2BLOA

Elastase before a high dose x-ray "burn"
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
total genus 63
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bloA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bloA01
2AIPA 4WF8A 2Y80A 2QF0A 1NT1A 2XCNA 1AFQB 4U01A 3SHCH 2VIVA 2YOLA 1BHXB 3SHAH 1RGQA 2GX4A 1TGTA 3RMNH 2J92A 1GHBG 2PUQH 1Y5BT 2BLOA 2FOFA 2QGRA 1GJ6A 2STAE 1YM0A 4OS6A 1DWCH 2A7JA 4YOGA 2OC7A 2FOGA 1GJCB 1JRTA 3ZVGA 2XRCA 1O2IA 1SOZA 4BAOB 3RXDA 1GJ8B 4I33A 4WH6A 3VXFH 2QXIA 1TQ7B 4FUGA 4D9QA 5HM2A 1S5SA 3TGIE 4WMFA 4CRCA 1E36B 3A7WA 4NSVA 2W7SA 1RJXB 5I25A 3ZZ4A 1T32A 1Y5AT 3NK8A 3QZRA 1LVOA 3P17H 1O3FA 3B23B 4ISOA 2OD3B 1W8BH 1QHRB 1TMUH 4GPGA 1UVUH 2ZHDA 1TMBH 2G5VA 4B2BA 1QL9A 4E05H 2NU4E 2VVUA 1GJ9B 1G30B 1BTZA 1EJNA 5SGAE 2ZI2H 4NIXA 4NFFA 3RXIA 1LMWB 1DM4B 4PROA 2BD3A 2KAIA 1JIMA 2FTLE 3M5OA 1WTGH 4MNWA 3SO3A 4NZLA 1CT2E 1PPFE 2NU2E 1WU1A 1SGQE 1F7ZA 1GCDA 4MPUA 1GCTC 1ELFA 4BAMB 3T5FH 4Q7XA 1XKAC 4FU9A 1HAVA 4B75A 1BT7A 3ATLA 4AOQA 1MU8B 5FCRA 2PKAA 3ATWA 3T28A 4Y11E 3RC4A 1KDQA 1G32B 1KTTB 3UWJH 3MO6A 1B0FA 1C2LA 1OKXA 1V2KT 3I77A 2BY6X 4JYUH 1KIGH 5T3HA 3BG4C 1O5CB 3QGJA 3R0FA 5A09A 4GCHF 1LTOA 1XVMA 1TOCB 1YYY1 1UO6A 5F8XA 1ORFA 3PM3A 5FCKA 2FI4E 4WH8A 3F68H 5E0JA 2SGFE 2VIOA 2JETC 1C5XB 1P09A 3DT0H 1BBRK 4WVPE 1A7SA 4I32A 1LKAA 3P8GA 5JPMH 1UTQA 2TPIZ 1W7XH 4CBNA 3NXPA 1UTPA 2AGGX 1O2OA 1QA7A 3ZZ5A 1VITF 1UHBB 3MFJA 2A4RA 3GY4A 1QL7A 1S81A 4GLYA 3UPEA 1K1LA 5GDSH 3PTBA 1C1OA 1DS2E 1TNHA 1ZR0A 1V2NT 4GUXA 1P11E 1BA8B 3TJOA 4U30A 1GBBA 3TIUA 1O2TA 1UMAH 2VWLA 2BTCE 1VJ9U 1EUFA 2QF3A 1A4WH 3MNSA 1NPMA 5JB8S 4ZH8A 4YOJA 4Q2KA 3SV6A 3QZQA 1S84A 4ISLA 1V2JT 4UFDH 1MH0A 1V2QT 1V2OT 5A0AE 1Q2WA 1IQFA 1TPOA 2PKSB 3B9FH 1Z8IB 2ZU4A 1C2MA 1IQHA 1Z6EA 1P01A 4JK5A 4Q80A 1SFQB 4UONA 3A82A 1HJAB 4JK6A 1NRSH 2BDIA 4X0WU 4NA8A 4X6PA 3P70B 1QGFA 1KXDA 4TWWA 3ZYEA 3SQHE 3GY8A 3AVZA 1YCPH 4X6MA 2JH6D 5L6NH 2NWNA 2Y82A 3FP6E 2V3HH 4ISIH 4BTUB 1V2LT 2WV4A 1BHXF 1O2NA 4HI3A 1BCUH 2TGTA 2ANMH 1IQJA 1Y3UA 4I8GA 3SUEA 4XOJA 2OQUA 2ZECA 1SQAA 5G4BA 1AGJA 8LPRA 1FJSA 2WPIS 2FLRH 1O2JA 2XNIA 5DP6A 4XBBA 1AZZA 2QXHA 3S69A 1O33A 1DSUA 1TONA 1UCYE 2XC0A 3RXOA 4LZ4B 2BY8X 3T25A 1O2KA 5A8YA 1OSSA 2H6MA 2OC0A 3RXEA 1H1BA 2FEQH 4LZ1H 2GT8A 3QTOH 1GHYH 1XUJA 3KNXA 1EPTC 1C1VH 4KGAA 1EQ9A 1TRNA 2PGBB 4ZHAA 1ZTKA 4XBCA 3RU4D 2KAIB 5AF9H 5DP3A 1C5WB 1P2JA 1CHOF 1Y3YA 1NFXA 3D65E 3GY2A 3PMAB 5JBTA 2ZFQH 2CF8H 2EEKA 5TCAA 4Y8XA 1NN6A 1LVBA 4IGDA 1SR5C 1ZGIA 3RXRA 2FODA 3AASA 2G51A 1ZPCA 1BMAA 2VIQA 4AB8A 1OWJA 3P8NA 1LVYA 2HOBA 1MBQA 4K1TA 1XVOA 3BTWE 3GY3A 4TY6A 1PQ7A 5HMAA 2D8WA 4NFEA 2PTCE 1L4DA 3WY8A 2OINA 1O2MA 2V6NA 3SJOA 2C8WB 3S9BA 4UFGH 1T4VH 1KDQB 1Z6JH 2WYGA 3M36A 1RTFB 2ZCLP 5CE1A 1NRQH 2VWNA 2LPRA 1AUTC 1WSSH 2XXLA 4AGJA 1SGRE 4OS5A 2BOHB 3P8OA 1GDNA 2FESH 1ZHMA 1OWDA 3A88A 1FPHH 1QB6A 1Y3VA 3G01A 3GDSA 3D49H 1G3DA 1HAYB 3TITA 1QJ1B 3UREA 2PR3A 1O3AA 3R3GB 1CU1A 3PMBB 1TE0A 3PYHA 3TJVA 5T6GA 4FU7A 4B73A 1BTPA 1BUIA 1A61H 1O36A 1C5SA 1WV7H 2Q1JA 4JCNA 1MKXK 2CXVA 1B0EA 2AMPA 1QR3E 1YC0A 1Z1IA 1E35B 1AN1E 3FP8E 1FV9A 1W0ZU 4Q7ZA 1SGFG 3Q3XA 5CHAB 1TX6A 3SGQE 2AIQA 3KN2A 1YPHC 1FY1A 5HXFA 1YBWA 3LOXA 2I6SA 1GBAA 4BTIB 2GCTB 3ZZ6A 1GJ5H 1OYTH 3HK6B 1E0FD 2GV6A 2J38A 1K1PA 1O5FH 4BNRA 3LGTA 2DE8A 1O3GA 4H6SB 1C2IA 2ZDMA 1F92A 1PPHE 4A92A 3A81A 4JZDH 1ESBA 4XFQA 1C4Y2 1D3QB 2O8TA 5DGJA 2GDDA 3A7ZA 2RA0A 2OP9A 1J17T 1H9IE 2F9VA 5L2ZH 1GMCG 5C1YA 1VCQA 4Y8ZA 1C5LH 1O5EH 1IQNA 4YTAA 4CBOA 1BOQA 4K8BA 5JYIA 2F9OA 1DITH 3GICB 1P2MA 1GVLA 1SLWB 4O3UA 3Q3KA 1CGIE 2R2MB 1UCYK 1ANCA 3MU0A 2AGEX 1V2MT 1F0UA 1ZJKA 2VGCC 1KXBA 1F5KU 4JYVH 4I31A 2BVXH 1GJ7B 1XUKA 2YNAA 3S9AA 1AB9B 4Y7AA 9LPRA 1GHBF 3LJOA 3UNRA 3SQEE 3SU3A 1MUEB 1TQ0B 1N8OB 1EZXC 3UY9A 1G3BA 1L4ZA 2JH0D 2Z9LA 3MI4A 4FUCA 3N7OA 4CHAC 3SU6A 1NFUA 3HGPA 1OWKA 1KXCA 1NY22 2ZCKP 1QFKH 1CGHA 3LGVA 4CR9A 2ILNA 1TX7A 2P59A 1RFNA 4X1QU 1A5HA 2BD2A 1UVTH 1C5ZB 1BZXE 3V3MA 2TGPZ 2DE9A 4ABFA 4Y71A 3V7TA 1QCPA 2P94A 3MU4A 1TX8A 2WPLS 2IOTA 2PGQB 1ARBA 2BVRH 1GJDB 1EAWA 2A2XH 2AMDA 2R0KA 3V12A 1OP0A 1ZRBA 4F4OC 1XUHA 1CQQA 3BTTE 1P57B 1LHGH 4WMDA 3E90B 3H5CB 2P8OB 2FOEA 2AFQB 1W11U 1W2KH 1X7AC 1W0YH 1YGCH 1EOJA 1A0LA 2G00A 3HGNA 2CHAC 1WQSA 4OS7A 1ZPZA 1ETRH 1MQ5A 1TFXA 1DUAA 4Y8YA 1P3EA 2B7DH 1HFDA 3C27B 1OOKB 1OP8A 4Y76A 2HVXA 1SHHB 9ESTA 1HDTH 4TPIZ 1RTLA 2UUYA 1AZ8A 3SNAA 1WTHD 3C1KA 1GGDB 1ZMLA 1TB6H 3PO1C 1PQ5A 4SGBE 2W5EA 1BJUA 3A85A 1BQYA 4HGCA 3MNBA 5JB9S 5LGOA 1NROH 5DP4A 3UWIA 1DANH 2AEIH 4X8VH 2ZO3H 3GCNA 3RLYH 5FXLA 3OTJE 1IQMA 2WV5A 1KXAA 1GVZA 3NKKA 1DPOA 5FBEA 3LJJA 2R2WU 2F9PA 1EATA 5LPEA 2FMJA 4GAWA 3HKIB 5LPRA 4UFEH 2HLCA 4ZKRU 5A0CA 3A7XA 2GDEH 3PMJA 1BBRE 1F5RA 7LPRA 4K1SA 4K69A 1GBMA 4X1RU 4Y0YE 2ZKSA 3A8CA 1C4V2 2FYRA 2UWOA 3M5MA 3SI3H 3O8RA 1O3NA 1QBNA 1VZQH 2C8XB 3OY6U 4NIVA 3V0XA 2WYJA 2WPHS 2PW8H 1C2DA 1J9CH 3DFLA 4A1XA 3A8BA 2BD7A 1QBVH 1WOFA 1N6YA 1EB1H 2BDYA 4YO9A 4MNXA 3TVJB 1KY9A 2D26C 1UK3A 1VGCC 3IG6B 1AMHA 1GHAG 