2BLOA

Elastase before a high dose x-ray "burn"
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ELASTASE 1
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bloA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bloA01
2PV9B 2ZHEH 4O97A 5H4IB 3LDXH 1L4DA 1V2RT 3M5MA 5A0CA 5DP8A 1L1JA 1MKXH 4ZKRU 4OS1A 2FEQH 2GCTB 4INKA 3RDZA 3BTHE 5FX6A 3QTOH 4XSKU 1AGJA 1ZPBA 1OWEA 2PR3A 1O3IA 1OWDA 1YPGH 1OS8A 1VJAU 3ZVCA 1O30A 2C8ZB 2ZDMA 1QGFA 3EQ0H 4NFEA 4K8YA 1BIOA 2QCYA 2VH0A 4Y8XA 1NT1A 3RXGA 5FHTA 5T6FA 1DUEA 3LJJA 1C1SA 3OY5U 1NRSH 1MTNB 1NFYA 4I8JA 5JBBS 2A45B 4ABAA 2HOBA 4R0IA 3LKWA 3TLOA 1O5EH 3LC5A 2FI3E 3GCNA 2JH0D 1BITA 1CSOE 3E0PB 4ZH8A 4A6LA 1OWIA 4XBDA 1Q2WA 2ZGCA 7ESTE 1DDJA 1P01A 2ZA5A 2YOLA 1L1GA 4AZ2B 3MU5A 1P09A 3F9EA 1UHBA 2EA3A 3BTFE 1F0UA 5A8XA 1YLCA 4BOHA 1UHBB 1W2KH 2BD9A 3ITIA 1JRSA 1C5NH 1O2TA 2STBE 1C1NA 3F9HA 3S69A 3QZQA 2ZTYA 3U1JB 1UCYE 1ETRH 1HGTH 2RA3A 4LOYH 4OS6A 1O36A 1TYNA 2SNVA 1C5MD 1YCPK 3E91A 3PWBA 5GIBA 1ELVA 1GBKA 4ABHA 4D9RA 3V12A 1MAYA 4FUGA 2BDYA 4UEHH 2F9PA 5L2YH 1C2GA 2WYGA 3RXMA 5C2ZA 5CMXH 2CHAB 2AMPA 3D62A 3LT3A 2DE8A 5C3NA 3E3TA 4Z0KA 2BM2A 3T5FH 2PGQB 2BHGA 2W26A 2VIDA 1ELGA 3LOXA 3P17H 2VVVA 4BTTB 2M5TA 1MAXA 2A4OA 4WMEA 1XKAC 1NRNH 4A92A 1ZSLA 1C5OH 4CBNA 5FXLA 3SQHE 2OC7A 3RM2H 1RIWC 4X0WU 3DT0H 1BHXF 6ESTA 3QUMP 2BD4A 4CRAA 1QRXA 2BOKA 2XBYA 1WV7H 6CHAB 4UFDH 2THFB 1GG6B 4IC5A 2GT7A 4ISNA 4R8TB 3VXFH 1ETTH 4NWKA 2HNTF 2BQWB 2F91A 2Z3DA 8KME2 1N8OC 1LPKB 4MPXA 1CU1A 2CF9H 1MBMA 1E37B 4O9VA 3PWCA 5DO4H 3E6PH 1P10A 4GVUA 2BLQA 2ZHWH 4IMZA 3O8DA 4KTSA 2G4UA 2BY8X 1NESE 1TX7A 3KN2A 1INCA 1EASA 1XUKA 3AAVA 2ZDNA 1O2GH 2P3UB 1BUIA 4MG3A 2ILNA 1TABE 1C5WB 5DKMA 3TJNA 1T4UH 1RGQA 1YPMH 2H9EH 1CGJE 4OGXA 3GOVB 4Y76A 3SI4H 1FN6A 3BTKE 4X6OA 3MTYA 3NPSA 1SVPA 3MH5A 2GV7A 2ZHFH 3T2NA 5GWZA 4WH6A 2F9UA 3SU5A 5F6MA 1DX5M 1S6FA 4YM9A 2NWNA 1J16A 5ABWA 4CRDA 2WUBA 4OGYA 3MO3A 1SQTA 3KL6A 1MMJN 3TGIE 2BVRH 3S9AA 2HLCA 3HGNA 1LMWB 2GMTC 3NWUA 1P2NA 1C1WH 1O3KA 5EPYA 4YTAA 3TPIZ 4D7GA 1UTNA 1UTKA 3RXEA 1TLDA 1GPZA 4NIWA 3P8NA 2ZU3A 2TRMA 4PROA 5E0HA 3UNSA 4BAKB 3GCOA 1T7CA 3DFLA 1C4Y2 3G01A 2NU2E 2W3IA 1O5DH 1O2PA 5F8TA 1E34B 1V2NT 5LPEA 4FUIA 2SNWA 1EAIA 1G9IE 1SGFA 1FQ3A 1LVOA 2R3YA 1DSTA 1WU1A 1C5SA 1FV9A 1PQ8A 3SUEA 2BLOA 2BLVA 1TE0A 1SLVB 2GDEH 2H1UA 1EKBB 3FVFB 2C90B 1THPB 1C5UA 2F9OA 1KXBA 1ORFA 2D26C 4X2WA 3ATKA 4SGAE 1SLUB 2VGCC 3CENA 9ESTA 3MU0A 2HNTC 1C5VA 1ZZZA 1MTSA 2GVFA 1ZHMA 2G4TA 3SZNA 2OBOA 3IITA 3EAJA 2XNIA 2UUYA 1G37A 5FBEA 1SQOA 2PFEA 4I8HA 4XBCA 4ISIH 2OC8A 4X6NA 1OWHA 3SNBA 1FXYA 1ABIH 1GI8B 4FUDA 4KKDA 3URCA 4JZDH 5JB8S 1S6HA 3UTUH 3S9BA 4ZHLU 2HALA 2J92A 5TCAA 1TNKA 1C1VH 3A7VA 3GCHC 1NU7B 1OYQA 2BQ6B 1AVGH 3M5OA 4D9QA 3RC6A 1D3PB 1YKTA 3BF6H 3D65E 4Y0ZE 5EXLA 2I6SA 2BZ6H 2ZG0H 3SGBE 3SU3A 1ZGIA 3MU4A 5LGOA 1QR3E 2Q6DA 1F5LA 2SGAA 2Y7ZA 4KP0A 1Y3WA 2UUKB 1O3HA 1HFDA 4FVDA 1VZQH 1O3FA 1ZTLA 3RU4T 1GHAG 3B9FH 1EJAA 4I8LA 1MZAA 1PYTC 1T8MA 3A80A 3R0FA 1Z1JA 3MMGA 1LPZB 2Z94A 4FUHA 2ODYB 2TGTA 3EA7A 3V0XA 1O5GH 1O5AB 1O3MA 2J34A 2H5CA 1ANDA 4UE7H 3RXUA 3LGVA 2BTCE 1OOKB 3PB1E 4A1TA 4B2AA 3K6YA 2J94A 2SGQE 3SU6A 3MI4A 3K6ZA 1FZZA 1GBJA 3ATWA 2AMQA 1PQAA 1E0FD 2ZGJA 4AFUA 4CBOA 1GVZA 1GI2A 1QA0A 1GJ4H 4X2VA 2R0KA 3SNCA 3TGJE 2HPQH 4IGDA 1FAXA 3T28A 1ID5H 1MH0A 1HJAB 2NU4E 2RDLA 1GHZA 3A81A 3SN8A 3LGYA 3P8FA 4ABGA 7GCHF 2ZEBA 1O37A 1VITF 1PPCE 1Z8JB 1DWCH 1RRKA 1V2ST 5HGGA 3NUMA 1AHTH 1GJDB 2BD7A 2BY6X 1LVBA 5PTPA 1CT4E 1AIXH 5EQSA 2OC0A 4VGCC 2QXHA 1TBRH 3FP6E 2GZ7A 2IN2A 1ZRBA 1C5XB 1BMNH 1ABJH 2OCVB 1BJUA 1CGHA 2NU0E 4GHQA 2GT8A 2PTNA 2PWXA 1HJ9A 5FPYA 5EW2H 1K9OE 3UWIA 3A86A 4F4OC 3A82A 2BDIA 3ZZDA 4ZAEA 1GDQA 5DP4A 3A8CA 4Q7YA 1A0JA 3GCTG 4YOGA 1QCPA 1ZYOA 4NIVA 2JH5D 4X8VH 1IQNA 1SOTA 1V2KT 5A09A 3LH1A 3VGCB 4AOQA 1YYY1 5T6GA 1QA7A 3U69H 4YO9A 4MLFB 3DD2H 2OLGA 4IS5A 2LPRA 4HTCH 2VVCA 1AB9B 3UPEA 4XFQA 3FZZA 3RXRA 2A7JA 4I8GA 1HPGA 1P2MA 2AGEX 4KTCA 3UOUA 1ZSJA 4A7IB 1EPTC 4CRBA 3UIRA 3ZZBA 7KMEH 1CT2E 2H6MA 4OS7A 2OXSA 3EYDA 1GBMA 3LGIA 1W12U 3VB5A 4CRCA 1GI7B 1MQ6A 2ANYA 1JWTA 1VGCC 1HV7A 1QB1A 2AERH 1C2LA 4XOJA 3GCTF 3QLPH 1TMBH 4X2YA 4MNXA 3SNAA 4I8KA 2BDBA 1XUHA 2PTCE 1IQFA 2QXJA 5A0AE 1Z8IB 3Q77A 4ISOA 3HKJB 4X6PA 2ZECA 3ATLA 2ZO3H 3Q3XA 2FPZA 1BBRK 1FY3A 4DIIH 2Z9GA 3U1IB 2ANWA 4U01A 1YPHC 2AFQB 4NSYA 1O3GA 3UQVA 2WPMS 2AEIH 4AFQA 1CHOF 2ZCKP 3BTQE 2UWLA 1ARBA 2B5TB 4BAQB 1ANEA 1NC6A 4RN6A 4H6SB 1GJ9B 2GCTC 4NSVA 2UUJB 1KXDA 1V2JT 1LO6A 1AO5A 3BTDE 1V3XA 4X1QU 1QRWA 2QF3A 2P3FH 4E05H 2Z6BD 1GJ6A 1A4WH 4ESTE 1OSSA 2R0LA 3EE0B 2YNBA 4IN1A 1RTKA 1C2IA 3FZDA 2D2DA 1TIOA 3URDA 1YP9A 1BMLA 3ZV8A 3I78A 1E36B 1MTNC 4CREA 3D23A 1LHCH 2BDAA 3GY7A 3H7TA 1LCYA 2VWNA 3K9XB 3VB3A 1TGSZ 4M7GA 1C4U2 4SGBE 4UD9H 5HXFA 3T27A 2QXGA 2LNCA 3SJ8A 2A5IA 3Q00A 2EI7A 1W3CA 4ABEA 4TPIZ 2FS9A 4O3TA 4B1TA 2WPKS 1MKXK 2BDCA 1W14U 5F03A 4U32A 1FIZA 2BDGA 1E35B 3ENSB 1UK3A 1K1PA 1EUFA 3TH4H 1K22H 4MNYA 5E2PA 1YPJH 1D3DB 1XX9A 1BBRH 1JMOH 1G36A 2JH6D 3KHVA 3RXKA 