1OX1A

Crystal structure of the bovine trypsin complex with a synthetic 11 peptide inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsinogen, cationic
publication title crystal structure of the bovine trypsin complex with a synthetic 11 peptide inhibitor
rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ox1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ox1A02
2WPIS 4AB9A 4JK5A 1FAKH 3E8LA 5GPIB 3VB4A 3LPRA 4INLA 3GCHC 2ESTE 3H7TA 3DFJA 3M61U 3LJOA 1ESBA 1JIMA 1LTOA 1MTVA 1THSH 1TNIA 1KXBA 5F8XA 2JH5D 1C2EA 2QXJA 1BCUH 3VEQB 4YOJA 3MFJA 2R3UA 3PTBA 4GHQA 1VR1H 1GBJA 1EB1H 3RMNH 4Q2KA 4CR5A 9ESTA 3GCHB 1QL7A 1EAIA 4UFGH 3UPEA 2EC9H 1AIXH 1GBTA 3TU7H 1OWHA 3MH6A 3CS7A 4I7YH 1TNJA 3GDVA 4MPWA 2HOBA 1K2I1 2O8LA 1O5AB 1VZQH 1SGIB 3PMHB 3RLYH 5GJ4B 3M36A 4HTCH 1KTSB 2FIRH 2FDAA 1DPOA 1D3DB 3M3VA 4AFUA 3UNQA 2C4FH 2UUJB 1QFKH 1YPEH 3SUEA 1MKXK 3OU0A 1NY22 5EQSA 2EEKA 1NRSH 2ZG0H 1N8OB 1TFXA 1GCTC 5J4SA 1SL3A 2C8ZB 1Z7KA 5JB8S 3RC5A 4CBOA 1K1LA 4NFEA 4ABDA 1ZHPA 1UHBA 2UUYA 2JH6D 3ZZ5A 2AS9A 2ALPA 1GBMA 3A88A 7GCHG 5HMAA 2ZDNA 1OOKB 4IBLH 2F9VA 2UUFB 1GL1A 4X1NU 3STIA 4MQAA 3T25A 1UVUH 1ZYOA 1YLDA 1TOCB 1F5KU 1GI0A 3SGBE 2ODQA 2ZFPH 1QHRB 3VXFH 1QA7A 3T62A 3MNCA 5LPEA 1SMFE 2HLCA 3TK9A 1L1JA 1BBRE 4GCHG 1O3PB 2I6QA 1UCYH 2FS9A 2OCVB 1SGDE 1IHSH 4YOIA 1A5GH 3S9AA 1FXYA 3U8OH 1QB9A 4KGAA 2Z3EA 5T6FA 4B75A 4CR9A 2XWBI 2AGGX 4HFPB 1YPMH 5JBBS 2R0KA 3TH3H 2ZU4A 3RXFA 1FZZA 1O3HA 1YF4A 1VCPA 1ZRBA 2D2DA 1E37B 1UTMA 3SJOA 1FNIA 2FLBH 4ABAA 2WUCA 3ZZ3A 2QCYA 2VWOA 1CBWC 4U2WA 4H4FA 3UOPA 2BY5X 4WXVA 1UJ1A 1GWAA 1V2QT 3I29A 1HAXB 1TLDA 4JYVH 3A86A 5BPEA 4FU9A 1A5HA 1GG6C 2G81E 5GDSH 1SQTA 1TPSA 3LGWA 1CBWB 1J16A 1C4Y2 3ZZ8A 2EI8A 6ESTA 3BV9B 1IAUA 2Z6BD 5AF9H 2NU4E 1PYTD 1TGTA 3UNRA 1QIXB 1P9SA 3AAVA 2WPKS 1K1JA 1ZHRA 2GCTB 4TY6A 2JH0D 1BDAA 5F8TA 1UTNA 3RXLA 2O8TA 4FUJA 1B7XB 3HKJB 3RXSA 2EI7A 2ZA5A 5F8ZA 3Q3KA 2XYAA 1HAVA 1A0HB 1WTGH 1XXDA 4BAHB 4X8TH 4NIXA 1GI2A 1GGDB 2FX6A 3RXEA 2ZI2H 3S69A 2A32A 2FOCA 4A6LA 1F5LA 1JRTA 3S9BA 4JZIA 4CREA 5DKMA 1SGQE 1ZR0A 3IG6B 1O2RA 1GI9B 2W3KA 3LH3A 5K7RA 4IW4E 1W0YH 5LPRA 1ESTA 2BDAA 2QC2A 1P2MA 5C2ZA 3NPSA 1O2TA 3B9FH 5T6DA 3RXBA 2PHBA 5H4IB 1T4UH 2GX4A 1FQ3A 1T8NA 3T26A 1OP2A 4DCDA 1ANDA 2BD9A 3PM3A 4D76A 5A0CA 4CH2B 5FPYA 2VB0A 3LGYA 1NC6A 5FAHA 1ESAA 1GMCF 1GBAA 2GGVB 3QTVH 2V3HH 1T8LA 6GCHF 3TGIE 4ABJA 4UEHH 5C67A 4J2YB 2BY6X 1TRMA 4XOJA 1L1GA 1AVXA 1NFYA 1W0ZU 1DXWA 4AGKA 2H5DA 1W14U 2F83A 4SGAE 1YCPH 1LDTT 5JPMH 1A4WH 4FUDA 1KXEA 2GT8A 1G3DA 1H1BA 4AX9H 1TNKA 3KQBA 1C1RA 1HAYB 3UIRA 1UHBB 1C2MA 4MG3A 1THPB 1MTWA 3ZZDA 1C5UA 1E35B 2HNTF 1RRKA 2GT7A 1HAPH 3PMAB 3QLPH 4INHA 1UO6A 4IS5A 3RXKA 3ZZ9A 1TA2A 1MH0A 4XBCA 1OWEA 1HB0B 1AD8H 5ABWA 1TONA 2PTNA 3IITA 5A0BA 1KXAA 1O3MA 1P0SH 2OP9A 3RC6A 1OYTH 1EAUA 1DY8A 1O36A 2HPPH 1O34A 2AMQA 5TJXA 5DP8A 1RIWC 1YCPM 2A4RA 3PMBB 5DK1A 1SGYE 2SNWA 2SFAA 1DICA 2A5KA 5A09A 5A8ZA 3SU0A 3ATMA 4A1VA 1GBHA 2XCFA 1EJAA 1F2SE 1UVSH 1QJ6B 2XTTB 1ELBA 1P12E 2NU3E 1ELTA 1QNJA 1CGHA 1ANCA 2A7CA 1BBRH 8GCHF 3O8RA 2D1JA 4BTUB 5L30H 1RIWB 5F03A 2ZIQH 5FPTA 3EA7A 4OS6A 1D3PB 1S85A 2ZHWH 4K1EA 1O3EA 4TPYA 3B8JA 4BXWA 3TIUA 2FEQH 3VGCC 1O2KA 1K1PA 3TLOA 1H9LB 2BQ7B 3E0NB 1AVWA 3SI3H 2FX4A 3VB3A 1Q3XA 2OC1A 2VNTA 1NN6A 2SGEE 2FI4E 1ZZZA 4FUHA 1TWXB 2AGEX 2V3OH 2H9EH 4NA8A 2GZ9A 1VITH 1Y5AT 1O2ZA 3SU5A 3M3TA 1BTUA 1V2JT 2C93B 3M7UA 3U98H 4ZHLU 3P95A 1FPHH 3A8BA 1TBZH 3ZVFA 1FAXA 1AN1E 1LVBA 2IOTA 4NIWA 1SBWA 4Q7ZA 2ASUB 1EZQA 1A61H 2ZCKP 5AVDA 3C27B 1ZJKA 2TRMA 1SHHB 1DWEH 1GBEA 4NIVA 3IWMA 2BY9X 2ZF0H 2FOGA 3OYPA 5IYTA 1VCWA 3MI4A 4R0IA 3JZ2B 1NFUA 2Z7FE 3UNSA 3OY6U 3E6PH 2VGCB 4I33A 4I32A 2B5TB 4WY3A 1HV7A 1XKAC 4ZKRU 2BX4A 3MH4A 4BAOB 1BQYA 3L3TA 4B2CA 1WYKA 3PO1C 2SGPE 1V2ST 1WU1A 4YO9A 1SG8B 2BOHB 1BTZA 1OWDA 5T6GA 5EQRA 5DGJA 1Y3WA 1ZTLA 1RGQA 1HAHH 2BOKA 2SGQE 4ABFA 1O35A 4CRCA 4KTSA 4Y10E 1Q31A 5C1XA 4WJG2 1V2MT 2P3TB 1FMGA 1G3EA 4HI3A 3SW2B 4GUXA 2WYGA 2BD4A 2ZFFH 2HALA 1EATA 1C1OA 3ENSB 1Z1JA 4OS4A 2ZFSA 1GVZA 1SVPA 1WTHD 1CHGA 3LC3A 1ELEE 3BEUA 2GV6A 1GDUA 1Q2WA 3M37A 4Z6AH 1QQ4A 2ZCHP 3FFGA 1ELAA 1V2LT 1Y5UT 1SHYA 2A4GA 1RXPA 3GCOA 3KQEA 1LPZB 1JIRA 2BD3A 1EXFA 1O2NA 3A80A 2PFEA 1OP8A 2H6MA 3NWUA 2ZECA 2P3UB 1GHAF 1QRWA 3E3TA 1ZHMA 3SU6A 2BDYA 2ODYB 1UTJA 3SV8A 3DUXH 5DP9A 2OTVA 3QZRA 9LPRA 3DFLA 4H6SB 4I8HA 1SQOA 2ZC9H 4ABBA 3RXJA 3SJ8A 1NM6A 1HCGA 1GBKA 2ANKH 2Q1JA 4LOYH 1BHXB 4DIIH 2VVVA 3ODDA 1YPHE 3EAJA 4RKJB 4YLUA 1AE5A 1V6DA 1DSUA 1UVPA 2P59A 4PROA 1G3BA 4QT8C 3T27A 3LGIA 4E7RG 2ZFTA 1MCVA 2OINA 4D9QA 1NESE 1TRYA 1OWJA 2BY7X 4CRBA 4OS7A 1ABIH 1XMNB 4NZLA 3ZVBA 1PFXC 2P8OC 1LQDB 1MTNB 3M5NA 4CH8B 5A8XA 1ZOMA 3KCGH 2H9HA 1VGCC 1V3XA 3S7HB 3MOCA 4M7GA 5J4QA 3TJNA 4I8LA 2P16A 4AOQA 2BXUH 1KLJH 1P06A 1QA0A 4O3TA 4YZUA 1AY6H 2GTBA 3BTTE 1CA0C 1NFXA 3R3GB 1F92A 1P02A 1N6YA 2YNBA 4BAQB 2P8OB 1OXGA 2FOEA 4CHAB 4AN7A 2A7JA 3HK3B 2R2MB 1DE7H 1P57B 5CHAC 4DT7B 3P92A 1VCQA 1AFEH 2HRVA 1DLEA 1SLXB 1W7GH 5FX6A 1ZMNA 2FWWA 2Z9LA 2GDEH 4UFDH 1H9IE 1YKTA 