2BLOA

Elastase before a high dose x-ray "burn"
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bloA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bloA01
4O97A 3IG6B 1CVWH 3RXQA 2H5DA 2HLCA 3DFJA 3R0FA 1UK2A 2F9NA 3GY3A 1UTOA 5LPRA 2FEQH 1P03A 2C90B 4NIVA 3I29A 3RXOA 1AI8H 3GCTG 5DP5A 1RXPA 1W13U 3P17H 1VGCB 1ZZZA 3UNSA 5DK1A 1GHWH 1AVGH 2CF8H 2AFQB 1AQ7A 2DE8A 3GCOA 2ZG0H 4NFEA 1TRYA 2P3FH 3ZZCA 1TGNA 2CHAB 3AASA 3TITA 1ELGA 2H9HA 1GBBA 2YNAA 4RKJB 4D9QA 1MTNC 5AVDA 3P6ZB 1EZSC 1ZLRA 2Z3DA 2BYAX 3M5LA 3S0NA 2V35A 1Z1JA 2Z3EA 3MH5A 1GHBF 2Y7XA 4U30A 2NU3E 1TNKA 1Y3YA 4K8YA 1AVXA 4YLQH 5TJXA 1QRWA 1ETRH 1P2IA 1EUFA 2ZFFH 4MNXA 1HAZB 1XVOA 1NRQH 4AGKA 2W7UA 7GCHF 5DPAA 2P59A 1GMCG 3M61U 1DM4B 1QB1A 3E3TA 1FN6A 4MPXA 2FOFA 3TNTA 1AZZA 1C2HA 1F7ZA 1KXFA 5JBBS 1O2YA 1C1RA 7KMEH 2ZFSA 1MAYA 2BZAA 2VIPA 1AY6H 1RS0A 2ZF0H 1O3BA 4K1TA 2QXJA 3HK3B 1TX6A 2ZDAH 1B0EA 2QC2A 4XBBA 2RG3A 1P2OA 2Z7FE 1KXBA 5TCAA 3RC6A 1BTZA 2OUAA 3FZZA 1ELTA 2P3UB 3A8BA 3HKJB 1F5RA 3A8CA 3OU0A 1C1PA 1ZPBA 4Y0ZE 1SOTA 3CS0A 2GT7A 1DSUA 3V3MA 5IDKA 3PTBA 3PROA 2A4OA 3LH1A 4X1PU 2I6QA 1HB0B 1HXFH 1A5HA 1M9UA 1BMMH 5EQSA 2TGDA 2Y81A 3BTKE 3OY6U 1LQDB 1XKBC 1C2DA 4BANB 4MTBA 1J14A 2PKAA 3SU3A 2F83A 3SW2B 5L2YH 1TLDA 5FPTA 1D3TB 2C8YB 4SGAE 5E2OA 5SGAE 2WYGA 4ZHAA 1WOFA 1K22H 4K8BA 1D3DB 1QB9A 3ENSB 1CA0B 1LCYA 4LXBH 1OWEA 3LC3A 3TGKE 3LH3A 3SV7A 1J9CH 3EA7A 3QO6A 1AU8A 2Y82A 1HJ9A 1BQYA 3OY5U 1ELEE 5A8XA 1P04A 3E1XB 4GPGA 1ZJDA 5A0BA 4UONA 5LPFA 3BN9A 3VGCB 2PR3A 3BEFB 1HIAA 1UMAH 2WPIS 3TH4H 2VIQA 1O3DA 1BTUA 1TBZH 1DWBH 2ZGXH 1DICA 4MVNA 1VGCC 1ZSJA 4OS6A 1WYKA 4BTUB 2FLRH 4LOYH 4ABJA 3E8LA 4QT8C 3FFGA 1G32B 2BD2A 3MH6A 2PWXA 5PTPA 2R2WU 5FHTA 2P3TB 1ETTH 3F9HA 1XUFA 1MCVA 2CHAC 2P95A 5EW1H 1O2OA 1GHVH 1O2WA 1MBMA 1EJMA 2ZU2A 3MU5A 1HAXB 1O39A 2XC4A 3JZ2B 4ASHA 3A82A 1Q3XA 3U1JB 5JYIA 1XUKA 2GD4B 3SU5A 2Z9JA 2ZHDA 4MQAA 2BLVA 1IHTH 1G37A 1UVUH 1GJ7B 1ZOMA 1O2LA 4D7FA 2QGRA 1FUJA 1C4Y2 2ZHQH 4PROA 5EOKA 1O36A 4UE7H 2G5VA 3GCTF 5ESBA 1O3KA 1SPJA 4Y10E 2ODQA 1TMUH 3T27A 1H4WA 2J34A 1K1MA 2Z9GA 4HI3A 1O3CA 4X8VH 4UFGH 3A80A 2FI3E 1EAIA 4JZFH 3SJOA 1DOJA 1P0SH 2SGQE 3NK8A 5CE1A 2ANWA 1C5WB 1EX3A 4GCHG 3KN2A 2YNBA 1C1VH 2A5AA 3BTGE 1ZTJA 5C1UA 2FX6A 3W94A 1J15A 1SI5H 2TIOA 1E36B 3U69H 1K9OE 2FPZA 2VVCA 3EGKH 1CA8B 1K1LA 1CBWC 4UFEH 1C2IA 1LKBA 1VITH 3PTNA 5EXNA 1KTSB 3S7KB 1NZQH 2ZZUH 1MKXK 4CRGA 1Z8JB 4GHQA 2C93B 1K1OA 2O8TA 1WV7H 3ZVCA 1JOUB 1CGJE 4LZ4B 1BRBE 3T29A 3BTME 1C5QA 5T6DA 1ZPCA 1GMCF 2F9UA 2VVUA 2ZECA 1A3BH 1P09A 2O8UA 1PPCE 3RUOA 3LT3A 1C1TA 4AB9A 1CHGA 4H6SB 1K1JA 3RU4T 1GI2A 5EGMA 1SGNE 2VIWA 5LH8A 1RTFB 1BMAA 3ESTA 1SGPE 2VJ1A 1C5RA 3GYMA 2A7CA 2ZEBA 3ZZ6A 3V7TA 1AFQC 2XC0A 2BLQA 2ZGBH 2BLWA 1YPJH 4AG1A 2R0KA 1A3EH 1T8NA 2A1DB 2ZTXA 3AVZA 3O8RA 1QJ6B 9LPRA 3ZVAA 4A1VA 1TNIA 2GCTB 1EAXA 1ZYOA 2CGAA 3RXLA 2QY0B 1IQKA 1NFXA 1GDNA 1J16A 1S84A 3ZVGA 1AGJA 3EDXB 3LONA 1EPTC 2A31A 1TABE 3PMBB 1O2KA 2BLOA 5GCHG 2PGBB 1ANEA 2J95A 2AGGX 5T6FA 2GMTB 3P70B 2J92A 3ZZ8A 2JH5D 2QF0A 4K2YA 1O2QA 3E16B 1SOZA 1SGTA 1EB1H 1SHHB 4UDWH 4K1SA 3C27B 1ZMNA 5C2ZA 1BMNH 2G51A 2JH0D 3UOUA 3MNXA 5E0JA 2FS8A 2ALPA 2OP9A 5GIBA 1O3MA 4YESB 2WPHS 2H5CA 2PFEA 1V6DA 1UVOA 3B8JA 4ABAA 2XCNA 3UQVA 1BRAA 1D4PB 4CRAA 3MU8A 1QIXB 3RXEA 2FX4A 1UVSH 1PFXC 1LHCH 1MTWA 1KLJH 1GI0A 1ELAA 1GHYH 1O2SA 4R8TB 4GVUA 5CMXH 1BBRK 3RMOH 3RXAA 2NU2E 2ZCHP 1P2MA 2ZDLA 3VB7A 3FZDA 1CHOG 3TLOA 1KDQB 3LPRA 3SN8A 5FX5A 5HMAA 4JZ1A 1K1NA 1YYY1 5A0CA 1JXPA 1KXCA 1GJ6A 4FUDA 2PTNA 3URCA 1SQOA 4TPYA 4X6NA 4AX9H 2ZPSA 2GZ7A 3GCNA 5ESTE 1O37A 5EQRA 2BQ6B 2BMGB 2FI4E 3MO9A 4FU7A 1WSSH 1GMHG 1PPFE 4FU8A 1A5IA 5E2PA 1MMJN 1GJ5H 3C1KA 4K1EA 1ELFA 3TJVA 1MQ5A 4J2YB 4ESTE 1IQFA 1YPLH 4Y8YA 3VB4A 2F9OA 5F03A 5DKMA 3QN7A 5JBAS 2XBWA 2AS9A 2OD3B 4ZH8A 1TWXB 1RTKA 4O3TA 4UEHH 1EAWA 1EZXC 2W7SA 3SU2A 1ESAA 1DWCH 3E6PH 4ISLA 1IOEA 1C2KA 2SNWA 2AGIX 2J38A 2EA3A 4I8LA 3SHAH 1MAXA 2W26A 4GCHF 4A92A 3ODFA 1SVPA 1GBLA 1Y59T 2CXVA 2PHBA 2VH0A 4Q7XA 3UNRA 1CT0E 1HBTH 3QZQA 1MTSA 4E7NA 3K6YA 1MD8A 1L1GA 2ZPRA 3MTYA 3BTDE 3GISB 1HXEH 2ZA5A 1UTMA 2ZU4A 1OWDA 1TQ7B 2BXUH 2ZTZA 2NU0E 5HM2A 4AFSA 1SGIB 5E8EH 1HCGA 2IJOB 3RXRA 5IYTA 1C9PA 2FYRA 4A7IB 2H9TH 1LVYA 1LHEH 2QXHA 1FIWA 1G30B 3QWCH 3T2NA 3QGNB 1F5KU 1DPOA 1BZXE 1B7XB 2FDAA 4BOHA 1ELBA 1O5EH 2J9NA 2ZNKH 1A46H 2GMTC 5A8ZA 1UCYK 4B75A 2BD4A 1GBCA 4CBOA 3PB1E 3LU9B 3PM3A 4VGCB 1G36A 3BV9B 3GY5A 1F0SA 3HATH 1IQEA 4A1TA 3JZ1B 1C1MA 1ORFA 1CSOE 1FI8A 5LPEA 2A7JA 2HOBA 1RIWC 1GBDA 2FESH 1DLEA 3M7QA 4ABEA 2ZDKA 4MNYA 1SQAA 3RXFA 1QR3E 1XXFA 3LC5A 1Y3UA 3GY8A 3PWCA 2CN0H 2FTLE 2VGCB 2SGDE 1BHXF 1QBNA 4YTAA 3ZV8A 4BTTB 1QY6A 1Y5AT 1MQ6A 2VIOA 1BTWA 3SUFA 3NWUA 1TBQH 4K5ZA 3ZZAA 1EZUC 1E35B 1EP5A 2ZGCA 1P10A 5F8XA 5GCHF 1DXPA 2UWPA 3MH4A 1TOMH 5JB8S 3A86A 3MOCA 4H42U 4BNRA 2AGEX 4Z0KA 3HPTB 4UFDH 4FUHA 3V13A 1OWHA 3ZZ5A 1ANBA 1UJ1A 5EQQA 2K1QA 1C1QA 3GYLB 1QGFA 4XSKU 1UTKA 1ELCA 4NWKA 4X8TH 5HM9A 1O30A 2IN2A 1CGIE 1YPMH 1QFKH 3STJA 3QZRA 3VB3A 