5C5OA 1SGPE 1ESAA 3FP8E 4X1SU 1IHSH 1O35A 3TU7H 3V13A 2ZNKH 4NA9H 3BEUA 3MU1A 2FOHA 2FXRA 2VB0A 1FNIA 1HXFH 4YT6H 5I25A 1ZPZA 2AMDA 1QNJA 2VVUA 3ZYDA 4MVNA 1OWKA 1W0ZU 1SGFG 3BIVH 4X1NU 2GD4B 3CS0A 6LPRA 2BVXH 2CHAC 5E8EH 1YM0A 1TGBA 2BYAX 3BG8A 2ZGBH 2ZQ2A 1SHYA 4GLYA 1PFXC 4YOIA 4TWYA 1O5FH 1P3CA 1DWEH 1GBEA 1O2IA 1QRZA 2F83A 1CBWB 2TIOA 3RXTA 1LHDH 5GCHF 1SPJA 1GL0E 3RLYH 3BN9A 1KXAA 4THNH 2C8YB 2EI6A 4AYYB 2G52A 2J9NA 1PPHE 3H5CB 2ZU1A 1NFUA 1ZGVA 1FDPA 1LVMA 5LPFA 3FP7E 6CHAC 1KIGH 1BTWA 8ESTE 4YLQH 2WV4A 2XRCA 1GG6C 4FUEA 2F9NA 5CHAB 5ESBA 2W7UA 1GMDF 1MD7A 2PKAA 1A5HA 2C8XB 3ATMA 1KXCA 1TX6A 5TJXA 3UUZA 3GYMA 4Y10E 4CRFA 4Y0YE 2PKAB 1OXGA 3HK3B 4HFPB 2ZKSA 1RTLA 1UTOA 2WINI 1AFEH 3E8LA 1B5GH 1J17T 1V2VT 1NY22 5SGAE 2OINA 1LHFH 2QXIA 4FUJA 4CRGA 1T8LA 3B8JA 3TH3H 3MH4A 3ZVDA 2UWOA 1GI9B 1O2QA 1MTUA 1IQLA 3KNXA 3RLWH 2SGFE 1CHGA 1DXPA 2ANKH 1HDTH 1F0RA 4X1PU 4UFEH 4X8UH 1CA8B 1C2EA 2XCFA 1C2MA 2CGAA 1NRRH 3ODFA 1A0LA 1EZSC 4WMDA 1WTGH 3RMMH 2BX4A 3QWCH 1ELAA 1SFQB 2W5EA 4MNWA 2ZCHP 2XC4A 3VB7A 2ALVA 1DFPA 1A61H 1O34A 1EZXC 1NRPH 1J14A 2ULLA 2FM2A 2EC9H 5JYIA 3VB4A 3SJKA 9LPRA 5JB9S 1TWXB 4WY3A 1H8DH 3TGKE 3A7YA 4DJZB 1TRYA 3SI3H 1UTJA 1KSNA 3UR9A 3ZZ6A 4B2CA 3LH3A 1TPAE 1MUEB 1F2SE 4JZFH 4MQAA 3VFEA 3GY6A 5EW1H 4OS4A 5JBTA 1NTPA 2PKSB 3KQEA 5DP9A 2ZC9H 3TJUA 5JBCS 3ZZ4A 1DICA 3ZZAA 2ESTE 2BQ7B 1GVKB 3BTEE 2FWWA 1EZQA 1HIAA 2BDHA 2O8LA 2BD5A 3BTME 1EAWA 1O2OA 1HIAB 3UNQA 2CF8H 4NFFA 3GY4A 4FUFA 4IC6A 1ZOMA 1GVLA 3A8AA 1O3EA 2VH6A 2TPIZ 4WXIA 1FPHH 5DGJA 3AW0A 5JPMH 1GBAA 1TNLA 3BTTE 1AI8H 2D8WA 3SNDA 4KELA 3BEIB 4JK5A 5EOKA 1TRNA 4WH8A 3LPRA 4K69A 1Y8TA 4DCDA 4HGCA 1C5ZB 4Y79A 1BDAA 2OBQA 3Q3KA 2Z9KA 3T26A 3AAUA 1G3DA 3M7TA 1L2EA 1FLEE 5HM2A 2ZDVH 4K1TA 2F3CE 2H9TH 4GCHF 1QB9A 2V0BA 4AFZA 1THRH 3D49H 5A8YA 3A87A 1WOFA 1QQUA 1TQ7B 3NZIA 1C5PA 1WUNH 3RUOA 5L2ZH 2V3HH 4A5TS 3F1SB 2GTBA 1LQDB 1T8NA 1Z7KA 1A3EH 2WPIS 1BB0B 3RXOA 1P12E 2BXUH 2ASUB 2ZI2H 1A0HB 1XM1A 1B7XB 1DVAH 1IQHA 1Y5UT 4LZ1H 4Y8YA 1D9IA 1P2JA 1ZHPA 4F49A 5I46H 3RU4D 3SJIA 3VPKA 5JDUB 1D6WA 2VIVA 3UREA 2AS9A 1H9IE 3RXAA 2Y5FA 3GY3A 3A84A 1CT0E 1GCTB 2IOTA 2W7SA 1KLJH 1C5RA 3L3TA 1RXPA 2AYWA 4AB9A 2VNTA 2TBSA 3CP7A 3KQDA 4ABBA 1D6RA 4DVAU 1ZJKA 4K1SA 4Q2KA 5EG4A 4DOQA 1TB6H 2A7CA 1HCGA 3QGJA 4GUXA 1BTPA 3GYLB 1C1UH 1O3NA 1GBCA 1ZTKA 3I29A 1UMAH 2QA9E 3PO1C 4B76A 2A1DB 1HJAC 2ZHDA 3F6UH 3EGKH 3M5LA 1JIMA 2ZDKA 4Y8ZA 1KXEA 3H7OA 2WPHS 2QGRA 2DE9A 3AASA 1SQAA 4B73A 1GJ5H 1Y5BT 4JYTA 5AFYH 4X8SH 1S82A 1OWJA 1DY8A 1ZTJA 2RCEA 1GGDB 2BY9X 1IQJA 4FU8A 1XMNB 1DWBH 2FOFA 3RXJA 5FPTA 5GDSH 1P3EA 1EAXA 1XUIA 2UWPA 3QN7A 4YLUA 2CV3A 1FI8A 4ABJA 3LONA 1C2JA 3R3GB 1OX1A 3S9CA 1GHWH 1QJ7B 5DP6A 3NKKA 3ZZ9A 3B23B 3QO6A 1AN1E 4U30A 3ELAH 1J9CH 1C9TA 1GJCB 2QY0B 3MNBA 3VGCC 2TGPZ 3MO9A 2GDDA 2XC5A 1G30B 3PMHB 4YT7H 2C4FH 1C2HA 1AB9C 2ANMH 1ESTA 1VR1H 2XYAA 2FZZA 4U2WA 1BRUP 1J15A 5EPNA 1EP5A 1WAYB 1T8OA 3OY6U 4HZHA 1ETSH 4NG9H 2FOBA 1O3PB 1SOZA 5C1YA 4YOJA 3U8TH 4I33A 4BAMB 2BLWA 1RTFB 2G5NA 4B74A 1O3LA 4K60A 1K1JA 3SV2H 2F9VA 3ODDA 2Y5GA 1Z6JH 2WPJS 3O8CA 1WQSA 3A88A 3HATH 3BV9B 4AFSA 1BCUH 3STJA 1GBBA 1N6YA 2HVXA 7GCHG 1VITG 4AGKA 3KIDU 3P8GA 1TGTA 2BY5X 2QV1A 5E2OA 1EJMA 2BD2A 1DT2A 2XCNA 2SFAA 2FX6A 1TBQH 2P59A 3V7TA 1SSXA 4K3JA 4KGAA 4XDEA 1MZDA 1C2KA 3MHWU 3SJ9A 3IWMA 2AGGX 4JMYA 5B6OA 4ASHA 3PTNA 1O2MA 2HGTH 1O3JA 1WCZA 4CR9A 5FX5A 5BRRE 4J1YA 1AQ7A 1NFXA 1W10U 3W94A 3PO1B 1FN8A 1LPGB 1HAIH 2G55A 1EXFA 4DW2U 1J8AA 3UNRA 1W0YH 4ZHMU 4K2YA 3UQOA 2WV5A 3TH2H 1XVOA 2P8OB 3IG6B 2A4RA 2GX4A 1ELFA 1C4V2 1CA0B 4GSOA 3QX5H 1GCDA 1SLWB 1DANH 2IPHA 4BXSA 1BRCE 2GCHF 3MU8A 2Z7FE 1XUFA 1ELTA 2V35A 4A1XA 4J2YB 4RKOB 1PPEE 1YPKH 1DITH 2PUXB 1RS0A 1P2IA 1QJ6B 2GGVB 3QZRA 3PYHA 1W11U 2PHBA 1TMTH 1DSUA 2FIRH 4BXWA 1CVWH 2SGPE 5A2MH 2XXLA 1SI5H 5EU8A 4ABIA 4MPUA 1TNHA 2V6NA 1NN6A 1H1BA 1WQVH 1O2XA 1U6QA 3HK6B 1DWDH 2B9LA 2CJIA 1QTFA 2Q6FA 1A5GH 1H9LB 2WPLS 2FX4A 1G3BA 5E0GA 3TJVA 3SUDA 3RXCA 4Y7BA 4INLA 1GDNA 1QL9A 5F8XA 4CH2B 1B0FA 1SGCA 2HPPH 2ZU4A 3A8DA 3DHKH 1SBWA 2ZGXH 1QFKH 3UFAA 2A2QH 4UONA 1GMHG 1CHOG 5C67A 4MPWA 3ZZ3A 1GI1A 1HAVB 4ABFA 1IQEA 3RXPA 1VITH 1ZMJA 2R9PA 2FOEA 2ZP0H 4LXBH 3UR6A 1KTTB 1CBWC 3MOCA 4WXVA 3CS7A 1O2VA 1UCYK 1XUJA 5DP3A 1TALA 1TPSA 1TNJA 1B0EA 3SHAH 1ZPCA 1SGYE 2ZFSA 3OX7U 1G3EA 2Z3CA 2FMJA 1BRAA 2J4IA 3DA9B 1YF4A 5TCCA 2ZTXA 4AG2A 2FODA 2PW8H 3TITA 1GMHF 3MNXA 4NWLA 1TGCA 3UWJH 1Z1IA 2FTLE 1TAWA 1XXFA 1ELBA 3M7UA 5CHAC 1L4ZA 4OS5A 4IN2A 1FIWA 1EQ9A 3BG4B 2A32A 2Z9LA 2VU8E 4AYVB 4JYUH 1O33A 1FY4A 4I7YH 1P03A 2C3SA 2QAAA 4NIXA 1O32A 3O8RA 5G4BA 4K1EA 4FU7A 3U8RH 3O8BA 3N7OA 2FS8A 1SR5C 1EX3A 1GHYH 1W7XH 1BA8B 1O2NA 1HAGE 1SGRE 1KY9A 1DXWA 3F68H 3EA8A 1BTUA 2PUQH 6GCHF 1KDQA 1HJ8A 4NZLA 3SO3A 2O8MA 1KDQB 3HPTB 2AGIX 3KCGH 3PMBB 4D8NA 3P6ZB 5T3HA 1BJVA 1S84A 4INHA 4MDSA 1N6XA 1DM4B 1TFXA 2YNAA 2P16A 1YC0A 2ZHQH 4K8BA 3RMOH 4X8TH 3M3SA 5EXMA 1ELCA 1UCYH 3KQCA 3BTWE 4GAWA 3OSYA 4Q7ZA 2ZGHA 3HKIB 3SU1A 1D3TB 5AVDA 1GJ8B 1LVYA 2BXTH 1RJXB 