1OX1A

Crystal structure of the bovine trypsin complex with a synthetic 11 peptide inhibitor
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsinogen, cationic
publication title crystal structure of the bovine trypsin complex with a synthetic 11 peptide inhibitor
rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ox1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ox1A02
1HJ8A 2BYAX 2NWNA 2HOBA 1AI8H 1BBRH 1ZSLA 3EAJA 1BTXA 3KQDA 1DWDH 4X1NU 2SGFE 2BQWB 1OYQA 4NIVA 1KXBA 3TJOA 4Q7YA 3S7KB 2AMQA 2ZHDA 3PLKA 5EXNA 2C8XB 3T5FH 2G00A 3A7YA 6CHAC 1F92A 4X1SU 2P16A 1O3FA 1D4PB 3MTYA 5T3HA 5TCCA 1GJ5H 3UQVA 1GHBG 1HAHH 1O3HA 2XBVA 4BAOB 4K1TA 1P57B 3VXEH 1NO9H 1OKXA 1JRSA 1GJAB 4K8BA 4YOJA 4JZEH 1GCTB 1LPGB 2BXUH 2ZPSA 1TNLA 1K2I1 2ZA5A 2H5CA 2BDHA 1A46H 4O3UA 3VB5A 1THPB 2Z6BD 4IS5A 5DG6A 1TBRH 3UNRA 1S6HA 1P09A 1LCYA 1V2PT 4HI3A 5DK1A 1CHGA 3OY5U 2P93A 2ZIQH 4Y79A 1HGTH 4OGYA 1RGQA 4K1SA 2ZDNA 3E8LA 1VR1H 3F9GA 1GI6A 1QRZA 2H9EH 2C8YB 2ZHWH 1FQ3A 3U98H 1ID5H 4SGAE 2A31A 3A83A 4FU8A 2M5TA 1BTHH 1HDTH 1HBTH 2ZHEH 1C2EA 1SL3A 1IHSH 1EASA 1G32B 2ZFRH 1K22H 2CF8H 1BZXE 1SGNE 2G55A 7ESTE 3PM3A 3LJJA 2QAAA 3T62A 1C2DA 2GMTC 1GHWH 1F5RA 2QA9E 1WQSA 3P8FA 2EI7A 1QCPA 2SGQE 2Z94A 2ZCKP 1DX5M 1TMUH 3M36A 4OS2A 4YESB 1GJDB 1SR5C 1D6RA 3GDUA 4ZXYH 3RP2A 2O9QA 2PKAB 5C20A 3UPEA 4THNH 5EODA 4X8TH 2ZU2A 2ZI2H 3LONA 1KXAA 1WOFA 3TK5A 1FAXA 1ZMJA 2GT7A 1TRYA 4Y10E 1V2VT 1UK3A 4YTAA 4DIIH 1DPOA 3R0FA 4NZQA 3UWIA 3U1JB 3B9FH 1YLDA 1TRNA 1SOTA 4UFFH 5FCRA 1F0UA 2D26C 3M5NA 1BT7A 1A7SA 1HAYB 2JH0D 1VITH 2UWPA 4YZUA 2P3TB 2PHBA 1P3CA 1NFYA 2ZDVH 1JWTA 3SO3A 2F9VA 2J94A 3UNQA 1V6DA 2BLVA 4A5TS 1YPKH 5TJXA 5L2YH 1GGDC 1C5VA 2ZTYA 1O35A 4XFQA 3MO6A 2ZGXH 1P8VC 1TNHA 6GCHF 1KLIH 4NWKA 1F5KU 5A8XA 3UOUA 1Y5BT 1O32A 2F91A 5C5NA 4ISHH 1L1GA 3BN9A 3EA9A 5FPYA 1XXDA 1HV7A 2Y80A 5L2ZH 5JB8S 4E06H 1P02A 4UFDH 1C2HA 4CBNA 3PMJA 1SHYA 3W95A 4DW2U 1LTOA 4LK4A 3SU1A 4E7NA 1UO6A 1O5FH 2OINA 1XXFA 3IITA 1LVOA 2EI6A 1BCUH 2O8TA 4Y71A 2O8UA 3AAVA 2FTMA 3V3MA 5EW1H 4ABBA 1HIAB 1H9HE 3KEEA 3U69H 2BLQA 3O8RA 4ZAEA 4K8YA 2OC1A 1YPLH 1C9TA 1IHTH 1AO5A 1EZQA 1MQ6A 3AVZA 1GJ9B 1RS0A 2C8ZB 5HYOA 3P6ZB 2HALA 2TRMA 3VFEA 3ZVEA 1LMWB 1H8DH 1YCPH 1HAVB 1P9UA 3SGBE 1H1BA 2QXGA 1C1WH 2SGAA 1UVPA 5JBTA 3MU4A 1J14A 5J4QA 3PMAB 4DCDA 1HAXB 2ILNA 1GBKA 2ZDMA 1BRUP 3HKIB 3BG8A 4MVNA 1EAIA 4CRDA 1FIWA 1EKBB 4ISLA 2KAIA 1GBHA 1LPZB 3TITA 1ZSJA 1QFKH 3SBKA 3QN7A 2ZFPH 1A1RA 4F4OC 1TQ0B 1G2LA 4FUBA 4KKDA 3ZVDA 1EB2A 3VEQB 5F8TA 1YPJH 1GI4A 1W2KH 1GVLA 2FODA 5GJ4B 2Z9IA 3RXIA 4ABAA 4BOHA 5LPEA 3A8AA 3GOVB 4ZUHA 1HAGE 4BXSA 3TPIZ 2UUFB 1QA0A 4AB9A 1GHYH 4RKOB 1FPCH 3H7TA 5E8EH 3QWCH 4MNVA 3TH3H 1N1LA 4KP0A 1WU1A 4FUJA 2W7SA 1O33A 1ZRBA 1EPTA 2CXVA 4NWLA 4Y8ZA 3T27A 1Y5AT 3K6YA 4DY7B 2Z9KA 3RMMH 3BEFB 1QBNA 2SFAA 1ETSH 4GSOA 1IQEA 5HM9A 3ZZBA 2VVCA 3SI3H 2TGPZ 3TGIE 4ABJA 1ZMNA 1GI2A 3OU0A 1BTUA 3SN8A 2UUKB 3G01A 1C1TA 3A80A 4NFFA 3FZZA 1NY22 3PLBA 3UR6A 4B2AA 1ZJKA 1EJNA 1JIMA 2BMGB 2J38A 4ZKRU 3NWUA 2ODYB 1A2CH 1Q31A 2FTLE 2ANKH 2FX4A 2F83A 1UVOA 2FEQH 1C2MA 1GWAA 1UTOA 1AIXH 4WXVA 1KTSB 2R3UA 2OD3B 2ZHQH 2O8MA 3NKKA 2J92A 2PR3A 1WV7H 3U1IB 3M5MA 1FNIA 3SQHE 2VJ1A 1TA6A 1MBMA 1O2JA 2ZGBH 4WMFA 1O30A 1SGCA 5GWZA 1G9IE 3SJOA 3OY6U 4CRFA 3H5CB 1Z71A 1AVXA 5EU8A 1G2MA 1JMOH 2FPZA 3QTOH 3SU5A 3ATWA 5GXPA 1CT2E 2P95A 1MAXA 2ZU3A 3FANA 1EQ9A 2ALVA 5AF9H 3DHKH 1P2JA 1DLEA 4I8GA 3ATLA 1KXDA 3I29A 1A0HB 1NRPH 1OP2A 1O2YA 1C5UA 1OPHB 3MI4A 1QL7A 4X6OA 1OYTH 2Y81A 1ELCA 3BTKE 1C2JA 4YOIA 1UCYH 1C2LA 4VGCC 2Z9LA 1UTQA 2JKHA 4YO9A 1CHOF 2GP9B 2GZ8A 3ESTA 2ZGHA 4ISIH 3LGUA 1Q3XA 2GD4B 2WPMS 1P2NA 3EA8A 2GZ7A 3RXBA 1ORFA 3SV9A 3MMGA 1O3KA 1LKBA 1PPBH 1DS2E 3EQ0H 3M3TA 1Z8GA 2FOFA 3PLPA 1G36A 2P3FH 1CU1A 1GBIA 5DP5A 2NU1E 1Z8RA 1IQGA 1L1JA 2A45B 3UY9A 1ELEE 2ZGJA 3ATIA 3MO9A 4OS1A 2H2ZA 6ESTA 1GG6B 4CR9A 2VGCB 1O2NA 3QGNB 1HJ9A 2PFEA 1GMDF 5DKMA 5F03A 3O8DA 1TX7A 2FOEA 1SB1H 2VINA 1GBTA 4Y11E 1UCYE 3SJ9A 1U6QA 3HPTB 1UJ1A 5CHAC 3A7WA 1O2LA 3MWIU 1W14U 2PUQH 3V12A 1ELAA 4OGXA 3D65E 2BVSH 4MNXA 1E37B 2AYWA 2GX4A 3BTDE 4GHQA 1AU8A 1O5AB 2BD5A 1BJUA 5JYIA 4CRCA 2DE8A 2HNTC 2G4TA 1CHOG 2VH0A 2FLRH 1O3EA 1E38B 4Q7XA 3VGCC 1TE0A 2FWWA 1VITF 3S9BA 2QY0B 1N6XA 1TGBA 4ZROA 5T6GA 4ZH8A 2XBXA 1E34B 3O8BA 4AFUA 1D3PB 4B2CA 1FMGA 1GG6C 3ATMA 1FY1A 1MTWA 1CGIE 2VWLA 1FPHH 2Y82A 3UQOA 1AKSB 1D3DB 1TB6H 3L33A 3NXPA 1EJAA 1GMDG 1SGEE 1ZHMA 3UFAA 2AMDA 5I46H 1O3DA 2WPLS 1V2RT 3M61U 3TNTA 1QJ7B 1XVOA 4GCHF 2FOCA 1TABE 4Y0YE 4BNRA 5F8XA 2FI4E 4R0IA 1S5SA 1LVBA 5LPFA 2BXTH 4ISNA 4RSPA 1VGCB 2EA3A 5EQRA 3P70B 1O3PB 1O2PA 4UD9H 1RTKA 1V2UT 2BVRH 3GY6A 2ZHFH 1KY9A 1UMAH 3LGTA 1EPTB 3PO1C 4CR5A 1KSNA 1VJ9U 1SGTA 8ESTE 2FOMB 4B74A 5EPNA 2ODPA 4NFEA 7GCHF 1OWDA 1V2ST 1XMNB 2TGAA 1ZGIA 2BX3A 4JMYA 1GBDA 3TU7H 1ZLRA 2Q6GA 1T8NA 3TK6A 2J95A 5EQQA 1QQUA 3I78A 4U2WA 1FY3A 3QK1A 1PPHE 1OWHA 4X1PU 5AFYH 1ZHPA 2ZFQH 3U8TH 4TPIZ 3B23B 3RLWH 1PJPA 1QB6A 4K3JA 5IYTA 2FX6A 3F6UH 1BRCE 2EI8A 3ODDA 4GCHG 3TJUA 2BDCA 1GCDA 3BIVH 2EC9H 