2IPHA 1DS2E 3KHVA 1XUJA 1Y3XA 4ZHAA 1TRNA 5LGOA 2RDLA 1GJDB 4ZKSU 1UTKA 2QF0A 2F9NA 3ZVCA 1ZPBA 5E8EH 4E7NA 3QUMP 2BXTH 2XBYA 1GI8B 1GMCG 2A5IA 1ZGIA 2J95A 3KN2A 1BIOA 4XBDA 3SV2H 6GCHG 1ZPCA 1DY9A 4GSOA 1G3CA 1NROH 1HRTH 1WSSH 1HJAB 6CHAC 2BLWA 1TX6A 2OC7A 2G8TA 3HPTB 1SFQB 5G4BA 3V3MA 1CU1A 5DPAA 1QJ7B 1C5NH 1BUIA 4IMZA 3CS0A 1G9IE 1K1MA 4WF8A 3ITIA 1BRBE 6CHAB 3U1IB 1DUAA 2OD3B 2FODA 4I31A 1QRZA 3E0PB 2BD7A 1J15A 1P2KA 2FI3E 3A7XA 2Y6TA 3QDZB 3PROA 1PYTC 4GLYA 1G2MA 3TITA 1FUJA 2O8UA 2J2UA 4OS1A 1HIAA 1O32A 1UTLM 3P8GA 3PWCA 3DHKH 2A5AA 1PPZA 2LNCA 1H4WA 2O9QA 4ISHH 1S81A 4LXBH 4A1XA 5I25A 5HM2A 1TX8A 3MU1A 1OWKA 4JZFH 4NA7A 5FCKA 1ARCA 1BRCE 2FYRA 2TIOA 2XBWA 5ETXA 1CHOF 2EA3A 2DUCA 1SGCA 3MU8A 1A1RA 5DP6A 1QURH 2DE8A 8GCHG 1GHVH 2BTCE 4AG1A 1SC8U 3V7TA 1BTXA 1Y3VA 3E90B 2WPLS 1C1NA 4YOGA 1TX7A 3RP2A 2BB4A 1GVKB 3TJOA 2J9NA 4FUGA 1C1UH 2A45B 3UFAA 2VVUA 3U8RH 1C2JA 2C8YB 4YTAA 2W3IA 1O3IA 1Z8RA 1Z6EA 4U32A 1IQEA 1ETSH 1IQLA 1ANEA 3BTQE 1N8OC 1GJ9B 3URCA 1O2GH 2ZTZA 3FZZA 3LU9B 3QO6A 1OYQA 1RS0A 1SGNE 1DXPA 4X8VH 1SGPE 2R3YA 4AFZA 2GZ7A 4CRGA 1YC0A 2G55A 2ZPRA 2KAIA 3EA8A 3M5LA 1GJ8B 4KTCA 1BTPA 4GVUA 1EP6A 1O39A 1PPGE 1V2OT 2VIVA 1PPCE 2ZU1A 2ODPA 2UUKB 1D6RA 4GAWA 2FTLE 3OTJE 3SNAA 3VB6A 2OQUA 3RXCA 2PUQH 3M7TA 1VITF 4F49A 1Y3UA 1G32B 2PKAA 4YM9A 4GHTA 1AQ7A 4YT6H 4DGJA 1UK4A 3OY5U 2VIOA 2UWOA 4UONA 1JOUB 3ZZ6A 1MBQA 2PKSC 1GJAB 3Q77A 2VU8E 3SUDA 1Z6JH 5SGAE 1LKAA 3SOSA 5C20A 4FUIA 4ZROA 2R2WU 1TABE 4OS5A 1MD7A 1NO9H 2ZZUH 3QGJA 5ESBA 5DP3A 4INKA 5DP7A 1ABJH 2PGQB 1BHXF 1TPAE 1D3QB 2Q6GA 1FONA 1JWTA 3UY9A 1C4V2 1O30A 2PKSB 1GVLA 3AW0A 3RMLH 1C9TA 4Q7YA 1A2CH 1Y5BT 4X1PU 1PJPA 2FOAA 2UWLA 1K1NA 1C5WB 4K8YA 3SJIA 2BQWB 3BF6H 4FU7A 1C5LH 4HGCA 1UVTH 1AB9B 4H6TA 4NSVA 4X1SU 1LQEA 3P6ZB 5CMXH 5JBTA 1HGTH 2QY0B 1GHAG 2ZTXA 1S6HA 1D9IA 2OUAA 3BTFE 1KY9A 3UQVA 1Y59T 4JK6A 4HZHA 1TGBA 1YM0A 4ISLA 3I78A 2P94A 1AFQB 3D23A 3GY3A 3P8FA 1O3DA 2LPRA 4JCNA 1ANBA 1S6FA 2GCTC 1FV9A 3SGQE 3MWIU 1GMDF 2A0QB 2ZDVH 1O2PA 3R0FA 1PQAA 2H2ZA 4ABIA 2GCHF 1HUTH 2AFQB 1BRAA 1GBBA 3M3SA 1SQAA 2OBOA 3MO3A 2ZDAH 1TAWA 1MTSA 2HVXA 2ZU2A 1XVMA 1BJVA 2W26A 1HIAB 4NIYA 4AZ2B 4XBBA 1GGDC 2BQ6B 2BDBA 2PW8H 2BDGA 2WV4A 1GJ7B 1IQIA 3KL6A 1W11U 1YPKH 1G2LA 2IJOB 3RXOA 7ESTE 1S82A 2G4TA 2V6NA 1UMAH 3SNDA 2TGPZ 1HAIH 5E0JA 3BIVH 5A0AE 3ZVDA 1AU8A 3SU2A 4O03A 1GDQA 1J14A 2H1UA 1HLTH 3D49H 2FOBA 1QBOA 4A7IB 3RXDA 1F0RA 1AHTH 1O2YA 2CV3A 2ZWLH 2G4UA 1C5XB 2ZHDA 1DOJA 2ZP0H 3S0NA 3H5CB 4BANB 3LDXH 4DIHH 5DP4A 2D8WA 4NWKA 1WQSA 3H7OA 1MBMA 1XUKA 3TH2H 1V2WT 1CT0E 1NFWA 4TWYA 1UTOA 8ESTE 2Z9KA 1S83A 2ZGHA 1EZUC 1L0ZA 1HDTH 2PWXA 3ATLA 2ANYA 2BYAX 4X6OA 3VFEA 4D9RA 1O33A 1Y3YA 2TGAA 2GKVE 3LIWA 3KQCA 3BTWE 1UVOA 2WYJA 4WMEA 1K9OE 3HKIB 1C1TA 2KAIB 4FXGH 4E05H 3GICB 3F1SB 4K5ZA 2G5NA 1S84A 1KXDA 1LPKB 2P3FH 3QWCH 4ASHA 4NSYA 2ZFRH 5FHTA 5FCRA 4FUCA 3ATIA 1FPCH 2BLQA 1O2HA 4JMYA 2PKAB 3UTUH 1GJ6A 4MPXA 1GI7B 1P11E 2QF3A 2TPIZ 2CMYA 4CRAA 1O2QA 3FP6E 2ZGJA 1A0JA 4Y76A 3EE0B 1O3OA 1C1VH 1O3KA 2Q6FA 8LPRA 1F0TA 4AGJA 1OKXA 1KSNA 3AAUA 3BEIB 5DJ7A 2QA9E 3MH5A 1FJSA 1P09A 4R8TB 1GJBB 4AFQA 3W94A 2ZCLP 3F6UH 1YBWA 2ZHFH 3GY4A 3HGNA 1EASA 1CHOG 1GCDA 5GCHF 3RU4T 2ZKSA 1THRH 3N7OA 4X2YA 3BTDE 2GV7A 2Y7ZA 3LOXA 2Y82A 3V13A 1TYNA 4DW2U 1BMMH 3ESTA 1P04A 1QBVH 4B74A 3TGJE 1T8MA 2VWNA 2J94A 4XDEA 1C5PA 2THFB 3M7QA 1NTPA 2QGRA 3RXVA 2Z9IA 4Y0ZE 1QBNA 1IQHA 1HPGA 1AKSB 1TGSZ 4TYDA 3BIUH 2M5TA 4X0WU 1EAWA 1GBIA 4B2AA 3STJA 2J4IA 3ZZAA 3ZV9A 3QK1A 5FBEA 1YLCA 1CSOE 1OSSA 5EXMA 3NZIA 1SSXA 2Y5HA 1K1IA 2B8OH 2GMTB 1O2VA 3RMOH 4B76A 3M35A 2HNTE 3L33A 3A82A 2K1QA 3A7VA 1KLIH 3F9FA 3ZV8A 1GI5A 1SGRE 1PQ5A 1P8VC 2PTCE 2YOLA 3UUZA 2VGCC 3SU3A 2F9BH 1D6WA 1A0LA 2W5EA 3NKKA 1VITG 1EAXA 5GXPA 2AMDA 3A81A 3O8DA 3TNTA 1LO6A 1E0FD 4AFSA 3TGKE 5GWZA 1XUGA 1WOFA 4RKOB 1GBDA 1MAYA 3A8CA 1LPGB 5JB9S 4XE4A 2ILNA 5EPNA 2G00A 3FVFB 3M5MA 2A2XH 1P3EA 3P8OA 1CGIE 2Y5GA 3LGUA 4X8UH 3BG4B 3RXIA 3MYWA 3ZZ4A 3V12A 1GJ4H 1C5RA 1TQ7B 1UCYK 3U9AH 1XUHA 1TOMH 3S7KB 2ZPQA 3K65B 4GPGA 4MNWA 1A3EH 1O5GH 2SGFE 2V35A 4B1TA 3QZQA 1HFDA 2XNIA 1JRSA 1BTWA 1GL0E 4NZQA 5TCCA 5E2OA 3BG8A 1QB1A 2Y7XA 3RXQA 4ABHA 4VGCB 1CE5A 2GZ8A 1EX3A 3RXHA 1NS3A 1IOEA 1V2KT 1XVOA 2FOMB 1IQFA 1AWHB 1DITH 4JZEH 3RXPA 1GMDG 1O5CB 1TE0A 2BDIA 3G01A 2FI5E 3BTME 1MTNC 5C1YA 1BZXE 2GCHG 1CO7E 1K21H 1TNLA 1W7XH 1F7ZA 3RU4E 3QTOH 4D7FA 1O2OA 1ZSKA 1C1SA 1PPEE 3F9GA 1P10A 1P9UA 1WV7H 1GBCA 1DUEA 1PQ8A 4OS2A 2C8XB 4X1QU 1FY5A 3MH7A 3SNCA 1N6XA 1BOQA 1C5OH 2BVRH 2OQ5A 3QX5H 4CHAC 1TMTH 3TH4H 1KXCA 4K8BA 1V2TT 4UDWH 2XC5A 2NU2E 7LPRA 3LONA 2PSXA 1T4VH 1EZXC 1S5SA 2XBVA 4NWLA 4ZXYH 3PYHA 3Q00A 2A31A 5E0HA 1O3CA 3L6PA 1GJCB 4TWWA 3ATWA 1JBUH 4NG9H 1EPTA 1DANH 1CVWH 1SB1H 3KEEA 1QTFA 3GYMA 1W8BH 5JDUB 4DVAU 4U01A 5E2PA 1BRUP 3BTKE 1BMAA 2AIPA 2OC0A 1XXFA 2XW9A 4FUFA 3A7WA 1UK3A 1M9UA 4AB8A 3RM0H 4YLQH 4E06H 1HJAC 3LC5A 4WH6A 2ZDLA 2FYQA 2PLXA 1GI1A 4A1TA 2EI6A 2CGAA 1K1OA 2CXVA 1ELVA 1GMHF 1MTUA 1YYY1 4BNRA 4X2VA 2AYWA 3Q3XA 3O8BA 1ZLRA 4AYYB 2VIPA 