3ATIA 1BTYA 1QY6A 5GCHG 1UK2A 4ZUHA 3OYPA 4D76A 1V2OT 8GCHG 1DY9A 2NU1E 3M3TA 3VEQB 4JZEH 3DFJA 4MNVA 1GI0A 4MTBA 4JZIA 1MKWH 1MTWA 1SL3A 1SB1H 2ZZUH 3TNTA 3PROA 1C1TA 3TK5A 1H8IH 2I6QA 2PKSC 2O8UA 1NO9H 4IW4E 3SOSA 2FOGA 1GMDG 2JETB 1TNGA 2GV6A 1NROH 2AIQA 1JOUB 3MWIU 4X1RU 3ZZCA 3M3VA 1LQEA 2VWOA 1AFQB 1S81A 4WF8A 1P05A 8GCHF 2RG3A 3JZ1B 3RXLA 1TONA 1Y3VA 4AG1A 2VWLA 2BMGB 2A4QA 2PGBB 2Q1JA 2EEKA 3KF2A 3RXQA 5DP7A 2J95A 1HAYB 3LU9B 5FBIA 1GBDA 1EB1H 2Y80A 5FCKA 4JCNA 4NGAH 1AZ8A 5HYOA 3ESTA 2FOMB 3NXPA 8LPRA 3UY9A 5EXNA 1W8BH 1L1NA 3BSQA 5C1UA 2CXVA 3Q76A 1ZRKA 2ZIQH 1AWHB 1V2MT 3PLKA 1UTQA 1PPGE 3LIWA 2ALPA 5FAHA 2RA0A 3RMNH 1OPHB 4B75A 1P8VC 3NCLA 1AUJA 1IQMA 3A8BA 1HBTH 5DP5A 2VIQA 1XVMA 1P2KA 4B71A 1XXDA 3P8OA 2XWBI 5JBAS 3RXFA 1PYTD 1HRTH 1SGDE 1PPBH 3A85A 3PLPA 4ZXYH 1DE7H 1UJ1A 2D1JA 5ETXA 1C5QA 2GZ8A 3LGUA 1RFNA 2G00A 3SV8A 3TIUA 1FY8E 1GI4A 1GCTC 1FJSA 1C1PA 1UVPA 2B0FA 2ZFFH 2ZFRH 1Z71A 1TOMH 1C1OA 2CN0H 3S7HB 2BB4A 1Y59T 1MTVA 2P95A 1GDUA 4CHAB 1AY6H 3TK9A 2STAE 2Y82A 3C1KA 1LHGH 2A7HA 3PTBA 1GBLA 2OD3B 1C2FA 1ZLRA 3RXIA 1C1MA 4KTUA 2VIOA 1RD3B 3SV9A 2P94A 1AKSA 3PM3A 1OP8A 1F0SA 1YBWA 3SGAE 1ARCA 3ZZ7A 1F5RA 3V3MA 1C5TA 3RXVA 1IQKA 1BBRE 1AKSB 5EGMA 3E16B 4H4FA 1HLTH 1PPZA 1AMHA 3A7ZA 1T31A 2Q6GA 1P9SA 1GHVH 4GCHG 3TK6A 1BT7A 1VCWA 1CGIE 2G81E 1UTMA 5J4QA 1ESBA 1IQIA 2ZWLH 4HI3A 1GGDC 1UVUH 1O39A 2V3OH 3KGPA 4WVPE 1P04A 3OU0A 1A3BH 1QL8A 5DJ7A 4FVBA 2AH4X 1P02A 1ZMNA 2ZQ1A 3KEEA 1QQ4A 4X6MA 3T29A 1P9UA 1OP2A 1DS2E 4BAOB 3LGWA 5FCRA 3RM0H 3SORA 1K1NA 2JKHA 1HYLA 3MNCA 3S7KB 1V6DA 5L30H 4TPYA 2SGDE 1KTSB 3SV6A 4YESB 1AUTC 1GL1A 1GI6A 1ANBA 1MD8A 3T62A 3A7WA 5A0BA 1VJ9U 2A31A 4FXGH 4JK6A 1S0QA 4ZXXH 4NIYA 1K1MA 4H42U 1S5SA 4OS2A 1PJPA 1TX8A 1O2ZA 1TOCB 1LKAA 3STIA 3GY8A 3GDVA 3FAOA 2C93B 3SQEE 2R2MB 3TJOA 3F9FA 4I32A 3P95A 2IJOB 4Y11E 2KAIA 4LK4A 4JZ1A 3SBKA 2C8WB 3WY8A 1YCPM 1DPOA 1S83A 1EB2A 1YCPH 1TBZH 2KAIB 2WUCA 4B2BA 3A7XA 1FPCH 1EAUA 2PSYA 1UVTH 3JZ2B 2FLBH 3RC4A 4WJG2 2QIQA 3K65B 1T32A 1UVOA 1TGNA 1LDTT 2W3KA 1DLKB 2ZCLP 1HB0B 5ESTE 2VJ1A 3ZV9A 4DT7B 5EODA 5A8ZA 2VWMA 1ZMLA 1LKBA 3QDZB 4ZKSU 3DUXH 2FP7B 3MH7A 4LZ4B 4RSPA 1LHEH 4ZHAA 3RXSA 3RC5A 1O2UA 1UTPA 2Y5HA 4MPVA 1TMUH 1F92A 3RXDA 1SMFE 3SU2A 1V2TT 1UO6A 3QTVH 1F7ZA 1TRMA 2P8OC 7LPRA 1GBFA 2A5KA 4X2XA 2DUCA 4FUCA 1S85A 2OP9A 3GY5A 4CH8B 1CA0C 3ZVAA 3MNSA 1NM6A 1ZHRA 1XUGA 1IQGA 1O3CA 1NS3A 1MCTA 4CR5A 4BNRA 2ZFTA 3S0NA 1M9UA 5IYTA 1MU6B 1K21H 2O8TA 1GI3A 4UFFH 1UTLM 1K2I1 4D7FA 1WBGB 1WTHD 1HAZB 1ELEE 1K28D 2NU3E 1IAUA 3RXBA 1QBNA 1GWAA 4IBLH 5DK1A 3W95A 1T4VH 4DY7B 3GISB 1O2RA 1FY1A 3SU0A 1RIWB 4GHTA 4QT8C 1F0TA 2QC2A 3BTGE 2P3TB 5FPSA 2FLRH 1QHRB 1SHHB 3EA9A 1UK4A 3M37A 1KYNA 1K1LA 2ZPRA 2K1QA 4O3UA 3A7TA 1THSH 4ZKOU 2TGAA 1O2KA 4Y7AA 4NCYA 1SGQE 1OYTH 2FESH 1BTXA 1O31A 5AF9H 2Y7XA 3GY2A 1CO7E 3LJOA 5C20A 3K2UA 1YLDA 2XBVA 4RKJB 1HAXB 2R3UA 1CQQA 2G8TA 2HWLB 1D3QB 1BTZA 2B7DH 2G51A 1G32B 1N8OB 3L6PA 1YPEH 1G3CA 1GHXH 1EOLA 3VXEH 3SHCH 1C2DA 2XWAA 1MBQA 1O3DA 1GHBG 1PPFE 1AE8H 4DGJA 4Y6DA 1DUAA 1FUJA 3ZVBA 4WMFA 1MQ5A 2PSXA 2ZTZA 1MCVA 2GP9B 4UFGH 1W13U 1Q3XA 1C5YB 5J4SA 1QJ1B 1Z6EA 2ZF0H 1YPLH 1HUTH 2H2ZA 1NFWA 2A2XH 4JYVH 1BZXE 2FYQA 1SC8U 1SGIB 3U98H 4O03A 5C5NA 3GDSA 1G2LA 2GCHG 3F9GA 1GJBB 2GZ9A 3OTJE 4TY7A 5K0HA 3BG4C 4GPGA 5C1XA 2HRVA 4TY6A 1AWFH 1KLIH 1EATA 2GKVE 2VIWA 2ZDLA 1GHBF 1ELDE 1AE5A 1IOEA 3A89A 3EDXB 1PQ5A 1C1QA 1H9HE 4AGJA 1TPOA 2UUFB 1GJAB 1P57B 4IMQA 1NPMA 2XC0A 2WYJA 1LTOA 1V2QT 2GMTB 3KQBA 1Y5AT 3TVJB 2A4GA 1L0ZA 5DG6A 1BMAA 2ZU5A 4E7NA 1BOQA 1D4PB 5EQQA 2SGEE 4AN7A 1H4WA 1HXEH 1ZJDA 1V2LT 1FY5A 3BIUH 1GHAF 3QK1A 2HNTE 4FU9A 4BANB 5L6NH 3A83A 1VCQA 5AHGH 1BHXB 2A5AA 1A1RA 2J2UA 3SNEA 1QBOA 4XE4A 5HMAA 1O5CB 1X7AC 4Q80A 5EQRA 1HAOH 2ZU2A 2CMYA 1P2OA 2Z3EA 1OKXA 2BOHB 1E38B 1QURH 3SU4A 4ZMAH 1WYKA 1SGTA 2VGCB 1NRQH 4ISLA 2XTTB 1QB6A 1Q31A 2OQUA 1V2UT 2B8OH 3M35A 1QL7A 5K7RA 1ANCA 2BD8A 4Z6AH 2ODPA 4YZUA 4WWYA 2ZPQA 1DOJA 1GMCG 3P92A 1Y3UA 3MO6A 2ZDAH 1AD8H 1SGNE 1HAVA 3UOPA 3E90B 3L33A 3E0NB 2Z9JA 3AW1A 3SUGA 1O2YA 1W7GH 3GCHB 2JETC 1IHTH 4H6TA 1QIXB 3MFJA 1DLEA 1AFQC 1K1OA 1OP0A 2Y6TA 4E06H 2VINA 3RXHA 5BPEA 1ACBE 1GMCF 1JXPA 2ZFQH 1GBIA 3RMLH 3SW2B 1GI5A 3Q3YA 1HAHH 4K5ZA 1TPPA 1A2CH 4ZKNU 6GCHG 1EJNA 2H5DA 1O3OA 1CE5A 3E1XB 2OTVA 3PLBA 5E0JA 2Z9IA 1MKWK 4AB8A 1QBVH 1SLXB 3P70B 1O2JA 4BAHB 2FOAA 5CE1A 1N1LA 1O3BA 1XKBC 4UDWH 1P11E 4ISHH 1A46H 4ZROA 3BEFB 2BVSH 2FDAA 2FI4E 1BRBE 4NZQA 3MYWA 4BTUB 1KXFA 1C9PA 1P06A 2OC1A 3ZZ5A 1JBUH 4XBBA 1G2MA 4TWWA 1C5LH 4ABDA 1Y3XA 3ZVEA 3C27B 3I77A 4I31A 3T25A 2OUAA 1BQYA 3GDUA 2ZFPH 5AFZH 3ZYEA 3M7QA 3VB6A 2A0QB 1HNEE 2AIPA 1EZUC 1F5KU 2BY7X 2ZPSA 3TNSA 1O5BB 5T6DA 1O2LA 3PMAB 3GICB 2BX3A 3NK8A 2G5VA 3ZZ8A 2FO9A 5F8ZA 1FMGA 1GBHA 1P0SH 1YGCH 2PLXA 1Y3YA 1EP6A 1SFIA 1A7SA 1FONA 2OQ5A 1AZZA 3M36A 4VGCB 4FUBA 2QN5T 1SG8B 3FANA 4DIHH 3M5NA 1JRTA 2Y81A 3ZVGA 2FI5E 3SUFA 4DG4A 3PV4A 5LH8A 2XW9A 4CHAC 1PQ7A 4A1VA 1KLTA 3LGTA 3FFGA 3U9AH 1NU9A 4AORA 1SGEE 2FYRA 2BZAA 2P93A 4TYDA 3SJOA 1V2WT 5DPAA 2EI8A 3M61U 1TNIA 1WSSH 3AVZA 1VCPA 1BMMH 4AX9H 3ZVFA 5IDKA 1AU8A 2TGDA 2ODQA 3U8OH 3MH6A 3QGNB 3LC3A 1EPTA 1A5IA 1Z8RA 2XBXA 1O0DH 1HAPH 1BTHH 2O8WA 1V2PT 1EPTB 3RP2A 3RU4E 1O2HA 1YPHE 5GJ4B 2VIPA 1EOJA 1JIRA 1GBTA 1ZR0A 4NA8A 5GPIB 3PMJA 1VGCB 4Y71A 2FOCA 1TA2A 2XBWA 5LPRA 1FAKH 4BTIB 1Z8GA 2O9QA 3SV7A 1O2WA 1TQ0B 1MU8B 2BD3A 2F9BH 1C1RA 1O38A 1S0RA 3SGQE 2H9HA 5HM9A 4Q7XA 2QYIA 2R2WU 1UVSH 1O2SA 1AVXA 2J38A 5GXPA 1O3AA 1NZQH 1TA6A 1ZSKA 2FTMA 1P2QA 4DURA 1K1IA 2QF0A 4NA7A 1GJ7B 1AVWA 3HGPA 4E7RG
