2BLOA

Elastase before a high dose x-ray "burn"
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bloA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bloA01
2GCHF 2WUCA 3LGTA 5I25A 5DP7A 2G51A 1ELCA 5FBIA 1KTSB 2B7DH 2BDCA 3T28A 4ZKNU 1ESTA 5A0BA 3EE0B 1ZPBA 1HAHH 1SC8U 1DY8A 2Y81A 1O3JA 3ZVCA 3PB1E 1J17T 1XUHA 2WPLS 2FWWA 2A4GA 1LPGB 3GCNA 1RIWB 2I6QA 1C5TA 3UWIA 1JXPA 1KLIH 1V2MT 1PPEE 3RLYH 3LC3A 3UPEA 4LZ1H 1GHBG 4B73A 1FXYA 2OBQA 1TNIA 4HI3A 1O2KA 2IPHA 3WY8A 4BTIB 4YOGA 1B5GH 1SGDE 4IC6A 3KQEA 4TY6A 1IQLA 1OWIA 1ELBA 1C1VH 5CHAC 3B8JA 3P8NA 1NFXA 3VXEH 3E90B 4FUEA 2RDLA 5AFZH 4KTSA 2WINI 2FOAA 2D2DA 4UD9H 4OGXA 2FMJA 1ELAA 1CA0C 1TQ0B 3E0NB 2FS8A 4YLQH 1G3DA 1SL3A 1C1SA 2FOCA 1J9CH 1S83A 2J38A 4B2BA 1C2MA 4NWLA 3SI3H 3UREA 1IQKA 2KAIB 1ARBA 1L1NA 2Q6FA 3ZZ7A 3TNTA 1ETSH 3BTFE 2FS9A 4LXBH 3S9BA 2R3YA 2A2QH 4K8BA 1NROH 3ZV9A 3CS7A 1AFQC 3TK5A 5EXLA 4X2VA 9ESTA 2F83A 4E05H 1NPMA 4K1EA 3RU4E 1SHHB 2JH0D 4E7RG 3ATMA 1KXDA 1AVGH 1GI5A 2OP9A 4WVPE 4INLA 4ABBA 1TPSA 2GCTC 3GYMA 2BDAA 1DT2A 4CBOA 1CA8B 1KLJH 3D23A 3M7QA 3AASA 3SNAA 3QTOH 4ABEA 4BTTB 1RJXB 3IWMA 1T31A 2SGDE 2THFB 3RUOA 3A7YA 4XFQA 3UIRA 8GCHF 1EPTB 4K5ZA 3RXKA 1ABJH 2TGTA 1UJ1A 5GJ4B 3LKWA 1NM6A 1V2UT 2ZKSA 2QY0B 4CRDA 3GOVB 3DD2H 1AI8H 5F8TA 3SNEA 2ZHFH 2G52A 1QURH 4NFEA 2P95A 4F4OC 5HGGA 2SNWA 2XRCA 2C3SA 3ZZ5A 4D9QA 4YM9A 1O38A 1P57B 2A5IA 1LHCH 2GV7A 1LHGH 3ZZAA 2GT8A 3GY3A 3M5NA 1Y3YA 3SU2A 4NA8A 3M7UA 3VGCB 1ZYOA 3BV9B 1TPPA 1QL9A 1W7GH 4AOQA 2NU4E 4BTUB 2HPQH 3LGVA 3P8FA 2OUAA 2R3UA 1UTMA 1LO6A 2UWOA 2A0QB 3EA9A 1UVTH 5DP3A 1B0FA 1JOUB 1A61H 3LONA 3Q77A 1LTOA 2Z9KA 2CHAB 3DUXH 4JZFH 2A31A 4AFQA 2FOFA 1BTWA 1FDPA 1GBIA 1Q31A 3GISB 4O03A 3T5FH 4ISLA 1BTXA 2PFEA 1F5LA 2OXSA 1TOCB 3V7TA 1PQAA 2VWMA 1UTOA 4I8HA 2ODYB 1RTKA 1BRAA 1O33A 3RC4A 4WWYA 3S7HB 1JIMA 2AFQB 1P05A 1BBRK 3GY7A 1S6FA 1DANH 2QF0A 3A80A 2WPHS 3KGPA 1HAXB 4ISNA 5ESTE 1GVLA 1UTJA 3UNQA 1GDQA 1F0TA 5K7RA 4CRFA 3AW0A 4QT8C 5C5OA 3RXQA 3LGIA 2GMTB 3R0FA 1UVPA 2BY6X 2Y5HA 4FUDA 4Y79A 3VFEA 3UNRA 1G2MA 1MTVA 1TNGA 5JB9S 1DFPA 1TAWA 1YGCH 1WYKA 1O3DA 3SNCA 3U1IB 3FAOA 2F9VA 5LPRA 4A5TS 1SGFA 4UE7H 1BOQA 1NO9H 2A32A 3CS0A 1MZDA 3RU4D 1VJ9U 1TPAE 1F0RA 1GCDA 5T3HA 2VWNA 3SU4A 3BSQA 3RXFA 4HTCH 4RN6A 1V2WT 4AGJA 1C1TA 3PWCA 4ABAA 2XBVA 1ARCA 1IQFA 4O3TA 1NC6A 4ESTE 1SG8B 4NCYA 1P9SA 1TA6A 1AWFH 2J94A 4ABDA 5C1UA 3E3TA 1MZAA 1ZHPA 1QR3E 1O5BB 3PTBA 1F92A 1TA2A 4NIWA 1UHBA 4GLYA 5T6DA 1UO6A 1HAGE 1LKAA 1PQ5A 1C5ZB 3LGWA 3NUMA 4Y8XA 1LQEA 2Z3EA 4NA7A 1RXPA 1DWDH 4FXGH 1O34A 1VCWA 1GHAF 1QBOA 4Z6AH 1HAOH 3M7TA 5C5NA 4ABGA 1DSTA 1BTHH 3RDZA 2R0KA 3F6UH 2ZTYA 2H5DA 3I29A 1K1JA 1Z8GA 4MNYA 2JKHA 3MYWA 1F5KU 1TE0A 4Y10E 1O2LA 3V3MA 1NFUA 2O8WA 1C1QA 4AYVB 3LC5A 2PSYA 3A88A 1IQJA 1G2LA 4ZHMU 3OY5U 1Y5AT 1UTKA 1YPLH 2Z7FE 5C2ZA 4INKA 1YPKH 1E36B 2Y7XA 1C5SA 1WTGH 3ZVAA 2ZECA 1KY9A 2WPIS 4X0WU 2C8WB 4BAHB 4VGCC 2R2WU 1CE5A 1O2XA 5FBEA 3PLKA 2V35A 4TPYA 1ABIH 5DJ7A 1GI2A 2GDEH 4ZXYH 1NFYA 3S7KB 1MU6B 4X6MA 1TQ7B 1RFNA 2V3HH 4UFFH 1EAIA 4XBCA 2CGAA 1QGFA 1FONA 4WXIA 1T4UH 3U8RH 3A8CA 5FPSA 1GJ5H 3E16B 1XUFA 3BTKE 3M3TA 3OYPA 3RMLH 3EGKH 4I31A 4X8UH 2OQ5A 1DXPA 1OWHA 2FI5E 2ZHDA 1WAYB 2BTCE 4FVBA 4X8VH 2STBE 1TFXA 2VGCC 1SQAA 2CF8H 2OCVB 1EJNA 1S85A 1GL1A 1Z71A 1MKXK 1BBRH 1NRNH 2WPKS 1LMWB 3SU6A 1CQQA 5I46H 4NIVA 5HXFA 1W13U 1GBKA 4O3UA 2ZU3A 1VJAU 3P6ZB 5EOKA 4JK6A 3SU1A 4JYVH 5L2YH 1NN6A 5EQRA 4IW4E 3ZZDA 3VPKA 4MVNA 1H9IE 4U30A 3RXSA 4YT7H 1XXFA 5T6FA 2Q6DA 2OC1A 1A1RA 4O9VA 4BAOB 3LGYA 2ZGJA 2LNCA 2GDDA 2V6NA 2BX3A 2ULLA 2BD9A 1GMDF 1P10A 2Z9JA 1Y8TA 1O36A 2G4TA 1UHBB 1YLDA 3NKKA 2FO9A 3ZYEA 1Q3XA 1P01A 1GGDB 1Y3VA 4AB8A 7ESTE 3P8GA 1ZSJA 3RMOH 4DG4A 1AE5A 1GPZA 4BXSA 1SGQE 3IG6B 5ABWA 3E0PB 3GCHB 5DK1A 2AMQA 1W12U 2XCNA 3ZZ3A 3EAJA 3M3VA 2RCEA 3RXIA 1NRSH 2D1JA 2J95A 1HYLA 1O5AB 1K1OA 2GZ8A 3C1KA 4X1SU 3PMAB 3S9AA 1UCYK 2XBWA 2QF3A 1GHWH 1TNJA 3NWUA 1MTSA 6CHAB 3M3SA 1TOMH 1Z1IA 5DG6A 4X8SH 3BIUH 5FCKA 4J1YA 4X6NA 1RRKA 3LU9B 3UY9A 2BYAX 1MUEB 1GCTC 1FAKH 4AGKA 2HLCA 2PWXA 3K9XB 1EZXC 1LVMA 1BMNH 4NGAH 1PQ8A 1C2KA 4B2AA 1D3PB 4ZROA 5EPNA 1QB9A 4H6SB 1HPGA 2RG3A 3A83A 3V13A 1HRTH 3H7TA 2ZFQH 1W2KH 2G5NA 2W5EA 8ESTE 3S0NA 3P92A 2WPMS 2GX4A 3ODDA 1MAYA 2Q1JA 3E1XB 4ABHA 1GI9B 1C5NH 1BJUA 1RGQA 5GCHF 1O3LA 2HNTE 1O30A 1DOJA 1CVWH 3SUEA 1ACBE 2BDGA 4YESB 1W3CA 2HALA 2IN2A 3D62A 1O3EA 4DCDA 2VH6A 2BVXH 1BRBE 1D6RA 1GJ9B 2F9NA 3SORA 1OWKA 3BTQE 5SGAE 4MPVA 3KNXA 5FPYA 1THSH 1QQ4A 1BHXF 2BD2A 3PO1C 8KME2 5EQQA 1YYY1 5EXNA 1C5QA 1PPHE 1DY9A 1S6HA 2JETC 3RXBA 4TYDA 2ZFPH 2FOBA 1TB6H 1KXCA 2TBSA 1GJDB 1G37A 1DWCH 3MO3A 3RC6A 1EZQA 4I8LA 4PROA 2BD7A 3M35A 5DP6A 4DIIH 1A0JA 2BM2A 3QO6A 3BG4C 1XM1A 5A8YA 1CHOG 3SJIA 4ZKSU 1P2QA 1G3BA 1SOZA 2P8OC 4CHAC 1BQYA 2QYIA 2ZA5A 3L3TA 3TJOA 4X2WA 4WH6A 4ZKRU 2ODQA 5GXPA 4AB9A 1FV9A 4FUJA 2YNBA 2A45B 1ZJKA 1GHYH 3UTUH 3T62A 2EI8A 4GCHF 1EX3A 4H42U 1SSXA 3RXRA 3DFLA 1GHAG 1VZQH 3M37A 3OY6U 4XOJA 1ZMJA 1QY6A 2AGEX 2H1UA 1P8VC 3SU3A 1DUAA 3QGJA 