1O2RA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2rA02
1H9IE 4UFGH 1H8IH 2ZCKP 3T28A 1O2OA 4WMFA 1CHOG 3FP7E 1D4PB 2PKSC 1YLCA 1L4DA 4CBNA 2ZTZA 4ABGA 1GMCG 1P2JA 3SN8A 4CRBA 2QAAA 5T6GA 1YCPH 3IITA 4ZHLU 3IG6B 4AORA 5A0BA 3L3TA 3U69H 3LDXH 2BQWB 5CMXH 3ZZCA 1C2LA 5FX5A 1KLJH 1O5FH 3MH5A 2WYGA 1GJ7B 3BIVH 1C1SA 3HGPA 5JB8S 1MCTA 2BOKA 1AKSA 2C4FH 1C5SA 3NPSA 1QRZA 1QBNA 1Y3YA 2ZDVH 3MWIU 4CH8B 1H4WA 1PPBH 1WAYB 3TGKE 1O3KA 2EC9H 1C2FA 3A86A 3RMNH 2HPQH 4I8LA 2K1QA 2OCVB 3RXTA 1NN6A 1O3MA 1O32A 3EQ0H 4JZ1A 3QZQA 3A88A 1QA0A 3CP7A 3BN9A 1GBDA 3ZZAA 4B2AA 1MKXH 1P05A 3PLBA 4DURA 1S85A 5EQRA 1SG8B 2F9PA 3D62A 1QJ1B 2ZFFH 4YLUA 2ZGBH 4IGDA 2BD5A 1NS3A 1QCPA 3M36A 3ZVCA 2FTMA 2P3UB 1MBMA 2PKAB 2O8MA 4DW2U 1SSXA 2EI7A 2ZKSA 1S82A 1SGNE 1QQUA 4UD9H 3BG4B 3QO6A 3U8OH 1S6HA 3TK9A 8LPRA 1SGEE 4MLFB 3NK8A 1NO9H 1BMNH 2VIPA 3ENSB 1OWEA 3F9HA 3RC6A 4A1VA 1N1LA 3C1KA 5J4SA 3PV4A 2FI3E 1UTPA 1AGJA 2QXJA 1EAXA 4DJZB 4TWYA 1P03A 2D8WA 1Z6EA 8GCHF 3NWUA 4O3UA 2GZ9A 5EW2H 4JYTA 4X1NU 1C5PA 1EOJA 1IQNA 2Y7ZA 1QJ7B 1FNIA 5J4QA 4HI3A 1DUAA 2C8ZB 2W5EA 3MO9A 2ZQ2A 4ZKNU 1SQTA 2J94A 1GI6A 2F9OA 1BCUH 3KN2A 1F7ZA 1M9UA 5EPNA 3M7QA 1J8AA 3ZYDA 2B5TB 2VVVA 4OGYA 1V2PT 1O2XA 1BT7A 4PROA 3SNAA 1AMHA 2PV9B 1DWCH 4KGAA 4X8UH 1ZMJA 2QY0B 5T3HA 1MQ5A 5C5NA 4ABEA 1SQOA 6GCHF 2Z3DA 4B76A 1RS0A 1UHBB 4XDEA 3RXQA 4DY7B 1DUEA 4FUBA 2G51A 1MTUA 1FXYA 3T29A 2BY8X 1QBVH 4TY7A 3MFJA 1V2TT 1EATA 5A8XA 2C90B 1AN1E 3R3GB 3OY6U 1FIZA 3SI3H 1IQEA 1OP8A 1C2DA 2ALPA 2WPLS 1GI9B 2FX4A 3VB6A 2XWAA 1NRQH 3M3TA 3OYPA 2RDLA 4Y11E 2UUKB 3RXEA 2PLXA 1PPHE 3ODFA 3UOUA 5GWZA 3W95A 1XVMA 1LKBA 3G01A 1A3BH 4ZH8A 1GBAA 3VPKA 2FXRA 2NU2E 2OUAA 1RRKA 3A84A 5DG6A 2A7CA 1ZTKA 2WYJA 1YGCH 2TIOA 1O2SA 3F9FA 1GHZA 1ZRBA 1GBKA 1SGTA 4XFQA 3L6PA 3RM0H 4NIWA 4WF8A 1B0EA 4UONA 4MPUA 5DP7A 1HBTH 1PJPA 1K1NA 1FY8E 5TCCA 2GZ8A 2ZPSA 1V2MT 2A31A 3O8CA 3L33A 1GI0A 3QX5H 1O3OA 2O8UA 3URDA 5F6MA 2ZF0H 2PWXA 1KXFA 5EXMA 1WTHD 1JXPA 4BTUB 2ASUB 4BAOB 2GP9B 1MTNB 7LPRA 2ZCHP 2ZDKA 1L2EA 2R3YA 4KELA 1VCQA 1XXDA 1S84A 1OX1A 1IQHA 1TNIA 2Z94A 1O3PB 3Q3XA 1G3DA 4JYUH 3RP2A 4O97A 2GD4B 4BTTB 4D76A 2ZHDA 1BQYA 1CT4E 1BRAA 1KLTA 2XC4A 3A7WA 3R0FA 5BRRE 1ID5H 2ZPQA 4K3JA 1XUHA 1GJ8B 2BX4A 4ZHAA 1V2ST 2V0BA 2VWLA 2WV5A 2IN2A 1ZSJA 4FU7A 3QDZB 1AZ8A 1OWJA 2UWLA 3MU0A 1P2KA 2BQ6B 2BVXH 4YESB 5GIBA 2A32A 2AIQA 4CBOA 3SNBA 2BOHB 1BMLA 4MPXA 1FAXA 2G8TA 2VVUA 4BAKB 1P2IA 3RXJA 2A0QB 4AFQA 3K9XB 4U2WA 3OTJE 1U6QA 4BAQB 1MU6B 1TIOA 2Y6TA 4FUDA 5EOKA 4NFFA 3PROA 1FZZA 1TX7A 2PSYA 3C27B 2C3SA 4GAWA 2BD4A 3P95A 3OX7U 4TPIZ 3VB5A 1DY8A 3UQOA 1NT1A 1ELEE 3K2UA 4Q2KA 3V12A 3FZZA 2ZEBA 5A0AE 2NU1E 1BRBE 2FTLE 4AYYB 1Z8RA 4CRFA 1VITG 3S9CA 1HAXB 1C2KA 5TJXA 1DXPA 2BD2A 3KHVA 1C4Y2 2FOMB 1JRTA 3GCHB 3SGQE 2A2XH 1QURH 4IMQA 3ZVDA 1EZUC 2VIVA 2CGAA 4ISOA 