1V3XA 6CHAB 5C5OA 4I7YH 3ZZCA 1GHBF 3GCOA 1G3EA 4NIXA 2OLGA 4JZDH 2A0QB 3F9HA 2B8OH 4BAQB 2WYGA 1EPTC 4FXGH 5AHGH 2WV4A 3E0NB 1WUNH 2ULLA 3VB6A 3PMHB 4NA7A 5K0HA 1ANDA 1QBOA 3A8BA 5EPYA 1ARBA 5K7RA 3PB1E 4U32A 4WJG2 3S69A 4IN1A 1GL1A 1C1SA 4WMEA 1EP5A 3ZZ8A 2D8WA 2BD4A 3F1SB 1NM6A 1BB0B 3MNBA 1TGCA 2V35A 2Y7XA 1L1NA 1LQEA 1CT0E 5AVDA 2BY6X 3BTWE 2HVXA 1EAUA 5FXLA 3BTQE 2SNVA 2AERH 4KELA 1W0YH 4CHAC 1HB0B 5DGJA 1ZZZA 3GDSA 1GHXH 2FI5E 3R3GB 1ZTLA 2O8WA 2P59A 5GDSH 4MTBA 1O3BA 1C1RA 3AAUA 4IC5A 2CJIA 2JETC 3QTVH 1GMHF 2F3CE 1A0JA 4O03A 1OXGA 3NPSA 3VPKA 2ZECA 4SGBE 1O5GH 3ODFA 1YYY1 2GMTB 1P05A 1SLWB 1Y3WA 2G8TA 2BTCE 3TIUA 4HGCA 5EW2H 4FUDA 4JZFH 1AFQC 1BBRE 1L2EA 1GDQA 1CE5A 2VH6A 1F0RA 1W10U 3Q3XA 2PV9B 3LH3A 3SUEA 2WPIS 3WY8A 1TPPA 5HGGA 2QC2A 1YC0A 1C1QA 1A5GH 1EUFA 1EZSC 2O8LA 3L6PA 3ZZ7A 1K28D 2AGIX 4X6MA 1J9CH 2BD9A 1TGNA 2FOHA 3N7OA 4WH8A 4B73A 2ANWA 3K9XB 2Y5GA 2Z3DA 1O5DH 4F49A 1GBFA 1RRKA 4UE7H 1AFEH 1NRNH 1EJMA 2F9UA 3OSYA 1EZXC 2VIVA 1P10A 4DOQA 2A2QH 3B8JA 4YT6H 4DJZB 1ELTA 1OWEA 3SORA 3PROA 1YBWA 1OWIA 4YT7H 2GDDA 3CENA 3FP7E 4I33A 1ANEA 5E0JA 1GMHG 2AH4X 1DY9A 1MKXK 2P8OC 1HLTH 1HFDA 2QXHA 1TOCB 4ZMAH 4BXWA 4TWYA 1MKXH 2G5VA 3E0PB 1P3EA 4K5ZA 1GGDB 2FZZA 3ZZ5A 2OXSA 2ZG0H 2FMJA 3MYWA 1W11U 1MU6B 2HNTF 1PPGE 3GY4A 1UVSH 1SGRE 1ZPCA 3FP6E 2B0FA 2H1UA 5E0GA 2NU3E 9ESTA 5L30H 1BIOA 1O2ZA 4UDWH 1INCA 2STBE 3P8GA 3A85A 4NA8A 3UUZA 4WF8A 4X1RU 3JZ2B 1HPGA 1ZPBA 1HXFH 4ABFA 1P2MA 2IPHA 3M7UA 2WUCA 3E91A 4TPYA 2ANMH 1JRTA 1MU8B 1QIXB 4XSKU 5JB9S 4JZIA 3V13A 1P2IA 2J4IA 9LPRA 1XKBC 3BSQA 1D3QB 1NC6A 3BEUA 3F9EA 1BQYA 1O39A 2HLCA 4WVPE 4Y8XA 1AMHA 3SJKA 3LPRA 4ABGA 3FP8E 1UHBA 2A7HA 2BLWA 1O3GA 3L3TA 1P04A 1C5LH 3RXKA 2HWLB 1YPGH 1C1OA 1F7ZA 1UK4A 2GT8A 3TH2H 1BMLA 1ANCA 4NZLA 3ZYDA 3FZDA 1AGJA 1TOMH 1GDNA 3MU0A 4K2YA 2BD2A 1XKAC 3RC4A 4O3TA 1ELBA 2W5EA 2XCNA 4JCNA 2DE9A 1KXEA 4QT8C 1ELDE 5I25A 3TGKE 3UIRA 3MH7A 1O37A 2BY5X 5EG4A 2XWAA 1FY8E 1XUIA 1BTYA 3TJVA 3OX7U 3SUGA 3SU0A 1DXPA 1WTGH 1O2GH 1PPFE 1LKAA 1UVTH 2J9NA 2Z3EA 1ZSKA 1GJCB 1LQDB 1V2QT 3DFLA 3URDA 2GV6A 5A09A 4BAKB 5C3NA 2WUBA 1TX8A 2ZEBA 2TBSA 4XDEA 1IQJA 1ESBA 5GCHF 1V2OT 1T8LA 5JPMH 1ACBE 1XUJA 4JYTA 2BY9X 3P92A 2G52A 5AFZH 1A3EH 2XC0A 1X7AC 2A32A 4CH2B 1KLTA 2ZWLH 2HGTH 1HAZB 1O3NA 1GJ6A 2A5AA 1SGYE 3LC5A 3SZNA 2ZDAH 1EXFA 4Q80A 4BTUB 3NUMA 4DURA 1T31A 3SJ8A 2A2XH 1QA7A 2SNWA 1XUGA 1Z1IA 3RXSA 1P06A 2NU0E 2AIPA 3TVJB 2A4OA 3RMLH 1CQQA 1BHXF 1ETRH 2FOGA 1A5HA 2WPHS 1SFIA 3UREA 3GCTF 3ZZ9A 3S9AA 4R8TB 2W26A 4INLA 1BTWA 1F0TA 1CSOE 1QY6A 1ABJH 4LOYH 4H4FA 2BLOA 4LZ1H 3QUMP 2XWBI 1O3OA 1SBWA 1RXPA 1EAXA 2W7UA 3TNSA 1TX6A 3MU5A 4JK6A 1KXFA 1ZJDA 5C1XA 1GI0A 4ESTE 4X8UH 1DUAA 3KCGH 5GCHG 2BQ6B 1T8MA 4ZHAA 2GV7A 1B5GH 2ZFFH 3RXLA 8KME2 3GY8A 4D9RA 1MD7A 5IDKA 3MNCA 3S9CA 4JYUH 3SU6A 4U01A 2W3IA 3DD2H 1H9LB 1N6YA 1Y59T 2XBYA 3UWJH 1ETTH 8GCHF 4LZ4B 2A7CA 3HKJB 2BZAA 5JDUB 1SLXB 2ZC9H 5EGMA 2ASUB 1HAOH 1O2SA 5T6DA 2LNCA 1GI9B 1AZ8A 4X0WU 2AIQA 4FVBA 1PQ7A 4AORA 2XCFA 1O34A 1C5NH 3GCTG 1OS8A 2SGPE 1K1OA 3SQEE 1QB1A 1LPKB 1QB9A 1UTLM 2I6SA 1OOKB 4VGCB 1ARCA 1LVMA 2PSYA 2FDAA 4AN7A 4HZHA 3QZQA 1QRWA 1EOJA 1WAYB 2G81E 1G3CA 1TBZH 1YPHC 1C4U2 1O2WA 2AS9A 2QIQA 3JZ1B 1K1NA 1W13U 1TALA 1J16A 5HM2A 1NRQH 2C93B 1LDTT 1TBQH 1YPHE 1NN6A 1TAWA 3A81A 2OUAA 4KGAA 2GZ9A 4ZHLU 3ELAH 3D49H 4JZ1A 2ZPRA 1K21H 4FVDA 3A84A 1K1MA 3E90B 4IN2A 2OTVA 1L0ZA 2GCTC 1MMJN 2RA0A 1SGIB 1DLKB 3DUXH 3MOCA 1BMAA 3EGKH 1SMFE 1K9OE 1NTPA 8GCHG 3KQBA 4DGJA 1O3AA 1ZTKA 3M35A 1RJXB 3RXVA 1QBVH 3ZV9A 1PPEE 4XE4A 5EOKA 2C4FH 1TRMA 5CHAB 2CV3A 1ZHRA 3S7HB 3PV4A 2WYJA 1HYLA 3M5LA 1W12U 3RXUA 3LKWA 1SGQE 1GBCA 1E36B 3A7XA 3LH1A 4K69A 2A4RA 4UEHH 3HK6B 3PWCA 1T4VH 2BZ6H 1FAKH 2GTBA 3KIDU 1NRSH 1AHTH 2ZFTA 3KNXA 2VIWA 3VB3A 4A92A 1SPJA 5F6MA 1BDAA 3Q77A 1W7GH 4MQAA 4Y0ZE 4B75A 3VGCB 2J34A 4AYYB 2Z9JA 4PROA 3BG4C 3RXEA 1K1JA 3A86A 1OWJA 2XBWA 3MHWU 4ABDA 5H4IB 1O2VA 4Y6DA 4ZKNU 1THSH 1O2TA 3GY5A 4Y7AA 4IBLH 1CVWH 1AUJA 4NIYA 1S81A 1MD8A 1BRBE 3PYHA 1DANH 5DP7A 3O8CA 1P11E 1F2SE 2RG3A 1VZQH 5A0AE 2CN0H 2IJOB 3ZV8A 2CMYA 2FLBH 2ESTE 1HNEE 3MNSA 4AB8A 2A5KA 1L4DA 3HGPA 3OTJE 4AGJA 1E0FD 1O3IA 3BEIB 4FUGA 1HUTH 1DDJA 4MDSA 5EQSA 2BDAA 1W3CA 4RN6A 1V2NT 4XBDA 4AZ2B 1S85A 2GCHF 1O2IA 1J17T 1ZPZA 3LC3A 4K60A 1RIWC 4MPWA 4NCYA 3UNSA 2PKSB 1HAPH 3ZZ3A 1SGFA 1T32A 2QN5T 3GDVA 3P8OA 1CA8B 4OS6A 3PO1B 1P2OA 5JBCS 2FS8A 2FS9A 3A7TA 1A0LA 1Z8JB 3E3TA 5E2OA 2NU4E 1O2XA 2HNTE 4NG9H 1HAIH 3RMOH 4LXBH 1LO6A 1QRXA 2GKVE 4AX9H 4GHTA 4DIHH 1ESTA 1NPMA 1TMBH 3D62A 2R0LA 3SV6A 2A4QA 1C5SA 2ZZUH 2OQ5A 1ESAA 3RU4T 2QCYA 1O3MA 4KTUA 2ZU5A 2XC4A 1CBWC 3SNBA 3T25A 2KAIB 1TPSA 1Y5UT 3MU1A 1JOUB 1Z1JA 3V7TA 1GHVH 2C3SA 3F68H 1V2LT 2NU2E 3NCLA 1C1VH 2TPIZ 1FONA 4BANB 5DP8A 2ZO3H 4AGKA 1C5WB 3K2UA 1UVUH 5EXLA 1GPZA 3SU4A 2QGRA 4D8NA 1NZQH 3S0NA 1OP0A 4DT7B 3SNCA 2AEIH 5BRRE 1LHEH 5DP9A 4GVUA 1UTPA 3VB4A 2B5TB 2GCHG 2PKSC 2PTCE 3M37A 5E2PA 1S82A 3MFJA 1AWHB 1DFPA 1BHXB 1ZRKA 1DSUA 1MTNC 3Q00A 3K6ZA 5T6FA 2AGEX 2FM2A 5A0BA 5A8YA 2G51A 