1FDPA 1TGNA 1AWFH 1MUEB 1LHDH 3GY8A 4IN2A 1YCPK 1P2NA 5AHGH 3VB5A 1F5RA 3Q76A 4KTUA 4X6NA 1BMNH 3SQEE 3A8DA 3CENA 3S9CA 1BTYA 1OS8A 2XCNA 3A7ZA 4K1SA 1L1NA 3MU0A 3QN7A 1ELCA 1DSTA 2NWNA 2A2QH 1YPLH 2ANMH 3TJVA 1CA8B 4Y0YE 1NPMA 3U8TH 1F0UA 1BJUA 1O5BB 3PMJA 2YNAA 4BTIB 3MTYA 2GP9B 1W12U 4AG2A 4A92A 1BA8B 3HK6B 2AIQA 1AO5A 5GCHG 4BOHA 4JYUH 3EGKH 1QGFA 3SU1A 2CHAB 3A84A 1G30B 2FESH 1O2WA 3PV4A 2WINI 3FANA 1MU8B 1QB6A 1A46H 1ID5H 5FPSA 1J17T 1BBRK 2PV9B 1E36B 5C5NA 1C5VA 2FMJA 2WV5A 1PPFE 2J34A 3MMGA 1LHGH 4MNYA 1AGJA 1SPJA 4X8SH 1SGFG 5C5OA 5EXNA 3B23B 2OXSA 1B0FA 1HAGE 1ZMJA 2BY8X 2H9TH 1ZPZA 1QRXA 1LCYA 4KKDA 2TGTA 2R0LA 3GY5A 2SGDE 1UTPA 1V2UT 3P8NA 1LMWB 5TCAA 2CF8H 1CT2E 2BMGB 3WY8A 1P01A 2BD5A 2NU1E 3KF2A 1HYLA 1Z8JB 1GJ5H 1OP0A 4CRFA 2STBE 1NZQH 3AASA 1T8OA 2BD8A 3CP7A 2ZO3H 2GDDA 1DT2A 3GCNA 5L6NH 3DA9B 3OX7U 4I8GA 1D4PB 1MQ5A 4IC6A 1GI6A 3LH1A 2WUBA 4NA9H 2ZEBA 4MTBA 3VPKA 5AFYH 2ZHQH 4UE7H 1FIZA 2Y80A 1L4DA 4FVDA 1SLVB 3OSYA 4K69A 1EPTC 1XX9A 5I46H 4ISOA 1D3TB 2F91A 5DG6A 1A5IA 2AH4X 2ZQ2A 4Y7AA 4XFQA 2PSYA 4SGBE 4OGYA 1CGJE 1TA6A 2Z94A 2P93A 3SQHE 1CT4E 5L2YH 1XUFA 1V2PT 1KXFA 1EPTB 2ZHEH 4NGAH 2Z3CA 2R9PA 1C2DA 4DJZB 4FVBA 4Y8YA 1NU9A 1GCTB 1AZZA 1O5FH 4A5TS 5L2ZH 2A4OA 1HXEH 1AB9C 1C5SA 4NCYA 3LKWA 2XBXA 2RA0A 1TQ0B 5CE1A 1O2IA 2AERH 2ZTYA 1GHXH 2O8WA 2OLGA 1Z71A 1WUNH 2HGTH 1WAYB 1O2LA 4ZAEA 1AFQC 1YPHC 2DE9A 3EQ0H 3A85A 3HATH 2PR3A 4BAKB 1O2MA 1AKSA 1TNGA 2C8WB 1TBQH 2UWPA 1YP9A 2J92A 1W2KH 1NRNH 3GCTF 1LHCH 3FAOA 4AORA 3UR9A 1SI5H 4RN6A 3UWJH 1BB0B 1LHEH 1FLEE 1UK2A 1ELFA 1X7AC 2IN2A 4YT7H 1U6QA 7KMEH 1C1WH 2OC8A 1T7CA 4O9VA 5EODA 8KME2 1IQKA 1SLUB 2FTMA 1LVYA 3E16B 4WXIA 2QV1A 4MVNA 4NFFA 1NRRH 4OGXA 4DOQA 1S0QA 3TVJB 5PTPA 4JZ1A 2VWLA 5FXLA 1HAOH 4YESB 2RG3A 1GI3A 1O3NA 1TBRH 1DX5M 3MO9A 3K2UA 4Y6DA 4WH8A 5LH8A 4THNH 3U69H 1J8AA 1P2QA 2VIWA 1MMJN 1C2HA 5B6OA 2WPMS 1RTKA 3SV6A 1GHZA 1C5MD 1FN6A 4B2BA 2G5VA 2BDCA 1GI4A 2ALVA 4ZMAH 3UOUA 3PLKA 4ZKOU 4JYTA 4UD9H 4DY7B 1GG6B 1PPHE 1T31A 2J38A 1LVOA 3GDUA 2TGDA 1K28D 1O5EH 3C1KA 1C5QA 5IDKA 1C2GA 2Z3DA 1SGTA 4BAMB 1ARBA 1XM1A 2QXIA 2W7SA 1CQQA 1RTLA 4MNVA 2VIQA 4JZDH 5EU8A 3O8CA 1C5ZB 5K0HA 3SGAE 3ZZCA 3SJKA 5F6MA 1C2LA 1EUFA 4I8KA 2WPJS 3SN8A 1MD8A 4DG4A 1NRPH 1H9HE 1EOLA 2NU0E 1V2NT 1MZDA 1AZ8A 1EP5A 4IN1A 2ZDMA 1W10U 3URDA 1EZSC 1ZRKA 5JBCS 1LVMA 1GDNA 5DO4H 3RLWH 2BLOA 3EDXB 1GMHG 1AE8H 1HJ8A 1HJ9A 1IQMA 2SNVA 5HYOA 1AUTC 1MCTA 1O2JA 1SLWB 1C4U2 2D26C 3E91A 2HWLB 2ZNKH 2QIQA 1C1PA 3BTGE 5FX5A 5JBAS 1EB2A 3ATKA 2F9OA 1GHYH 4BTTB 1RD3B 1SOTA 1V2RT 1DLKB 1HAZB 4Y71A 5FBIA 5EW1H 3BSQA 3BEFB 4D7GA 4ABEA 4K1TA 1S0RA 2FLRH 2XC4A 2QXGA 4O3UA 1O0DH 4MLFB 1FN8A 1Y8TA 2H5CA 2QYIA 4F4OC 4DURA 3P17H 1GHWH 3SUFA 3FP7E 4FU8A 4IGDA 1KLTA 1XUIA 5DP5A 1JXPA 1KTTB 1C1MA 3SHAH 1A7SA 1JMOH 4TPIZ 1FY1A 1MKWH 4BXSA 5BRRE 3SBKA 3BTEE 2ZGBH 1FY3A 1GHBF 1ZMLA 4Y8ZA 3GYLB 1O3BA 1WCZA 3GY7A 2V0BA 3LGTA 2ZGXH 3LJJA 4X6MA 2AGIX 3T28A 1V2VT 3TK5A 2BLVA 1A3BH 1TMUH 2VH0A 6LPRA 1KDQA 3A89A 1O3LA 5LPFA 4WWYA 2ZU5A 2GD4B 4WVPE 1HBTH 1ZJDA 3SNEA 3EYDA 2XRCA 3RXMA 1L4ZA 3MU4A 2GVFA 1SR5C 1IHTH 3RU4D 4ZKNU 2CJIA 3A87A 3GISB 3SORA 5JYIA 1UTQA 1DDJA 2AMPA 3DD2H 3I77A 2JETC 1Z8GA 1LKBA 1P05A 3AVZA 2GMTC 3D62A 3A7TA 2A4QA 1P2OA 3ZYDA 5C3NA 4Y11E 1TGCA 3TJUA 1TIOA 2HPQH 3MHWU 2ZGCA 2JETB 5EQQA 4K2YA 1SGEE 2Z9JA 1O31A 4IMQA 4FUBA 4FUEA 2WPHS 5E0GA 2F9PA 3SO3A 3DT0H 3VXEH 4AYVB 1WBGB 2VWMA 1BMLA 1QQUA 4Y79A 2CN0H 3EA9A 4ESTE 1QL9A 3PTNA 1ELGA 4D8NA 1TPPA 1QJ1B 3BTHE 4UFFH 3K6ZA 2ANWA 1BITA 1EQ9A 2BM2A 3VB7A 3ZYEA 1TNHA 4ZH8A 3T5FH 2PUXB 3VGCB 4UFEH 4CRDA 1DWBH 1MKXH 4K60A 1ZGVA 3K9XB 5EGMA 3BG4C 3W95A 1EKBB 3SZNA 2AEIH 3F9EA 1PQ7A 1P2JA 3MU5A 4KP0A 1YGCH 1TALA 1RFNA 5A2MH 1DVAH 1O37A 1O2SA 2CF9H 2VIDA 4H42U 2STAE 2BX3A 1IQGA 3RUOA 4K3JA 3MNXA 2XXLA 1YPJH 2Z9GA 3P70B 3D65E 1L2EA 7GCHF 2ULLA 3E1XB 1C2IA 4ISNA 1ZSLA 1AI8H 2XC0A 1HAVB 2TBSA 1HNEE 4LZ4B 1ELDE 3FZDA 2QN5T 1IQNA 1ORFA 3F9HA 4VGCC 3SUGA 1SFIA 4ABGA 1B5GH 1N1LA 2FZZA 3A7YA 1RTFB 5AFZH 4GCHF 1MQ6A 1XKBC 1NRQH 1QL8A 1O3FA 4MPVA 1QY6A 1SOZA 2B9LA 5EW2H 3NK8A 3ZVGA 4WMDA 1TB6H 1W3CA 1OX1A 3PO1B 1KIGH 5GIBA 2A7HA 3UQOA 2FP7B 1Z8IB 1FY4A 4TY7A 3RM2H 2XWAA 2OBQA 2ZFQH 4Q80A 1E38B 4WMFA 3GCTG 5EPYA 3RMMH 1O5DH 5T3HA 2BZ6H 3SI4H 3ELAH 3RC4A 1K22H 4X2WA 1C5TA 3JZ1B 2FM2A 1HXFH 2BHGA 3SV9A 1EJNA 3MO6A 1ETTH 4J1YA 4IC5A 4X2XA 2Q6DA 3KNXA 2RCEA 3RXAA 3V0XA 2QXHA 4KELA 4CBNA 5EXLA 3RXRA 1O3GA 4U30A 1KYNA 1MZAA 3RDZA 3SV7A 1GPZA 1ZSJA 1ZTKA 2Y81A 3T29A 1VJ9U 1FI8A 1DWDH 3NUMA 1DFPA 3ZVEA 3RXTA 2JKHA 1OWIA 3KGPA 5HXFA 3FP8E 3KIDU 1O2XA 1INCA 1VJAU 3F68H 3PWBA 2BZAA 3ZZ7A 3GDSA 3QGNB 1ZTJA 1KDQB 4MDSA 3SU4A 1Z1IA 2ZU3A 3BN9A 3TK6A 1G37A 2G52A 2VJ1A 5HM9A 4XSKU 4I8JA 3GY2A 4ZHMU 1BTHH 3PB1E 1T32A 3TPIZ 2FXRA 2VVCA 3A8AA 2FOFA 1P2IA 3MNSA 2BVSH 1SGFA 1B0EA 2A1DB 4Y8XA 1UCYE 2ZPSA 3UWIA 4LZ1H 4Y7BA 3ODFA 2QAAA 1C5YB 1MU6B 1O38A 1LHFH 3HGPA 4B73A 3Q3YA 2F3CE 4Q7XA 2ZQ1A 5EG4A 3K6YA 1C1QA 1VGCB 1W13U 1MAXA 2W7UA 1C2FA 1O3AA 5EOKA 1FIWA 1ETRH 3SHCH 3PLPA 1YPGH 2FO9A 1CA0B 2B7DH 1QCPA 1OPHB 1DWCH 1H8IH 3TNSA 1DM4B 2FPZA 1AVGH 3PLBA 1TMBH 2RA3A 3LGVA 3KQDA 4ZXXH 1FY8E 5CHAB 2FOHA 1TPOA 1AUJA 5A8YA 2C90B 3ZZBA 3ZVAA 3NCLA 2FS8A 3AW1A 2VH6A 3GY6A 4B71A 4O97A 1EJMA 1NU7B 4X1RU 1P3CA 4ISIH 5ESTE 2I6SA 1E34B 1QR3E 1F0SA 3T2NA 1AMHA 1J9CH 3MNBA 4X6PA 1C9PA 1EOJA 3SJ9A 1C2KA 3LT3A 2BVXH 5C1UA 1GBFA 2PGBB 4RSPA 2VINA 3RXUA 2F9UA 4Z0KA 2O8MA 1BT7A 1RJXB 1GHBG 3U1JB 2CHAC 2P95A 2C3SA 3SNBA 1MKWK 4MNXA 2BD2A 1ACBE 1GBLA 4MPUA 1H8DH 1IQJA 1O3JA 3NXPA 1WQVH 5HGGA 3M5OA 2G51A 2Y5FA 4LK4A 3UR6A 1NT1A 3GOVB 3A83A 2SGAA 3UREA 1P03A 2B0FA 4ZUHA 3RXGA 2ZDKA 1G36A 2BDHA 1PPBH 2HNTC 1O2UA
