 1GHAG 4AG2A 4ZHAA 2AIQA 3MH4A 5EODA 2VIPA 1WQVH 1YPHE 4Q2KA 3T29A 4ZKNU 4OGYA 4WJG2 1U6QA 1J14A 1ANBA 2CF9H 2GKVE 1S6HA 1OWJA 3SNAA 3SGAE 3TJOA 3FP6E 3FP7E 1O2UA 4B2BA 1NRRH 2Y81A 1ZMLA 5TCAA 1T7CA 4UDWH 3UB0A 2VIOA 3URDA 4OM9A 1BUIA 3STJA 1FAXA 1OXGA 5LPFA 3AASA 4RT1A 3KCGH 1UTNA 1Z1IA 1O5DH 2ALVA 1C2DA 1PPEE 1ORFA 4R0IA 1C2IA 1OP0A 2J92A 3ZZ5A 2PLXA 4I8LA 3TK9A 3QDZB 1AFQB 4BAQB 1DE7H 3IG6B 1XXDA 3TJNA 4ESTE 4TT3D 3MU8A 3QGJA 1T8NA 2ZGJA 3ZZ6A 3F2FA 1LQEA 1BMAA 1P9SA 3RXFA 4Z6AH 2GX4A 2BOKA 1V2TT 4KGAA 1NRPH 1O2VA 3MHWU 2PUQH 3RXDA 3R3GB 3VFEA 2BOHB 3AAUA 3OYPA 4A92A 2ESTE 1EPTC 1GDNA 3TH4H 3M37A 1DITH 1BTUA 2W3IA 3GYMA 2C8WB 2AYWA 4O9VA 2FX4A 3LGWA 3E8LA 1MTSA 1TMTH 1VCQA 1XKAC 5KGOA 3A88A 1E0FD 1OS8A 3HK3B 3ZZ8A 3P95A 1AVGH 1LHCH 3A7WA 3GCTF 3SGBE 1S84A 1GI3A 2OUAA 1TPOA 5JDUB 1Z1JA 1A2CH 3BTDE 4MPVA 4Y0ZE 1F0SA 4DCDA 2VVVA 2CN0H 4I86A 1TRNA 2A7JA 4J1YA 3F1SB 2CV3A 3SU1A 3WW7A 1LVOA 1GGDC 4GAWA 1CHOF 4D7FA 4ASUD 1O2JA 2UUKB 2R0KA 4X6NA 3SUFA 3UY9A 4A1TA 1OYTH 1TGBA 4O3TA 4AGKA 3U8RH 1ELTA 2C90B 3SV7A 2LELA 3D62A 1HYLA 2HPQH 4FUIA 2ZCLP 1MTNB 1DSUA 3IWMA 3PWBA 2KCPA 5C67A 3MOCA 3DFJA 4HTCH 4K5ZA 3M5OA 5C2ZA 1ZTLA 1G37A 1V2PT 1D6WA 5L6NH 2FI4E 3A7YA 4FUBA 4HFPB 3RP2A 2THFB 1RGQA 2BTCE 2TRMA 5K0HA 4OS5A 3SNBA 1G36A 2AERH 5FX6A 4MNVA 1AZZA 4OS7A 4AGJA 3UNRA 5ABWA 2VH0A 2H9HA 4ISIH 3S69A 1SGRE 1BTWA 1FLEE 1YWUA 4Q4LA 1C5TA 2QE7D 1SGFA 4K60A 2G00A 1IQMA 2QA9E 3RU4D 1WTGH 1WCZA 2BDHA 5BPEA 3MO6A 1T4UH 5GNDA 3LGVA 1TAWA 1EAXA 1H9HE 4ISLA 4XFQA 1BTHH 6LPRA 3M3TA 2AGEX 2BDYA 3BTWE 5EQRA 2FIRH 2Y80A 2STBE 1GMCF 1IQLA 1GBDA 3PM3A 2ZC9H 2YNBA 2ZPSA 4GUXA 2HNTE 1CGJE 8GCHF 3LIWA 2Q1JA 1N8OC 1A5GH 1O2OA 2O8MA 1TBZH 1F7ZA 4XRNA 5A8XA 1V2RT 4X6OA 3QZQA 4NZLA 1HBTH 3LJOA 3RXBA 3RMOH 5C20A 1V2JT 3LH1A 3BTEE 4SGAE 2PKAA 4LZ1H 3I77A 1F2SE 1W0KD 1BCUH 3EA8A 1ZGIA 1WQSA 1HXFH 3E0NB 1OWKA 1SGNE 1MH0A 2ZQ1A 4CH8B 3Q77A 5GCHG 3BEIB 1PJPA 2RA3A 3BEFB 1TWXB 1GG6B 4NA9H 1O0DH 2RA0A 2FOMB 4K69A 1THPB 4K8BA 2BVSH 1ZMJA 5EJZA 4RKOB 4ZXYH 1HV7A 1CHGA 1SGPE 2GT7A 4GPGA 4X1QU 1ZSKA 1UMAH 1GJ7B 2ANMH 2HVYB 4R8TB 1VITG 1NS3A 2Q6FA 2BD5A 1L1NA 2G81E 2GCTC 3EA9A 5B6OA 2BY7X 1EASA 1V2LT 2EI7A 1PYTD 4Y11E 1O2GH 1MQ5A 4KKDA 1C5RA 3RMMH 1AI8H 2ZFPH 2GZ8A 3V13A 2GDEH 2ZGXH 2WPLS 3Q3XA 1AZ8A 4WF8A 2SFAA 2QV1A 4O3UA 3T5FH 1ARBA 1GVKB 3KQDA 2D1JA 3FAOA 2IPHA 1EOLA 1GI0A 2GT8A 4B1TA 1EP5A 1GJBB 4B71A 3F3BA 1GBBA 1BJVA 3N7DA 1NFXA 1DVAH 2GP9B 3MO9A 1VR1H 5HM9A 1GI6A 4FXGH 4JZFH 1OWEA 3VEQB 1G3EA 1DWEH 2JH0D 3KYGA 1WV7H 1UVSH 3PWCA 3DCLA 1Y5AT 5CDFE 2Y7ZA 1P3CA 1YPEH 3DSPA 3E6PH 3ZZAA 3KF2A 1K1OA 1MTVA 5DSFA 3BTME 3RM2H 2G55A 3ZVFA 1C2LA 1QRXA 3BEUA 3RXLA 1XUKA 1ZHPA 2ZNKH 1SGIB 3M7TA 4LXBH 4XBDA 2PWXA 5EPYA 1BBRE 2VIWA 1BTZA 3EYDA 1HJAC 2FX6A 1S82A 1A3EH 1P0SH 2HLCA 4WXVA 1NN6A 1LHEH 1ANEA 1GHZA 4FU8A 3U1JB 3SW2B 1OP8A 2CMYA 4Y7BA 1PPHE 1GMHG 4TY6A 