1OX1A

Crystal structure of the bovine trypsin complex with a synthetic 11 peptide inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen, cationic
publication title crystal structure of the bovine trypsin complex with a synthetic 11 peptide inhibitor
rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ox1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ox1A02
4ABEA 2G5NA 3M5MA 3M36A 1OP2A 1O3EA 9ESTA 2ILNA 3MO6A 2B8OH 3RXEA 4UDWH 2Y5HA 4DG4A 3PMHB 4XBCA 2GCHF 1NFUA 1ELFA 1JWTA 3ZZBA 1IQJA 4GHQA 1FLEE 1ORFA 1HJ9A 1O5GH 2P93A 1HAOH 4MVNA 1ID5H 1ELGA 2HGTH 1NS3A 1TAWA 4TWYA 3PMAB 4DVAU 5JB9S 2XBXA 2VWNA 2ZCKP 2Y7XA 1BMMH 3EE0B 2XWBI 2VJ1A 3SV8A 1D3PB 1C1MA 2BDIA 1ELEE 1P2IA 3FANA 1S81A 1EATA 1G37A 1G30B 2OC7A 5AFYH 3MYWA 2A4OA 1C5ZB 2ZDKA 1Y3XA 5I46H 3BEFB 3GDVA 1C2JA 4AORA 1BDAA 1T8NA 3B23B 5A0BA 3FZDA 4YLUA 2J95A 1SGDE 2R9PA 1QB9A 1ZSJA 1YGCH 3UTUH 4X1PU 1IAUA 5LPFA 4D9RA 2UWLA 3U98H 2GGVB 1XKAC 4FUIA 1SHHB 1S0RA 1SI5H 2P3TB 1V2WT 2PKSC 2TGDA 1GJAB 2EI7A 4DGJA 1EZSC 1O5FH 2H9EH 2GD4B 4ZAEA 1RS0A 1S85A 1SLXB 2H1UA 1O34A 5K0HA 1NFWA 4MTBA 1IHSH 4YT7H 3BTKE 4FXGH 3QWCH 1D6RA 1Z1IA 1DS2E 1A5HA 3T2NA 1O2WA 2GCTB 3UWJH 3KNXA 2G00A 2VNTA 3BV9B 3EA9A 2C8YB 3P95A 3EDXB 4RN6A 1XUKA 1JXPA 2ZGXH 1MD8A 2J4IA 4TY7A 4NG9H 5A0CA 1ZLRA 3KN2A 1L1NA 4WJG2 3SNEA 2FOMB 1K2I1 1T8LA 3BEIB 1BTPA 1TNKA 3RXLA 1GBMA 3GYMA 2Z6BD 3MH5A 2BX3A 2ZWLH 1HXEH 1MCTA 1GGDC 3VB4A 2P94A 1F5KU 2R3YA 1O2MA 1TQ0B 2FS8A 1O2IA 1L4ZA 1EKBB 1HLTH 1O31A 1AN1E 4E7RG 2W26A 2ZTYA 4ESTE 1GVKB 1CBWC 1SLVB 5L6NH 3LC5A 1MCVA 2CMYA 1AD8H 4GAWA 1ZJDA 1C5MD 1SQAA 1HAYB 2O8UA 3T26A 5CE1A 1F0TA 3TNSA 3KGPA 1OWKA 1QBOA 3V12A 5DJ7A 1MQ5A 1NM6A 2ZHFH 3EA7A 2PSXA 4Y8XA 1GJ6A 2WYGA 1V2UT 2YOLA 2WINI 1QY6A 1TGSZ 1LVMA 2ZHEH 1CE5A 1HAIH 2Y82A 1TPOA 2FZZA 2AIPA 2D8WA 4K69A 1HJAC 2OP9A 2FYRA 1ESTA 3MU8A 1KTTB 1GBJA 2WPKS 3K9XB 1O2HA 2FESH 4LZ1H 1BRBE 3RM0H 2BQ7B 1ABJH 1EB2A 1BBRK 4ASHA 4JYVH 1O3CA 1XXDA 4HZHA 2PTNA 5DP7A 1SGTA 4KGAA 5T6FA 1FPHH 3P17H 2VGCC 1GI7B 4U2WA 3A7YA 1HAHH 1ELTA 3PM3A 1TX6A 2O8WA 4BTTB 1FZZA 3MTYA 2P8OC 3TJUA 4NZQA 1BMLA 1W14U 1WUNH 3ITIA 1C5RA 3LJOA 1HIAA 1Y59T 1BRCE 4AG1A 4FU8A 1A5IA 2ZP0H 4Q80A 4B2AA 4ABAA 3ZVBA 2O8LA 2FOGA 2ZQ1A 3FFGA 1FDPA 4ABIA 1C1PA 1OWDA 1ZJKA 4O03A 1HBTH 2C90B 2SFAA 5FPTA 1P2KA 4XBDA 4Y10E 4AYVB 4NFEA 4FVBA 2ANWA 2ZFFH 4AG2A 3TJNA 1TOMH 2F9NA 1O3LA 1V2PT 4I32A 1N6XA 4F4OC 5EPNA 1SGFG 1BTUA 1ANDA 3QZRA 7ESTE 2SNVA 4YZUA 2R0KA 1AVWA 2FX6A 4JZ1A 1A4WH 3A87A 1QBVH 4GVUA 3L6PA 2WYJA 3TLOA 2ZPSA 4LZ4B 1UTOA 1UCYK 4VGCC 3TNTA 1TALA 1V2OT 1ZPCA 3Q3YA 3UWIA 1O0DH 3M7TA 1O5EH 1FN6A 1DANH 2D2DA 1EPTA 2K1QA 3HK6B 4AB9A 2HOBA 5FAHA 3ELAH 1THPB 2CJIA 1FAXA 2Z3CA 4YESB 4XBBA 1ETSH 4CHAC 3VB6A 1AHTH 3HKIB 4HI3A 2FOEA 2QV1A 3SGBE 1PQ5A 1BQYA 1GMCF 3SQEE 1OX1A 1H1BA 2BXUH 1B0EA 2W7SA 1YLDA 4MNYA 2Y5FA 3Q3KA 1GJ9B 1OS8A 2XYAA 3MHWU 1O2NA 5HYOA 1ABIH 1BT7A 3TH4H 5E0HA 1QJ6B 3MU0A 2IPHA 1MBQA 1Z8IB 2JH5D 3SV9A 1G32B 1TGNA 2WUCA 1ZRBA 1P09A 1YPGH 3A84A 1OWHA 2OC1A 1P2MA 1C5XB 1G36A 4X6NA 1DWEH 3E0PB 1NZQH 3RU4D 5E2OA 1AWFH 2EEKA 3S0NA 3O8CA 3E90B 4ZKOU 1EPTC 1GHXH 1YPEH 3RM2H 4ABJA 3OU0A 4Y7AA 1SPJA 1IQEA 1XUGA 3SV2H 1ELDE 1VITH 3LGTA 1F5RA 4IN1A 1TA6A 3SI4H 1Z8RA 3NKKA 1ANBA 1IQGA 3LDXH 4GCHG 3SJIA 1YBWA 2XCFA 1QB6A 1AMHA 1V2JT 3QGNB 2BD7A 4UD9H 4CR5A 1P3EA 1C5LH 3MNCA 2XCNA 5K7RA 5DP8A 3GY2A 1NPMA 1CGJE 2KAIA 3RXKA 3ZYDA 3E8LA 4K2YA 1C1NA 1AUJA 1HGTH 3KL6A 4OGYA 4BAQB 1TYNA 3IG6B 3ZVGA 4MPVA 3DA9B 2PGBB 2QXJA 1W7XH 3MMGA 2VIDA 2P59A 4AX9H 1DXWA 4XFQA 1CT0E 1ZHPA 4X6MA 4GCHF 4CR9A 2TPIZ 3M5LA 2ZECA 4WH8A 1ZOMA 4BXSA 2W3KA 2GV6A 2HNTE 3UUZA 1W12U 1TE0A 2ZDMA 3DT0H 4CRDA 2FPZA 5C1UA 2G5VA 1HNEE 5LH8A 1P2OA 3BTGE 5GWZA 1BZXE 1PPCE 2RG3A 5AF9H 4A1TA 2HLCA 1TPSA 1PPBH 1BBRE 4WH6A 3SZNA 1K28D 3K6ZA 3CP7A 2A7HA 1O3NA 2JETB 4X2WA 1TLDA 1GBKA 4NA7A 2BVXH 6LPRA 2NU1E 2AIQA 1UVPA 1VZQH 1SGYE 1MTSA 2G4TA 2LNCA 4BOHA 2UUYA 5I25A 1C1RA 1GBCA 1TBRH 2O8TA 3GCTG 2ZI2H 1TNJA 1LHFH 4IBLH 4OS7A 3SU0A 2Z9IA 3GISB 4IS5A 1C1TA 3RXRA 1A1RA 2XRCA 1GBEA 2AGIX 1J14A 2GCTC 2VVVA 1HJAB 3D23A 8KME2 2ZU5A 3W94A 3ZZ6A 1NC6A 2B0FA 3MOCA 1C1OA 1THSH 3RXGA 1BTZA 5EODA 3SU4A 3LC3A 2JH6D 1NRRH 5HGGA 1FAKH 3GCTF 2G81E 2PWXA 1UTJA 2PW8H 3ATIA 7GCHG 1KXDA 1JOUB 5L2YH 2Q6GA 1O2SA 1LO6A 2ZCHP 3SNBA 1UHBA 4MQAA 3F9HA 2H9TH 4KTCA 2AGEX 1QFKH 1SOZA 2BY7X 1KXAA 1ZTKA 4ISOA 3RUOA 1KXFA 1OSSA 3PLBA 2BDAA 2Y7ZA 3FP7E 3V3MA 1LVOA 4MNWA 3VB5A 1NTPA 2PGQB 2V35A 4ZKNU 1WQVH 1O2LA 4DIHH 1JRTA 1EASA 2XWAA 3UR9A 1VITF 3GY8A 5FX5A 2GZ9A 3UOUA 3UPEA 1UCYH 1GPZA 4INHA 5JYIA 1BHXB 1DY9A 1HCGA 4AFZA 3ZZAA 1O2ZA 2VVCA 3U8TH 7GCHF 5EPYA 1EAUA 2W7UA 1F0RA 1QGFA 4CRGA 4DIIH 1O36A 2F91A 3SHAH 1SGQE 4JK5A 5C5NA 1GMHF 2SGPE 2ESTE 3OY5U 4M7GA 1EAXA 1O5DH 5SGAE 4IMQA 1F0UA 1NY22 5EGMA 1YF4A 5EW1H 4X8UH 5FPSA 2ANYA 1BB0B 2BY8X 1L1GA 1HIAB 2ULLA 2BYAX 1P03A 2LPRA 3TVJB 3GY7A 4AFQA 1DY8A 3JZ1B 2BVRH 3EAJA 1G3EA 1Y3WA 3M61U 4UE7H 5E0JA 1SGIB 5FX6A 1CGIE 5IDKA 1UMAH 2FYQA 2ZGHA 4OGXA 4BTIB 1IOEA 1E34B 1K1MA 2HNTF 3ZZ9A 