chains in the Genus database with same CATH superfamily
2PV9B 2ZHEH 4O97A 5H4IB 3LDXH 1L4DA 1V2RT 3M5MA 5A0CA 5DP8A 1L1JA 1MKXH 4ZKRU 4OS1A 2FEQH 2GCTB 4INKA 3RDZA 3BTHE 5FX6A 3QTOH 4XSKU 1AGJA 1ZPBA 1OWEA 2PR3A 1O3IA 1OWDA 1YPGH 1OS8A 1VJAU 4HG6A 3ZVCA 1O30A 2C8ZB 2ZDMA 1QGFA 3EQ0H 4NFEA 4K8YA 1BIOA 2QCYA 2VH0A 4Y8XA 1NT1A 3RXGA 1FX0B 5FHTA 5DSFA 5T6FA 1DUEA 3LJJA 1C1SA 3OY5U 4XD7D 1NRSH 1MTNB 1NFYA 4I8JA 5JBBS 2A45B 4ABAA 2HOBA 4R0IA 3LKWA 3TLOA 1O5EH 3LC5A 2FI3E 3GCNA 2JH0D 1BITA 1CSOE 4Z1MD 3E0PB 3VG8A 4ZH8A 4A6LA 1OWIA 4XBDA 1Q2WA 2ZGCA 7ESTE 1DDJA 1P01A 2ZA5A 2YOLA 1L1GA 4AZ2B 3MU5A 1P09A 3F9EA 1UHBA 2EA3A 5KGOA 3BTFE 1F0UA 5A8XA 1YLCA 4BOHA 1UHBB 1W2KH 2BD9A 3ITIA 1JRSA 1C5NH 1O2TA 2WPDD 2STBE 1C1NA 3F9HA 3S69A 3QZQA 2ZTYA 3U1JB 1UCYE 1ETRH 1H8ED 1HGTH 2RA3A 4LOYH 4OS6A 1O36A 1TYNA 2SNVA 1C5MD 1YCPK 3E91A 3PWBA 5GIBA 1ELVA 1GBKA 4ABHA 4D9RA 3V12A 1MAYA 4FUGA 2BDYA 4UEHH 5CDFE 2F9PA 5L2YH 1C2GA 2WYGA 3RXMA 5C2ZA 5CMXH 2CHAB 2AMPA 3D62A 3LT3A 2DE8A 5C3NA 3E3TA 1BMFD 4Z0KA 2BM2A 3T5FH 2PGQB 2BHGA 2W26A 2VIDA 1ELGA 3LOXA 3P17H 2VVVA 4BTTB 2M5TA 1MAXA 2A4OA 4WMEA 1XKAC 1NRNH 4A92A 1ZSLA 1C5OH 3DSPA 2F4LA 5FXLA 3SQHE 4CBNA 2OC7A 3RM2H 1RIWC 4X0WU 3DT0H 1BHXF 6ESTA 3QUMP 2BD4A 4CRAA 3F2GA 1QRXA 2BOKA 2XBYA 1WV7H 6CHAB 4UFDH 2THFB 1GG6B 4IC5A 5HIZA 2GT7A 4ISNA 4R8TB 3VXFH 1ETTH 4NWKA 2HNTF 2BQWB 2F91A 2Z3DA 8KME2 1N8OC 1LPKB 4MPXA 1CU1A 2CF9H 1MBMA 1E37B 4O9VA 3PWCA 5DO4H 3E6PH 1P10A 4GVUA 2BLQA 2ZHWH 4IMZA 3O8DA 4KTSA 2G4UA 2BY8X 1NESE 1TX7A 3KN2A 1INCA 1EASA 1XUKA 3AAVA 1OHHD 2XOKD 2ZDNA 1O2GH 2P3UB 1BUIA 4MG3A 2ILNA 1TABE 1C5WB 5DKMA 3TJNA 1T4UH 1RGQA 1YPMH 2H9EH 1CGJE 4OGXA 3GOVB 4Y76A 3SI4H 1FN6A 3BTKE 4X6OA 3MTYA 3NPSA 1SVPA 4RT1A 3MH5A 2GV7A 2ZHFH 3T2NA 5GWZA 4WH6A 2F9UA 3SU5A 5F53A 5F6MA 1DX5M 1S6FA 4YM9A 2NWNA 1J16A 3FKSD 5ABWA 4CRDA 2WUBA 4OGYA 3MO3A 1SQTA 3KL6A 1MMJN 3TGIE 2BVRH 3S9AA 2HLCA 3HGNA 1LMWB 2GMTC 3NWUA 1P2NA 1C1WH 1YWUA 1O3KA 2IJD1 5EPYA 4YTAA 3TPIZ 4D7GA 1UTNA 1UTKA 3RXEA 1TLDA 1GPZA 1KMHB 4NIWA 3P8NA 2ZU3A 2TRMA 4PROA 5E0HA 3UNSA 4BAKB 3GCOA 1T7CA 3DFLA 1C4Y2 2VBCA 2NU2E 3G01A 2W3IA 1O5DH 1O2PA 5F8TA 1E34B 4P02A 1V2NT 5LPEA 4FUIA 2SNWA 1EAIA 1G9IE 1SGFA 1FQ3A 1LVOA 2R3YA 1DSTA 1WU1A 1C5SA 1FV9A 1PQ8A 3SUEA 2BLOA 2BLVA 1TE0A 1S6LA 1SLVB 2GDEH 1EKBB 2H1UA 2C90B 2YMSB 3FVFB 1THPB 1C5UA 2F9OA 1KXBA 1ORFA 2D26C 4X2WA 3ATKA 4SGAE 1SLUB 2VGCC 3CENA 9ESTA 3MU0A 2HNTC 1C5VA 1ZZZA 1MTSA 2GVFA 1ZHMA 2KCPA 2G4TA 2LELA 3SZNA 2OBOA 3IITA 3EAJA 2XNIA 2UUYA 2WSSD 1G37A 5FBEA 1SQOA 2PFEA 4I8HA 4XBCA 4ISIH 2OC8A 4X6NA 1OWHA 3SNBA 1FXYA 1ABIH 1GI8B 4FUDA 4KKDA 3URCA 4JZDH 5JB8S 1S6HA 3UTUH 3KQ5A 3S9BA 4ZHLU 4F48B 2HALA 2J92A 5TCAA 3PRDA 1TNKA 1C1VH 3A7VA 3GCHC 1NU7B 1OYQA 1W0KD 1AVGH 2BQ6B 3M5OA 4D9QA 3RC6A 1D3PB 1YKTA 3BF6H 3D65E 4Y0ZE 5EXLA 2I6SA 2BZ6H 2ZG0H 3SGBE 3SU3A 1ZGIA 3MU4A 5LGOA 1QR3E 2Q6DA 1F5LA 2SGAA 2Y7ZA 4KP0A 1Y3WA 2UUKB 1O3HA 1HFDA 4FVDA 1VZQH 1O3FA 1ZTLA 3RU4T 1GHAG 3B9FH 1EJAA 4I8LA 1MZAA 1PYTC 1T8MA 3A80A 3PRBA 3R0FA 1Z1JA 3MMGA 1LPZB 2Z94A 4FUHA 2ODYB 2TGTA 3EA7A 3V0XA 1O5GH 1O5AB 1O3MA 2J34A 2H5CA 1ANDA 4UE7H 3RXUA 3LGVA 2BTCE 1OOKB 3PB1E 4A1TA 4B2AA 3K6YA 2J94A 2SGQE 3SU6A 3MI4A 3F0PA 3K6ZA 1FZZA 1GBJA 3ATWA 2AMQA 1PQAA 1E0FD 2ZGJA 2QE7D 4AFUA 4CBOA 1GVZA 1GI2A 1QA0A 3FN8A 1GJ4H 4X2VA 2R0KA 3SNCA 3TGJE 2HPQH 4IGDA 1FAXA 3T28A 1ID5H 1MH0A 1HJAB 2NU4E 2RDLA 1GHZA 3A81A 3SN8A 3LGYA 3P8FA 4ABGA 7GCHF 2ZEBA 1O37A 1VITF 1EFRD 1PPCE 1Z8JB 1DWCH 1RRKA 1V2ST 5HGGA 3NUMA 1AHTH 1GJDB 2BD7A 2BY6X 1LVBA 3PV2A 5PTPA 1CT4E 1AIXH 5EQSA 2OC0A 4VGCC 2QXHA 1TBRH 3FP6E 2GZ7A 2IN2A 1ZRBA 1C5XB 1BMNH 1ABJH 2OCVB 1BJUA 1CGHA 2NU0E 4GHQA 5C94A 2GT8A 2PTNA 3NRLA 2PWXA 1HJ9A 5FPYA 5EW2H 1K9OE 3UWIA 3A86A 4F4OC 3A82A 2BDIA 3ZZDA 4ZAEA 1GDQA 5DP4A 3A8CA 4Q7YA 1A0JA 3GCTG 4YOGA 1QCPA 1ZYOA 4NIVA 2JH5D 4X8VH 1IQNA 1SOTA 1V2KT 5A09A 3LH1A 3VGCB 4AOQA 1YYY1 5T6GA 1QA7A 3U69H 4YO9A 4MLFB 4FOUC 2OLGA 3DD2H 4IS5A 2LPRA 4HTCH 2VVCA 1AB9B 3UPEA 4XFQA 3FZZA 3RXRA 2A7JA 4I8GA 1HPGA 1P2MA 2AGEX 4KTCA 3UOUA 1ZSJA 4A7IB 1EPTC 5EJLA 4CRBA 3UIRA 3ZZBA 7KMEH 1CT2E 2H6MA 4OS7A 2OXSA 3EYDA 1GBMA 3LGIA 1W12U 3VB5A 4CRCA 1GI7B 1MQ6A 2ANYA 1JWTA 1VGCC 1HV7A 1QB1A 2AERH 1C2LA 4XOJA 3GCTF 3QLPH 1TMBH 4X2YA 4MNXA 3SNAA 4I8KA 2BDBA 1XUHA 2PTCE 1IQFA 2QXJA 5A0AE 1Z8IB 3Q77A 4ISOA 3HKJB 4X6PA 2ZECA 3ATLA 2ZO3H 3Q3XA 2FPZA 1BBRK 1FY3A 4DIIH 2Z9GA 3U1IB 2ANWA 4U01A 1YPHC 2V3MA 2AFQB 4NSYA 1O3GA 3UQVA 