1P9UA 2OC1A 5CE1A 3EQ0H 4JYUH 4YOGA 4K1TA 2AMDA 1LO6A 1O3DA 5DP6A 5GJ4B 1FV9A 5T6FA 1E38B 1QRZA 1EXFA 2ZPQA 2F9NA 1OPHB 2ZU5A 1HJ8A 4UONA 1NRNH 3ZZDA 1O30A 2ZIQH 3KIDU 4NSYA 4YLQH 1IQIA 2VJ1A 1GJ8B 1H9LB 2QAAA 1ZSJA 2PTNA 1SHHB 2WV5A 2A7HA 2Z9JA 4AYYB 1XM1A 5DP8A 1Y5BT 2FI5E 1CBWC 1MD7A 2SGFE 3MYWA 4ZH8A 3VXEH 2O8TA 2B5TB 1GHBF 1VCPA 3NRLA 2ZQ2A 1E36B 3LGIA 3TH3H 1GMDF 4M7GA 1V2ST 2Q6GA 4FUDA 5AF9H 3RMNH 4BOHA 2XTTB 4MPUA 3A84A 1ZJDA 1QBNA 1HAOH 3GY8A 1BJUA 3AK5A 2P3FH 4P02A 2IOTA 4FOUC 1YCPK 2I6QA 1C1QA 3SI4H 2C8YB 1HAXB 4P00A 4B73A 3KNXA 2QF0A 3S0NA 1XUIA 1AO5A 1NFYA 1BRBE 1S0RA 2BLOA 3T2NA 3H09A 3RDZA 1GPZA 1TNLA 3MFJA 2PKAB 2F9OA 3LONA 4JYTA 1P06A 3RMLH 1YPKH 2FOCA 3T28A 3CNRA 3LGUA 3N7EA 1NU7B 2BVRH 2EY4C 1ACBE 1TBRH 2WUBA 3M61U 2CJIA 5EJ1A 4IS5A 2J38A 1C2KA 2PKSC 1NZQH 1MQ6A 1KXAA 1SGFG 1GI8B 1YCPM 1TOCB 3WWFA 1GDQA 1ZPCA 4YLUA 5DP7A 3SU6A 2AFQB 5TJXA 1FY3A 1MTWA 4BTIB 1NFWA 5EJLA 4NIXA 1INCA 1FY1A 5C17A 2BDBA 1GJ9B 1S83A 3ZVCA 4K2YA 2PTCE 3ZV8A 4FUCA 1YGCH 3UQVA 3PB1E 1Y5UT 4KELA 1YPLH 4TPIZ 2ZHFH 1ZPBA 1O3OA 1ZMNA 4CR9A 4NWLA 2ZFSA 5FPTA 1Q2WA 3MWIU 4X8UH 3RC4A 1MZDA 1GI7B 1FDPA 4ABGA 3U9AH 2EI8A 5B6LA 1EB2A 3QUMP 4ZCNA 3L33A 1V2KT 1V2VT 4D9QA 2PSXA 3SOSA 4JMYA 3RC6A 3E3TA 1MKXK 2WPKS 1WU1A 3UAIC 1ELEE 3RXTA 3Q00A 4I32A 4GCHG 1Y3VA 1PPGE 2CK3D 1UO6A 3URCA 1K28D 3F9GA 5LGOA 4X2XA 1DPOA 2G4UA 2M5TA 2XWAA 1C9TA 3A86A 3U8OH 2R2WU 2SGPE 1O2ZA 2J97A 4I8JA 1DS2E 5CHAC 1O5GH 3Q3YA 3V0XA 1SC8U 2OC7A 1SMFE 4D9RA 5DPAA 1FY5A 5PTPA 1ZPZA 2F9UA 5T3HA 1UK2A 2IPQX 3DD2H 2CHAB 5EXNA 2LP6A 4NZQA 2VWNA 1UW7A 3MNSA 1MKWH 2OLGA 5GIBA 3SJ8A 3UQOA 5HMAA 1YF4A 2GGVB 1TPSA 1BRUP 4IMZA 1KTSB 1DSTA 1P2JA 1HB0B 3OTJE 4E06H 4JZ1A 2OQUA 4B76A 4H4FA 3PLKA 2W26A 1SLWB 5J4QA 4AFQA 1TQ0B 5JBAS 1TALA 1XUGA 2QF5A 3E16B 4DW2U 1FAKH 1S6FA 3A8BA 3BSQA 5FBEA 5GWZA 2R0LA 3NWUA 1ELDE 5I46H 1ID5H 4K1EA 3M5LA 1NPMA 1PPZA 1ZRBA 4H6SB 1AB9C 1RS0A 2FTMA 3A87A 3FOAA 3PRDA 5GXPA 1YPMH 4FU7A 3DSGA 1C5SA 1AQ7A 1ZSLA 5C94A 5DO4H 1NM6A 1CA0C 4AC9A 2J2UA 1A0JA 1O3PB 1K21H 3TU7H 2NU2E 1YYY1 2GD4B 1TNKA 4X1SU 1TA6A 1O3KA 2OBQA 3RXRA 3A80A 1W7GH 4IN2A 1RXPA 3SJOA 1H1BA 2BXUH 1HPGA 1OWDA 3KQ5A 2FLRH 1QJ1B 1LHFH 2DE8A 3H7TA 1EZXC 1T32A 1ETTH 2YMSC 4K3JA 3PYHA 1GI5A 4WWYA 4YESB 1Y59T 1DDJA 3TJVA 2PUXB 2B7DH 4MLFB 3EA7A 2F9PA 3F9HA 3ODDA 1TFXA 2BHGA 2QXJA 1QTFA 2VGCB 3MO3A 1THSH 4I8GA 1N6YA 2FOFA 2FYQA 1HUTH 3DA9B 5DG6A 1ZOMA 5I25A 4HG6A 5AHGH 3E90B 2BY9X 3S9BA 4K1SA 4CBNA 2H9TH 1LKAA 3ZIAD 2FZZA 3O8RA 1BITA 1QBOA 2G4TA 5GPIB 3RXPA 2PGBB 1MZAA 3QWCH 2HVXA 1ETRH 4YT6H 3M7QA 3W94A 3HPTB 1UTMA 3K6ZA 1DICA 5FXLA 1OX1A 1UK3A 3W1EA 3PTNA 3KGPA 4MQAA 1ZTKA 2ZWLH 1SGEE 2FS8A 4Q80A 1G3BA 1HXEH 4NIVA 3BV9B 4X6MA 2WINI 2WSSD 3GY2A 1CT2E 1CA8B 4XSKU 2WPDD 4Y8ZA 4ISHH 3QX5H 2Z7FE 3OEED 3TGIE 2DUCA 2OTVA 2WPJS 2HPPH 2AEIH 2ALPA 1CVWH 5EQQA 1L4DA 1SHYA 1O34A 4LK4A 2Z3DA 2A32A 