5GCHF 3TIUA 2ZDNA 3S7KB 2R2WU 1C1UH 3T29A 2QGRA 5FHTA 1GCTB 1MD7A 4MPXA 8GCHG 1T8OA 4TPIZ 4WMEA 5EQRA 4JK6A 3GY3A 1JMOH 3BSQA 6CHAB 1YLCA 3AW0A 1OKXA 1BJUA 1W0YH 1O2XA 1GDNA 2A4QA 2VIPA 2ZFPH 1A0HB 2RCEA 3T5FH 3T27A 1QHRB 1TA2A 1QA0A 2PV9B 1O5BB 2P95A 2A32A 3SUEA 2OTVA 1EPTB 4FUDA 1HAGE 2BLWA 3RXVA 1WTGH 1SLWB 1SFQB 2ALPA 1O3BA 1N1LA 2VINA 3QO6A 3A82A 1MTNB 1UVOA 1DX5M 1MTWA 1MBMA 1OWIA 3GYLB 1ELAA 1QRXA 1JRSA 1D4PB 1P57B 1DM4B 1MTVA 2CV3A 1TPAE 1DITH 1FY4A 1NRPH 4X1NU 1OPHB 2XC0A 2ZU4A 1YPHC 1H8DH 2H6MA 2UUJB 1LDTT 4OS5A 5EQQA 1ELBA 3M3VA 1TGCA 1C1SA 2ZA5A 2QIQA 3M35A 3RXSA 5J4SA 1VCWA 4ISIH 1TGBA 1O2VA 2UWPA 1SSXA 4B74A 5JPMH 1HUTH 1FIZA 1UTMA 5DPAA 2BX4A 5C1XA 3A8AA 5IYTA 3QX5H 3O8BA 1A3BH 4AYYB 5CMXH 3RU4T 2HRVA 2AS9A 1QBNA 2ZC9H 1N8OB 1G3CA 4CREA 1TRNA 2DE8A 2ALVA 2BDBA 1C5VA 1Y3VA 2BD4A 1DUAA 1C4Y2 1ZHMA 4D8NA 4Y6DA 4ZXXH 1OYQA 1IQKA 1CHOG 1OP0A 1EX3A 3MH7A 2KAIB 1UVTH 3RLYH 4BTUB 1WOFA 1TPPA 5LPEA 2J94A 2AMQA 1GI5A 2C4FH 2ZDAH 2SGAA 2C3SA 4JZIA 1TGTA 2ZQ2A 4X2YA 2TGTA 1C1QA 2OD3B 1SGPE 1PQAA 2RDLA 4O3TA 5JB8S 1HDTH 2FWWA 3KF2A 4YOIA 4NZLA 3D62A 2ZU3A 4NIYA 1GL0E 3F9FA 1CHOF 1TABE 3TPIZ 1GHAG 4B76A 4IC5A 1NFXA 4X1QU 3L33A 3PYHA 2BMGB 3LGWA 2J38A 1AVXA 1T7CA 4FUFA 1UK2A 4Q7XA 3SW2B 3NUMA 2F9BH 3P8NA 2GT8A 3S9CA 5DP9A 5BPEA 1UVSH 2VWLA 3H7OA 1GJ8B 1W11U 1ETRH 2BXTH 3PMBB 1RGQA 2PFEA 4AN7A 3HGNA 2ZDLA 1Y3UA 2FOAA 3GDSA 1KDQB 1D3TB 1XVOA 1Z6EA 2QF0A 1KLJH 2JETC 3DFLA 3RMMH 4XE4A 4CRAA 3EYDA 1FY8E 1FY1A 2TRMA 2ODYB 3NCLA 1MH0A 3ZZ5A 3LGVA 1LTOA 4ISHH 3GDUA 5FBIA 1WV7H 2O9QA 5DP5A 1ZGVA 1TQ7B 1G2MA 2JKHA 1X7AC 4WY3A 1FI8A 2VH6A 3AW1A 3PWBA 1BJVA 4Y79A 3STIA 3HPTB 3SI3H 3EGKH 1GHBG 2XXLA 4TPYA 3ZVFA 4Z6AH 2DE9A 4KP0A 3KQEA 4JMYA 4K5ZA 5E2PA 1DWDH 1GHWH 1O2KA 1C2LA 1H4WA 2FP7B 4BAMB 2ZFSA 4YOGA 3NPSA 1UHBB 1SVPA 2VIOA 1V6DA 1RIWB 4MDSA 4IMZA 4Y11E 2OLGA 3QZQA 3SV7A 1W0ZU 5HXFA 5C20A 1C2HA 4CRCA 1AQ7A 1VJAU 4O3UA 3RP2A 1P2QA 4NFFA 2ZKSA 1BITA 1ACBE 3VPKA 4A5TS 1O2RA 1AI8H 1XM1A 1GHBF 2M5TA 1P9SA 3K6YA 1SC8U 3SHCH 1C9TA 1GJBB 4RKJB 1A3EH 3ATLA 5F8ZA 4UFEH 2QN5T 1N6YA 1O38A 3E91A 3QTOH 5FCKA 1T4VH 1O30A 2ZGCA 3HGPA 1GJDB 3GICB 4D9QA 2TGPZ 1TBZH 2ZO3H 1FIWA 3LIWA 4X2VA 1T31A 2NWNA 4B2BA 1AY6H 3TK6A 4KTUA 1SQTA 5TJXA 3A83A 3M7UA 3RMOH 3LJJA 3NXPA 5FCRA 2OXSA 1Q31A 1C2DA 3F68H 3VXFH 4H6TA 1BMAA 4NSVA 5F8XA 3CENA 4WVPE 1TIOA 2ZIQH 1AU8A 3MU5A 4ZHMU 2VIQA 3LOXA 1K1IA 3RXDA 3SU6A 1ELCA 2P16A 2NU3E 2A5KA 2A45B 2ZEBA 3KIDU 5EQSA 1V2MT 1C2KA 1C1VH 1RD3B 1W2KH 5ETXA 4E05H 5B6OA 1PPZA 4XDEA 1LHGH 3ZVAA 1NRSH 1ZTJA 1W10U 1EZUC 1XUHA 3OX7U 1MTUA 4ZHLU 1FUJA 1CO7E 3DUXH 3P92A 1GCTC 5DP4A 3U8OH 3URDA 2UWOA 1TX8A 2ZU1A 1O5CB 1IQHA 1KY9A 1GG6B 3ZZ7A 1W8BH 4AGJA 2ZHQH 1H9IE 1O3PB 3FAOA 6CHAC 3FVFB 1BRUP 3A89A 2BDYA 2Z3EA 3FP8E 3U1JB 2I6SA 2FO9A 3U8RH 1Z6JH 1BCUH 1ESAA 1TRYA 3Q3XA 5F03A 3SO3A 2CF8H 4B2CA 1DDJA 3M3SA 3M7QA 2B5TB 1YCPM 1OXGA 1VJ9U 4UFGH 4WMDA 3H5CB 3QGJA 3OY6U 1MZAA 1MTNC 3RXQA 5GIBA 4INLA 2ZG0H 1PPHE 1E0FD 1Y3YA 2SGQE 2G52A 2A5AA 1K21H 3UY9A 1DLEA 3OYPA 1SGCA 1S6FA 1TOCB 1TMTH 1AB9B 4K8BA 2P3UB 1V2NT 1D3QB 2ZZUH 1A46H 3A7ZA 2Y81A 3BG4B 3IWMA 1DLKB 1BOQA 1FNIA 1O35A 3BTEE 1GWAA 2FI5E 1HJ8A 2ODQA 4Y71A 2CGAA 1GI6A 3ODDA 1P02A 3ZVEA 2IJOB 1DXPA 1J17T 3R3GB 1LVBA 4X2XA 2VWMA 2PSYA 1EP5A 2BTCE 1W7GH 2OCVB 3T62A 1SQOA 2WPHS 4Y0YE 1KIGH 2IOTA 1O3JA 1S84A 2AFQB 2FM2A 3SUFA 3VFEA 3VGCB 2F3CE 1NRNH 5GXPA 2FEQH 2WV5A 2ZFRH 3A88A 1C2EA 1AKSB 4AB8A 1O3IA 1EOJA 2D26C 1TNGA 4U01A 1NT1A 1TMBH 2BVSH 1O2JA 1N8OC 3DFJA 3QN7A 1GVLA 1UTKA 1TBQH 3C27B 3GCHB 1W13U 3EQ0H 4A1VA 3SUGA 4NIXA 3RXOA 4NWLA 1WQSA 1C9PA 1E36B 1LKAA 1KXCA 2VWOA 2NU2E 4H42U 3STJA 3LGUA 1LHEH 4X1RU 1GBIA 1S83A 1GVZA 1YPLH 5TCCA 4IW4E 3SN8A 3LGIA 1BBRH 1H9LB 1KDQA 1SGNE 1DFPA 3A80A 3TJOA 4JZFH 4WF8A 1GBTA 2QC2A 3KQDA 5EW2H 1DE7H 4I31A 1GMDG 7LPRA 1EAWA 1E38B 4DURA 3T25A 5C2ZA 1ZGIA 2GKVE 2F9PA 1EOLA 2FS9A 3BG8A 4X0WU 1EZXC 1B7XB 3I77A 2ASUB 1F5LA 1DOJA 1GBFA 1K9OE 2FDAA 1EAIA 4A7IB 1UJ1A 3BTME 1QURH 3OTJE 1AZ8A 4O97A 3UIRA 1XKBC 2XNIA 2H2ZA 1IQFA 1GBHA 2B9LA 1XUFA 2XW9A 3CS0A 1GMDF 3ZZDA 3PB1E 1ETTH 4MNXA 4LOYH 2Y80A 3URCA 4ZROA 5A09A 4CBNA 1U6QA 1KTSB 1C2FA 1QIXB 1V2KT 1GBBA 4B1TA 1S5SA 3PTBA 2NU0E 1GHZA 1QL9A 1KYNA 1EQ9A 2GMTB 3BTHE 3ZV8A 1BTXA 1C5YB 3SNDA 1T8MA 1F92A 5T6GA 4YOJA 2HPPH 4WMFA 3HK3B 2WV4A 3BTFE 4BXWA 1MKWK 1Y5UT 1D9IA 1P11E 5T6DA 1K1PA 1IQMA 5H4IB 3SV6A 1Y8TA 2HNTC 2I6QA 3MFJA 2OQ5A 3F9GA 4GHTA 1LHCH 5A8XA 2GP9B 2F83A 2BD3A 1ZMLA 2GZ7A 1RFNA 4TYDA 2EA3A 4WXIA 1LMWB 2QY0B 1RIWC 3H7TA 3P6ZB 2PTCE 4OS1A 1BTWA 2TIOA 2FOBA 2YNAA 1A2CH 3M5NA 3SU1A 4FUHA 2BQ6B 4ZMAH 3BEUA 3MU1A 1ARCA 4ZKSU 1TNLA 2ZFTA 1QL8A 4FUEA 1P8VC 3A8CA 1RXPA 1LPKB 3VXEH 3ZZ3A 5AFZH 3DHKH 1CT4E 2PUXB 3E0NB 5GJ4B 4FUGA 5C3NA 3MO3A 3PMJA 1O32A 3SOSA 1O39A 2BDGA 3ZZ4A 3QLPH 1C2IA 3BF6H 4KKDA 1TONA 3O8DA 4DCDA 3KQCA 2V3OH 2GT7A 4NGAH 2THFB 2Z7FE 2ZHWH 4Q7YA 1O2QA 1YM0A 2SGDE 3MI4A 2OC0A 2BLQA 3E16B 5EXMA 2HALA 5T3HA 3ZYEA 2C8WB 1QJ1B 3BTQE 2CHAB 1GI1A 2ZDVH 4HGCA 1CA0C 1G3DA 1QR3E 3P8GA 4MPWA 