chains in the Genus database with same CATH superfamily
2WPIS 4AB9A 4JK5A 1FAKH 3E8LA 5GPIB 3VB4A 3LPRA 4INLA 3GCHC 2ESTE 3H7TA 3DFJA 3M61U 3LJOA 1ESBA 1JIMA 1LTOA 1MTVA 1THSH 1TNIA 1KXBA 5F8XA 2JH5D 1C2EA 2QXJA 1BCUH 3VEQB 4YOJA 3MFJA 2R3UA 3PTBA 4GHQA 1VR1H 1GBJA 1EB1H 3RMNH 4Q2KA 4CR5A 4AC9A 9ESTA 3GCHB 1QL7A 1E79D 2KZ4A 1EAIA 4UFGH 3UPEA 2EC9H 1AIXH 1GBTA 3TU7H 1OWHA 3MH6A 3CS7A 4I7YH 1MABB 1TNJA 3GDVA 4MPWA 2HOBA 1K2I1 2O8LA 1O5AB 1VZQH 1W0KD 1SGIB 3PMHB 3RLYH 5GJ4B 3M36A 4HTCH 1KTSB 2FIRH 2FDAA 1DPOA 1D3DB 3M3VA 4AFUA 3UNQA 2C4FH 2UUJB 1QFKH 3PV2A 1YPEH 3SUEA 1MKXK 3OU0A 1NY22 5EQSA 2EEKA 1NRSH 2ZG0H 1N8OB 1TFXA 1GCTC 5J4SA 1SL3A 2C8ZB 1Z7KA 5JB8S 3RC5A 4CBOA 1K1LA 4NFEA 4ABDA 1ZHPA 1UHBA 5C94A 2UUYA 2JH6D 3ZZ5A 2AS9A 2ALPA 1GBMA 3A88A 7GCHG 5HMAA 2ZDNA 1OOKB 4IBLH 2F9VA 2UUFB 1GL1A 4X1NU 3STIA 4MQAA 3T25A 1UVUH 1ZYOA 1YLDA 1TOCB 1F5KU 1GI0A 3OEHD 3SGBE 2ODQA 2ZFPH 1QHRB 3VXFH 1QA7A 3T62A 3MNCA 5LPEA 1SMFE 2HLCA 3TK9A 1L1JA 1BBRE 4GCHG 1O3PB 2I6QA 1UCYH 2FS9A 2OCVB 1SGDE 1IHSH 4YOIA 1A5GH 5T1VA 1FXYA 3S9AA 3U8OH 1QB9A 4KGAA 2Z3EA 5T6FA 4B75A 4CR9A 2XWBI 2AGGX 4HFPB 1YPMH 5JBBS 2R0KA 3TH3H 2ZU4A 3RXFA 1FZZA 1O3HA 1YF4A 1VCPA 1ZRBA 2D2DA 1E37B 1UTMA 3SJOA 1FNIA 2FLBH 4ABAA 3FOAA 2WUCA 3KQ5A 3WWBA 3ZZ3A 2QCYA 2VWOA 1CBWC 4U2WA 4H4FA 3UOPA 2BY5X 4WXVA 1UJ1A 1GWAA 1V2QT 3I29A 1HAXB 1TLDA 4JYVH 3A86A 5BPEA 3SYJA 4FU9A 1A5HA 3PV5A 1GG6C 2G81E 5GDSH 1SQTA 1TPSA 3LGWA 1CBWB 1J16A 1C4Y2 3ZZ8A 2EI8A 6ESTA 3BV9B 1IAUA 2Z6BD 5AF9H 2NU4E 1PYTD 1TGTA 3UNRA 3FKSD 1QIXB 1P9SA 3AAVA 2WPKS 1K1JA 1ZHRA 2GCTB 4TY6A 2JH0D 1BDAA 5F8TA 1UTNA 3RXLA 2O8TA 4FUJA 1B7XB 3HKJB 3RXSA 2EI7A 2ZA5A 5F8ZA 3Q3KA 5FL7D 2XYAA 1HAVA 1A0HB 1WTGH 1XXDA 4BAHB 4X8TH 4NIXA 1GI2A 1GGDB 2FX6A 3RXEA 2ZI2H 3S69A 2A32A 2FOCA 4A6LA 1F5LA 1JRTA 3S9BA 4JZIA 4CREA 5DKMA 1SGQE 2J97A 1ZR0A 3IG6B 1O2RA 1GI9B 2W3KA 3LH3A 5K7RA 4IW4E 1W0YH 5LPRA 1ESTA 2BDAA 2QC2A 1P2MA 5C2ZA 3NPSA 1O2TA 3B9FH 5T6DA 3RXBA 2PHBA 5H4IB 1T4UH 2GX4A 1FQ3A 1T8NA 3T26A 1OP2A 4DCDA 1ANDA 2BD9A 3PM3A 4D76A 5A0CA 4CH2B 5FPYA 2VB0A 3LGYA 1NC6A 5FAHA 1ESAA 1GMCF 1GBAA 2GGVB 3QTVH 2V3HH 1T8LA 6GCHF 3TGIE 3DSOA 4ABJA 4UEHH 5C67A 4J2YB 2BY6X 1TRMA 4XOJA 1L1GA 1AVXA 1NFYA 1W0ZU 1DXWA 4AGKA 2H5DA 1W14U 2F83A 4SGAE 1YCPH 1LDTT 5JPMH 1A4WH 4FUDA 1KXEA 1WDIA 2GT8A 1G3DA 1H1BA 4AX9H 1TNKA 3KQBA 1C1RA 1HAYB 3UIRA 1UHBB 1C2MA 4MG3A 1THPB 1MTWA 3ZZDA 1C5UA 1E35B 2HNTF 1RRKA 2GT7A 1HAPH 3PMAB 3QLPH 4INHA 1UO6A 4IS5A 3RXKA 3ZZ9A 1TA2A 1MH0A 4XBCA 1OWEA 1HB0B 1AD8H 5ABWA 1TONA 2PTNA 3IITA 5A0BA 1KXAA 1O3MA 1P0SH 2OP9A 3RC6A 1OYTH 1EAUA 1DY8A 1O36A 2HPPH 1O34A 2AMQA 5TJXA 5DP8A 1RIWC 1YCPM 2A4RA 3PMBB 5DK1A 1SGYE 2SNWA 2SFAA 1DICA 2A5KA 5A09A 5A8ZA 3SU0A 3ATMA 4RT1A 4A1VA 1GBHA 2XCFA 1EJAA 1F2SE 1UVSH 1QJ6B 2J98B 2XTTB 1ELBA 1P12E 2NU3E 1ELTA 1QNJA 1CGHA 1ANCA 2A7CA 1BBRH 8GCHF 3O8RA 2D1JA 4BTUB 5L30H 1RIWB 5F03A 2ZIQH 5FPTA 3EA7A 4OS6A 1D3PB 1S85A 2ZHWH 4K1EA 1O3EA 4TPYA 3B8JA 4BXWA 3TIUA 2FEQH 3VGCC 1O2KA 1K1PA 3TLOA 1H9LB 2BQ7B 3E0NB 1AVWA 3SI3H 2FX4A 3VB3A 1Q3XA 2OC1A 2VNTA 1NN6A 2SGEE 2FI4E 1ZZZA 4FUHA 1TWXB 2AGEX 2V3OH 2H9EH 4NA8A 2GZ9A 1VITH 1Y5AT 1O2ZA 3SU5A 3M3TA 1BTUA 1V2JT 2C93B 3M7UA 3U98H 4ZHLU 3P95A 1FPHH 3A8BA 1TBZH 3ZVFA 1FAXA 1AN1E 1LVBA 2IOTA 4NIWA 1SBWA 4Q7ZA 2ASUB 1EZQA 1A61H 2ZCKP 5AVDA 3C27B 1ZJKA 5C17A 2TRMA 1SHHB 1DWEH 1GBEA 4NIVA 3WW7A 3IWMA 2BY9X 2ZF0H 2FOGA 3OYPA 5IYTA 1VCWA 2V3MA 3MI4A 4R0IA 3JZ2B 1NFUA 2Z7FE 3UNSA 3OY6U 3E6PH 2VGCB 4I33A 4I32A 2B5TB 4WY3A 1HV7A 1XKAC 4ZKRU 2BX4A 3MH4A 4BAOB 1BQYA 3L3TA 4B2CA 1WYKA 3PO1C 2SGPE 1V2ST 1WU1A 4YO9A 1SG8B 2BOHB 1BTZA 1OWDA 5T6GA 5EQRA 5DGJA 4ZCNA 1Y3WA 1ZTLA 1RGQA 1HAHH 2BOKA 2SGQE 4ABFA 1O35A 4CRCA 4KTSA 4Y10E 1Q31A 5C1XA 4WJG2 1V2MT 2P3TB 1FMGA 1G3EA 4HI3A 3SW2B 4GUXA 2WYGA 2BD4A 2ZFFH 2HALA 1EATA 1C1OA 3ENSB 1Z1JA 4OS4A 2ZFSA 1GVZA 1SVPA 1WTHD 1CHGA 2EY4C 3LC3A 1ELEE 3BEUA 2GV6A 2M2AA 1GDUA 1Q2WA 3M37A 4Z6AH 1QQ4A 2ZCHP 3FFGA 1ELAA 1V2LT 1Y5UT 1SHYA 2A4GA 1RXPA 3GCOA 3KQEA 1LPZB 1JIRA 2BD3A 1EXFA 1O2NA 3A80A 2PFEA 1OP8A 2H6MA 3NWUA 2ZECA 2P3UB 1GHAF 1QRWA 2LELA 3E3TA 1ZHMA 3SU6A 2BDYA 2ODYB 1UTJA 3SV8A 3DUXH 5DP9A 2OTVA 3QZRA 9LPRA 3DFLA 1YY3A 4H6SB 4I8HA 1SQOA 2ZC9H 4ABBA 5B6LA 3RXJA 3SJ8A 1NM6A 1HCGA 1GBKA 2ANKH 2Q1JA 4LOYH 1BHXB 2KM0A 4DIIH 2VVVA 3ODDA 1YPHE 3EAJA 4RKJB 4YLUA 1AE5A 1V6DA 1DSUA 1UVPA 2P59A 4PROA 1G3BA 4QT8C 