1L1NA 1NRSH 3KQCA 1EAUA 1O2HA 2A4RA 3TGJE 1L1JA 1UHBB 2J2UA 4UFFH 4X2WA 3RXJA 2W5EA 2CJIA 1LVMA 2Z9LA 3E91A 1C2FA 2C8WB 5EPNA 1AKSB 2AMDA 1XUJA 4MPVA 1CHOF 2FI5E 2SGEE 2IOTA 1CO7E 3ZYDA 4IMQA 1UCYH 2QIQA 1FPHH 1MTUA 7LPRA 3QLPH 2QXGA 3K2UA 2VB0A 1YM0A 5JDUB 2WUBA 1ABJH 2GT8A 2C4FH 5EXMA 4BAQB 1E0FD 1IQHA 4IN1A 5DP3A 1WAYB 1O2JA 5C3NA 1XUGA 4JZEH 2BB4A 1HJ8A 3RU4E 1GMHF 1BRUP 3KGPA 2BVXH 2Y5GA 1H1BA 3S9CA 1O2VA 4A5TS 3QGJA 4THNH 2OBQA 4ABBA 1GHAG 3GOVB 1Y3XA 1SLVB 4AORA 3BEUA 3TPIZ 1DS2E 2HNTC 1YLCA 3VEQB 1YCPH 3A85A 1A0HB 4INLA 3SGBE 1ZGVA 1TGTA 4VGCC 4CRDA 1O3IA 1S5SA 1ELDE 3RXCA 1UTNA 1P2QA 5AF9H 1HAVA 4UD9H 4KP0A 2BM2A 3GICB 3RXPA 2HNTE 1EB2A 2F9BH 2VGCC 1EASA 4CHAC 1NESE 4ZHLU 1P9SA 3RDZA 2P94A 2ZHWH 2RDLA 1QRZA 2AIPA 2XBXA 1GJAB 2QAAA 1S6FA 3MFJA 4INHA 3ZV9A 3P8NA 4DGJA 1ZTKA 2J4IA 1UTPA 3L33A 1Z6EA 1NN6A 1X7AC 3TVJB 1SHYA 2GX4A 5JBTA 5L2ZH 4F4OC 3SUEA 4BAKB 4FVDA 2PLXA 1ANCA 1SLUB 4HZHA 4TY7A 3RLYH 3T26A 1FJSA 1TPAE 4FUFA 2SGAA 4CREA 4ABDA 4AGJA 4CRBA 2BX3A 1O5BB 4NSYA 1NRPH 1C1UH 2A32A 1TPPA 3P8OA 5K7RA 2BD3A 1GDUA 1CBWB 3BTTE 3QX5H 1GBMA 3HGNA 3BTQE 4AG2A 3RLWH 3SNEA 4JYVH 2WYJA 4Y79A 1ETSH 2BY7X 1N8OB 4AYYB 3KL6A 4JZIA 4SGBE 2G81E 1XXDA 3B23B 2Z94A 4ISNA 9ESTA 1U6QA 1P3EA 4Z6AH 1W0ZU 5BRRE 1RTLA 2FIRH 1H9IE 4DY7B 2CF9H 2EEKA 4JCNA 5GDSH 4X2YA 1KYNA 3UWIA 1N1LA 1A0JA 1V2NT 1HAIH 3FAOA 1PQ7A 1F5LA 2A7HA 2VINA 1ZRBA 1HAGE 1LTOA 1RFNA 2XYAA 1K28D 1P3CA 3Q77A 3WY8A 3A7ZA 5FPSA 2JETB 2GDEH 1AFQB 1E34B 4FUBA 4B73A 1AD8H 4WJG2 1GL0E 3RU4D 1BUIA 2RA3A 2VVVA 3PLBA 3TU7H 4XOJA 1P2NA 5EW2H 1MBQA 1QRXA 1SG8B 1PPBH 1T4UH 1YCPM 3KNXA 3TK9A 1PJPA 1LHFH 3EQ0H 4OS5A 1J8AA 1FLEE 1NRRH 1V2LT 3P95A 1EPTB 1GPZA 3IITA 1BTXA 5FBEA 1O2RA 2OLGA 2FOHA 2PUXB 1GBKA 3HK6B 4YO9A 2F9VA 3MNCA 1SLXB 1DWEH 3K9XB 2UUYA 1NU9A 2B9LA 5DO4H 1ESBA 1V2VT 2ZCLP 3VXEH 4TY6A 2F91A 4X1RU 1QQUA 3BTFE 2FYQA 1JMOH 3VPKA 1QA0A 5AFZH 1G3EA 3BIUH 1O5CB 1UCYE 5ABWA 1V2UT 3H7OA 3RMLH 3BG4B 1GBHA 1Z6JH 2ZDNA 1ESTA 5EODA 2OC0A 4NIWA 2KAIA 1F2SE 1J17T 4KTCA 2AMPA 5DG6A 3UQOA 1G3CA 1NS3A 2Q6DA 1QL7A 1GI3A 1KLIH 4H4FA 1GHAF 1DDJA 4Y8XA 2VWLA 5F8ZA 5EXLA 3PYHA 2A45B 4JYUH 1G2MA 2BY9X 3F1SB 2QXIA 3OSYA 4DG4A 2ASUB 2BD5A 1JBUH 3PO1B 2VWMA 2QF3A 3A84A 5C5NA 5FAHA 3MMGA 1DUEA 1TAWA 1SLWB 1AN1E 5FBIA 3TIUA 2GTBA 2P16A 3OYPA 2OQUA 4WY3A 1DE7H 4Q80A 1THRH 1HDTH 3SV8A 4AFQA 1D6WA 8GCHG 1TQ0B 4CH2B 5DGJA 1G2LA 1ZHPA 4BAOB 5C1XA 2ODYB 1PPZA 1ZPZA 2HALA 2Q1JA 1C5YB 5DP9A 2QCYA 2BQ7B 2LPRA 1N8OC 2ZFQH 3UIRA 3LJOA 2BOHB 2W3IA 1A5GH 2C3SA 2SGFE 2ZO3H 3PMHB 2ZU5A 2B7DH 2QYIA 1FY5A 1SGCA 1Y3WA 2D26C 1D9IA 3RXKA 3F9EA 4E7RG 3PLKA 1GGDB 4FUGA 4H6TA 5C20A 5C67A 2BY5X 1P8VC 2EC9H 1THSH 1GI7B 1ID5H 2XWBI 1T32A 1S82A 2JETC 4K60A 2BOKA 2PKSB 1O3JA 2UWLA 3RMMH 1BJUA 3AAVA 4K69A 2FS9A 1T31A 1AE8H 1AZ8A 1O2UA 3ZYEA 1RGQA 2XXLA 1O5GH 3V12A 2WINI 4MLFB 2Y6TA 1TYNA 4NIXA 1JIRA 2B5TB 4E06H 3SQHE 4I32A 2JKHA 2GVFA 5CHAB 2FXRA 3T62A 1SGQE 1FMGA 4AFZA 4DVAU 3RXUA 2BDBA 3E0NB 1PQ8A 1B5GH 4NA9H 5H4IB 1L4DA 3A7TA 3M3SA 1T8LA 3RM2H 2FO9A 3EE0B 2PUQH 2G52A 1A2CH 3NPSA 5L6NH 4B2CA 3KF2A 3EYDA 1FAXA 4AFUA 3V0XA 1C1SA 1DWDH 3SUGA 1XM1A 1RIWB 4BXSA 2BQWB 1ZGIA 3U8TH 5GXPA 1NRNH 1WTGH 4X8SH 3SU0A 4CBNA 1SGRE 1LQEA 1MH0A 1QJ7B 2H2ZA 3BG4C 5DP7A 1VCPA 1XUHA 5F8TA 1VR1H 1O32A 1WTHD 2FOCA 2TGPZ 1HAOH 1GI5A 1UTQA 3LIWA 1OXGA 5L30H 4Y7BA 3I77A 1O3EA 1JRTA 1MKXH 3P8FA 1HFDA 6GCHG 4JK5A 1O2MA 2PKAB 4NCYA 5EPYA 1ZMLA 4INKA 2GDDA 3BTHE 4WMDA 1XKAC 1TONA 2NWNA 1LPGB 2V0BA 1FNIA 1EZQA 2WUCA 2ZFTA 4IMZA 3PO1C 1MZAA 3PLPA 2PGQB 4CR5A 3GCHB 2D1JA 2R0LA 1V2OT 1ANDA 2DUCA 1W7XH 1BMLA 1HAPH 3KCGH 1NY22 8KME2 4I8KA 3ZZ4A 3SV9A 1TPSA 1V2MT 4IS5A 4YT6H 4IN2A 1GBFA 2F9PA 2BX4A 1MU6B 3U8RH 2BDIA 1TA6A 4I8JA 1EKBB 2A0QB 4RKOB 4XBDA 1HIAB 3TJUA 3ELAH 1O3NA 2GZ9A 5C1YA 1PPGE 2WPJS 1AWHB 4B1TA 2HVXA 2ILNA 4DIHH 3STIA 1OOKB 3A83A 1HGTH 3LGUA 1BHXB 1GCTB 3BTEE 3AAUA 1GGDC 4IC5A 1YGCH 4YOGA 2HGTH 2P93A 1Z71A 1W11U 3U98H 2R2MB 3ZZDA 4BAMB 5JB9S 1O3FA 1LKAA 1TGBA 1ZSLA 2ZFRH 1H8DH 2ALVA 4I31A 3VXFH 1IQLA 4AYVB 2FOEA 3ZVBA 2PKSC 2VH6A 1YPGH 3O8BA 5GWZA 3UOPA 4NZQA 3QUMP 1WQVH 1GHXH 3ATMA 1G3DA 2G5NA 1FV9A 1BT7A 2XBVA 3S69A 1C2LA 3BIVH 8GCHF 3GY2A 1SMFE 1IAUA 1L2EA 3LJJA 2AYWA 3DT0H 3MI4A 1GBTA 3A7WA 3ZZBA 1WUNH 4Y8ZA 5CHAC 2WPKS 3TH3H 3KEEA 4KTSA 2WPMS 1OWKA 1CE5A 1AWFH 2VIDA 1DY9A 1DXWA 3Q76A 1GVKB 1BBRH 4AN7A 2VU8E 3ATIA 3RXHA 2V6NA 3M3VA 1QQ4A 2HPPH 3ATWA 5JPMH 3MNSA 3MO3A 3NUMA 2EI6A 2FWWA 4Y76A 4WMEA 2VIVA 4ZHMU 1DSTA 1KXDA 1OP0A 4KGAA 3O8CA 1NTPA 1HPGA 2D2DA 1NFYA 1TFXA 1W10U 4CHAB 2ZC9H 4U2WA 4KELA 1NC6A 3QDZB 1HJAB 1AB9B 4Y71A 1F92A 4KKDA 1C5XB 1WCZA 1O3LA 2FMJA 1IQMA 5J4SA 4LZ1H 3CENA 1WU1A 2GKVE 1G9IE 1MU8B 2DE9A 5J4QA 3FP6E 3S7HB 1MD7A 4NSVA 4ISOA 1JRSA 1RJXB 4RSPA 1FZZA 5DP8A 1SGFA 1PPHE 2HWLB 3MU1A 4X1QU 3LOXA 5T6GA 2XW9A 1TRNA 3SQEE 5FXLA 3FP7E 3GY4A 2V3HH 4Y11E 3GCHC 1UK3A 4NWLA 3A87A 3GDVA 1FIZA 2PV9B 2ANMH 4YLUA 1S6HA 2OC1A 3ZZ3A 3EAJA 4OS2A 1IHSH 1ZR0A 1AE5A 1O34A 1TNGA 4FXGH 1YPHC 1BTPA 1C5TA 