4ZHLU 3TJNA 1GI4A 1SLUB 1GHVH 2FI4E 2BVSH 2IOTA 2VWOA 3RXJA 4J2YB 1MD7A 1H9LB 1OKXA 4R0IA 2Q6GA 2J92A 1BRUP 2CV3A 3SNBA 4XBBA 1AGJA 1TBZH 1P3CA 1B0EA 1PPGE 2BLWA 3U98H 5EODA 3Q00A 1W11U 2FOHA 3FFGA 1NY22 2FZZA 3NPSA 2VIOA 1GI6A 1G9IE 3A82A 5F8XA 3D49H 1UCYH 1CT0E 5L2ZH 1MBQA 3Q3XA 1GJ6A 3SV7A 3UR9A 1IHTH 1S0QA 5JDUB 1KXFA 2HOBA 3BTDE 1YPHC 4K2YA 1EASA 3MH7A 4I7YH 3M36A 3MU8A 1QQUA 3TGKE 3SU0A 1QRXA 2YNAA 3SV8A 3T27A 1S82A 1EAWA 1EUFA 1T4VH 4IBLH 2FXRA 2ZPRA 1H1BA 4BOHA 1C5OH 1XUGA 3VB4A 1SLVB 1F7ZA 1ZR0A 3BEIB 2OINA 3KHVA 1G3EA 4Q80A 5FCRA 2FOMB 2ZGXH 1BTYA 3DA9B 1CHGA 3ATIA 1QRWA 1TX6A 2ZU1A 1OS8A 1GBFA 5E0HA 4MNXA 2DE9A 2O8UA 1OP8A 4JYTA 4U32A 5L6NH 3E8LA 1P06A 1O39A 2ZG0H 1SFQB 1SGNE 1C1WH 1CT2E 1ELFA 1FJSA 3ZV8A 1A4WH 1LVOA 1DXWA 1BITA 4AYYB 5DO4H 3SHAH 1MD8A 2SGFE 2FOEA 1WCZA 2C8YB 2WPJS 1BHXB 1HAZB 2VVUA 2I6SA 4ABIA 3MH6A 4A1XA 4GSOA 2VINA 3GY5A 1GMDG 4INHA 2C8XB 3TH2H 3ZVFA 1DITH 1P09A 3F9HA 3KL6A 2SGAA 4MG3A 1MQ6A 4Y0YE 4UDWH 1ESBA 1KXBA 2BX4A 2OTVA 4MNWA 3LJOA 1C5YB 1O3PB 1TWXB 1MTUA 2OLGA 1OX1A 1Q2WA 1SLXB 1C4Y2 2SNVA 2W26A 5HMAA 3K2UA 5JBAS 1JRSA 5IDKA 5L30H 1V6DA 2BQWB 3RU4T 1Y3UA 1AUTC 5H4IB 1GMHF 2W3IA 4BNRA 1N8OC 1QBVH 1AZ8A 2J9NA 1KIGH 4I8KA 1IHSH 2P94A 4GHQA 2RA0A 2GGVB 1IAUA 1HJ9A 2FYQA 4GPGA 2GKVE 4GUXA 1TBRH 1RIWC 3UR6A 2W7UA 4WXVA 2ZPSA 1FPCH 1A5IA 1N1LA 2BDYA 1AE8H 1T8NA 1CU1A 3MO9A 3MFJA 1D9IA 1P2OA 5K0HA 3GCTF 2NU0E 2FOGA 1DE7H 1TGTA 2BLVA 1AY6H 1CBWB 1A0HB 4HFPB 4YZUA 1ELDE 1DS2E 3EA7A 1BB0B 2BD4A 1O2RA 1DLKB 3MU4A 3ZVBA 2ZCLP 5JBBS 4WMDA 1P12E 1GWAA 2C8ZB 5JBCS 2H2ZA 1SGEE 1DUEA 2ZGCA 3IITA 3S9CA 4BAMB 1EATA 1DM4B 4NZLA 4XSKU 5GDSH 4CH2B 1NRQH 4NFFA 4CBNA 2PR3A 1F5RA 2UUKB 1C5RA 1YM0A 4JZIA 3AAVA 2VH0A 3SBKA 2ZWLH 1HGTH 4OS7A 1GI0A 1ZMLA 1BMMH 4A1VA 4YT6H 1O2YA 5DP4A 1MCVA 2GT7A 1FZZA 1EZUC 2O8TA 3ESTA 1ZOMA 1MMJN 5LPFA 2D26C 1A5HA 1ZMNA 1YPGH 1IQIA 1YF4A 4SGBE 1C1MA 1EJAA 2TPIZ 2XCFA 1C5VA 5A8ZA 1HAYB 1GHXH 4I33A 3L6PA 3QGNB 1P2MA 1QIXB 1C4U2 1C9TA 1SLWB 1BMAA 3HK3B 4Y76A 5ESBA 4CR9A 5HM9A 1AKSA 3ZYDA 4JCNA 3SUGA 2Z3DA 5AHGH 3SO3A 2JH6D 2ZQ2A 4MPUA 1DX5M 1ZPCA 1EPTC 2VIPA 5EW1H 2QN5T 4D76A 3KIDU 3ITIA 2ZFSA 4CRCA 4VGCB 1TMTH 2C4FH 3L33A 2FDAA 4FUFA 1ETTH 2HNTF 3PMBB 5DGJA 1TGCA 1EXFA 4WY3A 3A7ZA 1BDAA 1FY1A 3RP2A 1G36A 2AGIX 1NTPA 1O5FH 1L4ZA 1V2PT 1XUJA 5AVDA 3VB3A 2TGAA 1BUIA 1AFEH 1M9UA 3RXUA 4GAWA 3HK6B 2GTBA 2FX4A 1Y3WA 2UUFB 1YKTA 2H5CA 3MU0A 2W7SA 4Y11E 1OPHB 3FZZA 1V2RT 1XXDA 3ZZ4A 2CF9H 2PKSB 3VGCC 1S0RA 2O8MA 3C27B 2PGQB 2FODA 4UFGH 1TGBA 1QRZA 2OD3B 1T8LA 1PPCE 2R0LA 1Y5UT 3MU5A 1GVZA 3A81A 2GCHG 2CHAC 1BCUH 3LH1A 1ELVA 3ATLA 5JBTA 5JPMH 2ANYA 5DPAA 4FU9A 3H7OA 3MMGA 2G5VA 1A46H 1F0SA 1O5GH 3SGAE 3DFJA 1NFWA 3RXVA 2OC7A 1V2QT 1ANBA 1WOFA 1FIZA 3KEEA 1O3BA 1Z7KA 2O9QA 2A4QA 1Z1JA 1WQVH 4LK4A 5AF9H 3AVZA 2ZNKH 1SGCA 1P02A 1HJ8A 1OYQA 2ODPA 1C5UA 1EQ9A 2GMTC 1SGTA 4X2YA 1A7SA 3KCGH 1HIAA 2PV9B 4KKDA 3ELAH 1CO7E 2BY8X 3KQDA 4OS2A 1TRYA 1F2SE 5A2MH 3SV6A 1SBWA 3BG8A 2PKAA 1O5DH 4AN7A 1O2HA 2ALVA 4BAQB 2FLBH 3URCA 1CGJE 3NCLA 2F3CE 4KTCA 2TRMA 3PLBA 4CREA 5CE1A 1ESAA 3VEQB 2ZDLA 1HFDA 1Y59T 3SHCH 1D3TB 1AUJA 1T8MA 3BEUA 4Y8ZA 4DIHH 3BEFB 1A3BH 5C3NA 2XBYA 5HM2A 2FPZA 2XNIA 4FU8A 3B23B 4FUCA 3U69H 3TGIE 3W95A 1GDNA 2SGQE 1GHBF 1CGIE 1TMBH 1VGCB 1YPEH 2PLXA 1BMLA 1P04A 2G81E 4BANB 1LHEH 1ELGA 2XWAA 1OOKB 1TONA 1TRMA 1RD3B 1MQ5A 5F03A 1UVUH 1DPOA 1BTUA 3RXPA 1HAPH 1GG6C 1UTNA 1QB1A 3D65E 1SHYA 2BMGB 2EI6A 3FZDA 2HVXA 1S5SA 1GBJA 2ZPQA 1C2GA 1O3HA 4FVDA 4Q2KA 2GD4B 3NK8A 4H6TA 1AVXA 1GMHG 4A1TA 4JYUH 1ANEA 1Z6JH 3SV2H 1BT7A 5A0AE 2ZIQH 3SZNA 8GCHG 1THRH 2VJ1A 2G00A 1AZZA 5IYTA 2ZP0H 1HNEE 4LZ4B 1O3MA 3RXTA 4MDSA 2XC4A 1SGIB 1GBMA 1FY3A 3BN9A 3ENSB 2B9LA 3HKIB 3GDUA 1O2MA 4WH8A 1Z8RA 3EDXB 2VWLA 3RC5A 1BZXE 1CGHA 3PO1B 7KMEH 3GCTG 1PJPA 2JETB 1O2SA 4AFZA 2ZQ1A 3O8BA 4HGCA 3UFAA 1OWDA 1E0FD 2SGPE 3A8DA 5E2PA 3HGNA 1C1NA 3F9FA 5JYIA 1MH0A 1XX9A 1MKWK 2R9PA 1E37B 4X6OA 4LOYH 3CENA 1O2UA 3T2NA 1LHDH 3B9FH 1TMUH 2XW9A 5B6OA 5BPEA 3LIWA 1IOEA 1DICA 1W8BH 5FX6A 4CHAB 1ETRH 1GBHA 1HXFH 2B8OH 4K1SA 4A6LA 3VB7A 1GJAB 1FAXA 5J4QA 1PYTC 1W0ZU 3SJ9A 4Y8YA 5CMXH 1KDQA 2ZFFH 1SQOA 2PTCE 2F9OA 4CRAA 1SR5C 2QXIA 1HIAB 2BOHB 4UFEH 1D3QB 2WUBA 3TK9A 3S69A 1FN8A 1E38B 2VNTA 2XXLA 4I8JA 1OXGA 3U8TH 2Z9IA 3T25A 1LCYA 1WBGB 2J2UA 3LDXH 2PKAB 3F9EA 2A7JA 3LJJA 4ABJA 1SGFG 3RXLA 2AIQA 4RKJB 3A87A 1ELEE 3RM2H 3M5MA 3A7TA 2NU2E 2A1DB 2H9EH 3RXEA 4KGAA 2ZDMA 1O2WA 3UOPA 7GCHF 2A2XH 2ILNA 6LPRA 3UUZA 4Y7BA 5FX5A 2XTTB 4IMQA 1C4V2 1DSUA 1O32A 3SGQE 2UWPA 1GDUA 1ZGIA 3KN2A 3LOXA 3GCHC 1WU1A 1GJ7B 4ZHAA 3QZQA 3PV4A 3ZZ6A 1FY4A 1P2NA 3ZZ8A 1QL8A 2O8LA 3ZZCA 3HKJB 2ZHWH 3F1SB 1QA0A 4JZ1A 1MKXH 2ANMH 2ZU5A 1ORFA 2F9PA 1AQ7A 6CHAC 3H5CB 5EQSA 2FESH 1A2CH 3JZ1B 2B5TB 2HPPH 4IN1A 2UUJB 2FIRH 2HWLB 4IGDA 2H6MA 2AEIH 2BHGA 1C2LA 2Z94A 1TNKA 3GY2A 5CHAB 2V3OH 1GJCB 3K65B 2BDHA 1K22H 3P70B 4CRBA 1W14U 2GV6A 3URDA 1CA0B 2WYGA 2Y82A 4DW2U 1C5MD 1GBTA 4ABFA 4D9RA 1H4WA 4FUGA 2R2MB 2AS9A 1TNHA 1KXEA 1UTPA 