4JZEH 3TGKE 2F3CE 3AAVA 4ABGA 2ZQ2A 1GI2A 3JZ1B 2AERH 1LVMA 3D23A 2BLQA 3ODFA 1GBKA 1FPCH 2OUAA 3UNQA 3Q77A 2P3UB 2H9HA 3EE0B 2A45B 1KXFA 1P04A 2PFEA 3GOVB 1FY3A 1SG8B 1P2OA 1DLEA 1JXPA 2FPZA 1UTNA 4ABIA 1D6RA 1DDJA 1INCA 1FONA 2H1UA 4WWYA 1GG6C 1DWBH 1ABJH 1LPGB 3BTME 5I46H 5E8EH 1O3IA 4ZAEA 1O3JA 1C5VA 1C1PA 3U8TH 3K2UA 4K1EA 2GTBA 3ESTA 1LKBA 2AS9A 2BZ6H 1O2YA 3RU4E 3S0NA 1G37A 2RG3A 5C5OA 3MNXA 1SGPE 1O3HA 5EU8A 2BLWA 1P03A 4O03A 5PTPA 4X6OA 1QRXA 2FX6A 1OWEA 4ZXXH 1MKWK 1GHVH 3FAOA 3SZNA 1PYTD 1AIXH 5EGMA 1HYLA 3RXGA 3PLPA 1K1OA 2ZGBH 2IPHA 1K22H 1P2QA 1C1RA 4MPWA 4THNH 3TJUA 5C5NA 1CT0E 1O2WA 1GJAB 2C3SA 1T8NA 2PKSC 4LOYH 4ASHA 1K2I1 5F8ZA 1BRAA 1BTHH 2BD5A 1AKSB 5DP9A 1LHFH 3ZZ3A 2ZDKA 2GMTC 3A7VA 1A3EH 3RXJA 1GDQA 4OGYA 1O2XA 1TGNA 1HV7A 3FZDA 2C8ZB 1P02A 2ZZUH 2H9TH 1Y3WA 1THPB 1FN6A 3ZV9A 3EDXB 1MU6B 1ID5H 4NWLA 4ZMAH 1O3PB 1BDAA 1O2QA 2A5IA 1G3CA 1TABE 8GCHG 3A89A 3ZZ9A 1WYKA 3LH1A 4GVUA 1DVAH 1ZMJA 2Z6BD 3E3TA 2NU1E 3U1IB 1BTWA 1FDPA 4GHQA 3BSQA 1CBWC 3SUDA 2VINA 3HKJB 4RN6A 3S7KB 4AFSA 3U69H 2ALPA 2Z9IA 6CHAB 2ZGJA 1S6FA 4CREA 5C20A 4XE4A 1WAYB 1ACBE 2FX4A 1O3LA 4BXSA 1N6XA 2Z3EA 5HGGA 2GGVB 4H42U 5FHTA 4FUBA 2FS9A 1MKXH 1L0ZA 1UTLM 1QBOA 5CMXH 1S0QA 3Q76A 4NA7A 5EQRA 2XBYA 1Z8JB 3SV9A 5DPAA 4ZUHA 2BDHA 3TGJE 2GZ8A 4H4FA 2O8WA 4JZFH 2G52A 1M9UA 3KQEA 2J95A 2XWBI 1GI8B 4X8TH 1C5TA 4Z0KA 2Z3DA 2Q6FA 1C2KA 3M3VA 1YPGH 1WBGB 4ZROA 3T27A 2A4GA 3LPRA 2BXTH 2OTVA 1NZQH 3P95A 4I8HA 3KCGH 1XMNB 1TBQH 3A87A 5EQQA 3GCTG 1TYNA 3RU4T 1FZZA 2PV9B 1W3CA 4JZIA 1SLUB 7GCHG 2BQWB 2P95A 4YM9A 2VIPA 5A2MH 1K21H 2CN0H 1LPZB 1MTWA 1CA0C 1T4UH 1C1NA 3STIA 2F83A 4NA9H 1SGYE 1ELBA 1SMFE 1EPTA 1OX1A 1AE5A 2SGEE 3GY6A 3TNTA 1P9UA 1GI6A 2QIQA 3KEEA 2XCFA 3A7YA 1SGEE 3A7TA 3GY7A 3SV8A 1V2WT 1YF4A 1C5YB 2O8MA 3T2NA 1O2RA 4HFPB 1TNLA 1S85A 1UCYH 4MLFB 2FIRH 3DFJA 1GMCF 1JRSA 3RXTA 2C90B 1W13U 3RXPA 1C2HA 2P93A 1TNJA 2WPMS 5FBIA 3PB1E 5JBCS 4D7FA 2ZU5A 4JZ1A 2Y5HA 4F49A 3ZZDA 1L2EA 4RSPA 3T29A 4INLA 2BQ6B 1LHDH 3H7OA 4ISNA 4B1TA 2J94A 2ZCHP 4X1PU 3KIDU 2R3UA 1PQAA 1RS0A 1C9PA 1UK4A 4J1YA 4MG3A 3DD2H 1LQDB 4CRAA 1H9LB 2UWPA 1UVOA 3QN7A 3S9CA 2R9PA 1C4U2 3A8DA 3BG4B 1GMHG 2OXSA 5CHAC 1SQTA 1J8AA 2FZZA 1F0RA 1PQ8A 2VIWA 1TMTH 2ZFTA 2CGAA 2ZHQH 2B8OH 2HNTE 4YOIA 2F9UA 3RDZA 1QNJA 3LKWA 1PPBH 3OSYA 1GBCA 4IN1A 1ZLRA 1RD3B 1JBUH 2GVFA 3DUXH 4B2AA 4DCDA 5C3NA 5JBAS 4D76A 1VITH 3RM0H 1SPJA 4VGCC 1VCPA 3A83A 2GZ9A 1MAXA 1HAZB 2W3KA 2FOBA 1C5RA 3RP2A 1O35A 1EAUA 1GI5A 4XDEA 3MH4A 4NCYA 3PWCA 2QXJA 1C5UA 1XUIA 3EAJA 5DJ7A 1Z7KA 4A1TA 3QWCH 2Z7FE 4TY7A 2VVCA 5K0HA 1MTSA 1HAVB 3SUFA 3T26A 1K1NA 3LC3A 2PKAB 2VH6A 4Y79A 2CMYA 3MO9A 4KKDA 3BTHE 3BTKE 5JBBS 3RMMH 2UWLA 1TIOA 2RDLA 2DUCA 4K60A 1UTKA 1THRH 1O3DA 4FUFA 4X8UH 1V2VT 2A2QH 4A5TS 2ZTXA 1SC8U 5DKMA 2XBWA 2CJIA 1MAYA 1DX5M 1O2GH 2GZ7A 4NWKA 3SGAE 5C2ZA 4B71A 1BJVA 1D3TB 4UDWH 1N8OC 3ZVCA 1W14U 2F91A 1PPGE 1AVXA 2G8TA 4KTUA 4DG4A 1JMOH 2TGDA 3SV7A 1FLEE 7KMEH 1D6WA 2ZU3A 4MPXA 3BIVH 1A5IA 1YP9A 2BDAA 3PLKA 3K6ZA 3ZZBA 3SJIA 1ELEE 1HUTH 3RXSA 1BTUA 1HIAA 3VB6A 3BTEE 4YT6H 2C93B 4RKJB 2J9NA 1GMDG 5C67A 2ZP0H 2VVVA 3MTYA 1EJAA 3U1JB 4ZKOU 3L3TA 1O2PA 4O9VA 4ABHA 4IMQA 1MCTA 3RXAA 3VB7A 3RXLA 1T8OA 2HALA 3P6ZB 1DSTA 3FVFB 2ZG0H 1L1GA 2FOMB 3KQCA 1SLXB 1AO5A 1RIWC 1KLJH 3GCHC 4AYYB 3E1XB 3ZYDA 2ZDNA 1LCYA 1GI3A 5AFZH 4I8JA 4O3TA 1O3KA 1EPTB 1ELAA 3DHKH 3TH2H 1GHWH 2VWOA 1EXFA 1KTSB 1TLDA 1QQ4A 2ANYA 4BAHB 3ATKA 1GBLA 1T7CA 1DXWA 1NU9A 1TALA 1C9TA 4WMEA 4JYTA 1DY9A 3SNBA 3LU9B 1KYNA 2XC5A 3MH5A 1S0RA 2STBE 4OGXA 1AY6H 1TWXB 4K2YA 4FUEA 1K1IA 2B0FA 1GHAF 2V35A 4YT7H 1F0TA 2NU3E 1TPSA 2BDGA 1C1WH 1XM1A 4A7IB 1ZGVA 3MH7A 1YCPK 1GHZA 3RMOH 1MBMA 1GGDC 3MU8A 4FVDA 5DG6A 5EPYA 1EZUC 1GI0A 3PROA 3AW1A 4RKOB 3W95A 5F6MA 4ZKSU 1AU8A 3NWUA 2XC4A 4AG2A 3F6UH 4X2VA 1A3BH 4CR5A 1P12E 1C2JA 1B7XB 3SU4A 1ESAA 1J16A 2GD4B 1MTNB 2EC9H 2ZNKH 3MHWU 4UD9H 1EAIA 1O2VA 1FMGA 1QB1A 1FNIA 2SGQE 2THFB 2ZC9H 4IMZA 1TNKA 4Y10E 4LXBH 1AE8H 1GJBB 1MKWH 2BX4A 2FYQA 1ETTH 1J15A 2XTTB 2FTMA 1W7GH 5AFYH 1TA6A 2RA3A 5ESBA 3U9AH 1FIZA 3SGBE 1CSOE 3W94A 1ZOMA 2SFAA 2HPPH 7ESTE 1FY8E 2ZHEH 4X2XA 2EI6A 2WUCA 3GYMA 4INHA 3MU1A 1GI7B 4AORA 1AVGH 1DWEH 1S82A 4FVBA 3BG8A 3QUMP 1AI8H 1O2SA 3SU0A 3M35A 1MD8A 3IWMA 4CRGA 5LPFA 1P05A 2JH5D 3A8AA 1ZHPA 2F9BH 2FI3E 3ZZ7A 1ELGA 4E06H 1AFQC 2Y6TA 1AQ7A 3I78A 1S83A 1TGBA 4GSOA 3K6YA 5AHGH 1K9OE 4X2WA 4DT7B 1ZMNA 1TGSZ 3B8JA 5EXMA 1YCPM 3ITIA 4K5ZA 1FQ3A 5DP5A 1G2LA 1EASA 1JIRA 3LONA 1P2IA 3RXQA 1CE5A 3UIRA 4NIWA 1Y5UT 4E7NA 1SSXA 1SI5H 4HZHA 8GCHF 4AB9A 2ZWLH 1G3EA 5ABWA 2ZEBA 1TBZH 1IOEA 4AGKA 4D9RA 1BBRH 1OWHA 4DW2U 3UQOA 4ABEA 1UVSH 4UFFH 1SGNE 4AX9H 3RXHA 3ZV8A 5EOKA 5C1XA 2Z9GA 4ZHLU 3RMLH 3TK5A 4CH8B 1HXEH 3A86A 2VGCB 2BD8A 3RXKA 1Q3XA 3BEFB 1MD7A 2BZAA 1H8DH 1BITA 2PHBA 1SGIB 3QDZB 1HGTH 3ATMA 2SGPE 3EQ0H 1EX3A 2R3YA 1QB9A 2Y7ZA 1HLTH 4CRFA 1NC6A 2VJ1A 1BMLA 2G81E 2SGAA 5FPTA 1FY5A 1PPCE 1MCVA 3OYPA 1PFXC 4IS5A 4CHAB 3TK9A 1PYTC 1F2SE 2CV3A 1UHBA 3UNSA 1TGCA 4OS2A 1NS3A 1BTYA 