3T27A 3U28C 3LGIA 4E7RG 2ZFTA 3F0OA 1MCVA 2OINA 4D9QA 1NESE 1TRYA 1OWJA 2BY7X 3UB0A 4CRBA 4OS7A 1ABIH 1XMNB 3N7DA 4NZLA 3ZVBA 1PFXC 5DN6D 2P8OC 1LQDB 1MTNB 3M5NA 4CH8B 5A8XA 1ZOMA 3KCGH 2H9HA 1VGCC 1V3XA 3S7HB 3MOCA 4M7GA 5J4QA 3TJNA 4I8LA 2P16A 4AOQA 2BXUH 1KLJH 1P06A 1QA0A 4O3TA 4YZUA 1AY6H 2GTBA 2W6JD 3BTTE 1CA0C 1NFXA 3R3GB 1F92A 1P02A 1N6YA 2YNBA 4BAQB 2P8OB 1OXGA 2FOEA 4CHAB 3GS9A 4AN7A 2A7JA 3HK3B 2R2MB 1DE7H 1P57B 5CHAC 4DT7B 3P92A 1VCQA 1AFEH 2HRVA 1DLEA 1SLXB 4Q63A 1W7GH 5FX6A 1ZMNA 2FWWA 2Z9LA 2GDEH 4UFDH 1H9IE 1YKTA 2IPHA 1DS2E 3KHVA 1XUJA 1Y3XA 4ZHAA 1TRNA 5LGOA 2RDLA 1GJDB 4ZKSU 1UTKA 2QF0A 2F9NA 3ZVCA 1ZPBA 5E8EH 4E7NA 3OE7D 3QUMP 2BXTH 2XBYA 1GI8B 1GMCG 2A5IA 1ZGIA 2J95A 3KN2A 1BIOA 4XBDA 3SV2H 6GCHG 1ZPCA 1DY9A 4GSOA 1G3CA 1NROH 1HRTH 1WSSH 1HJAB 6CHAC 2BLWA 1TX6A 2OC7A 2G8TA 3HPTB 4OM9A 1SFQB 5G4BA 3V3MA 1CU1A 5DPAA 1QJ7B 4FETA 1C5NH 1BUIA 3F2GA 4IMZA 3CS0A 1G9IE 2XOKD 1K1MA 4WF8A 3ITIA 1BRBE 6CHAB 3U1IB 1DUAA 2OD3B 2FODA 4I31A 1QRZA 2WHXA 3E0PB 2BD7A 2GJGA 1J15A 1P2KA 2FI3E 3A7XA 2Y6TA 3QDZB 3PROA 1PYTC 4GLYA 1G2MA 3TITA 1FUJA 2O8UA 2J2UA 4OS1A 1HIAA 1O32A 1UTLM 3P8GA 3PWCA 3DHKH 2A5AA 2V7QD 1PPZA 2LNCA 1H4WA 2O9QA 4ISHH 1S81A 4LXBH 4A1XA 5I25A 5HM2A 1TX8A 3MU1A 1OWKA 4JZFH 4NA7A 5FCKA 1ARCA 1BRCE 2FYRA 2TIOA 2XBWA 5ETXA 1CHOF 2EA3A 2DUCA 1SGCA 3MU8A 1A1RA 5DP6A 1QURH 2DE8A 8GCHG 1GHVH 2BTCE 2WSSD 4AG1A 1SC8U 3V7TA 1BTXA 1Y3VA 3E90B 2WPLS 1C1NA 4YOGA 1TX7A 3RP2A 2BB4A 1GVKB 3TJOA 2J9NA 4FUGA 1C1UH 2A45B 3UFAA 2VVUA 3U8RH 1C2JA 2C8YB 4YTAA 2W3IA 1O3IA 1Z8RA 1Z6EA 4U32A 1IQEA 1ETSH 1IQLA 1ANEA 3BTQE 4RT0A 1N8OC 1GJ9B 3URCA 1O2GH 2ZTZA 3FZZA 3LU9B 3QO6A 1OYQA 1RS0A 1SGNE 4P00A 1DXPA 4X8VH 1SGPE 2R3YA 4AFZA 2GZ7A 4CRGA 1YC0A 2G55A 2ZPRA 2KAIA 3EA8A 3M5LA 1GJ8B 4KTCA 1BTPA 4GVUA 1EP6A 1O39A 1PPGE 1V2OT 2VIVA 1PPCE 2ZU1A 2XNDD 2ODPA 2UUKB 1D6RA 4GAWA 2FTLE 3OTJE 3SNAA 2W6ID 3VB6A 2OQUA 3RXCA 2PUQH 3M7TA 1VITF 4F49A 1Y3UA 1G32B 2PKAA 4YM9A 4GHTA 1AQ7A 4YT6H 4DGJA 3VG8A 1UK4A 3OY5U 1COWD 3OAAD 2VIOA 2UWOA 4UONA 1JOUB 3ZZ6A 1MBQA 2PKSC 1GJAB 3Q77A 2VU8E 3SUDA 1Z6JH 2YMSB 1LKAA 5SGAE 3SOSA 5C20A 4FUIA 1EFRD 4ZROA 1NBMD 2R2WU 1TABE 4OS5A 1MD7A 1NO9H 2ZZUH 1K0HA 3QGJA 5ESBA 5DP3A 4INKA 5DP7A 1ABJH 2PGQB 1BHXF 1TPAE 1D3QB 2Q6GA 1FONA 1JWTA 3UY9A 1C4V2 1O30A 2J98A 1GVLA 2PKSB 1VKYA 3ZIAD 3AW0A 3RMLH 1C9TA 4Q7YA 1A2CH 1Y5BT 4X1PU 1PJPA 2FOAA 2UWLA 1K1NA 1C5WB 4K8YA 3SJIA 2BQWB 3BF6H 4FU7A 1C5LH 4HGCA 1UVTH 1AB9B 4H6TA 4NSVA 4X1SU 1LQEA 3P6ZB 5CMXH 5JBTA 1BMFD 1HGTH 2QY0B 1GHAG 2ZTXA 1S6HA 1D9IA 2OUAA 3BTFE 1KY9A 3UQVA 1Y59T 4JK6A 4HZHA 1TGBA 1YM0A 4ISLA 3I78A 2P94A 1AFQB 3D23A 3GY3A 4ACBA 3P8FA 1O3DA 2LPRA 4JCNA 1ANBA 1S6FA 2GCTC 1WXRA 1FV9A 3SGQE 3MWIU 1GMDF 2A0QB 2ZDVH 1O2PA 3R0FA 1PQAA 2H2ZA 4ABIA 2GCHF 1HUTH 2AFQB 1BRAA 1GBBA 3M3SA 1SQAA 2OBOA 3MO3A 2ZDAH 3WWFA 1TAWA 1MTSA 2HVXA 4F55A 2ZU2A 1XVMA 1BJVA 2W26A 1HIAB 2KX4A 4NIYA 4AZ2B 4XBBA 1GGDC 2BQ6B 2BDBA 2PW8H 2BDGA 2WV4A 1GJ7B 1IQIA 3KL6A 1W11U 1YPKH 1G2LA 2IJOB 2IJD1 3RXOA 7ESTE 1S82A 2G4TA 2V6NA 1UMAH 3SNDA 2TGPZ 1HAIH 5E0JA 3BIVH 5A0AE 3ZVDA 1AU8A 3SU2A 4O03A 1GDQA 1J14A 2H1UA 1HLTH 3D49H 2FOBA 2IPQX 1QBOA 4A7IB 3RXDA 1F0RA 1AHTH 1O2YA 2CV3A 2ZWLH 2G4UA 1C5XB 2ZHDA 1DOJA 2ZP0H 3S0NA 3H5CB 4BANB 1H8HD 3LDXH 4DIHH 5DP4A 2D8WA 4NWKA 1WQSA 3H7OA 1MBMA 1XUKA 3TH2H 1V2WT 1CT0E 1NFWA 4TWYA 1UTOA 8ESTE 2Z9KA 1S83A 2ZGHA 4Z1MD 1EZUC 1L0ZA 1SKYE 1HDTH 2PWXA 3ATLA 2ANYA 1SQRA 2RDEA 2BYAX 4X6OA 3VFEA 4D9RA 1O33A 1Y3YA 2TGAA 2GKVE 3LIWA 3KQCA 3BTWE 1UVOA 2WYJA 4WMEA 1K9OE 3HKIB 1C1TA 2KAIB 4FXGH 1NBME 4E05H 2F43B 3GICB 3F1SB 4K5ZA 2G5NA 1S84A 1KXDA 2YMSD 1LPKB 2P3FH 3QWCH 4ASHA 4NSYA 2WV9A 2ZFRH 5FHTA 5FCRA 4FUCA 3ATIA 3F0PA 1FPCH 2BLQA 1O2HA 4JMYA 2PKAB 3UTUH 1GJ6A 4MPXA 1GI7B 1P11E 2JIZD 2QF3A 2TPIZ 2CMYA 4CRAA 3OFND 5C0TA 1O2QA 3FP6E 2ZGJA 1A0JA 4Y76A 3EE0B 1O3OA 1C1VH 1O3KA 2Q6FA 8LPRA 1F0TA 4AGJA 1OKXA 1KSNA 3AAUA 3BEIB 5DJ7A 5HKKD 2QA9E 1E1QD 3MH5A 1FJSA 1P09A 4R8TB 1GJBB 4AFQA 3W94A 2ZCLP 3F6UH 1YBWA 2ZHFH 3GY4A 3HGNA 1E1RD 1EASA 1CHOG 1GCDA 5DSFA 5GCHF 3RU4T 2ZKSA 1THRH 3N7OA 4X2YA 3BTDE 2GV7A 2Y7ZA 3LOXA 2Y82A 3V13A 1TYNA 4DW2U 1BMMH 3ESTA 1P04A 1QBVH 4B74A 2KCOA 3TGJE 1T8MA 2VWNA 2J94A 4XDEA 1C5PA 2THFB 3M7QA 1NTPA 2QGRA 3RXVA 5EJZA 2Z9IA 4Y0ZE 1QBNA 1IQHA 1HPGA 1AKSB 1TGSZ 4TYDA 3BIUH 2M5TA 4DT4A 4X0WU 1EAWA 2KR7A 1GBIA 4B2AA 3STJA 2J4IA 3ZZAA 3ZV9A 3QK1A 5FBEA 1YLCA 1CSOE 1OSSA 5EXMA 4ACAA 3NZIA 1SSXA 2Y5HA 1K1IA 2B8OH 2GMTB 1O2VA 3RMOH 4B76A 3M35A 2HNTE 3L33A 3A82A 2K1QA 3A7VA 1KLIH 3F9FA 3ZV8A 1GI5A 1SGRE 1PQ5A 1P8VC 2PTCE 2YOLA 3UUZA 2VGCC 3SU3A 2F9BH 1D6WA 2F4LA 3EE7A 1A0LA 2W5EA 3NKKA 1VITG 1EAXA 5GXPA 2AMDA 3A81A 3O8DA 3TNTA 1LO6A 1E0FD 4AFSA 3TGKE 5GWZA 1XUGA 1WOFA 4RKOB 1GBDA 1MAYA 3H09A 3A8CA 1LPGB 5JB9S 4XE4A 2ILNA 5EPNA 2G00A 3FVFB 3M5MA 2A2XH 1P3EA 3P8OA 1CGIE 2Y5GA 3LGUA 4X8UH 3N7EA 3BG4B 4TSFD 3RXIA 3MYWA 3ZZ4A 3V12A 1GJ4H 1C5RA 1TQ7B 1UCYK 5KGOA 3U9AH 5CHBA 1XUHA 1TOMH 3S7KB 2ZPQA 3K65B 4GPGA 4MNWA 5CDFE 2QF4A 2KFWA 1A3EH 1O5GH 2SGFE 2V35A 