1QFKH 2DE9A 3H5CB 2ZTYA 1HAZB 1KXCA 2NWNA 2JDID 2QF4A 2OK5A 1GBLA 1Y8TA 3RU4E 1O2YA 4B75A 1A5IA 2ANWA 5T1VA 2WUCA 5AFZH 1KIGH 2ZECA 3UNQA 2K1QA 2OXSA 3SV2H 2SNWA 2HRVA 1O3AA 1PPFE 4Q63A 5C5OA 2JETB 1TRYA 4MNXA 1K22H 1W14U 1ZGVA 2ZU3A 1O5EH 1A1RA 4BAHB 1UTKA 1SB1H 3SUGA 4NA7A 3DFLA 1V2WT 1XX9A 1O2IA 2F43B 1QJ7B 1MUEB 5H4IB 1FUJA 2ZDVH 4WMDA 3SU2A 3TJUA 1VJAU 3SV9A 1ABIH 3SJ9A 4DJZB 1N1LA 2ZHDA 3KN2A 2OP9A 1YLCA 3ENSB 2QY0B 4FUGA 4D76A 3RXEA 1TMUH 1A61H 3HKIB 1LVBA 1NY22 5HIYA 2V3OH 3BF6H 3UOPA 2AMQA 2RG3A 1QCPA 1PPCE 1SLVB 1DWBH 3P8GA 4HGCA 3HK6B 4ZMAH 2F91A 1EZSC 2D8WA 3BTHE 3TNSA 1QL8A 3ZZ9A 1AMHA 1GBKA 3NCLA 3OEHD 1NC6A 4I8KA 1YPHC 2ZF0H 1TYNA 2W6ID 4AFUA 1VKYA 4TWWA 1K1IA 2ZDMA 1TNJA 5GCHF 2EA3A 1PQ5A 3T26A 1UCYE 7GCHG 3V3MA 1HAYB 4Y8YA 4DOQA 1PFXC 1SPJA 2F9BH 2CF8H 2V7QD 1VJ9U 2Y7XA 1O32A 1UTLM 3M3SA 2VH6A 1P8VC 5CHBA 1JRSA 3PTBA 2WPIS 1D9IA 3S7KB 4IN1A 3A8DA 1D6RA 1RJXB 3UFAA 1FXYA 3PMAB 4I7YH 1MAYA 1P09A 1E1RD 1O3JA 1YY3A 3O8DA 3ATMA 1SGYE 1HAHH 5L2ZH 2GV6A 2BLWA 4CHAB 1B0FA 5E2OA 1P2QA 3BTGE 1GI1A 3LOXA 4UD9H 2JH5D 3DT0H 1EZUC 5C5NA 1TLDA 3EAJA 2P8OB 1PQAA 5JB9S 2BYAX 2A45B 2XBVA 1TOMH 1C1UH 6GCHG 2A4RA 4ZROA 5C0TA 5JB8S 3U69H 1FPHH 3EE7A 3UIRA 1YP9A 1SGCA 1Z7KA 1O5CB 5E8EH 3LC3A 1C5OH 1HCGA 1O2PA 5F8ZA 4IW4E 3N99A 1AN1E 2ZU4A 1IQNA 1TBQH 5DJ7A 3RXKA 3PMBB 3VGCB 4JZDH 1DXPA 1DY9A 3LDXH 1WUNH 1O2WA 1EAUA 1UJ1A 1XVOA 5HKKD 1SG8B 3FN8A 1DOJA 3OU0A 1BMNH 3CS7A 1G2LA 5LH8A 4F4OC 1RIWC 5FL7D 1O3EA 3SZNA 4CREA 3A7ZA 1LHDH 1IQGA 1FN8A 2KX4A 1CO7E 1GL1A 4FUJA 3RLWH 1FY8E 1A46H 3MNXA 1IQKA 1ELBA 1H4WA 2ZA5A 1EX3A 2ZI2H 3BTQE 1YLNA 3AW0A 1PYTC 3QTOH 4BANB 5IDKA 3GCNA 2A1DB 1GBHA 1K1MA 1L1JA 3BG4B 2ODQA 4DIHH 1G2MA 1D4PB 2V3HH 3S9CA 1E34B 2ANYA 1GMHF 4B74A 4H6TA 2P59A 1GI9B 4AG1A 1GBFA 2XCFA 1HIAA 3SHAH 1H9IE 2OCVB 1O3NA 1TNGA 5EPNA 5EU8A 1KLJH 1HGTH 3GCHB 1O33A 4INKA 3A7XA 1RTKA 2ZU2A 1O2QA 3JZ2B 3SO3A 3ODFA 1TABE 1ZYOA 3GCTG 2FEQH 2ZCHP 1QB9A 1T8MA 1G3DA 1YKTA 2P93A 3I29A 2KAIA 3QO6A 1LVYA 4DIIH 4X1RU 4AFSA 3VXFH 1S5SA 2O8LA 5J4SA 3EDXB 1VGCB 2GMTB 1GBEA 4AFZA 2AGGX 1ZHMA 3RXUA 4WMEA 5EG4A 5DP3A 5EGMA 1AE8H 2SGDE 4KTUA 3V12A 1J16A 4JCNA 1P57B 1J15A 2GV7A 3TGJE 1FMGA 2ZDLA 7KMEH 4X1NU 1HFDA 1ELGA 1ABJH 2F4LA 3C1KA 4UFDH 4QT8C 1ESAA 4JK6A 2A7CA 2ZG0H 1SR5C 5F03A 4UFGH 3M3VA 1W8BH 3AAVA 1AFQC 4XE4A 1C1WH 2L6OA 2AGIX 1QHRB 2HOBA 2IJD1 2IJOB 1TPPA 2VWMA 4JYVH 4Y0YE 2IN2A 2TGTA 4X0WU 4WH6A 2QF3A 1SKYE 3O8CA 3C27B 1O37A 2G51A 1O3GA 2HNTC 1C1MA 1DM4B 4U30A 3L3TA 1C2JA 1DUEA 1O2RA 2KFWA 2F9VA 5DP4A 4YO9A 1RRKA 2JJ1D 3VG8A 4MDSA 5JPMH 1J8AA 3BTKE 4DVAU 3ZVDA 1H8ED 3LH3A 1XUFA 4HI3A 1QQUA 3B23B 3PLBA 1AWFH 1JXPA 2BQ6B 2RFKC 1GHXH 2HALA 2ZP0H 2QC2A 2NU3E 3UWIA 3OTPA 2FTLE 5C0UA 1DX5M 3ZZ3A 1F0RA 3Q76A 1MABB 2SGEE 2AMPA 2ZDNA 1T8OA 1G30B 4D7GA 1F0UA 3OE7D 3SU5A 3DUXH 1F5KU 1QB6A 1W10U 5ESBA 8GCHG 3U98H 3O8BA 4YTAA 4GCHF 