2WPMS 2AEIH 4AFQA 1CHOF 2ZCKP 3BTQE 2UWLA 1ARBA 2B5TB 4BAQB 1ANEA 1NC6A 4RN6A 4H6SB 1GJ9B 2GCTC 4NSVA 5IK2D 2UUJB 1KXDA 1V2JT 1LO6A 1AO5A 3BTDE 1V3XA 4X1QU 1QRWA 2QF3A 2P3FH 4E05H 2Z6BD 1GJ6A 1A4WH 4ESTE 1OSSA 2R0LA 3EE0B 2YNBA 4IN1A 1RTKA 1C2IA 3FZDA 2D2DA 1TIOA 3URDA 1YP9A 1BMLA 3ZV8A 3I78A 1E36B 1MTNC 4CREA 3D23A 1LHCH 2BDAA 3GY7A 3H7TA 1LCYA 2VWNA 3K9XB 3VB3A 1TGSZ 4M7GA 1C4U2 4SGBE 4UD9H 5HXFA 3T27A 2QXGA 2LNCA 3SJ8A 2A5IA 3Q00A 2EI7A 1W3CA 4ABEA 4TPIZ 2FS9A 4O3TA 4B1TA 2WPKS 1MKXK 2BDCA 1W14U 2QF5A 5F03A 4U32A 1FIZA 2BDGA 4ASUD 1E35B 3ENSB 1UK3A 1K1PA 3AK5A 1EUFA 3TH4H 1K22H 4MNYA 5E2PA 1YPJH 1D3DB 1XX9A 1BBRH 1JMOH 1G36A 2JH6D 3KHVA 2LP6A 5C5OA 3RXKA 1SGPE 2V7QD 1ESAA 3FP8E 4X1SU 1IHSH 1O35A 3TU7H 3V13A 2ZNKH 4NA9H 3BEUA 3MU1A 2FOHA 2FXRA 2VB0A 1FNIA 1HXFH 4YT6H 5I25A 1ZPZA 1YY3A 2AMDA 1QNJA 2VVUA 3ZYDA 4MVNA 1OWKA 1W0ZU 1SGFG 3BIVH 4X1NU 2GD4B 4TT3D 3CS0A 6LPRA 2BVXH 2CHAC 5E8EH 1YM0A 1TGBA 2BYAX 3BG8A 2ZGBH 2ZQ2A 1SHYA 1SQRA 4GLYA 1PFXC 4YOIA 4TWYA 1O5FH 1P3CA 1DWEH 1GBEA 1O2IA 1QRZA 2F83A 1CBWB 2TIOA 3RXTA 1LHDH 5GCHF 5DN6D 1SPJA 1W0JD 1GL0E 3RLYH 3BN9A 1KXAA 4THNH 2C8YB 2EI6A 4AYYB 2G52A 2J9NA 1PPHE 3H5CB 5FL7D 2ZU1A 1NFUA 1ZGVA 1FDPA 1LVMA 5LPFA 3FP7E 6CHAC 2HVYB 1KIGH 1BTWA 8ESTE 4YLQH 2WV4A 2XRCA 1GG6C 4FUEA 2F9NA 5CHAB 5ESBA 2W7UA 1GMDF 1MD7A 2PKAA 1A5HA 2C8XB 3ATMA 1KXCA 1TX6A 2W6JD 5TJXA 3UUZA 3GYMA 4Y10E 4CRFA 4Y0YE 2PKAB 1OXGA 3HK3B 4HFPB 2ZKSA 1RTLA 1UTOA 2WINI 1AFEH 3E8LA 1B5GH 1J17T 1V2VT 1NY22 5SGAE 2OINA 1LHFH 2QXIA 4FUJA 4CRGA 1T8LA 3B8JA 3TH3H 3MH4A 3ZVDA 2UWOA 1GI9B 1O2QA 1MTUA 1IQLA 3KNXA 3RLWH 2SGFE 1CHGA 1DXPA 2ANKH 1HDTH 1F0RA 4X1PU 4UFEH 4X8UH 1CA8B 1C2EA 2XCFA 1C2MA 2CGAA 1NRRH 3ODFA 1A0LA 1EZSC 4WMDA 1WTGH 3RMMH 2BX4A 3QWCH 1ELAA 1SFQB 2W5EA 4MNWA 2ZCHP 2XC4A 3VB7A 2ALVA 1DFPA 1A61H 1O34A 1EZXC 1NRPH 1J14A 2ULLA 2FM2A 2EC9H 5JYIA 3VB4A 3SJKA 9LPRA 5JB9S 1TWXB 4WY3A 1H8DH 1K0HA 3TGKE 3A7YA 4DJZB 1TRYA 3SI3H 1UTJA 1KSNA 3UR9A 3DSGA 3ZZ6A 4B2CA 3LH3A 1TPAE 1MUEB 3KYFA 1F2SE 4JZFH 4MQAA 3VFEA 3GY6A 5EW1H 4OS4A 5JBTA 1NTPA 4FETA 2IPQX 2PKSB 3KQEA 5DP9A 2ZC9H 3TJUA 5JBCS 3ZZ4A 1DICA 3ZZAA 2ESTE 2BQ7B 1GVKB 3BTEE 2FWWA 1EZQA 1HIAA 2BDHA 2O8LA 2BD5A 4ACBA 2YMSC 3BTME 1EAWA 1O2OA 1HIAB 3UNQA 2CF8H 4NFFA 3GY4A 4FUFA 4IC6A 1ZOMA 1GVLA 3A8AA 1O3EA 2VH6A 2TPIZ 4WXIA 1FPHH 5KECA 1NBMD 3AW0A 5DGJA 1GBAA 5JPMH 1TNLA 3BTTE 1AI8H 2D8WA 3FO8D 3SNDA 4KELA 3BEIB 4JK5A 5EOKA 1TRNA 4WH8A 3LPRA 4K69A 4Q63A 1Y8TA 4DCDA 4HGCA 1C5ZB 4Y79A 1BDAA 2OBQA 3Q3KA 2Z9KA 3T26A 3AAUA 1G3DA 3M7TA 1L2EA 1FLEE 5HM2A 2ZDVH 4K1TA 2F3CE 2H9TH 4GCHF 1QB9A 2V0BA 4AFZA 1THRH 5EIYA 3D49H 5A8YA 3A87A 1WOFA 1QQUA 2CK3D 1TQ7B 3NZIA 1C5PA 1WUNH 3RUOA 5L2ZH 2V3HH 4A5TS 3F1SB 2GTBA 1LQDB 2KCYA 1T8NA 1Z7KA 1A3EH 2WPIS 1BB0B 3RXOA 1P12E 2BXUH 2ASUB 2ZI2H 5C17A 1A0HB 1XM1A 1B7XB 1DVAH 1IQHA 1Y5UT 4LZ1H 4Y8YA 2F43B 1D9IA 1P2JA 1ZHPA 4F49A 5I46H 3RU4D 3SJIA 3VPKA 5JDUB 1D6WA 2VIVA 3UREA 2AS9A 1E1RD 1H9IE 3RXAA 2Y5FA 3GY3A 3A84A 1CT0E 1GCTB 2IOTA 2W7SA 1KLJH 1C5RA 3L3TA 1RXPA 2AYWA 4AB9A 2VNTA 2TBSA 3CP7A 3KQDA 4ABBA 1D6RA 4DVAU 1ZJKA 4K1SA 4Q2KA 5EG4A 4DOQA 1TB6H 2A7CA 1HCGA 3QGJA 4GUXA 1BTPA 4B6FA 3GYLB 1C1UH 1O3NA 1GBCA 3MQKC 1ZTKA 3I29A 1UMAH 2QA9E 3PO1C 4B76A 2A1DB 1HJAC 2ZHDA 3F6UH 3EGKH 3M5LA 1JIMA 2ZDKA 4Y8ZA 1KXEA 3H7OA 2WPHS 2QGRA 2DE9A 3AASA 1SQAA 3F2FA 4B73A 1GJ5H 1Y5BT 4JYTA 5AFYH 4X8SH 1S82A 1H8HD 1OWJA 1DY8A 1ZTJA 2RCEA 1GGDB 2BY9X 4ZCNA 1IQJA 4FU8A 1XMNB 1DWBH 2FOFA 3RXJA 5FPTA 5GDSH 1P3EA 1EAXA 1XUIA 2UWPA 3QN7A 4YLUA 4OM9A 2CV3A 1FI8A 4ABJA 3LONA 1C2JA 3R3GB 1OX1A 3S9CA 1GHWH 1QJ7B 5DP6A 3NKKA 3ZZ9A 3B23B 3QO6A 1AN1E 4U30A 3ELAH 1J9CH 1C9TA 1GJCB 2QY0B 3MNBA 3VGCC 2TGPZ 3MO9A 2GDDA 3WWBA 2XC5A 1G30B 3PMHB 4YT7H 2C4FH 1C2HA 1AB9C 2ANMH 1ESTA 1VR1H 2XYAA 2FZZA 4U2WA 1BRUP 1J15A 5EPNA 1EP5A 1WAYB 2QF4A 1T8OA 3OY6U 4HZHA 1ETSH 4NG9H 2FOBA 1O3PB 1SOZA 5C1YA 4YOJA 3U8TH 4I33A 4BAMB 2BLWA 1RTFB 2G5NA 4B74A 1O3LA 4K60A 1K1JA 3SV2H 2F9VA 3ODDA 2Y5GA 1Z6JH 2WPJS 3O8CA 1WQSA 3A88A 3HATH 3BV9B 4AFSA 1BCUH 3STJA 1GBBA 1N6YA 2HVXA 7GCHG 1VITG 4AGKA 3KIDU 3P8GA 1TGTA 2BY5X 2K8IA 2QV1A 5E2OA 1EJMA 2BD2A 1DT2A 2XCNA 2SFAA 2FX6A 1TBQH 2P59A 3V7TA 1SSXA 4K3JA 4KGAA 4XDEA 5GNDA 1MZDA 1C2KA 3MHWU 3SJ9A 5HIYA 3IWMA 2AGGX 4JMYA 2M2AA 5B6OA 4ASHA 3PTNA 1O2MA 2HGTH 1O3JA 1WCZA 4CR9A 5FX5A 5BRRE 4J1YA 1AQ7A 1NFXA 1W10U 3W94A 3PO1B 1FN8A 1LPGB 1HAIH 2G55A 1EXFA 4DW2U 1J8AA 3UNRA 1W0YH 4ZHMU 4K2YA 2KFWA 3UQOA 2WV5A 3TH2H 1XVOA 2P8OB 1SKYE 3IG6B 2A4RA 2GX4A 1ELFA 1C4V2 1CA0B 4GSOA 3QX5H 1GCDA 1SLWB 1DANH 2IPHA 4BXSA 1BRCE 2GCHF 3MU8A 2Z7FE 1XUFA 1ELTA 2V35A 4A1XA 4J2YB 4RKOB 1PPEE 1YPKH 1DITH 2PUXB 1RS0A 1P2IA 1QJ6B 2GGVB 3QZRA 3PYHA 1W11U 2PHBA 1TMTH 1DSUA 2KR7A 2FIRH 4BXWA 1CVWH 2SGPE 5A2MH 2XXLA 1SI5H 5EU8A 4ABIA 4MPUA 1TNHA 2V6NA 1NN6A 1H1BA 1WQVH 1O2XA 1U6QA 3HK6B 1DWDH 2B9LA 2CJIA 1QTFA 2Q6FA 1A5GH 1H9LB 2WPLS 2FX4A 1G3BA 5E0GA 3TJVA 3SUDA 3RXCA 4Y7BA 4INLA 1GDNA 1QL9A 5F8XA 4CH2B 1B0FA 1SGCA 2HPPH 2ZU4A 2PP6A 3A8DA 3DHKH 