1V3XA 1GCTC 1C2GA 3GY7A 1UVUH 1GWAA 3E16B 4Q80A 1AHTH 5FHTA 1SQAA 4CHAC 3DT0H 1BA8B 4KKDA 1T7CA 2R0LA 2WPIS 2IPHA 3ATKA 1RTLA 1A61H 3U8TH 1UTQA 2A4RA 2PW8H 4AFUA 1NROH 2J4IA 4ASHA 1UCYK 2QXGA 3ZZ8A 2FLBH 2BX3A 1OSSA 2H9EH 1P04A 3QWCH 1BBRE 1BHXF 2H2ZA 2B0FA 2ZDNA 5B6OA 4ESTE 2G52A 4Y0ZE 1C5MD 4ISLA 3ZZDA 1MUEB 3A82A 1G3EA 5C67A 3F1SB 5CE1A 2TBSA 1AVGH 2V35A 4A1TA 2VWNA 3RXRA 3GY4A 2FS8A 1IQGA 1K21H 3MMGA 1YP9A 1O2LA 1D3DB 3VXFH 3A7TA 1K1PA 3PO1B 4IW4E 3PMHB 1EAWA 1N6YA 1TMTH 4INKA 2I6QA 4M7GA 1Y5UT 1Y3VA 4KTUA 1UJ1A 1H8DH 3SNCA 3VFEA 2OBOA 1BJUA 1TPPA 2KAIB 2NU4E 1V2OT 3EAJA 1TGSZ 1EUFA 1IAUA 1HNEE 2FOCA 1PPFE 1PQ5A 2EA3A 3LGYA 1GJCB 3RXMA 1TGTA 4B71A 1MD8A 2BTCE 3MNSA 4Y8XA 1G3CA 2BY6X 2VGCC 3V0XA 3P6ZB 4WH8A 1ELVA 1FV9A 4K8YA 3NZIA 1F5KU 1DY9A 1P12E 1QRXA 2XW9A 2SGQE 1QB1A 3A80A 2BDCA 2VU8E 4H6TA 1W10U 1HJ8A 3E0PB 4GCHG 1C1UH 4YOJA 1YF4A 3A81A 1P3EA 2BQ7B 5FX6A 1G36A 4A6LA 4Q7YA 1PYTC 1TRYA 2AMQA 1HIAB 5HYOA 4UFDH 2A4QA 4VGCB 4H4FA 1TBQH 5A8YA 1ANDA 1MAYA 2VWMA 4FUHA 1GBBA 1L1NA 1LMWB 2ZHFH 4YLQH 2PTNA 3KQBA 4XSKU 3S7HB 2ZHWH 3NUMA 4BAHB 1NY22 2ILNA 1GJDB 1HIAA 1S83A 3SU4A 1ZJKA 4CREA 1F5LA 1H1BA 4XE4A 1DWEH 1QGFA 1SFIA 1GI4A 1A46H 4CRCA 1BZXE 2QV1A 1P0SH 1O3HA 1SGPE 3QTOH 1SGFA 4TPYA 3V3MA 2XC5A 1W11U 1A0JA 1CO7E 3RXPA 4DIHH 4MPWA 1SOZA 1C5ZB 3BTGE 1K1MA 1QL7A 1J16A 1P8VC 2BDAA 3I77A 3UTUH 2NWNA 2FEQH 1LO6A 3UWIA 1CGHA 1O2TA 1RXPA 1GG6C 3E91A 2D1JA 1TPAE 4U30A 1LPKB 1V2LT 4K2YA 3RXDA 4AFSA 2QN5T 3UFAA 3A7VA 3ZVBA 3QK1A 1TNHA 2FESH 1TRNA 2ZDLA 1DLKB 1TLDA 1TABE 1DXWA 1O2PA 2ZFQH 1K1JA 1TONA 2B9LA 2ZCLP 3A8AA 1S0QA 2AGEX 2Q6FA 3GCTG 1V2WT 3SV7A 1O2KA 3SJKA 1MTNC 2XCNA 3P8FA 5E0GA 1NFXA 2OTVA 1JWTA 2WUBA 4TWWA 3PM3A 2VIOA 4IN2A 4UFEH 4MNYA 4LOYH 1N6XA 1AKSB 3EDXB 2SGDE 2FLRH 1HRTH 2GGVB 1YC0A 3M37A 3AAUA 4OS5A 1ZHRA 3EA7A 1AFQB 3RXUA 4NGAH 2OC7A 4GLYA 1FPHH 1E34B 1C5QA 1KXDA 1TMBH 1RD3B 2GZ7A 2Y81A 5DPAA 4FU9A 5JBCS 1HGTH 1GHYH 2AFQB 3ATMA 5L6NH 1YM0A 3P8OA 1UCYH 1AUTC 1A5IA 1O3LA 4RKJB 3LGUA 3URCA 1OOKB 3KQEA 1RJXB 2IJOB 1UVSH 4NG9H 4MNWA 1O3EA 1F0UA 2GX4A 1W12U 2FS9A 3AASA 4X1QU 2A45B 1EKBB 1GBMA 3RDZA 4WMEA 1OWKA 1HAZB 4JK6A 3RXVA 1MCVA 3D65E 2R2MB 3DA9B 3MU1A 2BD7A 1C5UA 2ANWA 3MO6A 4FUCA 1ELCA 2CN0H 3LJJA 1GJBB 5EXNA 1G3BA 2FOFA 5EW1H 1KY9A 2SNWA 1LHDH 4WXIA 1MZDA 1OWIA 1KXEA 1FY3A 2OC8A 1KTTB 1HAYB 1QL8A 1UTKA 1BRUP 3RM2H 4NA8A 3SZNA 2BZ6H 3SHCH 1GDNA 1C2HA 2FODA 4I8KA 3TK5A 3MH6A 1C5RA 1YCPM 1AVWA 2F9BH 1VCWA 3GYMA 1W7XH 1FIWA 2FDAA 4MG3A 5DGJA 1BUIA 3VGCB 4JZFH 3BTDE 3F9EA 4X2VA 2R2WU 1IQMA 1A4WH 1XUKA 3AAVA 1P06A 3SU5A 1SGQE 4A5TS 2FWWA 1D3QB 1QB6A 4LXBH 7ESTE 4JMYA 5E2OA 1QL9A 4GUXA 1ELTA 4NA7A 3SBKA 3UIRA 1QBOA 6LPRA 3LKWA 1CU1A 1BTPA 1PPCE 3SUGA 1O34A 5C1XA 3ELAH 1PQ7A 2Y82A 1FY4A 1HAVB 1GHVH 1EZXC 1NFWA 4H6SB 3M61U 3TH4H 4DOQA 1GVLA 4E05H 3PMAB 1K1OA 