4ISIH 3EYDA 1Z8JB 4NIYA 3MO6A 4WMEA 3MTYA 3ZZ9A 1TGNA 1O2NA 3M5OA 4FU7A 1RTFB 2RA3A 1O5CB 2ZU2A 1SGRE 4ZMAH 4D7FA 1PYTD 1FLEE 1FPHH 2FI3E 2QV1A 1EPTA 2EC9H 1GI3A 1SVPA 1FN6A 1AFQB 3QUMP 4THNH 1L1GA 1YPHE 5T6GA 1FIWA 4YOIA 4JZEH 3QDZB 2A4RA 1NRPH 9LPRA 1ZTLA 2PHBA 1VR1H 1RTLA 3SJKA 1MKWH 1HXEH 1OWEA 1LHFH 2ZCKP 1BJVA 1O37A 2GCTB 3FVFB 3RXOA 5E8EH 3FP6E 1JIRA 1MTNC 4KP0A 2TGPZ 2QAAA 3JZ2B 3A8AA 4A92A 1K1PA 2G4UA 2BLQA 1ID5H 4IS5A 3SUFA 3GDVA 4X8TH 1TALA 5EPYA 1N8OB 1T32A 1EJMA 1ZJDA 3A89A 4R8TB 3UQVA 1L0ZA 3U8OH 4Q7XA 2QXHA 2ZTZA 3ZVGA 2FTMA 3DHKH 4D8NA 3VB6A 3NXPA 1HJAC 3FANA 1UMAH 3QX5H 3Q3YA 2UWLA 4ZKOU 4X1NU 2XC0A 3SQEE 2EA3A 3A84A 2BB4A 3MNBA 5TCCA 1EKBB 3SOSA 1DLEA 3RMNH 1QB6A 1GBAA 3I77A 1TABE 1MU8B 1Y5BT 3PYHA 1Z6EA 2A5KA 2AH4X 1PPZA 2BY5X 4ZH8A 4D7GA 2OC0A 2XYAA 3QN7A 1NZQH 1W10U 1AB9C 1OWJA 2FEQH 4Y7AA 2PUXB 4F49A 1AHTH 5DP9A 1YP9A 2Y6TA 4XE4A 2P3UB 3KQCA 4B1TA 1EZSC 4NA9H 2ASUB 4Y0ZE 2FM2A 1HDTH 1H8DH 1SI5H 1HUTH 4TPIZ 2A7CA 1FY8E 1H8IH 2ZI2H 2ZDNA 2P3TB 3OX7U 4MNVA 5EXMA 1JBUH 1D6WA 3PWBA 1KSNA 2ANKH 6GCHF 1NRRH 4NSYA 4TWWA 5LH8A 1QJ1B 3BTME 2EI7A 3U1JB 2Y5FA 1INCA 2PTNA 2P59A 1HBTH 2C93B 3Q3KA 1A0LA 3KQBA 1V2TT 4MPXA 3RXMA 1HAIH 2ZFRH 3TIUA 3PMHB 3T29A 1IQMA 2WV5A 2Y7ZA 4I8GA 5C1XA 2BD5A 4XBDA 4DY7B 1ZHMA 1AN1E 1NESE 1Z8IB 3RXDA 3UWJH 2AMDA 4XDEA 3KF2A 5F6MA 4B71A 1O2ZA 4YLUA 1C2JA 1O3FA 3UQOA 1XVOA 4NWKA 1SQTA 2PUQH 3STJA 3LT3A 1YCPM 5C67A 4BAKB 3W94A 1XMNB 1P03A 1V2KT 2D8WA 1C5LH 1IQEA 4KELA 4OS4A 1SPJA 1QL7A 1QNJA 1ZRBA 2ZTXA 3RXAA 2AERH 5C1YA 2J34A 3P95A 4JK5A 1QHRB 1AVWA 1IQHA 2BDBA 1OP2A 1OSSA 4HZHA 2A4OA 4UFDH 5GIBA 3U9AH 1C1OA 2CJIA 1O2IA 4AFSA 5E2OA 1ZRKA 3TK6A 2HGTH 3GY4A 5GCHG 1HAVA 1ZSKA 1MAXA 1K21H 4DURA 1GBBA 1ANCA 1AIXH 1AD8H 1TRNA 1GHZA 1JRTA 2JH5D 2QIQA 3BTGE 4U01A 1THPB 1GMCF 2ZGBH 3SQHE 4KTUA 3O8RA 1XKBC 1O2TA 4Z0KA 1K1IA 5JB8S 1KXAA 4UEHH 3K6YA 7GCHG 1VITF 3RLWH 1A3EH 1OYTH 1MBMA 2ANWA 3I78A 3MNXA 1V2OT 2BXTH 1LKBA 1EOLA 2Y5GA 4A7IB 1C2DA 2ZDVH 2VIWA 4ASHA 4CRGA 1TYNA 1V2ST 1WTHD 3UOUA 1TIOA 4X1RU 4X6PA 1BBRE 3F68H 2BDIA 2LPRA 3BF6H 4OGYA 3MWIU 3VXFH 1P0SH 3F9GA 1C2HA 3STIA 2STAE 1N6YA 2H9HA 3RXCA 2ZFTA 4FUIA 2M5TA 4JMYA 4NIXA 1UTLM 1QA7A 1FMGA 4B76A 3GCOA 2ESTE 3LGUA 3TU7H 5FXLA 4MTBA 3GY8A 2PSXA 2Z9GA 3BTTE 3EA8A 4DJZB 2FX6A 4DVAU 3MH5A 1NS3A 1A5GH 1AU8A 4GCHG 4E06H 3P17H 2C90B 3A86A 4SGAE 1TGSZ 4GVUA 5A8XA 2TGDA 2WV4A 2ZC9H 4Y71A 1CBWC 1BIOA 1NU7B 4AG2A 1K2I1 1MTWA 1J16A 1AO5A 3FP8E 4X2XA 2HRVA 2AGGX 5EGMA 5LGOA 2OC8A 1DWEH 4YOJA 1CHOF 3UNSA 1YPJH 4OS1A 4WF8A 5ETXA 3A8BA 4K3JA 1K28D 3PROA 1C9PA 1D4PB 1J15A 3NZIA 4MPWA 1EB1H 3TH4H 2VGCB 2ZU4A 2IJOB 5FAHA 1TPOA 1BTZA 1SOTA 3MI4A 3QLPH 2CN0H 2F91A 1K9OE 2VIDA 1QJ7B 4WJG2 1GL0E 1O3AA 2A7HA 1CSOE 1QJ6B 1MCTA 1SGYE 3P8OA 2F9BH 1P2IA 2DUCA 4ZAEA 1TX8A 2SFAA 4X1QU 1GG6B 3GY6A 4H4FA 3QWCH 3G01A 4AX9H 1SFIA 2CMYA 4JZDH 1HAVB 1LDTT 1EP5A 1C5PA 1P3EA 1AMHA 1GI8B 2P93A 1H9HE 1LPZB 1UK3A 4Q7YA 1O5EH 5A0CA 4YO9A 4NG9H 1W7XH 4ISHH 3R3GB 1T7CA 2B0FA 1GBCA 1OP0A 1O2GH 5AFYH 2K1QA 2BY7X 2FLRH 1IQNA 1K1LA 2QXJA 1UTQA 1D3DB 1HLTH 1XUKA 1ANDA 5FPTA 3RM0H 1PPFE 4M7GA 2OBOA 3SU5A 3SV9A 4WMFA 1YPMH 4Y6DA 2J4IA 3TH3H 1QBNA 1V2NT 3SW2B 2YOLA 1PQ7A 1UK4A 2QGRA 3MU1A 4X1PU 1LVBA 1DWBH 1ZGVA 4K69A 1AKSB 2BD3A 4DGJA 1TBQH 4Q7ZA 5EU8A 1O3KA 3TLOA 1JMOH 5DP8A 1EOJA 1YCPK 2QXGA 1G32B 4RKOB 1GCTB 1O3IA 3TNSA 2VVVA 1IQGA 4OS6A 4K1TA 4O97A 1O3NA 4AFUA 2OQUA 2BY9X 4U2WA 2PKSC 1ZTKA 4GHTA 4DT7B 2ZEBA 1TLDA 3M5LA 3A7XA 1O3GA 2NWNA 3BTEE 4UONA 1L4DA 1WUNH 1C2FA 3MH4A 2DE8A 3A7WA 6GCHG 4AG1A 1EAXA 2NU3E 2VB0A 1BRCE 4IC5A 1CT4E 1NT1A 1GI1A 2BQ7B 1ZSLA 3DT0H 3SJ8A 4CR5A 3TJVA 3SUDA 1EB2A 1ZPZA 1V2LT 5HYOA 3TGJE 5EW2H 4ISOA 3TPIZ 2BD8A 3PMJA 3ODFA 2QA9E 2FTLE 3LPRA 3ATKA 1C1RA 1GJ8B 2QC2A 4RSPA 1YC0A 5F8ZA 5EG4A 2ZO3H 1V3XA 1S84A 1V2VT 4I32A 2ALPA 1G3CA 4IMZA 3GDSA 1WQSA 3O8CA 1HB0B 3PLPA 1FUJA 1XKAC 1P9UA 1BA8B 2Z9LA 3SN8A 1BTPA 5G4BA 3EQ0H 2BQ6B 1L2EA 3N7OA 1O2QA 1UCYE 2Z3CA 1ZLRA 4AORA 5DKMA 3SJOA 1O2JA 4MLFB 3BG4B 3MOCA 3V0XA 1VCQA 2CXVA 3QTVH 2GVFA 2H9TH 5PTPA 1O35A 1LPKB 3V12A 2Y80A 1C2IA 3AW1A 4YTAA 2P8OB 5J4SA 3CP7A 5GWZA 5C20A 3T26A 2PW8H 2FYRA 1K1NA 1LQDB 2V0BA 1C1PA 2PGBB 1GMCG 4MQAA 2AYWA 3Q76A 1YLCA 1P2KA 3FP7E 1SB1H 5E0GA 1AWHB 1FY5A 1VGCC 2BZ6H 3BTHE 1K1MA 1O2VA 1VITG 4CH8B 3BIVH 1VCPA 1GI7B 2W3KA 2G8TA 1EAUA 1ZHRA 2XWBI 1PFXC 1Y3XA 2AIPA 1F0UA 2BVRH 1GVKB 1C2EA 1C5XB 2VIVA 3SGBE 1ZZZA 2P16A 2ZCHP 5GPIB 2ZHEH 3BTWE 3K6ZA 5A09A 1E35B 3OTJE 4NZQA 2GZ9A 2WYJA 3HPTB 1J8AA 1KTTB 1U6QA 2NU1E 3HATH 4B2CA 1WSSH 2HNTC 1GGDC 2UUYA 3ATWA 3AAUA 2VIQA 5TJXA 1O3OA 2VVCA 1UVSH 1GBDA 1LVYA 1GJBB 2GZ7A 5E0JA 3TVJB 3MNSA 2P3FH 4DOQA 1JWTA 3LH3A 1O2PA 1GBLA 1FQ3A 5BRRE 7LPRA 2F9UA 2ZDAH 1UK2A 3ZVDA 4K60A 3VB5A 2SGEE 2ZHQH 4ZUHA 2VU8E 1NU9A 3E6PH 1W0YH 1EP6A 1HCGA 3OSYA 3RXGA 4AZ2B 1GJ4H 3GYLB 2QCYA 1MTNB 1P2JA 1YCPH 2XC5A 1O0DH 1ZTJA 2BLOA 3GICB 3SI4H 1TNLA 1L1JA 1S81A 1FI8A 2Z6BD 3A85A 1TX7A 1SMFE 2EEKA 1QTFA 2ZF0H 1QCPA 1X7AC 4TY7A 2FP7B 3PTNA 2KAIA 4NSVA 1RS0A 1HJAB 1E34B 3RXHA 3PM3A 3OU0A 4OS5A 1B7XB 1DDJA 2A5AA 3ZZBA 3MNCA 1PPBH 1KYNA 1QFKH 3HGPA 1FNIA 1J14A 1DVAH 3MHWU 2XBXA 3A7VA 3SNDA 1XUIA 5DP5A 1C1UH 4B74A 1KLTA 2ZDKA 3QK1A 1V2JT 5LPEA 1G30B 1AB9B 1YBWA 1XVMA 2ZGHA 1P11E 3QZRA 6ESTA 2BXUH 3TJUA 5TCAA 1SGPE 4ZXXH 3O8DA 4TWYA 3ZVEA 2G55A 2BOKA 1C5WB 1WV7H 4FUHA 3TITA 1O3CA 2ZZUH 2AMPA 1T8OA 4IN2A 8LPRA 3RMMH 1UVOA 1HV7A 4FUBA 4E7NA 1O31A 2BZAA 1KDQB 2GP9B 1O2OA 1ELTA 4BXWA 1N6XA 3E91A 4B75A 2TIOA 1VITH 5FHTA 3M61U 4K8YA 1GBEA
