3UNQA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKLCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3unqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3unqA02
3GY6A 1P57B 2CXVA 5T3HA 3IITA 4NFFA 1E35B 1S82A 1DWEH 1CGJE 2VH6A 1O5EH 6LPRA 3AW1A 1VCWA 1N6YA 2JKHA 4BAHB 2RA0A 3SU4A 2ANWA 1DITH 1T8OA 3F9HA 3RXTA 1GI9B 2GT8A 2PTNA 3AAVA 1O2HA 1V2QT 2OC0A 4AORA 4Y76A 2TGDA 5LPRA 3V0XA 1HAXB 1SVPA 3QUMP 3MH5A 8KME2 1TGBA 5CHAC 5FX5A 4INLA 1AKSA 3A7TA 3S69A 1UHBB 2P8OB 1DWBH 1JIRA 1ZLRA 1E36B 4XE4A 1MCTA 1WU1A 1D3QB 1PPHE 4SGBE 1VJAU 4O3UA 3SNBA 1DWDH 3P6ZB 2J94A 3RU4T 2BZAA 2VWLA 3QGJA 4FUJA 3SBKA 1OP2A 4X8UH 1GJAB 3MMGA 2O8UA 1CSOE 1O3MA 1O30A 2Q1JA 1AI8H 3M7QA 4K1EA 6GCHG 1XKAC 3A7ZA 4YESB 2BM2A 1FZZA 1GBJA 4Y0ZE 5HMAA 1AZ8A 2BLVA 2OP9A 2XXLA 3E1XB 3QLPH 3FP6E 4GHQA 5EW2H 5I46H 1BZXE 3SQHE 1SOTA 4J1YA 6GCHF 3GDSA 2GDDA 2V6NA 5EQQA 2FX4A 1EUFA 1AZZA 1GI4A 1TPAE 4X1PU 5GCHG 2ZZUH 3MWIU 3GY2A 4BTUB 2SNWA 3TNSA 1S83A 3A7XA 1M9UA 2A5KA 2ZFSA 2Z6BD 4YO9A 3TJNA 5LH8A 3PTBA 3R3GB 3UOPA 1TBRH 2FOEA 4Q7XA 4NSVA 2ANMH 1QL7A 2PTCE 3MU4A 4ZKSU 5JB8S 2BQ6B 1YF4A 3GDVA 2OC7A 2R0KA 1HJ9A 1JRTA 3ZV8A 4H4FA 8LPRA 2EI7A 2J2UA 1EZSC 1CHOG 1MKWH 1AKSB 1B0EA 2BY9X 5E0JA 1OP0A 3UIRA 3M61U 1SGFA 5JBAS 1MZDA 5DP6A 2QXHA 2VVCA 2FMJA 1V2PT 1X7AC 1T31A 1TONA 4NIVA 4IS5A 3UWIA 1CHOF 1AE8H 3FAOA 1DX5M 2Z3DA 2WUCA 1W2KH 1MCVA 2ZHWH 2WPMS 5B6OA 4ABBA 4X6OA 4E05H 1C1RA 4GPGA 3OX7U 4X2VA 4KTUA 3AW0A 5DP7A 2TGAA 3T2NA 1P02A 1O5GH 3U8OH 1H9IE 1P3EA 1RIWB 3K9XB 4RN6A 1ELAA 1O3GA 4XBBA 5A8YA 4X8SH 4IN2A 4ZROA 4BAMB 1HIAA 3M3VA 1PPCE 1A5GH 4IC6A 1V2MT 1CGHA 2CHAB 2J38A 3BEFB 1HXFH 1RTKA 2ZCKP 3U9AH 1A7SA 1C5PA 2SGAA 2OUAA 3OTJE 2ZPSA 2AYWA 2HPQH 3B8JA 1FMGA 1VGCB 5FAHA 3ZVGA 1QIXB 1VITH 2ZECA 5SGAE 1P06A 1WV7H 1P2IA 2WV4A 2VINA 3TK5A 2R2MB 1C2GA 2Q6GA 3E0PB 4U30A 3MU8A 1ELTA 3VGCC 1KXFA 1GVZA 2EA3A 1IQKA 1TGNA 3MH4A 1OWIA 1Z8RA 2H9EH 1T32A 1Y3UA 3GICB 2ZDNA 2XBWA 1ZRBA 1XXFA 1LQDB 1TLDA 2GCTC 3A89A 3BG4B 4K60A 1P2JA 1K2I1 2B5TB 3SU5A 1IOEA 1HV7A 2A1DB 3SV8A 2PW8H 3S7HB 1G9IE 1JOUB 1XKBC 2FO9A 4XFQA 1HPGA 4IW4E 1P09A 4Y71A 2BY7X 2Y80A 4TY6A 1OKXA 1H1BA 2A4GA 2ZFRH 1ETSH 4ISIH 6CHAC 1HAOH 3QDZB 1TGTA 1PPZA 4X1QU 1L1NA 4VGCC 1LO6A 2Q6FA 5AF9H 9ESTA 2XC5A 2VGCC 1SI5H 1Q31A 1OYTH 4LOYH 1UVOA 1EOJA 1ZPCA 3F1SB 1FUJA 1O35A 4MDSA 3Q3XA 1WBGB 2P3TB 3DUXH 1UK3A 1V2KT 1BRAA 1ZPZA 4ASHA 2BOHB 2SNVA 4ABGA 1LHCH 4NFEA 1K21H 2WYJA 4DIIH 1GGDB 3G01A 1FN8A 2ZFTA 3PMJA 2ILNA 1SFQB 1LHFH 4XSKU 1D3PB 3T29A 1YPJH 3W94A 1K1IA 3TJUA 4MNVA 2ZDKA 3MYWA 4JYUH 4HFPB 4LK4A 1HJ8A 4AB8A 2OCVB 5IYTA 1LKBA 1SGTA 2FXRA 2ULLA 4Y79A 5C5OA 1C5LH 3GCHC 1SGYE 4MNWA 1D9IA 1C2IA 1J15A 3GY8A 7LPRA 1GMCG 1FONA 4OS1A 2FODA 1BTXA 2IOTA 1C2LA 2HOBA 2FZZA 2WUBA 1ANDA 2VB0A 1C9TA 2GZ8A 4ZMAH 3SZNA 4YLQH 1GHZA 1AY6H 3GCOA 3QZQA 1P0SH 4DY7B 1P2NA 1GMCF 2C8YB 2OBQA 4CRBA 1A46H 3DT0H 1C9PA 1OS8A 3PTNA 5DK1A 3LJJA 3EA9A 1BMNH 2V0BA 4NCYA 1O2MA 1TA2A 3NPSA 5EXLA 2BDHA 3M7UA 1DLKB 1WAYB 3EQ0H 1T8NA 1UCYK 3EGKH 3RP2A 4GHTA 3TH3H 3VXEH 5C2ZA 5TJXA 3RLYH 1GJBB 1BITA 1XUIA 4A5TS 3MO6A 1NU7B 2QYIA 4NWKA 3M3SA 4OS4A 1AVGH 3I78A 4KKDA 4IGDA 4I31A 1PQ5A 7GCHG 3LGWA 3I29A 1F0SA 2ZDMA 2IJOB 1IQMA 1VCQA 3KIDU 5CHAB 4NIWA 2CGAA 4DOQA 1W0ZU 4DW2U 3ATWA 1C5OH 1O3KA 1CHGA 3BTKE 1Z6EA 1O2GH 2XCNA 2BDYA 1SPJA 1A5HA 1ANEA 1WQSA 1EAWA 2ZKSA 1C5TA 4ZXYH 1NRSH 1NRRH 4OGYA 1QHRB 3SNDA 4YM9A 5J4QA 2RG3A 2PV9B 4I8HA 1TA6A 1P2QA 3KQEA 1THSH 3DFLA 3DA9B 2VVUA 1YLCA 2FTMA 1SGDE 1ESAA 1S6FA 2WINI 3BEIB 5LPFA 3M36A 3UR9A 3UFAA 1C1NA 4U01A 1FAXA 3LONA 5FPTA 1XUGA 2UWPA 3DD2H 3SGBE 1QB1A 3BTFE 1ZJDA 5GPIB 3SGQE 2GV6A 1C2HA 1P9SA 2D8WA 2V3OH 2TIOA 4KP0A 2B7DH 4ZKOU 2ZGJA 1HB0B 1HGTH 3TGJE 1RXPA 1MMJN 1BJVA 1GHAG 1V2VT 4K1TA 1ARCA 3P8OA 3D62A 1P8VC 1XX9A 2AERH 1RGQA 4QT8C 2FOHA 2UUKB 2J4IA 1G3EA 1GHAF 1OWKA 3RU4D 4A92A 2ODQA 1O3BA 5BPEA 3T27A 2A45B 4YLUA 5TCAA 3K6YA 4I7YH 1TALA 4D9RA 2W5EA 1BTHH 3UNRA 5PTPA 3PWCA 1G2MA 2BXUH 3RXMA 4JZIA 4X8TH 2Z9JA 4K2YA 2CF8H 1OWHA 4E7NA 1ANCA 4FUFA 1ELVA 1KIGH 3A86A 3A88A 1CO7E 3JZ2B 3F6UH 4GCHG 1B0FA 2XBXA 3ZVBA 1LVBA 4B76A 4NGAH 1F7ZA 1C5QA 3LIWA 3V7TA 3A8BA 2Z3CA 3H5CB 5FXLA 2W26A 2VWNA 1QL8A 3A87A 3AAUA 2GX4A 2PLXA 5DP8A 3ODDA 3RLWH 1N1LA 3TJOA 1LPGB 3M5NA 1P05A 4GCHF 5L2YH 1YGCH 1O2LA 5DG6A 4CHAB 4K3JA 1MKWK 1C2JA 1NO9H 3F9FA 4OS5A 1BMAA 1C1PA 1DUEA 4TWWA 3QTVH 2SGFE 1W13U 3ZZ4A 1DSUA 1WQVH 1XMNB 4B2AA 2FI3E 2ZA5A 4Z0KA 4CRDA 3NKKA 3LJOA 1F0RA 4TWYA 2VJ1A 2QY0B 3MO3A 4AN7A 4Y7BA 1O3PB 1ZMNA 2ZP0H 4AYYB 5EPNA 2PFEA 3SOSA 3HKJB 2VIDA 1GG6C 2ANKH 2F3CE 4WJG2 3PYHA 1KLTA 3VGCB 2ZDLA 3C1KA 2OLGA 1QB9A 2QAAA 4UFFH 6ESTA 5EGMA 1O3FA 2QC2A 2LNCA 5C20A 4B2CA 1PPGE 3E3TA 1B7XB 2BMGB 3GCTG 4UFGH 1GHWH 1QQ4A 3TJVA 2GCTB 1HAPH 1BBRE 4O9VA 1UO6A 1XUJA 4ZKNU 5EOKA 1FPCH 1L0ZA 4DJZB 3GCTF 5L6NH 3TVJB 4B71A 1C1UH 1GHXH 3U1JB 2W7UA 3KL6A 2FWWA 1DANH 3HK6B 2EI6A 1AU8A 5F8TA 6CHAB 1YPGH 4RSPA 1C1WH 4VGCB 1OOKB 2FOBA 1O2UA 3SI3H 2O8LA 5L2ZH 3RMLH 1MD8A 3M5MA 3SORA 1BB0B 2VWMA 