1Z8IB 1C4Y2 3TLOA 2D1JA 2ZNKH 3SU3A 4B1TA 3OYPA 3MU8A 2HRVA 4NGAH 1LHGH 3EA7A 4ASHA 1AQ7A 1MKWK 3C1KA 3M3VA 2TGDA 4HTCH 2OCVB 1EAWA 2PLXA 3QGJA 1N8OC 3D23A 3VB7A 1SOZA 1O36A 2F9PA 2VIPA 1MKWH 2ZFSA 1ABIH 2BB4A 3A7VA 4KTCA 1GHZA 3ZVFA 1SI5H 4XBBA 2VB0A 4CHAB 4TYDA 1GHAF 5JBAS 4FUIA 4H6TA 2R3YA 1AY6H 3ZVBA 1OWKA 2B7DH 3GCHC 4AOQA 2JETB 3IWMA 2Z7FE 1YGCH 3RXHA 4KTSA 1E35B 1M9UA 4Q7ZA 2JH5D 2BHGA 1YP9A 2A4GA 3TH4H 1C2FA 4XOJA 1C1UH 1TA2A 3U9AH 4A1TA 2FXRA 3HGNA 5A0CA 1GJ4H 1KTTB 1ELFA 4X2YA 5TCAA 4I8HA 4MPUA 4I8LA 4DVAU 1SGDE 1XUFA 1AFQB 5A8ZA 1C2KA 2CGAA 2BDIA 3QZRA 4IW4E 3T2NA 3GYLB 1GVKB 2TIOA 3BTEE 3HK3B 5BPEA 1AZZA 1TNIA 1FIZA 2DUCA 2VWMA 1HIAA 2BY8X 5C2ZA 2ZKSA 1BUIA 2VVVA 1YM0A 1S84A 1MUEB 1C1NA 2ZQ2A 3MH5A 5DP3A 3SNDA 2Y7ZA 4GPGA 4Y8YA 1UTJA 1HAVA 1QURH 1QJ6B 1DWEH 3Q3KA 1PYTD 1C5XB 3KQEA 1GDUA 2VWOA 1GHAG 1P01A 3A89A 1H9IE 3RU4D 2OBQA 1P9SA 4NSYA 3EYDA 4B71A 1G30B 2P8OB 1BOQA 3W94A 2ZGCA 1EP6A 4FUCA 4O97A 5LPRA 1CA0C 2XC5A 1TGSZ 3FFGA 1V2JT 3UR9A 4ZKOU 2C90B 3RC6A 4ZHMU 3E16B 2CF9H 1TFXA 1V2KT 1SHHB 5FPSA 1YPEH 4FU9A 1C5TA 1FV9A 4GUXA 5ESBA 1YLCA 2ZTXA 1MAYA 1F5LA 2ZDLA 4X6PA 4CRBA 3GYMA 1MZDA 1W0ZU 1XM1A 2FYRA 3BTFE 1AWFH 4ISOA 1PYTC 1P12E 3RXQA 1D3TB 1GI3A 2H9HA 1O5EH 2BM2A 4E05H 5GPIB 1MTSA 1D9IA 4TY7A 1SC8U 3RU4E 2FOBA 2QF3A 4D7GA 1TMTH 1YF4A 3M5OA 1QNJA 5HXFA 1GJBB 1NESE 3QDZB 4WMDA 1YKTA 2RA3A 1FY4A 1NT1A 1KLJH 2V3HH 4I8KA 5EXMA 4UFEH 1AB9B 1DUEA 1TONA 4RKJB 4BAMB 3MH6A 4X2WA 2R0KA 1UTNA 1GBAA 1H8IH 5FAHA 1B7XB 3GICB 4TWWA 3DA9B 4BAHB 4Z6AH 1DXWA 1QL8A 1CT4E 7LPRA 3GCNA 1SLVB 1Z6EA 1HJAB 1GL0E 1J8AA 1JIRA 5LGOA 2FESH 4Z0KA 4AG1A 1GCTC 1GBJA 3BIUH 1AVWA 2R2MB 4MNWA 1EX3A 2WINI 2PSXA 1SGPE 1LHDH 4X2XA 3SGAE 1SSXA 3TGJE 2VWNA 1O38A 3SW2B 2Y6TA 4ABEA 5C1YA 1FLEE 3K65B 4YOGA 4AYVB 2W3KA 2H6MA 1O2MA 1MCTA 8LPRA 1DT2A 1JXPA 2J2UA 2SGEE 1Y8TA 1TPOA 3ITIA 1ZMLA 3RXDA 2Y5HA 3STIA 1C5OH 1AB9C 3ZZDA 2XXLA 2BQ7B 1DM4B 3P95A 1IAUA 2Q6FA 4X8SH 2F9BH 3EDXB 3U8RH 2GDEH 4I8JA 3LOXA 1A3BH 1RTLA 1XUHA 1GMCF 1IQFA 1SQTA 1HJAC 4ABIA 4NIWA 1Y3VA 1SQAA 1DSTA 1W8BH 3GY7A 2QF0A 1ELVA 4I32A 1GBBA 1O3CA 1IQIA 1AE8H 1Q2WA 3A87A 1Z6JH 5ETXA 4Y7BA 1V2MT 3KL6A 4NSVA 4A6LA 1O5BB 2ZF0H 4IMQA 2BDYA 1C9PA 2QV1A 3PWBA 2THFB 2YOLA 3ZVCA 1AUTC 3QX5H 1KDQA 3RXFA 2I6QA 1LHCH 5ESTE 2ODQA 1C5PA 1TYNA 1AN1E 5SGAE 1UK2A 1MCVA 1BRAA 2ZQ1A 2VIDA 1CGHA 3PMBB 1J15A 1O0DH 1P2KA 1PPCE 2F9NA 3CS0A 5FX5A 1QJ1B 1Y3XA 4BTIB 1YCPK 3T28A 2QXJA 3PTNA 1GMCG 1SQOA 1G3DA 1VJAU 4GAWA 5CMXH 5FBIA 2RCEA 3RM2H 4YLUA 1DY8A 3V0XA 1O31A 1EZUC 1PQAA 4X1QU 3TK9A 1TNKA 2QYIA 1GI1A 1RD3B 3NZIA 1WQVH 2F9OA 3GY3A 4X8VH 1O2HA 1NS3A 1TGTA 2XRCA 3FVFB 1GVZA 3A88A 4OS7A 6GCHG 1K1LA 1NU7B 2UWOA 1GBMA 1OSSA 1UTKA 3C27B 3ATKA 1TWXB 4B2BA 1P03A 1AKSA 2TGTA 3A82A 1O2OA 1NROH 4XBCA 2BY7X 4X2VA 3LU9B 2ZDKA 2EEKA 5C67A 4OS5A 2PGQB 2OC0A 2K1QA 3AW0A 1WCZA 2BVXH 5ABWA 1T8OA 2GCTB 3KGPA 3LIWA 2BOKA 2PUXB 3EE0B 3RDZA 3LGYA 3QO6A 3SUDA 3ZZAA 4IMZA 3SNAA 1BITA 2OBOA 5FPTA 4Q2KA 4A1VA 1GBLA 1NRRH 1O3JA 1SVPA 1ZGVA 4ZXXH 3LJOA 3RMNH 1TNJA 1ZOMA 1ZTJA 2OC7A 3P17H 5F8ZA 2Z9GA 4CBOA 1IQNA 4WXIA 3RC5A 3SHAH 3LT3A 2BX4A 1KIGH 1OX1A 1G37A 1XX9A 1MQ5A 2YNBA 1Y3YA 4JK5A 1TIOA 1O2RA 3BG4B 1IOEA 1NFXA 1A5IA 1UTMA 4FU7A 2ANYA 4AFZA 1K1IA 2IOTA 1NU9A 2WV5A 3NK8A 2VVUA 5L6NH 1C5YB 3H7OA 3KN2A 4IC6A 3BV9B 1WTHD 3SGQE 3F9FA 1AE5A 3GISB 4Y76A 5DPAA 4TY6A 4YM9A 3MO3A 2H9TH 1ZYOA 3LGWA 3BTTE 3RXOA 2FIRH 3DFJA 3HATH 4D9QA 3ENSB 2C8WB 1YCPM 4HFPB 1C1PA 1PFXC 1WYKA 2Q6DA 4J1YA 1V2TT 1TLDA 1EOLA 4BTTB 1K1PA 1RIWB 6LPRA 1C5ZB 4D7FA 1MH0A 1C1MA 4MLFB 1C5QA 3SV2H 1QR3E 2A1DB 2VNTA 1FDPA 1UHBB 1PQ5A 2ZU4A 5G4BA 1H4WA 2IN2A 1D6WA 4MPVA 2D2DA 5FX6A 3UTUH 1FN8A 2BOHB 1TNGA 2FP7B 4H42U 4DG4A 1B0FA 4UFGH 2ZPQA 2LPRA 1UCYK 1KYNA 3LGVA 2FO9A 4WY3A 1DICA 4CRAA 1WBGB 1DE7H 1BMMH 3A8DA 1CBWB 3E6PH 3SOSA 1IQLA 3BTHE 3RXTA 1FJSA 2BD7A 1S0QA 1O2UA 4ZKSU 1FZZA 1AD8H 3ZZ6A 2H5DA 2P94A 3RXMA 2QXIA 1T4UH 2Z3CA 1DOJA 3CP7A 1MTVA 1S0RA 3RXGA 3VXFH 1OP8A 4UONA 1SFQB 1DWCH 1PPZA 1L4ZA 2XYAA 1C4V2 2FYQA 1O2KA 1BTZA 2FOAA 4U30A 2SGDE 5FHTA 1MZAA 1PQ8A 5DP4A 4FUHA 5A2MH 1KDQB 1EB1H 1LVYA 1S6FA 1V2WT 2BDGA 4H6SB 2PW8H 1GBEA 1TQ7B 3UOPA 5LH8A 5E0HA 2OC8A 3KHVA 1XVMA 1MTNB 1TPAE 1O3LA 2V6NA 1RTFB 4YLQH 4J2YB 4MG3A 5FCKA 3P8NA 4M7GA 1SGFG 3IG6B 5FBEA 3SI4H 3STJA 4CREA 3I77A 2Y5FA 2HPPH 1GJ7B 5HMAA 3ZYEA 3KQCA 5CE1A 1A61H 1N8OB 1C5MD 4E7RG 1WSSH 2FI3E 3RXAA 2UWLA 2A5IA 2AMPA 2VIOA 3M7QA 1LHFH 2VU8E 1FI8A 2B9LA 2ZCLP 3A7ZA 2XW9A 1O5CB 5J4SA 1EATA 1GI5A 2VGCC 2BDBA 1VCPA 3RXRA 1NFUA 1QGFA 1CO7E 3GCHB 7KMEH 4INKA 1FXYA 3U8OH 4CH8B 3RXJA 2UUJB 3MH4A 2PKAA 1ELGA 2CHAB 1IQHA 1BMNH 3ZVAA 3SJIA 2PWXA 1SG8B 1FUJA 1DWBH 2AGGX 4WH6A 3RLYH 1RFNA 1QL9A 4I31A 4WWYA 3RM0H 1DITH 4K1EA 5GIBA 4X6NA 2OQUA 2ZCHP 3M3SA 2BD3A 1FN6A 2BD8A 2V3OH 1FY5A 4MNYA 2WPKS 2R9PA 1YPMH 1S83A 3T29A 1MBQA 1THRH 3AW1A 1IQMA 3BF6H 5DO4H 3M7TA 3KF2A 3BTGE 1C2IA 2ZU1A 4MPXA 2YNAA 1CGJE 3AASA 2G5NA 2A7JA 1IQKA 1QTFA 1GJ8B 1AVGH 1VITG 3Q3YA 3SV8A 1C2GA 3SNEA 5PTPA 1JBUH 1HXEH 1P2QA 3RXPA 1O2QA 1Y3UA 2R2WU 4A7IB 3PTBA 1A4WH 2VIQA 4GLYA 3T26A 1XUKA 5DP6A 1ANBA 1F0SA 1W7XH 1BTPA 3QLPH 2Q1JA 2UUYA 4AFQA 1Z7KA 1G3BA 3SHCH 2CHAC 4B76A 2ZTZA 3GY2A 3Q76A 3FAOA 3LDXH 4AFSA 3ZVGA 2GGVB 2ALPA 3RXCA 4CRGA 2WPJS 3CS7A 2HPQH 1CA0B 4OS4A 1DVAH 1P0SH 4IGDA 2V0BA 5JBBS 5B6OA 1VCWA 1T7CA 4INHA 2XNIA 4ABHA 3SUFA 3ZZ4A 2G4UA 1VGCC 3MNXA 5C1UA 1B0EA 1BA8B 3A8CA 4NA9H 3BTME 3SU2A 1C5RA 4AG2A 2ZP0H 3DT0H 2P3UB 1VCQA 3URCA 1SLUB 2STAE 3E1XB 2PGBB 4O9VA 1QQ4A 1HRTH 2AFQB 1GI7B 1HCGA 1KXCA 2OP9A 1QHRB 1MTUA 4D76A 2JH6D 2RDLA 1ZR0A 4A1XA 3LGIA 7GCHG 3SV7A 4JYVH 1GI8B 2PTNA 5DJ7A 1NFWA 4FUFA 1BJVA 3TJNA 2GVFA 4FUEA 3RUOA 1BBRK 2XTTB