2EI6A 2F9OA 5JBTA 5AVDA 1HAZB 2AMDA 3D65E 1O3KA 5EU8A 3W95A 4DOQA 4XSKU 1O2OA 3S7HB 3MH6A 3K65B 2CF9H 3RLWH 3RMNH 8GCHF 1A61H 1TWXB 1O2GH 5FXLA 1EB1H 4CRFA 1YKTA 3FZZA 1HRTH 2FLRH 1LPGB 1ZRKA 2BZ6H 3ODFA 5PTPA 3UOPA 3AAUA 1HV7A 1DSUA 4INKA 1GI0A 2FI4E 2GX4A 2PKAA 1QQ4A 1CVWH 4IC6A 4YLQH 3RXIA 7KMEH 2VIVA 1RJXB 1L4DA 4Q2KA 4BAOB 4DJZB 1LCYA 4CBOA 3HKJB 2JH0D 1MAYA 1YC0A 4K60A 3G01A 1PQ8A 1FN8A 1SOTA 3KQBA 3I78A 4FVDA 1C5NH 1P9UA 4KELA 1YPKH 1NESE 4IGDA 3RU4E 1GG6C 3TH2H 1P10A 1JIMA 1O3DA 2WPJS 1RRKA 1S0QA 4NA8A 3DD2H 1CU1A 3K2UA 1GBLA 4D7FA 1PYTC 3SJKA 3ATKA 2A4GA 3MWIU 2VIWA 2R2MB 2ODPA 1L1JA 1TFXA 3GOVB 4RKOB 1GI4A 1C5UA 1PPGE 4GSOA 2AMPA 1B0FA 2DUCA 3RC4A 1AKSA 1GHVH 1O37A 1F0SA 5DO4H 4GLYA 3SJ9A 1C4V2 2G51A 3ATWA 1MKXK 2GDEH 3SNCA 2TGAA 1ANCA 3A7XA 1A0JA 1LQEA 1S82A 2C8ZB 4FU7A 4BANB 1AO5A 1TMUH 2XBVA 4GPGA 6ESTA 1AB9C 4YM9A 3ESTA 1KXBA 4FUJA 1HB0B 1C4U2 1FY5A 4BNRA 2QXGA 5FPYA 3UNRA 3BG4C 2ZTZA 5C67A 4I8JA 3SJ8A 4B75A 1WYKA 3GY5A 1XX9A 5ESTE 3S9AA 4Z0KA 1C5QA 2H5CA 2ZHDA 3B8JA 1C5OH 1K1JA 4KTSA 1F2SE 1TX7A 2RA0A 3TJVA 1QB1A 1UO6A 4MPUA 4CH2B 3CS7A 1ZTLA 3F9EA 3VGCC 2GTBA 1OOKB 8LPRA 1DT2A 3TGIE 3P8OA 4ISLA 2A2QH 4MNVA 1IQNA 4FUBA 4OS2A 2WPLS 3PWCA 1G2LA 4SGBE 3BTTE 1GJ5H 1S6HA 2BD8A 1SGEE 4OS4A 3GCHC 1MKWH 4XOJA 1G9IE 1V2RT 3SU2A 1V2QT 4BAHB 3U9AH 1H8IH 1YCPK 1XMNB 2J9NA 2ZPRA 3U1IB 4ABGA 1AE5A 3PV4A 2GVFA 2OC8A 4A6LA 1PFXC 1BA8B 1GHAF 1QJ7B 3SJOA 3NWUA 5HM9A 4FUCA 1MMJN 1WBGB 1O3FA 2GV7A 5EG4A 4X8VH 5DG6A 2BQWB 2BM2A 3ATMA 2AEIH 1EUFA 4DT7B 1GI2A 2HPQH 1A0LA 1P12E 2J2UA 2UUFB 2C8XB 4Y8ZA 5DP6A 1GBAA 1GJCB 3SGAE 1F7ZA 2HVXA 1GJ7B 1O33A 3ZVDA 1SGFA 1YPJH 2FODA 1MU8B 3E3TA 3P70B 4UEHH 5L30H 3SQHE 2WPMS 5EXLA 1UTNA 6GCHG 1AGJA 1NFYA 1NU7B 1C5PA 3WY8A 1H9HE 4AOQA 2VH0A 1SL3A 1AFQB 1AUTC 2R0LA 3SORA 1BTHH 2Z9GA 3RC5A 1QNJA 1UK3A 2BLOA 5DP3A 3P8FA 4AFUA 4BAKB 1ESBA 4B73A 4F49A 2XC4A 3ENSB 3OSYA 4NSYA 1Z1JA 1AZZA 5HM2A 2VVUA 1KLIH 1XVMA 1VGCC 4NWKA 1A7SA 1W3CA 1THRH 4ZKRU 5JBCS 2BDCA 2OBOA 1Q3XA 2ANKH 2QYIA 2W5EA 3TK9A 1NROH 1XXFA 3KEEA 2FXRA 3GCNA 1SMFE 2GMTC 6GCHF 1ZPZA 1YYY1 4JZDH 1NU9A 1A5GH 1ZYOA 3E1XB 4X1SU 2BOHB 1ZMNA 1MQ6A 3QK1A 1V3XA 1WAYB 1UTLM 2XC5A 3NZIA 3A8BA 4JCNA 3LGYA 2TBSA 2PR3A 2BY6X 1KLTA 1ZPBA 1DWBH 4X8SH 3QUMP 2STBE 2FLBH 3ZV9A 4U30A 3MH4A 1VCPA 1BIOA 3C1KA 4AZ2B 1J16A 3KHVA 1CA0B 1PYTD 4H4FA 1P2JA 1QL7A 5JBBS 1E35B 3FP6E 1PJPA 2Y6TA 1QTFA 1QQUA 4CH8B 1IHTH 3PLPA 1SFIA 1DUEA 2ZF0H 2OQUA 3F1SB 5CHAB 1Z8JB 5ESBA 1Z7KA 2G4UA 1SLUB 4B71A 4JZEH 3LH1A 1SB1H 1K22H 1KSNA 1B5GH 3PLKA 1LHDH 1UK4A 3TGJE 2BB4A 4R8TB 3L3TA 2Z3DA 1HXFH 4UFDH 3AAVA 1FY3A 1ELVA 1D3DB 1Z71A 1NO9H 4NIVA 2AH4X 1GMCG 2P3FH 2PHBA 3ZVCA 3PO1B 1C5TA 1C1WH 1G3BA 3RMLH 2ZU2A 5A0AE 1ZMJA 1GDQA 4R0IA 4UFFH 1WU1A 2D1JA 3QDZB 1HAVB 3TITA 1BHXF 2ZNKH 5LPRA 2BLVA 2FOCA 1CSOE 1E37B 2GDDA 1YPMH 5TCAA 1MKXH 2OUAA 2A5IA 1ARBA 2A1DB 2AGGX 1C5SA 1OYTH 1VR1H 1BTYA 2CHAC 3LPRA 2W3IA 2B7DH 1IQLA 3MNBA 4I8LA 3EA8A 4YO9A 1O3HA 2BY9X 3B9FH 4K1TA 4J2YB 2VU8E 1GL1A 3LONA 2PKAB 1RTKA 2PLXA 3RXJA 1YP9A 3RXFA 1EXFA 1KXEA 1O5AB 1MUEB 1XUJA 2FTMA 2RA3A 1K1OA 4JYUH 2J92A 2SGFE 3N7OA 5DGJA 4J1YA 1QRWA 1LKBA 4NA9H 2ZGJA 4A92A 1ZSKA 5F6MA 2Q6FA 2BY5X 4O9VA 4PROA 1JIRA 2A2XH 3UNQA 2G55A 5LGOA 1FV9A 3SU5A 4YTAA 4NCYA 1ZHRA 2PUQH 2O8MA 3TK5A 1AIXH 2IN2A 1P06A 3TGKE 5DKMA 1SGRE 1FONA 1GCDA 2BD9A 1WCZA 3D49H 2CN0H 1QRZA 1DICA 5GPIB 3BN9A 3MNXA 2PKSB 3UR6A 2CXVA 4NIWA 3SUDA 1T4UH 1O2YA 1QCPA 2YNBA 2FOFA 1DSTA 3ZZ8A 2R3UA 3ZZCA 5A2MH 2V0BA 4DW2U 1P04A 4CRBA 1IQIA 1TRMA 1YCPH 3A86A 3UREA 1PPFE 3RXCA 1O3AA 3U69H 5A8ZA 9LPRA 4U32A 2FIRH 1ZZZA 4ZUHA 2XBWA 5BRRE 1T32A 1DWCH 2BHGA 1MU6B 4E06H 5JDUB 2GZ8A 4ZH8A 2A7CA 2ZTXA 3S9BA 2C93B 5E0GA 1AVGH 5DK1A 1FMGA 1D6WA 3T28A 4I33A 3UQOA 4HTCH 4OS6A 1JBUH 4X8TH 8ESTE 2HWLB 1FPCH 3BIUH 2VB0A 4LK4A 3RXBA 2FMJA 1V2VT 4THNH 4WXVA 1GGDB 1GI9B 1V2ST 1LVYA 1J8AA 3LT3A 2V6NA 1ANEA 1V2LT 3A81A 5E8EH 4I8GA 1Y5AT 1CBWB 2NU4E 1LQDB 3A7VA 3VB3A 2F9VA 3UQVA 1J15A 3RXTA 1HAPH 1CHGA 1QA7A 4Y7BA 1GDUA 2QCYA 3RC6A 3IITA 1Y5BT 2BZAA 1FXYA 1FQ3A 1OWJA 3VB7A 2OINA 4FU9A 1M9UA 3LU9B 2BOKA 1HFDA 3V0XA 2Q1JA 2EC9H 5HMAA 3RXPA 1GI3A 3S69A 3GY4A 1LPZB 3KCGH 2ZCLP 3JZ2B 5C1YA 1BUIA 3RXHA 3AVZA 1TB6H 4GUXA 2OBQA 4AFSA 3M3TA 4Y8YA 5JBAS 5C5OA 1XUIA 4Y76A 1SBWA 1WSSH 3V13A 1EJMA 1P0SH 1UVUH 4X6PA 4ABBA 2Z9JA 4WWYA 3BTDE 1SR5C 1VGCB 1RTFB 4MG3A 1VITG 2Z9KA 1MZDA 5AHGH 4Y0ZE 2VGCB 4K3JA 3A85A 3QTVH 1UTQA 3LH3A 3I29A 4I8KA 3Q76A 4ZHAA 2QAAA 1C5WB 1PPEE 2P8OB 1SHYA 4ISNA 3O8RA 1CA8B 2ZGBH 3M37A 3RDZA 2ZFQH 3AASA 1GMHG 4ZXYH 2ANMH 1UCYE 1P3CA 2EI8A 1O3OA 1HPGA 2Q6DA 1CT2E 2FOHA 1Q2WA 4LXBH 1INCA 4SGAE 1BRAA 4ABDA 4IN2A 3BIVH 2Y5GA 2H5DA 1CQQA 4D76A 2J34A 3R0FA 1DPOA 1TNIA 2Z94A 4I8HA 3NK8A 3SU3A 3V7TA 1HAXB 5ABWA 2XTTB 3VEQB 1AFQC 1WTHD 1NN6A 1YPHE 3MNSA 2STAE 1C2GA 5F8TA 3Q77A 1MAXA 3PROA 3HATH 1ZR0A 1OWEA 2AERH 4Q7ZA 4MLFB 1P01A 1GHYH 4YT6H 1CGHA 2A31A 3BTWE 3MU4A 1EZQA 1GI8B 2QXIA 4TY6A 3TU7H 3E6PH 1PQ7A 1EJNA 1RTLA 1BMNH 4VGCB 5GCHG 2ZPQA 1P2NA 1V2TT 2BD2A 2FX4A 1J9CH 4ABHA 5EOKA 4X6OA 1K1NA 3A7WA 1EP6A 1O2TA 4QT8C 2F9UA 3GY6A 1O2UA 3RXAA 2QA9E 2FTLE 2BD5A 1O3GA 3RXMA 1AFEH 3TH3H 1FJSA 2SGEE 4AGKA 3MO9A 2BDHA 2WPIS 2SNWA 4CHAB 4I7YH 2A7JA 1OP8A 3SGQE 3Q00A 4D7GA 4A1XA 1TNHA 4TWWA 1GJ4H 2FI3E 2WUBA 1C2MA 1AE8H 1Z8GA 3RXUA 1HAVA 1VCQA 5A8YA 4HFPB 4K1EA 1EJAA 5J4QA 3F6UH 5G4BA 2G8TA 2Z9LA 1SG8B 2A4RA 3SBKA 3UNSA 3A8DA 2A0QB 4UONA 1O3MA 1UTPA 5EXNA 1P05A 5CHAC 3PTNA 4DY7B 3A7TA 3LKWA 2QF3A 1DVAH 2V3HH 2XBYA 2GCHG 4K1SA 3M5OA 5GDSH 4ABFA 3UFAA 5L2ZH 3GCOA 4RSPA 1HYLA 3SNAA 4H6SB 2QXHA 4JYTA 1ZSLA 1L0ZA 2AYWA 1L2EA 5FBEA 3PO1C 1K1LA 1NRQH 1GBDA 2UUKB 1AWHB 1O2PA 4E7NA 4K8YA 2H9HA