2D1JA 3VFEA 5FPYA 3L33A 1O32A 4MPVA 1IQGA 3MMGA 2AGIX 2K1QA 3LGYA 2FP7B 5FAHA 3SJ8A 1C2FA 1ZJDA 1ELTA 3M3SA 1C1UH 2BY5X 1RRKA 2IN2A 1V2UT 2ODYB 3GCTF 1MTVA 1G9IE 1O2UA 1DY8A 1NESE 1O3BA 4ISHH 2ALVA 1BMMH 2B5TB 4M7GA 7GCHF 2PSXA 3VPKA 4A6LA 4DURA 1OPHB 4IC6A 1MZDA 4TYDA 5J4SA 1XUGA 2Z9JA 4NGAH 1IAUA 5L2YH 3MNCA 1GBFA 1HBTH 2J4IA 1Y8TA 4Q7YA 6CHAC 3A80A 1HJ9A 1EAXA 3U8OH 3NUMA 3VGCB 2FOHA 1OP2A 4AFZA 2HRVA 3ZVEA 5ETXA 1ZSJA 3RM2H 1NM6A 1C5QA 2CHAB 5FX6A 1SHYA 1AWFH 3RXVA 2GP9B 4FU8A 3K65B 2BB4A 3I29A 5E0HA 3BV9B 3PTNA 4MNVA 4AG1A 1W10U 1HAPH 1ZYOA 1BMNH 1O2ZA 2JKHA 1YPLH 3RXUA 3Q00A 1XXFA 3ZVFA 1GI4A 1SB1H 5GCHG 1V3XA 1Z8GA 3SUGA 3MYWA 2Q6DA 2OCVB 2GKVE 1ELCA 4I7YH 1P8VC 1GVKB 3E0PB 5EW2H 8ESTE 4JMYA 3PO1B 2TIOA 4H6TA 1O3OA 1ARCA 1GBDA 3SNEA 1MMJN 1NRPH 1V2RT 1ANDA 2A4QA 2QA9E 1GMHF 3SNDA 2FI5E 3SU5A 5A0BA 1O0DH 2G4UA 2G5NA 3EGKH 2V0BA 3PWBA 1O3EA 3LDXH 5F03A 2FS8A 1GHXH 1OWIA 2A7CA 2ZGXH 4KTSA 2A0QB 1K1JA 2B9LA 1OS8A 1HJAC 1HXFH 2BD9A 4R0IA 3RUOA 2F9NA 2VB0A 2HNTF 2WUBA 1QRZA 3BTGE 2ZFSA 1C1QA 2UUJB 3O8BA 5DP8A 2FLBH 1DFPA 2O8LA 1HNEE 4NSYA 1ZHRA 2ZF0H 2H5CA 2FWWA 2A5KA 2RCEA 4OS1A 1WCZA 3LH3A 1S6HA 5GJ4B 1FI8A 6GCHG 5IYTA 2BQ7B 3GDUA 2WPKS 3E8LA 1SGTA 2OBOA 2QYIA 2VWMA 1XKBC 2ZFRH 3L6PA 3KQDA 1UVPA 3EA9A 3KGPA 1H9HE 2FOCA 1VGCB 3O8CA 3M7TA 1A1RA 4DVAU 1ZSKA 3M5LA 3SW2B 4B74A 1TNIA 2OQ5A 4MQAA 4NZQA 2Y5GA 3CS7A 1IQIA 5H4IB 1CGJE 1AVWA 1G36A 1XUFA 2BM2A 4DJZB 1V6DA 4AN7A 1O37A 1Z1JA 3U98H 2HWLB 1K28D 2OC8A 2LNCA 3SU2A 2ZHFH 2A7HA 1HAIH 3RXMA 2ZDLA 1J14A 1GG6B 3SNCA 1ZZZA 3UR6A 1HAXB 3STJA 1IQEA 1SGDE 2GCHG 4NG9H 3CP7A 2ZPSA 4TWYA 4OS4A 4ABBA 1TOMH 5EXNA 5EW1H 5GIBA 1TPAE 1A2CH 1DICA 3ZZCA 2ZTYA 4ABJA 1GMDF 1GWAA 3UR9A 5GWZA 5DO4H 4Z6AH 3PMHB 3GY5A 1AFEH 1KXEA 1D4PB 3VEQB 1YLCA 1SFIA 2UUKB 1NFWA 1O5BB 2BVSH 1TPPA 2AYWA 3F9GA 6ESTA 2OLGA 2BLVA 1AD8H 3TPIZ 1Q31A 5L30H 1NTPA 1QURH 2Z94A 3KQBA 5BRRE 1SVPA 1SBWA 1HAHH 1L1JA 2NU0E 1ZTLA 2BY7X 2ZTZA 3UFAA 2GMTB 1GCTB 1C1MA 1JWTA 5A8XA 3PV4A 2C8YB 1O5DH 2SNWA 2A31A 4O97A 1UTJA 2A32A 1P3CA 1L1NA 2VNTA 2Y7XA 4MDSA 2ZPRA 1YPMH 1OXGA 1ELDE 2PUXB 3NPSA 5TJXA 2ZIQH 1QJ7B 3EA8A 5GXPA 1EP6A 4D8NA 2V3OH 1UJ1A 1C5PA 2ANWA 3TLOA 1KSNA 1CBWB 3P8FA 1LQEA 3LC5A 1O38A 4X6NA 3E91A 1KLIH 5EPNA 1SOTA 3BTQE 4IC5A 3PLBA 1YPHE 4ZHMU 3ATIA 4Y6DA 1E38B 2Z3CA 1EZSC 3E6PH 1HAGE 2H9EH 2XYAA 1GI9B 3LGUA 1VJAU 3TK6A 1VR1H 2JETB 4X2YA 3TNSA 1FXYA 2P3FH 3MOCA 1V2ST 3TJNA 4FUDA 2GCTC 4FUIA 5EODA 1C5NH 1A0HB 1C5OH 5A8ZA 1O3MA 1CHGA 4ABAA 1EP5A 4ABDA 5EXLA 4FUHA 3F9FA 3SI4H 1FN8A 3M7UA 3QO6A 1BRBE 1FAKH 2EI7A 1LDTT 1C1TA 2PTNA 5J4QA 2QC2A 1T31A 3BTFE 1UTMA 3MWIU 1FIWA 3EYDA 3VB4A 2ZU1A 3TU7H 2G55A 1TNGA 4WXIA 1RXPA 4KTCA 1QA0A 1O5GH 2H5DA 4DY7B 4YESB 1A5GH 3AAUA 2A4OA 5LH8A 1EB2A 3OX7U 3E16B 3OU0A 1MTUA 1BRUP 1O34A 1QRWA 2A1DB 3ZVBA 5FX5A 2FOAA 1YKTA 1Y3XA 1BB0B 1NRRH 3K9XB 2W7UA 1D3DB 2M5TA 5EQSA 3NZIA 1HCGA 3M37A 3BN9A 3ZZAA 2P3TB 1CA0B 3SV2H 2FXRA 4KP0A 3LIWA 1CVWH 2QXGA 1NRNH 2VIDA 3S7HB 1T8MA 3SJKA 3VXEH 4YLQH 2C4FH 1LPKB 1AB9C 1WQVH 2EI8A 2AMQA 3VB5A 2ZHWH 4GCHG 1FUJA 1QQUA 2ZDVH 1HRTH 2HGTH 5BPEA 1O2HA 1XXDA 4NIYA 1IHTH 1E37B 3M3TA 2ZPQA 3GYLB 1NO9H 3F1SB 5K7RA 1MTNC 2Y81A 3RXCA 4B2CA 4SGAE 2Q6GA 1VITG 2OBQA 1CT4E 1IQLA 4X1SU 1PPZA 4A1VA 2XBVA 1GPZA 1MZAA 1O39A 1F5LA 1CO7E 3KF2A 4AYVB 3D62A 1G2MA 4DIHH 4XBDA 1C5MD 3T62A 4FUJA 1EOLA 2D2DA 3KL6A 2ASUB 2PLXA 3EA7A 1SLVB 1V2PT 3M5NA 4AZ2B 3SOSA 1CA8B 1TRYA 4BAQB 3RC6A 4U32A 4X8SH 1E34B 3FP7E 3KHVA 3SJ9A 4WJG2 2VH0A 2QV1A 3BIUH 1ANEA 3FFGA 2HNTC 4BAKB 2J34A 1NFYA 1U6QA 2P8OC 2TGAA 3NCLA 4LK4A 4AFQA 1XX9A 3ELAH 4Y7BA 3SBKA 4Y0ZE 3QLPH 3HATH 3IITA 3URDA 1SGFA 2QN5T 1JOUB 4UEHH 1SGCA 1IQKA 1A46H 1V2TT 1ETSH 3SU1A 1NU7B 1ABIH 3ZVAA 4R8TB 4VGCB 3RLWH 2WINI 4MNYA 4DGJA 1GL0E 2BMGB 1C2GA 4I8KA 3RXBA 1DE7H 1QJ6B 2R0LA 4K8YA 1Y59T 5E2OA 3U8RH 4CRDA 1EJMA 2AH4X 4ZXYH 4IW4E 2VU8E 1GJ4H 5B6OA 3GDVA 3ODDA 1DUEA 3UTUH 1PPEE 3P92A 4FXGH 4U2WA 1AHTH 1GL1A 1GBHA 2H2ZA 1B5GH 4CRBA 2A5AA 2CF9H 1YLDA 1TRMA 3E0NB 3HPTB 4IN2A 3HK3B 4UE7H 1F0SA 4XSKU 2ZFFH 3TH3H 2O9QA 2TRMA 5HYOA 2BX3A 3A84A 2GT7A 1P0SH 2QY0B 3BTDE 1DLKB 2BDBA 3BF6H 4YZUA 4CH2B 4J2YB 4X1NU 2WPJS 1P9SA 2EA3A 3UQVA 5E2PA 2ZA5A 5GCHF 1GBIA 2PWXA 1UTOA 1D9IA 3ZVDA 4DIIH 1P2KA 4WXVA 3GCOA 3UUZA 5F8TA 2FO9A 3MH6A 1DXPA 3FZZA 2BY9X 1P10A 3AW0A 1D3PB 1BIOA 5GPIB 3SN8A 5JDUB 5DP7A 4B76A 2GV7A 1CHOG 2W26A 1O31A 2TBSA 2Z9KA 1GBEA 1QL8A 1FAXA 1KLTA 4MVNA 1AWHB 3SORA 2FDAA 2BOKA 1BTXA 3VB3A 4INKA 1AUJA 1MQ6A 1LO6A 1T8LA 3MO3A 3FANA 1GDUA 2I6QA 2ZU2A 4GHTA 2ANKH 3UOUA 1QIXB 2QAAA 1RIWB 3GCHB 3LGIA 1UK2A 2ESTE 1AKSA 1QY6A 2XWAA 2ODPA 5DK1A 4AFUA 2YNBA 2J2UA 2PSYA 1ZSLA 1GBJA 1TA2A 2ZQ1A 2BYAX 3VGCC 2W3IA 4HTCH 2ULLA 2IJOB 3JZ2B 1A0JA 3ZZ8A 1TBRH 4DOQA 3ENSB 1Z8RA 1YPKH 1FY4A 2BDCA 4KELA 6GCHF 1ANBA 1HPGA 1QTFA 1GI1A 1ZPBA 5TCCA 2FM2A 4BTTB 3LT3A 3URCA 3F9EA 2P16A 1EKBB 1LHCH 5FPSA 5T6DA 3RXFA 5AVDA 1OYQA 3LGWA 1HIAB 2O8UA 1ZRKA 5T6FA 1THSH 1BRCE 1H4WA 4D7GA 4QT8C 1SL3A 4ZKNU 2QCYA 1HB0B 3CS0A 1YPEH 2BD4A 3M7QA 3Q3YA 2Y5FA 1O3CA 2XW9A 1P06A 4YLUA 1EZQA 4WY3A 2SGDE 5EG4A 1HAOH 2BHGA 5E0GA 1HJ8A 1DWDH 1SQOA 2SNVA 2ZDAH 3QX5H 1DT2A 3H7TA 4BXWA 3V13A 3BEUA 3MU5A 4K3JA 1ZTJA 1K1MA 1O2LA 2GCHF 1WUNH 1O30A 3OY5U 8KME2 1ELVA 1C1SA 5C1UA 2ODQA 3RC5A 3QGNB 2HPQH 3M61U 1DOJA 1W12U 2G4TA 4I8LA 1GBTA 1TAWA 4TPYA 6LPRA 1LHEH 1Z71A 3GISB 3F9HA 4IBLH 4BANB 3BEIB 1N1LA 1PJPA 3O8DA 1ESTA 2ZGCA 3DA9B 3TH4H 1P2NA 2BXUH 3UOPA 2UUFB 1O5AB 2OC1A 1C2EA 3QTVH 1IHSH 2ZGHA 4MTBA 5HM9A 5IDKA 5ESTE 2ZFPH 1RTKA 4E7RG 4ESTE 3CENA 1H8IH 4BOHA 1VCWA 1YPJH 3QK1A 2XBXA