chains in the Genus database with same CATH superfamily
2GCHF 2WUCA 3LGTA 5I25A 5DP7A 4FETA 2G51A 1ELCA 5FBIA 1KTSB 2B7DH 2BDCA 3T28A 2QF4A 4ZKNU 1ESTA 5A0BA 3EE0B 1ZPBA 1HAHH 1SC8U 1DY8A 2Y81A 1O3JA 3ZVCA 3PB1E 1J17T 2KR7A 1XUHA 2WPLS 2FWWA 2A4GA 1LPGB 3GCNA 1RIWB 2I6QA 1C5TA 3F0PA 3UWIA 1JXPA 1KLIH 1V2MT 1PPEE 3RLYH 3LC3A 3UPEA 4LZ1H 1GHBG 4B73A 1FXYA 2OBQA 1TNIA 4HI3A 1O2KA 2IPHA 3WY8A 4BTIB 4YOGA 1B5GH 1SGDE 4IC6A 3KQEA 4TY6A 1IQLA 1OWIA 1ELBA 1C1VH 5CHAC 3B8JA 4ACBA 3P8NA 1NFXA 3VXEH 3E90B 4FUEA 2RDLA 5AFZH 4KTSA 2WINI 2FOAA 2D2DA 2JDID 4UD9H 4OGXA 2FMJA 1ELAA 1CA0C 1TQ0B 3E0NB 2FS8A 4YLQH 1G3DA 1SL3A 4B6EA 1C1SA 2FOCA 1J9CH 1S83A 2J38A 4B2BA 1C2MA 4NWLA 3SI3H 3UREA 1IQKA 2KAIB 1ARBA 1L1NA 2Q6FA 3ZZ7A 3TNTA 1ETSH 3BTFE 2FS9A 4LXBH 3S9BA 2R3YA 2A2QH 4K8BA 1NROH 3ZV9A 3CS7A 1AFQC 3TK5A 5EXLA 4X2VA 9ESTA 2F83A 4E05H 1NPMA 4K1EA 3RU4E 1SHHB 2JH0D 1VKYA 3ATMA 4E7RG 3WWBA 1KXDA 5DN6D 1AVGH 1GI5A 2OP9A 4WVPE 4INLA 4ABBA 2F4LA 1TPSA 2GCTC 1FX0B 3GYMA 2BDAA 1DT2A 4CBOA 1CA8B 1KLJH 3D23A 3M7QA 3AASA 3SNAA 3QTOH 3OTPA 4ABEA 4BTTB 1RJXB 3IWMA 1T31A 2SGDE 2THFB 3RUOA 3A7YA 4XFQA 3UIRA 8GCHF 1EPTB 4K5ZA 3SYJA 3RXKA 1ABJH 2TGTA 1UJ1A 5GJ4B 3LKWA 5T1VA 1NM6A 1V2UT 2ZKSA 2QY0B 4CRDA 3GOVB 3DD2H 1AI8H 5F8TA 3SNEA 2ZHFH 2G52A 1QURH 4NFEA 2P95A 4F4OC 5HGGA 2SNWA 2XRCA 2C3SA 3ZZ5A 4D9QA 4YM9A 1O38A 1P57B 2A5IA 1LHCH 2GV7A 1LHGH 3ZZAA 2GT8A 3GY3A 2PP6A 3M5NA 1Y3YA 3SU2A 4NA8A 3M7UA 2EY4C 3VGCB 1ZYOA 3BV9B 1TPPA 1QL9A 1W7GH 4AOQA 2NU4E 4BTUB 2HPQH 3LGVA 3P8FA 2OUAA 2R3UA 1UTMA 1LO6A 2UWOA 2A0QB 3EA9A 1UVTH 5DP3A 1B0FA 1JOUB 1A61H 3LONA 3Q77A 1LTOA 2Z9KA 2CHAB 3DUXH 4JZFH 2A31A 4AFQA 2FOFA 1BTWA 1FDPA 1GBIA 1NBME 1Q31A 3GISB 4O03A 3T5FH 4ISLA 1BTXA 2PFEA 5C17A 1F5LA 2OXSA 4TSFD 1TOCB 3V7TA 1PQAA 2VWMA 1UTOA 4I8HA 2ODYB 1RTKA 1BRAA 1O33A 3RC4A 4WWYA 3S7HB 1JIMA 2AFQB 1P05A 1BBRK 3GY7A 1S6FA 1DANH 2QF0A 2IPQX 3A80A 2WPHS 3F0OA 3KGPA 1HAXB 4ISNA 5ESTE 1GVLA 1UTJA 3UNQA 1GDQA 1F0TA 5K7RA 4CRFA 3AW0A 4QT8C 5C5OA 3RXQA 3LGIA 2GMTB 3R0FA 1UVPA 2BY6X 2Y5HA 4FUDA 4Y79A 3VFEA 3UNRA 1G2MA 1MTVA 1TNGA 5JB9S 1DFPA 1TAWA 1YGCH 1WYKA 1O3DA 3SNCA 3U1IB 3FAOA 2F9VA 5LPRA 4A5TS 1SGFA 4UE7H 1BOQA 1NO9H 2A32A 3CS0A 1MZDA 3RU4D 1VJ9U 1TPAE 1F0RA 1GCDA 5T3HA 2VWNA 3SU4A 3BSQA 3RXFA 4HTCH 4RN6A 1V2WT 4AGJA 1C1TA 3PWCA 4ABAA 2XBVA 1ARCA 1IQFA 4O3TA 1H8HD 1NC6A 4ESTE 1SG8B 4NCYA 1P9SA 1TA6A 1AWFH 2J94A 4ABDA 5C1UA 3E3TA 1MZAA 1ZHPA 1QR3E 1O5BB 3PTBA 1F92A 2V3MA 1TA2A 4NIWA 1UHBA 4GLYA 5T6DA 1UO6A 1HAGE 1LKAA 1PQ5A 1C5ZB 3LGWA 3NUMA 5C0UA 4Y8XA 1LQEA 2GJGA 2Z3EA 4NA7A 1RXPA 1DWDH 4FXGH 1O34A 1VCWA 1GHAF 1QBOA 4Z6AH 1HAOH 1W0KD 3M7TA 4Z1MD 5C5NA 4ABGA 1DSTA 1BTHH 3RDZA 2R0KA 3F6UH 2ZTYA 2H5DA 3I29A 1K1JA 1Z8GA 4MNYA 2JKHA 3MYWA 1F5KU 1TE0A 4Y10E 1O2LA 3V3MA 3N99A 1NFUA 2O8WA 1C1QA 4AYVB 3LC5A 4RT1A 2PSYA 3A88A 1IQJA 1G2LA 4ZHMU 3OY5U 1Y5AT 1UTKA 1YPLH 2Z7FE 5C2ZA 4INKA 1YPKH 1E36B 2Y7XA 1C5SA 1WTGH 3ZVAA 2ZECA 1KY9A 2WPIS 4X0WU 2C8WB 4BAHB 4VGCC 2R2WU 1CE5A 1O2XA 5FBEA 3PLKA 1NBMD 2V35A 4TPYA 1ABIH 5DJ7A 1GI2A 2GDEH 4ZXYH 1NFYA 3S7KB 4F55A 1QZ8A 1MU6B 4X6MA 1TQ7B 1RFNA 2V3HH 3PRBA 4UFFH 1EAIA 4XBCA 2CGAA 2YMSC 1QGFA 4M9FA 1FONA 4WXIA 1T4UH 3U8RH 3A8CA 5FPSA 1GJ5H 3E16B 1XUFA 3BTKE 3M3TA 3OYPA 3RMLH 3EGKH 4I31A 4X8UH 2OQ5A 1DXPA 1OWHA 2FI5E 2ZHDA 1WAYB 2BTCE 4FVBA 4X8VH 2STBE 1TFXA 2VGCC 1SQAA 2CF8H 2OCVB 1EJNA 1S6LA 1S85A 1GL1A 1Z71A 1MKXK 1BBRH 1NRNH 2WPKS 1LMWB 3F2HA 3SU6A 1CQQA 5I46H 4NIVA 5HXFA 1W13U 1GBKA 4O3UA 2ZU3A 1VJAU 3P6ZB 5EOKA 4JK6A 3SU1A 4JYVH 5L2YH 1NN6A 5EQRA 4IW4E 3ZZDA 3VPKA 4MVNA 1H9IE 4U30A 3RXSA 4YT7H 1XXFA 5T6FA 2Q6DA 2OC1A 1A1RA 4O9VA 4BAOB 3LGYA 2ZGJA 2HLDD 2LNCA 2GDDA 2V6NA 2BX3A 2ULLA 2BD9A 1GMDF 1P10A 2Z9JA 3FO8D 1Y8TA 1O36A 2G4TA 1UHBB 1YLDA 3NKKA 2FO9A 3ZYEA 1Q3XA 1P01A 1GGDB 1Y3VA 4AB8A 7ESTE 3P8GA 1ZSJA 3RMOH 4DG4A 1AE5A 1GPZA 4BXSA 1SGQE 4Q4LA 3IG6B 5ABWA 3E0PB 3GCHB 5DK1A 2AMQA 1W12U 2XCNA 3ZZ3A 3EAJA 3M3VA 2RCEA 3RXIA 3GS9A 1NRSH 2D1JA 2J95A 1HYLA 5EJZA 1O5AB 1K1OA 2GZ8A 3C1KA 4X1SU 3PMAB 3S9AA 1UCYK 2XBWA 2QF3A 1GHWH 1TNJA 3NWUA 1MTSA 6CHAB 3M3SA 1TOMH 1Z1IA 5DG6A 4X8SH 3BIUH 5FCKA 4J1YA 4X6NA 1RRKA 3LU9B 3UY9A 2KZ4A 2BYAX 1MUEB 1GCTC 1FAKH 4AGKA 2HLCA 2PWXA 3K9XB 1EZXC 1LVMA 1BMNH 4NGAH 1PQ8A 1C2KA 4B2AA 1D3PB 4ZROA 5EPNA 1QB9A 4FOUC 4H6SB 3FOAA 1HPGA 2RG3A 3A83A 3V13A 1HRTH 3H7TA 2ZFQH 1W2KH 2G5NA 2W5EA 3AK5A 8ESTE 3S0NA 3P92A 2WPMS 2GX4A 3ODDA 1MAYA 2Q1JA 3E1XB 2WZQA 4ABHA 1GI9B 1C5NH 1BJUA 1RGQA 3FN8A 5GCHF 