chains in the Genus database with same CATH superfamily
4ABEA 2G5NA 3M5MA 3M36A 1OP2A 1O3EA 9ESTA 1UW7A 2ILNA 3MO6A 2B8OH 3RXEA 4UDWH 2Y5HA 4DG4A 3PMHB 4XBCA 2GCHF 1NFUA 1ELFA 1JWTA 3ZZBA 1IQJA 4GHQA 1FLEE 1ORFA 1HJ9A 1O5GH 2P93A 1HAOH 4MVNA 1ID5H 1ELGA 2HGTH 1NS3A 1TAWA 4TWYA 3PMAB 1YLNA 4DVAU 5JB9S 2JJ1D 2XBXA 2VWNA 2ZCKP 2Y7XA 1MABB 1BMMH 3EE0B 2XWBI 2VJ1A 3SV8A 5IK2D 1D3PB 1C1MA 2BDIA 1ELEE 1P2IA 3FANA 1S81A 1EATA 1G37A 1G30B 2OC7A 5AFYH 3MYWA 2A4OA 1C5ZB 2ZDKA 1Y3XA 5I46H 3BEFB 3GDVA 1C2JA 4AORA 1BDAA 1T8NA 3B23B 5A0BA 3FZDA 4YLUA 2J95A 1SGDE 2R9PA 1QB9A 1ZSJA 1YGCH 3UTUH 4X1PU 1IAUA 5LPFA 4D9RA 2UWLA 3U98H 2GGVB 1XKAC 4FUIA 1SHHB 1S0RA 1SI5H 2P3TB 1V2WT 2PKSC 2TGDA 1GJAB 2EI7A 4DGJA 1EZSC 1O5FH 2H9EH 2GD4B 4ZAEA 2J98B 1RS0A 1S85A 1SLXB 1WDIA 2H1UA 1O34A 5K0HA 4ACBA 1NFWA 4MTBA 1IHSH 4YT7H 5HIZA 3BTKE 4FXGH 3QWCH 1D6RA 1Z1IA 2K0QA 1DS2E 1A5HA 3T2NA 1O2WA 2GCTB 3UWJH 3KNXA 2G00A 2VNTA 3BV9B 3EE7A 3EA9A 2C8YB 3P95A 3EDXB 4RN6A 1XUKA 1JXPA 2ZGXH 1MD8A 2J4IA 4TY7A 4NG9H 5A0CA 1ZLRA 3KN2A 1L1NA 4WJG2 3KYFA 3SNEA 2FOMB 1K2I1 1T8LA 3BEIB 1BTPA 3WW7A 1SKYE 1TNKA 3RXLA 1GBMA 3GYMA 2Z6BD 3MH5A 2BX3A 2ZWLH 1HXEH 1MCTA 1GGDC 3VB4A 2P94A 1F5KU 2R3YA 1O2MA 1TQ0B 1O2IA 2FS8A 1L4ZA 2KCOA 1EKBB 1HLTH 1O31A 1AN1E 4E7RG 2W26A 2ZTYA 4ESTE 1GVKB 1CBWC 1SLVB 5L6NH 3LC5A 1MCVA 2CMYA 1OHHD 1AD8H 4GAWA 1ZJDA 1C5MD 1SQAA 1HAYB 2O8UA 3T26A 5CE1A 1F0TA 3TNSA 3KGPA 1OWKA 1QBOA 3V12A 5DJ7A 1MQ5A 1NM6A 2ZHFH 5EJ1A 3EA7A 2PSXA 4Y8XA 1GJ6A 2WYGA 1V2UT 2GJGA 2YOLA 2WINI 1QY6A 1TGSZ 1LVMA 2ZHEH 3OTPA 1CE5A 1HAIH 2Y82A 1TPOA 2FZZA 2AIPA 2D8WA 4K69A 1HJAC 2OP9A 2FYRA 2HVYB 1ESTA 3MU8A 1KTTB 1GBJA 2WPKS 3K9XB 1O2HA 2FESH 1S6LA 4LZ1H 1BRBE 3RM0H 2BQ7B 1ABJH 1EB2A 1BBRK 4ASHA 2W6ID 4JYVH 1O3CA 1XXDA 4HZHA 2PTNA 5DP7A 1SGTA 4KGAA 5T6FA 1FPHH 3P17H 2VGCC 1GI7B 4U2WA 3A7YA 1HAHH 1ELTA 3PM3A 1TX6A 2O8WA 3W1EA 4BTTB 1FZZA 3MTYA 2P8OC 3TJUA 4NZQA 1BMLA 1W14U 1WUNH 3ITIA 1C5RA 3LJOA 1HIAA 1Y59T 1BRCE 4AG1A 4FU8A 1A5IA 2ZP0H 4Q80A 4B2AA 4ABAA 3ZVBA 2O8LA 2FOGA 2ZQ1A 3FFGA 1FDPA 4ABIA 1C1PA 1OWDA 1ZJKA 4O03A 1HBTH 2C90B 2SFAA 5FPTA 1P2KA 4XBDA 4Y10E 3CNRA 4AYVB 4NFEA 4FVBA 2ANWA 2ZFFH 4AG2A 3TJNA 1TOMH 2F9NA 1O3LA 1V2PT 1E1QD 4I32A 1N6XA 4F4OC 5CDFE 5EPNA 1SGFG 1BTUA 1ANDA 3QZRA 2LELA 7ESTE 2SNVA 4YZUA 3F0PA 2R0KA 1AVWA 2FX6A 4JZ1A 1A4WH 3A87A 1QBVH 2WZQA 4GVUA 3L6PA 2WYJA 3TLOA 2ZPSA 4LZ4B 1UTOA 4F48B 1UCYK 4VGCC 3TNTA 1TALA 1V2OT 1ZPCA 3Q3YA 3UWIA 1O0DH 1E1RD 3M7TA 1O5EH 1FN6A 1DANH 2D2DA 1EPTA 2K1QA 3HK6B 4AB9A 2HOBA 5FAHA 3ELAH 1THPB 2CJIA 1FAXA 2Z3CA 4YESB 2JJ2D 4XBBA 1ETSH 4CHAC 3VB6A 5KECA 1AHTH 3HKIB 4HI3A 2FOEA 2QV1A 3SGBE 1PQ5A 1BQYA 1GMCF 3SQEE 1OX1A 1H1BA 2BXUH 1B0EA 2W7SA 1YLDA 4MNYA 2Y5FA 3Q3KA 1GJ9B 1OS8A 2XYAA 5HKKD 3MHWU 1O2NA 5HYOA 1ABIH 1BT7A 3TH4H 5E0HA 1QJ6B 3MU0A 2IPHA 1MBQA 1Z8IB 2JH5D 2QE7D 3SV9A 1G32B 1TGNA 2WUCA 1ZRBA 1P09A 1YPGH 3A84A 1OWHA 2OC1A 2VBCA 1P2MA 1C5XB 4F55A 1G36A 4X6NA 1DWEH 3E0PB 1NZQH 3RU4D 5E2OA 2EEKA 1AWFH 3S0NA 3O8CA 3E90B 4ZKOU 1EPTC 1GHXH 1YPEH 3RM2H 4ABJA 3OU0A 4Y7AA 1SPJA 1IQEA 1XUGA 3SV2H 1ELDE 1VITH 3LGTA 1F5RA 4IN1A 1TA6A 3SI4H 1Z8RA 3NKKA 1ANBA 1IQGA 3LDXH 4GCHG 3SJIA 1YBWA 1FX0B 2XCFA 1QB6A 1AMHA 1V2JT 2LP6A 3QGNB 2BD7A 4UD9H 4CR5A 1P3EA 1C5LH 3MNCA 2XCNA 5K7RA 5DP8A 3UB0A 3GY2A 1NPMA 2WV9A 1CGJE 2KAIA 3RXKA 1W0KD 3ZYDA 3E8LA 4K2YA 1C1NA 1AUJA 1HGTH 3KL6A 4OGYA 4BAQB 1TYNA 3IG6B 2AHME 3ZVGA 2J98A 4MPVA 3DA9B 2PGBB 2QXJA 1W7XH 3MMGA 2VIDA 2P59A 4AX9H 1DXWA 4XFQA 1CT0E 1ZHPA 4X6MA 4GCHF 4CR9A 2TPIZ 2IPQX 3M5LA 2ZECA 4WH8A 1ZOMA 4BXSA 2W3KA 2GV6A 2HNTE 3UUZA 1W12U 1TE0A 2ZDMA 3DT0H 4CRDA 5T1VA 2FPZA 5C1UA 2G5VA 1HNEE 5LH8A 1P2OA 3BTGE 5GWZA 1BZXE 1PPCE 2RG3A 5AF9H 4A1TA 2HLCA 1TPSA 1PPBH 1BBRE 4P00A 4WH6A 3SZNA 1K28D 3K6ZA 3CP7A 2A7HA 1O3NA 2JETB 4X2WA 1W0JD 1TLDA 1GBKA 4NA7A 2BVXH 6LPRA 2NU1E 2AIQA 1UVPA 1VZQH 1SGYE 1MTSA 2G4TA 2LNCA 4BOHA 2UUYA 5I25A 1C1RA 1GBCA 1TBRH 2O8TA 3GCTG 5KEDA 2ZI2H 4P02A 1TNJA 1LHFH 4IBLH 4OS7A 3SU0A 2Z9IA 3GISB 4FETA 4IS5A 1C1TA 3RXRA 1A1RA 2XRCA 1GBEA 2AGIX 1J14A 1H8ED 2GCTC 2VVVA 1HJAB 2XOKD 3D23A 8KME2 2ZU5A 3W94A 3ZZ6A 1NC6A 2B0FA 3MOCA 1C1OA 1THSH 3RXGA 1BTZA 5EODA 3SU4A 3LC3A 2JH6D 3FO8D 1NRRH 5HGGA 1FAKH 3GCTF 2G81E 2PWXA 1UTJA 2PW8H 3ATIA 7GCHG 1KXDA 1JOUB 5L2YH 2Q6GA 1O2SA 1LO6A 2ZCHP 3SNBA 1UHBA 4MQAA 3ZIAD 3F9HA 2H9TH 4KTCA 2AGEX 1QFKH 1SOZA 2BY7X 1KXAA 1ZTKA 4ISOA 