1GDNA 2XYAA 3LGUA 4K8YA 1O3NA 3M5LA 1GJ7B 2ODYB 2A2XH 1W7GH 2PGBB 1ACBE 1HNEE 1QBNA 1SQAA 8GCHG 4JYVH 2F9VA 3H7TA 1ZHMA 4NA7A 4ZHLU 1G3CA 1S85A 1VR1H 1GVKB 2BDAA 2FOCA 1U6QA 2PKSC 1Y59T 2ODPA 5FCKA 2R9PA 3PMBB 1GI7B 2SGEE 3KNXA 4FUCA 2XBVA 2AIQA 2ZDAH 2ZQ2A 3RU4E 8GCHF 1BMLA 4GAWA 3RXOA 1O3LA 5E0HA 1K1JA 2UUYA 3GY4A 5F8ZA 3GCHB 1P10A 4I33A 5T6FA 5JYIA 1GI2A 1QJ6B 4A1XA 1AB9C 1JXPA 4BAQB 2BD5A 3SHCH 4ABFA 2HNTC 3SNAA 3MI4A 2B0FA 2J34A 2IN2A 2NU2E 1SSXA 4MG3A 2GDEH 3SV6A 3PO1C 1TRYA 4THNH 1DY9A 1TNHA 3E91A 4A7IB 1LMWB 5C3NA 1Z71A 3PROA 3LDXH 1ZTJA 4Q80A 1KLJH 1IHTH 1TOMH 2QF3A 2H5CA 1NY22 2NWNA 1VCPA 3RXUA 2H6MA 2BDIA 2JH0D 5GDSH 1UTPA 3UUZA 1SC8U 1YKTA 1TPPA 2GMTC 3SW2B 3RXJA 2BB4A 2P59A 2Y7ZA 3SN8A 3LU9B 2DE9A 1LHDH 4WXIA 1O36A 3P8NA 1C4V2 1WYKA 3P70B 4YT6H 3KQDA 1GMDF 1EOLA 1QTFA 2AEIH 3EA7A 5T6DA 5T6GA 4ABHA 1SFIA 1UVSH 3KF2A 2P93A 4CRGA 1UK2A 1DM4B 2VNTA 4AYVB 1CBWC 3K65B 1GDUA 1TBQH 1O2XA 1TGCA 1TABE 1YPMH 1GJ8B 1F92A 1IQLA 3A8CA 3UY9A 1EX3A 2VIOA 1ZHPA 2BD3A 1BJUA 1GCTC 4K1SA 4GSOA 3CP7A 2STBE 3VB6A 1PPFE 1GBAA 3NCLA 3BTME 4INKA 1NRQH 2SFAA 1HAZB 2BDBA 4XDEA 1N6XA 5E0GA 1QURH 1L4ZA 5IDKA 3VEQB 2ZI2H 2W3KA 1K1PA 5DGJA 4FUHA 1T7CA 2ZTYA 5G4BA 3SUGA 3RMMH 5EW1H 1BBRH 1W12U 2YNAA 1Y5AT 2GV7A 3ESTA 1SGEE 2F9BH 3GDUA 3BSQA 1C5SA 2P94A 4BXWA 1ZOMA 4WMDA 1IQIA 2ZPQA 3FZDA 1OWEA 1BCUH 2ZPRA 1BT7A 4ABDA 2ZGHA 1B5GH 1SR5C 1YPHE 5K7RA 3VB3A 1G36A 2ZTXA 1CA0C 1MQ6A 3QTOH 3TK9A 2UWOA 3VXFH 1NM6A 4BTIB 4X6PA 3RXKA 1PYTD 2ANYA 1KDQA 1HUTH 2ZWLH 1C2DA 1P2MA 1MBQA 1J8AA 1BRUP 4WWYA 3Q3KA 4B1TA 1C5WB 2BLQA 1DWCH 3SJOA 3TU7H 1F5LA 2BHGA 2P3FH 1T4VH 2GCHG 2C8WB 4HTCH 3MU0A 1NRPH 3PV4A 8ESTE 3BTDE 1FLEE 1O2WA 4BAKB 1GDQA 1W7XH 3R0FA 3P8FA 1EZXC 3U98H 1DY8A 1V2WT 1LVMA 1O33A 2OD3B 1CE5A 4ZXXH 3FZZA 2PKAA 3ZVCA 5A0CA 4UDWH 2GCHF 2HGTH 4B73A 3SUFA 1DS2E 3UQVA 1O3AA 1O3CA 1UTQA 2Y5FA 2G52A 1ZSJA 1PQ8A 1AQ7A 1IQNA 1TMUH 1UTNA 4H42U 3ZZ5A 3ODFA 1MTNC 2PWXA 3QX5H 5A2MH 5JBTA 5CE1A 1FY4A 1P12E 3SU2A 4YOIA 3PWBA 2STAE 5EXMA 2PGQB 1V2ST 4SGAE 1DDJA 2BOKA 5AFZH 1QJ1B 2P16A 1Q3XA 2HWLB 2Z9IA 2ZFFH 4MPXA 4BNRA 1UTJA 2VIQA 2FOAA 4FUGA 1O31A 4WH8A 4JYTA 4D8NA 3RUOA 2G81E 1SQOA 2ZU2A 1GG6B 1O3OA 1KXEA 1YCPM 2F9NA 3RXHA 3N7OA 1D3TB 2XTTB 3TITA 2I6QA 1HIAB 1KDQB 2ZCHP 1ELGA 4B75A 1ZGIA 2BD2A 5AVDA 2NU4E 2TBSA 2WPJS 5GJ4B 3SJKA 1SMFE 1OX1A 4JCNA 1YPEH 1QRWA 2WYGA 4WVPE 1ZSKA 4X0WU 1Y3XA 4U2WA 1HCGA 1A0JA 2AMQA 4MNYA 1PQ7A 3PLBA 5C1YA 1QFKH 2BD8A 2RDLA 3IWMA 3RXFA 2O8MA 1MAYA 2ZQ1A 1TQ0B 3ZYEA 2CF9H 1F5KU 1K1NA 2BY8X 4DCDA 1QJ7B 1FY3A 1CQQA 1L1JA 1O2RA 3M7TA 1GVLA 1KXDA 5HXFA 2SGQE 1LVYA 2ZHQH 2FI4E 5EPYA 1ID5H 2M5TA 4CH2B 1GBCA 4UE7H 3RM0H 3P17H 3T25A 1W11U 2BY6X 1QNJA 1PFXC 2ZDVH 3UREA 4Y11E 2GP9B 1ZMLA 1DOJA 1BTPA 4NZQA 5EU8A 1TPOA 1G30B 1GHVH 4RKJB 1A4WH 1N8OC 5EODA 2GVFA 2TGTA 5JBBS 1GWAA 1IAUA 3MO9A 2Z3EA 4KELA 2Z94A 1EZQA 4Y6DA 4NA9H 2PKSB 1YYY1 2QGRA 3ATIA 2ZHEH 4FVBA 3NZIA 1GBLA 1L2EA 1GBMA 1P04A 1LPZB 1A5IA 1Z1JA 1XUFA 1CT0E 3S9BA 1TNIA 1Y5UT 5C5NA 1GMHG 3KN2A 3M5OA 4CRAA 3PB1E 3TGIE 1UTKA 3MU5A 4UONA 4XOJA 5I25A 1EJAA 1BRBE 3PMHB 4ZKRU 1C1MA 2V35A 5ETXA 1O5AB 2A32A 1MZAA 1XVMA 1MTWA 4PROA 1FQ3A 1GMHF 3RXQA 3RXCA 4WY3A 2BXTH 5FBEA 3PO1B 2JH6D 1ANBA 1E38B 3Q77A 3QZRA 3E8LA 5HM9A 2IPHA 2AGEX 1TPSA 4I8LA 4XBDA 2A4OA 3LC3A 2A31A 3LOXA 1S0RA 1BOQA 2A5AA 1XM1A 2WV5A 1SG8B 4JZFH 1HYLA 3A80A 4YT7H 2PR3A 2C3SA 3TIUA 4CH8B 1QB6A 2YOLA 2HVXA 5DJ7A 1E37B 2BQ7B 5HYOA 2R0LA 2ZU3A 3T62A 2GMTB 1H9HE 1XUHA 2KAIA 1K9OE 3KEEA 1G3DA 1Z6JH 1ZTKA 4D9QA 3VB5A 2H9TH 1QA0A 1UK4A 3SHAH 3VPKA 1TRMA 3RXVA 3SU3A 3ATLA 1ABIH 2GD4B 1AWFH 1DSTA 2PSXA 1G37A 1GJ5H 3P8GA 1THRH 1WCZA 3RXRA 2XNIA 2A7HA 2OC8A 5AHGH 3ZZ7A 4K8BA 4MPVA 3P92A 1CBWB 1P3CA 1ZHRA 1K1OA 1KXBA 2WPIS 1LPKB 2AH4X 3VB7A 5HM2A 1YBWA 4NA8A 1ZSLA 1CVWH 1AVXA 1FJSA 1J9CH 2B8OH 1GCTB 4UEHH 1TB6H 1QA7A 4AFUA 2QF0A 1V2TT 2FOMB 1YM0A 1GBFA 4JMYA 3RDZA 1JRSA 1Y3VA 5FHTA 1W8BH 3E90B 1TNLA 2ASUB 3RM2H 4MTBA 5E2PA 2ZF0H 3BTEE 1Y3WA 3PLPA 1FN6A 3ZZDA 2F9OA 4OGXA 3TGKE 2F91A 1PPEE 2NU0E 3TH2H 5E2OA 1GI0A 5LPEA 1RIWC 2D2DA 1DICA 3MNBA 3ZYDA 1BUIA 1C5UA 1ETRH 1NFUA 4MVNA 7ESTE 3MNXA 2JETC 2KAIB 1FY8E 3SU6A 1O5DH 1AUTC 1KSNA 4MPWA 3NUMA 2XCFA 4X2YA 1EZUC 1XVOA 1YPKH 4IBLH 2J9NA 1HBTH 2H9HA 3LGYA 1EPTC 1FXYA 4HI3A 1FAKH 3SJ9A 1ETTH 1MKXH 2ALVA 3SV2H 1Y3YA 3UNSA 5LGOA 3K2UA 1DXWA 3S0NA 2FLRH 1OP8A 4ABIA 1BA8B 5HGGA 2XW9A 1GL0E 4K5ZA 1O2VA 4AB9A 1GHBG 2FI5E 3FVFB 4I32A 3RC4A 3A8AA 2CMYA 2FS8A 1BBRK 1AFEH 2BD9A 3HK3B 2W3IA 1CU1A 4DGJA 2FLBH 3ZVDA 3L3TA 3UWJH 1O38A 1HJAC 4WMEA 3HGNA 4CRCA 2BVXH 1FY1A 4OS6A 1GHBF 3A85A 3S9AA 3MOCA 4X6NA 3LKWA 5GIBA 1O39A 3QN7A 2K1QA 1D3DB 4AGJA 1O34A 4MQAA 5F8XA 4ZHMU 4CR5A 3GY3A 3BIUH 1MTNB 3P95A 4ISHH 1SLVB 2A0QB 2VIPA 4UD9H 1C1VH 3SUDA 2OTVA 1MTSA 5FPSA 4FUDA 4AGKA 3TNTA 1NFYA 2SGPE 2V3HH 3O8CA 1P9UA 3T5FH 1Z8GA 5J4SA 4GLYA 1GJCB 1EAXA 1E34B 1EASA 1FIZA 2O8TA 2R2WU 2GKVE 3U8RH 4TPIZ 3RMOH 1T4UH 3EDXB 2Y81A 1K1LA 3A84A 1ELFA 1QGFA 2Z7FE 4X1RU 1HAVA 1O32A 1O2OA 2B9LA 