1O3LA 2HNTE 1O30A 1DOJA 1CVWH 3SUEA 1ACBE 2BDGA 4YESB 1W3CA 2HALA 2IN2A 3D62A 1O3EA 4DCDA 2VH6A 2BVXH 2J5UA 1BRBE 1D6RA 1GJ9B 2F9NA 3SORA 1OWKA 3BTQE 5SGAE 4MPVA 3KNXA 5FPYA 1THSH 1QQ4A 1BHXF 2BD2A 3PO1C 8KME2 5EQQA 4HG6A 1YYY1 5EXNA 1C5QA 1PPHE 1DY9A 1S6HA 2JETC 3RXBA 4TYDA 2ZFPH 2FOBA 1TB6H 1KXCA 2TBSA 1GJDB 3OFND 1G37A 1DWCH 3MO3A 3WWFA 3RC6A 1EZQA 4I8LA 4PROA 2BD7A 3M35A 5DP6A 4DIIH 1A0JA 2BM2A 3QO6A 3BG4C 1XM1A 5A8YA 1CHOG 3SJIA 4ZKSU 1P2QA 1G3BA 1SOZA 2P8OC 4CHAC 1BQYA 2QYIA 2ZA5A 3L3TA 4Q63A 3TJOA 4X2WA 4WH6A 4ZKRU 2ODQA 5GXPA 4AB9A 1FV9A 4FUJA 2YNBA 2A45B 1ZJKA 1GHYH 3UTUH 3T62A 2EI8A 4GCHF 1EX3A 4H42U 1SSXA 3RXRA 3DFLA 1GHAG 1VZQH 3M37A 3OY6U 4XOJA 3F2GA 1ZMJA 1QY6A 2AGEX 2H1UA 1P8VC 3SU3A 1DUAA 3QGJA 4ZHLU 3TJNA 1GI4A 1SLUB 1OHHD 1GHVH 2FI4E 2BVSH 2IOTA 2VWOA 3RXJA 4J2YB 1MD7A 4XD7D 1H9LB 1OKXA 4R0IA 2Q6GA 3MQKC 2J92A 1BRUP 2CV3A 3SNBA 4XBBA 1AGJA 1TBZH 1P3CA 1B0EA 1PPGE 2BLWA 3U98H 5EODA 3Q00A 1W11U 2FOHA 3FFGA 2QE7D 1NY22 2FZZA 3NPSA 2VIOA 1GI6A 1G9IE 3A82A 5F8XA 3D49H 1UCYH 1CT0E 5L2ZH 1MBQA 3Q3XA 1GJ6A 3SV7A 3U28C 3UR9A 1IHTH 1S0QA 5JDUB 1KXFA 2HOBA 3BTDE 1YPHC 4TT3D 4K2YA 1EASA 3MH7A 4I7YH 3M36A 3MU8A 1QQUA 3TGKE 3SU0A 1QRXA 2YNAA 3SV8A 3T27A 1S82A 1EAWA 1EUFA 1T4VH 4IBLH 2FXRA 2ZPRA 1H1BA 4BOHA 1C5OH 1XUGA 3VB4A 1SLVB 1F7ZA 1ZR0A 3BEIB 2OINA 3KHVA 1G3EA 4Q80A 5FCRA 2FOMB 2ZGXH 1BTYA 3DA9B 1CHGA 3ATIA 1QRWA 1TX6A 2ZU1A 1OS8A 1GBFA 5E0HA 4MNXA 2DE9A 2O8UA 1OP8A 4JYTA 4AC9A 4U32A 5L6NH 3E8LA 1P06A 1O39A 2ZG0H 1SFQB 1SGNE 1C1WH 1CT2E 1ELFA 1FJSA 3ZV8A 1A4WH 3N7EA 1LVOA 2WV9A 1BITA 2LP6A 4AYYB 5DO4H 1DXWA 5HIYA 3SHAH 1MD8A 2SGFE 2FOEA 1WCZA 5B6LA 2C8YB 2WPJS 1BHXB 2XNDD 1HAZB 2VVUA 3OE7D 2I6SA 4ABIA 3MH6A 4A1XA 4GSOA 2VINA 3GY5A 1GMDG 4INHA 2C8XB 3TH2H 3ZVFA 1DITH 1P09A 3F9HA 3KL6A 2SGAA 4MG3A 1MQ6A 4Y0YE 1W0JD 4UDWH 1ESBA 3EE7A 1KXBA 3KYFA 2BX4A 2OTVA 4MNWA 3LJOA 1C5YB 1O3PB 1TWXB 1MTUA 2OLGA 1OX1A 1Q2WA 1SLXB 3OEHD 4ZCNA 1C4Y2 2SNVA 2W26A 5HMAA 3K2UA 5JBAS 1JRSA 3H09A 5IDKA 5L30H 1V6DA 2BQWB 3RU4T 1Y3UA 1AUTC 5H4IB 1GMHF 2W3IA 4BNRA 1N8OC 1QBVH 1AZ8A 2J9NA 1KIGH 2KCPA 1IHSH 2P94A 4I8KA 4GHQA 2RA0A 5GNDA 2GGVB 1IAUA 1HJ9A 2FYQA 4GPGA 2GKVE 1MABB 4GUXA 1TBRH 1RIWC 3UR6A 2W7UA 4WXVA 2ZPSA 1FPCH 1A5IA 1N1LA 2BDYA 1AE8H 1T8NA 1CU1A 2KCAA 3MO9A 3MFJA 1D9IA 1P2OA 5K0HA 3GCTF 2NU0E 2FOGA 1DE7H 5EJLA 5F53A 1TGTA 2BLVA 1AY6H 1CBWB 1YLNA 1A0HB 4HFPB 4YZUA 1ELDE 1DS2E 3EA7A 1BB0B 4RI0A 2BD4A 1O2RA 1DLKB 3MU4A 3ZVBA 2ZCLP 5JBBS 4WMDA 1P12E 1GWAA 2C8ZB 1SQRA 5JBCS 2H2ZA 2OK5A 1SGEE 1DUEA 2ZGCA 3IITA 3S9CA 4BAMB 1EATA 1DM4B 4NZLA 4XSKU 5GDSH 4CH2B 1NRQH 4NFFA 4CBNA 2PR3A 1F5RA 2UUKB 1C5RA 1YM0A 4JZIA 3AAVA 2VH0A 3SBKA 2ZWLH 1HGTH 4OS7A 1GI0A 1ZMLA 1BMMH 4A1VA 4YT6H 1O2YA 5DP4A 1MCVA 2GT7A 1FZZA 1EZUC 2O8TA 3ESTA 1ZOMA 1MMJN 5LPFA 2D26C 1A5HA 1H8ED 1ZMNA 1YPGH 5HIZA 1IQIA 1YF4A 4SGBE 1C1MA 1EJAA 5IK2D 2TPIZ 2XCFA 1C5VA 5A8ZA 1HAYB 1GHXH 4I33A 3L6PA 3QGNB 1P2MA 4B6FA 1QIXB 1C4U2 1C9TA 1SLWB 1BMAA 3HK3B 4Y76A 5ESBA 4CR9A 5HM9A 1AKSA 3ZYDA 4JCNA 3SUGA 2Z3DA 5AHGH 3SO3A 2JH6D 2ZQ2A 4MPUA 1DX5M 1ZPCA 1EPTC 2VIPA 5EW1H 2QN5T 4D76A 3KIDU 3ITIA 2ZFSA 4CRCA 4VGCB 1TMTH 2C4FH 3L33A 2FDAA 4FUFA 1ETTH 2HNTF 3PMBB 5DGJA 1TGCA 1EXFA 4WY3A 3A7ZA 1BDAA 1FY1A 3RP2A 1G36A 2AGIX 1NTPA 1O5FH 1L4ZA 1V2PT 1XUJA 5AVDA 3VB3A 2TGAA 1BUIA 1AFEH 1M9UA 3RXUA 4GAWA 3HK6B 2GTBA 2FX4A 1Y3WA 2UUFB 1YKTA 2H5CA 3MU0A 3PV5A 2W7SA 4Y11E 1OPHB 3FZZA 1V2RT 1XXDA 3ZZ4A 2CF9H 2PKSB 3VGCC 1S0RA 2O8MA 3C27B 2PGQB 2FODA 4UFGH 1COWD 1TGBA 1QRZA 2OD3B 1T8LA 1PPCE 2R0LA 2F43B 1Y5UT 3MU5A 1GVZA 3A81A 2GCHG 2CHAC 1BCUH 3LH1A 5KGOA 1ELVA 1BMFD 3ATLA 5JBTA 5JPMH 2ANYA 5DPAA 4FU9A 3H7OA 1UW7A 3MMGA 2G5VA 1A46H 1F0SA 1O5GH 3SGAE 3DFJA 1NFWA 3RXVA 2OC7A 1V2QT 1ANBA 1WOFA 1FIZA 3KEEA 1O3BA 1Z7KA 2O9QA 2A4QA 1Z1JA 1WQVH 4LK4A 5AF9H 3AVZA 1E1RD 2ZNKH 5C0TA 1SGCA 1P02A 1HJ8A 1OYQA 2ODPA 1C5UA 1EQ9A 2GMTC 2HVYB 1SGTA 4X2YA 1A7SA 3KCGH 1HIAA 1WDIA 2PV9B 4KKDA 3ELAH 1CO7E 2BY8X 3KQDA 4OS2A 1TRYA 1F2SE 5A2MH 3SV6A 4F48B 1SBWA 3BG8A 2PKAA 1O5DH 4AN7A 1O2HA 2ALVA 4BAQB 2FLBH 3URCA 1CGJE 3NCLA 2F3CE 4KTCA 2TRMA 3PLBA 4CREA 5CE1A 1ESAA 3VEQB 2ZDLA 1HFDA 1Y59T 4OM9A 3SHCH 1D3TB 1AUJA 1T8MA 3BEUA 4Y8ZA 4DT4A 4DIHH 3BEFB 1A3BH 5C3NA 2XBYA 5HM2A 2FPZA 2XNIA 4FU8A 3B23B 4FUCA 3U69H 3TGIE 3W95A 1GDNA 2SGQE 1GHBF 3FKSD 1CGIE 1TMBH 1VGCB 1YPEH 2PLXA 1BMLA 1P04A 2G81E 4BANB 1LHEH 1ELGA 2XWAA 1OOKB 1TONA 1TRMA 3W1EA 1RD3B 1MQ5A 5F03A 1UVUH 1DPOA 1BTUA 5CHBA 3RXPA 1HAPH 2K0QA 1GG6C 1UTNA 1QB1A 3D65E 1SHYA 2BMGB 2EI6A 3FZDA 2HVXA 3F2FA 1S5SA 1GBJA 2ZPQA 1C2GA 2JJ2D 1O3HA 4FVDA 4Q2KA 2GD4B 3NK8A 4H6TA 1AVXA 1GMHG 2RFKC 4A1TA 4JYUH 1ANEA 1Z6JH 3SV2H 1BT7A 5A0AE 2ZIQH 3SZNA 8GCHG 1THRH 2VJ1A 2G00A 1AZZA 5IYTA 2ZP0H 1HNEE 4LZ4B 1O3MA 3RXTA 4MDSA 2XC4A 1SGIB 1GBMA 1FY3A 3BN9A 3ENSB 2B9LA 3HKIB 3GDUA 1O2MA 4WH8A 1Z8RA 3EDXB 2VWLA 3RC5A 1BZXE 1CGHA 3PO1B 7KMEH 3GCTG 3N7DA 1PJPA 2JETB 1O2SA 4AFZA 2ZQ1A 3O8BA 4HGCA 3UFAA 1OWDA 1E0FD 2SGPE 3A8DA 5E2PA 3HGNA 1C1NA 3F9FA 5JYIA 