4YXWD 1SBWA 2ZGXH 1QFKH 3UFAA 2A2QH 4UONA 1GMHG 1CHOG 5C67A 4MPWA 3ZZ3A 1GI1A 1HAVB 4ABFA 1IQEA 3RXPA 1VITH 4P00A 1ZMJA 2R9PA 2FOEA 2ZP0H 2EY4C 4LXBH 3UR6A 1KTTB 1CBWC 3MOCA 4WXVA 3CS7A 1O2VA 1UCYK 1XUJA 5DP3A 1TALA 1TPSA 1TNJA 1B0EA 3N7EA 3SHAH 1ZPCA 1SGYE 2ZFSA 3OX7U 1G3EA 2Z3CA 2FMJA 1BRAA 2J4IA 2XNDD 2GJGA 3DA9B 1YF4A 5TCCA 2ZTXA 4AG2A 2FODA 2PW8H 3TITA 1GMHF 3MNXA 4NWLA 1TGCA 2HLDD 1Z1IA 3UWJH 2FTLE 1TAWA 1XXFA 1ELBA 3M7UA 5CHAC 1L4ZA 4OS5A 4IN2A 1FIWA 1EQ9A 3BG4B 2A32A 2Z9LA 2VU8E 2WHXA 4AYVB 4JYUH 1O33A 1FY4A 4I7YH 1P03A 2C3SA 2QAAA 4NIXA 1WDIA 1O32A 3O8RA 4I86A 5G4BA 4K1EA 4FU7A 3U8RH 3O8BA 3N7OA 2FS8A 1SR5C 1EX3A 1GHYH 1W7XH 1BA8B 1O2NA 1HAGE 1SGRE 1VKYA 1KY9A 1DXWA 3F68H 3EA8A 1BTUA 2PUQH 6GCHF 1KDQA 1HJ8A 4NZLA 3SO3A 2O8MA 1KDQB 3HPTB 2AGIX 2JJ2D 3KCGH 3PMBB 4D8NA 3P6ZB 5T3HA 1BJVA 1S84A 4INHA 1NBME 4MDSA 1N6XA 1DM4B 1TFXA 2YNAA 2P16A 1YC0A 2ZHQH 2KX4A 4K8BA 5C0UA 3RMOH 4X8TH 3M3SA 5EXMA 1ELCA 1UCYH 3KQCA 3BTWE 4GAWA 3OSYA 4Q7ZA 2ZGHA 3HKIB 3SU1A 1D3TB 5AVDA 1GJ8B 1LVYA 2BXTH 1RJXB 3ATIA 1BTYA 1QY6A 4ACAA 5GCHG 1UK2A 4ZUHA 3OYPA 4D76A 1V2OT 8GCHG 1DY9A 2NU1E 3M3TA 3VEQB 4JZEH 3DFJA 4MNVA 1GI0A 4MTBA 4JZIA 1MKWH 1MTWA 1SL3A 3UB0A 1SB1H 2ZZUH 3TNTA 3F2HA 3PROA 1C1TA 3TK5A 1H8IH 2I6QA 2PKSC 2O8UA 2J97A 1NO9H 4IW4E 3SOSA 2FOGA 1GMDG 2JETB 4RI0A 1TNGA 2GV6A 1NROH 1QZ8A 2AIQA 3EE7A 1JOUB 3MWIU 2KM0A 4X1RU 3ZZCA 3M3VA 1LQEA 2VWOA 1AFQB 1S81A 4WF8A 1WXRA 1P05A 8GCHF 2RG3A 3JZ1B 3RXLA 1TONA 1Y3VA 4AG1A 2VWLA 2BMGB 2A4QA 2PGBB 2Q1JA 2EEKA 3KF2A 3RXQA 5DP7A 2J95A 1HAYB 3LU9B 5FBIA 1GBDA 1EB1H 2Y80A 5FCKA 4JCNA 4NGAH 1AZ8A 5HYOA 3ESTA 2FOMB 3NXPA 8LPRA 3UY9A 5EXNA 1W8BH 1L1NA 3BSQA 5C1UA 2CXVA 3Q76A 1ZRKA 2ZIQH 1AWHB 1V2MT 4RT0A 3PLKA 1UTQA 1PPGE 3LIWA 2ALPA 5FAHA 2RA0A 3RMNH 1OPHB 4B75A 1P8VC 3NCLA 5T1VA 1AUJA 2WV9A 1IQMA 3A8BA 1HBTH 5DP5A 2VIQA 1XVMA 1P2KA 4B71A 1XXDA 3P8OA 2XWBI 5JBAS 3RXFA 1PYTD 1HRTH 1SGDE 1PPBH 3A85A 3PLPA 5EJ1A 4ZXYH 1DE7H 1UJ1A 2D1JA 5ETXA 1C5QA 2GZ8A 3LGUA 1RFNA 2G00A 3H09A 3SV8A 3TIUA 1FY8E 3N99A 1GI4A 1UW7A 1GCTC 1FJSA 1C1PA 1UVPA 2B0FA 2ZFFH 2ZFRH 1Z71A 1TOMH 2CN0H 1C1OA 3S7HB 2BB4A 1Y59T 1MTVA 3OFND 2JJ1D 2P95A 1GDUA 4CHAB 2JDID 1AY6H 3TK9A 2STAE 2Y82A 3C1KA 1LHGH 2A7HA 3PTBA 1GBLA 2OD3B 2WZQA 1C2FA 1ZLRA 3RXIA 1C1MA 4KTUA 2VIOA 1RD3B 3SV9A 3FOAA 2P94A 1AKSA 3PM3A 1OP8A 1F0SA 1YBWA 3SGAE 1ARCA 3ZZ7A 1F5RA 3V3MA 1C5TA 3RXVA 1IQKA 1BBRE 1AKSB 5EGMA 3E16B 4H4FA 1HLTH 1PPZA 1AMHA 3A7ZA 1T31A 2Q6GA 1P9SA 1GHVH 4GCHG 3TK6A 1BT7A 1VCWA 1CGIE 2G81E 1UTMA 5J4QA 1ESBA 1IQIA 2ZWLH 4HI3A 1GGDC 3UAIC 1UVUH 1O39A 2V3OH 3OAAD 3KGPA 4WVPE 1P04A 3OU0A 1A3BH 1QL8A 5DJ7A 4FVBA 2AH4X 1P02A 1ZMNA 2ZQ1A 3KEEA 1QQ4A 4X6MA 3T29A 1P9UA 4DT4A 1OP2A 1DS2E 1MABB 4BAOB 3LGWA 5FCRA 3RM0H 3SORA 1K1NA 2JKHA 1HYLA 3MNCA 3S7KB 1V6DA 5L30H 4TPYA 2SGDE 1KTSB 3SV6A 4YESB 1AUTC 1GL1A 1GI6A 1ANBA 1MD8A 3T62A 3A7WA 5A0BA 3N7DA 1VJ9U 2A31A 4FXGH 4JK6A 1S0QA 4ZXXH 4NIYA 1K1MA 4H42U 1S5SA 4OS2A 1PJPA 1TX8A 1O2ZA 1TOCB 1LKAA 3STIA 3DSOA 3GY8A 3GDVA 3FAOA 2C93B 3SQEE 2R2MB 3TJOA 5KEDA 3F9FA 4I32A 3P95A 2IJOB 4Y11E 2KAIA 4LK4A 4JZ1A 3OEHD 3SBKA 2C8WB 3WY8A 1YCPM 1DPOA 1S83A 1EB2A 1YCPH 1TBZH 2KAIB 2WUCA 4B2BA 3A7XA 1FPCH 1EAUA 2PSYA 1UVTH 3JZ2B 2FLBH 3RC4A 4WJG2 2QIQA 3K65B 1T32A 1UVOA 5EJZA 1TGNA 1LDTT 2W3KA 1DLKB 2ZCLP 1HB0B 5ESTE 1YLNA 2VJ1A 3ZV9A 4DT7B 5EODA 5A8ZA 2VWMA 3OE7D 1ZMLA 1LKBA 3QDZB 4ZKSU 2L74A 3DUXH 2FP7B 3MH7A 4LZ4B 4RSPA 1LHEH 4ZHAA 3RXSA 3RC5A 1O2UA 1UTPA 2Y5HA 4MPVA 2EQNA 5B6LA 1TMUH 1F92A 3RXDA 4AC9A 1SMFE 3SU2A 1V2TT 1UO6A 3QTVH 4Q4LA 1F7ZA 1TRMA 2P8OC 7LPRA 1GBFA 2A5KA 4X2XA 2DUCA 4FUCA 1S85A 2OP9A 3GY5A 4CH8B 1CA0C 3ZVAA 3MNSA 1NM6A 1ZHRA 1XUGA 1IQGA 2JIZD 1O3CA 2KZ4A 1NS3A 1MCTA 4CR5A 4BNRA 2W6ID 2ZFTA 3S0NA 1M9UA 5IYTA 1MU6B 1K21H 2O8TA 1GI3A 4UFFH 1UTLM 1K2I1 4D7FA 1WBGB 1WTHD 1HAZB 1ELEE 1K28D 2NU3E 1IAUA 3RXBA 1QBNA 1GWAA 3CNRA 4IBLH 5DK1A 3W95A 1T4VH 4DY7B 3GISB 1O2RA 1FY1A 3SU0A 1RIWB 4GHTA 4QT8C 1F0TA 2QC2A 3BTGE 2P3TB 5FPSA 2FLRH 1QHRB 1SHHB 3EA9A 1UK4A 3KYGA 3M37A 1KYNA 5C0TA 1K1LA 2ZPRA 2K1QA 4O3UA 3A7TA 2RFKC 1THSH 4ZKOU 2TGAA 1O2KA 4Y7AA 4NCYA 1SGQE 1OYTH 3F0OA 2FESH 1BTXA 1O31A 5AF9H 2Y7XA 3GY2A 1CO7E 3LJOA 5C20A 3K2UA 1YLDA 2XBVA 4RKJB 1HAXB 2R3UA 1CQQA 2G8TA 2HWLB 1D3QB 1BTZA 2B7DH 2G51A 1G32B 1N8OB 3PV5A 3L6PA 1YPEH 5CHBA 1G3CA 1GHXH 1EOLA 3VXEH 3SHCH 1C2DA 2XWAA 3W1EA 1MBQA 1O3DA 1GHBG 1PPFE 1AE8H 4DGJA 4Y6DA 1DUAA 1FUJA 3ZVBA 4WMFA 1MQ5A 2PSXA 2ZTZA 1MCVA 2GP9B 4UFGH 1W13U 1Q3XA 1C5YB 5J4SA 1QJ1B 1Z6EA 2ZF0H 1YPLH 1HUTH 2H2ZA 1NFWA 2A2XH 4XRNA 4JYVH 1BZXE 2FYQA 1SC8U 1SGIB 3U98H 4O03A 5C5NA 3GDSA 1G2LA 2GCHG 3F9GA 3U28C 1GJBB 2GZ9A 3OTJE 4TY7A 5K0HA 3BG4C 4GPGA 5C1XA 2HRVA 4TY6A 1AWFH 1KLIH 1EATA 2GKVE 2VIWA 2ZDLA 1GHBF 1ELDE 1AE5A 1IOEA 3A89A 3EDXB 1PQ5A 1C1QA 1H9HE 4AGJA 1TPOA 2UUFB 1GJAB 1P57B 4IMQA 1NPMA 2XC0A 2WYJA 1LTOA 1V2QT 2GMTB 3KQBA 1Y5AT 3TVJB 2A4GA 1L0ZA 5DG6A 1BMAA 5HKKD 2ZU5A 4E7NA 3F3BA 1BOQA 1D4PB 5EQQA 2SGEE 4AN7A 1H4WA 1HXEH 1ZJDA 1V2LT 1FY5A 3BIUH 1GHAF 