2ZFQH 1EJMA 1FIWA 1TFXA 1RRKA 4OS2A 4K69A 2VGCB 1ZMJA 1V3XA 3ITIA 2FS9A 3V12A 1UHBA 3IG6B 3EAJA 1C5VA 3OY6U 2P3UB 2BD4A 1O3HA 1SGIB 1QR3E 2NU1E 1C2FA 1UVTH 1CT2E 2SGDE 1NT1A 2A5IA 3BV9B 1RTFB 2HRVA 5A0BA 4FUEA 1NS3A 1O2NA 3RXEA 1YPLH 3GYLB 3L6PA 3ZZ6A 4BTTB 2AGIX 2BYAX 3HGPA 1IHSH 4ZH8A 4CREA 3OY5U 4M7GA 1UTLM 3KQCA 3KHVA 2FM2A 2BZ6H 1SL3A 4DVAU 4AFZA 1O3JA 1EP6A 1A61H 3FANA 1AN1E 1GBDA 1ZPBA 1N8OB 4AG2A 2XC4A 3SV7A 1C1SA 4AX9H 1DLEA 2ZNKH 1AGJA 1BRCE 1HAIH 1WSSH 3I77A 1SLWB 1BHXB 4IN1A 3MTYA 2UUJB 4WF8A 4UFDH 1C2EA 5C1UA 1BIOA 2FOGA 1S6HA 3ZVAA 1A1RA 2H2ZA 1ZTLA 1A2CH 2GTBA 1UTOA 2ZU1A 1O3EA 4JK5A 4X1SU 4ZHAA 1KY9A 2F9UA 2AGGX 1HAVB 2OC1A 1O2KA 1RFNA 3NK8A 3FP8E 3HATH 4INHA 1DVAH 2WPHS 4TYDA 2Y5GA 3RXGA 1FI8A 1GMDG 1Z1IA 1NN6A 1W3CA 1CT4E 2VH0A 2Y5HA 1GBKA 1IQEA 1KXCA 3MNSA 4NIYA 2R3YA 1SHYA 1XXDA 2CV3A 4TY7A 4IC5A 2H5DA 2QCYA 3D23A 1C5XB 1EQ9A 1CA8B 3RXBA 4Y0YE 2XWBI 3KGPA 2A7JA 3ENSB 1GHYH 5ESBA 3BTGE 4D76A 2UUFB 3RXIA 4ABJA 1H8IH 4I8JA 4JZ1A 4Y7AA 4AZ2B 3SJIA 3WY8A 1BTZA 2Z9GA 1V2LT 3MH7A 2EEKA 1W0YH 2ESTE 1HAYB 5EQSA 3B23B 1MU6B 1MD7A 3VB4A 1QRXA 1Q2WA 2A7CA 4JZDH 1GBHA 1VZQH 7KMEH 3DHKH 4O03A 2QXJA 1IQGA 2ZIQH 4BXSA 4FU8A 4YTAA 3ATKA 5ESTE 1P01A 1D6WA 1EPTA 5DPAA 4Q7YA 1SQTA 3L33A 3QK1A 3ZZCA 1INCA 4A1TA 1SGFG 3E6PH 3JZ1B 3F9GA 1G3BA 1GJDB 1TMBH 2GT7A 5DKMA 3KQBA 1V2OT 1ESTA 5GCHF 2G8TA 3FFGA 2QV1A 1SGNE 1KTTB 2BDGA 1ZYOA 1ZJKA 4R8TB 4ZAEA 3RC6A 2AMDA 1RJXB 5DP5A 3T28A 2UWLA 2XBYA 1C5MD 5F03A 2WPKS 1TAWA 5FX6A 1F5RA 3MH6A 2Y7XA 1G2LA 2EC9H 4BANB 4TPYA 4E06H 1O2SA 3TPIZ 3Q76A 2VWOA 2VU8E 3NWUA 1TQ7B 1Z7KA 3OSYA 4A1VA 4ABEA 2W7SA 3Q00A 4CR9A 1SGRE 1DXPA 4AFQA 1TX6A 1BTWA 2BY5X 2CN0H 3RXDA 1GI5A 5FCRA 2Y6TA 2TRMA 2G4UA 3T26A 2QXGA 4A6LA 2JETB 4WH6A 1H9LB 4E7RG 3DFJA 3LT3A 4F4OC 3V13A 4DIHH 2XC0A 3CS0A 3PLKA 3SJ8A 1ORFA 3A7YA 4CHAC 2A4RA 1A0LA 1ZZZA 1EPTB 1MH0A 3A82A 4OS7A 4DT7B 4KTSA 3U8TH 3W95A 9LPRA 2QXIA 1PQAA 3BIVH 4FU7A 2THFB 4CBOA 1FY5A 1MQ5A 3M35A 3ZZ3A 2HPPH 3ZZBA 4BAOB 3BG8A 2F83A 4Y8ZA 1THPB 3TK6A 1Z8IB 4MNXA 1MAXA 1PJPA 2ZU4A 1O5FH 4Q2KA 2XRCA 1GJ6A 2OXSA 3U1IB 4B2BA 2QIQA 1NRNH 1EJNA 3EE0B 2G00A 1HRTH 1A0HB 3F68H 2LPRA 1O2JA 1TMTH 5DP3A 1A3EH 1LHGH 3A83A 3LGTA 5A8ZA 1UVPA 3SI4H 1HJAB 4U32A 3SGAE 1F0TA 2FIRH 2ZC9H 1OPHB 1AWHB 4JK6A 1GL1A 3O8DA 1O3IA 2FYQA 4JZEH 2G5VA 4UFEH 1E0FD 1O5CB 1SGQE 3A81A 2AS9A 2RCEA 2ZHFH 2FDAA 2GGVB 3E16B 2R3UA 1MKXK 2GZ7A 2QN5T 4I8KA 4Q7ZA 3BTQE 2C4FH 4NWLA 1FPHH 2PUQH 3Q3YA 1QL9A 3RC5A 5A0AE 3TLOA 4RKOB 1LKAA 2DE8A 5TCCA 2FP7B 3A7VA 3SO3A 1JMOH 2TGPZ 3LH1A 1KXAA 1V2RT 2HNTF 3D49H 1AFQC 1JBUH 3BTWE 2PKAB 1UMAH 2WPLS 1V2UT 1W14U 3SNCA 2BX4A 4Y8YA 1J17T 1OWDA 2DUCA 2ZG0H 3MNCA 4FUIA 3E0NB 1O5BB 1SBWA 3AASA 1HXEH 2BVRH 3EYDA 3HKIB 1TE0A 1EB2A 2Z9KA 3UNQA 1QBOA 5AFYH 5A8XA 1WTHD 3O8RA 4R0IA 2G51A 1LCYA 2BLWA 5JDUB 5EXNA 1DPOA 2ZFPH 4ISNA 5BRRE 3HPTB 3NXPA 3BTHE 2BD7A 4HZHA 3QGNB 3RXSA 1SOZA 1C2MA 1WTGH 3GOVB 2O8WA 1ELBA 1F2SE 2AFQB 1EXFA 4BOHA 1H4WA 1AVWA 1C5RA 1YP9A 1AO5A 2A2QH 1RD3B 5DP9A 4H6TA 1G32B 4HGCA 2ZGCA 3KCGH 4WMFA 2RA3A 1TGSZ 3MU1A 1MBMA 3SV9A 1O0DH 1MTUA 1JIMA 1FNIA 1O2IA 2G55A 4FUBA 2C8ZB 2ZCLP 1AB9B 4DG4A 5GWZA 1GBEA 2P8OC 3ATMA 4X6MA 1VJ9U 1GJ4H 1L1GA 2Y82A 2A4QA 1ELDE 1SGPE 5GXPA 1AHTH 1SHHB 1HDTH 1ZGVA 3M37A 2D26C 3GCNA 3LGIA 4KTCA 1P2OA 1LTOA 4AOQA 2BTCE 3MFJA 4X1NU 1TNKA 1GI8B 1GJ9B 3URCA 2FOFA 3LGVA 2ZGBH 2ZHDA 5A09A 1TIOA 4J2YB 4CRFA 2HNTE 1DE7H 4D7FA 5E8EH 2QA9E 1YCPK 3ZZAA 2BVSH 1NROH 1P11E 2FPZA 4X8VH 1EAIA 3STJA 3URDA 1AMHA 1Z8JB 3A8DA 5L30H 4GVUA 3S9CA 7GCHF 1D6RA 3ZZ8A 4IMQA 5C67A 2VIVA 2BX3A 4O97A 1UCYE 1C4Y2 3PM3A 2ZGXH 2J95A 1ZR0A 1SLXB 1ELCA 3SNEA 1OWJA 1SB1H 2P95A 3GY5A 1FDPA 1AUJA 2F9PA 3ZVFA 1J16A 1PPBH 2FYRA 1HAHH 3OU0A 4AFSA 1NESE 3TH4H 2J92A 2YNBA 4NG9H 4ISLA 1BDAA 1J14A 1H8DH 1ARBA 2I6SA 4CBNA 3D65E 5F6MA 1YPHC 1LQEA 1GI6A 1GBBA 1NPMA 3SU0A 4XBCA 2FX6A 3UQOA 4FXGH 2FEQH 1NZQH 2OQ5A 2OINA 1Y5BT 2BLOA 1C4U2 1D4PB 5H4IB 5CMXH 5C1XA 1W10U 1K1MA 1UTMA 3A7WA 4B74A 1YLDA 1BTYA 1QQUA 2Z9LA 5EG4A 4F49A 1O2YA 1ESBA 2FTLE 3BN9A 1GCDA 3RXAA 5ABWA 1EB1H 3M3TA 2ZU5A 4GUXA 1LHEH 1TBZH 3ELAH 2VIWA 3F9EA 5FBIA 2GZ9A 2G4TA 1L4DA 2OBOA 2CHAC 1TOCB 1GBTA 1CA0B 1OYQA 1QBVH 3PMAB 3RXPA 2O9QA 1WOFA 1YC0A 2CJIA 1C2KA 1TX8A 3GISB 2PHBA 1XUKA 1T8MA 2FESH 1VGCC 5EQRA 1KLIH 2AMPA 3BEUA 2ZO3H 3UPEA 2OQUA 1C1TA 4ABAA 2AIPA 4X2WA 2PUXB 2VVVA 2BQWB 1TNJA 2EI8A 3H7OA 2HLCA 3UOUA 1GPZA 1AIXH 1VITG 1KYNA 3S7KB 1F0UA 1ELEE 1EP5A 1MUEB 5JPMH 1BQYA 4FU9A 1LVOA 1A3BH 2Q6DA 1UVUH 3LPRA 2BDCA 2PSYA 4O3TA 2JH5D 1S5SA 3SU1A 1VITF 1JWTA 3BG4C 1OXGA 3MHWU 4Y10E 5DO4H 1O2ZA 1QCPA 1GBIA 4YOGA 3LH3A 4H6SB 1GI3A 1EKBB 1TWXB 1CGIE 4ISOA 1GI1A 1T8LA 4NIXA 1RTLA 1QY6A 2NU3E 1KTSB 1V6DA 2D1JA 4NZLA 1S84A 1V2JT 4MLFB 4LZ4B 3V3MA 1MTVA 1OSSA 3CS7A 4X2XA 1K22H 1AD8H 2G5NA 3FP7E 3ZVEA 1TYNA 3SUEA 4D7GA 1O3DA 2TPIZ 4NSYA 4AG1A 1SLUB 3BTTE 1TNGA 1NFWA 4ZUHA 1C5ZB 1WUNH 4YOJA 2C8XB 3BF6H 5K0HA 1MU8B 1ZRKA 4YZUA 1RS0A 4LXBH 4Y8XA 4KGAA 1BHXF 1IQFA 3GYMA 1UJ1A 3GY7A 1C5NH 3RXLA 4LZ1H 1QRZA 3K6ZA 4Z6AH 2HALA 1BMMH 3U69H 1P03A 1DFPA 1DT2A 2H1UA 3EA8A 1GGDC 1P2KA 3UR6A 3AVZA 1O2QA 1C5YB 3OYPA 3STIA 4I8GA 1S81A 2ALPA 3B9FH 3QWCH 1NU9A 3QO6A 5JB9S 1V2NT 2C93B 1UCYH 1HFDA 1Y8TA 1O37A 1AE5A 1HLTH 4WXVA 1FV9A 1NC6A 3ZV9A 1NTPA 2C90B 3VFEA 1PYTC 1AFQB 3SQEE 1C1OA 3RMNH 3ZZ9A 1ABJH 1BTUA 1IQJA 3C27B 1EATA 1C1QA 1O2TA 1YCPH 1HAGE 2ZEBA 3O8BA 5DP4A 1EAUA 3LC5A 1TRNA 1IQHA 4ESTE 1K28D 4IMZA 4DURA 4FVDA 5FPYA 1S0QA 1NFXA 1TX7A 4MPUA 5JBCS 3UTUH 1LDTT 3CENA 2XWAA 1DUAA 1SGCA 1O2PA 2ZTZA