1MH0A 2W6ID 1XX9A 1MKWK 2R9PA 2KX4A 1E37B 4X6OA 4LOYH 3CENA 1O2UA 3T2NA 1LHDH 3B9FH 1TMUH 2XW9A 5B6OA 5BPEA 3PRDA 3LIWA 1IOEA 1DICA 3CNRA 1W8BH 5FX6A 4CHAB 1ETRH 1GBHA 1HXFH 2B8OH 4K1SA 4A6LA 3VB7A 1GJAB 1FAXA 4YXWD 5J4QA 1PYTC 1W0ZU 3SJ9A 4Y8YA 5CMXH 1KDQA 2ZFFH 1SQOA 2PTCE 2F9OA 4CRAA 1SR5C 2QXIA 2CK3D 1HIAB 2BOHB 4UFEH 1D3QB 2WUBA 3TK9A 3S69A 1FN8A 1E38B 2VNTA 2YMSD 2XXLA 4I8JA 1OXGA 3U8TH 2Z9IA 3T25A 1LCYA 1WBGB 2J2UA 3LDXH 2PKAB 3F9EA 2A7JA 3LJJA 4ABJA 1SGFG 3RXLA 2AIQA 4RKJB 3A87A 1YY3A 1ELEE 3RM2H 3M5MA 3A7TA 2NU2E 2A1DB 2H9EH 3RXEA 4KGAA 2ZDMA 1O2WA 3UOPA 7GCHF 2A2XH 2ILNA 6LPRA 3UUZA 4Y7BA 3ZIAD 5FX5A 2XTTB 4IMQA 1C4V2 1DSUA 1O32A 3SGQE 1E1QD 2UWPA 1GDUA 1ZGIA 3KN2A 3LOXA 2JJ1D 3GCHC 1WU1A 1GJ7B 4ZHAA 3QZQA 3PV4A 3ZZ6A 2J97A 1FY4A 1P2NA 3ZZ8A 1QL8A 2W6JD 2O8LA 3ZZCA 4I86A 3HKJB 2ZHWH 3F1SB 1QA0A 4RT0A 4JZ1A 1MKXH 2ANMH 2ZU5A 1ORFA 2F9PA 1AQ7A 6CHAC 3H5CB 5EQSA 2FESH 1A2CH 3JZ1B 2B5TB 2HPPH 4IN1A 2UUJB 2FIRH 2HWLB 4IGDA 2H6MA 2AEIH 2BHGA 1C2LA 2Z94A 3F3BA 1TNKA 3GY2A 5CHAB 2V3OH 1GJCB 3K65B 2BDHA 3PV2A 1K22H 3P70B 4CRBA 1W14U 2GV6A 5KEDA 3URDA 1CA0B 2WYGA 2Y82A 4DW2U 1C5MD 1GBTA 4ABFA 4D9RA 2WHXA 1H4WA 4FUGA 2R2MB 2AS9A 1TNHA 1KXEA 1UTPA 4ISIH 3EYDA 1Z8JB 4NIYA 3MO6A 4WMEA 3MTYA 3ZZ9A 1TGNA 1O2NA 3M5OA 4FU7A 1RTFB 2RA3A 5EJ1A 1O5CB 2ZU2A 1SGRE 4ZMAH 4D7FA 1PYTD 1FLEE 1FPHH 2FI3E 2QV1A 1EPTA 2EC9H 1GI3A 1SVPA 1FN6A 1AFQB 2IJD1 3QUMP 4THNH 1L1GA 1YPHE 2KM0A 5T6GA 1FIWA 4YOIA 4JZEH 3QDZB 2A4RA 1NRPH 9LPRA 1ZTLA 2PHBA 1VR1H 1RTLA 3SJKA 1MKWH 1HXEH 1OWEA 1LHFH 2ZCKP 1BJVA 1O37A 2GCTB 3FVFB 3RXOA 5E8EH 3FP6E 1JIRA 1MTNC 4KP0A 2TGPZ 2QAAA 3JZ2B 3A8AA 4A92A 1K1PA 2G4UA 2BLQA 1ID5H 4IS5A 3SUFA 3GDVA 4X8TH 1TALA 5EPYA 1N8OB 1T32A 1EJMA 1ZJDA 3A89A 4R8TB 3UQVA 1L0ZA 3U8OH 4Q7XA 2QXHA 2ZTZA 3ZVGA 2FTMA 3DHKH 4D8NA 3VB6A 3NXPA 1HJAC 3FANA 4P02A 1UMAH 3QX5H 3Q3YA 2UWLA 4ZKOU 4X1NU 2XC0A 3SQEE 2EA3A 3A84A 2BB4A 3MNBA 5TCCA 1EKBB 3SOSA 1DLEA 3RMNH 1E79D 1QB6A 1GBAA 3I77A 1TABE 1MU8B 1Y5BT 3PYHA 1Z6EA 2A5KA 2AH4X 1PPZA 2BY5X 4ZH8A 4D7GA 2OC0A 5KECA 2XYAA 3QN7A 1NZQH 1W10U 1AB9C 2L6OA 1OWJA 2FEQH 4Y7AA 2PUXB 4F49A 1AHTH 5DP9A 1YP9A 2Y6TA 2AHME 2P3UB 4XE4A 3KQCA 4B1TA 1EZSC 4NA9H 2ASUB 2K8IA 4Y0ZE 2FM2A 1HDTH 1H8DH 1SI5H 5C94A 1HUTH 4TPIZ 2QF5A 2A7CA 1FY8E 3SZEA 1H8IH 2ZI2H 2ZDNA 2P3TB 3OX7U 4MNVA 5EXMA 1JBUH 1EFRD 1D6WA 3PWBA 1KSNA 2ANKH 6GCHF 1NRRH 4NSYA 4TWWA 5LH8A 1QJ1B 3BTME 5EIYA 2EI7A 3U1JB 2Y5FA 1INCA 2PTNA 2P59A 1HBTH 2C93B 3Q3KA 1A0LA 3KQBA 1V2TT 4XRNA 4MPXA 3RXMA 1HAIH 2ZFRH 3TIUA 3PMHB 3T29A 1IQMA 2RDEA 2WV5A 3KQ5A 1KMHB 2Y7ZA 4I8GA 5C1XA 2BD5A 4XBDA 4DY7B 1ZHMA 1AN1E 1NESE 1Z8IB 3RXDA 3UWJH 2AMDA 4XDEA 3KF2A 5F6MA 4B71A 1O2ZA 4YLUA 1C2JA 1O3FA 3UQOA 1XVOA 4NWKA 1SQTA 2PUQH 3STJA 3LT3A 1YCPM 5C67A 4BAKB 3W94A 1XMNB 1P03A 1V2KT 2D8WA 1C5LH 1IQEA 4KELA 4OS4A 1SPJA 1QL7A 1QNJA 1ZRBA 2ZTXA 3RXAA 2AERH 5C1YA 2J34A 3P95A 4JK5A 1QHRB 1AVWA 1IQHA 2BDBA 1OP2A 1OSSA 4HZHA 2A4OA 4UFDH 5GIBA 3U9AH 1C1OA 2CJIA 1O2IA 4AFSA 5E2OA 1ZRKA 3DSGA 3TK6A 2HGTH 3GY4A 5GCHG 1HAVA 1ZSKA 1MAXA 1K21H 4DURA 1GBBA 1ANCA 1AIXH 1AD8H 3DSOA 1TRNA 1GHZA 1JRTA 2JH5D 2QIQA 3BTGE 4U01A 1THPB 1GMCF 2ZGBH 3SQHE 3DCLA 4KTUA 3O8RA 1XKBC 1O2TA 4Z0KA 1K1IA 5JB8S 1KXAA 4UEHH 3K6YA 7GCHG 1VITF 4ACAA 3RLWH 1A3EH 1OYTH 1MBMA 2ANWA 3I78A 3MNXA 1V2OT 2JIZD 2BXTH 1LKBA 1EOLA 2Y5GA 4A7IB 1C2DA 2ZDVH 2VIWA 4ASHA 4CRGA 1TYNA 1V2ST 1WTHD 3UOUA 1TIOA 4X1RU 4X6PA 1BBRE 3F68H 2BDIA 2LPRA 3BF6H 4OGYA 3MWIU 3VXFH 1P0SH 3F9GA 1C2HA 3STIA 2STAE 5DSFA 1N6YA 2H9HA 3RXCA 2ZFTA 4FUIA 2M5TA 4JMYA 4NIXA 1UTLM 1QA7A 1FMGA 4B76A 3GCOA 2ESTE 3LGUA 3TU7H 5FXLA 4MTBA 3GY8A 2PSXA 2Z9GA 3BTTE 3EA8A 4DJZB 2FX6A 4DVAU 3MH5A 1NS3A 1A5GH 1AU8A 4GCHG 4E06H 3P17H 2C90B 3A86A 4SGAE 1WXRA 1TGSZ 4GVUA 5A8XA 2TGDA 2WV4A 2ZC9H 4Y71A 1CBWC 1BIOA 1NU7B 4AG2A 1K2I1 1MTWA 1J16A 2YMSB 1AO5A 3FP8E 4X2XA 2HRVA 2AGGX 5EGMA 5LGOA 2OC8A 1DWEH 4YOJA 1CHOF 3UNSA 1YPJH 4OS1A 4WF8A 5ETXA 3A8BA 4K3JA 1K28D 3PROA 1C9PA 1D4PB 1J15A 3NZIA 4MPWA 1EB1H 3TH4H 2VGCB 2ZU4A 2IJOB 5FAHA 1TPOA 1BTZA 1SOTA 3MI4A 3QLPH 2CN0H 2F91A 1K9OE 2VIDA 1QJ7B 4WJG2 1GL0E 1O3AA 2A7HA 1CSOE 1QJ6B 1MCTA 1SGYE 3P8OA 2F9BH 1P2IA 2DUCA 1K0HA 4ZAEA 1TX8A 2SFAA 4X1QU 1GG6B 3GY6A 4H4FA 3QWCH 3G01A 4AX9H 1SFIA 2CMYA 4JZDH 1HAVB 1LDTT 1EP5A 1C5PA 1P3EA 1AMHA 1GI8B 2P93A 1H9HE 2L74A 1LPZB 1UK3A 4Q7YA 1O5EH 5A0CA 4YO9A 4NG9H 1W7XH 4ISHH 3R3GB 1T7CA 2B0FA 1GBCA 1OP0A 1O2GH 1SKYE 5AFYH 2K1QA 2BY7X 2FLRH 1IQNA 1K1LA 2QXJA 1UTQA 1D3DB 1HLTH 1XUKA 1ANDA 5FPTA 3RM0H 4ASUD 3WW7A 1PPFE 4M7GA 2OBOA 3SU5A 3SV9A 4WMFA 1YPMH 4Y6DA 2J4IA 3TH3H 1QBNA 1V2NT 3SW2B 2YOLA 1PQ7A 1UK4A 2QGRA 3MU1A 4X1PU 1LVBA 1DWBH 1ZGVA 4K69A 1AKSB 2BD3A 4DGJA 1TBQH 4Q7ZA 5EU8A 1O3KA 3TLOA 1JMOH 5DP8A 1EOJA 1YCPK 2QXGA 1G32B 4RKOB 1GCTB 1O3IA 3TNSA 2VVVA 1IQGA 4OS6A 4K1TA 4O97A 1O3NA 4AFUA 2OQUA 2BY9X 4U2WA 2PKSC 1ZTKA 4GHTA 4DT7B 2ZEBA 1TLDA 3M5LA 3A7XA 1O3GA 2NWNA 3BTEE 4UONA 1L4DA 1WUNH 1C2FA 3MH4A 2DE8A 3A7WA 2VBCA 6GCHG 4AG1A 1EAXA 2NU3E 2VB0A 1BRCE 4IC5A 