4B1TA 5KEDA 3QZQA 1HFDA 2XNIA 1JRSA 1BTWA 1GL0E 4NZQA 5TCCA 5E2OA 3BG8A 1QB1A 2Y7XA 3RXQA 4ABHA 4VGCB 1CE5A 2GZ8A 2J5UA 1EX3A 3RXHA 1NS3A 1IOEA 3CNRA 1V2KT 1XVOA 2FOMB 1IQFA 1AWHB 1DITH 4JZEH 3RXPA 1GMDG 1O5CB 1TE0A 2BDIA 3G01A 2FI5E 3BTME 1MTNC 5C1YA 1BZXE 2GCHG 1CO7E 1K21H 1TNLA 1W7XH 1F7ZA 3RU4E 3QTOH 4D7FA 1O2OA 1ZSKA 1C1SA 1PPEE 4ASUD 3F9GA 1P10A 1P9UA 1WV7H 1GBCA 1DUEA 1PQ8A 4OS2A 2C8XB 4X1QU 1FY5A 3MH7A 3SNCA 1N6XA 1BOQA 1C5OH 2BVRH 2OQ5A 3QX5H 4CHAC 1TMTH 3TH4H 1KXCA 4K8BA 1V2TT 4UDWH 2XC5A 2NU2E 7LPRA 3LONA 2PSXA 1T4VH 1EZXC 1S5SA 2XBVA 4NWLA 4ZXYH 3PYHA 3Q00A 2A31A 5E0HA 1O3CA 3L6PA 1GJCB 4TWWA 3ATWA 1JBUH 4NG9H 1EPTA 1DANH 1CVWH 1SB1H 3KEEA 1QTFA 3GYMA 1W8BH 5JDUB 4DVAU 4U01A 5E2PA 1BRUP 3BTKE 1BMAA 2AIPA 2OC0A 1XXFA 2XW9A 4FUFA 3A7WA 1UK3A 1M9UA 4AB8A 3RM0H 4YLQH 4E06H 1HJAC 3LC5A 4WH6A 2ZDLA 2FYQA 5EJLA 2PLXA 1GI1A 3F3BA 4A1TA 2EI6A 2CGAA 3KYGA 1K1OA 2CXVA 1ELVA 1GMHF 1MTUA 1YYY1 4BNRA 1KMHB 4X2VA 2AYWA 3Q3XA 3O8BA 1ZLRA 4AYYB 2VIPA 1FDPA 1TGNA 1AWFH 1MUEB 4HG6A 1LHDH 3GY8A 4IN2A 1YCPK 5HIYA 1P2NA 5AHGH 3VB5A 1F5RA 3Q76A 4KTUA 1OHHD 4X6NA 1BMNH 3SQEE 3A8DA 3CENA 3S9CA 2KCPA 1BTYA 1OS8A 2XCNA 3A7ZA 4K1SA 1L1NA 3MU0A 3QN7A 1ELCA 1DSTA 2NWNA 2A2QH 1YPLH 2ANMH 3TJVA 2LP6A 1CA8B 4Y0YE 3UAIC 1NPMA 5GNDA 3U8TH 1F0UA 1BJUA 1O5BB 3PMJA 2YNAA 4BTIB 3MTYA 2GP9B 1W12U 4AG2A 4A92A 1BA8B 2KCAA 3HK6B 2AIQA 1AO5A 5GCHG 2QE7D 1FX0B 4BOHA 4JYUH 3EGKH 1QGFA 3SU1A 2CHAB 3A84A 1G30B 2FESH 1O2WA 3PV4A 2WINI 4M9FA 3FANA 1MU8B 1QB6A 1A46H 1ID5H 5FPSA 1J17T 1BBRK 2PV9B 1E36B 5C5NA 1C5VA 2FMJA 2WV5A 1PPFE 2J34A 3MMGA 1LHGH 4MNYA 1AGJA 1SPJA 4X8SH 1SGFG 5C5OA 5EXNA 3B23B 2OXSA 1B0FA 1HAGE 1ZMJA 2BY8X 2H9TH 1ZPZA 1QRXA 1LCYA 4KKDA 2TGTA 2R0LA 2HVYB 3GY5A 2SGDE 1UTPA 1V2UT 3P8NA 1LMWB 5TCAA 2CF8H 1CT2E 2BMGB 3WY8A 1P01A 4YXWD 2BD5A 2NU1E 3KF2A 1HYLA 1Z8JB 1GJ5H 1OP0A 4CRFA 2STBE 1NZQH 3AASA 1T8OA 2BD8A 3CP7A 3NRLA 2ZO3H 2GDDA 1DT2A 3GCNA 5L6NH 3DA9B 3OX7U 4I8GA 1D4PB 1MQ5A 4IC6A 2K0QA 1GI6A 3OEED 3LH1A 2WUBA 4NA9H 1W0JD 2ZEBA 4MTBA 3VPKA 5AFYH 2ZHQH 4UE7H 1FIZA 2Y80A 1L4DA 1UW7A 1SLVB 4FVDA 3OSYA 4K69A 2YMSC 1EPTC 1XX9A 5I46H 4ISOA 1D3TB 2F91A 5DG6A 1A5IA 2AH4X 2ZQ2A 4Y7AA 4XFQA 2PSYA 4SGBE 4OGYA 1CGJE 1TA6A 2Z94A 2P93A 3SQHE 1CT4E 5L2YH 1XUFA 1V2PT 1KXFA 1EPTB 2ZHEH 4NGAH 2Z3CA 2R9PA 1C2DA 4DJZB 4FVBA 4Y8YA 1NU9A 1GCTB 1AZZA 1O5FH 4A5TS 5L2ZH 2A4OA 1HXEH 2JJ2D 1AB9C 1C5SA 4NCYA 3LKWA 2XBXA 2RA0A 1TQ0B 2PP6A 5CE1A 1O2IA 2AERH 2ZTYA 1GHXH 2O8WA 2OLGA 1Z71A 1WUNH 2HGTH 1WAYB 1O2LA 1S6LA 4ZAEA 1AFQC 1YPHC 2DE9A 3EQ0H 3A85A 3HATH 3F2HA 2PR3A 4BAKB 3MQKC 1O2MA 1AKSA 1TNGA 2C8WB 1TBQH 2UWPA 1QZ8A 1YP9A 2J92A 1W2KH 1NRNH 3GCTF 1LHCH 3FAOA 4AORA 3UR9A 1SI5H 4RN6A 3UWJH 1BB0B 1LHEH 1FLEE 1UK2A 1ELFA 1X7AC 2IN2A 4YT7H 1U6QA 7KMEH 1C1WH 2OC8A 1T7CA 4O9VA 5EODA 8KME2 2WZQA 1IQKA 1SLUB 2FTMA 4FOUC 4F48B 1LVYA 3E16B 4WXIA 2QV1A 4MVNA 4NFFA 5C0UA 1NRRH 4OGXA 4B6EA 4RI0A 4DOQA 1S0QA 3TVJB 5PTPA 4JZ1A 2VWLA 5FXLA 1HAOH 4YESB 2RG3A 1GI3A 1O3NA 1TBRH 1DX5M 3MO9A 3K2UA 4Y6DA 4WH8A 5LH8A 4THNH 3U69H 1J8AA 1P2QA 1YLNA 2VIWA 1MMJN 1C2HA 4P02A 5B6OA 3AK5A 2WPMS 1RTKA 3SV6A 1GHZA 1C5MD 1FN6A 4B2BA 2G5VA 2BDCA 2VBCA 1GI4A 2ALVA 4ZMAH 3UOUA 3PLKA 4ZKOU 4JYTA 4UD9H 5F53A 4DY7B 1GG6B 1PPHE 1T31A 4TT3D 2J38A 1LVOA 3GDUA 2TGDA 1K28D 1O5EH 4B6FA 3C1KA 1C5QA 5IDKA 1C2GA 2Z3DA 1SGTA 4BAMB 1ARBA 1XM1A 2QXIA 2W7SA 1CQQA 1RTLA 4MNVA 2JJ1D 2VIQA 4JZDH 5EU8A 3O8CA 1H8ED 3FO8D 1C5ZB 5K0HA 2AHME 3SGAE 3ZZCA 3SJKA 5F6MA 1C2LA 1EUFA 4I8KA 2WPJS 3SN8A 1MD8A 2L6OA 4DG4A 1NRPH 1H9HE 1EOLA 2NU0E 1V2NT 1MZDA 1AZ8A 1EP5A 4IN1A 2ZDMA 1W10U 3URDA 1EZSC 5HIZA 1ZRKA 5JBCS 1LVMA 1GDNA 5DO4H 3RLWH 2BLOA 3EDXB 1GMHG 1AE8H 1HJ8A 3F2FA 1HJ9A 1IQMA 2SNVA 5HYOA 1AUTC 1MCTA 1O2JA 1SLWB 1C4U2 2D26C 3E91A 2HWLB 2ZNKH 2QIQA 1C1PA 3BTGE 1YWUA 5FX5A 5JBAS 1EB2A 3ATKA 2F9OA 1GHYH 4BTTB 1RD3B 1SOTA 1V2RT 1DLKB 1HAZB 4Y71A 5FBIA 5EW1H 3BSQA 3BEFB 4D7GA 4ABEA 4K1TA 1S0RA 2FLRH 2XC4A 2QXGA 4O3UA 1O0DH 4MLFB 1FN8A 1Y8TA 2H5CA 2QYIA 4F4OC 4DURA 3P17H 1GHWH 3SUFA 3FP7E 4FU8A 2CK3D 4IGDA 1KLTA 1XUIA 3OTPA 1JXPA 3DCLA 1KTTB 5DP5A 1C1MA 3SHAH 1A7SA 1JMOH 4TPIZ 1FY1A 1MKWH 4BXSA 5BRRE 5EIYA 3SBKA 3BTEE 2ZGBH 1FY3A 1GHBF 1ZMLA 4Y8ZA 3GYLB 1O3BA 1WCZA 3GY7A 2V0BA 3LGTA 2ZGXH 3LJJA 4X6MA 2AGIX 3T28A 1V2VT 3TK5A 2BLVA 1A3BH 1TMUH 2VH0A 6LPRA 1KDQA 3A89A 1O3LA 5LPFA 4WWYA 2ZU5A 2GD4B 4WVPE 1HBTH 1ZJDA 3SNEA 3EYDA 2XRCA 4XRNA 3RXMA 1L4ZA 3MU4A 2GVFA 1SR5C 1IHTH 3RU4D 4ZKNU 2CJIA 3A87A 3GISB 3SORA 5JYIA 1UTQA 1DDJA 2AMPA 3DD2H 3I77A 2JETC 1Z8GA 4Q4LA 1LKBA 1P05A 3AVZA 2GMTC 3D62A 3A7TA 2A4QA 1P2OA 3ZYDA 5C3NA 4Y11E 5IK2D 1TGCA 3TJUA 2WPDD 1TIOA 2HPQH 3MHWU 2ZGCA 2JETB 5EQQA 2OK5A 4K2YA 1SGEE 2Z9JA 1O31A 4IMQA 4FUBA 4FUEA 2WPHS 5E0GA 2F9PA 3SO3A 3DSPA 3DT0H 3VXEH 4AYVB 1WBGB 2VWMA 1BMLA 1QQUA 4Y79A 2CN0H 3EA9A 4ESTE 1QL9A 3PTNA 1ELGA 4D8NA 1TPPA 1QJ1B 3BTHE 4UFFH 3K6ZA 2ANWA 1BITA 1EQ9A 2BM2A 2EQNA 4I86A 3VB7A 3ZYEA 1TNHA 4ZH8A 3T5FH 2PUXB 3VGCB 4UFEH 4CRDA 1DWBH 1MKXH 4K60A 1ZGVA 3K9XB 5EGMA 3BG4C 3W95A 1EKBB 3SZNA 