chains in the Genus database with same CATH superfamily
3GY6A 1P57B 2CXVA 5T3HA 3IITA 4NFFA 1E35B 1S82A 1DWEH 1CGJE 2VH6A 5CHBA 5C0UA 1O5EH 6LPRA 3AW1A 1VCWA 3SYJA 1N6YA 2JKHA 4BAHB 2RA0A 3SU4A 2WSSD 2ANWA 1DITH 1T8OA 3F9HA 3RXTA 1GI9B 2GT8A 1MABB 2PTNA 3AAVA 1O2HA 1V2QT 2OC0A 2RDEA 4AORA 4Y76A 2TGDA 5LPRA 3V0XA 1HAXB 1SVPA 3QUMP 3MH5A 8KME2 1TGBA 5CHAC 5FX5A 4INLA 1AKSA 3A7TA 3S69A 1UHBB 2P8OB 1DWBH 1JIRA 1ZLRA 1E36B 4XE4A 1MCTA 1WU1A 1D3QB 1PPHE 4SGBE 1SKYE 1VJAU 4O3UA 3SNBA 1DWDH 3P6ZB 2J94A 3RU4T 2BZAA 2VWLA 3QGJA 4FUJA 3SBKA 1OP2A 4X8UH 3UAIC 1GJAB 3MMGA 2O8UA 1CSOE 1O3MA 2JJ2D 1O30A 2Q1JA 1AI8H 3M7QA 4K1EA 6GCHG 1XKAC 3A7ZA 4YESB 2BM2A 1FZZA 1GBJA 2XOKD 4Y0ZE 5HMAA 1AZ8A 2BLVA 2OP9A 2XXLA 3E1XB 3QLPH 3FP6E 4GHQA 5EW2H 5I46H 1BZXE 3SQHE 1SOTA 4J1YA 6GCHF 3GDSA 2GDDA 2V6NA 1YLNA 5EQQA 2FX4A 1EUFA 1AZZA 1GI4A 1TPAE 4X1PU 5GCHG 2ZZUH 3MWIU 3GY2A 4BTUB 2SNWA 3TNSA 1S83A 3A7XA 1M9UA 2A5KA 2ZFSA 2Z6BD 4YO9A 3TJNA 5LH8A 3PTBA 3R3GB 3UOPA 1TBRH 2FOEA 4Q7XA 4NSVA 2ANMH 1QL7A 2PTCE 3MU4A 4ZKSU 5JB8S 2BQ6B 1W0JD 1YF4A 3GDVA 2OC7A 2R0KA 1HJ9A 1JRTA 3ZV8A 5KECA 4H4FA 8LPRA 2EI7A 5FL7D 2J2UA 1EZSC 1CHOG 1MKWH 1AKSB 1B0EA 2BY9X 5E0JA 4Q63A 1OP0A 3UIRA 3DSGA 3M61U 1SGFA 5JBAS 1MZDA 5DP6A 2QXHA 2VVCA 2FMJA 1V2PT 1X7AC 1T31A 1TONA 4NIVA 4IS5A 3UWIA 1CHOF 1AE8H 3FAOA 1DX5M 2Z3DA 2WUCA 1W2KH 4FETA 1MCVA 2F4LA 2ZHWH 2WPMS 3OE7D 4ABBA 4X6OA 5B6OA 4E05H 1C1RA 4GPGA 3OX7U 4X2VA 4KTUA 3AW0A 5DP7A 5EJ1A 2TGAA 3T2NA 1P02A 1O5GH 3U8OH 1H9IE 1P3EA 1RIWB 3K9XB 4RN6A 1ELAA 1O3GA 4XBBA 5A8YA 4X8SH 4IN2A 4ZROA 4BAMB 1HIAA 3M3VA 1PPCE 1A5GH 4IC6A 1V2MT 3WWBA 1CGHA 2CHAB 2J38A 3BEFB 1HXFH 1RTKA 2ZCKP 3U9AH 1A7SA 1C5PA 2SGAA 2OUAA 3OTJE 2ZPSA 2AYWA 2HPQH 3B8JA 1FMGA 1VGCB 5FAHA 3ZVGA 1QIXB 1VITH 2ZECA 5SGAE 1P06A 5KGOA 1WV7H 1P2IA 2WV4A 2VINA 3TK5A 2R2MB 1C2GA 2Q6GA 3E0PB 4U30A 3MU8A 1ELTA 3VGCC 1KXFA 1GVZA 2EA3A 1IQKA 1TGNA 3MH4A 1OWIA 1Z8RA 2H9EH 1T32A 1Y3UA 3GICB 2ZDNA 2XBWA 1ZRBA 1XXFA 1LQDB 1TLDA 2GCTC 3A89A 3BG4B 4K60A 1P2JA 1K2I1 2B5TB 3U28C 3SU5A 1IOEA 1HV7A 2A1DB 3SV8A 2PW8H 3S7HB 1G9IE 1JOUB 1XKBC 2FO9A 4XFQA 1HPGA 4IW4E 1P09A 4Y71A 2BY7X 2Y80A 4TY6A 1OKXA 2V3MA 1H1BA 2A4GA 2ZFRH 1ETSH 4ISIH 6CHAC 1HAOH 3QDZB 1TGTA 1PPZA 4X1QU 1L1NA 4VGCC 1LO6A 2Q6FA 5AF9H 9ESTA 2XC5A 2VGCC 1SI5H 1Q31A 1OYTH 4LOYH 1UVOA 1EOJA 1ZPCA 3F1SB 1FUJA 1O35A 4MDSA 3Q3XA 1WBGB 2P3TB 3DUXH 1UK3A 1V2KT 1BRAA 1ZPZA 4ASHA 2BOHB 2SNVA 4ABGA 1LHCH 4NFEA 1K21H 2WYJA 4DIIH 1GGDB 3G01A 1FN8A 2ZFTA 3PMJA 2ILNA 1SFQB 1LHFH 4XSKU 1D3PB 3T29A 2YMSB 1YPJH 3W94A 1K1IA 3TJUA 2J97A 4MNVA 2ZDKA 3MYWA 4JYUH 4HFPB 4LK4A 1HJ8A 4AB8A 2OCVB 2KM0A 5IYTA 1LKBA 1SGTA 2FXRA 2ULLA 4Y79A 5C5OA 1NBMD 1C5LH 3GCHC 1SGYE 4MNWA 1D9IA 3H09A 1C2IA 1J15A 3GY8A 7LPRA 1GMCG 3F0PA 1FONA 4OS1A 2FODA 1BTXA 2IOTA 1C2LA 2HOBA 2FZZA 2WUBA 2WHXA 1ANDA 2VB0A 1C9TA 2GZ8A 4ZMAH 3SZNA 4YLQH 1GHZA 1AY6H 3GCOA 3QZQA 1P0SH 4DY7B 1P2NA 1GMCF 2C8YB 2OBQA 4CRBA 1A46H 3DT0H 1C9PA 1OS8A 3PTNA 5DK1A 2JIZD 3LJJA 3EA9A 1BMNH 3OAAD 2V0BA 4NCYA 1O2MA 1TA2A 2KR7A 3NPSA 5EXLA 2BDHA 3M7UA 1DLKB 1WAYB 3EQ0H 1T8NA 1UCYK 1FX0B 3EGKH 2EY4C 3RP2A 4GHTA 3TH3H 3VXEH 5C2ZA 5TJXA 3RLYH 1GJBB 1BITA 1XUIA 4A5TS 3MO6A 1NU7B 2QYIA 4NWKA 3M3SA 4OS4A 1AVGH 2W6ID 2L6OA 3I78A 4IGDA 4I31A 1PQ5A 4KKDA 7GCHG 3LGWA 3I29A 1F0SA 2ZDMA 2IJOB 1IQMA 1VCQA 3KIDU 5CHAB 4NIWA 2CGAA 4DOQA 1W0ZU 5EJZA 4DW2U 3ATWA 1C5OH 1O3KA 1CHGA 3BTKE 1Z6EA 1O2GH 2XCNA 2BDYA 1SPJA 3UB0A 2QE7D 1A5HA 1ANEA 1WQSA 1EAWA 2ZKSA 1C5TA 4ZXYH 1NRSH 1NRRH 4OGYA 1YY3A 1QHRB 3SNDA 4YM9A 3N7EA 5J4QA 1UW7A 2RG3A 2PV9B 4I8HA 1TA6A 1P2QA 3KQEA 1THSH 3DFLA 4TT3D 3ZIAD 3DA9B 4B6FA 2VVUA 1YLCA 2K0QA 2FTMA 1SGDE 1ESAA 1S6FA 3F0OA 2WINI 3BEIB 5LPFA 3M36A 3UR9A 3UFAA 1C1NA 4U01A 1FAXA 3LONA 5FPTA 1XUGA 2UWPA 3DD2H 3SGBE 1QB1A 3BTFE 1ZJDA 5GPIB 3SGQE 2GV6A 1C2HA 1P9SA 2D8WA 2V3OH 2TIOA 2XNDD 4KP0A 2B7DH 4ZKOU 2ZGJA 1HB0B 2AHME 1HGTH 3TGJE 1RXPA 1MMJN 1BJVA 1GHAG 1V2VT 4K1TA 1ARCA 3P8OA 3D62A 1P8VC 1XX9A 2AERH 1RGQA 2KZ4A 4QT8C 2FOHA 3OEHD 2UUKB 2J4IA 3VG8A 1G3EA 1GHAF 1OWKA 3RU4D 4A92A 2ODQA 1O3BA 5BPEA 3T27A 2A45B 4YLUA 5TCAA 3K6YA 4I7YH 1TALA 4D9RA 2W5EA 1BTHH 4DT4A 3UNRA 5PTPA 3PWCA 1G2MA 2BXUH 3RXMA 4JZIA 4X8TH 2Z9JA 4K2YA 2CF8H 1OWHA 5KEDA 4E7NA 1ANCA 4FUFA 1ELVA 1KIGH 3A86A 3A88A 1CO7E 3JZ2B 3F6UH 4GCHG 1B0FA 2XBXA 3ZVBA 1LVBA 4B76A 2J5UA 4NGAH 1F7ZA 1C5QA 3LIWA 3V7TA 3A8BA 1W0KD 2Z3CA 3H5CB 5FXLA 2J98B 2W26A 2VWNA 1QL8A 3A87A 3AAUA 2GX4A 2PLXA 5DP8A 3ODDA 3RLWH 