2ZTZA 3RXVA 1QRWA 3SI3H 1D3DB 1Z8GA 1C2MA 1YC0A 2CXVA 2WPMS 4ABAA 1C4U2 2XXLA 3SYJA 1JIMA 3U28C 4O97A 4OS6A 4U01A 1C5XB 2PHBA 1KLIH 5AFYH 2VBCA 4MNYA 2BQ7B 2ZO3H 1SGDE 2C8XB 3M7UA 5E0HA 5DKMA 2RDEA 1W0YH 1K1PA 1GBTA 2R3UA 2FI3E 4Y6DA 4ASHA 1HNEE 1SGTA 3A7TA 1HAVA 2BQWB 4F55A 1MTNC 2XC0A 1P2OA 1V2NT 1W11U 4XD7D 1EKBB 1GL0E 5KEDA 4ABEA 5KECA 1ELFA 1GCTB 4RSPA 3U1IB 4AN7A 3GICB 1TA2A 3NKKA 4CHAC 4U2WA 3TNTA 4MVNA 1MD8A 1GDUA 2AHME 3GY5A 1GJDB 1HDTH 5HGGA 1K1LA 1C1SA 1NRSH 1P10A 2EQNA 2BD2A 1UHBA 2PV9B 2ZGHA 2A2QH 1SLXB 1IQEA 3D23A 2WV4A 1C2FA 3D65E 1Y3YA 3PV4A 1GBAA 5FHTA 3UR6A 3ZVAA 2FP7B 5EXMA 1F92A 1DLEA 2TBSA 1HIAB 1O2TA 1TGTA 3VGCC 2FXRA 4UE7H 1OWHA 1JOUB 4AORA 3OAAD 1KLTA 1AUJA 3B9FH 3QN7A 1GHVH 5A2MH 2KAIB 1ZRKA 1ETSH 1EP6A 2H9EH 3SN8A 1TX7A 2NU4E 4MNWA 4NFFA 5HYOA 2ODYB 1DT2A 4UEHH 2D26C 2QXIA 2Y82A 1MCVA 1O2NA 2BDCA 3A8CA 1LTOA 1C5YB 4RI0A 2KCOA 1CGIE 3S9AA 1DXWA 4M9FA 2WPHS 1LPKB 1C2HA 1CE5A 1BA8B 1JBUH 2PSYA 3RXAA 4NWKA 1AY6H 1GG6C 3U8TH 1HAGE 4X1PU 2EC9H 4CRAA 1EJMA 1X7AC 4OS4A 1AUTC 2Z3CA 1SVPA 2PGQB 1J9CH 2BX3A 4HZHA 8LPRA 1O5AB 1GHAF 4ZKOU 1QQ4A 1S81A 4GSOA 2H5CA 1Z8JB 1K1NA 1FJSA 1W3CA 2H6MA 1BZXE 3RLYH 3ATWA 1GGDB 3UREA 3LPRA 2Y5HA 3SU3A 1BHXF 1MBQA 2Z9IA 1GI4A 2HGTH 4A7IB 1A4WH 4E7RG 1EAIA 1V2QT 1AHTH 2Y5FA 4NCYA 1FQ3A 2A4QA 3ZZ4A 5EW1H 1F0TA 3G01A 3MNCA 3ZYEA 1DANH 1OHHD 3ZZCA 2GCHG 1SQTA 2WYJA 1LPGB 2YOLA 3E1XB 3PLPA 1WTHD 1K1JA 1UVPA 2F83A 4BXWA 4TSFD 1DY8A 1FY4A 4VGCB 5K7RA 2FDAA 4IGDA 3GDVA 1THRH 2FOGA 1O3MA 1W12U 3N7OA 3RXHA 1SQAA 2L74A 1AKSB 1GCDA 2BY8X 3PO1B 1G32B 4AYVB 4OS2A 1Z6JH 1NT1A 2TGDA 4DT7B 5DP9A 3HGPA 2XC4A 5A0AE 1DLKB 4ZKSU 3BIVH 4WVPE 3LJJA 3P70B 3MU4A 3T25A 3GDSA 1A0LA 5DGJA 3RXIA 1Z8RA 1BBRH 1QBVH 3PV5A 2H2ZA 3P8OA 2BLVA 1VITH 4CRDA 1BQYA 1H8IH 2JKHA 1HAVB 1D3QB 4JZIA 3B8JA 2QGRA 4GHQA 1JRTA 1ZZZA 2W6JD 2ZEBA 1E37B 1ELCA 4WY3A 5LPEA 1MAXA 4Y79A 1T4VH 2BDAA 2BXTH 2ZTXA 1ESTA 2Z94A 1GVLA 1QR3E 3SJKA 1Q3XA 2XWBI 5F6MA 2STAE 4Y71A 1GBCA 4E7NA 2QYIA 1EB1H 1N8OB 1ZHRA 2RCEA 3Q3KA 4Z1MD 7GCHF 4I8HA 1EAWA 4YM9A 3QTVH 2WZQA 1UHBB 4E05H 1EJNA 1A7SA 2HNTF 1UTQA 1ANCA 2BDIA 3BTFE 3SBKA 1XVMA 1IHSH 1O2SA 1W0JD 1ZTJA 1P02A 4IC6A 2GDDA 5JBBS 4WH8A 4TPYA 3CP7A 3K2UA 4ABJA 2B0FA 1IQHA 3LU9B 3NK8A 3ZZBA 4B6FA 1HAIH 2W3KA 4B2CA 3VB7A 4CRCA 8KME2 2NU1E 2EI6A 4Q7ZA 1IOEA 2YMSD 3F2GA 4SGBE 3OX7U 4AX9H 1Q31A 4YOIA 2Y6TA 1V2OT 2VVUA 1C5UA 3EE0B 1AGJA 1BT7A 2GCTB 3VB5A 1AE5A 3RXQA 5F8XA 1AFEH 3RXSA 2J5UA 3KYFA 1NTPA 1P3EA 1NRQH 3ELAH 3OY6U 4LZ4B 3KQCA 1FIZA 4Y76A 6GCHF 2TGPZ 3NPSA 1AWHB 3PROA 1C5QA 2TIOA 1XUJA 3P92A 4X8VH 1VZQH 1GJ5H 1YPGH 1JIRA 1TGNA 3TH2H 3QLPH 1Z6EA 1BB0B 4FVBA 1UVTH 1LVMA 2J9NA 1QZ8A 4IC5A 1GVZA 4INLA 1B0EA 4A1VA 2ZFTA 5EIYA 1LKBA 1NROH 2K0QA 3EGKH 3A85A 2BY5X 3LGYA 1MBMA 1VCWA 1P01A 2XNDD 1GHYH 2J95A 3GY3A 4THNH 4X2WA 5IYTA 1WBGB 1O5FH 1NBME 4AB8A 2BX4A 2HWLB 1KXFA 2V3MA 