1CGHA 4ABGA 1PQ5A 4F49A 4NIYA 1C5VA 4I7YH 2M5TA 4MPUA 3D23A 1KIGH 2BDAA 3T5FH 6CHAC 3B9FH 2XC5A 4MNWA 4X1NU 3LDXH 3SU1A 2ZGJA 1TNJA 1GCTC 1YLDA 6GCHF 1B0FA 3SI4H 4YOJA 2RA0A 1C4V2 1YPHE 5GJ4B 5FCRA 3SHCH 2WV4A 1O0DH 1ZMJA 1EXFA 2ZQ2A 1ARBA 1C5OH 1FY4A 2UUJB 1EJAA 2HPQH 1AHTH 1BTYA 1S0RA 1VCWA 3MHWU 1O2IA 2J94A 1V2JT 4U32A 4I8HA 1W7GH 3K6ZA 1GI4A 2BY6X 2BXTH 3A88A 3FANA 4WH8A 1DANH 1Y5UT 3Q00A 4DT7B 2F3CE 2ZPQA 3P92A 2Y7ZA 1KY9A 2STAE 1O2NA 1GMDG 1V2QT 2ULLA 1DVAH 2H1UA 2ZFPH 1TNLA 4AOQA 3RM0H 3TK6A 1W0YH 1DUAA 1W14U 4O3UA 1T8MA 1C5ZB 1O3AA 3RXIA 1S0QA 1GI9B 1QHRB 1TB6H 2QV1A 1VJ9U 1TMBH 3GY7A 1TIOA 4X6OA 2XBYA 4TWWA 1P05A 1EQ9A 2A5KA 3VB5A 1C1WH 3GDSA 3LGWA 2Y80A 1C2GA 1DLKB 5ETXA 3BSQA 3RP2A 1QA7A 2BD9A 3VFEA 1W2KH 3TNSA 1O3GA 3EA9A 3FP8E 4X1SU 4DW2U 1V2ST 1E38B 5E0GA 1AVWA 1UK4A 2O8WA 1HUTH 2O8LA 1HJAC 1AB9C 1W3CA 4D9RA 1HNEE 1YKTA 1SGFG 1ZRKA 3SUDA 1C5MD 2GV6A 1GDQA 3A8DA 3M36A 3RXBA 1D3PB 1Q2WA 1GI8B 1LHGH 2JH6D 2CMYA 3IWMA 3PWBA 1VZQH 3KHVA 2Q6FA 3SV2H 2Z3CA 1LHDH 4K3JA 4B74A 3MU4A 4DCDA 1DY8A 1KTTB 1A7SA 2SFAA 2GGVB 1AMHA 2ESTE 2ZTYA 2TRMA 1QL9A 1EP6A 1SQTA 1H9HE 2NU4E 2RCEA 3RXDA 2FODA 3LGYA 1BBRE 1Z8GA 1BB0B 2ANYA 1BA8B 5EU8A 1KXAA 3UFAA 4OS4A 3URDA 1BITA 4A1XA 4RN6A 3A81A 4ZKRU 1TBRH 5I25A 3BG8A 2QN5T 2ZGHA 3M37A 3GY6A 3K65B 2FOBA 3T25A 1V2TT 2ZIQH 1AIXH 1YP9A 1GJ9B 1BRCE 3KQBA 2A2XH 4ZMAH 3RXMA 2ZU1A 3N7OA 3EA8A 4D8NA 1BIOA 1ZHRA 1NT1A 2TGTA 3L3TA 1Y8TA 3ZVEA 2Z9KA 4LK4A 2BDHA 2BVSH 4WWYA 5HYOA 1T4VH 3M3TA 3W95A 4U01A 1FPCH 1MZDA 1FY3A 2WPLS 4XDEA 1V2WT 3TJOA 2VWNA 3P8GA 2FLBH 4TWYA 2NU1E 8ESTE 1GBJA 1N6YA 4DJZB 2FM2A 4AZ2B 1H8IH 4BTIB 1Y5BT 4M7GA 1DX5M 3RXGA 3T28A 2P8OB 4MPWA 3CP7A 1GBEA 1KDQA 5FCKA 5A09A 3PV4A 1K1PA 1GBIA 2PSXA 3KIDU 1MKWK 4Q2KA 1F0UA 1GJ8B 1C1NA 1OYTH 4GLYA 3PMAB 4Y0YE 1SBWA 2OC7A 2BZ6H 3S9AA 1PYTD 1VJAU 3TH2H 4IBLH 1OS8A 4YT7H 1QL8A 1C5SA 3KQEA 3F9GA 3A8AA 1FXYA 1GCDA 2ZDMA 4JYTA 3SO3A 1XX9A 1C2EA 1O2GH 2FOGA 2VWOA 1VITG 2GZ8A 3BEIB 4GAWA 3SNBA 3H7TA 3M5MA 1ABIH 2FOMB 3SGAE 1NO9H 3D62A 3SJ9A 4CR9A 1EOJA 2PSYA 1GMDF 4WVPE 1H9LB 1RD3B 4WH6A 4AB8A 1ZSKA 3ITIA 1GJCB 1Q31A 1XUIA 4ZKNU 3F6UH 5A2MH 1GBAA 2FZZA 1HV7A 5HGGA 1OPHB 2W3KA 1C4U2 1OSSA 2A4QA 4ISIH 3H5CB 1P2KA 3BF6H 2OCVB 3UR6A 1FQ3A 2BY8X 1JWTA 3SU6A 4J1YA 2ZDVH 4WMFA 4Q7YA 3QK1A 4MDSA 5LGOA 4X2VA 6LPRA 2OQ5A 2ZQ1A 3Q3XA 3SORA 1O5DH 2ZI2H 3D65E 4HGCA 1DITH 1SFQB 3M5OA 4WXIA 4ZUHA 3GDUA 3G01A 1AFEH 2HRVA 1Y3VA 3Q3YA 3NZIA 2YOLA 2G00A 1GG6B 3R3GB 4GSOA 4I8GA 4JZDH 1O2ZA 1ARCA 6ESTA 2Y5FA 3VB6A 1GL1A 2BDGA 1MUEB 1AO5A 1UTLM 1XMNB 4NA7A 4OS7A 4TPIZ 1XVMA 2XTTB 4X8UH 4B71A 1TA2A 1IQJA 2QA9E 2FOAA 4MNVA 3OX7U 1EJNA 1UVPA 4NZLA 4X6PA 1P06A 4YZUA 1N6XA 3UREA 1ZJKA 3PMJA 1MKWH 2EI7A 3NCLA 2ZCKP 3TGIE 4NFFA 1TMTH 3O8DA 1QTFA 3E0PB 1YF4A 4ZAEA 1QBVH 3E90B 1HYLA 7ESTE 4BXWA 1HLTH 2BD7A 2WV5A 1HAVB 3UPEA 1P02A 2R3UA 5A0AE 1MCTA 2LNCA 2OXSA 1FAKH 1C2MA 1ZTLA 4HFPB 1T8OA 4WXVA 5EG4A 5BPEA 3M35A 2P8OC 4DOQA 1DFPA 2ZWLH 1LVOA 1CA0C 5A8YA 1V2RT 1BDAA 1SSXA 3ZVDA 3I78A 2TBSA 3TJNA 1VCQA 1V2PT 5TCCA 3ATLA 3DA9B 2XNIA 1TALA 2H9EH 1SGYE 2XRCA 3DHKH 3VGCC 5AHGH 4ZXXH 1WQSA 1MTVA 2G4TA 1UHBA 2BD8A 2TGAA 2BHGA 2STBE 1IQNA 2ZU3A 3UR9A 1UVTH 2XWAA 3AW0A 1S85A 1YPEH 1YBWA 1LPZB 4MG3A 1OKXA 1HRTH 4KTUA 5K0HA 3HKIB 4E05H 1GI6A 3UTUH 1QURH 1W8BH 1AUJA 4O03A 1THPB 1AKSA 1C2JA 1W12U 2PTCE 1L4ZA 3ODDA 4JK6A 5G4BA 2G8TA 4NA8A 1TGCA 4B2BA 1LDTT 1RRKA 1FY8E 2ZHFH 2GP9B 4X2XA 3SJIA 2AERH 1ELVA 3MWIU 3SOSA 1QCPA 1K21H 1P9UA 3RXTA 2R9PA 4GHTA 4XE4A 2CV3A 4TYDA 2AIQA 1TPOA 3S9BA 2GCHG 1UTJA 4FU9A 2A5IA 5HXFA 5FPYA 2Z9IA 2SNVA 5E0HA 4ZKOU 4YOIA 1GHZA 2IPHA 5C5OA 4B76A 2PW8H 1LPKB 3RC5A 1FONA 2ZHEH 1TGSZ 4X6MA 1C5LH 1OYQA 1O35A 1LO6A 1QB6A 2XCFA 1VITF 3M5NA 3UWJH 1O33A 4FUIA 1GG6C 3M7UA 4CRFA 1KXEA 2BTCE 2B8OH 1CT2E 1IQIA 1A1RA 1C5PA 3SNCA 1C9TA 4WF8A 2VNTA 1Z8IB 4CH8B 1S81A 6CHAB 4IGDA 1EOLA 3MNBA 2Z6BD 2TPIZ 1O38A 3A7YA 2D8WA 3SJ8A 1CU1A 1GJBB 2O8MA 4DIIH 1TRMA 3MU0A 4Y6DA 3CS7A 1NFUA 1OWIA 1BOQA 3ZZ7A 3RC4A 1KLTA 4NGAH 1SR5C 3DUXH 3L6PA 3F9FA 1TX7A 1C5NH 1ZHMA 4ABIA 3SGQE 1Z8RA 3SU4A 3Q3KA 1LVBA 3OTJE 1BJVA 1YPKH 1O3PB 1O3HA 5I46H 2KAIB 3MH7A 3SNAA 3SI3H 1YC0A 1JIMA 1GI1A 2A2QH 3QTVH 1OP2A 4Q7ZA 2BDYA 2AMQA 3QTOH 3MO6A 4CRCA 4ZXYH 1GVZA 3UY9A 3A7VA 1F0TA 1GHBG 4BAHB 5DJ7A 3SNDA 1NROH 1INCA 2GCTC 3HGPA 4XBCA 2ODPA 4X0WU 2UUKB 2R3YA 1K2I1 5T3HA 8LPRA 3LGTA 3LGIA 2FTMA 3SJKA 1E37B 1Z7KA 2UUFB 7GCHG 3DD2H 5FX6A 2G4UA 1A4WH 4B2AA 1QJ1B 5GPIB 1F0RA 2OBOA 1EATA 1SC8U 3AW1A 5AFYH 3TK5A 1AUTC 3A89A 1SGEE 4FUCA 1C5UA 1L0ZA 4A6LA 4NG9H 2I6SA 3M7TA 4IC6A 1P2JA 4XFQA 2ANKH 1HAYB 1D6RA 1Z1IA 2Q6GA 4JMYA 3RMNH 1MTNB 1O5AB 1SL3A 2OINA 4I33A 4GUXA 2B0FA 2AEIH 1G3BA 2H6MA 1CT4E 1V3XA 4ISHH 2C8ZB 1TOCB 1GJ4H 1OX1A 1O5FH 2Y5HA 1SB1H 3ZZ9A 3BTWE 2THFB 3LGVA 1P12E 1D3QB 2C8XB 1O2TA 2BVRH 1YCPK 1C1OA 3UNQA 1EPTA 4ABFA 3A7XA 1OP8A 4D76A 2AH4X 1PPEE 3RXSA 3RXVA 1NU7B 2FP7B 5DP4A 1TNHA 2GV7A 1FY1A 3NKKA 1DT2A 5B6OA 1GWAA 1NPMA 1QNJA 1O3OA 1WBGB 2ZKSA 3U8OH 4FUJA 1TE0A 3NXPA 1PQAA 4HTCH 1IQGA 3D49H 1O31A 4D7GA 1GVLA 2EI8A 2G55A 3ATKA 4DURA 2BDCA 1QBOA 4Y7AA 3KQDA 1S83A 3ZVFA 1A61H 4IW4E 3SV6A 3UUZA 2O9QA 2GCHF 1O2XA 2ZP0H 2UWOA 1ACBE 1KSNA 1GJDB 2OTVA 1BTHH 2HNTF 5JBCS 1BCUH 1FDPA 1P57B 3SZNA 1FN8A 4FUEA 3F68H 2V3OH 4FVBA 1T7CA 2A4GA 2SGPE 1OWJA 1HAHH 1TX8A 1UO6A 4R0IA 1A0LA 1NM6A 3SBKA 1NFWA 1SFIA 5DP6A 5F6MA 3U1IB 1P01A 4ZKSU 3LKWA 4O9VA 1CQQA 4YM9A 3FVFB 1PYTC 1SGDE 1K1IA 4ZROA 4ABHA 2OC8A 1LMWB 4OGXA 1V2KT 4OGYA 1O2PA 3DFLA 3MYWA 3U9AH 1P11E 4OS1A