1N1LA 3TJOA 1LPGB 3M5NA 1P05A 4GCHF 5L2YH 3GS9A 1YGCH 1O2LA 5DG6A 4CHAB 2F43B 1MKWK 1C2JA 1NO9H 3F9FA 4K3JA 1BMAA 4OS5A 3FO8D 1C1PA 1DUEA 4TWWA 3QTVH 2SGFE 1W13U 3ZZ4A 1DSUA 1WQVH 1XMNB 4B2AA 2FI3E 4M9FA 2ZA5A 3EE7A 4Z0KA 4CRDA 3NKKA 3LJOA 2GJGA 1F0RA 4TWYA 2VJ1A 2QY0B 3MO3A 4AN7A 4Y7BA 1O3PB 1ZMNA 2ZP0H 4AYYB 5EPNA 2PFEA 3SOSA 3HKJB 2VIDA 1GG6C 2ANKH 2F3CE 4WJG2 3PYHA 1KLTA 3VGCB 1WDIA 2ZDLA 3C1KA 2OLGA 1QB9A 2QAAA 4UFFH 2HVYB 6ESTA 5EGMA 1O3FA 2QC2A 2LNCA 5C20A 4B2CA 1PPGE 3E3TA 3DSOA 1B7XB 2BMGB 3GCTG 4UFGH 1GHWH 1QQ4A 3TJVA 2GCTB 1HAPH 1BBRE 4O9VA 1UO6A 1XUJA 4ZKNU 5EOKA 1FPCH 1L0ZA 4ASUD 4DJZB 3GCTF 5L6NH 2KX4A 3TVJB 4B71A 1C1UH 1GHXH 3U1JB 5CDFE 2W7UA 3KL6A 2FWWA 5C94A 1DANH 3HK6B 2EI6A 1AU8A 5F8TA 6CHAB 1YPGH 4RSPA 1C1WH 4VGCB 1OOKB 2FOBA 1O2UA 3SI3H 2O8LA 5L2ZH 3RMLH 1MD8A 3M5MA 3SORA 1BB0B 2VWMA 1GDNA 2XYAA 3LGUA 4K8YA 1O3NA 3M5LA 1GJ7B 2ODYB 2A2XH 1W7GH 2PGBB 1ACBE 1HNEE 1QBNA 1SQAA 8GCHG 4JYVH 2F9VA 3H7TA 4Q4LA 1ZHMA 4NA7A 4ZHLU 1G3CA 1S85A 1VR1H 1GVKB 2BDAA 2FOCA 1U6QA 2PKSC 1Y59T 2ODPA 5FCKA 2R9PA 3PMBB 1GI7B 2SGEE 3KNXA 4FUCA 2XBVA 2AIQA 2ZDAH 2ZQ2A 3RU4E 8GCHF 1BMLA 4GAWA 3RXOA 1O3LA 5E0HA 1K1JA 2UUYA 3GY4A 3DSPA 5F8ZA 3GCHB 1P10A 4I33A 5T6FA 5JYIA 1GI2A 1QJ6B 4A1XA 1AB9C 1JXPA 4BAQB 2BD5A 3SHCH 4ABFA 2IJD1 2HNTC 3SNAA 3MI4A 2B0FA 2J34A 5DSFA 2IN2A 2NU2E 1SSXA 5GNDA 4MG3A 2GDEH 3SV6A 3PO1C 5HIZA 1TRYA 1COWD 4THNH 1DY9A 1TNHA 3E91A 4A7IB 3OTPA 1LMWB 5C3NA 1Z71A 3PROA 3LDXH 1ZTJA 4Q80A 1KLJH 1IHTH 1TOMH 2QF3A 2H5CA 1NY22 2NWNA 1VCPA 3RXUA 2H6MA 2BDIA 2JH0D 3PRBA 5F53A 1UTPA 5GDSH 3UUZA 2EQNA 1SC8U 1YKTA 1TPPA 2GMTC 3SW2B 3RXJA 2BB4A 2P59A 2Y7ZA 3SN8A 3LU9B 2DE9A 1LHDH 4WXIA 1O36A 3P8NA 1C4V2 1WYKA 3P70B 4YT6H 3KQDA 1GMDF 1EOLA 1QTFA 2AEIH 3EA7A 5T6DA 5T6GA 4ABHA 5C0TA 1SFIA 1UVSH 3KF2A 2P93A 4CRGA 1UK2A 1DM4B 2VNTA 4AYVB 1CBWC 3K65B 1GDUA 1TBQH 1O2XA 1TGCA 4RT0A 1TABE 1YPMH 1GJ8B 1F92A 1IQLA 3A8CA 3UY9A 1EX3A 2VIOA 1ZHPA 2BD3A 1BJUA 1GCTC 4K1SA 4GSOA 3CP7A 4P00A 2STBE 3VB6A 1PPFE 1GBAA 3NCLA 3BTME 4INKA 1NRQH 2SFAA 1HAZB 2BDBA 4XDEA 1N6XA 5E0GA 1QURH 1L4ZA 5IDKA 3VEQB 2ZI2H 2W3KA 4B6EA 1K1PA 5DGJA 4FUHA 1T7CA 2ZTYA 5G4BA 3SUGA 3RMMH 5EW1H 1BBRH 1W12U 2YNAA 1Y5AT 2GV7A 3ESTA 1SGEE 2F9BH 3GDUA 3BSQA 1C5SA 2P94A 4BXWA 1ZOMA 4WMDA 1IQIA 5IK2D 2ZPQA 3FZDA 1OWEA 2YMSD 1BCUH 2ZPRA 1BT7A 4ABDA 2ZGHA 1B5GH 1SR5C 1YPHE 5K7RA 3VB3A 1G36A 2ZTXA 1CA0C 1MQ6A 3QTOH 3TK9A 2UWOA 3VXFH 1NM6A 4BTIB 4X6PA 3RXKA 1PYTD 2ANYA 1KDQA 1YWUA 1HUTH 2ZWLH 1C2DA 1P2MA 1MBQA 1J8AA 4FOUC 1BRUP 4WWYA 3Q3KA 4B1TA 1C5WB 2BLQA 1DWCH 3SJOA 3TU7H 1F5LA 2BHGA 2P3FH 1T4VH 2GCHG 2C8WB 4HTCH 3MU0A 1NRPH 3PV4A 8ESTE 3BTDE 1OHHD 1FLEE 1O2WA 4BAKB 1GDQA 1W7XH 3R0FA 3P8FA 1EZXC 3U98H 1DY8A 4P02A 3WW7A 1V2WT 1LVMA 1O33A 2OD3B 1CE5A 4ZXXH 3FZZA 2PKAA 3ZVCA 5A0CA 2LP6A 4UDWH 2GCHF 2HGTH 4B73A 3SUFA 2HLDD 1DS2E 3UQVA 1O3AA 1O3CA 1UTQA 2Y5FA 2G52A 1ZSJA 2WPDD 1PQ8A 1AQ7A 1IQNA 1TMUH 1UTNA 3CNRA 4H42U 3ZZ5A 3ODFA 1MTNC 2PWXA 3QX5H 5A2MH 5JBTA 5CE1A 1FY4A 1P12E 3SU2A 4YOIA 3PWBA 2STAE 5EXMA 2PGQB 1V2ST 2CK3D 4SGAE 1DDJA 2BOKA 5AFZH 1QJ1B 2P16A 1Q3XA 2HWLB 2Z9IA 2ZFFH 4MPXA 4BNRA 1UTJA 2VIQA 2FOAA 4FUGA 1O31A 4WH8A 4JYTA 4D8NA 3RUOA 2G81E 1SQOA 2ZU2A 1GG6B 1O3OA 5B6LA 1KXEA 1YCPM 2F9NA 3RXHA 3N7OA 1D3TB 2XTTB 3TITA 2I6QA 1HIAB 1KDQB 2ZCHP 1ELGA 4B75A 1ZGIA 2BD2A 5AVDA 5C17A 2NU4E 2TBSA 2WPJS 5GJ4B 3SJKA 1SMFE 1OX1A 4JCNA 1YPEH 1QRWA 2WYGA 4WVPE 1ZSKA 4X0WU 1Y3XA 4U2WA 1HCGA 1A0JA 2AMQA 4MNYA 1PQ7A 3PLBA 5C1YA 1QFKH 2BD8A 2RDLA 3IWMA 3RXFA 2O8MA 1MAYA 2ZQ1A 1TQ0B 3ZYEA 2CF9H 1F5KU 2WZQA 1K1NA 2BY8X 4DCDA 1QJ7B 1FY3A 1CQQA 1L1JA 1O2RA 3M7TA 1GVLA 1KXDA 5HXFA 4I86A 2SGQE 1LVYA 2ZHQH 2FI4E 5EPYA 1ID5H 2M5TA 4CH2B 1GBCA 4UE7H 3RM0H 3P17H 3T25A 1W11U 2BY6X 1QNJA 1PFXC 2ZDVH 3UREA 4Y11E 2GP9B 1ZMLA 1DOJA 1BTPA 4NZQA 5EU8A 1TPOA 1G30B 1GHVH 4RKJB 1A4WH 1N8OC 5EODA 2GVFA 2TGTA 5JBBS 1GWAA 1IAUA 3MO9A 2Z3EA 4KELA 2Z94A 1EZQA 4Y6DA 4NA9H 2PKSB 1YYY1 2QGRA 3ATIA 2ZHEH 4FVBA 3NZIA 1GBLA 1L2EA 1GBMA 1P04A 1LPZB 1A5IA 1Z1JA 1XUFA 2KFWA 1CT0E 3S9BA 1TNIA 1Y5UT 5C5NA 1GMHG 3KN2A 3M5OA 4CRAA 3PB1E 3TGIE 1UTKA 3MU5A 4UONA 4XOJA 5I25A 1EJAA 1BRBE 3PMHB 4ZKRU 1C1MA 2V35A 5ETXA 1O5AB 2A32A 1MZAA 1XVMA 1MTWA 3WWFA 4PROA 1FQ3A 1GMHF 3RXQA 3RXCA 4WY3A 2BXTH 5FBEA 3PO1B 4RI0A 2JH6D 1ANBA 1E38B 3Q77A 3QZRA 3E8LA 5HM9A 2IPHA 2AGEX 1TPSA 3F2HA 4I8LA 4XBDA 2A4OA 3LC3A 2A31A 3LOXA 1S0RA 1BOQA 2A5AA 1XM1A 2WV5A 1SG8B 4JZFH 1HYLA 3A80A 4YT7H 2PR3A 2C3SA 3TIUA 4CH8B 1QB6A 2YOLA 2HVXA 4RT1A 5DJ7A 1E37B 2BQ7B 5HYOA 2R0LA 2ZU3A 3T62A 2GMTB 1H9HE 1XUHA 2KAIA 1K9OE 3KEEA 1G3DA 1Z6JH 1ZTKA 4D9QA 3VB5A 2H9TH 1QA0A 1UK4A 3SHAH 3VPKA 1TRMA 2IPQX 3RXVA 3SU3A 3ATLA 1ABIH 2GD4B 1AWFH 1DSTA 2PSXA 1G37A 1GJ5H 3P8GA 1THRH 1WCZA 3RXRA 2XNIA 2A7HA 2OC8A 5AHGH 3ZZ7A 4K8BA 4MPVA 3P92A 1CBWB 1P3CA 1ZHRA 2VBCA 1K1OA 1KXBA 2WPIS 1LPKB 2AH4X 3VB7A 5HM2A 1YBWA 4NA8A 4XRNA 1ZSLA 1CVWH 1AVXA 4F48B 1FJSA 1J9CH 2B8OH 1GCTB 4UEHH 1TB6H 2JDID 1QA7A 4AFUA 2QF0A 1V2TT 2K8IA 2FOMB 1YM0A 1GBFA 