3QK1A 2HNTE 4FU9A 4BANB 5L6NH 3A83A 1VCQA 4B6EA 5AHGH 1BHXB 2A5AA 1A1RA 2J2UA 2KCOA 1QBOA 3SNEA 4XE4A 5HMAA 1O5CB 1X7AC 4Q80A 5EQRA 1HAOH 2ZU2A 2CMYA 1P2OA 2Z3EA 1OKXA 2BOHB 1E38B 1QURH 1COWD 3SU4A 4ZMAH 1WYKA 1SGTA 4TSFD 2VGCB 1NRQH 4ISLA 2XTTB 1QB6A 1Q31A 1V2UT 2OQUA 2B8OH 3M35A 1QL7A 3OEED 5K7RA 1ANCA 2BD8A 4Z6AH 2ODPA 4YZUA 4WWYA 2ZPQA 1DOJA 1GMCG 3P92A 2AHME 1Y3UA 3MO6A 2ZDAH 1AD8H 1SGNE 1HAVA 3UOPA 3E90B 3L33A 3E0NB 2Z9JA 2J98A 2L6OA 3AW1A 3SUGA 2J98B 1O2YA 1W7GH 3GCHB 2JETC 2YMSD 1IHTH 4H6TA 3WW7A 1QIXB 3MFJA 1DLEA 1AFQC 1K1OA 1OP0A 2Y6TA 4E06H 2VINA 3RXHA 5BPEA 1ACBE 1GMCF 1JXPA 2ZFQH 1GBIA 3RMLH 3SW2B 1GI5A 3Q3YA 1HAHH 4K5ZA 2K0QA 1TPPA 1A2CH 3WWFA 4ZKNU 3ZIAD 6GCHG 1EJNA 2H5DA 1O3OA 1CE5A 3SZEA 3E1XB 2OTVA 3PLBA 5E0JA 2Z9IA 1MKWK 4AB8A 1QBVH 1SLXB 3P70B 1O2JA 4BAHB 2FOAA 5CE1A 1N1LA 1O3BA 1XKBC 4UDWH 1P11E 4ISHH 1A46H 4ZROA 2RDEA 2BVSH 3BEFB 2FDAA 2FI4E 1BRBE 4NZQA 3MYWA 4BTUB 1KXFA 1C9PA 1P06A 2OC1A 2OK5A 3ZZ5A 1JBUH 4XBBA 1G2MA 4TWWA 1E79D 3DCLA 1C5LH 4ABDA 1Y3XA 3ZVEA 3C27B 3I77A 4I31A 3T25A 2OUAA 1BQYA 3GDUA 2ZFPH 5AFZH 3GS9A 3ZYEA 3M7QA 3VB6A 2A0QB 1HNEE 2AIPA 2KCAA 1EZUC 1F5KU 2BY7X 2ZPSA 3TNSA 1O5BB 5T6DA 1O2LA 3PMAB 3GICB 2BX3A 3NK8A 2G5VA 3ZZ8A 2FO9A 5F8ZA 1FMGA 1GBHA 1P0SH 1YGCH 2PLXA 1Y3YA 1EP6A 1SFIA 1A7SA 1FONA 2OQ5A 1AZZA 1E1QD 3M36A 4VGCB 4FUBA 2QN5T 1SG8B 3FANA 4DIHH 3M5NA 1JRTA 2Y81A 3ZVGA 2FI5E 3SUFA 4DG4A 3PV4A 3OTPA 5LH8A 2XW9A 4CHAC 1PQ7A 4A1VA 1KLTA 3LGTA 3FFGA 3U9AH 1NU9A 4AORA 1SGEE 2FYRA 2BZAA 2P93A 4TYDA 3SJOA 1V2WT 5DPAA 2EI8A 3M61U 1TNIA 1WSSH 3AVZA 1VCPA 1BMMH 4AX9H 3ZVFA 5IDKA 1AU8A 2TGDA 2ODQA 3SYJA 3U8OH 3MH6A 3QGNB 3LC3A 1EPTA 1A5IA 1Z8RA 2XBXA 1O0DH 1HAPH 1BTHH 2O8WA 1V2PT 1EPTB 3RP2A 3RU4E 1O2HA 1YPHE 5GJ4B 2VIPA 1EOJA 1JIRA 1GBTA 1ZR0A 4NA8A 5GPIB 3PMJA 1VGCB 4Y71A 2FOCA 4M9FA 1TA2A 2XBWA 5LPRA 1FAKH 4BTIB 1Z8GA 2O9QA 3SV7A 1O2WA 1TQ0B 1MU8B 2BD3A 2F9BH 1C1RA 1O38A 1S0RA 3SGQE 2H9HA 5HM9A 4F55A 2J5UA 4Q7XA 2QYIA 2R2WU 1UVSH 1O2SA 1AVXA 2J38A 5GXPA 1O3AA 1NZQH 1TA6A 1ZSKA 2FTMA 1P2QA 4DURA 1K1IA 2QF0A 4NA7A 1GJ7B 1AVWA 3HGPA 4E7RG
chains in the Genus database with same CATH topology
2PV9B 2ZHEH 4O97A 5H4IB 3LDXH 1L4DA 1V2RT 3M5MA 5A0CA 5DP8A 1L1JA 1MKXH 4ZKRU 4OS1A 2FEQH 2GCTB 4INKA 3RDZA 3BTHE 5FX6A 3QTOH 4XSKU 1AGJA 1ZPBA 1OWEA 2PR3A 1O3IA 1OWDA 1YPGH 1OS8A 1VJAU 3ZVCA 1O30A 2C8ZB 2ZDMA 1QGFA 3EQ0H 4NFEA 4K8YA 1BIOA 2QCYA 2VH0A 4Y8XA 1NT1A 3RXGA 5FHTA 5T6FA 1DUEA 3LJJA 1C1SA 3OY5U 1NRSH 1MTNB 1NFYA 4I8JA 5JBBS 2A45B 4ABAA 2HOBA 4R0IA 3LKWA 3TLOA 1O5EH 3LC5A 2FI3E 3GCNA 2JH0D 1BITA 1CSOE 3E0PB 4ZH8A 4A6LA 1OWIA 4XBDA 1Q2WA 2ZGCA 7ESTE 1DDJA 1P01A 2ZA5A 2YOLA 1L1GA 4AZ2B 3MU5A 1P09A 3F9EA 1UHBA 2EA3A 3BTFE 1F0UA 5A8XA 1YLCA 4BOHA 1UHBB 1W2KH 2BD9A 3ITIA 1JRSA 1C5NH 1O2TA 2STBE 1C1NA 3F9HA 3S69A 3QZQA 2ZTYA 3U1JB 1UCYE 1ETRH 1HGTH 2RA3A 4LOYH 4OS6A 1O36A 1TYNA 2SNVA 1C5MD 1YCPK 3E91A 3PWBA 5GIBA 1ELVA 1GBKA 4ABHA 4D9RA 3V12A 1MAYA 4FUGA 2BDYA 4UEHH 2F9PA 5L2YH 1C2GA 2WYGA 3RXMA 5C2ZA 5CMXH 2CHAB 2AMPA 3D62A 3LT3A 2DE8A 5C3NA 3E3TA 4Z0KA 2BM2A 3T5FH 2PGQB 2BHGA 2W26A 2VIDA 1ELGA 3LOXA 3P17H 2VVVA 4BTTB 2M5TA 1MAXA 2A4OA 4WMEA 1XKAC 1NRNH 4A92A 1ZSLA 1C5OH 4CBNA 5FXLA 3SQHE 2OC7A 3RM2H 1RIWC 4X0WU 3DT0H 1BHXF 6ESTA 3QUMP 2BD4A 4CRAA 1QRXA 2BOKA 2XBYA 1WV7H 6CHAB 4UFDH 2THFB 1GG6B 4IC5A 2GT7A 4ISNA 4R8TB 3VXFH 1ETTH 4NWKA 2HNTF 2BQWB 2F91A 2Z3DA 8KME2 1N8OC 1LPKB 4MPXA 1CU1A 2CF9H 1MBMA 1E37B 4O9VA 3PWCA 5DO4H 3E6PH 1P10A 4GVUA 2BLQA 2ZHWH 4IMZA 3O8DA 4KTSA 2G4UA 2BY8X 1NESE 1TX7A 3KN2A 1INCA 1EASA 1XUKA 3AAVA 2ZDNA 1O2GH 2P3UB 1BUIA 4MG3A 2ILNA 1TABE 1C5WB 5DKMA 3TJNA 1T4UH 1RGQA 1YPMH 2H9EH 1CGJE 4OGXA 3GOVB 4Y76A 3SI4H 1FN6A 3BTKE 4X6OA 3MTYA 3NPSA 1SVPA 3MH5A 2GV7A 2ZHFH 3T2NA 5GWZA 4WH6A 2F9UA 3SU5A 5F6MA 1DX5M 1S6FA 4YM9A 2NWNA 1J16A 5ABWA 4CRDA 2WUBA 4OGYA 3MO3A 1SQTA 3KL6A 1MMJN 3TGIE 2BVRH 3S9AA 2HLCA 3HGNA 1LMWB 2GMTC 3NWUA 1P2NA 1C1WH 1O3KA 5EPYA 4YTAA 3TPIZ 4D7GA 1UTNA 1UTKA 3RXEA 1TLDA 1GPZA 4NIWA 3P8NA 2ZU3A 2TRMA 4PROA 5E0HA 3UNSA 4BAKB 3GCOA 1T7CA 3DFLA 1C4Y2 3G01A 2NU2E 2W3IA 1O5DH 1O2PA 5F8TA 1E34B 1V2NT 5LPEA 4FUIA 2SNWA 1EAIA 1G9IE 1SGFA 1FQ3A 1LVOA 2R3YA 1DSTA 1WU1A 1C5SA 1FV9A 1PQ8A 3SUEA 2BLOA 2BLVA 1TE0A 1SLVB 2GDEH 2H1UA 1EKBB 3FVFB 2C90B 1THPB 1C5UA 2F9OA 1KXBA 1ORFA 2D26C 4X2WA 3ATKA 4SGAE 1SLUB 2VGCC 3CENA 9ESTA 3MU0A 2HNTC 1C5VA 1ZZZA 1MTSA 2GVFA 1ZHMA 2G4TA 3SZNA 2OBOA 3IITA 3EAJA 2XNIA 2UUYA 1G37A 5FBEA 1SQOA 2PFEA 4I8HA 4XBCA 4ISIH 2OC8A 4X6NA 1OWHA 3SNBA 1FXYA 1ABIH 1GI8B 4FUDA 4KKDA 3URCA 4JZDH 5JB8S 1S6HA 3UTUH 3S9BA 4ZHLU 2HALA 2J92A 5TCAA 1TNKA 1C1VH 3A7VA 3GCHC 1NU7B 1OYQA 2BQ6B 1AVGH 3M5OA 4D9QA 3RC6A 1D3PB 1YKTA 3BF6H 3D65E 4Y0ZE 5EXLA 2I6SA 2BZ6H 2ZG0H 3SGBE 3SU3A 1ZGIA 3MU4A 5LGOA 1QR3E 2Q6DA 1F5LA 2SGAA 2Y7ZA 4KP0A 1Y3WA 2UUKB 1O3HA 1HFDA 4FVDA 1VZQH 1O3FA 1ZTLA 3RU4T 1GHAG 3B9FH 1EJAA 4I8LA 1MZAA 1PYTC 1T8MA 3A80A 3R0FA 1Z1JA 3MMGA 1LPZB 2Z94A 4FUHA 2ODYB 2TGTA 3EA7A 3V0XA 1O5GH 1O5AB 1O3MA 2J34A 2H5CA 1ANDA 