2AEIH 3F9EA 1PQ7A 1P2JA 3MU5A 4KP0A 1YGCH 1TALA 1RFNA 5A2MH 2L74A 1DVAH 1O37A 1O2SA 2CF9H 2VIDA 4H42U 2STAE 2BX3A 1IQGA 3RUOA 4K3JA 3MNXA 2XXLA 1YPJH 2Z9GA 3P70B 3D65E 1L2EA 7GCHF 2ULLA 3E1XB 1C2IA 4ISNA 1ZSLA 1AI8H 2XC0A 1HAVB 2TBSA 1HNEE 4LZ4B 1ELDE 3FZDA 2QN5T 1IQNA 1ORFA 3F9HA 4VGCC 3SUGA 1SFIA 4ABGA 1B5GH 1N1LA 2FZZA 3A7YA 1RTFB 5AFZH 4GCHF 1MQ6A 1XKBC 1NRQH 1QL8A 1O3FA 4MPVA 1QY6A 1SOZA 2B9LA 5EW2H 3NK8A 3ZVGA 4WMDA 5EJ1A 1TB6H 1W3CA 1OX1A 3PO1B 1KIGH 5GIBA 2A7HA 3UQOA 2FP7B 1Z8IB 3SZEA 1FY4A 4TY7A 3RM2H 2JDID 2OBQA 2XWAA 2ZFQH 1E38B 4Q80A 4WMFA 3GCTG 5EPYA 3RMMH 1O5DH 5T3HA 2BZ6H 3SI4H 3ELAH 3RC4A 1K22H 4X2WA 1C5TA 3JZ1B 2FM2A 1HXFH 2BHGA 3SV9A 1EJNA 3MO6A 1ETTH 4J1YA 4IC5A 4X2XA 2Q6DA 3KNXA 2RCEA 4XD7D 3RXAA 3V0XA 2QXHA 4KELA 4CBNA 5EXLA 3DSGA 3RXRA 1O3GA 4U30A 1KYNA 1MZAA 3RDZA 3SV7A 1GPZA 1ZSJA 1ZTKA 2Y81A 3T29A 1VJ9U 1FI8A 1DWDH 3NUMA 1DFPA 3ZVEA 3RXTA 2JKHA 1OWIA 3KGPA 5HXFA 3FP8E 3KIDU 1O2XA 1INCA 1VJAU 3F68H 3PWBA 2BZAA 3ZZ7A 3GDSA 3QGNB 1ZTJA 1KDQB 4MDSA 3SU4A 1Z1IA 2ZU3A 3BN9A 3TK6A 1G37A 2G52A 2VJ1A 5HM9A 4XSKU 4I8JA 3GY2A 4ZHMU 1BTHH 3PB1E 1T32A 3TPIZ 2FXRA 2VVCA 3A8AA 2FOFA 1P2IA 3MNSA 2BVSH 2K8IA 1SGFA 1B0EA 2A1DB 4Y8XA 1UCYE 2ZPSA 3UWIA 4LZ1H 4Y7BA 3ODFA 3KYFA 2QAAA 5KECA 1C5YB 1MU6B 1O38A 1LHFH 3HGPA 4B73A 3Q3YA 2F3CE 4Q7XA 2ZQ1A 5EG4A 3K6YA 1C1QA 1VGCB 1W13U 1MAXA 2W7UA 1C2FA 1O3AA 5EOKA 1FIWA 1ETRH 3SHCH 3PLPA 1YPGH 2FO9A 1CA0B 2B7DH 1QCPA 1OPHB 1DWCH 1H8IH 3TNSA 1DM4B 2FPZA 1AVGH 3PLBA 1TMBH 2RA3A 3LGVA 3KQDA 4ZXXH 1FY8E 5CHAB 2FOHA 1TPOA 1AUJA 5A8YA 2C90B 3ZZBA 3ZVAA 3NCLA 2FS8A 3AW1A 2VH6A 3GY6A 3PRBA 3FN8A 4B71A 4O97A 1EJMA 1NU7B 4X1RU 1P3CA 4ISIH 5ESTE 2I6SA 1E34B 3W1EA 1QR3E 1F0SA 3T2NA 3N99A 1AMHA 1J9CH 3MNBA 4X6PA 1C9PA 1EOJA 3SJ9A 1C2KA 3LT3A 2BVXH 5C1UA 1GBFA 2PGBB 4RSPA 2VINA 3RXUA 2F9UA 4Z0KA 2O8MA 1BT7A 1RJXB 1GHBG 3U1JB 2CHAC 2P95A 2C3SA 3SNBA 1MKWK 4MNXA 2BD2A 1ACBE 2QF5A 1GBLA 3PRDA 4MPUA 1H8DH 2RFKC 2HLDD 1IQJA 1O3JA 3NXPA 1WQVH 5HGGA 3M5OA 2G51A 2Y5FA 4LK4A 3UR6A 1NT1A 3GOVB 2KCYA 3A83A 2SGAA 3UREA 1P03A 2B0FA 4ZUHA 3RXGA 2ZDKA 1G36A 2BDHA 1PPBH 2HNTC 1O2UA
chains in the Genus database with same CATH topology
2WPIS 4AB9A 4JK5A 1FAKH 3E8LA 5GPIB 3VB4A 3LPRA 4INLA 3GCHC 2ESTE 3H7TA 3DFJA 3M61U 3LJOA 1ESBA 1JIMA 1LTOA 1MTVA 1THSH 1TNIA 1KXBA 5F8XA 2JH5D 1C2EA 2QXJA 1BCUH 3VEQB 4YOJA 3MFJA 2R3UA 3PTBA 4GHQA 1VR1H 1GBJA 1EB1H 3RMNH 4Q2KA 4CR5A 9ESTA 3GCHB 1QL7A 1EAIA 4UFGH 3UPEA 2EC9H 1AIXH 1GBTA 3TU7H 1OWHA 3MH6A 3CS7A 4I7YH 1TNJA 3GDVA 4MPWA 2HOBA 1K2I1 2O8LA 1O5AB 1VZQH 1SGIB 3PMHB 3RLYH 5GJ4B 3M36A 4HTCH 1KTSB 2FIRH 2FDAA 1DPOA 1D3DB 3M3VA 4AFUA 3UNQA 2C4FH 2UUJB 1QFKH 1YPEH 3SUEA 1MKXK 3OU0A 1NY22 5EQSA 2EEKA 1NRSH 2ZG0H 1N8OB 1TFXA 1GCTC 5J4SA 1SL3A 2C8ZB 1Z7KA 5JB8S 3RC5A 4CBOA 1K1LA 4NFEA 4ABDA 1ZHPA 1UHBA 2UUYA 2JH6D 3ZZ5A 2AS9A 2ALPA 1GBMA 3A88A 7GCHG 5HMAA 2ZDNA 1OOKB 4IBLH 2F9VA 2UUFB 1GL1A 4X1NU 3STIA 4MQAA 3T25A 1UVUH 1ZYOA 1YLDA 1TOCB 1F5KU 1GI0A 3SGBE 2ODQA 2ZFPH 1QHRB 3VXFH 1QA7A 3T62A 3MNCA 5LPEA 1SMFE 2HLCA 3TK9A 1L1JA 1BBRE 4GCHG 1O3PB 2I6QA 1UCYH 2FS9A 2OCVB 1SGDE 1IHSH 4YOIA 1A5GH 3S9AA 1FXYA 3U8OH 1QB9A 4KGAA 2Z3EA 5T6FA 4B75A 4CR9A 2XWBI 2AGGX 4HFPB 1YPMH 5JBBS 2R0KA 3TH3H 2ZU4A 3RXFA 1FZZA 1O3HA 1YF4A 1VCPA 1ZRBA 2D2DA 1E37B 1UTMA 3SJOA 1FNIA 2FLBH 4ABAA 2WUCA 3ZZ3A 2QCYA 2VWOA 1CBWC 4U2WA 4H4FA 3UOPA 2BY5X 4WXVA 1UJ1A 1GWAA 1V2QT 3I29A 1HAXB 1TLDA 4JYVH 3A86A 5BPEA 4FU9A 1A5HA 1GG6C 2G81E 5GDSH 1SQTA 1TPSA 3LGWA 1CBWB 1J16A 1C4Y2 3ZZ8A 2EI8A 6ESTA 3BV9B 1IAUA 2Z6BD 5AF9H 2NU4E 1PYTD 1TGTA 3UNRA 1QIXB 1P9SA 3AAVA 2WPKS 1K1JA 1ZHRA 2GCTB 4TY6A 2JH0D 1BDAA 5F8TA 1UTNA 3RXLA 2O8TA 4FUJA 1B7XB 3HKJB 3RXSA 2EI7A 2ZA5A 5F8ZA 3Q3KA 2XYAA 1HAVA 1A0HB 1WTGH 1XXDA 4BAHB 4X8TH 4NIXA 1GI2A 1GGDB 2FX6A 3RXEA 2ZI2H 3S69A 2A32A 2FOCA 4A6LA 1F5LA 1JRTA 3S9BA 4JZIA 4CREA 5DKMA 1SGQE 1ZR0A 3IG6B 1O2RA 1GI9B 2W3KA 3LH3A 5K7RA 4IW4E 1W0YH 5LPRA 1ESTA 2BDAA 2QC2A 1P2MA 5C2ZA 3NPSA 1O2TA 3B9FH 5T6DA 3RXBA 2PHBA 5H4IB 1T4UH 2GX4A 1FQ3A 1T8NA 3T26A 1OP2A 4DCDA 1ANDA 2BD9A 3PM3A 4D76A 5A0CA 4CH2B 5FPYA 2VB0A 3LGYA 1NC6A 5FAHA 1ESAA 1GMCF 1GBAA 2GGVB 3QTVH 2V3HH 1T8LA 6GCHF 3TGIE 4ABJA 4UEHH 5C67A 4J2YB 2BY6X 1TRMA 4XOJA 1L1GA 1AVXA 1NFYA 1W0ZU 1DXWA 4AGKA 2H5DA 1W14U 2F83A 4SGAE 1YCPH 1LDTT 5JPMH 1A4WH 4FUDA 1KXEA 2GT8A 1G3DA 1H1BA 4AX9H 1TNKA 3KQBA 1C1RA 1HAYB 3UIRA 1UHBB 1C2MA 4MG3A 1THPB 1MTWA 3ZZDA 1C5UA 1E35B 2HNTF 1RRKA 2GT7A 1HAPH 3PMAB 3QLPH 4INHA 1UO6A 4IS5A 3RXKA 3ZZ9A 1TA2A 1MH0A 4XBCA 1OWEA 1HB0B 1AD8H 5ABWA 1TONA 2PTNA 3IITA 5A0BA 1KXAA 1O3MA 1P0SH 2OP9A 3RC6A 1OYTH 1EAUA 1DY8A 1O36A 2HPPH 1O34A 2AMQA 5TJXA 5DP8A 1RIWC 1YCPM 2A4RA 3PMBB 5DK1A 1SGYE 2SNWA 2SFAA 1DICA 2A5KA 5A09A 5A8ZA 3SU0A 3ATMA 4A1VA 1GBHA 2XCFA 1EJAA 1F2SE 1UVSH 1QJ6B 2XTTB 1ELBA 1P12E 2NU3E 1ELTA 1QNJA 1CGHA 1ANCA 2A7CA 1BBRH 8GCHF 3O8RA 2D1JA 4BTUB 5L30H 1RIWB 5F03A 2ZIQH 5FPTA 3EA7A 4OS6A 1D3PB 1S85A 2ZHWH 4K1EA 1O3EA 4TPYA 3B8JA 4BXWA 3TIUA 2FEQH 3VGCC 1O2KA 1K1PA 3TLOA 1H9LB 2BQ7B 3E0NB 1AVWA 