4JMYA 3RDZA 1JRSA 5EIYA 1Y3VA 5FHTA 1W8BH 3E90B 1TNLA 2ASUB 3RM2H 4MTBA 5E2PA 1NBME 2ZF0H 3BTEE 1Y3WA 3PLPA 1FN6A 3ZZDA 2F9OA 4OGXA 3TGKE 2F91A 1PPEE 2NU0E 3TH2H 5E2OA 1GI0A 2LELA 5LPEA 1RIWC 2D2DA 1DICA 3MNBA 3ZYDA 1BUIA 1C5UA 1ETRH 1NFUA 4MVNA 7ESTE 3MNXA 2JETC 2KAIB 1FY8E 3SU6A 1O5DH 1AUTC 1KSNA 4MPWA 3NUMA 2XCFA 4X2YA 1EZUC 1XVOA 1YPKH 4IBLH 2J9NA 4ACAA 1HBTH 2H9HA 3NRLA 3LGYA 1EPTC 1FXYA 4HI3A 1FAKH 3SJ9A 1ETTH 1MKXH 2ALVA 3SV2H 1Y3YA 3UNSA 5LGOA 3K2UA 1DXWA 3S0NA 2FLRH 1OP8A 4ABIA 1BA8B 5HGGA 2XW9A 1GL0E 4K5ZA 1O2VA 4AB9A 1GHBG 2FI5E 3FVFB 4I32A 3RC4A 3A8AA 2CMYA 2FS8A 1BBRK 1AFEH 2BD9A 3HK3B 2W3IA 1CU1A 4DGJA 2FLBH 3ZVDA 3L3TA 3UWJH 1O38A 1HJAC 4WMEA 3HGNA 4CRCA 2BVXH 1FY1A 4OS6A 1GHBF 3A85A 3S9AA 3MOCA 4X6NA 3LKWA 5GIBA 1O39A 3QN7A 2K1QA 1D3DB 4AGJA 1O34A 4MQAA 5F8XA 4ZHMU 4CR5A 3GY3A 3BIUH 1MTNB 3P95A 4ISHH 1SLVB 2A0QB 2VIPA 4UD9H 1C1VH 3SUDA 2OTVA 1MTSA 5FPSA 4FUDA 4AGKA 3TNTA 1NFYA 2SGPE 2V3HH 3O8CA 1P9UA 5EJLA 3T5FH 1Z8GA 5J4SA 4GLYA 1GJCB 1EAXA 1E34B 1EASA 1FIZA 2O8TA 2R2WU 2GKVE 3U8RH 3PRDA 4TPIZ 3RMOH 1T4UH 3EDXB 2Y81A 1K1LA 3A84A 1ELFA 1QGFA 2Z7FE 4X1RU 4Z1MD 1HAVA 1O32A 1O2OA 2B9LA 2ZFQH 1EJMA 1FIWA 1TFXA 1RRKA 4OS2A 4K69A 5HKKD 2VGCB 1ZMJA 1V3XA 3ITIA 2FS9A 3V12A 1UHBA 3IG6B 3EAJA 1C5VA 3OY6U 5DN6D 2P3UB 2BD4A 1O3HA 1SGIB 1QR3E 2NU1E 1C2FA 1UVTH 2L74A 1CT2E 2SGDE 1NT1A 2A5IA 1QZ8A 1RTFB 2HRVA 3BV9B 5A0BA 4FUEA 1NS3A 1O2NA 3RXEA 1YPLH 3GYLB 3L6PA 3ZZ6A 4BTTB 2AGIX 2BYAX 3HGPA 1IHSH 4ZH8A 4CREA 3OY5U 4M7GA 1UTLM 3KQCA 3KHVA 2FM2A 2BZ6H 1SL3A 4DVAU 4AFZA 1O3JA 2PP6A 1EP6A 1A61H 3FANA 1AN1E 1GBDA 1ZPBA 1N8OB 4AG2A 2XC4A 4TSFD 3SV7A 1C1SA 4AX9H 1DLEA 2ZNKH 1AGJA 1BRCE 1HAIH 1WSSH 3I77A 1SLWB 1BHXB 4IN1A 3MTYA 2UUJB 4WF8A 4UFDH 1C2EA 5C1UA 1BIOA 2FOGA 3PV5A 1S6HA 3ZVAA 1A1RA 2H2ZA 1ZTLA 1A2CH 2GTBA 1UTOA 2ZU1A 1O3EA 4JK5A 4X1SU 4ZHAA 1KY9A 2F9UA 2AGGX 1HAVB 3AK5A 2OC1A 1O2KA 1RFNA 3NK8A 3FP8E 3HATH 4INHA 1DVAH 2WPHS 4TYDA 2Y5GA 3RXGA 1FI8A 1GMDG 1Z1IA 1NN6A 1W3CA 1CT4E 2VH0A 2Y5HA 1GBKA 1IQEA 1KXCA 3MNSA 4NIYA 2R3YA 1SHYA 1XXDA 2CV3A 4TY7A 4IC5A 2H5DA 2QCYA 3D23A 1C5XB 1EQ9A 1CA8B 3RXBA 4Y0YE 2XWBI 3KGPA 2A7JA 3ENSB 1GHYH 5ESBA 3BTGE 4D76A 2UUFB 3RXIA 4ABJA 1H8IH 4I8JA 4JZ1A 4Y7AA 4AZ2B 3SJIA 3WY8A 1BTZA 2Z9GA 1V2LT 3MH7A 2EEKA 1W0YH 2ESTE 1HAYB 5EQSA 3B23B 1MU6B 1MD7A 3VB4A 1QRXA 1Q2WA 2A7CA 4JZDH 1GBHA 1VKYA 1VZQH 7KMEH 3DHKH 4O03A 2QXJA 1IQGA 2ZIQH 4BXSA 4FU8A 4YTAA 3ATKA 5ESTE 1P01A 1D6WA 1EPTA 5DPAA 4Q7YA 1SQTA 3L33A 3QK1A 3ZZCA 1INCA 3KQ5A 4A1TA 1SGFG 3E6PH 3JZ1B 3F9GA 1G3BA 1GJDB 1TMBH 1KMHB 2GT7A 5DKMA 2RFKC 3KQBA 1V2OT 1ESTA 5GCHF 2G8TA 3FFGA 2QV1A 1SGNE 1KTTB 2BDGA 1ZYOA 1ZJKA 4R8TB 4ZAEA 3RC6A 2AMDA 1RJXB 5DP5A 3T28A 2UWLA 2XBYA 1C5MD 5F03A 2WPKS 1TAWA 5FX6A 1F5RA 3MH6A 2Y7XA 1G2LA 2EC9H 1E1QD 4BANB 4TPYA 4E06H 3F3BA 1O2SA 3TPIZ 3Q76A 2VWOA 1S6LA 2VU8E 3NWUA 1TQ7B 1Z7KA 3OSYA 4A1VA 4ABEA 2W7SA 3Q00A 4CR9A 1SGRE 1DXPA 4AFQA 3W1EA 1TX6A 1BTWA 2BY5X 2CN0H 3RXDA 1GI5A 5FCRA 2Y6TA 2TRMA 2G4UA 3T26A 2QXGA 4A6LA 2JETB 4F55A 4WH6A 1H9LB 4E7RG 3DFJA 3LT3A 4F4OC 3V13A 4DIHH 2XC0A 3CS0A 2M2AA 3PLKA 3SJ8A 1ORFA 3A7YA 4CHAC 2A4RA 1A0LA 1ZZZA 1EPTB 1MH0A 3A82A 4OS7A 4YXWD 4DT7B 4KTSA 3U8TH 3W95A 9LPRA 2QXIA 1PQAA 3BIVH 3F2GA 2THFB 3FN8A 1FY5A 4FU7A 4CBOA 1MQ5A 3M35A 3ZZ3A 2HPPH 3ZZBA 4BAOB 3BG8A 2F83A 4Y8ZA 1THPB 3TK6A 1Z8IB 4MNXA 1MAXA 1PJPA 2ZU4A 1O5FH 4Q2KA 2XRCA 1K0HA 1GJ6A 2OXSA 3U1IB 4B2BA 2QIQA 1NRNH 1EJNA 3EE0B 2G00A 1HRTH 1A0HB 3F68H 2LPRA 1O2JA 1TMTH 5DP3A 1A3EH 1LHGH 3A83A 3SZEA 3LGTA 5A8ZA 2JJ1D 1UVPA 3SI4H 1HJAB 4U32A 3SGAE 1F0TA 2FIRH 2ZC9H 1OPHB 1AWHB 4JK6A 3KYFA 1GL1A 3O8DA 1O3IA 2FYQA 4JZEH 4HG6A 2G5VA 4UFEH 1E0FD 1O5CB 1SGQE 3A81A 4ZCNA 2AS9A 2RCEA 2ZHFH 2FDAA 2KCPA 2GGVB 3E16B 2R3UA 1MKXK 2GZ7A 2QN5T 4I8KA 4Q7ZA 3BTQE 2C4FH 4NWLA 1FPHH 2PUQH 3Q3YA 1QL9A 3RC5A 5A0AE 3TLOA 4RKOB 1LKAA 2DE8A 5TCCA 2FP7B 3A7VA 1E79D 3SO3A 1JMOH 2TGPZ 3LH1A 1KXAA 1V2RT 2HNTF 3D49H 1AFQC 1JBUH 3BTWE 1H8ED 2PKAB 1UMAH 2WPLS 1V2UT 1W14U 3SNCA 2BX4A 4Y8YA 1J17T 1OWDA 2DUCA 3N7DA 2ZG0H 3MNCA 4FUIA 3E0NB 1O5BB 1SBWA 3AASA 1HXEH 2BVRH 3EYDA 3HKIB 1TE0A 1EB2A 2Z9KA 3UNQA 1QBOA 3DCLA 5AFYH 5A8XA 1WTHD 3O8RA 4R0IA 4ACBA 2G51A 1LCYA 2BLWA 5JDUB 5EXNA 1DPOA 2ZFPH 4ISNA 5BRRE 3HPTB 3NXPA 3BTHE 2BD7A 4HZHA 3QGNB 3RXSA 5T1VA 1SOZA 1C2MA 2WV9A 1WTGH 3GOVB 2O8WA 1ELBA 1F2SE 2AFQB 1EXFA 4BOHA 1H4WA 1AVWA 1C5RA 1YP9A 1AO5A 2A2QH 1RD3B 5DP9A 4H6TA 1G32B 4HGCA 2ZGCA 3KCGH 4WMFA 2RA3A 1TGSZ 3MU1A 1MBMA 3SV9A 1O0DH 1MTUA 1JIMA 1FNIA 1O2IA 2G55A 4FUBA 2C8ZB 2ZCLP 1AB9B 4DG4A 5GWZA 1GBEA 2P8OC 3ATMA 3FOAA 1BMFD 4X6MA 1VJ9U 1GJ4H 1L1GA 2Y82A 2A4QA 1ELDE 1SGPE 5GXPA 1AHTH 1SHHB 1HDTH 1ZGVA 3M37A 2D26C 3GCNA 3LGIA 4KTCA 1P2OA 1LTOA 4AOQA 2BTCE 3MFJA 4X1NU 1TNKA 1GI8B 1GJ9B 3URCA 1E1RD 2FOFA 3LGVA 2ZGBH 2ZHDA 5A09A 1TIOA 4J2YB 4CRFA 2HNTE 1DE7H 4D7FA 5E8EH 2QA9E 1YCPK 2OK5A 2BVSH 3ZZAA 1NROH 1P11E 2FPZA 4X8VH 1EAIA 3STJA 3URDA 1AMHA 1Z8JB 3A8DA 5L30H 4GVUA 3S9CA 7GCHF 1D6RA 3ZZ8A 4IMQA 2W6JD 4XD7D 5C67A 2VIVA 