chains in the Genus database with same CATH superfamily
3DSPA 1HJ8A 2BYAX 2NWNA 2HOBA 1AI8H 1BBRH 1ZSLA 3EAJA 1BTXA 3KQDA 1DWDH 4X1NU 2SGFE 2BQWB 1OYQA 2KR7A 4NIVA 1KXBA 3TJOA 4Q7YA 3S7KB 2AMQA 2ZHDA 3PLKA 2KM0A 2C8XB 5EXNA 3T5FH 2G00A 3A7YA 6CHAC 1F92A 2W6JD 4X1SU 2P16A 1O3FA 1D4PB 3MTYA 5T3HA 1QZ8A 1GJ5H 5TCCA 1GHBG 3UQVA 1HAHH 1O3HA 1BMFD 2XBVA 4BAOB 4K1TA 1P57B 3VXEH 1NO9H 1OKXA 1JRSA 1GJAB 4K8BA 4YOJA 4JZEH 1GCTB 1LPGB 2BXUH 2ZPSA 1TNLA 1K2I1 2ZA5A 2H5CA 3PRBA 2BDHA 1A46H 4O3UA 3VB5A 1THPB 2Z6BD 4IS5A 5DG6A 3OTPA 1TBRH 3UNRA 1S6HA 1P09A 1LCYA 1V2PT 4HI3A 5DK1A 1CHGA 3OY5U 4AC9A 2P93A 2ZIQH 4Y79A 1HGTH 4OGYA 1RGQA 4K1SA 2ZDNA 3E8LA 1VR1H 3F9GA 1GI6A 1QRZA 3DSGA 2H9EH 2C8YB 2ZHWH 1FQ3A 3U98H 4FOUC 1ID5H 4SGAE 2A31A 3A83A 4FU8A 2M5TA 1BTHH 1HDTH 1HBTH 2ZHEH 1C2EA 1SL3A 1IHSH 1EASA 1G32B 2ZFRH 1K22H 2CF8H 1BZXE 1SGNE 2G55A 7ESTE 3PM3A 2JJ2D 3LJJA 2QAAA 3T62A 1C2DA 2GMTC 1GHWH 1F5RA 2QA9E 1WQSA 3P8FA 2EI7A 1QCPA 2SGQE 2Z94A 2ZCKP 1DX5M 1TMUH 3M36A 4OS2A 4M9FA 4YESB 1GJDB 1SR5C 1D6RA 3GDUA 4ZXYH 3RP2A 2O9QA 2PKAB 3VG8A 3F0OA 5C20A 3UPEA 4THNH 5EODA 4X8TH 2ZU2A 2ZI2H 3LONA 1KXAA 1WOFA 3TK5A 1FAXA 1ZMJA 2GT7A 1TRYA 4Y10E 1V2VT 1UK3A 4YTAA 2HLDD 4DIIH 1DPOA 3R0FA 4FETA 4NZQA 3UWIA 3U1JB 3B9FH 1YLDA 1TRNA 1SOTA 4UFFH 5FCRA 1F0UA 2D26C 2KFWA 3M5NA 1BT7A 1A7SA 1HAYB 2JH0D 1VITH 2UWPA 4YZUA 2P3TB 2PHBA 1P3CA 1NFYA 2ZDVH 1JWTA 3SO3A 2F9VA 2J94A 3UNQA 1V6DA 2BLVA 4A5TS 1YPKH 2WZQA 5TJXA 5L2YH 1GGDC 1C5VA 2ZTYA 1O35A 4XFQA 3MO6A 2ZGXH 1P8VC 1VKYA 1TNHA 6GCHF 1KLIH 2QF4A 4NWKA 1F5KU 5A8XA 2KZ4A 3UOUA 1Y5BT 1O32A 2F91A 5C5NA 4ISHH 1L1GA 3BN9A 3EA9A 5FPYA 1XXDA 1HV7A 1K0HA 2Y80A 5L2ZH 5JB8S 4E06H 1P02A 4UFDH 1C2HA 4CBNA 3PMJA 1SHYA 3W95A 4DW2U 1LTOA 4LK4A 3KYFA 3SU1A 1UO6A 4E7NA 1O5FH 2OINA 1XXFA 2XNDD 3IITA 1LVOA 2EI6A 3FKSD 1BCUH 2O8TA 4Y71A 2O8UA 3AAVA 2FTMA 3V3MA 5EW1H 4ABBA 1HIAB 1H9HE 3KEEA 3U69H 3AK5A 2BLQA 3O8RA 4ZAEA 4K8YA 2OC1A 1YPLH 1C9TA 1IHTH 1AO5A 1EZQA 1MQ6A 3AVZA 1GJ9B 1RS0A 2C8ZB 5HYOA 3P6ZB 3MQKC 2HALA 2TRMA 3VFEA 3ZVEA 1LMWB 1H8DH 1YCPH 1HAVB 1P9UA 3SGBE 1H1BA 2QXGA 1C1WH 2SGAA 1UVPA 5JBTA 3MU4A 1J14A 5J4QA 3PMAB 4DCDA 1HAXB 2ILNA 1GBKA 2ZDMA 1BRUP 3HKIB 3BG8A 4MVNA 1EAIA 4CRDA 1FIWA 1EKBB 4ISLA 2KAIA 1GBHA 1LPZB 3TITA 1ZSJA 1QFKH 3SBKA 3QN7A 1WXRA 2ZFPH 1A1RA 4F4OC 1TQ0B 1G2LA 4FUBA 4KKDA 3ZVDA 1EB2A 3VEQB 5F8TA 1YPJH 1GI4A 1W2KH 1GVLA 2FODA 5GJ4B 2Z9IA 3RXIA 4ABAA 4BOHA 5LPEA 3A8AA 3GOVB 4ZUHA 1HAGE 4BXSA 3TPIZ 1WDIA 2UUFB 1QA0A 4AB9A 1GHYH 4RKOB 1FPCH 3H7TA 5E8EH 3QWCH 4MNVA 2YMSB 3TH3H 1N1LA 2YMSD 4KP0A 1WU1A 4FUJA 2W7SA 1O33A 1ZRBA 1EPTA 2CXVA 4NWLA 4Y8ZA 3T27A 1Y5AT 3K6YA 4DY7B 5CHBA 2Z9KA 3RMMH 3BEFB 1QBNA 2SFAA 1ETSH 5FL7D 4GSOA 1IQEA 5HM9A 3ZZBA 2VVCA 3SI3H 2TGPZ 3TGIE 4ABJA 1ZMNA 1GI2A 1W0KD 3OU0A 1BTUA 5DN6D 3SN8A 2UUKB 3G01A 1C1TA 3A80A 4NFFA 3FZZA 1NY22 3PLBA 3UR6A 4B2AA 1ZJKA 1EJNA 1JIMA 2BMGB 2J38A 4ZKRU 3NWUA 2ODYB 1A2CH 1Q31A 2FTLE 2ANKH 2FX4A 2F83A 1UVOA 2FEQH 1C2MA 1GWAA 1UTOA 1AIXH 4WXVA 1KTSB 2R3UA 2OD3B 2ZHQH 2O8MA 3NKKA 2J92A 2PR3A 3F0PA 2YMSC 1WV7H 3U1IB 3M5MA 1FNIA 2JIZD 3SQHE 2VJ1A 2EY4C 1TA6A 1MBMA 1O2JA 2ZGBH 4WMFA 1O30A 1SGCA 2CK3D 5GWZA 1G9IE 3SJOA 3OY6U 4CRFA 3H5CB 1Z71A 1AVXA 5EU8A 1G2MA 1JMOH 2FPZA 3QTOH 3SU5A 3ATWA 5GXPA 1CT2E 2P95A 1MAXA 2ZU3A 3FANA 1EQ9A 2ALVA 5AF9H 3DHKH 1P2JA 1DLEA 4I8GA 3ATLA 1KXDA 3I29A 1A0HB 1NRPH 1OP2A 1O2YA 1C5UA 1OPHB 3MI4A 1QL7A 4X6OA 3OE7D 1OYTH 2Y81A 1ELCA 3BTKE 1C2JA 4YOIA 1UCYH 1C2LA 4VGCC 2Z9LA 1UTQA 2JKHA 4YO9A 1CHOF 2GP9B 2GZ8A 3ESTA 2ZGHA 4ISIH 3LGUA 1Q3XA 2GD4B 2WPMS 1P2NA 3EA8A 2GZ7A 3RXBA 1ORFA 3SV9A 3MMGA 1O3KA 1LKBA 1PPBH 1DS2E 3EQ0H 3M3TA 1Z8GA 2FOFA 3PLPA 1G36A 2P3FH 1CU1A 1GBIA 5DP5A 2NU1E 1Z8RA 1IQGA 1L1JA 2A45B 3UY9A 1ELEE 2ZGJA 3ATIA 3MO9A 4OS1A 2H2ZA 6ESTA 1GG6B 4CR9A 2VGCB 4DT4A 1O2NA 3QGNB 1HJ9A 3F2GA 2PFEA 1GMDF 5DKMA 5F03A 3O8DA 4ACBA 1TX7A 2FOEA 1SB1H 2VINA 1GBTA 4Y11E 1UCYE 3SJ9A 1U6QA 3HPTB 1UJ1A 5CHAC 3A7WA 1O2LA 3MWIU 1W14U 4Q63A 2PUQH 3V12A 1ELAA 4OGXA 3D65E 2BVSH 4MNXA 1E37B 2AYWA 1YLNA 2GX4A 3BTDE 4GHQA 1AU8A 1O5AB 2BD5A 1BJUA 5JYIA 4CRCA 2DE8A 2HNTC 2G4TA 1CHOG 2VH0A 2FLRH 1O3EA 1E38B 4Q7XA 3VGCC 1TE0A 4B6FA 2FWWA 1VITF 3S9BA 2QY0B 1N6XA 1TGBA 4ZROA 5T6GA 4ZH8A 2XBXA 1E34B 3O8BA 4AFUA 1D3PB 4B2CA 1FMGA 1GG6C 3ATMA 1FY1A 1MTWA 1CGIE 2VWLA 1FPHH 2Y82A 3UQOA 1AKSB 1D3DB 1TB6H 3L33A 3NXPA 1EJAA 1GMDG 1SGEE 1ZHMA 