1W2KH 1FAKH 4I8HA 3U98H 4I33A 1AE8H 2CHAC 1BTUA 7KMEH 1NU9A 1HYLA 5F8ZA 2BLVA 1W14U 2YNBA 4JZIA 1H9HE 1AU8A 1DS2E 1Z8IB 2QC2A 2QF0A 3MH4A 1L1JA 1P10A 1HAHH 2LPRA 1C5VA 4NIVA 1Z8JB 5K7RA 1O2WA 2IOTA 1UVOA 3DFJA 4IS5A 1Y3XA 2UUJB 2F83A 1FPCH 3EYDA 1K1IA 1T8MA 2C93B 2RCEA 1SC8U 3GY8A 4X1RU 3RXKA 1FUJA 4J2YB 4Y79A 4FVBA 4I7YH 3ZV8A 3LPRA 2P16A 1AVXA 1OYTH 1SGIB 2BDIA 2WPMS 1VGCB 1C9PA 1UHBA 2D2DA 5A0CA 2AMDA 2BD8A 3VXEH 5E0HA 1LPGB 2QXHA 3LT3A 1P02A 1T32A 3GY2A 1GJAB 1G37A 1P2QA 1TE0A 1AFEH 4SGAE 3SJ9A 4INHA 1PPGE 2Y5GA 1C1NA 1VR1H 3UWJH 3RU4E 1TQ7B 5C20A 2W7SA 1W3CA 3RXSA 4NIXA 3F68H 3Q76A 2XXLA 4D9RA 1O2JA 4NZLA 4YT7H 4WXVA 2SGAA 5FCRA 1OPHB 1BTHH 4NSYA 1GBIA 4UFFH 1CHGA 4FUEA 5AVDA 1O30A 2A7HA 1O37A 3M7UA 4BAMB 2J92A 3E6PH 1O5GH 4UEHH 4K8BA 4NIYA 1P3CA 5DP5A 4ZKSU 1ZSKA 5DJ7A 1FJSA 3M5MA 2RG3A 1C2JA 2HLCA 1NZQH 4NWKA 2V6NA 1FN8A 1O38A 2ZQ1A 1A7SA 4A92A 1TX8A 3SJIA 3SORA 1C2MA 1ANBA 2G4TA 1SGCA 1SGRE 5C1YA 5E2PA 1INCA 1SLVB 1Z7KA 2ZU4A 2QXIA 1GVZA 3O8DA 5TCAA 3MU8A 3SGAE 3P70B 3BTEE 3UY9A 1ABJH 1UK2A 5HM9A 4F49A 1G32B 4HTCH 1MQ6A 5DP4A 3E3TA 5C2ZA 2XWBI 4MNXA 1V2QT 1WU1A 1TYNA 1TA2A 3T2NA 1EQ9A 2Z9KA 1EJMA 4YO9A 3MU5A 3A8BA 4WMDA 1KSNA 1ELBA 1Z71A 1GGDC 2CF8H 2ZZUH 1SR5C 3RLWH 3MOCA 3HATH 1UK4A 4MVNA 1IQLA 1UTLM 2ZA5A 4KP0A 1O3DA 3MI4A 5HMAA 1DITH 3GICB 4GVUA 2SGEE 2XC0A 4JZEH 2OQUA 3RXGA 1NFYA 2VWOA 4ABDA 1SGYE 1EPTC 4ZHMU 3RU4T 3SV9A 5IDKA 2F91A 1SGFG 4AX9H 4Y7BA 1TBRH 1NPMA 1W8BH 3MYWA 4AZ2B 3DUXH 5FPTA 2VJ1A 1GBEA 1ZHMA 3E8LA 1Z6JH 2ZI2H 1DVAH 3ZZ3A 5AFYH 3D49H 1JMOH 1YPHE 3FVFB 5L2ZH 1V2JT 4OS6A 3TNTA 2JH6D 1A1RA 1AIXH 1P09A 4MQAA 1GHBG 3TGIE 2BZAA 3PWCA 3GDVA 1N8OB 3A89A 3E90B 3WY8A 1ABIH 2O9QA 3S9AA 3TJNA 1CA0B 1HCGA 3SU6A 3LGVA 2GKVE 1XM1A 3ZVEA 5LPFA 1Q31A 4TY6A 4AN7A 1EAUA 1RFNA 4GHTA 1AWHB 1K22H 1GBFA 2Z7FE 2F9UA 5E0JA 2HNTE 3KF2A 1SI5H 7GCHF 2OXSA 3OSYA 4X6MA 4FUGA 1V2UT 1F0TA 3HKIB 1UCYE 1Q3XA 2H1UA 1ESAA 2F9VA 1O5DH 1JBUH 2OBQA 3FP8E 2HPPH 1JRSA 1P9UA 1LHCH 1KXCA 4BANB 2J95A 2G5VA 3I29A 2AERH 2GCTC 3AW1A 2OP9A 1FDPA 3A7XA 4YT6H 4Y6DA 3TJOA 1LHEH 2ANKH 1VCPA 2Z3EA 3TJUA 2HGTH 4X2WA 2W3KA 1VITH 1BDAA 1P2OA 5LPEA 2VGCB 1C1QA 1ELDE 5DK1A 1GL1A 3A85A 3RXFA 5A09A 2XBXA 4ZROA 1FN6A 2AS9A 1NM6A 4AG2A 1DPOA 1MBQA 2THFB 1HAPH 3QN7A 3VEQB 1ELFA 2GCHF 1GI3A 1ZGVA 1THSH 2BLWA 1ZR0A 3PLPA 1ZRKA 3FFGA 2CXVA 5EGMA 3RMMH 2ZWLH 3GDSA 1GBLA 5F8XA 4AFZA 2GDDA 2ZTYA 1QY6A 2PUQH 1Y59T 4X0WU 3DHKH 8KME2 2BY9X 4X1PU 1CT0E 7GCHG 3BG4C 4KTSA 1YLDA 2ZFSA 4Q7ZA 3Q00A 3MTYA 1O2UA 1SLXB 1FI8A 1BTZA 1L1GA 1NU7B 2BXTH 2ZTXA 1W0ZU 3H5CB 2ZGCA 4IC6A 1O2QA 1MKWH 1MTVA 1C5LH 2CV3A 1AFQC 2BDYA 3JZ2B 2FYRA 2H6MA 3PB1E 2FOHA 2CHAB 2ZP0H 4X8VH 4XBDA 1HPGA 1BMMH 2DUCA 2I6SA 3LU9B 4X1SU 4BOHA 1C4V2 1P11E 2A2QH 1WQVH 2AMPA 3H7TA 1SHYA 3SUFA 1TA6A 3SUDA 4LZ4B 1J15A 3QGNB 3V7TA 4NWLA 2SGPE 