3RUOA 1KXFA 2YMSB 1OSSA 3PLBA 2BDAA 2Y7ZA 3FP7E 3V3MA 1LVOA 4MNWA 3VB5A 1NTPA 2PGQB 2V35A 4ZKNU 1WQVH 1O2LA 4DIHH 1JRTA 1EASA 2XWAA 3UR9A 1VITF 3GY8A 5FX5A 2GZ9A 3UOUA 3UPEA 1UCYH 3F2HA 2WHXA 1GPZA 4INHA 5JYIA 1BHXB 1DY9A 1HCGA 4AFZA 3ZZAA 1O2ZA 2VVCA 3U8TH 7GCHF 5EPYA 1EAUA 2W7UA 1F0RA 1QGFA 4CRGA 4DIIH 3N7DA 1O36A 2F91A 3SHAH 1SGQE 4JK5A 5C5NA 1GMHF 2SGPE 2ESTE 3OY5U 4M7GA 1EAXA 3N99A 1O5DH 5SGAE 4IMQA 1F0UA 1NY22 5EGMA 1YF4A 5EW1H 4X8UH 5FPSA 2ANYA 4HG6A 1BB0B 2L74A 2BY8X 1L1GA 1HIAB 2ULLA 2BYAX 5GNDA 1P03A 2LPRA 3TVJB 3GY7A 4AFQA 1DY8A 3JZ1B 4DT4A 2BVRH 3EAJA 1G3EA 1Y3WA 3M61U 4UE7H 5E0JA 1SGIB 5FX6A 1CGIE 5IDKA 1UMAH 2FYQA 2ZGHA 4OGXA 4BTIB 1IOEA 1E34B 1K1MA 2HNTF 2V3MA 3ZZ9A 5GCHF 3TIUA 2ZDNA 3S7KB 2R2WU 1C1UH 3T29A 2QGRA 5FHTA 1GCTB 1MD7A 4MPXA 8GCHG 1T8OA 4TPIZ 4WMEA 5EQRA 4JK6A 3GY3A 1JMOH 3BSQA 2EQNA 6CHAB 1YLCA 3AW0A 1OKXA 1BJUA 1W0YH 1O2XA 1GDNA 2A4QA 2VIPA 2ZFPH 1A0HB 2RCEA 3T5FH 3T27A 1QHRB 1TA2A 1QA0A 2PV9B 1O5BB 2P95A 2A32A 3SUEA 2OTVA 1EPTB 4FUDA 3F2FA 1HAGE 2BLWA 3RXVA 1WTGH 1SLWB 1SFQB 2ALPA 1O3BA 1N1LA 2VINA 3QO6A 3A82A 1MTNB 1UVOA 1DX5M 1MTWA 1MBMA 1OWIA 3GYLB 1ELAA 1QRXA 1JRSA 1D4PB 1P57B 1DM4B 1MTVA 2CV3A 1TPAE 1DITH 1FY4A 1NRPH 4B6FA 4X1NU 1OPHB 2XC0A 2ZU4A 1YPHC 4B6EA 4Q4LA 1H8DH 2H6MA 2UUJB 1LDTT 4OS5A 5EQQA 1ELBA 3M3VA 1TGCA 1C1SA 2ZA5A 2QIQA 3M35A 3RXSA 5J4SA 1VCWA 3NRLA 4ISIH 1TGBA 1O2VA 2UWPA 1SSXA 2JDID 4B74A 5JPMH 1HUTH 1FIZA 1UTMA 5DPAA 2BX4A 5C1XA 3A8AA 3DCLA 5IYTA 3QX5H 3O8BA 1A3BH 4AYYB 5CMXH 3RU4T 2HRVA 2AS9A 1QBNA 2ZC9H 1YWUA 1N8OB 1G3CA 4CREA 1TRNA 2DE8A 2ALVA 1C5VA 2BDBA 1Y3VA 2BD4A 1DUAA 4TSFD 1C4Y2 1ZHMA 4D8NA 4Y6DA 4ZXXH 1OYQA 1IQKA 1CHOG 1OP0A 1EX3A 3MH7A 2KAIB 3WWFA 5DN6D 1UVTH 3RLYH 4BTUB 1WOFA 1TPPA 5LPEA 2J94A 2AMQA 1GI5A 2C4FH 2ZDAH 2SGAA 2C3SA 3DSOA 4JZIA 1TGTA 2ZQ2A 4X2YA 2TGTA 1C1QA 2OD3B 1SGPE 1PQAA 2RDLA 4O3TA 5JB8S 1HDTH 2FWWA 3KF2A 4YOIA 4NZLA 3D62A 2ZU3A 4NIYA 1GL0E 3F9FA 1CHOF 1TABE 3TPIZ 1GHAG 4B76A 4IC5A 1NFXA 4X1QU 3L33A 3PYHA 2BMGB 3LGWA 2J38A 1AVXA 1T7CA 4FUFA 1UK2A 4Q7XA 3SW2B 3NUMA 2F9BH 3P8NA 2GT8A 5F53A 3S9CA 5DP9A 5BPEA 1UVSH 2VWLA 3H7OA 1GJ8B 1W11U 1ETRH 2BXTH 3PMBB 1RGQA 2PFEA 4AN7A 3HGNA 2ZDLA 1Y3UA 2FOAA 3GDSA 1KDQB 1D3TB 1XVOA 1Z6EA 2QF0A 1KLJH 2JETC 3DFLA 3RMMH 4XE4A 4CRAA 3EYDA 1FY8E 1FY1A 2TRMA 2ODYB 3NCLA 1MH0A 3ZZ5A 3LGVA 1LTOA 4ISHH 3GDUA 5FBIA 1WV7H 2O9QA 5DP5A 1ZGVA 1TQ7B 1G2MA 4XRNA 2JKHA 4ZCNA 1X7AC 4WY3A 1FI8A 2VH6A 3AW1A 3PWBA 2HLDD 1BJVA 4Y79A 3STIA 3HPTB 3SI3H 3EGKH 1GHBG 2XXLA 4TPYA 3ZVFA 4Z6AH 2DE9A 4KP0A 3KQEA 4JMYA 4K5ZA 5E2PA 1EFRD 1DWDH 3OEED 1GHWH 1O2KA 1C2LA 1YY3A 1H4WA 2FP7B 4BAMB 2ZFSA 4YOGA 3NPSA 1UHBB 1SVPA 2VIOA 1V6DA 1RIWB 4MDSA 4IMZA 4Y11E 3DSGA 2OLGA 3QZQA 3SV7A 1W0ZU 5HXFA 5C20A 1C2HA 4CRCA 1AQ7A 1VJAU 4O3UA 3RP2A 1P2QA 4NFFA 2ZKSA 1BITA 1ACBE 3VPKA 4A5TS 1O2RA 1AI8H 1XM1A 1GHBF 2M5TA 1P9SA 3K6YA 1SC8U 3OE7D 1C9TA 1GJBB 4RKJB 3SHCH 2YMSC 1A3EH 3ATLA 5F8ZA 2KFWA 4UFEH 2M2AA 2QN5T 1N6YA 1O38A 3E91A 3QTOH 5FCKA 1T4VH 1O30A 2ZGCA 3HGPA 1GJDB 3GICB 5C0TA 4D9QA 2TGPZ 1TBZH 2ZO3H 1FIWA 3LIWA 4X2VA 1NBME 1T31A 2NWNA 4B2BA 1AY6H 3TK6A 4KTUA 1SQTA 5TJXA 3A83A 3M7UA 3RMOH 3LJJA 3NXPA 5FCRA 3OFND 2OXSA 1Q31A 1C2DA 3F68H 3VXFH 4H6TA 1BMAA 4NSVA 5F8XA 3CENA 4WVPE 1TIOA 2ZIQH 1AU8A 3MU5A 4ZHMU 2VIQA 3LOXA 1K1IA 3RXDA 3SU6A 1ELCA 2P16A 2NU3E 2A5KA 2A45B 2ZEBA 3KIDU 5EQSA 1V2MT 1C2KA 1C1VH 1RD3B 1W2KH 5ETXA 4E05H 3AK5A 2JIZD 1PPZA 4XDEA 5B6OA 1LHGH 3ZVAA 1NRSH 1ZTJA 1W10U 1EZUC 4AC9A 1XUHA 3OX7U 1MTUA 4ZHLU 1FUJA 1CO7E 3DUXH 3P92A 1GCTC 5DP4A 3U8OH 3URDA 2UWOA 1TX8A 2ZU1A 1O5CB 1IQHA 1KY9A 1GG6B 3ZZ7A 1W8BH 4AGJA 2ZHQH 1H9IE 1O3PB 3FAOA 6CHAC 3FVFB 1BRUP 3A89A 2BDYA 2Z3EA 3FP8E 3U1JB 2I6SA 2FO9A 3U8RH 1Z6JH 1BCUH 1ESAA 1TRYA 3Q3XA 5F03A 3SO3A 4RT0A 1BMFD 2CF8H 4B2CA 1DDJA 3M3SA 3M7QA 2B5TB 1YCPM 1OXGA 1VJ9U 4UFGH 4WMDA 3H5CB 3QGJA 3OY6U 1MZAA 1MTNC 3RXQA 5GIBA 4INLA 2ZG0H 1PPHE 1E0FD 2EY4C 1Y3YA 2SGQE 2G52A 2A5AA 1K21H 3UY9A 1DLEA 3OYPA 1SGCA 1S6FA 1TOCB 1TMTH 1AB9B 4K8BA 2P3UB 1V2NT 1D3QB 2ZZUH 1A46H 3A7ZA 2Y81A 3BG4B 3IWMA 1DLKB 1BOQA 1FNIA 1O35A 3BTEE 1GWAA 2FI5E 1HJ8A 2ODQA 4Y71A 2CGAA 1GI6A 3ODDA 1P02A 3ZVEA 2IJOB 1DXPA 1J17T 3R3GB 1LVBA 4X2XA 2VWMA 2PSYA 1EP5A 2BTCE 1W7GH 2OCVB 3T62A 1SQOA 2WPHS 4Y0YE 1KIGH 2IOTA 1O3JA 1S84A 2AFQB 2FM2A 3SUFA 3VFEA 3VGCB 2F3CE 1NRNH 5GXPA 2FEQH 2WV5A 2ZFRH 3A88A 1C2EA 1AKSB 4AB8A 1O3IA 5CHBA 1EOJA 2D26C 1SQRA 1TNGA 4U01A 1NT1A 1TMBH 2BVSH 1O2JA 1N8OC 2L6OA 3DFJA 3QN7A 1GVLA 1UTKA 1TBQH 3C27B 3GCHB 1W13U 2YMSD 4ACAA 3EQ0H 4A1VA 3SUGA 4NIXA 3RXOA 4NWLA 1WQSA 1C9PA 1E36B 1LKAA 1KXCA 2VWOA 2NU2E 4H42U 3STJA 3LGUA 1LHEH 4X1RU 1GBIA 1S83A 1KMHB 1GVZA 1YPLH 5TCCA 4IW4E 3SN8A 3LGIA 1BBRH 1H9LB 1KDQA 1SGNE 1DFPA 3A80A 3TJOA 4JZFH 2RDEA 1GBTA 4WF8A 2QC2A 3KQDA 5EW2H 1DE7H 4I31A 1GMDG 7LPRA 1EAWA 1E38B 4DURA 3T25A 5C2ZA 1ZGIA 2GKVE 2F9PA 1EOLA 3F2GA 2FS9A 3BG8A 3OAAD 4X0WU 1EZXC 1B7XB 3I77A 2ASUB 1F5LA 1DOJA 1GBFA 1K9OE 2K8IA 2FDAA 1EAIA 4A7IB 1UJ1A 3BTME 1QURH 3OTJE 1AZ8A 4O97A 3UIRA 1XKBC 2XNIA 