2BX3A 4O97A 1UCYE 1C4Y2 3FKSD 3PM3A 2ZGXH 2J95A 1ZR0A 1SLXB 1ELCA 3SNEA 1EFRD 1OWJA 1SB1H 2P95A 3GY5A 1FDPA 1AUJA 2F9PA 3ZVFA 1J16A 3PV2A 1PPBH 2FYRA 2QF4A 1HAHH 3OU0A 4AFSA 1NESE 3TH4H 2QF5A 2J92A 2YNBA 2KCOA 4NG9H 4ISLA 1BDAA 1J14A 1H8DH 1ARBA 2I6SA 2J98A 3D65E 4CBNA 5F6MA 1YPHC 1LQEA 4AC9A 1GI6A 1GBBA 1NPMA 3SU0A 4XBCA 2FX6A 3UQOA 4FXGH 2FEQH 1NZQH 2OINA 2OQ5A 1Y5BT 2BLOA 1C4U2 1D4PB 5H4IB 5CMXH 5C1XA 3MQKC 1W10U 1K1MA 1UTMA 3A7WA 4B74A 1YLDA 1BTYA 1QQUA 2Z9LA 5EG4A 4F49A 1O2YA 1ESBA 2FTLE 3BN9A 1GCDA 3RXAA 3KYGA 5ABWA 1EB1H 3M3TA 2ZU5A 4GUXA 1LHEH 1TBZH 3ELAH 2VIWA 3F9EA 5FBIA 2GZ9A 2G4TA 1L4DA 2OBOA 2CHAC 1TOCB 1GBTA 1CA0B 1OYQA 1QBVH 3PMAB 3RXPA 2O9QA 1WOFA 1YC0A 2CJIA 1C2KA 1TX8A 3GISB 2PHBA 1XUKA 1T8MA 2FESH 1VGCC 2KCYA 5EQRA 1KLIH 2AMPA 3BEUA 2ZO3H 3UPEA 2OQUA 1C1TA 5HIYA 4ABAA 2KCAA 2AIPA 4X2WA 2PUXB 2VVVA 2BQWB 1TNJA 2EI8A 3H7OA 2HLCA 3UOUA 1GPZA 1AIXH 1VITG 1KYNA 3S7KB 1F0UA 1ELEE 1EP5A 1MUEB 5JPMH 1BQYA 4FU9A 1LVOA 3N99A 1A3BH 1WXRA 2Q6DA 1UVUH 3LPRA 2BDCA 2PSYA 4O3TA 1SQRA 2JH5D 1S5SA 3OEED 3SU1A 1VITF 1JWTA 3BG4C 1OXGA 3MHWU 4Y10E 5DO4H 1O2ZA 1QCPA 1GBIA 4YOGA 3LH3A 4H6SB 1GI3A 1EKBB 1TWXB 1CGIE 4ISOA 1GI1A 1T8LA 4NIXA 1RTLA 1QY6A 2NU3E 1KTSB 1V6DA 2D1JA 4NZLA 1S84A 1V2JT 4MLFB 4LZ4B 3V3MA 1MTVA 1OSSA 3CS7A 4X2XA 1K22H 1AD8H 2G5NA 3FP7E 3ZVEA 1TYNA 3SUEA 4D7GA 1O3DA 2TPIZ 4NSYA 4AG1A 1SLUB 3BTTE 1TNGA 1NFWA 4ZUHA 1C5ZB 2V7QD 1WUNH 4YOJA 2C8XB 3BF6H 5K0HA 1MU8B 1ZRKA 4YZUA 1RS0A 4LXBH 4Y8XA 1H8HD 4KGAA 1BHXF 1IQFA 3GYMA 1UJ1A 3GY7A 1C5NH 3RXLA 4LZ1H 1QRZA 3K6ZA 4Z6AH 2HALA 1BMMH 3U69H 4OM9A 1P03A 1DFPA 1DT2A 2H1UA 3EA8A 1GGDC 1P2KA 3UR6A 3AVZA 1O2QA 1C5YB 3OYPA 3STIA 2YMSC 4I8GA 1S81A 2ALPA 3B9FH 3QWCH 3OFND 1NU9A 3QO6A 5JB9S 1V2NT 2C93B 1UCYH 1HFDA 1Y8TA 1O37A 1AE5A 1HLTH 4WXVA 1FV9A 1NC6A 3ZV9A 1NTPA 2C90B 3VFEA 1PYTC 1AFQB 3SQEE 1C1OA 3RMNH 3ZZ9A 1ABJH 1BTUA 1IQJA 3C27B 1EATA 1C1QA 1O2TA 1YCPH 1HAGE 2ZEBA 3O8BA 5DP4A 1EAUA 3LC5A 1TRNA 1IQHA 4ESTE 1K28D 4IMZA 4DURA 4FVDA 5FPYA 1S0QA 1NFXA 1TX7A 4MPUA 5JBCS 3UTUH 1LDTT 3CENA 2XWAA 3F2FA 1DUAA 1SGCA 1O2PA 2ZTZA
chains in the Genus database with same CATH topology
3GY6A 1P57B 2CXVA 5T3HA 3IITA 4NFFA 1E35B 1S82A 1DWEH 1CGJE 2VH6A 1O5EH 6LPRA 3AW1A 1VCWA 1N6YA 2JKHA 4BAHB 2RA0A 3SU4A 2ANWA 1DITH 1T8OA 3F9HA 3RXTA 1GI9B 2GT8A 2PTNA 3AAVA 1O2HA 1V2QT 2OC0A 4AORA 4Y76A 2TGDA 5LPRA 3V0XA 1HAXB 1SVPA 3QUMP 3MH5A 8KME2 1TGBA 5CHAC 5FX5A 4INLA 1AKSA 3A7TA 3S69A 1UHBB 2P8OB 1DWBH 1JIRA 1ZLRA 1E36B 4XE4A 1MCTA 1WU1A 1D3QB 1PPHE 4SGBE 1VJAU 4O3UA 3SNBA 1DWDH 3P6ZB 2J94A 3RU4T 2BZAA 2VWLA 3QGJA 4FUJA 3SBKA 1OP2A 4X8UH 1GJAB 3MMGA 2O8UA 1CSOE 1O3MA 1O30A 2Q1JA 1AI8H 3M7QA 4K1EA 6GCHG 1XKAC 3A7ZA 4YESB 2BM2A 1FZZA 1GBJA 4Y0ZE 5HMAA 1AZ8A 2BLVA 2OP9A 2XXLA 3E1XB 3QLPH 3FP6E 4GHQA 5EW2H 5I46H 1BZXE 3SQHE 1SOTA 4J1YA 6GCHF 3GDSA 2GDDA 2V6NA 5EQQA 2FX4A 1EUFA 1AZZA 1GI4A 1TPAE 4X1PU 5GCHG 2ZZUH 3MWIU 3GY2A 4BTUB 2SNWA 3TNSA 1S83A 3A7XA 1M9UA 2A5KA 2ZFSA 2Z6BD 4YO9A 3TJNA 5LH8A 3PTBA 3R3GB 3UOPA 1TBRH 2FOEA 4Q7XA 4NSVA 2ANMH 1QL7A 2PTCE 3MU4A 4ZKSU 5JB8S 2BQ6B 1YF4A 3GDVA 2OC7A 2R0KA 1HJ9A 1JRTA 3ZV8A 4H4FA 8LPRA 2EI7A 2J2UA 1EZSC 1CHOG 1MKWH 1AKSB 1B0EA 2BY9X 5E0JA 1OP0A 3UIRA 3M61U 1SGFA 5JBAS 1MZDA 5DP6A 2QXHA 2VVCA 2FMJA 1V2PT 1X7AC 1T31A 1TONA 4NIVA 4IS5A 3UWIA 1CHOF 1AE8H 3FAOA 1DX5M 2Z3DA 2WUCA 1W2KH 1MCVA 2ZHWH 2WPMS 5B6OA 4ABBA 4X6OA 4E05H 1C1RA 4GPGA 3OX7U 4X2VA 4KTUA 3AW0A 5DP7A 2TGAA 3T2NA 1P02A 1O5GH 3U8OH 1H9IE 1P3EA 1RIWB 3K9XB 4RN6A 1ELAA 1O3GA 4XBBA 5A8YA 4X8SH 4IN2A 4ZROA 4BAMB 1HIAA 3M3VA 1PPCE 1A5GH 4IC6A 1V2MT 1CGHA 2CHAB 2J38A 3BEFB 1HXFH 1RTKA 2ZCKP 3U9AH 1A7SA 1C5PA 2SGAA 2OUAA 3OTJE 2ZPSA 2AYWA 2HPQH 3B8JA 1FMGA 1VGCB 5FAHA 3ZVGA 1QIXB 1VITH 2ZECA 5SGAE 1P06A 1WV7H 1P2IA 2WV4A 2VINA 3TK5A 2R2MB 1C2GA 2Q6GA 3E0PB 4U30A 3MU8A 1ELTA 3VGCC 1KXFA 1GVZA 2EA3A 1IQKA 1TGNA 3MH4A 1OWIA 1Z8RA 2H9EH 1T32A 1Y3UA 3GICB 2ZDNA 2XBWA 1ZRBA 1XXFA 1LQDB 1TLDA 2GCTC 3A89A 3BG4B 4K60A 1P2JA 1K2I1 2B5TB 3SU5A 1IOEA 1HV7A 2A1DB 3SV8A 2PW8H 3S7HB 1G9IE 1JOUB 1XKBC 2FO9A 4XFQA 1HPGA 4IW4E 1P09A 4Y71A 2BY7X 2Y80A 4TY6A 1OKXA 1H1BA 2A4GA 2ZFRH 1ETSH 4ISIH 6CHAC 1HAOH 3QDZB 1TGTA 1PPZA 4X1QU 1L1NA 4VGCC 1LO6A 2Q6FA 5AF9H 9ESTA 2XC5A 2VGCC 1SI5H 1Q31A 1OYTH 4LOYH 1UVOA 1EOJA 1ZPCA 3F1SB 1FUJA 1O35A 4MDSA 3Q3XA 1WBGB 2P3TB 3DUXH 1UK3A 1V2KT 1BRAA 1ZPZA 4ASHA 2BOHB 2SNVA 4ABGA 1LHCH 4NFEA 1K21H 2WYJA 4DIIH 1GGDB 3G01A 1FN8A 2ZFTA 3PMJA 2ILNA 1SFQB 1LHFH 4XSKU 1D3PB 3T29A 1YPJH 3W94A 1K1IA 3TJUA 4MNVA 2ZDKA 3MYWA 4JYUH 4HFPB 4LK4A 1HJ8A 4AB8A 2OCVB 5IYTA 1LKBA 1SGTA 2FXRA 2ULLA 4Y79A 5C5OA 1C5LH 3GCHC 1SGYE 4MNWA 1D9IA 1C2IA 1J15A 3GY8A 7LPRA 1GMCG 1FONA 4OS1A 2FODA 1BTXA 2IOTA 1C2LA 2HOBA 2FZZA 2WUBA 1ANDA 2VB0A 1C9TA 2GZ8A 4ZMAH 3SZNA 4YLQH 1GHZA 1AY6H 3GCOA 3QZQA 1P0SH 4DY7B 1P2NA 1GMCF 2C8YB 2OBQA 4CRBA 1A46H 3DT0H 1C9PA 1OS8A 3PTNA 5DK1A 3LJJA 3EA9A 1BMNH 2V0BA 4NCYA 1O2MA 1TA2A 3NPSA 5EXLA 2BDHA 3M7UA 1DLKB 1WAYB 3EQ0H 1T8NA 1UCYK 3EGKH 3RP2A 