1CT4E 1NT1A 1GI1A 2BQ7B 2EQNA 1ZSLA 3DT0H 3SJ8A 3OAAD 4CR5A 3TJVA 3SUDA 1EB2A 1ZPZA 1V2LT 5HYOA 3TGJE 5EW2H 4ISOA 3TPIZ 2BD8A 3PMJA 3ODFA 2QA9E 2FTLE 3LPRA 3ATKA 1C1RA 1GJ8B 2QC2A 4RSPA 1YC0A 5F8ZA 5EG4A 2ZO3H 2J98A 1V3XA 1S84A 1V2VT 4I32A 3UB0A 2ALPA 3NRLA 1G3CA 4IMZA 3GDSA 1WQSA 3O8CA 3KYGA 1HB0B 3PLPA 1FUJA 1XKAC 1P9UA 1BA8B 2Z9LA 3SN8A 1BTPA 5G4BA 3EQ0H 2BQ6B 1L2EA 3N7OA 1O2QA 1UCYE 2Z3CA 1ZLRA 4AORA 5DKMA 3SJOA 1O2JA 4MLFB 3BG4B 3MOCA 3V0XA 2LELA 1VCQA 2CXVA 3QTVH 2GVFA 2H9TH 5PTPA 1O35A 1LPKB 3V12A 2Y80A 1C2IA 3AW1A 4YTAA 2KCYA 2P8OB 5J4SA 3CP7A 5GWZA 5C20A 3T26A 2PW8H 2FYRA 1K1NA 1LQDB 2V0BA 1C1PA 2PGBB 1GMCG 3DSPA 4MQAA 2AYWA 3Q76A 2M2AA 1YLCA 1P2KA 3FP7E 1SB1H 5E0GA 1AWHB 1FY5A 1VGCC 2BZ6H 2XOKD 3BTHE 1K1MA 1O2VA 1VITG 4CH8B 3BIVH 1VCPA 1GI7B 2W3KA 2G8TA 1EAUA 1ZHRA 1YWUA 2XWBI 1PFXC 2WSSD 1Y3XA 2AIPA 1F0UA 2BVRH 1GVKB 1C2EA 1C5XB 2VIVA 3SGBE 1ZZZA 2P16A 2ZCHP 5GPIB 2ZHEH 3BTWE 3K6ZA 3OEED 5A09A 1E35B 3OTJE 4NZQA 2GZ9A 2WYJA 3HPTB 1J8AA 1KTTB 1U6QA 2NU1E 3HATH 4B2CA 1WSSH 2HNTC 1GGDC 2UUYA 3ATWA 3AAUA 2VIQA 5TJXA 1O3OA 2VVCA 5HKKD 1UVSH 1GBDA 1LVYA 1GJBB 2GZ7A 5E0JA 3TVJB 3MNSA 2P3FH 4DOQA 1JWTA 3LH3A 1O2PA 4P00A 1GBLA 1FQ3A 5BRRE 7LPRA 2F9UA 2ZDAH 1UK2A 3ZVDA 4K60A 3VB5A 2SGEE 2ZHQH 4ZUHA 2VU8E 1NU9A 3E6PH 1W0YH 1EP6A 1HCGA 3OSYA 3RXGA 4AZ2B 5FL7D 1GJ4H 3GYLB 2QCYA 1MTNB 1P2JA 1YCPH 2XC5A 1O0DH 1ZTJA 2BLOA 3GICB 3SI4H 1TNLA 1L1JA 1S81A 1FI8A 2Z6BD 3A85A 1TX7A 2KCOA 1SMFE 2EEKA 1QTFA 2ZF0H 1QCPA 1X7AC 4TY7A 2FP7B 3PTNA 2KAIA 4NSVA 1RS0A 1HJAB 1E34B 3RXHA 3PM3A 2J98B 3OU0A 4OS5A 1B7XB 1DDJA 2A5AA 3ZZBA 3MNCA 1PPBH 1KYNA 1QFKH 3HGPA 1FNIA 1J14A 1DVAH 3MHWU 2XBXA 3A7VA 3SNDA 1XUIA 5DP5A 1C1UH 4B74A 1KLTA 2ZDKA 3QK1A 1V2JT 5LPEA 1G30B 1AB9B 1YBWA 1XVMA 2ZGHA 1P11E 3QZRA 6ESTA 2BXUH 3TJUA 2V7QD 5TCAA 1SGPE 4ZXXH 3O8DA 4TWYA 3ZVEA 2WPDD 2G55A 2BOKA 1C5WB 1WV7H 4FUHA 3TITA 1O3CA 2ZZUH 2AMPA 1T8OA 4IN2A 8LPRA 3RMMH 1UVOA 1HV7A 4FUBA 4E7NA 1O31A 2BZAA 1KDQB 2GP9B 1O2OA 1ELTA 3VG8A 5CDFE 4BXWA 2KFWA 1N6XA 3E91A 4B75A 2TIOA 1VITH 5FHTA 3UAIC 3M61U 4K8YA 1GBEA
chains in the Genus database with same CATH topology
2GCHF 2WUCA 3LGTA 5I25A 5DP7A 2G51A 1ELCA 5FBIA 1KTSB 2B7DH 2BDCA 3T28A 4ZKNU 1ESTA 5A0BA 3EE0B 1ZPBA 1HAHH 1SC8U 1DY8A 2Y81A 1O3JA 3ZVCA 3PB1E 1J17T 1XUHA 2WPLS 2FWWA 2A4GA 1LPGB 3GCNA 1RIWB 2I6QA 1C5TA 3UWIA 1JXPA 1KLIH 1V2MT 1PPEE 3RLYH 3LC3A 3UPEA 4LZ1H 1GHBG 4B73A 1FXYA 2OBQA 1TNIA 4HI3A 1O2KA 2IPHA 3WY8A 4BTIB 4YOGA 1B5GH 1SGDE 4IC6A 3KQEA 4TY6A 1IQLA 1OWIA 1ELBA 1C1VH 5CHAC 3B8JA 3P8NA 1NFXA 3VXEH 3E90B 4FUEA 2RDLA 5AFZH 4KTSA 2WINI 2FOAA 2D2DA 4UD9H 4OGXA 2FMJA 1ELAA 1CA0C 1TQ0B 3E0NB 2FS8A 4YLQH 1G3DA 1SL3A 1C1SA 2FOCA 1J9CH 1S83A 2J38A 4B2BA 1C2MA 4NWLA 3SI3H 3UREA 1IQKA 2KAIB 1ARBA 1L1NA 2Q6FA 3ZZ7A 3TNTA 1ETSH 3BTFE 2FS9A 4LXBH 3S9BA 2R3YA 2A2QH 4K8BA 1NROH 3ZV9A 3CS7A 1AFQC 3TK5A 5EXLA 4X2VA 9ESTA 2F83A 4E05H 1NPMA 4K1EA 3RU4E 1SHHB 2JH0D 4E7RG 3ATMA 1KXDA 1AVGH 1GI5A 2OP9A 4WVPE 4INLA 4ABBA 1TPSA 2GCTC 3GYMA 2BDAA 1DT2A 4CBOA 1CA8B 1KLJH 3D23A 3M7QA 3AASA 3SNAA 3QTOH 4ABEA 4BTTB 1RJXB 3IWMA 1T31A 2SGDE 2THFB 3RUOA 3A7YA 4XFQA 3UIRA 8GCHF 1EPTB 4K5ZA 3RXKA 1ABJH 2TGTA 1UJ1A 5GJ4B 3LKWA 1NM6A 1V2UT 2ZKSA 2QY0B 4CRDA 3GOVB 3DD2H 1AI8H 5F8TA 3SNEA 2ZHFH 2G52A 1QURH 4NFEA 2P95A 4F4OC 5HGGA 2SNWA 2XRCA 2C3SA 3ZZ5A 4D9QA 4YM9A 1O38A 1P57B 2A5IA 1LHCH 2GV7A 1LHGH 3ZZAA 2GT8A 3GY3A 3M5NA 1Y3YA 3SU2A 4NA8A 3M7UA 3VGCB 1ZYOA 3BV9B 1TPPA 1QL9A 1W7GH 4AOQA 2NU4E 4BTUB 2HPQH 3LGVA 3P8FA 2OUAA 2R3UA 1UTMA 1LO6A 2UWOA 2A0QB 3EA9A 1UVTH 5DP3A 1B0FA 1JOUB 1A61H 3LONA 3Q77A 1LTOA 2Z9KA 2CHAB 3DUXH 4JZFH 2A31A 4AFQA 2FOFA 1BTWA 1FDPA 1GBIA 1Q31A 3GISB 4O03A 3T5FH 4ISLA 1BTXA 2PFEA 1F5LA 2OXSA 1TOCB 3V7TA 1PQAA 2VWMA 1UTOA 4I8HA 2ODYB 1RTKA 1BRAA 1O33A 3RC4A 4WWYA 3S7HB 1JIMA 2AFQB 1P05A 1BBRK 3GY7A 1S6FA 1DANH 2QF0A 3A80A 2WPHS 3KGPA 1HAXB 4ISNA 5ESTE 1GVLA 1UTJA 3UNQA 1GDQA 1F0TA 5K7RA 4CRFA 3AW0A 4QT8C 5C5OA 3RXQA 3LGIA 2GMTB 3R0FA 1UVPA 2BY6X 2Y5HA 4FUDA 4Y79A 3VFEA 3UNRA 1G2MA 1MTVA 1TNGA 5JB9S 1DFPA 1TAWA 1YGCH 1WYKA 1O3DA 3SNCA 3U1IB 3FAOA 2F9VA 5LPRA 4A5TS 1SGFA 4UE7H 1BOQA 1NO9H 2A32A 3CS0A 1MZDA 3RU4D 1VJ9U 1TPAE 1F0RA 1GCDA 5T3HA 2VWNA 3SU4A 3BSQA 3RXFA 4HTCH 4RN6A 1V2WT 4AGJA 1C1TA 3PWCA 4ABAA 2XBVA 1ARCA 1IQFA 4O3TA 1NC6A 4ESTE 1SG8B 4NCYA 1P9SA 1TA6A 1AWFH 2J94A 4ABDA 5C1UA 3E3TA 1MZAA 1ZHPA 1QR3E 1O5BB 3PTBA 1F92A 1TA2A 4NIWA 1UHBA 4GLYA 5T6DA 1UO6A 1HAGE 1LKAA 1PQ5A 1C5ZB 3LGWA 3NUMA 4Y8XA 1LQEA 2Z3EA 4NA7A 1RXPA 1DWDH 4FXGH 1O34A 1VCWA 1GHAF 1QBOA 4Z6AH 1HAOH 3M7TA 5C5NA 4ABGA 1DSTA 1BTHH 3RDZA 2R0KA 3F6UH 2ZTYA 2H5DA 3I29A 1K1JA 1Z8GA 4MNYA 2JKHA 3MYWA 1F5KU 1TE0A 4Y10E 1O2LA 3V3MA 1NFUA 2O8WA 1C1QA 4AYVB 3LC5A 2PSYA 3A88A 1IQJA 1G2LA 4ZHMU 3OY5U 1Y5AT 1UTKA 1YPLH 2Z7FE 5C2ZA 4INKA 1YPKH 1E36B 2Y7XA 1C5SA 1WTGH 3ZVAA 2ZECA 1KY9A 2WPIS 4X0WU 2C8WB 4BAHB 4VGCC 2R2WU 1CE5A 1O2XA 5FBEA 3PLKA 2V35A 4TPYA 1ABIH 5DJ7A 1GI2A 2GDEH 4ZXYH 1NFYA 3S7KB 1MU6B 4X6MA 1TQ7B 1RFNA 2V3HH 