1EOLA 1HDTH 2HRVA 5HM2A 2G4UA 4IN1A 4OGXA 1C5WB 1YPEH 2FOEA 4IBLH 3LIWA 3KL6A 1TAWA 1C1WH 4BXWA 1JIRA 1QA7A 5ABWA 5GPIB 2FOGA 4X8SH 3UPEA 1MMJN 3SI4H 3K6YA 3SJOA 2GT7A 2XBWA 4DIIH 1GCTB 1AE5A 4FUJA 4R8TB 4WJG2 3B23B 1FLEE 4BNRA 2FMJA 3DD2H 3RXLA 1EP6A 2C8WB 2RA3A 1YPKH 3W94A 4CHAB 1CGJE 3TNSA 3S7KB 3QGJA 1YYY1 5AF9H 3SW2B 5GCHG 2TGTA 4QT8C 3T25A 1G2LA 3DFLA 1EASA 2PR3A 4RSPA 1AB9B 3LGTA 5FPSA 2J34A 4GHQA 1Z1IA 1OP2A 2J9NA 3ZZ5A 1AD8H 1BJVA 2FP7B 4YOGA 5GXPA 3SU2A 2RA0A 1GDQA 4I31A 1HJ9A 1KLIH 1XXFA 1BTWA 2BDHA 1UTOA 3K65B 2R0KA 5A2MH 1GJ5H 1ETTH 3RXCA 3U1JB 1CE5A 2UUYA 3BTME 1GI8B 1TNJA 2G55A 1GVKB 2FO9A 2ODQA 1GL0E 2ODYB 3LH1A 5T6FA 1ANCA 2PHBA 2PKAA 4YM9A 2SGFE 3KCGH 1P2NA 3SUEA 2KAIA 1HAOH 1SHHB 1NFUA 1O3NA 2G81E 5FBEA 5A8ZA 1EJAA 2BMGB 1RIWB 1EP5A 2XNIA 4K1TA 4CR9A 1F5RA 2BD9A 2Z6BD 2H5DA 1B0FA 3GY6A 1BMAA 1YPMH 1GI7B 3QLPH 1GHAG 3HPTB 2PSXA 1DE7H 8ESTE 1IHTH 1TGBA 1KXBA 1LQDB 1F0SA 1O5BB 2GVFA 1H9LB 3TU7H 4GPGA 2H9HA 1XUGA 1IHSH 3PMBB 9ESTA 2ANYA 5CHAB 1E36B 1EJNA 4ABAA 1GI5A 2ZHQH 1CBWB 2VIWA 3QTVH 1MTSA 2JH5D 2TPIZ 3VB4A 4UDWH 3BTQE 1TX6A 1AZZA 1D3PB 2G5NA 1F0RA 2A5AA 5LPRA 2W26A 4WY3A 1KXAA 1RTFB 4INLA 1CHOF 4ZXYH 4WH6A 5JYIA 1O5EH 1E38B 6ESTA 1PFXC 1YPLH 1HXEH 1K2I1 1SVPA 1HJAB 3UR6A 5DP6A 4F4OC 1E37B 1L4ZA 3B9FH 3MH7A 4FUFA 2VNTA 1THPB 1QFKH 5L2YH 1HV7A 1LTOA 3BV9B 1EB1H 3TIUA 4I32A 3PTBA 5AFZH 1G30B 2PTCE 1LHFH 3GISB 3RMLH 4CR5A 2XYAA 3EA8A 5AHGH 3SO3A 2GV7A 2AH4X 4ABBA 3P17H 1ORFA 3FP6E 1JOUB 2ODPA 1WTGH 1AB9C 4A1XA 2EI6A 3GY3A 2ESTE 1DSTA 1OP0A 2DE9A 1BHXB 1ZLRA 4ZXXH 2A5IA 4ABIA 2H5CA 5F03A 3ITIA 2ZNKH 2C8XB 3EA9A 1KDQA 3F6UH 4DVAU 1O3GA 2AGGX 3K6ZA 2R3UA 1YCPK 3LGWA 4X2YA 2QA9E 1DICA 3RLYH 2A5KA 1DFPA 6CHAB 1QNJA 6GCHG 5FBIA 1GJ6A 1Z1JA 2QYIA 2VH6A 3BTTE 3EE0B 2Z9IA 3P92A 1VJAU 1G9IE 2Z3CA 1ZSLA 2BDGA 1K1LA 4GCHF 5DO4H 1A0LA 4U32A 3N7OA 4B2BA 1CSOE 2ZIQH 2JETC 1C1RA 3RXHA 3M3VA 1T8NA 3PTNA 1O33A 2SNVA 4GSOA 2FOAA 5ESTE 1C5OH 3SGBE 3SV8A 2ZO3H 1GHXH 1O3IA 1TNKA 3Q3YA 4B75A 2YNAA 4Y0YE 2BB4A 1Y8TA 4CRAA 4IMZA 4DCDA 1IQKA 1QB9A 1MH0A 1J9CH 3U1IB 4K1SA 1C4U2 4LZ1H 2XBYA 1MKXK 2PGBB 1F2SE 1TRMA 2ZECA 1NRPH 3P8NA 1V6DA 1LVOA 2BXUH 4X2XA 5FXLA 1LHGH 4JK5A 3O8BA 1K28D 5E8EH 4ABFA 4B74A 5I46H 1WOFA 1C1PA 3SHAH 4Y7AA 1GMCF 3RC4A 3A8DA 1P9SA 3UNRA 2JKHA 1TPOA 2R9PA 3P8GA 2FX6A 3T26A 1A5GH 2DE8A 4WWYA 5FAHA 2BYAX 1VJ9U 3BF6H 1ZYOA 1TNLA 1ELAA 3Q77A 5LGOA 2AEIH 1HB0B 2HWLB 4OS1A 1OKXA 5ESBA 1QIXB 5EQQA 1O5AB 4BXSA 1GMDG 1THRH 4OS4A 1ZTJA 1S0RA 2BY7X 3S9BA 1WQSA 4K5ZA 1SL3A 1ACBE 1TGNA 4OS7A 1ZJDA 3SV6A 2HNTF 3VGCC 1CT2E 1A3EH 1C5XB 5EXLA 1WYKA 4E06H 1SLUB 3M35A 6CHAC 1QTFA 3FANA 2CJIA 4JYVH 2OLGA 1YPHC 5BPEA 1XKAC 1Y5BT 5GJ4B 2VIDA 1GMHF 3U8RH 1C2EA 3AW0A 3UUZA 4U01A 1SPJA 2ZU5A 3RXOA 5T6DA 2ZFRH 1QJ6B 1TQ0B 2Q1JA 1GHWH 3BTFE 1AO5A 3MHWU 4Y8ZA 1SFQB 2Y5FA 