chains in the Genus database with same CATH superfamily
2AIPA 4WF8A 2Y80A 2QF0A 1NT1A 2XCNA 1AFQB 4U01A 3SHCH 2VIVA 2YOLA 1BHXB 3SHAH 1RGQA 2GX4A 1TGTA 3RMNH 2J92A 1GHBG 2PUQH 1Y5BT 2BLOA 2FOFA 2QGRA 1GJ6A 2STAE 1YM0A 4OS6A 1DWCH 2A7JA 4YOGA 2OC7A 2FOGA 1GJCB 1JRTA 3ZVGA 2XRCA 1O2IA 1SOZA 4BAOB 3RXDA 1GJ8B 4I33A 4WH6A 3VXFH 2QXIA 1TQ7B 4FUGA 4D9QA 5HM2A 1S5SA 3TGIE 4WMFA 4CRCA 1E36B 3A7WA 4NSVA 2W7SA 1RJXB 5I25A 3ZZ4A 1T32A 1Y5AT 3NK8A 3QZRA 1LVOA 3P17H 1O3FA 3B23B 4ISOA 2OD3B 1W8BH 1QHRB 1TMUH 4GPGA 1UVUH 2ZHDA 1TMBH 3KYGA 2G5VA 4B2BA 1QL9A 4E05H 2NU4E 2VVUA 1GJ9B 1G30B 1BTZA 1EJNA 5SGAE 2ZI2H 4NIXA 4NFFA 3RXIA 1LMWB 5EJ1A 1DM4B 4PROA 2BD3A 2KAIA 1JIMA 2FTLE 3M5OA 1WTGH 4MNWA 3SO3A 4FOUC 4NZLA 1CT2E 1PPFE 2NU2E 1WU1A 1SGQE 1F7ZA 1GCDA 4MPUA 1GCTC 1ELFA 2JDID 4BAMB 3T5FH 4Q7XA 1XKAC 4FU9A 1HAVA 4B75A 1BT7A 3ATLA 4AOQA 1MU8B 5FCRA 2PKAA 3ATWA 3T28A 4Y11E 3RC4A 1KDQA 1G32B 1E1RD 1KTTB 3UWJH 3MO6A 1B0FA 1C2LA 1OKXA 1V2KT 3I77A 2BY6X 4JYUH 1KIGH 5T3HA 3BG4C 1O5CB 3QGJA 3R0FA 5A09A 4GCHF 1LTOA 1XVMA 1TOCB 1YYY1 1UO6A 5F8XA 1ORFA 3PM3A 5FCKA 2FI4E 4WH8A 3F68H 5E0JA 2SGFE 2VIOA 2JETC 1C5XB 1P09A 3DT0H 1BBRK 4WVPE 1A7SA 4I32A 1LKAA 3P8GA 5JPMH 1UTQA 2TPIZ 1W7XH 4CBNA 3NXPA 1UTPA 2AGGX 1O2OA 1QA7A 3ZZ5A 1VITF 1UHBB 3MFJA 2A4RA 3GY4A 1QL7A 1S81A 4GLYA 3UPEA 1K1LA 5GDSH 3PTBA 1C1OA 1DS2E 1TNHA 1ZR0A 1V2NT 4GUXA 1P11E 1BA8B 3TJOA 4U30A 1GBBA 3TIUA 1O2TA 1UMAH 2VWLA 2BTCE 1VJ9U 1EUFA 2QF3A 2WPDD 4Z1MD 1A4WH 3MNSA 1NPMA 5JB8S 4ZH8A 4YOJA 4Q2KA 3SV6A 3QZQA 1S84A 4ISLA 3DSGA 1V2JT 4UFDH 1MH0A 1V2QT 1V2OT 5A0AE 1Q2WA 1IQFA 1TPOA 2PKSB 3B9FH 1Z8IB 1UW7A 2ZU4A 1C2MA 1IQHA 1Z6EA 1P01A 4JK5A 4Q80A 1SFQB 4UONA 3A82A 1HJAB 4JK6A 1NRSH 2BDIA 2IPQX 4NA8A 4X0WU 4X6PA 3P70B 1QGFA 1KXDA 4TWWA 3ZYEA 3SQHE 3GY8A 3AVZA 1YCPH 4X6MA 2JH6D 5L6NH 2NWNA 2Y82A 3FP6E 2V3HH 4ISIH 4BTUB 1V2LT 4DT4A 2WV4A 1BHXF 1O2NA 4HI3A 1BCUH 2TGTA 2ANMH 1IQJA 1Y3UA 4I8GA 3SUEA 4XOJA 2OQUA 1MABB 2ZECA 1SQAA 5G4BA 1AGJA 8LPRA 1FJSA 2WPIS 2FLRH 1O2JA 2XNIA 5DP6A 4XBBA 3UAIC 1AZZA 2QXHA 3S69A 1O33A 1DSUA 1TONA 2OK5A 1UCYE 2XC0A 3RXOA 2XNDD 4LZ4B 2BY8X 3T25A 1O2KA 5A8YA 1OSSA 2H6MA 2OC0A 3RXEA 1H1BA 2FEQH 4LZ1H 2GT8A 3QTOH 4TSFD 1GHYH 1XUJA 3KNXA 1EPTC 1C1VH 4KGAA 1EQ9A 1TRNA 2PGBB 4ZHAA 1ZTKA 4XBCA 3RU4D 2KAIB 5AF9H 5DP3A 1C5WB 1P2JA 1CHOF 1Y3YA 1NFXA 3D65E 3GY2A 3PMAB 5JBTA 2ZFQH 2CF8H 2EEKA 5TCAA 3OAAD 4Y8XA 1NN6A 1LVBA 4IGDA 1QZ8A 1SR5C 1ZGIA 3RXRA 2FODA 3AASA 2G51A 1ZPCA 1BMAA 2VIQA 4AB8A 1OWJA 3P8NA 1LVYA 2HOBA 1MBQA 4K1TA 1XVOA 3BTWE 3GY3A 4TY6A 1PQ7A 5HMAA 2D8WA 4NFEA 2PTCE 1L4DA 3WY8A 2OINA 2KR7A 1O2MA 2V6NA 3SJOA 2C8WB 3S9BA 4UFGH 1T4VH 1KDQB 1Z6JH 2WYGA 3M36A 1RTFB 2ZCLP 5CE1A 1NRQH 2VWNA 2LPRA 1AUTC 1WSSH 2XXLA 4AGJA 1SGRE 4OS5A 2BOHB 3P8OA 1GDNA 2FESH 1ZHMA 1OWDA 3A88A 1FPHH 1QB6A 1Y3VA 3G01A 3GDSA 3D49H 1G3DA 1HAYB 3TITA 1QJ1B 3UREA 2PR3A 1O3AA 3R3GB 1CU1A 3PMBB 1TE0A 3PYHA 3TJVA 5T6GA 4FU7A 4B73A 1BTPA 1BUIA 1A61H 1O36A 2W6ID 1C5SA 2KCPA 1WV7H 2Q1JA 4JCNA 1MKXK 2CXVA 1B0EA 2AMPA 1QR3E 1YC0A 1Z1IA 1E35B 1AN1E 3FP8E 1FV9A 1W0ZU 4Q7ZA 1SGFG 3Q3XA 5CHAB 3KQ5A 1TX6A 2QF5A 3SGQE 2AIQA 3KN2A 1YPHC 1FY1A 5HXFA 1YBWA 3LOXA 2I6SA 1GBAA 4BTIB 2GCTB 3ZZ6A 1GJ5H 1OYTH 3HK6B 1E0FD 2J38A 2GV6A 1K1PA 1O5FH 4BNRA 3LGTA 2DE8A 1O3GA 4H6SB 1C2IA 2ZDMA 1F92A 1PPHE 4A92A 3A81A 4JZDH 1ESBA 4XFQA 1C4Y2 1D3QB 2O8TA 5DGJA 2GDDA 3A7ZA 5GNDA 2RA0A 2OP9A 1J17T 1H9IE 2F9VA 5L2ZH 1GMCG 5C1YA 1VCQA 4Y8ZA 1C5LH 1O5EH 4ZCNA 5EJZA 1IQNA 4YTAA 4CBOA 1BOQA 2JIZD 4K8BA 5JYIA 2F9OA 2JJ1D 1DITH 3GICB 1P2MA 1GVLA 1SLWB 4O3UA 5IK2D 3Q3KA 1CGIE 2R2MB 1UCYK 1ANCA 3MU0A 2AGEX 5KGOA 1V2MT 1F0UA 1ZJKA 2VGCC 1KXBA 1F5KU 4JYVH 4I31A 2BVXH 1GJ7B 1XUKA 1YWUA 2YNAA 3S9AA 1AB9B 4Y7AA 9LPRA 1GHBF 3N7EA 4AC9A 3LJOA 3UNRA 3SQEE 3SU3A 1MUEB 3OE7D 1TQ0B 1N8OB 1EZXC 3UY9A 1G3BA 1L4ZA 2JH0D 2Z9LA 1YY3A 3MI4A 2J98A 4FUCA 3N7OA 4CHAC 3SU6A 1NFUA 3HGPA 1OWKA 1KXCA 2LP6A 1NY22 2ZCKP 1QFKH 1CGHA 3LGVA 4CR9A 2ILNA 1TX7A 2P59A 1RFNA 4X1QU 1A5HA 2BD2A 3FOAA 1UVTH 1C5ZB 1BZXE 3V3MA 2TGPZ 2DE9A 3KYFA 4ABFA 4Y71A 3V7TA 1QCPA 2P94A 3MU4A 1TX8A 2WPLS 2IOTA 2PGQB 1ARBA 2BVRH 1GJDB 1EAWA 2A2XH 2AMDA 2R0KA 3V12A 1OP0A 1ZRBA 4F4OC 1XUHA 1CQQA 3BTTE 1P57B 1LHGH 4WMDA 3E90B 3H5CB 2P8OB 2FOEA 2AFQB 1W11U 1W2KH 1X7AC 1W0YH 1YGCH 2HVYB 1EOJA 3F3BA 1A0LA 3FKSD 2G00A 3HGNA 2CHAC 1WQSA 2J97A 4OS7A 1ZPZA 1ETRH 1MQ5A 1TFXA 2RDEA 1DUAA 4Y8YA 5DSFA 1P3EA 2B7DH 1HFDA 3C27B 1OOKB 1OP8A 4Y76A 2HVXA 1SHHB 