2QN5T 1W13U 3TLOA 1KTTB 3UOUA 1PPBH 1O3IA 1GBIA 2XBWA 6CHAB 1H8HD 2FO9A 1LMWB 1E35B 3LT3A 1BMFD 1MKWK 3MQKC 2QCYA 4CRBA 1SFIA 2VIQA 1C5WB 1W7XH 1QGFA 1O38A 4MPXA 1QB1A 2ZCKP 2QXHA 5A09A 3R0FA 5EW2H 2BVXH 4ACAA 1EFRD 3STIA 1ESBA 3BTTE 4D8NA 1RD3B 2ZDAH 5DK1A 1HJAB 1QNJA 2B9LA 1SOZA 2FMJA 5FCRA 2LNCA 1SFQB 2Z9KA 4IMQA 1TPAE 4ISNA 2ZGBH 4O03A 4AZ2B 4ABBA 1P12E 2ANKH 1NFUA 1H8DH 2VU8E 3HGNA 2A5KA 1QIXB 1CSOE 4CRFA 1GBMA 4CBOA 1VITF 2GJGA 1GJ4H 4CH2B 3ZYDA 3UNSA 3A8AA 4IBLH 3TVJB 2FLBH 2KCYA 3A7VA 4KTSA 2CHAC 5E0GA 2A4GA 4TYDA 1HLTH 1TNHA 2XBXA 3F9FA 1QURH 1NO9H 1OP2A 2VWLA 3RUOA 1CT0E 5FX5A 1C1OA 3F68H 2NU0E 4KP0A 4A6LA 3H7OA 1TONA 1HJ9A 3SNCA 2A4OA 1FZZA 3FZDA 1UTJA 4MG3A 2FOAA 1BBRK 3ZV9A 1CBWB 4UFFH 2ZGCA 3D49H 1AVWA 2G52A 3E91A 1Z8IB 3SORA 4ISOA 5F53A 1V3XA 3SUEA 6ESTA 2OC8A 4YT7H 3QK1A 3SHCH 1Y3XA 4FUHA 2P94A 1MMJN 1RFNA 2TPIZ 2P16A 1UVOA 4VGCC 1G3CA 1MU8B 1F5RA 1IQFA 2VB0A 5EOKA 4F49A 1V6DA 1D3TB 2ZU1A 3OSYA 4Q7YA 2FPZA 4KTCA 4J2YB 4A5TS 3PO1C 3VB4A 2ZHEH 4H42U 4WMFA 4I33A 2RDLA 2OD3B 1O36A 1EJAA 1C5VA 1ANDA 2P3UB 1FIWA 3F0OA 3RC5A 3SUDA 2WHXA 1V2MT 2XBYA 3M5MA 2J4IA 4YOJA 1QJ6B 1K2I1 3SNDA 2G8TA 2V0BA 2SGQE 1P2NA 4LOYH 4GLYA 1O2HA 1DWDH 3SQHE 1IQJA 1ZR0A 2PKSB 2ZHQH 2GTBA 3FVFB 1QL9A 2ZKSA 2OINA 3RXGA 4MTBA 2VGCC 2BD4A 4X2YA 2BD7A 1NBMD 2ZFRH 2ZFFH 5DP5A 3ZVBA 1EUFA 2J98A 1P2MA 1F5LA 1KXDA 4B6EA 2A2XH 2KM0A 3K65B 5FPYA 3GY6A 4F48B 5L2YH 3KQEA 2OQ5A 1YCPH 5HM2A 1C2GA 3F6UH 4NG9H 4ZHMU 1UVUH 1GBJA 3FKSD 5T6GA 3PV2A 1J17T 3GY7A 3CS0A 3SU4A 4GHTA 1C1TA 1MU6B 1BDAA 2QIQA 3V7TA 1M9UA 1TRMA 3SQEE 2YNAA 2LPRA 1TGSZ 1C5PA 2FOBA 3TK5A 4A1XA 1C5LH 1IAUA 4DGJA 1JMOH 1SQRA 1O35A 2J34A 5EXLA 4FUFA 3UR9A 2PP6A 3LKWA 2F3CE 2ZDKA 1CHOG 2FOHA 5CHAB 1AIXH 2GZ7A 1EPTA 5A0CA 1FONA 3FFGA 1JWTA 1YBWA 2KZ4A 2QXGA 2P95A 3QGNB 3S7HB 3K9XB 1P05A 4BAOB 7LPRA 1KXBA 2C8ZB 3T27A 1D3PB 1O2XA 2FODA 3SJIA 1O2LA 1EATA 3SV6A 4NA8A 2BZ6H 2XYAA 2VNTA 5JBCS 3BN9A 3HATH 1Y3WA 4CR5A 3F0PA 4ZUHA 1KDQA 1SSXA 2OBOA 1LHGH 1ZJKA 1NESE 1MKXH 2JETC 1W2KH 2BMGB 2A0QB 2ZFQH 4Y8XA 1XUHA 2Z9LA 3E0PB 2M2AA 3K6YA 3RXMA 1QY6A 2K8IA 1AD8H 2VINA 3RM0H 3P8NA 4ACBA 3MI4A 5C1XA 5A8ZA 3NUMA 2OC0A 2BLQA 2HLDD 4ZXXH 3M35A 1TNIA 4XDEA 3MU1A 1AB9B 2A5IA 1O39A 1SBWA 2VIDA 1BTYA 3ZZ7A 4ZHLU 4WXIA 1CA0B 2AS9A 1W0ZU 3SGQE 1SGQE 1WXRA 1XXFA 1KYNA 4OGXA 2A31A 6CHAC 3KHVA 3HKJB 3RXJA 3SV8A 2PFEA 2GZ9A 3ITIA 5FCKA 1G9IE 1P11E 1A5HA 1C9PA 1C1PA 1EQ9A 4JZEH 1LQDB 4ABDA 2BZAA 1BMMH 1XMNB 2P3TB 2PR3A 2SGAA 3JZ1B 1GMCG 4RT0A 2CGAA 3SNEA 1OWIA 4ZAEA 1UCYH 1AKSA 2YMSB 3MMGA 1V2UT 3TIUA 2O9QA 1AU8A 4RKJB 2UUFB 4RN6A 3SU0A 1RTLA 4YXWD 2UUJB 3MH5A 1O5BB 5G4BA 1K0HA 3OFND 2BD9A 1DUAA 1C5MD 1O3CA 1C1RA 1TX6A 2W5EA 2C3SA 4XBBA 2FESH 4X6PA 4U32A 1WSSH 1PQ7A 2ILNA 5FPSA 4YZUA 3LGTA 1Z71A 4DURA 1C5ZB 4K8YA 4NFEA 1NU9A 3PMJA 4AOQA 1FNIA 1GHWH 1O3BA 1C1NA 1QL7A 2H5DA 3F2HA 2I6SA 4X2VA 1XKBC 3ZVGA 