3NCLA 1P57B 2NU0E 1GJ9B 1V2VT 3GYLB 5DP3A 1CA0C 1GMDF 1HAGE 5JBAS 5PTPA 3ATIA 3SQEE 2A7JA 1HFDA 4ISHH 3TPIZ 2UWPA 1DM4B 3BEFB 1FONA 1ETRH 1O2ZA 2VH0A 1O2MA 1WBGB 2GV6A 1T31A 2A4GA 2P3TB 2WPHS 1NRSH 1RGQA 2CF9H 4ZKOU 2PKSB 2XCFA 2UUFB 3KNXA 3PMJA 2Q6DA 5EU8A 1NRNH 1ZPZA 2W7UA 2Y7XA 3M7TA 1RIWC 3PO1C 5EODA 1GBCA 1O2RA 2Y80A 1ZPCA 2FI4E 1C9TA 1OWHA 1ARCA 4MDSA 1ZGIA 1CBWC 3SOSA 4B1TA 2JH0D 1MTWA 4A7IB 1ZPBA 2NU3E 2FOBA 1V2KT 5GCHF 4D8NA 1LKAA 2VINA 4JCNA 2J38A 4K60A 1TFXA 4YOIA 3NKKA 4HFPB 2A1DB 3ZZ6A 1B7XB 2HALA 1BOQA 1MU8B 2OD3B 2OC0A 3QUMP 4SGBE 1ZTLA 5C3NA 5FCKA 2OQ5A 3BIUH 1X7AC 2P8OC 3AVZA 5DP9A 5HGGA 1NRRH 3GCOA 1L0ZA 4ZKRU 2F9NA 5JBBS 2ZGXH 1IQFA 1YBWA 1GBTA 4I8GA 3PYHA 1O0DH 2HVXA 1W0YH 2ZGHA 5EG4A 1O5CB 2OC1A 1O3CA 1SMFE 1C5TA 3GCNA 5C5OA 4NSVA 4AB8A 1ARBA 1HAVA 3FZDA 1LCYA 1XUJA 5ETXA 2GDEH 1D9IA 1WSSH 1TOCB 2P95A 2FM2A 1DOJA 1A0HB 3LH3A 2JETB 3SQHE 3TLOA 2ZG0H 1JIMA 2OINA 2HNTC 1CGIE 3CS0A 4HGCA 4O3TA 4Y10E 3HGNA 5GDSH 1D6WA 3A7YA 4CRGA 1QRWA 3VB7A 4X6OA 1DLEA 1HLTH 1ZOMA 1C1MA 2BD3A 1O2IA 3F9GA 1FMGA 3A7ZA 1AWFH 1C5YB 2ZU3A 3MNBA 3KEEA 1GPZA 4XOJA 4Z0KA 4HZHA 2YOLA 1AY6H 4NA9H 1XVOA 4ABHA 1O3FA 4XBBA 3M5OA 3A8CA 2CMYA 1TNGA 2STBE 3ZVAA 2FPZA 3SNDA 2FIRH 1C1VH 1T8OA 4AB9A 1DWBH 3ESTA 3RC5A 1BTXA 1EX3A 2PUXB 1GI1A 1LQEA 1EZSC 1DT2A 2GMTC 3BTWE 3CS7A 2ZDAH 4D7GA 1V2NT 2PFEA 1TOMH 1N8OC 1GI2A 2W3IA 4ZAEA 1CVWH 2AYWA 4E7NA 2WINI 1GJ4H 3TITA 2BHGA 1C2IA 2TGDA 3RXBA 2EEKA 1SOTA 1D6RA 4Y76A 1FY1A 1D3TB 3LGIA 2O8WA 3LJOA 1Y5AT 1AQ7A 1TPSA 3IWMA 2P93A 1DANH 3GCTF 1GCDA 2Z9JA 4WVPE 5C1UA 1O35A 4IC5A 1G2MA 4AYVB 2C8YB 4NCYA 3H7OA 1K9OE 2GTBA 3ZYEA 3ODDA 4NZQA 1NC6A 1UTNA 2QF3A 4CRDA 3E0NB 1EPTA 4Y71A 8GCHG 2XBVA 2F3CE 4AOQA 4X6NA 3Q3KA 1ZMNA 1C1TA 3RU4D 3FAOA 2FI5E 2WV4A 5EPYA 3SJ8A 1HXFH 1O2VA 3UOPA 2A4OA 1GG6B 3ZV9A 3NXPA 5G4BA 4X6PA 4DG4A 3SU1A 1YPJH 3EGKH 1PYTD 2Y5HA 1IOEA 2ALVA 4ABJA 4AGKA 5DKMA 1S5SA 3BEUA 2J2UA 1SLWB 3GCHC 4D9QA 1ANEA 1NTPA 3TGJE 2SFAA 5JBTA 1CQQA 2BM2A 2EI8A 3MNXA 1GHAF 4JZDH 1E35B 1Y3WA 3TK6A 1CA8B 2LNCA 2WPJS 2Q6GA 2B8OH 2TGPZ 3MO3A 3D23A 3M3SA 3KQCA 4XBCA 4YZUA 2ZDMA 4B2CA 2XTTB 4MPVA 5FPYA 1KTSB 4DGJA 4FU8A 2M5TA 1QHRB 1AUJA 3TH3H 1HJAC 3BTKE 3BSQA 3SV2H 3SNEA 1EPTB 1TB6H 1XUIA 3RMOH 3ATWA 1LDTT 3M5LA 1UVTH 3T27A 1TMUH 1UVPA 1Y3UA 3V13A 3O8RA 9LPRA 2ZC9H 5IYTA 1SBWA 3KQDA 2ANMH 2B7DH 4FUIA 1O3AA 3GY5A 1PQ8A 1T4VH 2G00A 2FYQA 1C5NH 2ZU2A 2D26C 1IQJA 1F92A 5I25A 3ATLA 1ZZZA 2VB0A 1MKWK 5F8TA 4UE7H 2ULLA 4B73A 5JDUB 2Z9LA 2BVSH 1MZAA 2HOBA 3BTHE 5DP8A 4THNH 3ZVGA 4RN6A 1WV7H 2BY5X 2XRCA 1O2HA 1LVYA 2QGRA 2TGAA 3LC5A 3SU3A 1BIOA 1UO6A 5HXFA 1W13U 4D7FA 1ETSH 3KGPA 5H4IB 1FY5A 1WUNH 1PPZA 3TH2H 2AGIX 1VITF 1MD7A 1Q2WA 4MNVA 4FXGH 1A5HA 1ESTA 1PQAA 3LC3A 3MU4A 3JZ1B 4K69A 1GDUA 1O2YA 1XUFA 3BG8A 1UK3A 3HK3B 3PLKA 1FQ3A 3GDUA 1O3BA 1OYQA 