1SQRA 9ESTA 1HDTH 4TPIZ 1RTLA 2UUYA 1AZ8A 3SNAA 1WTHD 3C1KA 1GGDB 1ZMLA 1TB6H 3PO1C 1PQ5A 4SGBE 2W5EA 1BJUA 3A85A 1BQYA 4HGCA 3MNBA 5JB9S 5LGOA 1NROH 5DP4A 3UWIA 1DANH 3MQKC 2AEIH 4X8VH 2ZO3H 3GCNA 3RLYH 4YXWD 5FXLA 3OTJE 1IQMA 2WV5A 1KXAA 1GVZA 3NKKA 1DPOA 5FBEA 3LJJA 2R2WU 2F9PA 1EATA 5LPEA 2FMJA 4GAWA 3HKIB 5LPRA 4UFEH 2HLCA 4ZKRU 5A0CA 3A7XA 2GDEH 3PMJA 1BBRE 1F5RA 7LPRA 4K1SA 4K69A 1GBMA 4X1RU 4Y0YE 2ZKSA 3A8CA 1C4V2 2FYRA 2UWOA 3M5MA 3SI3H 3O8RA 1O3NA 1QBNA 1VZQH 2C8XB 3OY6U 4NIVA 3V0XA 2WYJA 2WPHS 2PW8H 1C2DA 1J9CH 3DFLA 4A1XA 3A8BA 2BD7A 1QBVH 1WOFA 1N6YA 1EB1H 2BDYA 4YO9A 4MNXA 3TVJB 1KY9A 5B6LA 2D26C 1UK3A 2IJD1 1VGCC 3IG6B 1AMHA 3SZEA 1GHAG 4JZEH 3TGKE 2F3CE 3OTPA 3AAVA 3F0PA 4ABGA 2ZQ2A 1GI2A 3JZ1B 2AERH 1LVMA 3D23A 2BLQA 3ODFA 1GBKA 1FPCH 2OUAA 3UNQA 3Q77A 2P3UB 4OM9A 2H9HA 3EE0B 2A45B 1KXFA 1P04A 2PFEA 3GOVB 5EJLA 1FY3A 1SG8B 1P2OA 1DLEA 1JXPA 2FPZA 3F0OA 1UTNA 2W6JD 4ABIA 1D6RA 1DDJA 1INCA 1FONA 2H1UA 4WWYA 1GG6C 1DWBH 1ABJH 1LPGB 3BTME 5I46H 5E8EH 1O3IA 4ZAEA 1O3JA 1C5VA 1C1PA 3U8TH 3K2UA 4K1EA 2GTBA 3ESTA 1LKBA 2AS9A 2BZ6H 1O2YA 3RU4E 3S0NA 1G37A 5C94A 2RG3A 1OHHD 5C5OA 3MNXA 1SGPE 1O3HA 5EU8A 2BLWA 1P03A 4O03A 5PTPA 4X6OA 1QRXA 2FX6A 1OWEA 4ZXXH 1MKWK 1GHVH 3FAOA 3SZNA 1PYTD 1AIXH 5EGMA 1HYLA 3RXGA 3PLPA 4RT0A 1K1OA 2ZGBH 2IPHA 1K22H 1P2QA 1C1RA 4MPWA 4THNH 3TJUA 5C5NA 1CT0E 1O2WA 1GJAB 2C3SA 1T8NA 2PKSC 4LOYH 4ASHA 1K2I1 5F8ZA 1BRAA 1BTHH 2BD5A 1AKSB 5DP9A 1LHFH 3ZZ3A 2ZDKA 2GMTC 3A7VA 1A3EH 3RXJA 1GDQA 2WSSD 4OGYA 1O2XA 1TGNA 1HV7A 3FZDA 2C8ZB 1P02A 2ZZUH 2H9TH 1Y3WA 1THPB 1FN6A 3ZV9A 3EDXB 3PRBA 2LELA 1MU6B 4P02A 1ID5H 4NWLA 4ZMAH 1O3PB 1BDAA 1O2QA 2A5IA 1G3CA 1TABE 8GCHG 3A89A 3ZZ9A 1WYKA 3LH1A 4GVUA 1DVAH 1ZMJA 2Z6BD 3E3TA 2NU1E 3U1IB 1BTWA 1FDPA 4GHQA 3BSQA 1CBWC 3SUDA 2VINA 3HKJB 4RN6A 3S7KB 4AFSA 3U69H 2ALPA 2Z9IA 6CHAB 2ZGJA 1S6FA 4CREA 5C20A 4B6FA 4XE4A 1WAYB 1ACBE 2FX4A 2J5UA 1O3LA 4BXSA 1N6XA 2Z3EA 5HGGA 2GGVB 4H42U 5FHTA 4FUBA 2FS9A 1MKXH 1L0ZA 1UTLM 1QBOA 4FETA 1S0QA 5CMXH 3Q76A 4NA7A 5EQRA 2XBYA 1Z8JB 4RI0A 3SV9A 4P00A 2K8IA 5DPAA 4ZUHA 2BDHA 3TGJE 2GZ8A 4H4FA 2O8WA 4JZFH 2G52A 1M9UA 3KQEA 2J95A 2XWBI 4TT3D 1GI8B 4X8TH 1C5TA 4B6EA 5C0UA 4Z0KA 2Z3DA 2Q6FA 1C2KA 3M3VA 1YPGH 1WBGB 4ZROA 3T27A 2A4GA 3LPRA 2BXTH 2OTVA 1NZQH 3P95A 4I8HA 3KCGH 1XMNB 1TBQH 3A87A 5EQQA 3GCTG 1TYNA 3RU4T 1FZZA 2PV9B 1W3CA 2K0QA 4JZIA 2L6OA 1SLUB 7GCHG 2BQWB 2P95A 4YM9A 2VIPA 5A2MH 1K21H 2CN0H 1LPZB 1MTWA 1CA0C 1T4UH 1C1NA 1WXRA 3STIA 2F83A 4NA9H 1SGYE 1ELBA 1SMFE 1EPTA 1OX1A 1AE5A 2SGEE 3GY6A 3TNTA 1P9UA 1GI6A 2QIQA 3KEEA 2XCFA 3A7YA 1SGEE 3A7TA 3GY7A 3SV8A 1V2WT 1YF4A 1C5YB 2O8MA 3T2NA 1O2RA 4HFPB 1TNLA 1S85A 1UCYH 4MLFB 2FIRH 3DFJA 2YMSC 1GMCF 1JRSA 3RXTA 2C90B 1W13U 3RXPA 1C2HA 2P93A 1TNJA 2WPMS 5FBIA 3PB1E 5CDFE 4D7FA 5JBCS 2ZU5A 4JZ1A 2Y5HA 4F49A 4XD7D 3ZZDA 1L2EA 4RSPA 3T29A 4INLA 2BQ6B 1LHDH 3H7OA 4ISNA 4B1TA 2J94A 2ZCHP 4X1PU 1FX0B 3KIDU 2R3UA 1PQAA 1RS0A 1C9PA 1UK4A 4J1YA 4MG3A 3DD2H 1LQDB 4CRAA 1H9LB 2UWPA 1UVOA 3U28C 3QN7A 3S9CA 2R9PA 1C4U2 3A8DA 3BG4B 1GMHG 2OXSA 5CHAC 1SQTA 1J8AA 2FZZA 1F0RA 1PQ8A 2VIWA 1TMTH 2ZFTA 2CGAA 2ZHQH 2B8OH 2HNTE 4YOIA 2F9UA 3RDZA 1QNJA 3LKWA 1PPBH 3OSYA 1GBCA 4IN1A 3W1EA 1ZLRA 1RD3B 1JBUH 2GVFA 3DUXH 4B2AA 4DCDA 5C3NA 5JBAS 4D76A 1VITH 3RM0H 1SPJA 4VGCC 1VCPA 3A83A 2GZ9A 1MAXA 1HAZB 2W3KA 2FOBA 1C5RA 3RP2A 1O35A 1EAUA 1GI5A 4XDEA 3MH4A 4NCYA 3PWCA 2HLDD 2QXJA 1C5UA 1XUIA 3EAJA 5DJ7A 1Z7KA 4A1TA 3QWCH 2Z7FE 4TY7A 2VVCA 5K0HA 1MTSA 1HAVB 3SUFA 3T26A 4ACBA 1K1NA 3LC3A 2PKAB 2VH6A 4Y79A 2CMYA 3MO9A 4KKDA 3BTHE 3BTKE 5JBBS 2JJ2D 3RMMH 2UWLA 1TIOA 1E1QD 1NBME 2DUCA 2RDLA 4K60A 1UTKA 1THRH 1O3DA 4FUFA 2L74A 4X8UH 1V2VT 3DSPA 2A2QH 4A5TS 2ZTXA 1SC8U 5DKMA 2XBWA 2CJIA 1MAYA 1DX5M 1O2GH 2GZ7A 4NWKA 3SGAE 5C2ZA 4B71A 5FL7D 1BJVA 1D3TB 4UDWH 1E79D 1N8OC 3ZVCA 1W14U 2F91A 1PPGE 1AVXA 2G8TA 4KTUA 4DG4A 1JMOH 2TGDA 3SV7A 1FLEE 7KMEH 1D6WA 2ZU3A 4MPXA 3BIVH 1A5IA 1YP9A 2BDAA 3PLKA 3K6ZA 3ZZBA 3SJIA 1ELEE 1HUTH 3RXSA 1BTUA 1HIAA 3DSOA 3VB6A 3BTEE 4YT6H 2C93B 4RKJB 2J9NA 1GMDG 5C67A 2ZP0H 2VVVA 3MTYA 1EJAA 3U1JB 4ZKOU 3L3TA 1O2PA 2EQNA 4O9VA 4ABHA 4IMQA 1MCTA 3RXAA 3VB7A 3RXLA 1T8OA 2HALA 3P6ZB 1DSTA 3FVFB 2ZG0H 1L1GA 2FOMB 3KQCA 1SLXB 4I86A 1AO5A 3WWBA 1RIWC 1KLJH 3GCHC 4AYYB 3E1XB 3ZYDA 2ZDNA 1LCYA 1GI3A 2KX4A 3WW7A 5AFZH 4I8JA 4O3TA 1O3KA 1EPTB 1ELAA 3DHKH 3TH2H 1GHWH 2VWOA 1EXFA 1KTSB 1TLDA 1QQ4A 2ANYA 4BAHB 3ATKA 1GBLA 1T7CA 1DXWA 1NU9A 1TALA 1C9TA 4WMEA 4JYTA 1DY9A 3SNBA 3LU9B 1KYNA 2XC5A 3MH5A 1S0RA 2STBE 4OGXA 1AY6H 1TWXB 4K2YA 4FUEA 1K1IA 2B0FA 1GHAF 2V35A 4YT7H 1F0TA 2NU3E 1TPSA 2BDGA 1C1WH 1XM1A 4A7IB 1ZGVA 3MH7A 1YCPK 1GHZA 3RMOH 1MBMA 1GGDC 3MU8A 4FVDA 5DG6A 5EPYA 1EZUC 1GI0A 3PROA 4Q4LA 3AW1A 4RKOB 3W95A 5F6MA 4ZKSU 1AU8A 3NWUA 2XC4A 4AG2A 3F6UH 4X2VA 1A3BH 2V7QD 4Q63A 4CR5A 1P12E 1C2JA 1B7XB 3SU4A 1ESAA 1J16A 2GD4B 1MTNB 2EC9H 2ZNKH 3MHWU 4UD9H 1EAIA 1O2VA 1FMGA 1QB1A 1FNIA 2SGQE 2THFB 2ZC9H 4IMZA 1TNKA 4Y10E 4LXBH 1AE8H 1GJBB 1MKWH 2BX4A 2FYQA 1ETTH 