3MH7A 3P17H 2Z3EA 4BTTB 1FN6A 1DWCH 3MU5A 4Z0KA 2UWOA 1TE0A 1TQ7B 4UFEH 1LCYA 3FZZA 2FOEA 1B5GH 5ESTE 1T8LA 1GJ6A 3CENA 3WY8A 5L30H 2WV9A 1O3FA 2P8OC 4MPWA 3VPKA 2GCHF 1BRAA 4GVUA 1ELAA 1OYQA 4TWYA 5IK2D 4AB9A 2FM2A 2R2MB 1MCTA 4DT4A 2FWWA 4TY7A 1YM0A 2J98B 1COWD 2G5VA 3UTUH 1KSNA 3A83A 5TCCA 2R3YA 1S0QA 5HXFA 1BRCE 3AVZA 3TPIZ 3OY5U 5A8YA 2BD3A 3GY4A 1TMBH 5JYIA 3A82A 3MNBA 1CQQA 2XW9A 4NGAH 5AVDA 2TGAA 3FP8E 2FS9A 5EQSA 1MTUA 1WDIA 2B8OH 5BRRE 3I78A 4BAMB 1A0HB 1P04A 2JH6D 1SOTA 1O2KA 2ZPRA 9LPRA 2PW8H 3WWBA 1FI8A 3DHKH 1GJCB 3GOVB 3T62A 3FANA 1N6XA 3UUZA 5A0BA 3A89A 1LDTT 1BTPA 1SL3A 1ELVA 1YLDA 2Y5GA 3MH6A 3KEEA 3ATIA 1GJAB 1EPTB 3P6ZB 2FYRA 1A3BH 3UPEA 1DFPA 2ZZUH 1TGCA 3BG4C 3DSOA 1BTXA 1CU1A 4FU9A 3PRBA 2H1UA 5SGAE 1KMHB 5GDSH
chains in the Genus database with same CATH topology
1ARCA 2VIVA 1UTPA 1T31A 1OSSA 1C1VH 1L2EA 2V35A 3IITA 4Q7XA 4ABHA 1WYKA 2EEKA 2XRCA 3W95A 2Z6BD 1C5NH 2BM2A 2XNIA 3GCHC 3VB3A 1KDQB 3MU0A 3F9EA 1KY9A 1UK4A 1P2KA 1O31A 2BY6X 4BNRA 5F8TA 4FUEA 2SNVA 2WYGA 4DG4A 1VGCC 2GMTC 4NIWA 5C1YA 4BXSA 4CRGA 1OOKB 4NSVA 4BTUB 3GISB 1OKXA 1Y3UA 3M36A 3TK6A 2ULLA 1O3LA 5FAHA 1BMLA 3ATKA 1GHBG 1L1GA 1PQ8A 4NIYA 4DY7B 1P2IA 1GMDG 3KQBA 9ESTA 1FPCH 1K9OE 1O3HA 3AW1A 7ESTE 1C2EA 2UUYA 3ESTA 2BB4A 8ESTE 2R9PA 4B2AA 4ZKRU 5CMXH 2W7SA 3RXCA 1SI5H 5LPRA 1HRTH 1UCYK 2BD8A 1HAPH 1SQOA 2J94A 1P03A 5C1UA 4INHA 2C93B 1BIOA 1SLUB 3VB6A 1O2MA 4Y7AA 1EZQA 2GVFA 3P8FA 1C4V2 2XCNA 4ABIA 2AIPA 1CT4E 1WOFA 2ZHWH 4FVDA 4XBCA 3RU4T 4ABFA 3LC5A 2UWLA 3TITA 3GDUA 3L6PA 5C3NA 2VWOA 2UWPA 1QA0A 2VVCA 3PMHB 5E2PA 3A81A 1LPZB 5FBIA 1L4ZA 1B7XB 2V6NA 1TIOA 2W7UA 1CGHA 4X8TH 3GYLB 1RIWB 3NXPA 4OS1A 4JK5A 2D2DA 1RTFB 1BHXB 4BAKB 3TGKE 3MTYA 2XC5A 3BG8A 3M5NA 2O8UA 5T6DA 1BOQA 1KXEA 2BDGA 2A5AA 1WAYB 2C4FH 5E0JA 1C4Y2 2O8WA 3QZRA 4Y10E 2AH4X 2Z9GA 1AVXA 2Q6DA 1TB6H 5JBTA 3BIUH 1GI2A 4XOJA 2G5NA 2ASUB 1UTOA 3NZIA 3RXOA 1S85A 3GCOA 5ETXA 3ATLA 1EOJA 1QA7A 2ODPA 1GWAA 3UWJH 4X8SH 1TX8A 3KL6A 1YPJH 4PROA 1GCTC 1IHTH 3ZVEA 1ZLRA 1L0ZA 4I31A 1GHAG 4AG2A 4ZHAA 2AIQA 3MH4A 5EODA 2VIPA 1WQVH 1YPHE 4Q2KA 3T29A 4ZKNU 4OGYA 4WJG2 1U6QA 1J14A 1ANBA 2CF9H 2GKVE 1S6HA 1OWJA 3SNAA 3SGAE 3TJOA 3FP6E 3FP7E 1O2UA 4B2BA 1NRRH 2Y81A 1ZMLA 5TCAA 1T7CA 4UDWH 2VIOA 3URDA 1BUIA 3STJA 1FAXA 1OXGA 5LPFA 3AASA 3KCGH 1UTNA 1Z1IA 1O5DH 2ALVA 1C2DA 1PPEE 1ORFA 4R0IA 1C2IA 1OP0A 2J92A 3ZZ5A 2PLXA 4I8LA 3TK9A 3QDZB 1AFQB 4BAQB 1DE7H 3IG6B 1XXDA 3TJNA 4ESTE 3MU8A 3QGJA 1T8NA 2ZGJA 3ZZ6A 1LQEA 1BMAA 1P9SA 3RXFA 4Z6AH 2GX4A 2BOKA 1V2TT 4KGAA 1NRPH 1O2VA 3MHWU 2PUQH 3RXDA 3R3GB 3VFEA 2BOHB 3AAUA 3OYPA 4A92A 2ESTE 1EPTC 1GDNA 3TH4H 3M37A 1DITH 1BTUA 2W3IA 3GYMA 2C8WB 2AYWA 4O9VA 2FX4A 3LGWA 3E8LA 1MTSA 1TMTH 1VCQA 1XKAC 3A88A 1E0FD 1OS8A 3HK3B 3ZZ8A 3P95A 1AVGH 1LHCH 3A7WA 3GCTF 3SGBE 1S84A 2OUAA 1GI3A 1TPOA 5JDUB 1Z1JA 1A2CH 3BTDE 4MPVA 4Y0ZE 1F0SA 4DCDA 