3UFAA 2AMDA 5I46H 1O3DA 2WPLS 1V2RT 3M61U 3TNTA 1QJ7B 1XVOA 4GCHF 2FOCA 1TABE 4Y0YE 4BNRA 5F8XA 2FI4E 4R0IA 1S5SA 1LVBA 5LPFA 2BXTH 4ISNA 1FX0B 4RSPA 1VGCB 2EA3A 5EQRA 3P70B 1O3PB 1O2PA 4UD9H 1RTKA 1V2UT 2BVRH 3GY6A 2ZHFH 1KY9A 1UMAH 3LGTA 1EPTB 3PO1C 4CR5A 1KSNA 1VJ9U 1SGTA 8ESTE 2FOMB 3EE7A 4B74A 5EPNA 2ODPA 4NFEA 7GCHF 1OWDA 1V2ST 1XMNB 2TGAA 1ZGIA 2BX3A 4JMYA 1GBDA 3TU7H 1ZLRA 2Q6GA 1T8NA 3TK6A 2J95A 5EQQA 1QQUA 3I78A 4U2WA 1FY3A 3QK1A 1PPHE 1OWHA 4X1PU 5AFYH 1ZHPA 2ZFQH 2V3MA 4TPIZ 3B23B 3U8TH 3RLWH 1PJPA 3CNRA 1QB6A 4K3JA 5IYTA 2FX6A 3F6UH 1BRCE 2EI8A 1SQRA 3ODDA 4GCHG 2KCYA 3TJUA 2BDCA 1GCDA 1E1RD 3BIVH 3FOAA 2EC9H 1V3XA 6CHAB 5C5OA 4I7YH 3ZZCA 1GHBF 3GCOA 1G3EA 4NIXA 2OLGA 4JZDH 2A0QB 3F9HA 2B8OH 4BAQB 2WYGA 1EPTC 4FXGH 5AHGH 2WV4A 3E0NB 5B6LA 1WUNH 2ULLA 3VB6A 3PMHB 4NA7A 5K0HA 1ANDA 1QBOA 3A8BA 5EPYA 1ARBA 5K7RA 1NBMD 3PB1E 4U32A 4WJG2 3S69A 4IN1A 1GL1A 1C1SA 4WMEA 1EP5A 2VBCA 3ZZ8A 1KMHB 2BD4A 2D8WA 1NM6A 3F1SB 1BB0B 4P00A 3MNBA 1TGCA 2V35A 2Y7XA 1L1NA 1LQEA 1CT0E 5AVDA 2BY6X 3BTWE 2HVXA 1EAUA 5FXLA 3BTQE 2SNVA 2AERH 4KELA 1W0YH 4CHAC 1HB0B 5DGJA 1ZZZA 3GDSA 1GHXH 2FI5E 3R3GB 1ZTLA 2O8WA 2J98A 2P59A 5GDSH 4MTBA 1O3BA 1C1RA 3AAUA 4IC5A 2CJIA 2JETC 3QTVH 1GMHF 2F3CE 1A0JA 4O03A 1OXGA 3NPSA 3VPKA 2ZECA 4SGBE 1O5GH 3ODFA 1YYY1 2GMTB 1P05A 1SLWB 1Y3WA 2G8TA 2BTCE 3TIUA 4HGCA 5EW2H 4FUDA 4JZFH 1AFQC 1BBRE 1L2EA 1GDQA 1CE5A 2VH6A 1F0RA 1W10U 3Q3XA 2PV9B 3LH3A 3SUEA 2WPIS 3WY8A 1TPPA 5HGGA 2QC2A 1YC0A 1C1QA 1A5GH 1EUFA 1EZSC 2O8LA 3L6PA 3ZZ7A 1K28D 2AGIX 4XD7D 4X6MA 1J9CH 5HKKD 2BD9A 1TGNA 2FOHA 3N7OA 4WH8A 4RT0A 2ANWA 4B73A 3K9XB 2KCPA 2Y5GA 2Z3DA 1O5DH 4F49A 1GBFA 1RRKA 4UE7H 1AFEH 1NRNH 1EJMA 2F9UA 3OSYA 1EZXC 2VIVA 1P10A 4DOQA 2A2QH 3B8JA 4YT6H 4DJZB 1ELTA 1OWEA 3SORA 3PROA 1YBWA 1OWIA 4YT7H 2GDDA 3CENA 3FP7E 4I33A 1ANEA 5E0JA 1GMHG 2AH4X 1DY9A 1MKXK 2P8OC 1HLTH 1HFDA 2QXHA 1TOCB 4ZMAH 4BXWA 4TWYA 1MKXH 2G5VA 3E0PB 1P3EA 4K5ZA 1MABB 1GGDB 1W0JD 2FZZA 3ZZ5A 2OXSA 2ZG0H 2FMJA 3MYWA 1W11U 1MU6B 2HNTF 1PPGE 3GY4A 1UVSH 1SGRE 1ZPCA 3FP6E 2B0FA 2H1UA 5E0GA 2NU3E 9ESTA 5L30H 1BIOA 1O2ZA 1H8HD 4UDWH 1INCA 2STBE 1COWD 3P8GA 3A85A 4NA8A 3UUZA 4WF8A 4X1RU 3JZ2B 1HPGA 1ZPBA 3SYJA 1HXFH 4ABFA 1P2MA 2IPHA 3M7UA 2WUCA 3E91A 4TPYA 1S6LA 2ANMH 1JRTA 1MU8B 1QIXB 4XSKU 5JB9S 4JZIA 3V13A 1P2IA 2J4IA 9LPRA 3SZEA 3W1EA 1XKBC 3BSQA 1D3QB 1NC6A 3BEUA 3F9EA 1BQYA 1O39A 2HLCA 4WVPE 4Y8XA 1AMHA 3SJKA 3LPRA 4ABGA 3FP8E 1UHBA 2A7HA 2BLWA 1O3GA 3L3TA 1P04A 1C5LH 3RXKA 2HWLB 1YPGH 1C1OA 1F7ZA 1UK4A 2GT8A 3TH2H 1BMLA 1ANCA 4NZLA 3ZYDA 3FZDA 1AGJA 1TOMH 1GDNA 3MU0A 4K2YA 2BD2A 1XKAC 3RC4A 4O3TA 1ELBA 2W5EA 2XCNA 4JCNA 2DE9A 1KXEA 4QT8C 1ELDE 3N7DA 5I25A 3TGKE 3UIRA 3MH7A 1O37A 2BY5X 2JDID 5EG4A 2XWAA 1FY8E 1XUIA 1BTYA 3TJVA 3OX7U 3SUGA 3SU0A 1DXPA 1WTGH 2QF5A 1O2GH 1PPFE 1LKAA 1UVTH 2J9NA 2Z3EA 1ZSKA 1GJCB 1LQDB 5C0UA 1V2QT 3DFLA 3URDA 2GV6A 2WHXA 5A09A 4BAKB 5C3NA 2WUBA 1TX8A 2ZEBA 2TBSA 4XDEA 1IQJA 1ESBA 5GCHF 1V2OT 1T8LA 5JPMH 1ACBE 1XUJA 4JYTA 2BY9X 3P92A 2G52A 5AFZH 1A3EH 2XC0A 1X7AC 2A32A 4CH2B 1KLTA 2ZWLH 2HGTH 1HAZB 1O3NA 1GJ6A 2A5AA 1SGYE 3LC5A 3SZNA 2ZDAH 1EXFA 4Q80A 4BTUB 3NUMA 4DURA 1T31A 3SJ8A 2A2XH 1QA7A 2SNWA 1XUGA 1Z1IA 3RXSA 2WPDD 1P06A 2NU0E 2AIPA 3TVJB 2A4OA 3RMLH 1CQQA 1BHXF 1ETRH 2FOGA 1A5HA 2WPHS 1SFIA 3UREA 3GCTF 3ZZ9A 3S9AA 4R8TB 2W26A 4INLA 1BTWA 1F0TA 1CSOE 1QY6A 1ABJH 4LOYH 4H4FA 2BLOA 4LZ1H 3QUMP 2XWBI 1O3OA 1SBWA 1RXPA 1EAXA 2W7UA 3TNSA 1TX6A 3MU5A 4JK6A 5C94A 1KXFA 1ZJDA 5C1XA 1GI0A 4ESTE 4X8UH 1DUAA 3KCGH 5GCHG 2BQ6B 1T8MA 4ZHAA 2GV7A 1B5GH 2ZFFH 3RXLA 8KME2 3GY8A 4D9RA 1MD7A 5IDKA 3MNCA 3S9CA 4JYUH 3SU6A 4U01A 2W3IA 3DD2H 1H9LB 1N6YA 1Y59T 2XBYA 3UWJH 1ETTH 8GCHF 4LZ4B 2A7CA 3HKJB 2BZAA 5JDUB 1SLXB 2ZC9H 5EGMA 2ASUB 1HAOH 1O2SA 5T6DA 2LNCA 1GI9B 1AZ8A 4X0WU 5DSFA 2AIQA 4FVBA 1PQ7A 4AORA 2XCFA 1O34A 1C5NH 3GCTG 1OS8A 2SGPE 1K1OA 3SQEE 1QB1A 1LPKB 1QB9A 1UTLM 2I6SA 1OOKB 4VGCB 1ARCA 1LVMA 2PSYA 2FDAA 4AN7A 4HZHA 3QZQA 1QRWA 1EOJA 1WAYB 2G81E 1G3CA 1TBZH 1YPHC 2LELA 1C4U2 1O2WA 2AS9A 2QIQA 3JZ1B 1K1NA 1W13U 1TALA 1J16A 5HM2A 1NRQH 2XOKD 2C93B 1LDTT 1YPHE 1TBQH 1NN6A 1TAWA 3A81A 2OUAA 4KGAA 2GZ9A 4ZHLU 3ELAH 3D49H 4JZ1A 2ZPRA 1K21H 4FVDA 3A84A 1K1MA 3E90B 4IN2A 2OTVA 1L0ZA 2GCTC 1MMJN 1E79D 2RA0A 1SGIB 1DLKB 3DUXH 3MOCA 1BMAA 3EGKH 1SMFE 1K9OE 1NTPA 8GCHG 3KQBA 4DGJA 1O3AA 5GNDA 1ZTKA 3F3BA 3M35A 1RJXB 3RXVA 1QBVH 5EIYA 3ZV9A 1PPEE 4XE4A 5EOKA 2C4FH 1TRMA 2L74A 2CV3A 1ZHRA 5CHAB 3S7HB 3PV4A 2WYJA 1HYLA 3M5LA 1YY3A 1W12U 3RXUA 3LKWA 1SGQE 1GBCA 1E36B 1EFRD 3A7XA 3LH1A 2A4RA 4K69A 4UEHH 3HK6B 3PWCA 1T4VH 2BZ6H 1FAKH 2GTBA 3KIDU 4F55A 1NRSH 1AHTH 2ZFTA 3KNXA 2VIWA 3VB3A 4A92A 1SPJA 2IPQX 1BDAA 3Q77A 1W7GH 4MQAA 5F6MA 4Y0ZE 4B75A 3VGCB 2J34A 4AYYB 2Z9JA 4PROA 3BG4C 3RXEA 1K1JA 3A86A 1OWJA 5EJ1A 2XBWA 3MHWU 4ABDA 5H4IB 1O2VA 4Y6DA 4ZKNU 1THSH 1O2TA 3GY5A 4Y7AA 4IBLH 1CVWH 1AUJA 4NIYA 1S81A 1MD8A 3UAIC 1BRBE 3PYHA 1DANH 5DP7A 3O8CA 1P11E 1F2SE 2RG3A 1VZQH 5A0AE 2CN0H 2IJOB 3ZV8A 2CMYA 2FLBH 2ESTE 1HNEE 3MNSA 4AB8A 2A5KA 