1J15A 2XTTB 2FTMA 1W7GH 5AFYH 1TA6A 2RA3A 3N99A 5ESBA 3UB0A 3U9AH 1FIZA 5C17A 3SGBE 1CSOE 3W94A 1ZOMA 2SFAA 2HPPH 7ESTE 1FY8E 2ZHEH 4X2XA 2EI6A 2WUCA 3GYMA 4INHA 3MU1A 1GI7B 4AORA 1AVGH 1DWEH 1S82A 4FVBA 3BG8A 3QUMP 1AI8H 1O2SA 3SU0A 3M35A 1MD8A 3IWMA 4CRGA 5LPFA 1P05A 2JH5D 3A8AA 1ZHPA 2F9BH 2FI3E 3ZZ7A 1ELGA 4E06H 1AFQC 2Y6TA 1AQ7A 3I78A 1VKYA 1S83A 1TGBA 4GSOA 3K6YA 5AHGH 1K9OE 4X2WA 4DT7B 1ZMNA 3ZIAD 1TGSZ 3B8JA 5CHBA 5EXMA 1YCPM 3ITIA 4K5ZA 1FQ3A 5DP5A 1G2LA 1EASA 1JIRA 3LONA 1P2IA 3RXQA 1CE5A 3UIRA 4NIWA 1Y5UT 4E7NA 1SSXA 1SI5H 4HZHA 8GCHF 4AB9A 2EY4C 2ZWLH 1G3EA 5ABWA 2ZEBA 1TBZH 1IOEA 4AGKA 4D9RA 1BBRH 1OWHA 4DW2U 3UQOA 4ABEA 1UVSH 4UFFH 1NBMD 1SGNE 4AX9H 3RXHA 3ZV8A 5EOKA 5C1XA 2Z9GA 2V3MA 3RMLH 4ZHLU 3TK5A 4CH8B 1HXEH 3A86A 2VGCB 2BD8A 3RXKA 1Q3XA 3BEFB 1MD7A 2BZAA 1H8DH 1BITA 2PHBA 1SGIB 3QDZB 1HGTH 3ATMA 2SGPE 3EQ0H 1EX3A 2R3YA 1QB9A 2Y7ZA 1HLTH 4CRFA 1NC6A 2VJ1A 1BMLA 2G81E 2SGAA 5FPTA 1FY5A 1PPCE 1MCVA 3OYPA 1PFXC 2VBCA 4IS5A 3SYJA 4CHAB 3TK9A 1PYTC 1F2SE 2CV3A 1UHBA 4XRNA 3UNSA 1TGCA 4OS2A 1NS3A 1BTYA 2D1JA 3VFEA 5FPYA 3L33A 3AK5A 1O32A 4MPVA 1IQGA 3MMGA 2AGIX 2K1QA 3LGYA 2FP7B 5FAHA 3SJ8A 1C2FA 1ZJDA 1ELTA 3M3SA 1C1UH 2BY5X 1RRKA 2IN2A 1V2UT 2ODYB 3GCTF 1MTVA 3PV5A 1G9IE 1O2UA 1DY8A 1NESE 1O3BA 4ISHH 2ALVA 1BMMH 2B5TB 4M7GA 7GCHF 2PSXA 3VPKA 4A6LA 4DURA 1OPHB 4IC6A 1YLNA 1MZDA 4TYDA 5J4SA 1XUGA 3OEHD 2Z9JA 4NGAH 1IAUA 5L2YH 3MNCA 1GBFA 1HBTH 2J4IA 1Y8TA 4Q7YA 6CHAC 3A80A 1HJ9A 1EAXA 2WHXA 3NUMA 3U8OH 2FOHA 3VGCB 1OP2A 4AFZA 2HRVA 3ZVEA 5ETXA 1ZSJA 3RM2H 1NM6A 1W0KD 1C5QA 2CHAB 5FX6A 1SHYA 1AWFH 3RXVA 2GP9B 4FU8A 3K65B 2BB4A 3I29A 5E0HA 3BV9B 3PTNA 2J98B 4MNVA 4AG1A 1W10U 1HAPH 1ZYOA 1BMNH 1O2ZA 2JKHA 1YPLH 3RXUA 3Q00A 1XXFA 3ZVFA 1GI4A 1SB1H 5GCHG 1V3XA 1Z8GA 3SUGA 3MYWA 2Q6DA 2OCVB 2GKVE 1ELCA 4I7YH 1P8VC 1GVKB 3E0PB 5EW2H 8ESTE 4JMYA 3PO1B 2TIOA 4H6TA 1O3OA 1ARCA 1GBDA 2M2AA 3SNEA 1MMJN 1NRPH 1V2RT 1ANDA 2A4QA 2QA9E 1GMHF 3SNDA 2FI5E 3SU5A 2PP6A 5A0BA 1O0DH 2G4UA 2G5NA 2GJGA 3EGKH 2V0BA 3PWBA 1O3EA 3LDXH 5F03A 2FS8A 1GHXH 1OWIA 2A7CA 2ZGXH 4KTSA 2A0QB 1K1JA 2B9LA 1OS8A 1HJAC 1HXFH 2BD9A 4R0IA 3RUOA 2F9NA 2VB0A 2HNTF 2WUBA 1QRZA 3BTGE 2ZFSA 1C1QA 2UUJB 3O8BA 5DP8A 2FLBH 1DFPA 2O8LA 1HNEE 4NSYA 1ZHRA 2ZF0H 2H5CA 2FWWA 2A5KA 2RCEA 4OS1A 1WCZA 3WWFA 3LH3A 1S6HA 5DN6D 5GJ4B 1FI8A 6GCHG 5IYTA 2QF4A 2BQ7B 3GDUA 2WPKS 3E8LA 1SGTA 2OBOA 2QYIA 2AHME 2VWMA 1XKBC 2ZFRH 3L6PA 3KQDA 1UVPA 3EA9A 3KGPA 1H9HE 2FOCA 1VGCB 3O8CA 3M7TA 1A1RA 4DVAU 1ZSKA 3M5LA 3SW2B 4B74A 1TNIA 2OQ5A 4MQAA 4NZQA 2Y5GA 3CS7A 1IQIA 5H4IB 1CGJE 3FN8A 1AVWA 1G36A 1XUFA 2BM2A 1H8ED 4DJZB 1V6DA 4AN7A 1O37A 1Z1JA 3U98H 2HWLB 1K28D 2OC8A 2LNCA 3SU2A 2ZHFH 2A7HA 1HAIH 3RXMA 2ZDLA 1J14A 1GG6B 3SNCA 1ZZZA 3UR6A 1HAXB 3STJA 1IQEA 1SGDE 2GCHG 4NG9H 5KEDA 3CP7A 2ZPSA 4TWYA 4OS4A 4ABBA 1TOMH 5EXNA 5EW1H 5GIBA 1TPAE 1A2CH 1DICA 3ZZCA 2ZTYA 4ABJA 1GMDF 1GWAA 3UR9A 5GWZA 5DO4H 4Z6AH 3PMHB 3GY5A 1AFEH 1KXEA 1D4PB 3VEQB 1YLCA 1SFIA 2UUKB 1NFWA 1O5BB 2BVSH 1TPPA 2AYWA 3F2GA 3F9GA 6ESTA 2OLGA 2BLVA 1AD8H 3TPIZ 1Q31A 5L30H 1NTPA 2KCAA 1QURH 2Z94A 3KQBA 5BRRE 1SVPA 1SBWA 1HAHH 1L1JA 2NU0E 1ZTLA 2BY7X 2ZTZA 3UFAA 2GMTB 1GCTB 1C1MA 1JWTA 5A8XA 3PV4A 2C8YB 1O5DH 2SNWA 1EFRD 2A31A 4O97A 1UTJA 2A32A 1P3CA 1L1NA 2VNTA 2Y7XA 4MDSA 2ZPRA 1YPMH 1OXGA 1ELDE 2PUXB 3H09A 3NPSA 5TJXA 2ZIQH 1QJ7B 3EA8A 5GXPA 1EP6A 4D8NA 2F43B 2V3OH 1UJ1A 1C5PA 2ANWA 3TLOA 1KSNA 1CBWB 3P8FA 1LQEA 3LC5A 1O38A 4X6NA 3E91A 1KLIH 5EPNA 1SOTA 3BTQE 4IC5A 3PLBA 1YPHE 4ZHMU 3ATIA 4Y6DA 1E38B 2Z3CA 1EZSC 3E6PH 1HAGE 2H9EH 2XYAA 1GI9B 3LGUA 1VJAU 3TK6A 1VR1H 2JETB 4X2YA 3TNSA 1FXYA 2P3FH 3MOCA 1V2ST 3TJNA 4FUDA 2GCTC 4FUIA 5EODA 1C5NH 1A0HB 1BMFD 1C5OH 5A8ZA 1O3MA 1CHGA 4ABAA 1EP5A 4ABDA 5EXLA 4FUHA 3F9FA 3SI4H 1FN8A 3M7UA 3DCLA 3QO6A 1BRBE 1FAKH 2EI7A 1LDTT 1C1TA 2PTNA 5J4QA 2QC2A 1T31A 3BTFE 1UTMA 3MWIU 1FIWA 3EYDA 3VB4A 2ZU1A 3VG8A 3TU7H 2G55A 3CNRA 2RFKC 1TNGA 4WXIA 1RXPA 4KTCA 1QA0A 1O5GH 2H5DA 4DY7B 4YESB 1A5GH 3AAUA 2A4OA 5LH8A 1EB2A 1WDIA 3E16B 3OX7U 3OU0A 1MTUA 1BRUP 1O34A 1QRWA 2A1DB 3ZVBA 5FX5A 2FOAA 1YKTA 1Y3XA 1BB0B 1NRRH 2KCOA 3K9XB 2W7UA 1D3DB 2M5TA 5EQSA 3NZIA 1HCGA 3M37A 3BN9A 3F2FA 2P3TB 1CA0B 3SV2H 3ZZAA 2FXRA 4KP0A 2WV9A 3LIWA 1CVWH 2QXGA 1NRNH 2VIDA 3S7HB 1T8MA 3SJKA 3VXEH 4YLQH 2C4FH 1LPKB 1AB9C 1WQVH 2EI8A 2AMQA 3VB5A 2ZHWH 4GCHG 1FUJA 1QQUA 2ZDVH 1HRTH 2HGTH 5BPEA 1O2HA 1XXDA 4NIYA 2YMSD 1IHTH 1E37B 3M3TA 2YMSB 2ZPQA 3GYLB 1NO9H 3F1SB 5K7RA 1MTNC 2Y81A 3RXCA 4B2CA 4SGAE 2Q6GA 1VITG 2OBQA 1CT4E 1IQLA 4X1SU 1PPZA 4A1VA 2XBVA 1GPZA 3N7DA 1MZAA 1O39A 1F5LA 1CO7E 3KF2A 4RT1A 4AYVB 3D62A 1G2MA 4DIHH 4XBDA 1C5MD 4F55A 3T62A 4FUJA 1EOLA 2D2DA 3KL6A 2ASUB 2PLXA 3EA7A 1SLVB 1V2PT 3M5NA 4AZ2B 5C0TA 3SOSA 1CA8B 1TRYA 4BAQB 3RC6A 4U32A 4X8SH 1E34B 3FP7E 3KHVA 3SJ9A 4WJG2 2VH0A 2QV1A 3BIUH 1ANEA 3FFGA 2HNTC 4BAKB 2J34A 1NFYA 1U6QA 2P8OC 2TGAA 3NCLA 4LK4A 4AFQA 1XX9A 3ELAH 4Y7BA 3SBKA 4Y0ZE 3QLPH 3HATH 3IITA 3URDA 1SGFA 2QN5T 1JOUB 4UEHH 1SGCA 1IQKA 1A46H 1V2TT 1ETSH 3SU1A 