2VVVA 2CN0H 1TRNA 2A7JA 4J1YA 3F1SB 2CV3A 3SU1A 1LVOA 1GGDC 4GAWA 1CHOF 4D7FA 1O2JA 2UUKB 2R0KA 4X6NA 3SUFA 3UY9A 4A1TA 1OYTH 1TGBA 4O3TA 4AGKA 3U8RH 1ELTA 2C90B 3SV7A 3D62A 1HYLA 2HPQH 4FUIA 2ZCLP 1MTNB 1DSUA 3IWMA 3PWBA 5C67A 3MOCA 3DFJA 4HTCH 4K5ZA 3M5OA 5C2ZA 1ZTLA 1G37A 1V2PT 1D6WA 5L6NH 2FI4E 3A7YA 4FUBA 4HFPB 3RP2A 2THFB 1RGQA 2BTCE 2TRMA 5K0HA 4OS5A 3SNBA 1G36A 2AERH 5FX6A 4MNVA 1AZZA 4OS7A 4AGJA 3UNRA 5ABWA 2VH0A 2H9HA 4ISIH 3S69A 1SGRE 1BTWA 1FLEE 1C5TA 1SGFA 4K60A 2G00A 1IQMA 2QA9E 3RU4D 1WTGH 1WCZA 2BDHA 5BPEA 3MO6A 1T4UH 3LGVA 1TAWA 1EAXA 1H9HE 4ISLA 4XFQA 1BTHH 6LPRA 3M3TA 2AGEX 2BDYA 3BTWE 5EQRA 2FIRH 2Y80A 2STBE 1GMCF 1IQLA 1GBDA 3PM3A 2ZC9H 2YNBA 2ZPSA 4GUXA 2HNTE 1CGJE 8GCHF 3LIWA 2Q1JA 1N8OC 1A5GH 1O2OA 2O8MA 1TBZH 1F7ZA 5A8XA 1V2RT 4X6OA 3QZQA 4NZLA 1HBTH 3LJOA 3RXBA 3RMOH 5C20A 1V2JT 3LH1A 3BTEE 4SGAE 2PKAA 4LZ1H 3I77A 1F2SE 1BCUH 3EA8A 1ZGIA 1WQSA 1HXFH 3E0NB 1OWKA 1SGNE 1MH0A 2ZQ1A 4CH8B 3Q77A 5GCHG 3BEIB 1PJPA 2RA3A 3BEFB 1TWXB 1GG6B 4NA9H 1O0DH 2RA0A 2FOMB 4K69A 1THPB 4K8BA 2BVSH 1ZMJA 4RKOB 4ZXYH 1HV7A 1CHGA 1SGPE 2GT7A 4GPGA 4X1QU 1ZSKA 1UMAH 1GJ7B 2ANMH 4R8TB 1VITG 1NS3A 2Q6FA 2BD5A 1L1NA 2G81E 2GCTC 3EA9A 5B6OA 2BY7X 1EASA 1V2LT 2EI7A 1PYTD 4Y11E 1O2GH 1MQ5A 4KKDA 1C5RA 3RMMH 1AI8H 2ZFPH 2GZ8A 3V13A 2GDEH 2ZGXH 2WPLS 3Q3XA 1AZ8A 4WF8A 2SFAA 2QV1A 4O3UA 3T5FH 1ARBA 1GVKB 3KQDA 2D1JA 3FAOA 2IPHA 1EOLA 1GI0A 2GT8A 4B1TA 1EP5A 1GJBB 4B71A 1GBBA 1BJVA 1NFXA 1DVAH 2GP9B 3MO9A 1VR1H 5HM9A 1GI6A 4FXGH 4JZFH 1OWEA 3VEQB 1G3EA 1DWEH 2JH0D 1WV7H 1UVSH 3PWCA 1Y5AT 2Y7ZA 1P3CA 1YPEH 3E6PH 3ZZAA 3KF2A 1K1OA 1MTVA 3BTME 3RM2H 2G55A 3ZVFA 1C2LA 1QRXA 3BEUA 3RXLA 1XUKA 1ZHPA 2ZNKH 1SGIB 3M7TA 4LXBH 4XBDA 2PWXA 5EPYA 1BBRE 2VIWA 1BTZA 3EYDA 1HJAC 2FX6A 1S82A 1A3EH 1P0SH 2HLCA 4WXVA 1NN6A 1LHEH 1ANEA 1GHZA 4FU8A 3U1JB 3SW2B 1OP8A 2CMYA 4Y7BA 1PPHE 1GMHG 4TY6A 1P9UA 2OC1A 5CE1A 3EQ0H 4JYUH 4YOGA 4K1TA 2AMDA 1LO6A 1O3DA 5DP6A 5GJ4B 1FV9A 5T6FA 1E38B 1QRZA 1EXFA 2ZPQA 2F9NA 1OPHB 2ZU5A 1HJ8A 4UONA 1NRNH 3ZZDA 1O30A 2ZIQH 3KIDU 4NSYA 4YLQH 1IQIA 2VJ1A 1GJ8B 1H9LB 2QAAA 1ZSJA 2PTNA 1SHHB 2WV5A 2A7HA 2Z9JA 4AYYB 1XM1A 5DP8A 1Y5BT 2FI5E 1CBWC 1MD7A 2SGFE 3MYWA 4ZH8A 3VXEH 2O8TA 1GHBF 1VCPA 2B5TB 2ZQ2A 1E36B 3LGIA 3TH3H 1GMDF 4M7GA 1V2ST 2Q6GA 4FUDA 5AF9H 3RMNH 4BOHA 2XTTB 4MPUA 3A84A 1ZJDA 1QBNA 1HAOH 3GY8A 1BJUA 2P3FH 2IOTA 1YCPK 2I6QA 1C1QA 3SI4H 2C8YB 1HAXB 4B73A 3KNXA 2QF0A 3S0NA 1XUIA 1AO5A 1NFYA 1BRBE 1S0RA 2BLOA 3T2NA 3RDZA 1GPZA 1TNLA 3MFJA 2PKAB 2F9OA 3LONA 4JYTA 1P06A 3RMLH 1YPKH 2FOCA 3T28A 3LGUA 1NU7B 2BVRH 1ACBE 1TBRH 2WUBA 3M61U 2CJIA 4IS5A 2J38A 1C2KA 2PKSC 1NZQH 1MQ6A 1KXAA 1SGFG 1GI8B 1YCPM 1TOCB 1GDQA 1ZPCA 4YLUA 5DP7A 3SU6A 2AFQB 5TJXA 1FY3A 1MTWA 4BTIB 1NFWA 4NIXA 1INCA 1FY1A 2BDBA 1GJ9B 1S83A 3ZVCA 4K2YA 2PTCE 3ZV8A 4FUCA 1YGCH 3UQVA 3PB1E 1Y5UT 4KELA 1YPLH 4TPIZ 2ZHFH 1ZPBA 1O3OA 