2H2ZA 5EIYA 1IQFA 1GBHA 2B9LA 1XUFA 2KCPA 2J97A 2XW9A 3CS0A 1GMDF 3ZZDA 3PB1E 1ETTH 4MNXA 4LOYH 2Y80A 3URCA 4ZROA 5A09A 4CBNA 1U6QA 1KTSB 1C2FA 1QIXB 1V2KT 1GBBA 4B1TA 1S5SA 3PTBA 2NU0E 1GHZA 3KQ5A 1QL9A 1KYNA 2RFKC 1EQ9A 2GMTB 3BTHE 3ZV8A 1BTXA 1C5YB 3SNDA 1T8MA 1F92A 5T6GA 4YOJA 2HPPH 4WMFA 3HK3B 2WV4A 2WPDD 3BTFE 4BXWA 1MKWK 1Y5UT 1D9IA 1E79D 1P11E 5T6DA 1K1PA 1IQMA 5H4IB 4OM9A 1Y8TA 2HNTC 2I6QA 3MFJA 4Q63A 3SV6A 2OQ5A 3F9GA 4GHTA 1QZ8A 1LHCH 5A8XA 2GP9B 2F83A 2BD3A 1ZMLA 2GZ7A 1RFNA 4TYDA 2EA3A 1VKYA 3PV2A 4WXIA 1LMWB 2QY0B 1RIWC 3H7TA 3P6ZB 2PTCE 3DSPA 4OS1A 1BTWA 2TIOA 2FOBA 2YNAA 1A2CH 3M5NA 3SU1A 4FUHA 2BQ6B 4ZMAH 3BEUA 3MU1A 1ARCA 4ZKSU 1TNLA 2ZFTA 1QL8A 4FUEA 1P8VC 3A8CA 1RXPA 1LPKB 3VXEH 3ZZ3A 5AFZH 3DHKH 1CT4E 2PUXB 3E0NB 5GJ4B 4FUGA 5C3NA 3MO3A 3PMJA 1O32A 3SOSA 1O39A 2BDGA 3ZZ4A 5C17A 3QLPH 1C2IA 3BF6H 4KKDA 1TONA 3O8DA 4DCDA 3KQCA 2V3OH 2GT7A 3WWBA 4NGAH 2THFB 2Z7FE 2ZHWH 4Q7YA 1O2QA 1YM0A 2SGDE 3MI4A 2OC0A 2BLQA 3E16B 5EXMA 2HALA 5T3HA 3ZYEA 2C8WB 1QJ1B 3BTQE 2CHAB 4YXWD 1GI1A 2ZDVH 4HGCA 1CA0C 1G3DA 1QR3E 3P8GA 4MPWA 2EI6A 2F9OA 5JBTA 5AVDA 1HAZB 2AMDA 3D65E 1O3KA 5EU8A 3W95A 3FOAA 4DOQA 4XSKU 1O2OA 3S7HB 3MH6A 3K65B 2CF9H 3RLWH 3RMNH 8GCHF 1A61H 1TWXB 1O2GH 5FXLA 1EB1H 4CRFA 1YKTA 3FZZA 1HRTH 2FLRH 1LPGB 1ZRKA 2BZ6H 3ODFA 5PTPA 3UOPA 3AAUA 1HV7A 1DSUA 4INKA 1GI0A 2FI4E 2GX4A 2PKAA 1QQ4A 1CVWH 4IC6A 4YLQH 3RXIA 7KMEH 2VIVA 1RJXB 1L4DA 4Z1MD 4Q2KA 4BAOB 4DJZB 1LCYA 4CBOA 3HKJB 2JH0D 1MAYA 1YC0A 4K60A 2KCYA 3G01A 1PQ8A 1FN8A 1SOTA 3KQBA 3I78A 4FVDA 1C5NH 1P9UA 4KELA 1YPKH 1NESE 4IGDA 3RU4E 1GG6C 3TH2H 1P10A 1JIMA 1O3DA 2WPJS 1RRKA 1S0QA 4NA8A 3DD2H 1CU1A 3K2UA 4RI0A 1GBLA 4D7FA 1PYTC 3SJKA 3ATKA 2A4GA 3MWIU 2VIWA 2R2MB 2ODPA 1L1JA 1TFXA 3GOVB 4RKOB 1GI4A 1C5UA 1PPGE 4GSOA 2AMPA 1B0FA 2DUCA 3RC4A 1AKSA 1GHVH 1O37A 2F4LA 1F0SA 5DO4H 4GLYA 4M9FA 3SJ9A 1C4V2 2G51A 3ATWA 1MKXK 2GDEH 3SNCA 2TGAA 1ANCA 3A7XA 1A0JA 1LQEA 1S82A 2C8ZB 4FU7A 4BANB 1AO5A 1TMUH 2XBVA 4GPGA 3OEHD 1AB9C 4YM9A 6ESTA 3ESTA 1KXBA 4FUJA 1HB0B 1C4U2 1FY5A 4BNRA 2QXGA 5FPYA 3UNRA 3BG4C 3U28C 2ZTZA 5C67A 4I8JA 5C94A 3SJ8A 4B75A 1WYKA 3GY5A 1XX9A 5ESTE 3S9AA 4Z0KA 1C5QA 2H5CA 2ZHDA 3B8JA 1C5OH 1K1JA 4KTSA 1F2SE 1TX7A 2RA0A 3TJVA 1QB1A 1UO6A 4MPUA 4CH2B 3CS7A 4I86A 1ZTLA 3F9EA 3VGCC 2GTBA 1OOKB 8LPRA 1DT2A 3TGIE 3P8OA 4ISLA 2A2QH 3UAIC 4MNVA 3MQKC 1IQNA 4FUBA 4OS2A 2WPLS 3PWCA 1G2LA 4SGBE 3BTTE 1GJ5H 1S6HA 2BD8A 1SGEE 4OS4A 3GCHC 1MKWH 4XOJA 1G9IE 1V2RT 3SU2A 1V2QT 4BAHB 3U9AH 4RT1A 1H8IH 1YCPK 1XMNB 2J9NA 2ZPRA 3U1IB 4ABGA 1AE5A 3PV4A 2GVFA 2OC8A 4A6LA 1PFXC 1BA8B 1GHAF 1QJ7B 3SJOA 3NWUA 5HM9A 4FUCA 1MMJN 1WBGB 1O3FA 2GV7A 5EG4A 4X8VH 5DG6A 2BQWB 2BM2A 3ATMA 2AEIH 1EUFA 4DT7B 1GI2A 2HPQH 1A0LA 1P12E 2J2UA 2UUFB 2C8XB 2V7QD 4Y8ZA 5DP6A 1GBAA 2J5UA 1GJCB 3SGAE 1F7ZA 2HVXA 1GJ7B 1O33A 3ZVDA 1SGFA 1YPJH 2FODA 1MU8B 3E3TA 3P70B 4UEHH 5L30H 3SQHE 2WPMS 5EXLA 1UTNA 5B6LA 2KCAA 6GCHG 1AGJA 1NFYA 1NU7B 1C5PA 3WY8A 1H9HE 4AOQA 2VH0A 1SL3A 1AFQB 1AUTC 2R0LA 3SORA 1BTHH 2Z9GA 3RC5A 1QNJA 1UK3A 2BLOA 5DP3A 3P8FA 4AFUA 4BAKB 1ESBA 4B73A 4F49A 2XC4A 3ENSB 3OSYA 4NSYA 1Z1JA 1AZZA 1WXRA 5HM2A 2VVUA 2F43B 1KLIH 1XVMA 3GS9A 1VGCC 4NWKA 1A7SA 1W3CA 1THRH 4ZKRU 5JBCS 2BDCA 2OBOA 1Q3XA 2ANKH 2QYIA 2W5EA 3TK9A 1NROH 1XXFA 3KEEA 2FXRA 3GCNA 1SMFE 2GMTC 6GCHF 1ZPZA 1YYY1 4JZDH 1NU9A 1A5GH 1ZYOA 3E1XB 4X1SU 2BOHB 1ZMNA 1MQ6A 3QK1A 1V3XA 1WAYB 1UTLM 2XC5A 3NZIA 3A8BA 4JCNA 3LGYA 2TBSA 3SYJA 2PR3A 2BY6X 1KLTA 1ZPBA 1DWBH 4X8SH 3QUMP 2STBE 2FLBH 3ZV9A 4U30A 3MH4A 1VCPA 1BIOA 3C1KA 4AZ2B 1J16A 3KHVA 1CA0B 1PYTD 4H4FA 1P2JA 1QL7A 5JBBS 1E35B 3FP6E 1PJPA 2Y6TA 1QTFA 1QQUA 4CH8B 1IHTH 3PLPA 1SFIA 1DUEA 2ZF0H 2OQUA 3F1SB 5CHAB 1Z8JB 5ESBA 1Z7KA 2G4UA 1SLUB 4B71A 4JZEH 3LH1A 3F3BA 1SB1H 1K22H 1KSNA 2KR7A 1B5GH 3PLKA 1LHDH 1UK4A 3TGJE 2BB4A 4R8TB 3L3TA 2Z3DA 1HXFH 4UFDH 3AAVA 1FY3A 1ELVA 1D3DB 1Z71A 1NO9H 4NIVA 2AH4X 1GMCG 2P3FH 2PHBA 3ZVCA 3PO1B 1C5TA 1C1WH 1G3BA 3RMLH 2ZU2A 5A0AE 1ZMJA 1GDQA 4R0IA 4UFFH 1WU1A 2D1JA 3QDZB 1HAVB 3TITA 1BHXF 1COWD 2ZNKH 5LPRA 2BLVA 5KGOA 2FOCA 1CSOE 1E37B 2GDDA 1YPMH 2KZ4A 5TCAA 1MKXH 2OUAA 2A5IA 1ARBA 2A1DB 2AGGX 1C5SA 1OYTH 1VR1H 1BTYA 2CHAC 3LPRA 2W3IA 2B7DH 1IQLA 2IJD1 3PRBA 3MNBA 4I8LA 3EA8A 4YO9A 1O3HA 2BY9X 3B9FH 4K1TA 3SZEA 4J2YB 2VU8E 1GL1A 3LONA 2PKAB 1RTKA 2PLXA 3RXJA 1YP9A 3RXFA 1EXFA 1KXEA 1O5AB 1MUEB 1XUJA 2FTMA 2RA3A 1K1OA 4TT3D 4JYUH 2J92A 2SGFE 3N7OA 5DGJA 5HIYA 4J1YA 1QRWA 1LKBA 4NA9H 2ZGJA 4A92A 1ZSKA 1K0HA 5F6MA 2Q6FA 2BY5X 4O9VA 2KM0A 4PROA 1JIRA 2A2XH 3UNQA 2G55A 3F0OA 5LGOA 1FV9A 3SU5A 4YTAA 4NCYA 2OK5A 1ZHRA 2PUQH 2O8MA 3TK5A 1AIXH 2IN2A 1P06A 3TGKE 5DKMA 1SGRE 2QF5A 1FONA 1GCDA 2BD9A 1WCZA 3D49H 2CN0H 1QRZA 1DICA 5GPIB 3BN9A 3MNXA 3PV5A 2PKSB 3UR6A 2PP6A 2CXVA 4NIWA 3SUDA 1T4UH 1O2YA 1QCPA 2YNBA 2FOFA 1DSTA 3KYGA 3ZZ8A 2R3UA 3ZZCA 5A2MH 2V0BA 4DW2U 1P04A 4CRBA 1IQIA 1TRMA 1YCPH 3A86A 3UREA 1PPFE 3RXCA 1O3AA 3U69H 5A8ZA 9LPRA 4U32A 2FIRH 1ZZZA 4ZUHA 2XBWA 3FKSD 5BRRE 1T32A 1DWCH 2BHGA 1MU6B 4E06H 5JDUB 2GZ8A 4ZH8A 2A7CA 