chains in the Genus database with same CATH superfamily
4O97A 3IG6B 1CVWH 3RXQA 2H5DA 2HLCA 3DFJA 3R0FA 1UK2A 2F9NA 3GY3A 1UTOA 5LPRA 2FEQH 1P03A 2C90B 4NIVA 3I29A 3RXOA 1AI8H 3GCTG 5DP5A 1RXPA 1W13U 3P17H 1VGCB 1ZZZA 3UNSA 5DK1A 1GHWH 1AVGH 2CF8H 4ZCNA 2AFQB 1AQ7A 2DE8A 2IJD1 2ZG0H 3GCOA 4NFEA 1TRYA 2P3FH 3ZZCA 1TGNA 2CHAB 3AASA 3TITA 1ELGA 2H9HA 1GBBA 2YNAA 4RKJB 4D9QA 3DSGA 1MTNC 5AVDA 2RFKC 2LELA 3P6ZB 1EZSC 1ZLRA 2Z3DA 2BYAX 3FKSD 3M5LA 3S0NA 2V35A 1Z1JA 2Z3EA 3MH5A 1GHBF 2Y7XA 4U30A 2NU3E 1TNKA 1Y3YA 4K8YA 1AVXA 4YLQH 5TJXA 1QRWA 1ETRH 1P2IA 1EUFA 2ZFFH 4MNXA 1HAZB 1XVOA 1NRQH 4AGKA 4F55A 2W7UA 7GCHF 5DPAA 2P59A 1GMCG 3M61U 1DM4B 1QB1A 3E3TA 1FN6A 4MPXA 2FOFA 3TNTA 1AZZA 1C2HA 1F7ZA 1KXFA 5JBBS 1O2YA 1C1RA 7KMEH 2ZFSA 1MAYA 2BZAA 2VIPA 1AY6H 1RS0A 2ZF0H 1O3BA 4K1TA 2QXJA 3HK3B 1TX6A 2ZDAH 1B0EA 2QC2A 3OTPA 4XBBA 2RG3A 1P2OA 2Z7FE 1KXBA 5TCAA 3RC6A 1BTZA 2OUAA 3FZZA 1ELTA 2P3UB 3A8BA 3HKJB 1F5RA 3A8CA 3OU0A 1C1PA 1ZPBA 4Y0ZE 1SOTA 3CS0A 2GT7A 1DSUA 3V3MA 5IDKA 3PTBA 3PROA 2A4OA 3LH1A 4X1PU 2I6QA 1HB0B 1HXFH 1A5HA 1M9UA 1BMMH 5EQSA 2TGDA 2Y81A 3BTKE 3OY6U 1LQDB 1XKBC 1C2DA 4BANB 4MTBA 1J14A 2PKAA 3SU3A 2F83A 3SW2B 5L2YH 1TLDA 5FPTA 1D3TB 2C8YB 4SGAE 5E2OA 5SGAE 2WYGA 4ZHAA 1WOFA 1K22H 4K8BA 1D3DB 4DT4A 1QB9A 3ENSB 1CA0B 1LCYA 4LXBH 1OWEA 3LC3A 3TGKE 3LH3A 3SV7A 1J9CH 3EA7A 3QO6A 1AU8A 2Y82A 1HJ9A 1BQYA 3OY5U 1ELEE 5A8XA 1P04A 3E1XB 4GPGA 1ZJDA 5A0BA 4UONA 5HIZA 3BN9A 3VGCB 2KX4A 5LPFA 2PR3A 3BEFB 1HIAA 1UMAH 2WPIS 3TH4H 2VIQA 1O3DA 1BTUA 1TBZH 1DWBH 2ZGXH 1DICA 4MVNA 1VGCC 1ZSJA 4OS6A 1WYKA 4BTUB 2FLRH 4LOYH 4ABJA 3E8LA 4QT8C 3FFGA 1G32B 2BD2A 3MH6A 2PWXA 5PTPA 2R2WU 5FHTA 1ETTH 2P3TB 3F9HA 1XUFA 1MCVA 2CHAC 2P95A 5EW1H 1O2OA 1GHVH 1O2WA 1MBMA 2WHXA 1EJMA 2ZU2A 3MU5A 1HAXB 1O39A 2XC4A 3JZ2B 4ASHA 3FOAA 3A82A 1Q3XA 3U1JB 5JYIA 1XUKA 2GD4B 3SU5A 2W6ID 2Z9JA 2ZHDA 4MQAA 2BLVA 1IHTH 1G37A 1UVUH 3OE7D 1GJ7B 1ZOMA 1O2LA 4D7FA 2QGRA 1FUJA 1C4Y2 2ZHQH 4PROA 5EOKA 1O36A 4UE7H 2G5VA 3GCTF 5ESBA 1O3KA 1SPJA 4Y10E 2ODQA 1TMUH 2CK3D 3T27A 1H4WA 2J34A 1K1MA 2Z9GA 4HI3A 1O3CA 4X8VH 4UFGH 3A80A 2FI3E 1EAIA 4JZFH 3SJOA 1DOJA 1P0SH 2SGQE 3NK8A 5CE1A 2ANWA 1C5WB 1EX3A 4GCHG 3KN2A 2YNBA 1C1VH 2A5AA 3BTGE 1ZTJA 5C1UA 2FX6A 3W94A 1J15A 1WDIA 1SI5H 2TIOA 1E36B 3U69H 1K9OE 2FPZA 2VVCA 3EGKH 1CA8B 1K1LA 1CBWC 4UFEH 1C2IA 1LKBA 1VITH 3PTNA 2JDID 5EXNA 1KTSB 3S7KB 1NZQH 2ZZUH 1MKXK 4CRGA 1Z8JB 4GHQA 2C93B 1K1OA 2O8TA 1WV7H 3ZVCA 1JOUB 1CGJE 4LZ4B 1BRBE 5KECA 3T29A 3BTME 1C5QA 5T6DA 1ZPCA 1GMCF 2F9UA 2VVUA 2ZECA 1A3BH 1P09A 1PPCE 2O8UA 1H8HD 3RUOA 3LT3A 1C1TA 4AB9A 1CHGA 4H6SB 1K1JA 3RU4T 1GI2A 5EGMA 1SGNE 2VIWA 5LH8A 1RTFB 1BMAA 3ESTA 1SGPE 5C94A 2VJ1A 1C5RA 3GYMA 2A7CA 2ZEBA 3ZZ6A 3V7TA 1AFQC 2XC0A 2BLQA 2ZGBH 2BLWA 1YPJH 2KZ4A 4AG1A 2R0KA 1A3EH 1T8NA 2A1DB 2ZTXA 3AVZA 3O8RA 1QJ6B 9LPRA 3ZVAA 4A1VA 1TNIA 2GCTB 1EAXA 1ZYOA 2CGAA 3RXLA 2QY0B 1IQKA 1NFXA 1GDNA 1J16A 1S84A 3ZVGA 1AGJA 3EDXB 3LONA 1EPTC 2A31A 1TABE 3PMBB 1O2KA 2BLOA 5GCHG 2PGBB 1ANEA 2J95A 2AGGX 5T6FA 2GMTB 3P70B 2J92A 2OK5A 2JH5D 3ZZ8A 2QF0A 4K2YA 1O2QA 3E16B 1SOZA 1SGTA 1EB1H 1SHHB 4AC9A 4UDWH 4K1SA 3C27B 1ZMNA 5C2ZA 1BMNH 2G51A 2JH0D 3UOUA 3MNXA 5E0JA 2FS8A 3PV2A 2ALPA 4I86A 2OP9A 5GIBA 1O3MA 4YESB 2WPHS 2H5CA 2PFEA 3OEED 1V6DA 2EY4C 1UVOA 3B8JA 4ABAA 2XCNA 3UQVA 1BRAA 1D4PB 4CRAA 3MU8A 1QIXB 3RXEA 2FX4A 5DSFA 1UVSH 1PFXC 1LHCH 1MTWA 1KLJH 1GI0A 1ELAA 1GHYH 1O2SA 4R8TB 1SKYE 4GVUA 5CMXH 1BBRK 3RMOH 3RXAA 2NU2E 2ZCHP 1P2MA 2ZDLA 3VB7A 3FZDA 5GNDA 1CHOG 3TLOA 1KDQB 3LPRA 3SN8A 5FX5A 5HMAA 4JZ1A 1K1NA 1YYY1 4ASUD 1JXPA 1KXCA 5A0CA 1GJ6A 4B6EA 4FUDA 2PTNA 3URCA 1SQOA 4TPYA 4X6NA 4AX9H 2ZPSA 3AK5A 2GZ7A 3GCNA 5ESTE 1O37A 5EQRA 2BQ6B 2BMGB 2FI4E 3MO9A 4FU7A 1WSSH 1GMHG 1PPFE 4FU8A 1A5IA 5E2PA 1MMJN 1GJ5H 3C1KA 4K1EA 1ELFA 3TJVA 1MQ5A 4J2YB 4ESTE 1IQFA 1YPLH 4Y8YA 3VB4A 2F9OA 5F03A 5DKMA 3QN7A 5JBAS 2XBWA 2AS9A 2OD3B 4ZH8A 1TWXB 1RTKA 4O3TA 4UEHH 1EAWA 1EZXC 2W7SA 3SU2A 1ESAA 1DWCH 3E6PH 4ISLA 5T1VA 1IOEA 1C2KA 2SNWA 2AGIX 2J38A 2EA3A 4I8LA 3SHAH 1MAXA 2W26A 4GCHF 4A92A 4TT3D 3ODFA 1SVPA 1GBLA 1Y59T 2CXVA 2PHBA 2VH0A 4Q7XA 3UNRA 1CT0E 1HBTH 3QZQA 1MTSA 4E7NA 3K6YA 1MD8A 1L1GA 2ZPRA 3MTYA 3BTDE 3GISB 1HXEH 2ZA5A 1UTMA 2ZU4A 1OWDA 1TQ7B 2BXUH 2ZTZA 2NU0E 5HM2A 4AFSA 1SGIB 5E8EH 1HCGA 2IJOB 3RXRA 5IYTA 1C9PA 2FYRA 4A7IB 2H9TH 1LVYA 1LHEH 2QXHA 1FIWA 1G30B 3QWCH 3T2NA 3QGNB 4YXWD 1F5KU 1DPOA 1BZXE 1B7XB 2FDAA 4BOHA 1ELBA 1O5EH 2J9NA 2ZNKH 5HKKD 1A46H 2GMTC 5A8ZA 3UB0A 