1L4DA 3HGPA 1OHHD 3OTJE 4AGJA 1E0FD 1O3IA 2L6OA 3BEIB 4FUGA 1HUTH 1DDJA 4MDSA 3PV2A 5EQSA 2BDAA 1W3CA 4RN6A 1V2NT 4XBDA 4AZ2B 2RDEA 1S85A 2GCHF 1O2IA 1J17T 1ZPZA 2JJ1D 3LC3A 4K60A 1RIWC 4MPWA 4NCYA 3UNSA 2PKSB 1HAPH 3ZZ3A 1SGFA 1T32A 2QN5T 3GDVA 3P8OA 1CA8B 3OEHD 4OS6A 3PO1B 1P2OA 5JBCS 2FS8A 2FS9A 3A7TA 1A0LA 1Z8JB 3E3TA 5E2OA 2NU4E 1O2XA 2HNTE 4NG9H 1HAIH 3RMOH 4LXBH 1LO6A 1QRXA 2GKVE 3OFND 4GHTA 4AX9H 4DIHH 1ESTA 1NPMA 1TMBH 3D62A 2R0LA 3SV6A 2A4QA 1C5SA 2ZZUH 2OQ5A 1ESAA 3RU4T 2QCYA 1O3MA 4KTUA 2ZU5A 2XC4A 1CBWC 3SNBA 3T25A 2KAIB 1TPSA 1Y5UT 3MU1A 1JOUB 1Z1JA 3V7TA 1GHVH 2C3SA 3F68H 1V2LT 2NU2E 3NCLA 1C1VH 2TPIZ 1FONA 4BANB 5DP8A 2ZO3H 4AGKA 1C5WB 3K2UA 1UVUH 2LP6A 5EXLA 1GPZA 3SU4A 2QGRA 4D8NA 1NZQH 3S0NA 1OP0A 4DT7B 3SNCA 2AEIH 5BRRE 1LHEH 5DP9A 4GVUA 1UTPA 3VB4A 2B5TB 2GCHG 2PKSC 2PTCE 3M37A 5E2PA 1S82A 3MFJA 1AWHB 1DFPA 1BHXB 1ZRKA 1DSUA 1MTNC 3Q00A 3K6ZA 5T6FA 2AGEX 2FM2A 5A0BA 3KQ5A 5A8YA 2G51A 1Z8IB 1C4Y2 3TLOA 2D1JA 2ZNKH 3SU3A 4B1TA 3OYPA 3MU8A 2HRVA 4NGAH 1LHGH 3EA7A 4ASHA 1AQ7A 1MKWK 3C1KA 3M3VA 2TGDA 4HTCH 2OCVB 1EAWA 2PLXA 3QGJA 1N8OC 3D23A 3VB7A 1SOZA 1O36A 2F9PA 2VIPA 1MKWH 2ZFSA 1ABIH 2BB4A 3A7VA 4KTCA 1GHZA 3ZVFA 1SI5H 4XBBA 2VB0A 4CHAB 4TYDA 1GHAF 5JBAS 4FUIA 4H6TA 2R3YA 1AY6H 4ZCNA 3ZVBA 1OWKA 2B7DH 3GCHC 4AOQA 2JETB 3IWMA 2Z7FE 1YGCH 3RXHA 4KTSA 1E35B 1M9UA 4Q7ZA 2JH5D 2BHGA 1YP9A 2A4GA 3TH4H 2K0QA 1C2FA 4XOJA 1C1UH 1TA2A 3U9AH 4A1TA 2FXRA 3HGNA 5A0CA 1GJ4H 1KTTB 1ELFA 2M2AA 4X2YA 5TCAA 4I8HA 4MPUA 4I8LA 4DVAU 1SGDE 1XUFA 1AFQB 5A8ZA 1SKYE 1C2KA 2CGAA 2BDIA 3QZRA 4IW4E 3T2NA 3GYLB 1GVKB 2TIOA 3BTEE 3HK3B 5BPEA 1AZZA 1TNIA 1FIZA 2DUCA 2VWMA 1HIAA 2BY8X 5C2ZA 2ZKSA 1BUIA 2VVVA 1YM0A 1S84A 1MUEB 1C1NA 2ZQ2A 3MH5A 5DP3A 3SNDA 2Y7ZA 4GPGA 4Y8YA 1UTJA 1HAVA 1QURH 1QJ6B 1DWEH 3Q3KA 1PYTD 1C5XB 3FN8A 3KQEA 1GDUA 2VWOA 1GHAG 1P01A 3A89A 1H9IE 3RU4D 2OBQA 1P9SA 4NSYA 3EYDA 4B71A 1G30B 2P8OB 1BOQA 3W94A 2ZGCA 1EP6A 4FUCA 4O97A 5LPRA 1CA0C 2XC5A 1TGSZ 5C0TA 3FFGA 1V2JT 3UR9A 4ZKOU 2C90B 3RC6A 4ZHMU 3E16B 2CF9H 1TFXA 1V2KT 1SHHB 5FPSA 1YPEH 4FU9A 1NBME 1C5TA 1FV9A 4GUXA 5ESBA 1YLCA 2ZTXA 1MAYA 1F5LA 2ZDLA 4X6PA 4CRBA 3GYMA 1MZDA 1W0ZU 1XM1A 2FYRA 3BTFE 1AWFH 4ISOA 1PYTC 1P12E 3RXQA 1D3TB 1GI3A 2H9HA 1O5EH 2BM2A 5HIYA 4E05H 5GPIB 1MTSA 1D9IA 4TY7A 1SC8U 3PRDA 3RU4E 2FOBA 2QF3A 4D7GA 1TMTH 1YF4A 3M5OA 1QNJA 5HXFA 1GJBB 1NESE 3QDZB 4WMDA 1YKTA 2RA3A 1FY4A 1NT1A 1KLJH 2V3HH 4I8KA 5EXMA 4UFEH 1AB9B 1DUEA 1TONA 4RKJB 4BAMB 3MH6A 4X2WA 2R0KA 1UTNA 1GBAA 1H8IH 5FAHA 1B7XB 2J5UA 3GICB 3DA9B 4TWWA 4BAHB 4Z6AH 1DXWA 1QL8A 1CT4E 7LPRA 3GCNA 5KECA 1SLVB 1Z6EA 1HJAB 1GL0E 4HG6A 1J8AA 1JIRA 5LGOA 2FESH 4Z0KA 4AG1A 1GCTC 1GBJA 3BIUH 1AVWA 2R2MB 4RI0A 4MNWA 1EX3A 2WINI 4Q4LA 2PSXA 1SGPE 1LHDH 4X2XA 5EJZA 3SGAE 1SSXA 3TGJE 2VWNA 1O38A 3SW2B 3WWFA 2Y6TA 4ABEA 5C1YA 1FLEE 3KYGA 3K65B 4YOGA 4AYVB 2W3KA 2H6MA 1O2MA 1MCTA 8LPRA 1DT2A 1JXPA 3DCLA 2J2UA 2SGEE 1Y8TA 2KX4A 1TPOA 3ITIA 1ZMLA 3RXDA 2Y5HA 3STIA 1C5OH 4B6EA 1AB9C 3ZZDA 2XXLA 2BQ7B 1DM4B 3P95A 3WWBA 1IAUA 2Q6FA 3N7EA 5IK2D 4X8SH 2F9BH 3EDXB 3U8RH 2GDEH 4I8JA 3LOXA 1A3BH 1RTLA 1XUHA 1GMCF 1IQFA 1SQTA 1HJAC 4ABIA 4NIWA 1Y3VA 1SQAA 1DSTA 4XRNA 1W8BH 3GY7A 2QF0A 1ELVA 4I32A 3N99A 1GBBA 1O3CA 4ACAA 1IQIA 5HIZA 1AE8H 1Q2WA 3A87A 3WW7A 1Z6JH 5ETXA 4Y7BA 1V2MT 3KL6A 4NSVA 4A6LA 1O5BB 2ZF0H 4IMQA 2BDYA 1C9PA 2QV1A 3PWBA 2THFB 2YOLA 3ZVCA 4Z1MD 1AUTC 3QX5H 1KDQA 3RXFA 2I6QA 1LHCH 4P02A 5ESTE 2ODQA 2WSSD 1C5PA 1TYNA 1AN1E 5SGAE 1UK2A 1MCVA 1BRAA 2ZQ1A 2VIDA 1CGHA 3PMBB 1J15A 1O0DH 1P2KA 1PPCE 2F9NA 3CS0A 5FX5A 1QJ1B 1Y3XA 4BTIB 1YCPK 4ASUD 3T28A 2QXJA 3PTNA 1GMCG 1SQOA 1G3DA 1VJAU 4GAWA 5CMXH 5FBIA 2RCEA 3RM2H 4YLUA 1DY8A 3V0XA 1O31A 1EZUC 1PQAA 4X1QU 5C17A 3TK9A 1TNKA 2QYIA 1GI1A 1RD3B 3NZIA 1WQVH 2J98B 2F9OA 3GY3A 4X8VH 1O2HA 4YXWD 1NS3A 1TGTA 2XRCA 3FVFB 1GVZA 3A88A 4OS7A 6GCHG 1K1LA 1NU7B 2KCAA 2UWOA 1GBMA 1OSSA 1UTKA 3C27B 3ATKA 1TWXB 4B2BA 1P03A 1AKSA 2TGTA 3A82A 1O2OA 1NROH 3NRLA 4XBCA 2BY7X 4X2VA 3LU9B 2ZDKA 2EEKA 5C67A 4OS5A 2PGQB 5T1VA 2OC0A 2K1QA 3AW0A 1H8ED 1WCZA 2BVXH 5ABWA 5KEDA 1T8OA 2GCTB 3KGPA 3LIWA 2BOKA 2PUXB 3EE0B 3RDZA 3LGYA 3QO6A 3SUDA 3ZZAA 4IMZA 3SNAA 1BITA 2OBOA 5FPTA 4Q2KA 4A1VA 2V7QD 1GBLA 1NRRH 2QE7D 1O3JA 1SVPA 1ZGVA 2OK5A 4ZXXH 5EJLA 3LJOA 3RMNH 1TNJA 1ZOMA 1ZTJA 2OC7A 3P17H 5F8ZA 3F2FA 2EQNA 2Z9GA 4CBOA 1IQNA 4WXIA 3RC5A 3SHAH 3LT3A 2BX4A 1KIGH 1OX1A 1G37A 1XX9A 1MQ5A 2YNBA 1Y3YA 4JK5A 2W6ID 1TIOA 1O2RA 3BG4B 1IOEA 1NFXA 1A5IA 1UTMA 4FU7A 2ANYA 4RT1A 4AFZA 1K1IA 2IOTA 1NU9A 2WV5A 3NK8A 3OEED 2VVUA 5L6NH 1YWUA 5KGOA 4I86A 2J97A 1C5YB 3H7OA 3KN2A 4IC6A 3GS9A 3BV9B 3PV5A 1WTHD 3SGQE 3F9FA 1AE5A 3GISB 4Y76A 3U28C 5DPAA 4TY6A 4YM9A 3MO3A 2H9TH 1ZYOA 3LGWA 3BTTE 3RXOA 2FIRH 3DFJA 3HATH 4D9QA 3ENSB 2C8WB 1YCPM 4HFPB 2KCOA 1C1PA 1PFXC 1WYKA 2Q6DA 4J1YA 1V2TT 1TLDA 1EOLA 4BTTB 1K1PA 1RIWB 6LPRA 1C5ZB 4D7FA 1MH0A 1C1MA 4MLFB 1C5QA 3SV2H 1QR3E 2A1DB 2VNTA 1FDPA 1UHBB 1PQ5A 2ZU4A 5G4BA 1H4WA 2IN2A 1D6WA 4MPVA 2D2DA 2IJD1 5FX6A 1FN8A 2BOHB 1TNGA 2FP7B 4H42U 1E1QD 