2ZTXA 3S9BA 2C93B 5E0GA 1AVGH 5DK1A 1FMGA 1D6WA 3T28A 4I33A 3UQOA 4ASUD 4HTCH 4OS6A 1JBUH 4X8TH 8ESTE 2KX4A 2HWLB 1FPCH 3BIUH 2VB0A 4LK4A 3RXBA 2FMJA 1V2VT 4THNH 4WXVA 1GGDB 1GI9B 1V2ST 1LVYA 3VG8A 1J8AA 3LT3A 2V6NA 1ANEA 1V2LT 3A81A 5E8EH 4I8GA 1Y5AT 1CBWB 2NU4E 1LQDB 3A7VA 3VB3A 2F9VA 3UQVA 1J15A 3RXTA 1HAPH 1CHGA 1QA7A 4Y7BA 1GDUA 3FN8A 2QCYA 2CK3D 3RC6A 4XD7D 3IITA 2W6JD 1Y5BT 2BZAA 1FXYA 1FQ3A 1OWJA 3VB7A 2OINA 4FU9A 5EJLA 1M9UA 3LU9B 2BOKA 1HFDA 3V0XA 2Q1JA 2EC9H 5HMAA 3RXPA 1GI3A 3S69A 3GY4A 1LPZB 3KCGH 2ZCLP 3JZ2B 5C1YA 1BUIA 3RXHA 3AVZA 2WSSD 1TB6H 4GUXA 2OBQA 4AFSA 3M3TA 4Y8YA 5JBAS 5C5OA 1XUIA 4Y76A 1SBWA 1WSSH 3V13A 1EJMA 1P0SH 1UVUH 4X6PA 4ABBA 2Z9JA 4WWYA 3BTDE 1SR5C 1VGCB 1RTFB 4MG3A 1VITG 2Z9KA 1MZDA 5AHGH 4Y0ZE 5C0UA 2VGCB 4K3JA 3A85A 3QTVH 1UTQA 3LH3A 3I29A 4I8KA 3Q76A 4ZHAA 5EJZA 2QAAA 1C5WB 1PPEE 1SHYA 2P8OB 4ISNA 3O8RA 1CA8B 2ZGBH 3M37A 3RDZA 2ZFQH 3AASA 3N7EA 1GMHG 4ZXYH 2ANMH 3H09A 1UCYE 1P3CA 2EI8A 1O3OA 1HPGA 2Q6DA 1CT2E 2FOHA 1Q2WA 4LXBH 1INCA 4SGAE 1BRAA 4ABDA 4IN2A 3BIVH 4FOUC 2Y5GA 2H5DA 5DSFA 1CQQA 4D76A 2J34A 3R0FA 1DPOA 1TNIA 2Z94A 4I8HA 3NK8A 3SU3A 3V7TA 1HAXB 5ABWA 2XTTB 5FL7D 3VEQB 1AFQC 1WTHD 1NN6A 1YPHE 3MNSA 2STAE 1C2GA 5F8TA 3Q77A 1MAXA 3PROA 3HATH 1ZR0A 1OWEA 2AERH 4Q7ZA 4MLFB 1P01A 1GHYH 4YT6H 1CGHA 2A31A 3BTWE 3MU4A 1EZQA 1GI8B 2QXIA 4TY6A 3TU7H 3E6PH 1PQ7A 1EJNA 1NBMD 1RTLA 1BMNH 4VGCB 5GCHG 2ZPQA 1P2NA 1V2TT 2BD2A 2FX4A 1J9CH 4ABHA 5EOKA 4X6OA 1K1NA 3A7WA 1EP6A 1O2TA 4QT8C 2F9UA 3GY6A 1O2UA 3RXAA 2QA9E 2FTLE 2BD5A 1O3GA 3RXMA 1AFEH 3TH3H 1FJSA 2SGEE 4AGKA 3MO9A 2BDHA 2WPIS 2SNWA 4CHAB 4I7YH 2A7JA 1OP8A 3SGQE 3Q00A 4D7GA 4A1XA 1H8HD 1TNHA 4TWWA 1GJ4H 2FI3E 2WUBA 1C2MA 1AE8H 1Z8GA 3RXUA 1HAVA 1VCQA 5A8YA 4HFPB 4K1EA 1EJAA 5J4QA 3F6UH 5G4BA 2G8TA 2Z9LA 1SG8B 2A4RA 3SBKA 3UNSA 3A8DA 2A0QB 4UONA 1O3MA 1UTPA 5EXNA 1P05A 5CHAC 3PTNA 4DY7B 3A7TA 3LKWA 2QF3A 1DVAH 2V3HH 2XBYA 2GCHG 4K1SA 3M5OA 5GDSH 4ABFA 3UFAA 5L2ZH 3GCOA 4RSPA 1HYLA 3SNAA 4H6SB 2QXHA 4JYTA 1ZSLA 1L0ZA 2AYWA 2XNDD 1L2EA 5FBEA 3PO1C 1K1LA 1NRQH 1GBDA 2UUKB 1AWHB 3PRDA 1O2PA 4E7NA 4K8YA 2QF4A 2H9HA
chains in the Genus database with same CATH topology
4ABEA 2G5NA 3M5MA 3M36A 1OP2A 1O3EA 9ESTA 2ILNA 3MO6A 2B8OH 3RXEA 4UDWH 2Y5HA 4DG4A 3PMHB 4XBCA 2GCHF 1NFUA 1ELFA 1JWTA 3ZZBA 1IQJA 4GHQA 1FLEE 1ORFA 1HJ9A 1O5GH 2P93A 1HAOH 4MVNA 1ID5H 1ELGA 2HGTH 1NS3A 1TAWA 4TWYA 3PMAB 4DVAU 5JB9S 2XBXA 2VWNA 2ZCKP 2Y7XA 1BMMH 3EE0B 2XWBI 2VJ1A 3SV8A 1D3PB 1C1MA 2BDIA 1ELEE 1P2IA 3FANA 1S81A 1EATA 1G37A 1G30B 2OC7A 5AFYH 3MYWA 2A4OA 1C5ZB 2ZDKA 1Y3XA 5I46H 3BEFB 3GDVA 1C2JA 4AORA 1BDAA 1T8NA 3B23B 5A0BA 3FZDA 4YLUA 2J95A 1SGDE 2R9PA 1QB9A 1ZSJA 1YGCH 3UTUH 4X1PU 1IAUA 5LPFA 4D9RA 2UWLA 3U98H 2GGVB 1XKAC 4FUIA 1SHHB 1S0RA 1SI5H 2P3TB 1V2WT 2PKSC 2TGDA 1GJAB 2EI7A 4DGJA 1EZSC 1O5FH 2H9EH 2GD4B 4ZAEA 1RS0A 1S85A 1SLXB 2H1UA 1O34A 5K0HA 1NFWA 4MTBA 1IHSH 4YT7H 3BTKE 4FXGH 3QWCH 1D6RA 1Z1IA 1DS2E 1A5HA 3T2NA 1O2WA 2GCTB 3UWJH 3KNXA 2G00A 2VNTA 3BV9B 3EA9A 2C8YB 3P95A 3EDXB 4RN6A 1XUKA 1JXPA 2ZGXH 1MD8A 2J4IA 4TY7A 4NG9H 5A0CA 1ZLRA 3KN2A 1L1NA 4WJG2 3SNEA 2FOMB 1K2I1 1T8LA 3BEIB 1BTPA 1TNKA 3RXLA 1GBMA 3GYMA 2Z6BD 3MH5A 2BX3A 2ZWLH 1HXEH 1MCTA 1GGDC 3VB4A 2P94A 1F5KU 2R3YA 1O2MA 1TQ0B 2FS8A 1O2IA 1L4ZA 1EKBB 1HLTH 1O31A 1AN1E 4E7RG 2W26A 2ZTYA 4ESTE 1GVKB 1CBWC 1SLVB 5L6NH 3LC5A 1MCVA 2CMYA 1AD8H 4GAWA 1ZJDA 1C5MD 1SQAA 1HAYB 2O8UA 3T26A 5CE1A 1F0TA 3TNSA 3KGPA 1OWKA 1QBOA 3V12A 5DJ7A 1MQ5A 1NM6A 2ZHFH 3EA7A 2PSXA 4Y8XA 1GJ6A 2WYGA 1V2UT 2YOLA 2WINI 1QY6A 1TGSZ 1LVMA 2ZHEH 1CE5A 1HAIH 2Y82A 1TPOA 2FZZA 2AIPA 2D8WA 4K69A 1HJAC 2OP9A 2FYRA 1ESTA 3MU8A 1KTTB 1GBJA 2WPKS 3K9XB 1O2HA 2FESH 4LZ1H 1BRBE 3RM0H 2BQ7B 1ABJH 1EB2A 1BBRK 4ASHA 4JYVH 1O3CA 1XXDA 4HZHA 2PTNA 5DP7A 1SGTA 4KGAA 5T6FA 1FPHH 3P17H 2VGCC 1GI7B 4U2WA 3A7YA 1HAHH 1ELTA 3PM3A 1TX6A 2O8WA 4BTTB 1FZZA 3MTYA 2P8OC 3TJUA 4NZQA 1BMLA 1W14U 1WUNH 3ITIA 1C5RA 3LJOA 1HIAA 1Y59T 1BRCE 4AG1A 4FU8A 1A5IA 2ZP0H 4Q80A 4B2AA 4ABAA 3ZVBA 2O8LA 2FOGA 2ZQ1A 3FFGA 1FDPA 4ABIA 1C1PA 1OWDA 1ZJKA 4O03A 1HBTH 2C90B 2SFAA 5FPTA 1P2KA 4XBDA 4Y10E 4AYVB 4NFEA 4FVBA 2ANWA 2ZFFH 4AG2A 3TJNA 1TOMH 2F9NA 1O3LA 1V2PT 4I32A 1N6XA 4F4OC 5EPNA 1SGFG 1BTUA 1ANDA 3QZRA 7ESTE 2SNVA 4YZUA 2R0KA 1AVWA 2FX6A 4JZ1A 1A4WH 3A87A 1QBVH 4GVUA 3L6PA 2WYJA 3TLOA 2ZPSA 4LZ4B 1UTOA 1UCYK 4VGCC 3TNTA 1TALA 1V2OT 1ZPCA 3Q3YA 3UWIA 1O0DH 3M7TA 1O5EH 1FN6A 1DANH 2D2DA 1EPTA 2K1QA 3HK6B 4AB9A 2HOBA 5FAHA 3ELAH 1THPB 2CJIA 1FAXA 2Z3CA 4YESB 4XBBA 1ETSH 4CHAC 3VB6A 1AHTH 3HKIB 4HI3A 2FOEA 2QV1A 3SGBE 1PQ5A 1BQYA 1GMCF 3SQEE 1OX1A 1H1BA 2BXUH 1B0EA 2W7SA 1YLDA 4MNYA 2Y5FA 3Q3KA 1GJ9B 1OS8A 2XYAA 3MHWU 1O2NA 5HYOA 1ABIH 1BT7A 3TH4H 5E0HA 1QJ6B 3MU0A 2IPHA 1MBQA 1Z8IB 2JH5D 3SV9A 1G32B 1TGNA 2WUCA 1ZRBA 1P09A 1YPGH 3A84A 1OWHA 2OC1A 1P2MA 1C5XB 1G36A 4X6NA 1DWEH 3E0PB 1NZQH 3RU4D 5E2OA 1AWFH 2EEKA 3S0NA 3O8CA 3E90B 4ZKOU 1EPTC 1GHXH 1YPEH 3RM2H 4ABJA 3OU0A 4Y7AA 1SPJA 1IQEA 1XUGA 3SV2H 1ELDE 1VITH 3LGTA 1F5RA 4IN1A 1TA6A 3SI4H 1Z8RA 