1UCYK 4B75A 2BD4A 1GBCA 4CBOA 3PB1E 4FETA 3LU9B 3PM3A 4VGCB 1G36A 3BV9B 3GY5A 1F0SA 3HATH 1IQEA 4A1TA 3JZ1B 1C1MA 1ORFA 1CSOE 1FI8A 5LPEA 2A7JA 2HOBA 1RIWC 1GBDA 2FESH 1DLEA 3M7QA 4ABEA 3WWFA 2ZDKA 4MNYA 1SQAA 3RXFA 1QR3E 1XXFA 3LC5A 1Y3UA 3GY8A 3PWCA 2CN0H 2FTLE 2VGCB 2SGDE 1BHXF 2J97A 1QBNA 4YTAA 3ZV8A 4BTTB 1QY6A 1Y5AT 1MQ6A 2VIOA 1BTWA 3SUFA 3NWUA 1TBQH 4K5ZA 3ZZAA 1EZUC 1E35B 1EP5A 2ZGCA 1P10A 5F8XA 5GCHF 1DXPA 2UWPA 3MH4A 1TOMH 5JB8S 3A86A 3MOCA 4H42U 4BNRA 2AGEX 4Z0KA 3HPTB 4UFDH 4FUHA 3V13A 1OWHA 3ZZ5A 1ANBA 1UJ1A 5EQQA 2K1QA 1C1QA 3GYLB 1QGFA 4XSKU 1UTKA 1ELCA 4NWKA 4X8TH 5HM9A 1O30A 2IN2A 1CGIE 1YPMH 1QFKH 3STJA 3QZRA 3VB3A 1L1NA 1NRSH 3KQCA 1EAUA 1O2HA 1S6LA 2M2AA 2A4RA 3TGJE 1L1JA 1UHBB 2J2UA 2XNDD 4UFFH 4X2WA 3RXJA 2W5EA 3SYJA 2CJIA 1LVMA 2Z9LA 3E91A 1C2FA 3CNRA 2C8WB 5EPNA 1AKSB 2AMDA 1XUJA 4MPVA 4B6FA 1CHOF 2FI5E 2SGEE 2IOTA 1CO7E 3ZYDA 4IMQA 1UCYH 2QIQA 1FPHH 1MTUA 7LPRA 3QLPH 2QXGA 3K2UA 2VB0A 1YM0A 5JDUB 2WUBA 1ABJH 2GT8A 2GJGA 2C4FH 5EXMA 4BAQB 1E0FD 1IQHA 4IN1A 5DP3A 1WAYB 1O2JA 5C3NA 1XUGA 4JZEH 2BB4A 1HJ8A 3RU4E 1GMHF 1BRUP 3KGPA 2BVXH 2Y5GA 1H1BA 3S9CA 1O2VA 4A5TS 3QGJA 4THNH 2OBQA 4ABBA 1GHAG 3GOVB 1Y3XA 1SLVB 4AORA 3BEUA 3TPIZ 1DS2E 2HNTC 1YLCA 3VEQB 1YCPH 3A85A 1A0HB 4INLA 3SGBE 1ZGVA 1TGTA 4VGCC 4CRDA 1O3IA 1S5SA 1ELDE 3RXCA 1UTNA 1P2QA 5AF9H 1HAVA 4UD9H 4OM9A 3F2GA 4KP0A 2BM2A 3GICB 3RXPA 2HNTE 1EB2A 2F9BH 2VGCC 1EASA 4CHAC 1NESE 4ZHLU 1P9SA 3RDZA 2P94A 2ZHWH 2RDLA 1QRZA 2AIPA 2XBXA 1GJAB 2QAAA 1S6FA 3MFJA 4INHA 3ZV9A 3P8NA 4DGJA 1ZTKA 2J4IA 1UTPA 3L33A 1Z6EA 1NN6A 1X7AC 3TVJB 1SHYA 2GX4A 5JBTA 5L2ZH 4F4OC 3SUEA 4BAKB 4FVDA 2PLXA 1ANCA 1SLUB 4HZHA 4TY7A 3RLYH 3T26A 1FJSA 1TPAE 4FUFA 2SGAA 4CREA 4ABDA 4AGJA 4CRBA 2BX3A 1O5BB 4NSYA 1NRPH 2J98A 1C1UH 2A32A 1TPPA 3P8OA 5K7RA 2BD3A 1GDUA 1CBWB 3BTTE 3QX5H 2IPQX 1GBMA 3HGNA 3BTQE 4AG2A 3RLWH 3SNEA 4JYVH 2WYJA 4Y79A 1ETSH 2BY7X 1N8OB 4AYYB 3H09A 3KL6A 4JZIA 4SGBE 2G81E 1XXDA 3B23B 2Z94A 2K8IA 4ISNA 9ESTA 1U6QA 1P3EA 4Z6AH 1W0ZU 5BRRE 1RTLA 2FIRH 1H9IE 4DY7B 2CF9H 3F0OA 2EEKA 4JCNA 5IK2D 5GDSH 4X2YA 1KYNA 3UWIA 1N1LA 1A0JA 1V2NT 1HAIH 3FAOA 1PQ7A 1F5LA 2A7HA 2VINA 1ZRBA 1HAGE 1LTOA 1RFNA 2XYAA 1K28D 1P3CA 3Q77A 3WY8A 2VBCA 3A7ZA 5FPSA 2JETB 2GDEH 1AFQB 1E34B 4FUBA 4B73A 1AD8H 4WJG2 1GL0E 3RU4D 1BUIA 2RA3A 2VVVA 3PLBA 3TU7H 4XOJA 1P2NA 5EW2H 1MBQA 1QRXA 1SG8B 1PPBH 5CDFE 1T4UH 1YCPM 3KNXA 3TK9A 1PJPA 1LHFH 3EQ0H 4OS5A 1J8AA 3N7EA 1FLEE 1NRRH 1V2LT 3P95A 1EPTB 1GPZA 3VG8A 3IITA 1BTXA 5FBEA 1O2RA 2OLGA 3DSOA 2FOHA 2PUXB 1GBKA 3HK6B 4YO9A 2F9VA 3MNCA 1SLXB 1DWEH 3K9XB 5KGOA 2UUYA 2KCOA 1NU9A 2B9LA 5DO4H 1ESBA 1V2VT 2ZCLP 3VXEH 4TY6A 2F91A 4X1RU 1QQUA 3BTFE 2FYQA 1JMOH 3VPKA 1QA0A 5AFZH 1G3EA 3BIUH 1O5CB 1UCYE 5ABWA 1V2UT 3H7OA 3RMLH 3BG4B 1GBHA 3F3BA 1Z6JH 2ZDNA 5HIYA 1ESTA 5EODA 2OC0A 4NIWA 2KAIA 1F2SE 1J17T 4KTCA 2AMPA 5DG6A 3UQOA 1G3CA 1NS3A 3N99A 2Q6DA 1QL7A 1GI3A 1KLIH 4H4FA 1GHAF 1DDJA 4Y8XA 2VWLA 5F8ZA 5EXLA 3PYHA 2A45B 4JYUH 1G2MA 3PV5A 2BY9X 3F1SB 2QXIA 4TSFD 3OSYA 4DG4A 2ASUB 2BD5A 1JBUH 3PO1B 2VWMA 2QF3A 3A84A 5C5NA 5FAHA 2KCPA 1DUEA 3MMGA 1TAWA 1SLWB 1AN1E 5FBIA 3TIUA 2GTBA 2P16A 3OYPA 2OQUA 4WY3A 1DE7H 4Q80A 1THRH 1HDTH 3SV8A 2KCAA 4AFQA 1D6WA 8GCHG 1TQ0B 4CH2B 5DGJA 1G2LA 1ZHPA 4BAOB 5C1XA 1PPZA 1ZPZA 2ODYB 2HALA 2Q1JA 1C5YB 5DP9A 2QCYA 2BQ7B 2LPRA 1N8OC 2ZFQH 3UIRA 3LJOA 2BOHB 2V7QD 2W3IA 1A5GH 2C3SA 2SGFE 2ZO3H 2KM0A 2HVYB 3PMHB 2ZU5A 2B7DH 2QYIA 1FY5A 1SGCA 1Y3WA 2D26C 1D9IA 3RXKA 3F9EA 4E7RG 5C0UA 3PLKA 1GGDB 4FUGA 4H6TA 5C20A 2YMSD 5C67A 2BY5X 1P8VC 2EC9H 1THSH 1GI7B 1ID5H 2XWBI 1T32A 1S82A 2JETC 4K60A 2BOKA 3KYGA 2PKSB 1O3JA 2UWLA 3RMMH 1BJUA 3AAVA 4K69A 2FS9A 1T31A 1AE8H 1AZ8A 1O2UA 5FL7D 3ZYEA 1RGQA 2XXLA 1O5GH 3V12A 2WINI 4MLFB 2Y6TA 1TYNA 4NIXA 1JIRA 2B5TB 4E06H 3SQHE 4I32A 2JKHA 2GVFA 5CHAB 2FXRA 3T62A 1SGQE 1FMGA 4AFZA 4DVAU 3RXUA 2BDBA 3E0NB 1PQ8A 1B5GH 4NA9H 5C17A 3WWBA 5H4IB 1L4DA 3A7TA 3M3SA 1T8LA 3RM2H 2FO9A 3EE0B 2PUQH 2G52A 1A2CH 3NPSA 5L6NH 4B2CA 3KF2A 3EYDA 3MQKC 1FAXA 4AFUA 3V0XA 1C1SA 1DWDH 3SUGA 1XM1A 1RIWB 3F2FA 3ZIAD 4BXSA 2BQWB 1NBME 1ZGIA 3U8TH 5GXPA 1NRNH 1WTGH 1BMFD 4X8SH 3SU0A 4CBNA 1SGRE 1LQEA 1MH0A 1QJ7B 2H2ZA 2AHME 3BG4C 5DP7A 1VCPA 1XUHA 5F8TA 1VR1H 1O32A 1WTHD 3EE7A 2FOCA 2TGPZ 1HAOH 1GI5A 1UTQA 3LIWA 1OXGA 5L30H 4Y7BA 3I77A 1O3EA 1JRTA 1MKXH 3P8FA 1HFDA 6GCHG 4JK5A 1O2MA 2PKAB 4NCYA 5EPYA 1ZMLA 4INKA 2GDDA 3F2HA 2JIZD 3BTHE 4WMDA 1XKAC 1TONA 2NWNA 1LPGB 2V0BA 1FNIA 1EZQA 5DN6D 2WUCA 2ZFTA 4IMZA 3PO1C 1MZAA 3PLPA 2PGQB 4CR5A 3GCHB 2D1JA 2R0LA 1V2OT 1ANDA 2DUCA 1W7XH 1BMLA 1HAPH 3KCGH 1NY22 8KME2 4I8KA 3WW7A 3ZZ4A 3SV9A 1TPSA 1V2MT 4IS5A 4YT6H 4IN2A 1GBFA 2F9PA 2BX4A 1MU6B 3U8RH 1H8ED 1TA6A 2BDIA 4I8JA 1EKBB 2A0QB 4RKOB 4XBDA 1HIAB 3TJUA 3ELAH 1O3NA 2GZ9A 5C1YA 1PPGE 2WPJS 1AWHB 4B1TA 2HVXA 2ILNA 4DIHH 3STIA 4ACBA 1OOKB 3A83A 1HGTH 3LGUA 1BHXB 1GCTB 3BTEE 3AAUA 1GGDC 4IC5A 1YGCH 4YOGA 2HGTH 2P93A 1Z71A 1W11U 3U98H 2R2MB 3ZZDA 4BAMB 5JB9S 1O3FA 1LKAA 1TGBA 1ZSLA 2ZFRH 1H8DH 