3OU0A 4ZMAH 1ZMLA 4RKOB 5JPMH 2ZFPH 1GMHG 3ZZ4A 4KTCA 1SB1H 2GCTB 2H9TH 2ZU1A 3STJA 2O8LA 4ZUHA 3QZRA 1P01A 1PPEE 2GMTB 3UR9A 4ISNA 1YKTA 1NESE 3B8JA 3PWBA 4K1EA 1DSUA 2ZHEH 1ELGA 4H42U 3HKJB 2Z9GA 1UTMA 4J1YA 2V3HH 3A83A 2GT8A 4MTBA 3UREA 1BTYA 3ZVFA 3STIA 1HAIH 2UWOA 1S6FA 3U9AH 3RUOA 1VZQH 1DX5M 2BVRH 1TBZH 1DWDH 4Y8YA 1LVMA 2ZFTA 1DDJA 3MNCA 1MAXA 2VIQA 1IQIA 2BDBA 2AIPA 1T8LA 1O31A 3SU0A 4DT7B 1KDQB 3CENA 4ISIH 1QQ4A 3KIDU 4AGJA 1LVBA 4E7RG 3OY5U 1BB0B 3ZZ9A 1EAIA 3T62A 1P2MA 3E1XB 3LONA 1UMAH 2WPKS 1EZQA 5L30H 3RXIA 4X8TH 1XX9A 5JB9S 1XKBC 4O9VA 1UTJA 3RXAA 1OWDA 1VGCC 2O8TA 4LK4A 4BTIB 1C1OA 3M5NA 1XMNB 4VGCC 1EB2A 3UNQA 1S81A 1OS8A 4TYDA 2P94A 1BBRK 3HK6B 5CHAC 3UNSA 1EXFA 2V3OH 3BEIB 4NFEA 3GOVB 3TVJB 2QIQA 3T5FH 1GBJA 1GGDB 2P8OB 3A87A 4R0IA 4AG1A 1GBHA 3I78A 1TALA 1T4UH 3S0NA 1KYNA 1W7GH 3ZZBA 4CH2B 5SGAE 1TWXB 4OS2A 1E0FD 2P59A 1YPGH 2WUCA 4Z6AH 5K0HA 1HUTH 3ZZ7A 2ZGJA 1J14A 1BRCE 2STAE 1V2RT 2ZPRA 1BBRH 1TGCA 1KIGH 4O03A 1SGDE 4FVDA 1RTKA 2FZZA 2PGQB 1O2NA 1LPZB 2BLQA 1O3JA 3VB3A 1WCZA 3UQVA 1AI8H 1ZHPA 3S69A 1ESBA 1OXGA 5LH8A 2P3FH 3TJVA 1B5GH 4YTAA 2GCHG 4I8JA 1J17T 5EQSA 2TRMA 2BLOA 1A2CH 1O2GH 1O36A 2VVCA 1BITA 1GHBF 2QCYA 4Q7XA 1Z8GA 3LOXA 1O39A 1QR3E
chains in the Genus database with same CATH superfamily
1H9IE 4UFGH 1H8IH 2ZCKP 3T28A 1O2OA 4WMFA 1CHOG 3FP7E 1D4PB 2PKSC 1YLCA 1L4DA 4CBNA 2ZTZA 4ABGA 1GMCG 1P2JA 3SN8A 4CRBA 2QAAA 5T6GA 2WSSD 1YCPH 3IITA 4ZHLU 3IG6B 4AORA 5A0BA 3L3TA 3U69H 3LDXH 2BQWB 5CMXH 3ZZCA 1C2LA 5FX5A 5HKKD 1KLJH 1O5FH 3MH5A 2WYGA 1GJ7B 3BIVH 1C1SA 3HGPA 5JB8S 1MCTA 2BOKA 1AKSA 2C4FH 1C5SA 2AHME 3NPSA 1QRZA 1QBNA 1Y3YA 2ZDVH 3MWIU 4CH8B 1H4WA 1PPBH 1WAYB 3TGKE 1O3KA 2EC9H 1C2FA 3A86A 3RMNH 2HPQH 4I8LA 2K1QA 2OCVB 3RXTA 1NN6A 1O3MA 1O32A 1MABB 3EQ0H 4JZ1A 3QZQA 3A88A 1QA0A 3CP7A 3BN9A 1GBDA 3ZZAA 4B2AA 1MKXH 1P05A 3PLBA 4DURA 4F55A 1S85A 5EQRA 1SG8B 2F9PA 3D62A 1QJ1B 2ZFFH 4YLUA 2ZGBH 4IGDA 2BD5A 1NS3A 1QCPA 3M36A 3ZVCA 2FTMA 2P3UB 1MBMA 2PKAB 2O8MA 2L6OA 4DW2U 3FO8D 1SSXA 2EI7A 2ZKSA 1S82A 1SGNE 1QQUA 4UD9H 3BG4B 3QO6A 3U8OH 1S6HA 3TK9A 8LPRA 1SGEE 4MLFB 3NK8A 1NO9H 1BMNH 2VIPA 3ENSB 1OWEA 3F9HA 3RC6A 4A1VA 1N1LA 3C1KA 3DSGA 5J4SA 3PV4A 2FI3E 1UTPA 1AGJA 2QXJA 1EAXA 4DJZB 4TWYA 1P03A 2D8WA 1Z6EA 8GCHF 5HIZA 3NWUA 3DSPA 4O3UA 2GZ9A 5EW2H 4JYTA 4X1NU 1C5PA 1EOJA 1IQNA 3OAAD 2Y7ZA 5C17A 1QJ7B 1FNIA 5J4QA 4HI3A 1DUAA 2C8ZB 2W5EA 3MO9A 2ZQ2A 4ZKNU 1SQTA 2J94A 1GI6A 2F9OA 1BCUH 3KN2A 2JDID 1F7ZA 1M9UA 5EPNA 3M7QA 4I86A 1J8AA 3ZYDA 2B5TB 2VVVA 4OGYA 1V2PT 1O2XA 1BT7A 4PROA 3SNAA 2KFWA 1AMHA 2PV9B 1DWCH 5C0TA 4KGAA 4X8UH 2QY0B 1ZMJA 5T3HA 1MQ5A 4B6EA 4ABEA 1SQOA 5C5NA 6GCHF 2Z3DA 4B76A 1RS0A 1UHBB 4XDEA 2IJD1 3RXQA 4DY7B 1DUEA 4FUBA 2G51A 1MTUA 1FXYA 3T29A 2BY8X 1QBVH 4TY7A 3MFJA 1V2TT 1EATA 5A8XA 2C90B 1AN1E 3R3GB 3OY6U 1FIZA 