1ZMNA 4CR9A 4NWLA 2ZFSA 5FPTA 1Q2WA 3MWIU 4X8UH 3RC4A 1MZDA 1GI7B 1FDPA 4ABGA 3U9AH 2EI8A 1EB2A 3QUMP 3L33A 1V2KT 1V2VT 4D9QA 2PSXA 3SOSA 4JMYA 3RC6A 3E3TA 1MKXK 2WPKS 1WU1A 1ELEE 3RXTA 3Q00A 4I32A 4GCHG 1Y3VA 1PPGE 1UO6A 3URCA 1K28D 3F9GA 5LGOA 4X2XA 1DPOA 2G4UA 2M5TA 2XWAA 1C9TA 3A86A 3U8OH 2R2WU 2SGPE 1O2ZA 4I8JA 1DS2E 5CHAC 1O5GH 3Q3YA 3V0XA 1SC8U 2OC7A 1SMFE 4D9RA 5DPAA 1FY5A 5PTPA 1ZPZA 2F9UA 5T3HA 1UK2A 3DD2H 2CHAB 5EXNA 4NZQA 2VWNA 3MNSA 1MKWH 2OLGA 5GIBA 3SJ8A 3UQOA 5HMAA 1YF4A 2GGVB 1TPSA 1BRUP 4IMZA 1KTSB 1DSTA 1P2JA 1HB0B 3OTJE 4E06H 4JZ1A 2OQUA 4B76A 4H4FA 3PLKA 2W26A 1SLWB 5J4QA 4AFQA 1TQ0B 5JBAS 1TALA 1XUGA 3E16B 4DW2U 1FAKH 1S6FA 3A8BA 3BSQA 5FBEA 5GWZA 2R0LA 3NWUA 1ELDE 5I46H 1ID5H 4K1EA 3M5LA 1NPMA 1PPZA 1ZRBA 4H6SB 1AB9C 1RS0A 2FTMA 3A87A 5GXPA 1YPMH 4FU7A 1C5SA 1AQ7A 1ZSLA 5DO4H 1NM6A 1CA0C 2J2UA 1A0JA 1O3PB 1K21H 3TU7H 2NU2E 1YYY1 2GD4B 1TNKA 4X1SU 1TA6A 1O3KA 2OBQA 3RXRA 3A80A 1W7GH 4IN2A 1RXPA 3SJOA 1H1BA 2BXUH 1HPGA 1OWDA 2FLRH 1QJ1B 1LHFH 2DE8A 3H7TA 1EZXC 1T32A 1ETTH 4K3JA 3PYHA 1GI5A 4WWYA 4YESB 1Y59T 1DDJA 3TJVA 2PUXB 2B7DH 4MLFB 3EA7A 2F9PA 3F9HA 3ODDA 1TFXA 2BHGA 2QXJA 1QTFA 2VGCB 3MO3A 1THSH 4I8GA 1N6YA 2FOFA 2FYQA 1HUTH 3DA9B 5DG6A 1ZOMA 5I25A 5AHGH 3E90B 2BY9X 3S9BA 4K1SA 4CBNA 2H9TH 1LKAA 2FZZA 3O8RA 1BITA 1QBOA 2G4TA 5GPIB 3RXPA 2PGBB 1MZAA 3QWCH 2HVXA 1ETRH 4YT6H 3M7QA 3W94A 3HPTB 1UTMA 3K6ZA 1DICA 5FXLA 1OX1A 1UK3A 3PTNA 3KGPA 4MQAA 1ZTKA 2ZWLH 1SGEE 2FS8A 4Q80A 1G3BA 1HXEH 4NIVA 3BV9B 4X6MA 2WINI 3GY2A 1CT2E 1CA8B 4XSKU 4Y8ZA 4ISHH 3QX5H 2Z7FE 3TGIE 2DUCA 2OTVA 2WPJS 2HPPH 2AEIH 2ALPA 1CVWH 5EQQA 1L4DA 1SHYA 1O34A 4LK4A 2Z3DA 2A32A 1QFKH 2DE9A 3H5CB 2ZTYA 1HAZB 1KXCA 2NWNA 1GBLA 1Y8TA 3RU4E 1O2YA 4B75A 1A5IA 2ANWA 2WUCA 5AFZH 1KIGH 2ZECA 3UNQA 2K1QA 2OXSA 3SV2H 2SNWA 2HRVA 1O3AA 1PPFE 5C5OA 2JETB 1TRYA 4MNXA 1K22H 1W14U 1ZGVA 2ZU3A 1O5EH 1A1RA 4BAHB 1UTKA 1SB1H 3SUGA 4NA7A 3DFLA 1V2WT 1XX9A 1O2IA 1QJ7B 1MUEB 5H4IB 1FUJA 2ZDVH 4WMDA 3SU2A 3TJUA 1VJAU 3SV9A 1ABIH 3SJ9A 4DJZB 1N1LA 2ZHDA 3KN2A 2OP9A 1YLCA 3ENSB 2QY0B 4FUGA 4D76A 3RXEA 1TMUH 1A61H 3HKIB 1LVBA 1NY22 2V3OH 3BF6H 3UOPA 2AMQA 2RG3A 1QCPA 1PPCE 1SLVB 1DWBH 3P8GA 4HGCA 3HK6B 4ZMAH 2F91A 1EZSC 2D8WA 3BTHE 3TNSA 1QL8A 3ZZ9A 1AMHA 1GBKA 3NCLA 1NC6A 4I8KA 1YPHC 2ZF0H 1TYNA 4AFUA 4TWWA 1K1IA 2ZDMA 1TNJA 5GCHF 2EA3A 1PQ5A 3T26A 1UCYE 7GCHG 3V3MA 1HAYB 4Y8YA 4DOQA 1PFXC 1SPJA 2F9BH 2CF8H 1VJ9U 2Y7XA 1O32A 1UTLM 3M3SA 2VH6A 1P8VC 1JRSA 3PTBA 2WPIS 1D9IA 3S7KB 4IN1A 3A8DA 1D6RA 1RJXB 3UFAA 1FXYA 3PMAB 4I7YH 1MAYA 1P09A 1O3JA 3O8DA 3ATMA 1SGYE 1HAHH 5L2ZH 2GV6A 2BLWA 4CHAB 1B0FA 5E2OA 1P2QA 3BTGE 1GI1A 3LOXA 4UD9H 2JH5D 3DT0H 1EZUC 5C5NA 1TLDA 3EAJA 2P8OB 1PQAA 5JB9S 2BYAX 2A45B 2XBVA 1TOMH 1C1UH 6GCHG 2A4RA 4ZROA 5JB8S 3U69H 1FPHH 3UIRA 1YP9A 1SGCA 1Z7KA 1O5CB 5E8EH 3LC3A 1C5OH 1HCGA 1O2PA 5F8ZA 4IW4E 1AN1E 2ZU4A 1IQNA 1TBQH