2ALVA 4I31A 3VXFH 1IQLA 1YLNA 4AYVB 2FOEA 3ZVBA 2PKSC 2VH6A 1YPGH 3O8BA 5GWZA 3UOPA 4NZQA 3QUMP 1WQVH 1GHXH 3ATMA 3PRDA 1G3DA 2G5NA 1FV9A 1BT7A 2XBVA 3S69A 1C2LA 3BIVH 8GCHF 3GY2A 1SMFE 1IAUA 1L2EA 3LJJA 2AYWA 3DT0H 3MI4A 1GBTA 3A7WA 3ZZBA 1WUNH 4Y8ZA 3OFND 5CHAC 2WPKS 4XRNA 3TH3H 3KEEA 4KTSA 2WPMS 1OWKA 1CE5A 1AWFH 1E1QD 2VIDA 1DY9A 1EFRD 1DXWA 3Q76A 1GVKB 1BBRH 4AN7A 2LP6A 1NBMD 2VU8E 3ATIA 3RXHA 2V6NA 3M3VA 1QQ4A 2HPPH 3ATWA 5JPMH 2J5UA 3MNSA 3MO3A 3NUMA 2EI6A 2FWWA 4Y76A 4WMEA 2VIVA 4ZHMU 1DSTA 1KXDA 1OP0A 4KGAA 3O8CA 1NTPA 1HPGA 2D2DA 1NFYA 1TFXA 1W10U 4CHAB 2ZC9H 4U2WA 4KELA 1NC6A 3QDZB 1HJAB 1AB9B 3SZEA 4Z1MD 4Y71A 1F92A 4KKDA 1C5XB 1WCZA 1O3LA 2K0QA 2FMJA 1IQMA 5J4SA 5EJLA 4LZ1H 3CENA 1WU1A 2GKVE 1G9IE 1MU8B 2DE9A 5J4QA 3FP6E 3S7HB 1MD7A 4NSVA 4ISOA 1JRSA 1RJXB 1YY3A 4RSPA 1FZZA 5DP8A 1SGFA 1PPHE 2HWLB 3MU1A 4X1QU 3LOXA 5T6GA 2XW9A 1TRNA 3SQEE 5FXLA 3FP7E 3GY4A 2V3HH 4Y11E 3GCHC 1UK3A 4NWLA 3A87A 3GDVA 1FIZA 2PV9B 2ANMH 4YLUA 1S6HA 2OC1A 3ZZ3A 3EAJA 4OS2A 1IHSH 1ZR0A 1AE5A 1O34A 1TNGA 4FXGH 1YPHC 1BTPA 1C5TA 1CGHA 4ABGA 1PQ5A 4F49A 4NIYA 1C5VA 4I7YH 2M5TA 4MPUA 3D23A 1KIGH 2BDAA 3T5FH 6CHAC 3B9FH 2XC5A 2YMSB 4MNWA 5CHBA 4X1NU 3LDXH 3SU1A 2ZGJA 1TNJA 1GCTC 1YLDA 6GCHF 2JJ1D 1B0FA 3SI4H 5F53A 4YOJA 2RA0A 1C4V2 1YPHE 2WV9A 5GJ4B 5FCRA 3SHCH 2WV4A 1ZMJA 1O0DH 1EXFA 2ZQ2A 1ARBA 1C5OH 1FY4A 2UUJB 1EJAA 2HPQH 1AHTH 1BTYA 2L6OA 3GS9A 1S0RA 1VCWA 3MHWU 1O2IA 4P00A 2J94A 1V2JT 4U32A 4I8HA 1W7GH 3K6ZA 1GI4A 2BY6X 2BXTH 3A88A 3FANA 4WH8A 1DANH 1Y5UT 3Q00A 4DT7B 2F3CE 2ZPQA 3P92A 2Y7ZA 1KY9A 2STAE 1O2NA 1GMDG 1V2QT 2ULLA 1DVAH 2H1UA 2ZFPH 1TNLA 4AOQA 3RM0H 3TK6A 1W0YH 1DUAA 1W14U 4O3UA 1T8MA 1C5ZB 1O3AA 3RXIA 1S0QA 1GI9B 1QHRB 1TB6H 2QV1A 1VJ9U 2XOKD 1TMBH 3GY7A 1TIOA 4ACAA 4X6OA 2XBYA 4TWWA 1P05A 1EQ9A 2A5KA 3VB5A 1C1WH 3GDSA 3LGWA 2Y80A 5EIYA 1C2GA 1DLKB 5ETXA 3BSQA 1OHHD 3RP2A 1QA7A 2BD9A 3VFEA 1W2KH 3TNSA 1O3GA 3EA9A 3FP8E 4X1SU 4DW2U 1V2ST 1E38B 5E0GA 1AVWA 1UK4A 2O8WA 1HUTH 2O8LA 1HJAC 1AB9C 1W3CA 4D9RA 1HNEE 1YKTA 1SGFG 1ZRKA 3SUDA 1C5MD 2GV6A 1GDQA 3A8DA 3M36A 3RXBA 1D3PB 1Q2WA 1GI8B 1LHGH 2JH6D 2CMYA 3IWMA 3PWBA 1VZQH 3KHVA 2Q6FA 3SV2H 2Z3CA 1LHDH 4K3JA 4B74A 3MU4A 4DCDA 1DY8A 1KTTB 1A7SA 2SFAA 2GGVB 1AMHA 2ESTE 2ZTYA 2TRMA 1QL9A 1EP6A 1SQTA 1H9HE 2W6JD 2NU4E 2RCEA 5B6LA 3RXDA 2FODA 3LGYA 1BBRE 1Z8GA 1BB0B 2ANYA 1BA8B 5EU8A 1KXAA 4M9FA 4OS4A 3UFAA 1BITA 3URDA 4A1XA 4RN6A 3A81A 4ZKRU 1TBRH 5I25A 3BG8A 2QN5T 2ZGHA 3M37A 3GY6A 3K65B 2FOBA 3T25A 1V2TT 2ZIQH 1AIXH 1YP9A 1GJ9B 2YMSC 1BRCE 3KQBA 2A2XH 4ZMAH 3RXMA 2ZU1A 3N7OA 3EA8A 4D8NA 1BIOA 1ZHRA 1NT1A 3OEHD 2TGTA 3L3TA 1Y8TA 3ZVEA 2Z9KA 1MABB 4LK4A 2BDHA 2BVSH 1KMHB 3OAAD 4WWYA 5HYOA 1T4VH 3M3TA 3W95A 4U01A 1FPCH 1MZDA 1FY3A 2WPLS 4XDEA 1V2WT 3TJOA 2VWNA 3P8GA 2FLBH 4TWYA 2NU1E 8ESTE 1GBJA 1N6YA 4DJZB 2FM2A 4AZ2B 1H8IH 5KEDA 4BTIB 1Y5BT 4M7GA 1DX5M 1W0JD 3RXGA 3T28A 2P8OB 4MPWA 3CP7A 1GBEA 1KDQA 5FCKA 5A09A 3PV4A 5EJZA 1K1PA 1GBIA 2PSXA 3KIDU 1UW7A 1MKWK 4Q2KA 1F0UA 1GJ8B 1C1NA 1OYTH 4GLYA 2WSSD 3PMAB 4Y0YE 1SBWA 2OC7A 2BZ6H 3S9AA 1PYTD 1VJAU 3TH2H 4IBLH 1OS8A 4YT7H 1QL8A 1C5SA 3KQEA 3F9GA 3A8AA 1FXYA 1GCDA 2ZDMA 4HG6A 4JYTA 3SO3A 2RDEA 1XX9A 1C2EA 1O2GH 2FOGA 2VWOA 1VITG 2GZ8A 3BEIB 4GAWA 3SNBA 1COWD 3H7TA 3M5MA 1ABIH 2FOMB 5EJ1A 3SGAE 1NO9H 3D62A 3SJ9A 4CR9A 1EOJA 2PSYA 1GMDF 4WVPE 1H9LB 1RD3B 4WH6A 2V3MA 4AB8A 1ZSKA 3ITIA 1GJCB 1Q31A 1XUIA 4ZKNU 3F6UH 5A2MH 1GBAA 2FZZA 1HV7A 5HGGA 1OPHB 2W3KA 1C4U2 1OSSA 2A4QA 4ISIH 3H5CB 1P2KA 3NRLA 3BF6H 2OCVB 3UR6A 1FQ3A 2BY8X 1JWTA 3SU6A 4J1YA 2ZDVH 4WMFA 4Q7YA 3QK1A 4MDSA 5LGOA 4X2VA 6LPRA 2OQ5A 2ZQ1A 3Q3XA 3SORA 1O5DH 2ZI2H 3D65E 4HGCA 1DITH 1SFQB 3M5OA 4WXIA 4ZUHA 3GDUA 3G01A 1AFEH 2HRVA 1Y3VA 3Q3YA 3NZIA 2YOLA 2G00A 1GG6B 3R3GB 4GSOA 4I8GA 4JZDH 2QE7D 1O2ZA 1ARCA 6ESTA 2Y5FA 3VB6A 1GL1A 2BDGA 1MUEB 1AO5A 1UTLM 1XMNB 4NA7A 4OS7A 4TPIZ 1XVMA 2XTTB 4X8UH 4B71A 1TA2A 4FOUC 4P02A 1IQJA 2QA9E 2FOAA 4MNVA 3OX7U 1EJNA 1UVPA 4NZLA 4X6PA 1P06A 4YZUA 1N6XA 4Q63A 3UREA 1ZJKA 3PMJA 1MKWH 3W1EA 2EI7A 3NCLA 2ZCKP 3TGIE 4NFFA 1TMTH 1E1RD 3O8DA 1QTFA 3E0PB 1YF4A 4ZAEA 1QBVH 3E90B 1HYLA 7ESTE 4BXWA 1HLTH 2BD7A 2WV5A 1HAVB 3UPEA 1P02A 2R3UA 5A0AE 1MCTA 2LNCA 2OXSA 1FAKH 1C2MA 1ZTLA 4HFPB 1T8OA 2QF5A 4WXVA 5EG4A 5BPEA 3M35A 2P8OC 4DOQA 1DFPA 4XD7D 2ZWLH 1LVOA 1K0HA 1CA0C 5A8YA 1V2RT 1BDAA 1SSXA 3ZVDA 3I78A 2TBSA 3TJNA 1VCQA 1V2PT 5TCCA 3ATLA 3DA9B 1SQRA 2XNIA 1TALA 2H9EH 1SGYE 2XRCA 3DHKH 3VGCC 5AHGH 4ZXXH 1WQSA 1MTVA 2G4TA 1UHBA 2BD8A 2TGAA 2BHGA 2STBE 1IQNA 2ZU3A 2J98B 1UVTH 3UR9A 2XWAA 3AW0A 1S85A 1YPEH 1YBWA 1LPZB 4MG3A 1OKXA 1HRTH 4KTUA 5K0HA 3HKIB 4E05H 1GI6A 3UTUH 1QURH 1W8BH 1AUJA 4O03A 1THPB 1AKSA 1C2JA 1QZ8A 1W12U 2PTCE 1L4ZA 3ODDA 3DCLA 4JK6A 5G4BA 2G8TA 4NA8A 1TGCA 4B2BA 1LDTT 1RRKA 1FY8E 2ZHFH 2GP9B 4X2XA 3SJIA 2AERH 1ELVA 3MWIU 2WZQA 3SOSA 1QCPA 1K21H 1P9UA 3RXTA 2R9PA 4GHTA 4XE4A 2CV3A 4TYDA 2AIQA 1TPOA 4RI0A 3S9BA 2GCHG 4F48B 1UTJA 4FU9A 2A5IA 5HXFA 5FPYA 2Z9IA 2SNVA 5E0HA 4ZKOU 4YOIA 4RT0A 1GHZA 2IPHA 