3UTUH 4DG4A 1B0FA 4UFGH 2ZPQA 2LPRA 1UCYK 1KYNA 3LGVA 2FO9A 4WY3A 1DICA 4CRAA 1WBGB 1DE7H 1BMMH 3A8DA 1CBWB 3E6PH 3SOSA 1IQLA 3BTHE 2F43B 3RXTA 1FJSA 2BD7A 1S0QA 1O2UA 4ZKSU 4TT3D 1FZZA 1AD8H 3ZZ6A 2H5DA 2P94A 3RXMA 2QXIA 1T4UH 2Z3CA 1DOJA 3CP7A 1MTVA 1S0RA 3RXGA 3VXFH 1OP8A 4UONA 1SFQB 1DWCH 1PPZA 1L4ZA 2XYAA 1C4V2 2FYQA 1O2KA 1BTZA 2FOAA 4U30A 2SGDE 5FHTA 1MZAA 1PQ8A 5DP4A 3DSOA 4FUHA 5A2MH 1KDQB 1EB1H 1LVYA 1S6FA 1V2WT 2BDGA 2PP6A 4H6SB 2PW8H 1GBEA 1TQ7B 3UOPA 5LH8A 5E0HA 2OC8A 3KHVA 1XVMA 2K8IA 1MTNB 1TPAE 1O3LA 2V6NA 1RTFB 4YLQH 4J2YB 4MG3A 5FCKA 3P8NA 4M7GA 1SGFG 3IG6B 5FBEA 3SI4H 3STJA 4CREA 3I77A 2Y5FA 2HPPH 1GJ7B 5HMAA 3ZYEA 3KQCA 5CE1A 1A61H 1N8OB 1C5MD 4E7RG 1WSSH 2FI3E 3RXAA 2UWLA 2A5IA 2AMPA 2VIOA 3M7QA 1LHFH 2VU8E 1FI8A 2B9LA 2ZCLP 3A7ZA 2XW9A 1O5CB 5J4SA 3UB0A 1EATA 1GI5A 2VGCC 2BDBA 1VCPA 3RXRA 1NFUA 1QGFA 1CO7E 2GJGA 3GCHB 7KMEH 4INKA 1FXYA 2RFKC 3U8OH 4CH8B 3RXJA 2UUJB 3MH4A 4F48B 2PKAA 1ELGA 2CHAB 1IQHA 1BMNH 2AHME 3ZVAA 3SJIA 2PWXA 1SG8B 1FUJA 1DWBH 2AGGX 4WH6A 3RLYH 1RFNA 1QL9A 4I31A 4WWYA 3RM0H 1DITH 4K1EA 4TSFD 5GIBA 4X6NA 2OQUA 2ZCHP 3M3SA 2BD3A 1FN6A 2BD8A 5CDFE 2V3OH 1FY5A 4MNYA 2WPKS 2WV9A 2R9PA 1YPMH 1S83A 3T29A 1MBQA 1THRH 3AW1A 1IQMA 3BF6H 5DO4H 3M7TA 3KF2A 3BTGE 1C2IA 2ZU1A 4MPXA 2YNAA 1CGJE 3AASA 2G5NA 2A7JA 1IQKA 1QTFA 1GJ8B 1AVGH 1VITG 3Q3YA 3SV8A 1C2GA 3SNEA 5PTPA 1JBUH 1HXEH 1P2QA 3OAAD 3RXPA 1O2QA 1Y3UA 3ZIAD 2R2WU 1UW7A 4A7IB 3PTBA 1A4WH 2VIQA 4GLYA 5F53A 3T26A 1XUKA 5DP6A 1ANBA 1F0SA 1W7XH 1BTPA 3QLPH 2Q1JA 2UUYA 4AFQA 1Z7KA 1G3BA 3SHCH 2CHAC 4B76A 2ZTZA 3GY2A 3Q76A 3FAOA 3LDXH 4AFSA 3ZVGA 2GGVB 2ALPA 3RXCA 4CRGA 2WPJS 3CS7A 2HPQH 1CA0B 4OS4A 1DVAH 1P0SH 4IGDA 2V0BA 5JBBS 5B6OA 1VCWA 1T7CA 4INHA 2XNIA 4ABHA 3SUFA 3ZZ4A 2G4UA 1VGCC 3MNXA 5C1UA 1B0EA 2F4LA 1BA8B 3A8CA 4NA9H 3BTME 3SU2A 1C5RA 3FO8D 4AG2A 2ZP0H 3DT0H 2P3UB 1VCQA 3URCA 1SLUB 2STAE 3E1XB 2PGBB 4O9VA 1QQ4A 1HRTH 2AFQB 1GI7B 1HCGA 1KXCA 2OP9A 1QHRB 1MTUA 4D76A 2JH6D 2RDLA 1ZR0A 4OM9A 3LGIA 4A1XA 7GCHG 3SV7A 4JYVH 1GI8B 2PTNA 5DJ7A 1NFWA 3H09A 1BJVA 4FUFA 3F2HA 3TJNA 2GVFA 4FUEA 2HVYB 3RUOA 1BBRK 2XTTB
chains in the Genus database with same CATH topology
1HJ8A 2BYAX 2NWNA 2HOBA 1AI8H 1BBRH 1ZSLA 3EAJA 1BTXA 3KQDA 1DWDH 4X1NU 2SGFE 2BQWB 1OYQA 4NIVA 1KXBA 3TJOA 4Q7YA 3S7KB 2AMQA 2ZHDA 3PLKA 5EXNA 2C8XB 3T5FH 2G00A 3A7YA 6CHAC 1F92A 4X1SU 2P16A 1O3FA 1D4PB 3MTYA 5T3HA 5TCCA 1GJ5H 3UQVA 1GHBG 1HAHH 1O3HA 2XBVA 4BAOB 4K1TA 1P57B 3VXEH 1NO9H 1OKXA 1JRSA 1GJAB 4K8BA 4YOJA 4JZEH 1GCTB 1LPGB 2BXUH 2ZPSA 1TNLA 1K2I1 2ZA5A 2H5CA 2BDHA 1A46H 4O3UA 3VB5A 1THPB 2Z6BD 4IS5A 5DG6A 1TBRH 3UNRA 1S6HA 1P09A 1LCYA 1V2PT 4HI3A 5DK1A 1CHGA 3OY5U 2P93A 2ZIQH 4Y79A 1HGTH 4OGYA 1RGQA 4K1SA 2ZDNA 3E8LA 1VR1H 3F9GA 1GI6A 1QRZA 2H9EH 2C8YB 2ZHWH 1FQ3A 3U98H 1ID5H 4SGAE 2A31A 3A83A 4FU8A 2M5TA 1BTHH 1HDTH 1HBTH 2ZHEH 1C2EA 1SL3A 1IHSH 1EASA 1G32B 2ZFRH 1K22H 2CF8H 1BZXE 1SGNE 2G55A 7ESTE 3PM3A 3LJJA 2QAAA 3T62A 1C2DA 2GMTC 1GHWH 1F5RA 2QA9E 1WQSA 3P8FA 2EI7A 1QCPA 2SGQE 2Z94A 2ZCKP 1DX5M 1TMUH 3M36A 4OS2A 4YESB 1GJDB 1SR5C 1D6RA 3GDUA 4ZXYH 3RP2A 2O9QA 2PKAB 5C20A 3UPEA 4THNH 5EODA 4X8TH 2ZU2A 2ZI2H 3LONA 1KXAA 1WOFA 3TK5A 1FAXA 1ZMJA 2GT7A 1TRYA 4Y10E 1V2VT 1UK3A 4YTAA 4DIIH 1DPOA 3R0FA 4NZQA 3UWIA 3U1JB 3B9FH 1YLDA 1TRNA 1SOTA 4UFFH 5FCRA 1F0UA 2D26C 3M5NA 1BT7A 1A7SA 1HAYB 2JH0D 1VITH 2UWPA 4YZUA 2P3TB 2PHBA 1P3CA 1NFYA 2ZDVH 1JWTA 3SO3A 2F9VA 2J94A 3UNQA 1V6DA 2BLVA 4A5TS 1YPKH 5TJXA 5L2YH 1GGDC 1C5VA 2ZTYA 1O35A 4XFQA 3MO6A 2ZGXH 1P8VC 1TNHA 6GCHF 1KLIH 4NWKA 1F5KU 5A8XA 3UOUA 1Y5BT 1O32A 2F91A 5C5NA 4ISHH 1L1GA 3BN9A 3EA9A 5FPYA 1XXDA 1HV7A 2Y80A 5L2ZH 5JB8S 4E06H 1P02A 4UFDH 1C2HA 4CBNA 3PMJA 1SHYA 3W95A 4DW2U 1LTOA 4LK4A 3SU1A 4E7NA 1UO6A 1O5FH 2OINA 1XXFA 3IITA 1LVOA 2EI6A 1BCUH 2O8TA 4Y71A 2O8UA 3AAVA 2FTMA 3V3MA 5EW1H 4ABBA 1HIAB 1H9HE 3KEEA 3U69H 2BLQA 3O8RA 4ZAEA 4K8YA 2OC1A 1YPLH 1C9TA 1IHTH 1AO5A 1EZQA 1MQ6A 3AVZA 1GJ9B 1RS0A 2C8ZB 5HYOA 3P6ZB 2HALA 2TRMA 3VFEA 3ZVEA 1LMWB 1H8DH 1YCPH 1HAVB 1P9UA 3SGBE 1H1BA 2QXGA 1C1WH 2SGAA 1UVPA 5JBTA 3MU4A 1J14A 5J4QA 3PMAB 4DCDA 1HAXB 2ILNA 1GBKA 2ZDMA 1BRUP 3HKIB 3BG8A 4MVNA 1EAIA 4CRDA 1FIWA 1EKBB 4ISLA 2KAIA 1GBHA 1LPZB 3TITA 1ZSJA 1QFKH 3SBKA 3QN7A 2ZFPH 1A1RA 4F4OC 1TQ0B 1G2LA 4FUBA 4KKDA 3ZVDA 1EB2A 3VEQB 5F8TA 1YPJH 1GI4A 1W2KH 1GVLA 2FODA 5GJ4B 2Z9IA 3RXIA 4ABAA 4BOHA 5LPEA 3A8AA 3GOVB 4ZUHA 1HAGE 4BXSA 3TPIZ 2UUFB 1QA0A 4AB9A 1GHYH 4RKOB 1FPCH 3H7TA 5E8EH 3QWCH 4MNVA 3TH3H 1N1LA 4KP0A 1WU1A 4FUJA 2W7SA 1O33A 1ZRBA 1EPTA 2CXVA 4NWLA 4Y8ZA 3T27A 1Y5AT 3K6YA 4DY7B 2Z9KA 3RMMH 3BEFB 1QBNA 2SFAA 1ETSH 4GSOA 1IQEA 5HM9A 3ZZBA 2VVCA 3SI3H 2TGPZ 3TGIE 4ABJA 1ZMNA 1GI2A 3OU0A 1BTUA 3SN8A 2UUKB 3G01A 1C1TA 3A80A 4NFFA 3FZZA 1NY22 3PLBA 3UR6A 4B2AA 1ZJKA 1EJNA 1JIMA 2BMGB 2J38A 4ZKRU 3NWUA 2ODYB 1A2CH 1Q31A 2FTLE 2ANKH 2FX4A 2F83A 1UVOA 2FEQH 1C2MA 1GWAA 1UTOA 1AIXH 4WXVA 1KTSB 2R3UA 2OD3B 2ZHQH 2O8MA 3NKKA 2J92A 2PR3A 1WV7H 3U1IB 3M5MA 1FNIA 3SQHE 2VJ1A 1TA6A 1MBMA 1O2JA 2ZGBH 4WMFA 1O30A 1SGCA 