1NU7B 1ABIH 3ZVAA 4R8TB 4VGCB 3RLWH 2WINI 4MNYA 5T1VA 1GL0E 2BMGB 4ACAA 4DGJA 1C2GA 2QE7D 5HKKD 5HIYA 4I8KA 1S6LA 3RXBA 1DE7H 1QJ6B 2R0LA 4K8YA 1Y59T 5E2OA 3U8RH 5EIYA 2KZ4A 4CRDA 1EJMA 2AH4X 4ZXYH 4IW4E 2VU8E 1GJ4H 5B6OA 3GDVA 3FO8D 3ODDA 1DUEA 3UTUH 1PPEE 3P92A 4FXGH 4U2WA 1AHTH 1GL1A 1GBHA 2H2ZA 1B5GH 1H8HD 4CRBA 2A5AA 2CF9H 1YLDA 1TRMA 3E0NB 3HPTB 4IN2A 3HK3B 4UE7H 1F0SA 4XSKU 2ZFFH 3TH3H 2O9QA 2TRMA 5HYOA 2CK3D 2BX3A 3A84A 2GT7A 1P0SH 2QY0B 3BTDE 1DLKB 2BDBA 3BF6H 4YZUA 4CH2B 4J2YB 4X1NU 5HIZA 2WPJS 1P9SA 2EA3A 3UQVA 5E2PA 2ZA5A 5GCHF 1GBIA 2PWXA 1UTOA 1D9IA 3ZVDA 4DIIH 1P2KA 4WXVA 3GCOA 3UUZA 5F8TA 2FO9A 3MH6A 1DXPA 3FZZA 2BY9X 1P10A 3AW0A 1D3PB 1BIOA 5GPIB 3SN8A 5JDUB 3OFND 5DP7A 4B76A 2GV7A 1CHOG 2W26A 1O31A 2TBSA 2Z9KA 1GBEA 1QL8A 1FAXA 1KLTA 4MVNA 1AWHB 3SORA 2FDAA 2BOKA 1BTXA 3VB3A 4INKA 1AUJA 1MQ6A 1LO6A 1W0JD 1T8LA 3EE7A 3FANA 3MO3A 1GDUA 2I6QA 2ZU2A 4GHTA 2ANKH 3UOUA 1QIXB 2QAAA 1RIWB 3GCHB 3LGIA 1UK2A 2ESTE 4ASUD 1AKSA 1QY6A 2XWAA 2ODPA 5DK1A 4AFUA 2YNBA 2J2UA 1SKYE 1ZSLA 1GBJA 1TA2A 2PSYA 2ZQ1A 2BYAX 3VGCC 2W3IA 4HTCH 2ULLA 5KECA 2IJOB 3JZ2B 1A0JA 3ZZ8A 1TBRH 4DOQA 3ENSB 1Z8RA 1YPKH 1FY4A 2BDCA 4KELA 6GCHF 1ANBA 1HPGA 1QTFA 1GI1A 1ZPBA 5TCCA 2FM2A 4BTTB 2WZQA 3LT3A 4M9FA 3PRDA 3URCA 3F9EA 2P16A 1EKBB 1LHCH 5FPSA 5T6DA 2KFWA 5AVDA 3RXFA 1OYQA 3LGWA 1HIAB 2O8UA 1ZRKA 5T6FA 1COWD 1THSH 1BRCE 1H4WA 4D7GA 4QT8C 1SL3A 4ZKNU 2QCYA 1HB0B 3CS0A 1YPEH 2BD4A 3M7QA 3PV2A 3Q3YA 2Y5FA 1O3CA 2XW9A 1P06A 4YLUA 1EZQA 4WY3A 2SGDE 5EG4A 1HAOH 1K0HA 2BHGA 5E0GA 1HJ8A 1DWDH 4F48B 1SQOA 2SNVA 2ZDAH 3QX5H 1DT2A 3H7TA 4BXWA 2KCYA 5F53A 3V13A 3BEUA 2KM0A 3MU5A 4K3JA 1ZTJA 1K1MA 1O2LA 2GCHF 1WUNH 1O30A 3OY5U 8KME2 2F4LA 1ELVA 1C1SA 5C1UA 2ODQA 3RC5A 3QGNB 2HPQH 3M61U 1DOJA 1W12U 2G4TA 4I8LA 1GBTA 1TAWA 4TPYA 6LPRA 1LHEH 1Z71A 3F2HA 3F9HA 3GISB 4IBLH 4HG6A 4BANB 3BEIB 1N1LA 1PJPA 3O8DA 1ESTA 2ZGCA 3DA9B 3OEED 1P2NA 2BXUH 3TH4H 3UOPA 2UUFB 1O5AB 3NRLA 2OC1A 1C2EA 3QTVH 1IHSH 2ZGHA 4MTBA 5HM9A 5IDKA 2XOKD 5ESTE 1KMHB 3GS9A 2ZFPH 1RTKA 4E7RG 4ESTE 3CENA 1H8IH 4BOHA 1VCWA 1YPJH 3QK1A 2XBXA
chains in the Genus database with same CATH topology
2AIPA 4WF8A 2Y80A 2QF0A 1NT1A 2XCNA 1AFQB 4U01A 3SHCH 2VIVA 2YOLA 1BHXB 3SHAH 1RGQA 2GX4A 1TGTA 3RMNH 2J92A 1GHBG 2PUQH 1Y5BT 2BLOA 2FOFA 2QGRA 1GJ6A 2STAE 1YM0A 4OS6A 1DWCH 2A7JA 4YOGA 2OC7A 2FOGA 1GJCB 1JRTA 3ZVGA 2XRCA 1O2IA 1SOZA 4BAOB 3RXDA 1GJ8B 4I33A 4WH6A 3VXFH 2QXIA 1TQ7B 4FUGA 4D9QA 5HM2A 1S5SA 3TGIE 4WMFA 4CRCA 1E36B 3A7WA 4NSVA 2W7SA 1RJXB 5I25A 3ZZ4A 1T32A 1Y5AT 3NK8A 3QZRA 1LVOA 3P17H 1O3FA 3B23B 4ISOA 2OD3B 1W8BH 1QHRB 1TMUH 4GPGA 1UVUH 2ZHDA 1TMBH 2G5VA 4B2BA 1QL9A 4E05H 2NU4E 2VVUA 1GJ9B 1G30B 1BTZA 1EJNA 5SGAE 2ZI2H 4NIXA 4NFFA 3RXIA 1LMWB 1DM4B 4PROA 2BD3A 2KAIA 1JIMA 2FTLE 3M5OA 1WTGH 4MNWA 3SO3A 4NZLA 1CT2E 1PPFE 2NU2E 1WU1A 1SGQE 1F7ZA 1GCDA 4MPUA 1GCTC 1ELFA 4BAMB 3T5FH 4Q7XA 1XKAC 4FU9A 1HAVA 4B75A 1BT7A 3ATLA 4AOQA 1MU8B 5FCRA 2PKAA 3ATWA 3T28A 4Y11E 3RC4A 1KDQA 1G32B 1KTTB 3UWJH 3MO6A 1B0FA 1C2LA 1OKXA 1V2KT 3I77A 2BY6X 4JYUH 1KIGH 5T3HA 3BG4C 1O5CB 3QGJA 3R0FA 5A09A 4GCHF 1LTOA 1XVMA 1TOCB 1YYY1 1UO6A 5F8XA 1ORFA 3PM3A 5FCKA 2FI4E 4WH8A 3F68H 5E0JA 2SGFE 2VIOA 2JETC 1C5XB 1P09A 3DT0H 1BBRK 4WVPE 1A7SA 4I32A 1LKAA 3P8GA 5JPMH 1UTQA 2TPIZ 1W7XH 4CBNA 3NXPA 1UTPA 2AGGX 1O2OA 1QA7A 3ZZ5A 1VITF 1UHBB 3MFJA 2A4RA 3GY4A 1QL7A 1S81A 4GLYA 3UPEA 1K1LA 5GDSH 3PTBA 1C1OA 1DS2E 1TNHA 1ZR0A 1V2NT 4GUXA 1P11E 1BA8B 3TJOA 4U30A 1GBBA 3TIUA 1O2TA 1UMAH 2VWLA 2BTCE 1VJ9U 1EUFA 2QF3A 1A4WH 3MNSA 1NPMA 5JB8S 4ZH8A 4YOJA 4Q2KA 3SV6A 3QZQA 1S84A 4ISLA 1V2JT 4UFDH 1MH0A 1V2QT 1V2OT 5A0AE 1Q2WA 1IQFA 1TPOA 2PKSB 3B9FH 1Z8IB 2ZU4A 1C2MA 1IQHA 1Z6EA 1P01A 4JK5A 4Q80A 1SFQB 4UONA 3A82A 1HJAB 4JK6A 1NRSH 2BDIA 4X0WU 4NA8A 4X6PA 3P70B 1QGFA 1KXDA 4TWWA 3ZYEA 3SQHE 3GY8A 3AVZA 1YCPH 4X6MA 2JH6D 5L6NH 2NWNA 2Y82A 3FP6E 2V3HH 4ISIH 4BTUB 1V2LT 2WV4A 1BHXF 1O2NA 4HI3A 1BCUH 2TGTA 2ANMH 1IQJA 1Y3UA 4I8GA 3SUEA 4XOJA 2OQUA 2ZECA 1SQAA 5G4BA 1AGJA 8LPRA 1FJSA 2WPIS 2FLRH 1O2JA 2XNIA 5DP6A 4XBBA 1AZZA 2QXHA 3S69A 1O33A 1DSUA 1TONA 1UCYE 2XC0A 3RXOA 4LZ4B 2BY8X 3T25A 1O2KA 5A8YA 1OSSA 2H6MA 2OC0A 3RXEA 1H1BA 2FEQH 4LZ1H 2GT8A 3QTOH 1GHYH 1XUJA 3KNXA 1EPTC 1C1VH 4KGAA 1EQ9A 1TRNA 2PGBB 4ZHAA 1ZTKA 4XBCA 3RU4D 2KAIB 5AF9H 5DP3A 1C5WB 1P2JA 1CHOF 1Y3YA 1NFXA 3D65E 3GY2A 3PMAB 5JBTA 2ZFQH 2CF8H 2EEKA 5TCAA 4Y8XA 1NN6A 1LVBA 4IGDA 1SR5C 1ZGIA 3RXRA 2FODA 3AASA 2G51A 1ZPCA 1BMAA 2VIQA 4AB8A 1OWJA 3P8NA 1LVYA 2HOBA 1MBQA 4K1TA 1XVOA 3BTWE 3GY3A 4TY6A 1PQ7A 5HMAA 2D8WA 4NFEA 2PTCE 1L4DA 3WY8A 2OINA 1O2MA 2V6NA 3SJOA 2C8WB 3S9BA 4UFGH 1T4VH 1KDQB 1Z6JH 2WYGA 3M36A 1RTFB 2ZCLP 5CE1A 1NRQH 2VWNA 2LPRA 1AUTC 1WSSH 2XXLA 4AGJA 1SGRE 4OS5A 2BOHB 3P8OA 1GDNA 2FESH 1ZHMA 1OWDA 3A88A 1FPHH 1QB6A 1Y3VA 3G01A 3GDSA 3D49H 1G3DA 1HAYB 3TITA 1QJ1B 3UREA 2PR3A 1O3AA 3R3GB 1CU1A 3PMBB 1TE0A 3PYHA 3TJVA 5T6GA 4FU7A 4B73A 1BTPA 1BUIA 1A61H 1O36A 1C5SA 1WV7H 2Q1JA 4JCNA 1MKXK 2CXVA 1B0EA 2AMPA 1QR3E 1YC0A 