5C5OA 2JJ2D 4B76A 2PW8H 1LPKB 3RC5A 1FONA 2ZHEH 1TGSZ 4X6MA 1C5LH 1OYQA 1O35A 1LO6A 1QB6A 2XCFA 3F0PA 1VITF 3M5NA 3UWJH 1O33A 4FUIA 1GG6C 3M7UA 4CRFA 1KXEA 2BTCE 2B8OH 1CT2E 1IQIA 3FO8D 1A1RA 1C5PA 3SNCA 1C9TA 4WF8A 2VNTA 1Z8IB 1E79D 3UAIC 4CH8B 1S81A 6CHAB 4IGDA 3KQ5A 1EOLA 3MNBA 2Z6BD 2TPIZ 1O38A 3A7YA 2D8WA 3SJ8A 1CU1A 1GJBB 2O8MA 4DIIH 1TRMA 3MU0A 1WXRA 4Y6DA 3CS7A 1NFUA 1OWIA 1BOQA 3ZZ7A 3RC4A 1KLTA 4NGAH 1SR5C 3DUXH 3L6PA 3F9FA 1TX7A 1C5NH 2EQNA 1ZHMA 4ABIA 3SGQE 1Z8RA 3SU4A 3Q3KA 1LVBA 3OTJE 1BJVA 1YPKH 1O3PB 1O3HA 3DSPA 5I46H 2KAIB 3MH7A 2HLDD 3SNAA 3SI3H 1YC0A 1JIMA 3PRBA 1GI1A 2A2QH 3QTVH 1OP2A 4Q7ZA 2BDYA 2AMQA 3QTOH 3MO6A 3U28C 4CRCA 4ZXYH 1GVZA 3UY9A 1W0KD 2PP6A 3KYFA 3A7VA 1F0TA 1GHBG 4BAHB 5DJ7A 3SNDA 1NROH 1INCA 2GCTC 3HGPA 4XBCA 2ODPA 3N7DA 2UUKB 2F4LA 4X0WU 2R3YA 1K2I1 5T3HA 8LPRA 3LGTA 3LGIA 2KCYA 4RT1A 2FTMA 3SJKA 1E37B 1Z7KA 2UUFB 7GCHG 3DD2H 5FX6A 2G4UA 1A4WH 4B2AA 1QJ1B 5GPIB 1F0RA 2OBOA 1EATA 1SC8U 3AW1A 5AFYH 3TK5A 1AUTC 3A89A 1SGEE 4FUCA 1C5UA 1L0ZA 4A6LA 4NG9H 2I6SA 3M7TA 2KR7A 4IC6A 1P2JA 4XFQA 2ANKH 3FN8A 1VKYA 1HAYB 1D6RA 1Z1IA 2Q6GA 4JMYA 3RMNH 1MTNB 1O5AB 1SL3A 2OINA 4I33A 4GUXA 2B0FA 2AEIH 1G3BA 2H6MA 1CT4E 1V3XA 4ISHH 2C8ZB 1TOCB 1GJ4H 1YWUA 1OX1A 1O5FH 2Y5HA 1SB1H 3ZZ9A 3BTWE 2THFB 3LGVA 1P12E 1D3QB 2C8XB 1O2TA 2BVRH 1YCPK 1C1OA 3UNQA 1EPTA 4ABFA 3A7XA 1OP8A 4D76A 2AH4X 1PPEE 3RXSA 3RXVA 1NU7B 2FP7B 5DP4A 1TNHA 2GV7A 1FY1A 3NKKA 1DT2A 5B6OA 1GWAA 1NPMA 1QNJA 1O3OA 1WBGB 2ZKSA 3U8OH 4FUJA 1TE0A 3NXPA 1PQAA 4HTCH 1IQGA 3D49H 1O31A 4D7GA 1GVLA 2EI8A 2G55A 3ATKA 4DURA 2BDCA 1QBOA 4Y7AA 3KQDA 1S83A 3ZVFA 1A61H 4IW4E 3SV6A 3UUZA 2O9QA 2GCHF 1O2XA 2ZP0H 2UWOA 2F43B 1ACBE 1KSNA 1GJDB 2OTVA 1BTHH 2HNTF 5JBCS 1BCUH 1FDPA 1P57B 3SZNA 1FN8A 4FUEA 3F68H 2V3OH 4FVBA 2WPDD 1T7CA 2A4GA 2SGPE 1OWJA 1HAHH 1TX8A 1UO6A 4R0IA 1A0LA 1NM6A 3SBKA 1NFWA 1SFIA 5DP6A 1FX0B 5F6MA 3U1IB 1P01A 4ZKSU 2L74A 3LKWA 4O9VA 5C0TA 1CQQA 4YM9A 3FVFB 1PYTC 1SGDE 1K1IA 4ZROA 4ABHA 2OC8A 1LMWB 4OGXA 1V2KT 4OGYA 2KFWA 2QF4A 1O2PA 4Q4LA 3DFLA 3MYWA 3U9AH 1P11E 4OS1A
chains in the Genus database with same CATH topology
4O97A 3IG6B 1CVWH 3RXQA 2H5DA 2HLCA 3DFJA 3R0FA 1UK2A 2F9NA 3GY3A 1UTOA 5LPRA 2FEQH 1P03A 2C90B 4NIVA 3I29A 3RXOA 1AI8H 3GCTG 5DP5A 1RXPA 1W13U 3P17H 1VGCB 1ZZZA 3UNSA 5DK1A 1GHWH 1AVGH 2CF8H 2AFQB 1AQ7A 2DE8A 3GCOA 2ZG0H 4NFEA 1TRYA 2P3FH 3ZZCA 1TGNA 2CHAB 3AASA 3TITA 1ELGA 2H9HA 1GBBA 2YNAA 4RKJB 4D9QA 1MTNC 5AVDA 3P6ZB 1EZSC 1ZLRA 2Z3DA 2BYAX 3M5LA 3S0NA 2V35A 1Z1JA 2Z3EA 3MH5A 1GHBF 2Y7XA 4U30A 2NU3E 1TNKA 1Y3YA 4K8YA 1AVXA 4YLQH 5TJXA 1QRWA 1ETRH 1P2IA 1EUFA 2ZFFH 4MNXA 1HAZB 1XVOA 1NRQH 4AGKA 2W7UA 7GCHF 5DPAA 2P59A 1GMCG 3M61U 1DM4B 1QB1A 3E3TA 1FN6A 4MPXA 2FOFA 3TNTA 1AZZA 1C2HA 1F7ZA 1KXFA 5JBBS 1O2YA 1C1RA 7KMEH 2ZFSA 1MAYA 2BZAA 2VIPA 1AY6H 1RS0A 2ZF0H 1O3BA 4K1TA 2QXJA 3HK3B 1TX6A 2ZDAH 1B0EA 2QC2A 4XBBA 2RG3A 1P2OA 2Z7FE 1KXBA 5TCAA 3RC6A 1BTZA 2OUAA 3FZZA 1ELTA 2P3UB 3A8BA 3HKJB 1F5RA 3A8CA 3OU0A 1C1PA 1ZPBA 4Y0ZE 1SOTA 3CS0A 2GT7A 1DSUA 3V3MA 5IDKA 3PTBA 3PROA 2A4OA 3LH1A 4X1PU 2I6QA 1HB0B 1HXFH 1A5HA 1M9UA 1BMMH 5EQSA 2TGDA 2Y81A 3BTKE 3OY6U 1LQDB 1XKBC 1C2DA 4BANB 4MTBA 1J14A 2PKAA 3SU3A 2F83A 3SW2B 5L2YH 1TLDA 5FPTA 1D3TB 2C8YB 4SGAE 5E2OA 5SGAE 2WYGA 4ZHAA 1WOFA 1K22H 4K8BA 1D3DB 1QB9A 3ENSB 1CA0B 1LCYA 4LXBH 1OWEA 3LC3A 3TGKE 3LH3A 3SV7A 1J9CH 3EA7A 3QO6A 1AU8A 2Y82A 1HJ9A 1BQYA 3OY5U 1ELEE 5A8XA 1P04A 3E1XB 4GPGA 1ZJDA 5A0BA 4UONA 5LPFA 3BN9A 3VGCB 2PR3A 3BEFB 1HIAA 1UMAH 2WPIS 3TH4H 2VIQA 1O3DA 1BTUA 1TBZH 1DWBH 2ZGXH 1DICA 4MVNA 1VGCC 1ZSJA 4OS6A 1WYKA 4BTUB 2FLRH 4LOYH 4ABJA 3E8LA 4QT8C 3FFGA 1G32B 2BD2A 3MH6A 2PWXA 5PTPA 2R2WU 5FHTA 2P3TB 1ETTH 3F9HA 1XUFA 1MCVA 2CHAC 2P95A 5EW1H 1O2OA 1GHVH 1O2WA 1MBMA 1EJMA 2ZU2A 3MU5A 1HAXB 1O39A 2XC4A 3JZ2B 4ASHA 3A82A 1Q3XA 3U1JB 5JYIA 1XUKA 2GD4B 3SU5A 2Z9JA 2ZHDA 4MQAA 2BLVA 1IHTH 1G37A 1UVUH 1GJ7B 1ZOMA 1O2LA 4D7FA 2QGRA 1FUJA 1C4Y2 2ZHQH 4PROA 5EOKA 1O36A 4UE7H 2G5VA 3GCTF 5ESBA 1O3KA 1SPJA 4Y10E 2ODQA 1TMUH 3T27A 1H4WA 2J34A 1K1MA 2Z9GA 4HI3A 1O3CA 4X8VH 4UFGH 3A80A 2FI3E 1EAIA 4JZFH 3SJOA 1DOJA 1P0SH 2SGQE 3NK8A 5CE1A 2ANWA 1C5WB 1EX3A 4GCHG 3KN2A 2YNBA 1C1VH 2A5AA 3BTGE 1ZTJA 5C1UA 2FX6A 3W94A 1J15A 1SI5H 2TIOA 1E36B 3U69H 1K9OE 2FPZA 2VVCA 3EGKH 1CA8B 1K1LA 1CBWC 4UFEH 1C2IA 1LKBA 1VITH 3PTNA 5EXNA 1KTSB 3S7KB 1NZQH 2ZZUH 1MKXK 4CRGA 1Z8JB 4GHQA 2C93B 1K1OA 2O8TA 1WV7H 3ZVCA 1JOUB 1CGJE 4LZ4B 1BRBE 3T29A 3BTME 1C5QA 5T6DA 1ZPCA 1GMCF 2F9UA 2VVUA 2ZECA 1A3BH 1P09A 2O8UA 1PPCE 3RUOA 3LT3A 1C1TA 4AB9A 1CHGA 4H6SB 1K1JA 3RU4T 1GI2A 5EGMA 1SGNE 2VIWA 5LH8A 1RTFB 1BMAA 3ESTA 1SGPE 2VJ1A 1C5RA 3GYMA 2A7CA 2ZEBA 3ZZ6A 3V7TA 1AFQC 2XC0A 2BLQA 2ZGBH 2BLWA 1YPJH 4AG1A 2R0KA 1A3EH 1T8NA 2A1DB 2ZTXA 3AVZA 3O8RA 1QJ6B 9LPRA 3ZVAA 4A1VA 1TNIA 2GCTB 1EAXA 1ZYOA 2CGAA 3RXLA 2QY0B 1IQKA 1NFXA 1GDNA 1J16A 1S84A 3ZVGA 1AGJA 3EDXB 3LONA 1EPTC 2A31A 1TABE 3PMBB 1O2KA 2BLOA 5GCHG 2PGBB 1ANEA 2J95A 2AGGX 5T6FA 2GMTB 3P70B 2J92A 3ZZ8A 