3NKKA 1ANBA 1IQGA 3LDXH 4GCHG 3SJIA 1YBWA 2XCFA 1QB6A 1AMHA 1V2JT 3QGNB 2BD7A 4UD9H 4CR5A 1P3EA 1C5LH 3MNCA 2XCNA 5K7RA 5DP8A 3GY2A 1NPMA 1CGJE 2KAIA 3RXKA 3ZYDA 3E8LA 4K2YA 1C1NA 1AUJA 1HGTH 3KL6A 4OGYA 4BAQB 1TYNA 3IG6B 3ZVGA 4MPVA 3DA9B 2PGBB 2QXJA 1W7XH 3MMGA 2VIDA 2P59A 4AX9H 1DXWA 4XFQA 1CT0E 1ZHPA 4X6MA 4GCHF 4CR9A 2TPIZ 3M5LA 2ZECA 4WH8A 1ZOMA 4BXSA 2W3KA 2GV6A 2HNTE 3UUZA 1W12U 1TE0A 2ZDMA 3DT0H 4CRDA 2FPZA 5C1UA 2G5VA 1HNEE 5LH8A 1P2OA 3BTGE 5GWZA 1BZXE 1PPCE 2RG3A 5AF9H 4A1TA 2HLCA 1TPSA 1PPBH 1BBRE 4WH6A 3SZNA 1K28D 3K6ZA 3CP7A 2A7HA 1O3NA 2JETB 4X2WA 1TLDA 1GBKA 4NA7A 2BVXH 6LPRA 2NU1E 2AIQA 1UVPA 1VZQH 1SGYE 1MTSA 2G4TA 2LNCA 4BOHA 2UUYA 5I25A 1C1RA 1GBCA 1TBRH 2O8TA 3GCTG 2ZI2H 1TNJA 1LHFH 4IBLH 4OS7A 3SU0A 2Z9IA 3GISB 4IS5A 1C1TA 3RXRA 1A1RA 2XRCA 1GBEA 2AGIX 1J14A 2GCTC 2VVVA 1HJAB 3D23A 8KME2 2ZU5A 3W94A 3ZZ6A 1NC6A 2B0FA 3MOCA 1C1OA 1THSH 3RXGA 1BTZA 5EODA 3SU4A 3LC3A 2JH6D 1NRRH 5HGGA 1FAKH 3GCTF 2G81E 2PWXA 1UTJA 2PW8H 3ATIA 7GCHG 1KXDA 1JOUB 5L2YH 2Q6GA 1O2SA 1LO6A 2ZCHP 3SNBA 1UHBA 4MQAA 3F9HA 2H9TH 4KTCA 2AGEX 1QFKH 1SOZA 2BY7X 1KXAA 1ZTKA 4ISOA 3RUOA 1KXFA 1OSSA 3PLBA 2BDAA 2Y7ZA 3FP7E 3V3MA 1LVOA 4MNWA 3VB5A 1NTPA 2PGQB 2V35A 4ZKNU 1WQVH 1O2LA 4DIHH 1JRTA 1EASA 2XWAA 3UR9A 1VITF 3GY8A 5FX5A 2GZ9A 3UOUA 3UPEA 1UCYH 1GPZA 4INHA 5JYIA 1BHXB 1DY9A 1HCGA 4AFZA 3ZZAA 1O2ZA 2VVCA 3U8TH 7GCHF 5EPYA 1EAUA 2W7UA 1F0RA 1QGFA 4CRGA 4DIIH 1O36A 2F91A 3SHAH 1SGQE 4JK5A 5C5NA 1GMHF 2SGPE 2ESTE 3OY5U 4M7GA 1EAXA 1O5DH 5SGAE 4IMQA 1F0UA 1NY22 5EGMA 1YF4A 5EW1H 4X8UH 5FPSA 2ANYA 1BB0B 2BY8X 1L1GA 1HIAB 2ULLA 2BYAX 1P03A 2LPRA 3TVJB 3GY7A 4AFQA 1DY8A 3JZ1B 2BVRH 3EAJA 1G3EA 1Y3WA 3M61U 4UE7H 5E0JA 1SGIB 5FX6A 1CGIE 5IDKA 1UMAH 2FYQA 2ZGHA 4OGXA 4BTIB 1IOEA 1E34B 1K1MA 2HNTF 3ZZ9A 5GCHF 3TIUA 2ZDNA 3S7KB 2R2WU 1C1UH 3T29A 2QGRA 5FHTA 1GCTB 1MD7A 4MPXA 8GCHG 1T8OA 4TPIZ 4WMEA 5EQRA 4JK6A 3GY3A 1JMOH 3BSQA 6CHAB 1YLCA 3AW0A 1OKXA 1BJUA 1W0YH 1O2XA 1GDNA 2A4QA 2VIPA 2ZFPH 1A0HB 2RCEA 3T5FH 3T27A 1QHRB 1TA2A 1QA0A 2PV9B 1O5BB 2P95A 2A32A 3SUEA 2OTVA 1EPTB 4FUDA 1HAGE 2BLWA 3RXVA 1WTGH 1SLWB 1SFQB 2ALPA 1O3BA 1N1LA 2VINA 3QO6A 3A82A 1MTNB 1UVOA 1DX5M 1MTWA 1MBMA 1OWIA 3GYLB 1ELAA 1QRXA 1JRSA 1D4PB 1P57B 1DM4B 1MTVA 2CV3A 1TPAE 1DITH 1FY4A 1NRPH 4X1NU 1OPHB 2XC0A 2ZU4A 1YPHC 1H8DH 2H6MA 2UUJB 1LDTT 4OS5A 5EQQA 1ELBA 3M3VA 1TGCA 1C1SA 2ZA5A 2QIQA 3M35A 3RXSA 5J4SA 1VCWA 4ISIH 1TGBA 1O2VA 2UWPA 1SSXA 4B74A 5JPMH 1HUTH 1FIZA 1UTMA 5DPAA 2BX4A 5C1XA 3A8AA 5IYTA 3QX5H 3O8BA 1A3BH 4AYYB 5CMXH 3RU4T 2HRVA 2AS9A 1QBNA 2ZC9H 1N8OB 1G3CA 4CREA 1TRNA 2DE8A 2ALVA 2BDBA 1C5VA 1Y3VA 2BD4A 1DUAA 1C4Y2 1ZHMA 4D8NA 4Y6DA 4ZXXH 1OYQA 1IQKA 1CHOG 1OP0A 1EX3A 3MH7A 2KAIB 1UVTH 3RLYH 4BTUB 1WOFA 1TPPA 5LPEA 2J94A 2AMQA 1GI5A 2C4FH 2ZDAH 2SGAA 2C3SA 4JZIA 1TGTA 2ZQ2A 4X2YA 2TGTA 1C1QA 2OD3B 1SGPE 1PQAA 2RDLA 4O3TA 5JB8S 1HDTH 2FWWA 3KF2A 4YOIA 4NZLA 3D62A 2ZU3A 4NIYA 1GL0E 3F9FA 1CHOF 1TABE 3TPIZ 1GHAG 4B76A 4IC5A 1NFXA 4X1QU 3L33A 3PYHA 2BMGB 3LGWA 2J38A 1AVXA 1T7CA 4FUFA 1UK2A 4Q7XA 3SW2B 3NUMA 2F9BH 3P8NA 2GT8A 3S9CA 5DP9A 5BPEA 1UVSH 2VWLA 3H7OA 1GJ8B 1W11U 1ETRH 2BXTH 3PMBB 1RGQA 2PFEA 4AN7A 3HGNA 2ZDLA 1Y3UA 2FOAA 3GDSA 1KDQB 1D3TB 1XVOA 1Z6EA 2QF0A 1KLJH 2JETC 3DFLA 3RMMH 4XE4A 4CRAA 3EYDA 1FY8E 1FY1A 2TRMA 2ODYB 3NCLA 1MH0A 3ZZ5A 3LGVA 1LTOA 4ISHH 3GDUA 5FBIA 1WV7H 2O9QA 5DP5A 1ZGVA 1TQ7B 1G2MA 2JKHA 1X7AC 4WY3A 1FI8A 2VH6A 3AW1A 3PWBA 1BJVA 4Y79A 3STIA 3HPTB 3SI3H 3EGKH 1GHBG 2XXLA 4TPYA 3ZVFA 4Z6AH 2DE9A 4KP0A 3KQEA 4JMYA 4K5ZA 5E2PA 1DWDH 1GHWH 1O2KA 1C2LA 1H4WA 2FP7B 4BAMB 2ZFSA 4YOGA 3NPSA 1UHBB 1SVPA 2VIOA 1V6DA 1RIWB 4MDSA 4IMZA 4Y11E 2OLGA 3QZQA 3SV7A 1W0ZU 5HXFA 5C20A 1C2HA 4CRCA 1AQ7A 1VJAU 4O3UA 3RP2A 1P2QA 4NFFA 2ZKSA 1BITA 1ACBE 3VPKA 4A5TS 1O2RA 1AI8H 1XM1A 1GHBF 2M5TA 1P9SA 3K6YA 1SC8U 3SHCH 1C9TA 1GJBB 4RKJB 1A3EH 3ATLA 5F8ZA 4UFEH 2QN5T 1N6YA 1O38A 3E91A 3QTOH 5FCKA 1T4VH 1O30A 2ZGCA 3HGPA 1GJDB 3GICB 4D9QA 2TGPZ 1TBZH 2ZO3H 1FIWA 3LIWA 4X2VA 1T31A 2NWNA 4B2BA 1AY6H 3TK6A 4KTUA 1SQTA 5TJXA 3A83A 3M7UA 3RMOH 3LJJA 3NXPA 5FCRA 2OXSA 1Q31A 1C2DA 3F68H 3VXFH 4H6TA 1BMAA 4NSVA 5F8XA 3CENA 4WVPE 1TIOA 2ZIQH 1AU8A 3MU5A 4ZHMU 2VIQA 3LOXA 1K1IA 3RXDA 3SU6A 1ELCA 2P16A 2NU3E 2A5KA 2A45B 2ZEBA 3KIDU 5EQSA 1V2MT 1C2KA 1C1VH 1RD3B 1W2KH 5ETXA 4E05H 5B6OA 1PPZA 4XDEA 1LHGH 3ZVAA 1NRSH 1ZTJA 1W10U 1EZUC 1XUHA 3OX7U 1MTUA 4ZHLU 1FUJA 1CO7E 3DUXH 3P92A 1GCTC 5DP4A 3U8OH 3URDA 2UWOA 1TX8A 2ZU1A 1O5CB 1IQHA 1KY9A 1GG6B 3ZZ7A 1W8BH 4AGJA 2ZHQH 1H9IE 1O3PB 3FAOA 6CHAC 3FVFB 1BRUP 3A89A 2BDYA 2Z3EA 3FP8E 3U1JB 2I6SA 2FO9A 3U8RH 1Z6JH 1BCUH 1ESAA 1TRYA 3Q3XA 5F03A 3SO3A 2CF8H 4B2CA 1DDJA 3M3SA 3M7QA 2B5TB 1YCPM 1OXGA 1VJ9U 4UFGH 4WMDA 3H5CB 3QGJA 3OY6U 1MZAA 1MTNC 3RXQA 5GIBA 4INLA 2ZG0H 1PPHE 1E0FD 1Y3YA 2SGQE 2G52A 2A5AA 1K21H 3UY9A 1DLEA 3OYPA 1SGCA 1S6FA 1TOCB 1TMTH 1AB9B 4K8BA 2P3UB 1V2NT 1D3QB 2ZZUH 1A46H 3A7ZA 2Y81A 3BG4B 3IWMA 1DLKB 1BOQA 1FNIA 1O35A 3BTEE 1GWAA 2FI5E 1HJ8A 2ODQA 4Y71A 2CGAA 1GI6A 3ODDA 1P02A 3ZVEA 2IJOB 1DXPA