3SI3H 2FX4A 3VB3A 1Q3XA 2OC1A 2VNTA 1NN6A 2SGEE 2FI4E 1ZZZA 4FUHA 1TWXB 2AGEX 2V3OH 2H9EH 4NA8A 2GZ9A 1VITH 1Y5AT 1O2ZA 3SU5A 3M3TA 1BTUA 1V2JT 2C93B 3M7UA 3U98H 4ZHLU 3P95A 1FPHH 3A8BA 1TBZH 3ZVFA 1FAXA 1AN1E 1LVBA 2IOTA 4NIWA 1SBWA 4Q7ZA 2ASUB 1EZQA 1A61H 2ZCKP 5AVDA 3C27B 1ZJKA 2TRMA 1SHHB 1DWEH 1GBEA 4NIVA 3IWMA 2BY9X 2ZF0H 2FOGA 3OYPA 5IYTA 1VCWA 3MI4A 4R0IA 3JZ2B 1NFUA 2Z7FE 3UNSA 3OY6U 3E6PH 2VGCB 4I33A 4I32A 2B5TB 4WY3A 1HV7A 1XKAC 4ZKRU 2BX4A 3MH4A 4BAOB 1BQYA 3L3TA 4B2CA 1WYKA 3PO1C 2SGPE 1V2ST 1WU1A 4YO9A 1SG8B 2BOHB 1BTZA 1OWDA 5T6GA 5EQRA 5DGJA 1Y3WA 1ZTLA 1RGQA 1HAHH 2BOKA 2SGQE 4ABFA 1O35A 4CRCA 4KTSA 4Y10E 1Q31A 5C1XA 4WJG2 1V2MT 2P3TB 1FMGA 1G3EA 4HI3A 3SW2B 4GUXA 2WYGA 2BD4A 2ZFFH 2HALA 1EATA 1C1OA 3ENSB 1Z1JA 4OS4A 2ZFSA 1GVZA 1SVPA 1WTHD 1CHGA 3LC3A 1ELEE 3BEUA 2GV6A 1GDUA 1Q2WA 3M37A 4Z6AH 1QQ4A 2ZCHP 3FFGA 1ELAA 1V2LT 1Y5UT 1SHYA 2A4GA 1RXPA 3GCOA 3KQEA 1LPZB 1JIRA 2BD3A 1EXFA 1O2NA 3A80A 2PFEA 1OP8A 2H6MA 3NWUA 2ZECA 2P3UB 1GHAF 1QRWA 3E3TA 1ZHMA 3SU6A 2BDYA 2ODYB 1UTJA 3SV8A 3DUXH 5DP9A 2OTVA 3QZRA 9LPRA 3DFLA 4H6SB 4I8HA 1SQOA 2ZC9H 4ABBA 3RXJA 3SJ8A 1NM6A 1HCGA 1GBKA 2ANKH 2Q1JA 4LOYH 1BHXB 4DIIH 2VVVA 3ODDA 1YPHE 3EAJA 4RKJB 4YLUA 1AE5A 1V6DA 1DSUA 1UVPA 2P59A 4PROA 1G3BA 4QT8C 3T27A 3LGIA 4E7RG 2ZFTA 1MCVA 2OINA 4D9QA 1NESE 1TRYA 1OWJA 2BY7X 4CRBA 4OS7A 1ABIH 1XMNB 4NZLA 3ZVBA 1PFXC 2P8OC 1LQDB 1MTNB 3M5NA 4CH8B 5A8XA 1ZOMA 3KCGH 2H9HA 1VGCC 1V3XA 3S7HB 3MOCA 4M7GA 5J4QA 3TJNA 4I8LA 2P16A 4AOQA 2BXUH 1KLJH 1P06A 1QA0A 4O3TA 4YZUA 1AY6H 2GTBA 3BTTE 1CA0C 1NFXA 3R3GB 1F92A 1P02A 1N6YA 2YNBA 4BAQB 2P8OB 1OXGA 2FOEA 4CHAB 4AN7A 2A7JA 3HK3B 2R2MB 1DE7H 1P57B 5CHAC 4DT7B 3P92A 1VCQA 1AFEH 2HRVA 1DLEA 1SLXB 1W7GH 5FX6A 1ZMNA 2FWWA 2Z9LA 2GDEH 4UFDH 1H9IE 1YKTA 2IPHA 1DS2E 3KHVA 1XUJA 1Y3XA 4ZHAA 1TRNA 5LGOA 2RDLA 1GJDB 4ZKSU 1UTKA 2QF0A 2F9NA 3ZVCA 1ZPBA 5E8EH 4E7NA 3QUMP 2BXTH 2XBYA 1GI8B 1GMCG 2A5IA 1ZGIA 2J95A 3KN2A 1BIOA 4XBDA 3SV2H 6GCHG 1ZPCA 1DY9A 4GSOA 1G3CA 1NROH 1HRTH 1WSSH 1HJAB 6CHAC 2BLWA 1TX6A 2OC7A 2G8TA 3HPTB 1SFQB 5G4BA 3V3MA 1CU1A 5DPAA 1QJ7B 1C5NH 1BUIA 4IMZA 3CS0A 1G9IE 1K1MA 4WF8A 3ITIA 1BRBE 6CHAB 3U1IB 1DUAA 2OD3B 2FODA 4I31A 1QRZA 3E0PB 2BD7A 1J15A 1P2KA 2FI3E 3A7XA 2Y6TA 3QDZB 3PROA 1PYTC 4GLYA 1G2MA 3TITA 1FUJA 2O8UA 2J2UA 4OS1A 1HIAA 1O32A 1UTLM 3P8GA 3PWCA 3DHKH 2A5AA 1PPZA 2LNCA 1H4WA 2O9QA 4ISHH 1S81A 4LXBH 4A1XA 5I25A 5HM2A 1TX8A 3MU1A 1OWKA 4JZFH 4NA7A 5FCKA 1ARCA 1BRCE 2FYRA 2TIOA 2XBWA 5ETXA 1CHOF 2EA3A 2DUCA 1SGCA 3MU8A 1A1RA 5DP6A 1QURH 2DE8A 8GCHG 1GHVH 2BTCE 4AG1A 1SC8U 3V7TA 1BTXA 1Y3VA 3E90B 2WPLS 1C1NA 4YOGA 1TX7A 3RP2A 2BB4A 1GVKB 3TJOA 2J9NA 4FUGA 1C1UH 2A45B 3UFAA 2VVUA 3U8RH 1C2JA 2C8YB 4YTAA 2W3IA 1O3IA 1Z8RA 1Z6EA 4U32A 1IQEA 1ETSH 1IQLA 1ANEA 3BTQE 1N8OC 1GJ9B 3URCA 1O2GH 2ZTZA 3FZZA 3LU9B 3QO6A 1OYQA 1RS0A 1SGNE 1DXPA 4X8VH 1SGPE 2R3YA 4AFZA 2GZ7A 4CRGA 1YC0A 2G55A 2ZPRA 2KAIA 3EA8A 3M5LA 1GJ8B 4KTCA 1BTPA 4GVUA 1EP6A 1O39A 1PPGE 1V2OT 2VIVA 1PPCE 2ZU1A 2ODPA 2UUKB 1D6RA 4GAWA 2FTLE 3OTJE 3SNAA 3VB6A 2OQUA 3RXCA 2PUQH 3M7TA 1VITF 4F49A 1Y3UA 1G32B 2PKAA 4YM9A 4GHTA 1AQ7A 4YT6H 4DGJA 1UK4A 3OY5U 2VIOA 2UWOA 4UONA 1JOUB 3ZZ6A 1MBQA 2PKSC 1GJAB 3Q77A 2VU8E 3SUDA 1Z6JH 5SGAE 1LKAA 3SOSA 5C20A 4FUIA 4ZROA 2R2WU 1TABE 4OS5A 1MD7A 1NO9H 2ZZUH 3QGJA 5ESBA 5DP3A 4INKA 5DP7A 1ABJH 2PGQB 1BHXF 1TPAE 1D3QB 2Q6GA 1FONA 1JWTA 3UY9A 1C4V2 1O30A 2PKSB 1GVLA 3AW0A 3RMLH 1C9TA 4Q7YA 1A2CH 1Y5BT 4X1PU 1PJPA 2FOAA 2UWLA 1K1NA 1C5WB 4K8YA 3SJIA 2BQWB 3BF6H 4FU7A 1C5LH 4HGCA 1UVTH 1AB9B 4H6TA 4NSVA 4X1SU 1LQEA 3P6ZB 5CMXH 5JBTA 1HGTH 2QY0B 1GHAG 2ZTXA 1S6HA 1D9IA 2OUAA 3BTFE 1KY9A 3UQVA 1Y59T 4JK6A 4HZHA 1TGBA 1YM0A 4ISLA 3I78A 2P94A 1AFQB 3D23A 3GY3A 3P8FA 1O3DA 2LPRA 4JCNA 1ANBA 1S6FA 2GCTC 1FV9A 3SGQE 3MWIU 1GMDF 2A0QB 2ZDVH 1O2PA 3R0FA 1PQAA 2H2ZA 4ABIA 2GCHF 1HUTH 2AFQB 1BRAA 1GBBA 3M3SA 1SQAA 2OBOA 3MO3A 2ZDAH 1TAWA 1MTSA 2HVXA 2ZU2A 1XVMA 1BJVA 2W26A 1HIAB 4NIYA 4AZ2B 4XBBA 1GGDC 2BQ6B 2BDBA 2PW8H 2BDGA 2WV4A 1GJ7B 1IQIA 3KL6A 1W11U 1YPKH 1G2LA 2IJOB 3RXOA 7ESTE 1S82A 2G4TA 2V6NA 1UMAH 3SNDA 2TGPZ 1HAIH 5E0JA 3BIVH 5A0AE 3ZVDA 1AU8A 3SU2A 4O03A 1GDQA 1J14A 2H1UA 1HLTH 3D49H 2FOBA 1QBOA 4A7IB 3RXDA 1F0RA 1AHTH 1O2YA 2CV3A 2ZWLH 2G4UA 1C5XB 2ZHDA 1DOJA 2ZP0H 3S0NA 3H5CB 4BANB 3LDXH 4DIHH 5DP4A 2D8WA 4NWKA 1WQSA 3H7OA 1MBMA 1XUKA 3TH2H 1V2WT 1CT0E 1NFWA 4TWYA 1UTOA 8ESTE 2Z9KA 1S83A 2ZGHA 1EZUC 1L0ZA 1HDTH 2PWXA 3ATLA 2ANYA 2BYAX 4X6OA 3VFEA 4D9RA 1O33A 1Y3YA 2TGAA 2GKVE 3LIWA 3KQCA 3BTWE 1UVOA 2WYJA 4WMEA 1K9OE 3HKIB 1C1TA 2KAIB 4FXGH 4E05H 3GICB 3F1SB 4K5ZA 2G5NA 1S84A 1KXDA 1LPKB 2P3FH 3QWCH 4ASHA 4NSYA 2ZFRH 5FHTA 5FCRA 4FUCA 3ATIA 1FPCH 2BLQA 1O2HA 4JMYA 2PKAB 3UTUH 1GJ6A 4MPXA 1GI7B 1P11E 2QF3A 2TPIZ 2CMYA 4CRAA 1O2QA 3FP6E 2ZGJA 1A0JA 4Y76A 3EE0B 1O3OA 1C1VH 1O3KA 2Q6FA 8LPRA 1F0TA 4AGJA 1OKXA 1KSNA 3AAUA 3BEIB 5DJ7A 2QA9E 3MH5A 1FJSA 1P09A 4R8TB 1GJBB 4AFQA 3W94A 2ZCLP 3F6UH 1YBWA 2ZHFH 3GY4A 3HGNA 1EASA 1CHOG 1GCDA 5GCHF 3RU4T 2ZKSA 1THRH 3N7OA 4X2YA 3BTDE