1Z1IA 1E35B 1AN1E 3FP8E 1FV9A 1W0ZU 4Q7ZA 1SGFG 3Q3XA 5CHAB 1TX6A 3SGQE 2AIQA 3KN2A 1YPHC 1FY1A 5HXFA 1YBWA 3LOXA 2I6SA 1GBAA 4BTIB 2GCTB 3ZZ6A 1GJ5H 1OYTH 3HK6B 1E0FD 2GV6A 2J38A 1K1PA 1O5FH 4BNRA 3LGTA 2DE8A 1O3GA 4H6SB 1C2IA 2ZDMA 1F92A 1PPHE 4A92A 3A81A 4JZDH 1ESBA 4XFQA 1C4Y2 1D3QB 2O8TA 5DGJA 2GDDA 3A7ZA 2RA0A 2OP9A 1J17T 1H9IE 2F9VA 5L2ZH 1GMCG 5C1YA 1VCQA 4Y8ZA 1C5LH 1O5EH 1IQNA 4YTAA 4CBOA 1BOQA 4K8BA 5JYIA 2F9OA 1DITH 3GICB 1P2MA 1GVLA 1SLWB 4O3UA 3Q3KA 1CGIE 2R2MB 1UCYK 1ANCA 3MU0A 2AGEX 1V2MT 1F0UA 1ZJKA 2VGCC 1KXBA 1F5KU 4JYVH 4I31A 2BVXH 1GJ7B 1XUKA 2YNAA 3S9AA 1AB9B 4Y7AA 9LPRA 1GHBF 3LJOA 3UNRA 3SQEE 3SU3A 1MUEB 1TQ0B 1N8OB 1EZXC 3UY9A 1G3BA 1L4ZA 2JH0D 2Z9LA 3MI4A 4FUCA 3N7OA 4CHAC 3SU6A 1NFUA 3HGPA 1OWKA 1KXCA 1NY22 2ZCKP 1QFKH 1CGHA 3LGVA 4CR9A 2ILNA 1TX7A 2P59A 1RFNA 4X1QU 1A5HA 2BD2A 1UVTH 1C5ZB 1BZXE 3V3MA 2TGPZ 2DE9A 4ABFA 4Y71A 3V7TA 1QCPA 2P94A 3MU4A 1TX8A 2WPLS 2IOTA 2PGQB 1ARBA 2BVRH 1GJDB 1EAWA 2A2XH 2AMDA 2R0KA 3V12A 1OP0A 1ZRBA 4F4OC 1XUHA 1CQQA 3BTTE 1P57B 1LHGH 4WMDA 3E90B 3H5CB 2P8OB 2FOEA 2AFQB 1W11U 1W2KH 1X7AC 1W0YH 1YGCH 1EOJA 1A0LA 2G00A 3HGNA 2CHAC 1WQSA 4OS7A 1ZPZA 1ETRH 1MQ5A 1TFXA 1DUAA 4Y8YA 1P3EA 2B7DH 1HFDA 3C27B 1OOKB 1OP8A 4Y76A 2HVXA 1SHHB 9ESTA 1HDTH 4TPIZ 1RTLA 2UUYA 1AZ8A 3SNAA 1WTHD 3C1KA 1GGDB 1ZMLA 1TB6H 3PO1C 1PQ5A 4SGBE 2W5EA 1BJUA 3A85A 1BQYA 4HGCA 3MNBA 5JB9S 5LGOA 1NROH 5DP4A 3UWIA 1DANH 2AEIH 4X8VH 2ZO3H 3GCNA 3RLYH 5FXLA 3OTJE 1IQMA 2WV5A 1KXAA 1GVZA 3NKKA 1DPOA 5FBEA 3LJJA 2R2WU 2F9PA 1EATA 5LPEA 2FMJA 4GAWA 3HKIB 5LPRA 4UFEH 2HLCA 4ZKRU 5A0CA 3A7XA 2GDEH 3PMJA 1BBRE 1F5RA 7LPRA 4K1SA 4K69A 1GBMA 4X1RU 4Y0YE 2ZKSA 3A8CA 1C4V2 2FYRA 2UWOA 3M5MA 3SI3H 3O8RA 1O3NA 1QBNA 1VZQH 2C8XB 3OY6U 4NIVA 3V0XA 2WYJA 2WPHS 2PW8H 1C2DA 1J9CH 3DFLA 4A1XA 3A8BA 2BD7A 1QBVH 1WOFA 1N6YA 1EB1H 2BDYA 4YO9A 4MNXA 3TVJB 1KY9A 2D26C 1UK3A 1VGCC 3IG6B 1AMHA 1GHAG 4JZEH 3TGKE 2F3CE 3AAVA 4ABGA 2ZQ2A 1GI2A 3JZ1B 2AERH 1LVMA 3D23A 2BLQA 3ODFA 1GBKA 1FPCH 2OUAA 3UNQA 3Q77A 2P3UB 2H9HA 3EE0B 2A45B 1KXFA 1P04A 2PFEA 3GOVB 1FY3A 1SG8B 1P2OA 1DLEA 1JXPA 2FPZA 1UTNA 4ABIA 1D6RA 1DDJA 1INCA 1FONA 2H1UA 4WWYA 1GG6C 1DWBH 1ABJH 1LPGB 3BTME 5I46H 5E8EH 1O3IA 4ZAEA 1O3JA 1C5VA 1C1PA 3U8TH 3K2UA 4K1EA 2GTBA 3ESTA 1LKBA 2AS9A 2BZ6H 1O2YA 3RU4E 3S0NA 1G37A 2RG3A 5C5OA 3MNXA 1SGPE 1O3HA 5EU8A 2BLWA 1P03A 4O03A 5PTPA 4X6OA 1QRXA 2FX6A 1OWEA 4ZXXH 1MKWK 1GHVH 3FAOA 3SZNA 1PYTD 1AIXH 5EGMA 1HYLA 3RXGA 3PLPA 1K1OA 2ZGBH 2IPHA 1K22H 1P2QA 1C1RA 4MPWA 4THNH 3TJUA 5C5NA 1CT0E 1O2WA 1GJAB 2C3SA 1T8NA 2PKSC 4LOYH 4ASHA 1K2I1 5F8ZA 1BRAA 1BTHH 2BD5A 1AKSB 5DP9A 1LHFH 3ZZ3A 2ZDKA 2GMTC 3A7VA 1A3EH 3RXJA 1GDQA 4OGYA 1O2XA 1TGNA 1HV7A 3FZDA 2C8ZB 1P02A 2ZZUH 2H9TH 1Y3WA 1THPB 1FN6A 3ZV9A 3EDXB 1MU6B 1ID5H 4NWLA 4ZMAH 1O3PB 1BDAA 1O2QA 2A5IA 1G3CA 1TABE 8GCHG 3A89A 3ZZ9A 1WYKA 3LH1A 4GVUA 1DVAH 1ZMJA 2Z6BD 3E3TA 2NU1E 3U1IB 1BTWA 1FDPA 4GHQA 3BSQA 1CBWC 3SUDA 2VINA 3HKJB 4RN6A 3S7KB 4AFSA 3U69H 2ALPA 2Z9IA 6CHAB 2ZGJA 1S6FA 4CREA 5C20A 4XE4A 1WAYB 1ACBE 2FX4A 1O3LA 4BXSA 1N6XA 2Z3EA 5HGGA 2GGVB 4H42U 5FHTA 4FUBA 2FS9A 1MKXH 1L0ZA 1UTLM 1QBOA 5CMXH 1S0QA 3Q76A 4NA7A 5EQRA 2XBYA 1Z8JB 3SV9A 5DPAA 4ZUHA 2BDHA 3TGJE 2GZ8A 4H4FA 2O8WA 4JZFH 2G52A 1M9UA 3KQEA 2J95A 2XWBI 1GI8B 4X8TH 1C5TA 4Z0KA 2Z3DA 2Q6FA 1C2KA 3M3VA 1YPGH 1WBGB 4ZROA 3T27A 2A4GA 3LPRA 2BXTH 2OTVA 1NZQH 3P95A 4I8HA 3KCGH 1XMNB 1TBQH 3A87A 5EQQA 3GCTG 1TYNA 3RU4T 1FZZA 2PV9B 1W3CA 4JZIA 1SLUB 7GCHG 2BQWB 2P95A 4YM9A 2VIPA 5A2MH 1K21H 2CN0H 1LPZB 1MTWA 1CA0C 1T4UH 1C1NA 3STIA 2F83A 4NA9H 1SGYE 1ELBA 1SMFE 1EPTA 1OX1A 1AE5A 2SGEE 3GY6A 3TNTA 1P9UA 1GI6A 2QIQA 3KEEA 2XCFA 3A7YA 1SGEE 3A7TA 3GY7A 3SV8A 1V2WT 1YF4A 1C5YB 2O8MA 3T2NA 1O2RA 4HFPB 1TNLA 1S85A 1UCYH 4MLFB 2FIRH 3DFJA 1GMCF 1JRSA 3RXTA 2C90B 1W13U 3RXPA 1C2HA 2P93A 1TNJA 2WPMS 5FBIA 3PB1E 5JBCS 4D7FA 2ZU5A 4JZ1A 2Y5HA 4F49A 3ZZDA 1L2EA 4RSPA 3T29A 4INLA 2BQ6B 1LHDH 3H7OA 4ISNA 4B1TA 2J94A 2ZCHP 4X1PU 3KIDU 2R3UA 1PQAA 1RS0A 1C9PA 1UK4A 4J1YA 4MG3A 3DD2H 1LQDB 4CRAA 1H9LB 2UWPA 1UVOA 3QN7A 3S9CA 2R9PA 1C4U2 3A8DA 3BG4B 1GMHG 2OXSA 5CHAC 1SQTA 1J8AA 2FZZA 1F0RA 1PQ8A 2VIWA 1TMTH 2ZFTA 2CGAA 2ZHQH 2B8OH 2HNTE 4YOIA 2F9UA 3RDZA 1QNJA 3LKWA 1PPBH 3OSYA 1GBCA 4IN1A 1ZLRA 1RD3B 1JBUH 2GVFA 3DUXH 4B2AA 4DCDA 5C3NA 5JBAS 4D76A 1VITH 3RM0H 1SPJA 4VGCC 1VCPA 3A83A 2GZ9A 1MAXA 1HAZB 2W3KA 2FOBA 1C5RA 3RP2A 1O35A 1EAUA 1GI5A 4XDEA 3MH4A 4NCYA 3PWCA 2QXJA 1C5UA 1XUIA 3EAJA 5DJ7A 1Z7KA 4A1TA 3QWCH 2Z7FE 4TY7A 2VVCA 5K0HA 1MTSA 1HAVB 3SUFA 3T26A 1K1NA 3LC3A 2PKAB 2VH6A 4Y79A 2CMYA 3MO9A 4KKDA 3BTHE 3BTKE 5JBBS 3RMMH 2UWLA 1TIOA 2RDLA 2DUCA 4K60A 1UTKA 1THRH 1O3DA 4FUFA 4X8UH 1V2VT 2A2QH 4A5TS 2ZTXA 1SC8U 5DKMA 2XBWA 2CJIA 1MAYA 1DX5M 1O2GH 2GZ7A 4NWKA 3SGAE 5C2ZA 4B71A 1BJVA 1D3TB 4UDWH 1N8OC 3ZVCA 1W14U 2F91A 1PPGE 1AVXA 2G8TA 4KTUA 4DG4A 1JMOH 2TGDA 3SV7A 1FLEE 7KMEH 1D6WA 2ZU3A 4MPXA 3BIVH 1A5IA 1YP9A 2BDAA 3PLKA 3K6ZA 3ZZBA 3SJIA 1ELEE 1HUTH 3RXSA 1BTUA 1HIAA 3VB6A 3BTEE 4YT6H 2C93B 4RKJB