2JH5D 2QF0A 4K2YA 1O2QA 3E16B 1SOZA 1SGTA 1EB1H 1SHHB 4UDWH 4K1SA 3C27B 1ZMNA 5C2ZA 1BMNH 2G51A 2JH0D 3UOUA 3MNXA 5E0JA 2FS8A 2ALPA 2OP9A 5GIBA 1O3MA 4YESB 2WPHS 2H5CA 2PFEA 1V6DA 1UVOA 3B8JA 4ABAA 2XCNA 3UQVA 1BRAA 1D4PB 4CRAA 3MU8A 1QIXB 3RXEA 2FX4A 1UVSH 1PFXC 1LHCH 1MTWA 1KLJH 1GI0A 1ELAA 1GHYH 1O2SA 4R8TB 4GVUA 5CMXH 1BBRK 3RMOH 3RXAA 2NU2E 2ZCHP 1P2MA 2ZDLA 3VB7A 3FZDA 1CHOG 3TLOA 1KDQB 3LPRA 3SN8A 5FX5A 5HMAA 4JZ1A 1K1NA 1YYY1 5A0CA 1JXPA 1KXCA 1GJ6A 4FUDA 2PTNA 3URCA 1SQOA 4TPYA 4X6NA 4AX9H 2ZPSA 2GZ7A 3GCNA 5ESTE 1O37A 5EQRA 2BQ6B 2BMGB 2FI4E 3MO9A 4FU7A 1WSSH 1GMHG 1PPFE 4FU8A 1A5IA 5E2PA 1MMJN 1GJ5H 3C1KA 4K1EA 1ELFA 3TJVA 1MQ5A 4J2YB 4ESTE 1IQFA 1YPLH 4Y8YA 3VB4A 2F9OA 5F03A 5DKMA 3QN7A 5JBAS 2XBWA 2AS9A 2OD3B 4ZH8A 1TWXB 1RTKA 4O3TA 4UEHH 1EAWA 1EZXC 2W7SA 3SU2A 1ESAA 1DWCH 3E6PH 4ISLA 1IOEA 1C2KA 2SNWA 2AGIX 2J38A 2EA3A 4I8LA 3SHAH 1MAXA 2W26A 4GCHF 4A92A 3ODFA 1SVPA 1GBLA 1Y59T 2CXVA 2PHBA 2VH0A 4Q7XA 3UNRA 1CT0E 1HBTH 3QZQA 1MTSA 4E7NA 3K6YA 1MD8A 1L1GA 2ZPRA 3MTYA 3BTDE 3GISB 1HXEH 2ZA5A 1UTMA 2ZU4A 1OWDA 1TQ7B 2BXUH 2ZTZA 2NU0E 5HM2A 4AFSA 1SGIB 5E8EH 1HCGA 2IJOB 3RXRA 5IYTA 1C9PA 2FYRA 4A7IB 2H9TH 1LVYA 1LHEH 2QXHA 1FIWA 1G30B 3QWCH 3T2NA 3QGNB 1F5KU 1DPOA 1BZXE 1B7XB 2FDAA 4BOHA 1ELBA 1O5EH 2J9NA 2ZNKH 1A46H 2GMTC 5A8ZA 1UCYK 4B75A 2BD4A 1GBCA 4CBOA 3PB1E 3LU9B 3PM3A 4VGCB 1G36A 3BV9B 3GY5A 1F0SA 3HATH 1IQEA 4A1TA 3JZ1B 1C1MA 1ORFA 1CSOE 1FI8A 5LPEA 2A7JA 2HOBA 1RIWC 1GBDA 2FESH 1DLEA 3M7QA 4ABEA 2ZDKA 4MNYA 1SQAA 3RXFA 1QR3E 1XXFA 3LC5A 1Y3UA 3GY8A 3PWCA 2CN0H 2FTLE 2VGCB 2SGDE 1BHXF 1QBNA 4YTAA 3ZV8A 4BTTB 1QY6A 1Y5AT 1MQ6A 2VIOA 1BTWA 3SUFA 3NWUA 1TBQH 4K5ZA 3ZZAA 1EZUC 1E35B 1EP5A 2ZGCA 1P10A 5F8XA 5GCHF 1DXPA 2UWPA 3MH4A 1TOMH 5JB8S 3A86A 3MOCA 4H42U 4BNRA 2AGEX 4Z0KA 3HPTB 4UFDH 4FUHA 3V13A 1OWHA 3ZZ5A 1ANBA 1UJ1A 5EQQA 2K1QA 1C1QA 3GYLB 1QGFA 4XSKU 1UTKA 1ELCA 4NWKA 4X8TH 5HM9A 1O30A 2IN2A 1CGIE 1YPMH 1QFKH 3STJA 3QZRA 3VB3A 1L1NA 1NRSH 3KQCA 1EAUA 1O2HA 2A4RA 3TGJE 1L1JA 1UHBB 2J2UA 4UFFH 4X2WA 3RXJA 2W5EA 2CJIA 1LVMA 2Z9LA 3E91A 1C2FA 2C8WB 5EPNA 1AKSB 2AMDA 1XUJA 4MPVA 1CHOF 2FI5E 2SGEE 2IOTA 1CO7E 3ZYDA 4IMQA 1UCYH 2QIQA 1FPHH 1MTUA 7LPRA 3QLPH 2QXGA 3K2UA 2VB0A 1YM0A 5JDUB 2WUBA 1ABJH 2GT8A 2C4FH 5EXMA 4BAQB 1E0FD 1IQHA 4IN1A 5DP3A 1WAYB 1O2JA 5C3NA 1XUGA 4JZEH 2BB4A 1HJ8A 3RU4E 1GMHF 1BRUP 3KGPA 2BVXH 2Y5GA 1H1BA 3S9CA 1O2VA 4A5TS 3QGJA 4THNH 2OBQA 4ABBA 1GHAG 3GOVB 1Y3XA 1SLVB 4AORA 3BEUA 3TPIZ 1DS2E 2HNTC 1YLCA 3VEQB 1YCPH 3A85A 1A0HB 4INLA 3SGBE 1ZGVA 1TGTA 4VGCC 4CRDA 1O3IA 1S5SA 1ELDE 3RXCA 1UTNA 1P2QA 5AF9H 1HAVA 4UD9H 4KP0A 2BM2A 3GICB 3RXPA 2HNTE 1EB2A 2F9BH 2VGCC 1EASA 4CHAC 1NESE 4ZHLU 1P9SA 3RDZA 2P94A 2ZHWH 2RDLA 1QRZA 2AIPA 2XBXA 1GJAB 2QAAA 1S6FA 3MFJA 4INHA 3ZV9A 3P8NA 4DGJA 1ZTKA 2J4IA 1UTPA 3L33A 1Z6EA 1NN6A 1X7AC 3TVJB 1SHYA 2GX4A 5JBTA 5L2ZH 4F4OC 3SUEA 4BAKB 4FVDA 2PLXA 1ANCA 1SLUB 4HZHA 4TY7A 3RLYH 3T26A 1FJSA 1TPAE 4FUFA 2SGAA 4CREA 4ABDA 4AGJA 4CRBA 2BX3A 1O5BB 4NSYA 1NRPH 1C1UH 2A32A 1TPPA 3P8OA 5K7RA 2BD3A 1GDUA 1CBWB 3BTTE 3QX5H 1GBMA 3HGNA 3BTQE 4AG2A 3RLWH 3SNEA 4JYVH 2WYJA 4Y79A 1ETSH 2BY7X 1N8OB 4AYYB 3KL6A 4JZIA 4SGBE 2G81E 1XXDA 3B23B 2Z94A 4ISNA 9ESTA 1U6QA 1P3EA 4Z6AH 1W0ZU 5BRRE 1RTLA 2FIRH 1H9IE 4DY7B 2CF9H 2EEKA 4JCNA 5GDSH 4X2YA 1KYNA 3UWIA 1N1LA 1A0JA 1V2NT 1HAIH 3FAOA 1PQ7A 1F5LA 2A7HA 2VINA 1ZRBA 1HAGE 1LTOA 1RFNA 2XYAA 1K28D 1P3CA 3Q77A 3WY8A 3A7ZA 5FPSA 2JETB 2GDEH 1AFQB 1E34B 4FUBA 4B73A 1AD8H 4WJG2 1GL0E 3RU4D 1BUIA 2RA3A 2VVVA 3PLBA 3TU7H 4XOJA 1P2NA 5EW2H 1MBQA 1QRXA 1SG8B 1PPBH 1T4UH 1YCPM 3KNXA 3TK9A 1PJPA 1LHFH 3EQ0H 4OS5A 1J8AA 1FLEE 1NRRH 1V2LT 3P95A 1EPTB 1GPZA 3IITA 1BTXA 5FBEA 1O2RA 2OLGA 2FOHA 2PUXB 1GBKA 3HK6B 4YO9A 2F9VA 3MNCA 1SLXB 1DWEH 3K9XB 2UUYA 1NU9A 2B9LA 5DO4H 1ESBA 1V2VT 2ZCLP 3VXEH 4TY6A 2F91A 4X1RU 1QQUA 3BTFE 2FYQA 1JMOH 3VPKA 1QA0A 5AFZH 1G3EA 3BIUH 1O5CB 1UCYE 5ABWA 1V2UT 3H7OA 3RMLH 3BG4B 1GBHA 1Z6JH 2ZDNA 1ESTA 5EODA 2OC0A 4NIWA 2KAIA 1F2SE 1J17T 4KTCA 2AMPA 5DG6A 3UQOA 1G3CA 1NS3A 2Q6DA 1QL7A 1GI3A 1KLIH 4H4FA 1GHAF 1DDJA 4Y8XA 2VWLA 5F8ZA 5EXLA 3PYHA 2A45B 4JYUH 1G2MA 2BY9X 3F1SB 2QXIA 3OSYA 4DG4A 2ASUB 2BD5A 1JBUH 3PO1B 2VWMA 2QF3A 3A84A 5C5NA 5FAHA 3MMGA 1DUEA 1TAWA 1SLWB 1AN1E 5FBIA 3TIUA 2GTBA 2P16A 3OYPA 2OQUA 4WY3A 1DE7H 4Q80A 1THRH 1HDTH 3SV8A 4AFQA 1D6WA 8GCHG 1TQ0B 4CH2B 5DGJA 1G2LA 1ZHPA 4BAOB 5C1XA 2ODYB 1PPZA 1ZPZA 2HALA 2Q1JA 1C5YB 5DP9A 2QCYA 2BQ7B 2LPRA 1N8OC 2ZFQH 3UIRA 3LJOA 2BOHB 2W3IA 1A5GH 2C3SA 2SGFE 2ZO3H 3PMHB 2ZU5A 2B7DH 2QYIA 1FY5A 1SGCA 1Y3WA 2D26C 1D9IA 3RXKA 3F9EA 4E7RG 3PLKA 1GGDB 4FUGA 4H6TA 5C20A 5C67A 2BY5X 1P8VC 2EC9H 1THSH 1GI7B 1ID5H 2XWBI 1T32A 1S82A 2JETC 4K60A 2BOKA 2PKSB 1O3JA 2UWLA 3RMMH 1BJUA 3AAVA 4K69A 2FS9A 1T31A 1AE8H 1AZ8A 1O2UA 3ZYEA 1RGQA 2XXLA 1O5GH 3V12A 2WINI 4MLFB 2Y6TA 1TYNA 4NIXA 1JIRA 2B5TB 4E06H 3SQHE 4I32A 2JKHA 2GVFA 5CHAB 2FXRA 3T62A 1SGQE 1FMGA 4AFZA 4DVAU 3RXUA 2BDBA 3E0NB 1PQ8A 1B5GH 4NA9H 5H4IB 1L4DA 3A7TA 3M3SA 1T8LA