5GWZA 1G9IE 3SJOA 3OY6U 4CRFA 3H5CB 1Z71A 1AVXA 5EU8A 1G2MA 1JMOH 2FPZA 3QTOH 3SU5A 3ATWA 5GXPA 1CT2E 2P95A 1MAXA 2ZU3A 3FANA 1EQ9A 2ALVA 5AF9H 3DHKH 1P2JA 1DLEA 4I8GA 3ATLA 1KXDA 3I29A 1A0HB 1NRPH 1OP2A 1O2YA 1C5UA 1OPHB 3MI4A 1QL7A 4X6OA 1OYTH 2Y81A 1ELCA 3BTKE 1C2JA 4YOIA 1UCYH 1C2LA 4VGCC 2Z9LA 1UTQA 2JKHA 4YO9A 1CHOF 2GP9B 2GZ8A 3ESTA 2ZGHA 4ISIH 3LGUA 1Q3XA 2GD4B 2WPMS 1P2NA 3EA8A 2GZ7A 3RXBA 1ORFA 3SV9A 3MMGA 1O3KA 1LKBA 1PPBH 1DS2E 3EQ0H 3M3TA 1Z8GA 2FOFA 3PLPA 1G36A 2P3FH 1CU1A 1GBIA 5DP5A 2NU1E 1Z8RA 1IQGA 1L1JA 2A45B 3UY9A 1ELEE 2ZGJA 3ATIA 3MO9A 4OS1A 2H2ZA 6ESTA 1GG6B 4CR9A 2VGCB 1O2NA 3QGNB 1HJ9A 2PFEA 1GMDF 5DKMA 5F03A 3O8DA 1TX7A 2FOEA 1SB1H 2VINA 1GBTA 4Y11E 1UCYE 3SJ9A 1U6QA 3HPTB 1UJ1A 5CHAC 3A7WA 1O2LA 3MWIU 1W14U 2PUQH 3V12A 1ELAA 4OGXA 3D65E 2BVSH 4MNXA 1E37B 2AYWA 2GX4A 3BTDE 4GHQA 1AU8A 1O5AB 2BD5A 1BJUA 5JYIA 4CRCA 2DE8A 2HNTC 2G4TA 1CHOG 2VH0A 2FLRH 1O3EA 1E38B 4Q7XA 3VGCC 1TE0A 2FWWA 1VITF 3S9BA 2QY0B 1N6XA 1TGBA 4ZROA 5T6GA 4ZH8A 2XBXA 1E34B 3O8BA 4AFUA 1D3PB 4B2CA 1FMGA 1GG6C 3ATMA 1FY1A 1MTWA 1CGIE 2VWLA 1FPHH 2Y82A 3UQOA 1AKSB 1D3DB 1TB6H 3L33A 3NXPA 1EJAA 1GMDG 1SGEE 1ZHMA 3UFAA 2AMDA 5I46H 1O3DA 2WPLS 1V2RT 3M61U 3TNTA 1QJ7B 1XVOA 4GCHF 2FOCA 1TABE 4Y0YE 4BNRA 5F8XA 2FI4E 4R0IA 1S5SA 1LVBA 5LPFA 2BXTH 4ISNA 4RSPA 1VGCB 2EA3A 5EQRA 3P70B 1O3PB 1O2PA 4UD9H 1RTKA 1V2UT 2BVRH 3GY6A 2ZHFH 1KY9A 1UMAH 3LGTA 1EPTB 3PO1C 4CR5A 1KSNA 1VJ9U 1SGTA 8ESTE 2FOMB 4B74A 5EPNA 2ODPA 4NFEA 7GCHF 1OWDA 1V2ST 1XMNB 2TGAA 1ZGIA 2BX3A 4JMYA 1GBDA 3TU7H 1ZLRA 2Q6GA 1T8NA 3TK6A 2J95A 5EQQA 1QQUA 3I78A 4U2WA 1FY3A 3QK1A 1PPHE 1OWHA 4X1PU 5AFYH 1ZHPA 2ZFQH 3U8TH 4TPIZ 3B23B 3RLWH 1PJPA 1QB6A 4K3JA 5IYTA 2FX6A 3F6UH 1BRCE 2EI8A 3ODDA 4GCHG 3TJUA 2BDCA 1GCDA 3BIVH 2EC9H 1V3XA 6CHAB 5C5OA 4I7YH 3ZZCA 1GHBF 3GCOA 1G3EA 4NIXA 2OLGA 4JZDH 2A0QB 3F9HA 2B8OH 4BAQB 2WYGA 1EPTC 4FXGH 5AHGH 2WV4A 3E0NB 1WUNH 2ULLA 3VB6A 3PMHB 4NA7A 5K0HA 1ANDA 1QBOA 3A8BA 5EPYA 1ARBA 5K7RA 3PB1E 4U32A 4WJG2 3S69A 4IN1A 1GL1A 1C1SA 4WMEA 1EP5A 3ZZ8A 2D8WA 2BD4A 3F1SB 1NM6A 1BB0B 3MNBA 1TGCA 2V35A 2Y7XA 1L1NA 1LQEA 1CT0E 5AVDA 2BY6X 3BTWE 2HVXA 1EAUA 5FXLA 3BTQE 2SNVA 2AERH 4KELA 1W0YH 4CHAC 1HB0B 5DGJA 1ZZZA 3GDSA 1GHXH 2FI5E 3R3GB 1ZTLA 2O8WA 2P59A 5GDSH 4MTBA 1O3BA 1C1RA 3AAUA 4IC5A 2CJIA 2JETC 3QTVH 1GMHF 2F3CE 1A0JA 4O03A 1OXGA 3NPSA 3VPKA 2ZECA 4SGBE 1O5GH 3ODFA 1YYY1 2GMTB 1P05A 1SLWB 1Y3WA 2G8TA 2BTCE 3TIUA 4HGCA 5EW2H 4FUDA 4JZFH 1AFQC 1BBRE 1L2EA 1GDQA 1CE5A 2VH6A 1F0RA 1W10U 3Q3XA 2PV9B 3LH3A 3SUEA 2WPIS 3WY8A 1TPPA 5HGGA 2QC2A 1YC0A 1C1QA 1A5GH 1EUFA 1EZSC 2O8LA 3L6PA 3ZZ7A 1K28D 2AGIX 4X6MA 1J9CH 2BD9A 1TGNA 2FOHA 3N7OA 4WH8A 4B73A 2ANWA 3K9XB 2Y5GA 2Z3DA 1O5DH 4F49A 1GBFA 1RRKA 4UE7H 1AFEH 1NRNH 1EJMA 2F9UA 3OSYA 1EZXC 2VIVA 1P10A 4DOQA 2A2QH 3B8JA 4YT6H 4DJZB 1ELTA 1OWEA 3SORA 3PROA 1YBWA 1OWIA 4YT7H 2GDDA 3CENA 3FP7E 4I33A 1ANEA 5E0JA 1GMHG 2AH4X 1DY9A 1MKXK 2P8OC 1HLTH 1HFDA 2QXHA 1TOCB 4ZMAH 4BXWA 4TWYA 1MKXH 2G5VA 3E0PB 1P3EA 4K5ZA 1GGDB 2FZZA 3ZZ5A 2OXSA 2ZG0H 2FMJA 3MYWA 1W11U 1MU6B 2HNTF 1PPGE 3GY4A 1UVSH 1SGRE 1ZPCA 3FP6E 2B0FA 2H1UA 5E0GA 2NU3E 9ESTA 5L30H 1BIOA 1O2ZA 4UDWH 1INCA 2STBE 3P8GA 3A85A 4NA8A 3UUZA 4WF8A 4X1RU 3JZ2B 1HPGA 1ZPBA 1HXFH 4ABFA 1P2MA 2IPHA 3M7UA 2WUCA 3E91A 4TPYA 2ANMH 1JRTA 1MU8B 1QIXB 4XSKU 5JB9S 4JZIA 3V13A 1P2IA 2J4IA 9LPRA 1XKBC 3BSQA 1D3QB 1NC6A 3BEUA 3F9EA 1BQYA 1O39A 2HLCA 4WVPE 4Y8XA 1AMHA 3SJKA 3LPRA 4ABGA 3FP8E 1UHBA 2A7HA 2BLWA 1O3GA 3L3TA 1P04A 1C5LH 3RXKA 2HWLB 1YPGH 1C1OA 1F7ZA 1UK4A 2GT8A 3TH2H 1BMLA 1ANCA 4NZLA 3ZYDA 3FZDA 1AGJA 1TOMH 1GDNA 3MU0A 4K2YA 2BD2A 1XKAC 3RC4A 4O3TA 1ELBA 2W5EA 2XCNA 4JCNA 2DE9A 1KXEA 4QT8C 1ELDE 5I25A 3TGKE 3UIRA 3MH7A 1O37A 2BY5X 5EG4A 2XWAA 1FY8E 1XUIA 1BTYA 3TJVA 3OX7U 3SUGA 3SU0A 1DXPA 1WTGH 1O2GH 1PPFE 1LKAA 1UVTH 2J9NA 2Z3EA 1ZSKA 1GJCB 1LQDB 1V2QT 3DFLA 3URDA 2GV6A 5A09A 4BAKB 5C3NA 2WUBA 1TX8A 2ZEBA 2TBSA 4XDEA 1IQJA 1ESBA 5GCHF 1V2OT 1T8LA 5JPMH 1ACBE 1XUJA 4JYTA 2BY9X 3P92A 2G52A 5AFZH 1A3EH 2XC0A 1X7AC 2A32A 4CH2B 1KLTA 2ZWLH 2HGTH 1HAZB 1O3NA 1GJ6A 2A5AA 1SGYE 3LC5A 3SZNA 2ZDAH 1EXFA 4Q80A 4BTUB 3NUMA 4DURA 1T31A 3SJ8A 2A2XH 1QA7A 2SNWA 1XUGA 1Z1IA 3RXSA 1P06A 2NU0E 2AIPA 3TVJB 2A4OA 3RMLH 1CQQA 1BHXF 1ETRH 2FOGA 1A5HA 2WPHS 1SFIA 3UREA 3GCTF 3ZZ9A 3S9AA 4R8TB 2W26A 4INLA 1BTWA 1F0TA 1CSOE 1QY6A 1ABJH 4LOYH 4H4FA 2BLOA 4LZ1H 3QUMP 2XWBI 1O3OA 1SBWA 1RXPA 1EAXA 2W7UA 3TNSA 1TX6A 3MU5A 4JK6A 1KXFA 1ZJDA 5C1XA 1GI0A 4ESTE 4X8UH 1DUAA 3KCGH 5GCHG 2BQ6B 1T8MA 4ZHAA 2GV7A 1B5GH 2ZFFH 3RXLA 8KME2 3GY8A 4D9RA 1MD7A 5IDKA 3MNCA 3S9CA 4JYUH 3SU6A 4U01A 2W3IA 3DD2H 1H9LB 1N6YA 1Y59T 2XBYA 3UWJH 1ETTH 8GCHF 4LZ4B 2A7CA 3HKJB 2BZAA 5JDUB 1SLXB 2ZC9H 5EGMA 2ASUB 1HAOH 1O2SA 5T6DA 2LNCA 1GI9B 1AZ8A 4X0WU 2AIQA 4FVBA 1PQ7A 4AORA 2XCFA 1O34A 1C5NH 3GCTG 1OS8A 2SGPE 1K1OA 3SQEE 1QB1A 1LPKB 1QB9A 1UTLM 2I6SA 1OOKB 4VGCB 1ARCA 1LVMA 2PSYA 2FDAA 4AN7A 4HZHA 3QZQA 1QRWA 1EOJA 1WAYB 2G81E 1G3CA 1TBZH 1YPHC 1C4U2 1O2WA 2AS9A 2QIQA 3JZ1B 1K1NA 1W13U 1TALA 1J16A