4UFFH 1EAIA 4XBCA 2CGAA 1QGFA 1FONA 4WXIA 1T4UH 3U8RH 3A8CA 5FPSA 1GJ5H 3E16B 1XUFA 3BTKE 3M3TA 3OYPA 3RMLH 3EGKH 4I31A 4X8UH 2OQ5A 1DXPA 1OWHA 2FI5E 2ZHDA 1WAYB 2BTCE 4FVBA 4X8VH 2STBE 1TFXA 2VGCC 1SQAA 2CF8H 2OCVB 1EJNA 1S85A 1GL1A 1Z71A 1MKXK 1BBRH 1NRNH 2WPKS 1LMWB 3SU6A 1CQQA 5I46H 4NIVA 5HXFA 1W13U 1GBKA 4O3UA 2ZU3A 1VJAU 3P6ZB 5EOKA 4JK6A 3SU1A 4JYVH 5L2YH 1NN6A 5EQRA 4IW4E 3ZZDA 3VPKA 4MVNA 1H9IE 4U30A 3RXSA 4YT7H 1XXFA 5T6FA 2Q6DA 2OC1A 1A1RA 4O9VA 4BAOB 3LGYA 2ZGJA 2LNCA 2GDDA 2V6NA 2BX3A 2ULLA 2BD9A 1GMDF 1P10A 2Z9JA 1Y8TA 1O36A 2G4TA 1UHBB 1YLDA 3NKKA 2FO9A 3ZYEA 1Q3XA 1P01A 1GGDB 1Y3VA 4AB8A 7ESTE 3P8GA 1ZSJA 3RMOH 4DG4A 1AE5A 1GPZA 4BXSA 1SGQE 3IG6B 5ABWA 3E0PB 3GCHB 5DK1A 2AMQA 1W12U 2XCNA 3ZZ3A 3EAJA 3M3VA 2RCEA 3RXIA 1NRSH 2D1JA 2J95A 1HYLA 1O5AB 1K1OA 2GZ8A 3C1KA 4X1SU 3PMAB 3S9AA 1UCYK 2XBWA 2QF3A 1GHWH 1TNJA 3NWUA 1MTSA 6CHAB 3M3SA 1TOMH 1Z1IA 5DG6A 4X8SH 3BIUH 5FCKA 4J1YA 4X6NA 1RRKA 3LU9B 3UY9A 2BYAX 1MUEB 1GCTC 1FAKH 4AGKA 2HLCA 2PWXA 3K9XB 1EZXC 1LVMA 1BMNH 4NGAH 1PQ8A 1C2KA 4B2AA 1D3PB 4ZROA 5EPNA 1QB9A 4H6SB 1HPGA 2RG3A 3A83A 3V13A 1HRTH 3H7TA 2ZFQH 1W2KH 2G5NA 2W5EA 8ESTE 3S0NA 3P92A 2WPMS 2GX4A 3ODDA 1MAYA 2Q1JA 3E1XB 4ABHA 1GI9B 1C5NH 1BJUA 1RGQA 5GCHF 1O3LA 2HNTE 1O30A 1DOJA 1CVWH 3SUEA 1ACBE 2BDGA 4YESB 1W3CA 2HALA 2IN2A 3D62A 1O3EA 4DCDA 2VH6A 2BVXH 1BRBE 1D6RA 1GJ9B 2F9NA 3SORA 1OWKA 3BTQE 5SGAE 4MPVA 3KNXA 5FPYA 1THSH 1QQ4A 1BHXF 2BD2A 3PO1C 8KME2 5EQQA 1YYY1 5EXNA 1C5QA 1PPHE 1DY9A 1S6HA 2JETC 3RXBA 4TYDA 2ZFPH 2FOBA 1TB6H 1KXCA 2TBSA 1GJDB 1G37A 1DWCH 3MO3A 3RC6A 1EZQA 4I8LA 4PROA 2BD7A 3M35A 5DP6A 4DIIH 1A0JA 2BM2A 3QO6A 3BG4C 1XM1A 5A8YA 1CHOG 3SJIA 4ZKSU 1P2QA 1G3BA 1SOZA 2P8OC 4CHAC 1BQYA 2QYIA 2ZA5A 3L3TA 3TJOA 4X2WA 4WH6A 4ZKRU 2ODQA 5GXPA 4AB9A 1FV9A 4FUJA 2YNBA 2A45B 1ZJKA 1GHYH 3UTUH 3T62A 2EI8A 4GCHF 1EX3A 4H42U 1SSXA 3RXRA 3DFLA 1GHAG 1VZQH 3M37A 3OY6U 4XOJA 1ZMJA 1QY6A 2AGEX 2H1UA 1P8VC 3SU3A 1DUAA 3QGJA 4ZHLU 3TJNA 1GI4A 1SLUB 1GHVH 2FI4E 2BVSH 2IOTA 2VWOA 3RXJA 4J2YB 1MD7A 1H9LB 1OKXA 4R0IA 2Q6GA 2J92A 1BRUP 2CV3A 3SNBA 4XBBA 1AGJA 1TBZH 1P3CA 1B0EA 1PPGE 2BLWA 3U98H 5EODA 3Q00A 1W11U 2FOHA 3FFGA 1NY22 2FZZA 3NPSA 2VIOA 1GI6A 1G9IE 3A82A 5F8XA 3D49H 1UCYH 1CT0E 5L2ZH 1MBQA 3Q3XA 1GJ6A 3SV7A 3UR9A 1IHTH 1S0QA 5JDUB 1KXFA 2HOBA 3BTDE 1YPHC 4K2YA 1EASA 3MH7A 4I7YH 3M36A 3MU8A 1QQUA 3TGKE 3SU0A 1QRXA 2YNAA 3SV8A 3T27A 1S82A 1EAWA 1EUFA 1T4VH 4IBLH 2FXRA 2ZPRA 1H1BA 4BOHA 1C5OH 1XUGA 3VB4A 1SLVB 1F7ZA 1ZR0A 3BEIB 2OINA 3KHVA 1G3EA 4Q80A 5FCRA 2FOMB 2ZGXH 1BTYA 3DA9B 1CHGA 3ATIA 1QRWA 1TX6A 2ZU1A 1OS8A 1GBFA 5E0HA 4MNXA 2DE9A 2O8UA 1OP8A 4JYTA 4U32A 5L6NH 3E8LA 1P06A 1O39A 2ZG0H 1SFQB 1SGNE 1C1WH 1CT2E 1ELFA 1FJSA 3ZV8A 1A4WH 1LVOA 1DXWA 1BITA 4AYYB 5DO4H 3SHAH 1MD8A 2SGFE 2FOEA 1WCZA 2C8YB 2WPJS 1BHXB 1HAZB 2VVUA 2I6SA 4ABIA 3MH6A 4A1XA 4GSOA 2VINA 3GY5A 1GMDG 4INHA 2C8XB 3TH2H 3ZVFA 1DITH 1P09A 3F9HA 3KL6A 2SGAA 4MG3A 1MQ6A 4Y0YE 4UDWH 1ESBA 1KXBA 2BX4A 2OTVA 4MNWA 3LJOA 1C5YB 1O3PB 1TWXB 1MTUA 2OLGA 1OX1A 1Q2WA 1SLXB 1C4Y2 2SNVA 2W26A 5HMAA 3K2UA 5JBAS 1JRSA 5IDKA 5L30H 1V6DA 2BQWB 3RU4T 1Y3UA 1AUTC 5H4IB 1GMHF 2W3IA 4BNRA 1N8OC 1QBVH 1AZ8A 2J9NA 1KIGH 4I8KA 1IHSH 2P94A 4GHQA 2RA0A 2GGVB 1IAUA 1HJ9A 2FYQA 4GPGA 2GKVE 4GUXA 1TBRH 1RIWC 3UR6A 2W7UA 4WXVA 2ZPSA 1FPCH 1A5IA 1N1LA 2BDYA 1AE8H 1T8NA 1CU1A 3MO9A 3MFJA 1D9IA 1P2OA 5K0HA 3GCTF 2NU0E 2FOGA 1DE7H 1TGTA 2BLVA 1AY6H 1CBWB 1A0HB 4HFPB 4YZUA 1ELDE 1DS2E 3EA7A 1BB0B 2BD4A 1O2RA 1DLKB 3MU4A 3ZVBA 2ZCLP 5JBBS 4WMDA 1P12E 1GWAA 2C8ZB 5JBCS 2H2ZA 1SGEE 1DUEA 2ZGCA 3IITA 3S9CA 4BAMB 1EATA 1DM4B 4NZLA 4XSKU 5GDSH 4CH2B 1NRQH 4NFFA 4CBNA 2PR3A 1F5RA 2UUKB 1C5RA 1YM0A 4JZIA 3AAVA 2VH0A 3SBKA 2ZWLH 1HGTH 4OS7A 1GI0A 1ZMLA 1BMMH 4A1VA 4YT6H 1O2YA 5DP4A 1MCVA 2GT7A 1FZZA 1EZUC 2O8TA 3ESTA 1ZOMA 1MMJN 5LPFA 2D26C 1A5HA 1ZMNA 1YPGH 1IQIA 1YF4A 4SGBE 1C1MA 1EJAA 2TPIZ 2XCFA 1C5VA 5A8ZA 1HAYB 1GHXH 4I33A 3L6PA 3QGNB 1P2MA 1QIXB 1C4U2 1C9TA 1SLWB 1BMAA 3HK3B 4Y76A 5ESBA 4CR9A 5HM9A 1AKSA 3ZYDA 4JCNA 3SUGA 2Z3DA 5AHGH 3SO3A 2JH6D 2ZQ2A 4MPUA 1DX5M 1ZPCA 1EPTC 2VIPA 5EW1H 2QN5T 4D76A 3KIDU 3ITIA 2ZFSA 4CRCA 4VGCB 1TMTH 2C4FH 3L33A 2FDAA 4FUFA 1ETTH 2HNTF 3PMBB 5DGJA 1TGCA 1EXFA 4WY3A 3A7ZA 1BDAA 1FY1A 3RP2A 1G36A 2AGIX 1NTPA 1O5FH 1L4ZA 1V2PT 1XUJA 5AVDA 3VB3A 2TGAA 1BUIA 1AFEH 1M9UA 3RXUA 4GAWA 3HK6B 2GTBA 2FX4A 1Y3WA 2UUFB 1YKTA 2H5CA 3MU0A 2W7SA 4Y11E 1OPHB 3FZZA 1V2RT 1XXDA 3ZZ4A 2CF9H 2PKSB 3VGCC 1S0RA 2O8MA 3C27B 2PGQB 2FODA 4UFGH 1TGBA 1QRZA 2OD3B 1T8LA 1PPCE 2R0LA 1Y5UT 3MU5A 1GVZA 3A81A 2GCHG 2CHAC 1BCUH 3LH1A 1ELVA 3ATLA 5JBTA 5JPMH 2ANYA 5DPAA 4FU9A 3H7OA 3MMGA 2G5VA 1A46H 1F0SA 1O5GH 3SGAE 3DFJA 1NFWA 3RXVA 2OC7A 1V2QT 1ANBA 1WOFA 1FIZA 3KEEA 1O3BA 1Z7KA 2O9QA 2A4QA 1Z1JA 1WQVH 4LK4A 5AF9H 3AVZA 2ZNKH 1SGCA 1P02A 1HJ8A 1OYQA 2ODPA 1C5UA 1EQ9A 2GMTC 1SGTA 4X2YA 1A7SA 3KCGH 1HIAA 2PV9B 4KKDA 3ELAH 1CO7E 2BY8X 3KQDA 4OS2A 1TRYA 1F2SE 5A2MH 3SV6A 1SBWA 3BG8A 2PKAA 1O5DH 4AN7A 1O2HA 2ALVA 4BAQB 2FLBH