3SI3H 1IQEA 1OP8A 1C2DA 2ALPA 2WPLS 1GI9B 2FX4A 3VB6A 2XWAA 1NRQH 3M3TA 3OYPA 2RDLA 4Y11E 2UUKB 3RXEA 2PLXA 2V3MA 1PPHE 3ODFA 3UOUA 5GWZA 3W95A 1XVMA 1LKBA 3G01A 1A3BH 4ZH8A 1GBAA 3VPKA 2FXRA 2NU2E 2OUAA 1RRKA 3A84A 5DG6A 2A7CA 1ZTKA 2WYJA 1YGCH 2TIOA 1O2SA 3F9FA 1GHZA 1ZRBA 1GBKA 1SGTA 4XFQA 2F43B 3L6PA 4NIWA 4WF8A 3RM0H 1B0EA 4UONA 5EJZA 4MPUA 5DP7A 1HBTH 1PJPA 1K1NA 1FY8E 5TCCA 2GZ8A 2ZPSA 1V2MT 2A31A 2LP6A 3O8CA 3L33A 1GI0A 3QX5H 1O3OA 2O8UA 3URDA 5F6MA 2ZF0H 2PWXA 1KXFA 5EXMA 1WTHD 1JXPA 4BTUB 2ASUB 4BAOB 2GP9B 1MTNB 7LPRA 2ZCHP 2ZDKA 1L2EA 2R3YA 4KELA 1VCQA 1XXDA 1S84A 1OX1A 1IQHA 1TNIA 2Z94A 1O3PB 3Q3XA 3DSOA 1E1QD 1G3DA 4JYUH 3RP2A 4O97A 1W0JD 2GD4B 4BTTB 2KR7A 4D76A 2ZHDA 1BQYA 1CT4E 1BRAA 1KLTA 2XC4A 3A7WA 3R0FA 5BRRE 1ID5H 4OM9A 2ZPQA 4K3JA 1XUHA 1GJ8B 2BX4A 4FETA 4ZHAA 1V2ST 2V0BA 2VWLA 3OTPA 2WV5A 2IN2A 1ZSJA 4FU7A 3QDZB 1AZ8A 1OWJA 2UWLA 3MU0A 1P2KA 2BQ6B 2BVXH 4YESB 5GIBA 2A32A 2AIQA 4CBOA 3SNBA 2BOHB 1S6LA 1BMLA 4MPXA 1FAXA 2G8TA 2VVUA 4BAKB 1P2IA 3RXJA 2A0QB 4AFQA 3K9XB 4U2WA 3OTJE 1UW7A 1U6QA 4BAQB 1MU6B 1TIOA 2Y6TA 4FUDA 5EOKA 4NFFA 3PROA 1FZZA 1TX7A 2PSYA 3C27B 2C3SA 4GAWA 2BD4A 3P95A 3OX7U 4TPIZ 3VB5A 1DY8A 3UQOA 1NT1A 1ELEE 3K2UA 4Q2KA 3V12A 3FZZA 2ZEBA 5A0AE 2NU1E 1BRBE 4ACBA 2FTLE 4AYYB 1Z8RA 4CRFA 4TSFD 1VITG 1SKYE 3S9CA 1HAXB 1SQRA 1C2KA 5TJXA 1DXPA 2BD2A 3KHVA 1C4Y2 2FOMB 3WWFA 1JRTA 3GCHB 3SGQE 2A2XH 1QURH 4IMQA 3ZVDA 1EZUC 3KQ5A 2VIVA 2CGAA 4ISOA 1V3XA 1GCTC 2GJGA 1C2GA 3GY7A 1UVUH 1GWAA 3E16B 5EJ1A 4Q80A 1AHTH 5FHTA 3PV2A 1SQAA 4CHAC 3DT0H 1BA8B 4KKDA 1T7CA 2R0LA 2WPIS 2IPHA 3ATKA 1RTLA 1A61H 3U8TH 1UTQA 2A4RA 2PW8H 4AFUA 1NROH 2J4IA 4ASHA 1UCYK 2QXGA 3ZZ8A 2FLBH 2BX3A 1OSSA 2H9EH 1P04A 3QWCH 1BBRE 1BHXF 2H2ZA 2B0FA 2ZDNA 3N7DA 4ESTE 5B6OA 2G52A 4Y0ZE 1C5MD 4ISLA 3ZZDA 1MUEB 3H09A 3A82A 1G3EA 5C67A 3F1SB 5CE1A 2TBSA 1AVGH 2V35A 4A1TA 2VWNA 3RXRA 4YXWD 1COWD 3GY4A 4Q4LA 2FS8A 1IQGA 1K21H 3MMGA 1YP9A 1O2LA 1D3DB 3VXFH 3A7TA 1K1PA 3PO1B 4IW4E 3PMHB 1EAWA 1N6YA 1TMTH 4INKA 2I6QA 4M7GA 1Y5UT 1Y3VA 4KTUA 1UJ1A 1H8DH 3SNCA 3VFEA 2OBOA 1BJUA 1TPPA 2KAIB 2NU4E 1V2OT 3EAJA 1TGSZ 1EUFA 1IAUA 1HNEE 3UAIC 2FOCA 1PPFE 1PQ5A 2EA3A 3LGYA 1GJCB 3RXMA 1TGTA 4B71A 1MD8A 2BTCE 3MNSA 4Y8XA 1G3CA 2BY6X 2VGCC 3WW7A 3V0XA 3P6ZB 4WH8A 1ELVA 1FV9A 4K8YA 3NZIA 1F5KU 1DY9A 1P12E 1QRXA 2XW9A 2SGQE 1QB1A 3A80A 2BDCA 2VU8E 4H6TA 1W10U 1HJ8A 2CK3D 3E0PB 4GCHG 1C1UH 4YOJA 1YF4A 3A81A 1P3EA 2BQ7B 5FX6A 1G36A 4Z1MD 4A6LA 4Q7YA 1PYTC 1TRYA 2AMQA 1HIAB 5HYOA 4UFDH 2A4QA 4VGCB 1E1RD 4H4FA 1TBQH 5A8YA 1ANDA 1MAYA 2VWMA 4FUHA 1GBBA 1L1NA 1LMWB 2ZHFH 4YLQH 2PTNA 3KQBA 4XSKU 3S7HB 2ZHWH 3NUMA 4BAHB 1NY22 2ILNA 1GJDB 1HIAA 1S83A 3SU4A 1ZJKA 4CREA 1F5LA 1H1BA 4XE4A 1DWEH 1QGFA 1SFIA 1GI4A 1A46H 3KYFA 4CRCA 1BZXE 2QV1A 1P0SH 1O3HA 1SGPE 3QTOH 1SGFA 1NBMD 4TPYA 3V3MA 2XC5A 