4UE7H 3RXUA 3LGVA 2BTCE 1OOKB 3PB1E 4A1TA 4B2AA 3K6YA 2J94A 2SGQE 3SU6A 3MI4A 3K6ZA 1FZZA 1GBJA 3ATWA 2AMQA 1PQAA 1E0FD 2ZGJA 4AFUA 4CBOA 1GVZA 1GI2A 1QA0A 1GJ4H 4X2VA 2R0KA 3SNCA 3TGJE 2HPQH 4IGDA 1FAXA 3T28A 1ID5H 1MH0A 1HJAB 2NU4E 2RDLA 1GHZA 3A81A 3SN8A 3LGYA 3P8FA 4ABGA 7GCHF 2ZEBA 1O37A 1VITF 1PPCE 1Z8JB 1DWCH 1RRKA 1V2ST 5HGGA 3NUMA 1AHTH 1GJDB 2BD7A 2BY6X 1LVBA 5PTPA 1CT4E 1AIXH 5EQSA 2OC0A 4VGCC 2QXHA 1TBRH 3FP6E 2GZ7A 2IN2A 1ZRBA 1C5XB 1BMNH 1ABJH 2OCVB 1BJUA 1CGHA 2NU0E 4GHQA 2GT8A 2PTNA 2PWXA 1HJ9A 5FPYA 5EW2H 1K9OE 3UWIA 3A86A 4F4OC 3A82A 2BDIA 3ZZDA 4ZAEA 1GDQA 5DP4A 3A8CA 4Q7YA 1A0JA 3GCTG 4YOGA 1QCPA 1ZYOA 4NIVA 2JH5D 4X8VH 1IQNA 1SOTA 1V2KT 5A09A 3LH1A 3VGCB 4AOQA 1YYY1 5T6GA 1QA7A 3U69H 4YO9A 4MLFB 3DD2H 2OLGA 4IS5A 2LPRA 4HTCH 2VVCA 1AB9B 3UPEA 4XFQA 3FZZA 3RXRA 2A7JA 4I8GA 1HPGA 1P2MA 2AGEX 4KTCA 3UOUA 1ZSJA 4A7IB 1EPTC 4CRBA 3UIRA 3ZZBA 7KMEH 1CT2E 2H6MA 4OS7A 2OXSA 3EYDA 1GBMA 3LGIA 1W12U 3VB5A 4CRCA 1GI7B 1MQ6A 2ANYA 1JWTA 1VGCC 1HV7A 1QB1A 2AERH 1C2LA 4XOJA 3GCTF 3QLPH 1TMBH 4X2YA 4MNXA 3SNAA 4I8KA 2BDBA 1XUHA 2PTCE 1IQFA 2QXJA 5A0AE 1Z8IB 3Q77A 4ISOA 3HKJB 4X6PA 2ZECA 3ATLA 2ZO3H 3Q3XA 2FPZA 1BBRK 1FY3A 4DIIH 2Z9GA 3U1IB 2ANWA 4U01A 1YPHC 2AFQB 4NSYA 1O3GA 3UQVA 2WPMS 2AEIH 4AFQA 1CHOF 2ZCKP 3BTQE 2UWLA 1ARBA 2B5TB 4BAQB 1ANEA 1NC6A 4RN6A 4H6SB 1GJ9B 2GCTC 4NSVA 2UUJB 1KXDA 1V2JT 1LO6A 1AO5A 3BTDE 1V3XA 4X1QU 1QRWA 2QF3A 2P3FH 4E05H 2Z6BD 1GJ6A 1A4WH 4ESTE 1OSSA 2R0LA 3EE0B 2YNBA 4IN1A 1RTKA 1C2IA 3FZDA 2D2DA 1TIOA 3URDA 1YP9A 1BMLA 3ZV8A 3I78A 1E36B 1MTNC 4CREA 3D23A 1LHCH 2BDAA 3GY7A 3H7TA 1LCYA 2VWNA 3K9XB 3VB3A 1TGSZ 4M7GA 1C4U2 4SGBE 4UD9H 5HXFA 3T27A 2QXGA 2LNCA 3SJ8A 2A5IA 3Q00A 2EI7A 1W3CA 4ABEA 4TPIZ 2FS9A 4O3TA 4B1TA 2WPKS 1MKXK 2BDCA 1W14U 5F03A 4U32A 1FIZA 2BDGA 1E35B 3ENSB 1UK3A 1K1PA 1EUFA 3TH4H 1K22H 4MNYA 5E2PA 1YPJH 1D3DB 1XX9A 1BBRH 1JMOH 1G36A 2JH6D 3KHVA 3RXKA 5C5OA 1SGPE 1ESAA 3FP8E 4X1SU 1IHSH 1O35A 3TU7H 3V13A 2ZNKH 4NA9H 3BEUA 3MU1A 2FOHA 2FXRA 2VB0A 1FNIA 1HXFH 4YT6H 5I25A 1ZPZA 2AMDA 1QNJA 2VVUA 3ZYDA 4MVNA 1OWKA 1W0ZU 1SGFG 3BIVH 4X1NU 2GD4B 3CS0A 6LPRA 2BVXH 2CHAC 5E8EH 1YM0A 1TGBA 2BYAX 3BG8A 2ZGBH 2ZQ2A 1SHYA 4GLYA 1PFXC 4YOIA 4TWYA 1O5FH 1P3CA 1DWEH 1GBEA 1O2IA 1QRZA 2F83A 1CBWB 2TIOA 3RXTA 1LHDH 5GCHF 1SPJA 1GL0E 3RLYH 3BN9A 1KXAA 4THNH 2C8YB 2EI6A 4AYYB 2G52A 2J9NA 1PPHE 3H5CB 2ZU1A 1NFUA 1ZGVA 1FDPA 1LVMA 5LPFA 3FP7E 6CHAC 1KIGH 1BTWA 8ESTE 4YLQH 2WV4A 2XRCA 1GG6C 4FUEA 2F9NA 5CHAB 5ESBA 2W7UA 1GMDF 1MD7A 2PKAA 1A5HA 2C8XB 3ATMA 1KXCA 1TX6A 5TJXA 3UUZA 3GYMA 4Y10E 4CRFA 4Y0YE 2PKAB 1OXGA 3HK3B 4HFPB 2ZKSA 1RTLA 1UTOA 2WINI 1AFEH 3E8LA 1B5GH 1J17T 1V2VT 1NY22 5SGAE 2OINA 1LHFH 2QXIA 4FUJA 4CRGA 1T8LA 3B8JA 3TH3H 3MH4A 3ZVDA 2UWOA 1GI9B 1O2QA 1MTUA 1IQLA 3KNXA 3RLWH 2SGFE 1CHGA 1DXPA 2ANKH 1HDTH 1F0RA 4X1PU 4UFEH 4X8UH 1CA8B 1C2EA 2XCFA 1C2MA 2CGAA 1NRRH 3ODFA 1A0LA 1EZSC 4WMDA 1WTGH 3RMMH 2BX4A 3QWCH 1ELAA 1SFQB 2W5EA 4MNWA 2ZCHP 2XC4A 3VB7A 2ALVA 1DFPA 1A61H 1O34A 1EZXC 1NRPH 1J14A 2ULLA 2FM2A 2EC9H 5JYIA 3VB4A 3SJKA 9LPRA 5JB9S 1TWXB 4WY3A 1H8DH 3TGKE 3A7YA 4DJZB 1TRYA 3SI3H 1UTJA 1KSNA 3UR9A 3ZZ6A 4B2CA 3LH3A 1TPAE 1MUEB 1F2SE 4JZFH 4MQAA 3VFEA 3GY6A 5EW1H 4OS4A 5JBTA 1NTPA 2PKSB 3KQEA 5DP9A 2ZC9H 3TJUA 5JBCS 3ZZ4A 1DICA 3ZZAA 2ESTE 2BQ7B 1GVKB 3BTEE 2FWWA 1EZQA 1HIAA 2BDHA 2O8LA 2BD5A 3BTME 1EAWA 1O2OA 1HIAB 3UNQA 2CF8H 4NFFA 3GY4A 4FUFA 4IC6A 1ZOMA 1GVLA 3A8AA 1O3EA 2VH6A 2TPIZ 4WXIA 1FPHH 5DGJA 3AW0A 5JPMH 1GBAA 1TNLA 3BTTE 1AI8H 2D8WA 3SNDA 4KELA 3BEIB 4JK5A 5EOKA 1TRNA 4WH8A 3LPRA 4K69A 1Y8TA 4DCDA 4HGCA 1C5ZB 4Y79A 1BDAA 2OBQA 3Q3KA 2Z9KA 3T26A 3AAUA 1G3DA 3M7TA 1L2EA 1FLEE 5HM2A 2ZDVH 4K1TA 2F3CE 2H9TH 4GCHF 1QB9A 2V0BA 4AFZA 1THRH 3D49H 5A8YA 3A87A 1WOFA 1QQUA 1TQ7B 3NZIA 1C5PA 1WUNH 3RUOA 5L2ZH 2V3HH 4A5TS 3F1SB 2GTBA 1LQDB 1T8NA 1Z7KA 1A3EH 2WPIS 1BB0B 3RXOA 1P12E 2BXUH 2ASUB 2ZI2H 1A0HB 1XM1A 1B7XB 1DVAH 1IQHA 1Y5UT 4LZ1H 4Y8YA 1D9IA 1P2JA 1ZHPA 4F49A 5I46H 3RU4D 3SJIA 3VPKA 5JDUB 1D6WA 2VIVA 3UREA 2AS9A 1H9IE 3RXAA 2Y5FA 3GY3A 3A84A 1CT0E 1GCTB 2IOTA 2W7SA 1KLJH 1C5RA 3L3TA 1RXPA 2AYWA 4AB9A 2VNTA 2TBSA 3CP7A 3KQDA 4ABBA 1D6RA 4DVAU 1ZJKA 4K1SA 4Q2KA 5EG4A 4DOQA 1TB6H 2A7CA 1HCGA 3QGJA 4GUXA 1BTPA 3GYLB 1C1UH 1O3NA 1GBCA 1ZTKA 3I29A 1UMAH 2QA9E 3PO1C 4B76A 2A1DB 1HJAC 2ZHDA 3F6UH 3EGKH 3M5LA 1JIMA 2ZDKA 4Y8ZA 1KXEA 3H7OA 2WPHS 2QGRA 2DE9A 3AASA 1SQAA 4B73A 1GJ5H 1Y5BT 4JYTA 5AFYH 4X8SH 1S82A 1OWJA 1DY8A 1ZTJA 2RCEA 1GGDB 2BY9X 1IQJA 4FU8A 1XMNB 1DWBH 2FOFA 3RXJA 5FPTA 5GDSH 1P3EA 1EAXA 1XUIA 2UWPA 3QN7A 4YLUA 2CV3A 1FI8A 4ABJA 3LONA 1C2JA 3R3GB 1OX1A 3S9CA 1GHWH 1QJ7B 5DP6A 3NKKA 3ZZ9A 3B23B 3QO6A 1AN1E 4U30A 3ELAH 1J9CH 1C9TA 1GJCB 2QY0B 3MNBA 3VGCC 2TGPZ 3MO9A 2GDDA 2XC5A 1G30B 3PMHB 4YT7H 2C4FH 1C2HA 1AB9C 2ANMH 1ESTA 1VR1H 2XYAA 2FZZA 4U2WA 1BRUP 1J15A 5EPNA 1EP5A 1WAYB 1T8OA 3OY6U 4HZHA 1ETSH 4NG9H 2FOBA 1O3PB 1SOZA 5C1YA 4YOJA 3U8TH 4I33A 4BAMB 2BLWA 1RTFB 2G5NA 4B74A 1O3LA 4K60A 1K1JA 3SV2H 2F9VA 3ODDA 2Y5GA 1Z6JH 2WPJS