4GHTA 3TH3H 3VXEH 5C2ZA 5TJXA 3RLYH 1GJBB 1BITA 1XUIA 4A5TS 3MO6A 1NU7B 2QYIA 4NWKA 3M3SA 4OS4A 1AVGH 3I78A 4KKDA 4IGDA 4I31A 1PQ5A 7GCHG 3LGWA 3I29A 1F0SA 2ZDMA 2IJOB 1IQMA 1VCQA 3KIDU 5CHAB 4NIWA 2CGAA 4DOQA 1W0ZU 4DW2U 3ATWA 1C5OH 1O3KA 1CHGA 3BTKE 1Z6EA 1O2GH 2XCNA 2BDYA 1SPJA 1A5HA 1ANEA 1WQSA 1EAWA 2ZKSA 1C5TA 4ZXYH 1NRSH 1NRRH 4OGYA 1QHRB 3SNDA 4YM9A 5J4QA 2RG3A 2PV9B 4I8HA 1TA6A 1P2QA 3KQEA 1THSH 3DFLA 3DA9B 2VVUA 1YLCA 2FTMA 1SGDE 1ESAA 1S6FA 2WINI 3BEIB 5LPFA 3M36A 3UR9A 3UFAA 1C1NA 4U01A 1FAXA 3LONA 5FPTA 1XUGA 2UWPA 3DD2H 3SGBE 1QB1A 3BTFE 1ZJDA 5GPIB 3SGQE 2GV6A 1C2HA 1P9SA 2D8WA 2V3OH 2TIOA 4KP0A 2B7DH 4ZKOU 2ZGJA 1HB0B 1HGTH 3TGJE 1RXPA 1MMJN 1BJVA 1GHAG 1V2VT 4K1TA 1ARCA 3P8OA 3D62A 1P8VC 1XX9A 2AERH 1RGQA 4QT8C 2FOHA 2UUKB 2J4IA 1G3EA 1GHAF 1OWKA 3RU4D 4A92A 2ODQA 1O3BA 5BPEA 3T27A 2A45B 4YLUA 5TCAA 3K6YA 4I7YH 1TALA 4D9RA 2W5EA 1BTHH 3UNRA 5PTPA 3PWCA 1G2MA 2BXUH 3RXMA 4JZIA 4X8TH 2Z9JA 4K2YA 2CF8H 1OWHA 4E7NA 1ANCA 4FUFA 1ELVA 1KIGH 3A86A 3A88A 1CO7E 3JZ2B 3F6UH 4GCHG 1B0FA 2XBXA 3ZVBA 1LVBA 4B76A 4NGAH 1F7ZA 1C5QA 3LIWA 3V7TA 3A8BA 2Z3CA 3H5CB 5FXLA 2W26A 2VWNA 1QL8A 3A87A 3AAUA 2GX4A 2PLXA 5DP8A 3ODDA 3RLWH 1N1LA 3TJOA 1LPGB 3M5NA 1P05A 4GCHF 5L2YH 1YGCH 1O2LA 5DG6A 4CHAB 4K3JA 1MKWK 1C2JA 1NO9H 3F9FA 4OS5A 1BMAA 1C1PA 1DUEA 4TWWA 3QTVH 2SGFE 1W13U 3ZZ4A 1DSUA 1WQVH 1XMNB 4B2AA 2FI3E 2ZA5A 4Z0KA 4CRDA 3NKKA 3LJOA 1F0RA 4TWYA 2VJ1A 2QY0B 3MO3A 4AN7A 4Y7BA 1O3PB 1ZMNA 2ZP0H 4AYYB 5EPNA 2PFEA 3SOSA 3HKJB 2VIDA 1GG6C 2ANKH 2F3CE 4WJG2 3PYHA 1KLTA 3VGCB 2ZDLA 3C1KA 2OLGA 1QB9A 2QAAA 4UFFH 6ESTA 5EGMA 1O3FA 2QC2A 2LNCA 5C20A 4B2CA 1PPGE 3E3TA 1B7XB 2BMGB 3GCTG 4UFGH 1GHWH 1QQ4A 3TJVA 2GCTB 1HAPH 1BBRE 4O9VA 1UO6A 1XUJA 4ZKNU 5EOKA 1FPCH 1L0ZA 4DJZB 3GCTF 5L6NH 3TVJB 4B71A 1C1UH 1GHXH 3U1JB 2W7UA 3KL6A 2FWWA 1DANH 3HK6B 2EI6A 1AU8A 5F8TA 6CHAB 1YPGH 4RSPA 1C1WH 4VGCB 1OOKB 2FOBA 1O2UA 3SI3H 2O8LA 5L2ZH 3RMLH 1MD8A 3M5MA 3SORA 1BB0B 2VWMA 1GDNA 2XYAA 3LGUA 4K8YA 1O3NA 3M5LA 1GJ7B 2ODYB 2A2XH 1W7GH 2PGBB 1ACBE 1HNEE 1QBNA 1SQAA 8GCHG 4JYVH 2F9VA 3H7TA 1ZHMA 4NA7A 4ZHLU 1G3CA 1S85A 1VR1H 1GVKB 2BDAA 2FOCA 1U6QA 2PKSC 1Y59T 2ODPA 5FCKA 2R9PA 3PMBB 1GI7B 2SGEE 3KNXA 4FUCA 2XBVA 2AIQA 2ZDAH 2ZQ2A 3RU4E 8GCHF 1BMLA 4GAWA 3RXOA 1O3LA 5E0HA 1K1JA 2UUYA 3GY4A 5F8ZA 3GCHB 1P10A 4I33A 5T6FA 5JYIA 1GI2A 1QJ6B 4A1XA 1AB9C 1JXPA 4BAQB 2BD5A 3SHCH 4ABFA 2HNTC 3SNAA 3MI4A 2B0FA 2J34A 2IN2A 2NU2E 1SSXA 4MG3A 2GDEH 3SV6A 3PO1C 1TRYA 4THNH 1DY9A 1TNHA 3E91A 4A7IB 1LMWB 5C3NA 1Z71A 3PROA 3LDXH 1ZTJA 4Q80A 1KLJH 1IHTH 1TOMH 2QF3A 2H5CA 1NY22 2NWNA 1VCPA 3RXUA 2H6MA 2BDIA 2JH0D 5GDSH 1UTPA 3UUZA 1SC8U 1YKTA 1TPPA 2GMTC 3SW2B 3RXJA 2BB4A 2P59A 2Y7ZA 3SN8A 3LU9B 2DE9A 1LHDH 4WXIA 1O36A 3P8NA 1C4V2 1WYKA 3P70B 4YT6H 3KQDA 1GMDF 1EOLA 1QTFA 2AEIH 3EA7A 5T6DA 5T6GA 4ABHA 1SFIA 1UVSH 3KF2A 2P93A 4CRGA 1UK2A 1DM4B 2VNTA 4AYVB 1CBWC 3K65B 1GDUA 1TBQH 1O2XA 1TGCA 1TABE 1YPMH 1GJ8B 1F92A 1IQLA 3A8CA 3UY9A 1EX3A 2VIOA 1ZHPA 2BD3A 1BJUA 1GCTC 4K1SA 4GSOA 3CP7A 2STBE 3VB6A 1PPFE 1GBAA 3NCLA 3BTME 4INKA 1NRQH 2SFAA 1HAZB 2BDBA 4XDEA 1N6XA 5E0GA 1QURH 1L4ZA 5IDKA 3VEQB 2ZI2H 2W3KA 1K1PA 5DGJA 4FUHA 1T7CA 2ZTYA 5G4BA 3SUGA 3RMMH 5EW1H 1BBRH 1W12U 2YNAA 1Y5AT 2GV7A 3ESTA 1SGEE 2F9BH 3GDUA 3BSQA 1C5SA 2P94A 4BXWA 1ZOMA 4WMDA 1IQIA 2ZPQA 3FZDA 1OWEA 1BCUH 2ZPRA 1BT7A 4ABDA 2ZGHA 1B5GH 1SR5C 1YPHE 5K7RA 3VB3A 1G36A 2ZTXA 1CA0C 1MQ6A 3QTOH 3TK9A 2UWOA 3VXFH 1NM6A 4BTIB 4X6PA 3RXKA 1PYTD 2ANYA 1KDQA 1HUTH 2ZWLH 1C2DA 1P2MA 1MBQA 1J8AA 1BRUP 4WWYA 3Q3KA 4B1TA 1C5WB 2BLQA 1DWCH 3SJOA 3TU7H 1F5LA 2BHGA 2P3FH 1T4VH 2GCHG 2C8WB 4HTCH 3MU0A 1NRPH 3PV4A 8ESTE 3BTDE 1FLEE 1O2WA 4BAKB 1GDQA 1W7XH 3R0FA 3P8FA 1EZXC 3U98H 1DY8A 1V2WT 1LVMA 1O33A 2OD3B 1CE5A 4ZXXH 3FZZA 2PKAA 3ZVCA 5A0CA 4UDWH 2GCHF 2HGTH 4B73A 3SUFA 1DS2E 3UQVA 1O3AA 1O3CA 1UTQA 2Y5FA 2G52A 1ZSJA 1PQ8A 1AQ7A 1IQNA 1TMUH 1UTNA 4H42U 3ZZ5A 3ODFA 1MTNC 2PWXA 3QX5H 5A2MH 5JBTA 5CE1A 1FY4A 1P12E 3SU2A 4YOIA 3PWBA 2STAE 5EXMA 2PGQB 1V2ST 4SGAE 1DDJA 2BOKA 5AFZH 1QJ1B 2P16A 1Q3XA 2HWLB 2Z9IA 2ZFFH 4MPXA 4BNRA 1UTJA 2VIQA 2FOAA 4FUGA 1O31A 4WH8A 4JYTA 4D8NA 3RUOA 2G81E 1SQOA 2ZU2A 1GG6B 1O3OA 1KXEA 1YCPM 2F9NA 3RXHA 3N7OA 1D3TB 2XTTB 3TITA 2I6QA 1HIAB 1KDQB 2ZCHP 1ELGA 4B75A 1ZGIA 2BD2A 5AVDA 2NU4E 2TBSA 2WPJS 5GJ4B 3SJKA 1SMFE 1OX1A 4JCNA 1YPEH 1QRWA 2WYGA 4WVPE 1ZSKA 4X0WU 1Y3XA 4U2WA 1HCGA 1A0JA 2AMQA 4MNYA 1PQ7A 3PLBA 5C1YA 1QFKH 2BD8A 2RDLA 3IWMA 3RXFA 2O8MA 1MAYA 2ZQ1A 1TQ0B 3ZYEA 2CF9H 1F5KU 1K1NA 2BY8X 4DCDA 1QJ7B 1FY3A 1CQQA 1L1JA 1O2RA 3M7TA 1GVLA 1KXDA 5HXFA 2SGQE 1LVYA 2ZHQH 2FI4E 5EPYA 1ID5H 2M5TA 4CH2B 1GBCA 4UE7H 3RM0H 3P17H 3T25A 1W11U 2BY6X 1QNJA 1PFXC 2ZDVH 3UREA 4Y11E 2GP9B 1ZMLA 1DOJA 1BTPA 4NZQA 5EU8A 1TPOA 1G30B 1GHVH 4RKJB 1A4WH 1N8OC 5EODA 2GVFA 2TGTA 5JBBS 1GWAA 1IAUA 3MO9A 2Z3EA 4KELA 2Z94A 1EZQA 4Y6DA 4NA9H 2PKSB 1YYY1 2QGRA 3ATIA 2ZHEH 4FVBA 3NZIA 1GBLA 1L2EA 1GBMA 1P04A 1LPZB 1A5IA 1Z1JA 1XUFA 1CT0E 3S9BA 1TNIA 1Y5UT 5C5NA 1GMHG 3KN2A 3M5OA