2XNDD 1W11U 1A0JA 2JIZD 1CO7E 2F4LA 3RXPA 4MPWA 4DIHH 1SOZA 1C5ZB 3BTGE 1K1MA 1QL7A 1J16A 1P8VC 2BDAA 3I77A 3UTUH 5F53A 2NWNA 2FEQH 1LO6A 3UWIA 1CGHA 1O2TA 1RXPA 1GG6C 4DT4A 3E91A 2D1JA 1TPAE 4U30A 1LPKB 1V2LT 4K2YA 3RXDA 4AFSA 2QN5T 3UFAA 3A7VA 1FX0B 3QK1A 3ZVBA 1TNHA 2FESH 1TRNA 2ZDLA 1DLKB 1TLDA 1TABE 1DXWA 1O2PA 2ZFQH 1K1JA 1TONA 2B9LA 2ZCLP 3A8AA 1S0QA 2AGEX 2Q6FA 3GCTG 1V2WT 3SV7A 1O2KA 3SJKA 1MTNC 2XCNA 3P8FA 5E0GA 1NFXA 2OTVA 1JWTA 2WUBA 4TWWA 3PM3A 2VIOA 5EJLA 4IN2A 4UFEH 4MNYA 4LOYH 1N6XA 1AKSB 3EDXB 2SGDE 2FLRH 1HRTH 2GGVB 1YC0A 3M37A 3AAUA 4OS5A 1ZHRA 3EA7A 1AFQB 3RXUA 4NGAH 2OC7A 1WDIA 4GLYA 1FPHH 1E34B 1C5QA 1KXDA 1TMBH 1RD3B 2GZ7A 2Y81A 5DPAA 4FU9A 5JBCS 1HGTH 1GHYH 2AFQB 3ATMA 5L6NH 1YM0A 3NRLA 3P8OA 1UCYH 1AUTC 1A5IA 1O3LA 4RKJB 3LGUA 3URCA 1OOKB 3KQEA 1RJXB 2IJOB 1UVSH 4NG9H 4B6FA 4MNWA 1O3EA 1F0UA 2GX4A 1W12U 2FS9A 3AASA 4X1QU 2A45B 1EKBB 1GBMA 3RDZA 4WMEA 1OWKA 1HAZB 4JK6A 3RXVA 1MCVA 3D65E 2R2MB 3DA9B 3MU1A 2BD7A 1C5UA 2ANWA 3MO6A 4FUCA 1ELCA 2CN0H 3LJJA 1GJBB 5EXNA 1G3BA 2FOFA 2VBCA 5EW1H 1KY9A 2SNWA 1LHDH 4WXIA 1MZDA 1OWIA 1KXEA 1FY3A 2OC8A 1KTTB 1HAYB 1QL8A 1UTKA 1BRUP 3RM2H 4NA8A 3SZNA 2BZ6H 3SHCH 1GDNA 1C2HA 2FODA 4I8KA 1H8HD 3MH6A 3TK5A 1C5RA 1YCPM 1AVWA 2F9BH 1VCWA 3GYMA 1W7XH 1FIWA 2FDAA 4MG3A 5DGJA 1BUIA 3VGCB 4JZFH 3BTDE 3F9EA 4X2VA 2R2WU 1IQMA 1A4WH 1XUKA 3AAVA 1P06A 3SU5A 1SGQE 4A5TS 2FWWA 1D3QB 1QB6A 4LXBH 2KCOA 7ESTE 4JMYA 5E2OA 1QL9A 4GUXA 1ELTA 4NA7A 3SBKA 2W6JD 3UIRA 1QBOA 6LPRA 3LKWA 1CU1A 1BTPA 1PPCE 5GNDA 3SUGA 1O34A 3SZEA 5C1XA 3ELAH 1PQ7A 2Y82A 1FY4A 1HAVB 1GHVH 1EZXC 1NFWA 4H6SB 3M61U 3TH4H 4DOQA 1GVLA 4E05H 1K0HA 3PMAB 1K1OA 1W2KH 1FAKH 4I8HA 3U98H 2KM0A 4I33A 1AE8H 1E79D 2CHAC 1BTUA 7KMEH 1NU9A 1HYLA 5F8ZA 2BLVA 5KGOA 1W14U 3F2FA 2YNBA 4JZIA 1H9HE 1AU8A 1DS2E 1Z8IB 2QC2A 2QF0A 3MH4A 1L1JA 1P10A 1HAHH 2LPRA 3OEED 1C5VA 4NIVA 1Z8JB 5K7RA 1O2WA 2IOTA 1UVOA 3DFJA 4IS5A 1Y3XA 2W6ID 2UUJB 2F83A 1FPCH 3EYDA 1K1IA 1T8MA 2C93B 2RCEA 1SC8U 3CNRA 3GY8A 4X1RU 3RXKA 1FUJA 4J2YB 4Y79A 3SYJA 4FVBA 4I7YH 3ZV8A 3LPRA 2P16A 1AVXA 1OYTH 1SGIB 2BDIA 2WPMS 1VGCB 1C9PA 1UHBA 4P00A 2D2DA 5A0CA 2AMDA 2BD8A 2WHXA 3VXEH 5E0HA 1LPGB 2QXHA 3LT3A 1P02A 1T32A 3GY2A 1GJAB 1G37A 1P2QA 1TE0A 1AFEH 2J97A 4SGAE 3SJ9A 4INHA 1PPGE 2Y5GA 1C1NA 1VR1H 3UWJH 3RU4E 1TQ7B 5C20A 1YY3A 2W7SA 1W3CA 3RXSA 4NIXA 3F68H 3Q76A 2XXLA 4D9RA 1O2JA 4NZLA 4YT7H 4WXVA 2SGAA 5FCRA 1OPHB 1BTHH 4NSYA 1GBIA 4UFFH 1CHGA 4FUEA 5AVDA 1O30A 2A7HA 1O37A 3M7UA 4BAMB 2J92A 3E6PH 2M2AA 1O5GH 4UEHH 4K8BA 4NIYA 1P3CA 5DP5A 4ZKSU 1ZSKA 5DJ7A 1FJSA 3M5MA 2WV9A 2RG3A 4AC9A 1C2JA 2HLCA 1NZQH 4NWKA 2V6NA 1FN8A 1O38A 2ZQ1A 1A7SA 4A92A 1TX8A 3SJIA 2WZQA 3SORA 1C2MA 1ANBA 2G4TA 1SGCA 1SGRE 5C1YA 5E2PA 1INCA 1SLVB 1Z7KA 2ZU4A 2LELA 2QXIA 1GVZA 3O8DA 5TCAA 3MU8A 3SGAE 3P70B 3F3BA 3BTEE 3UY9A 1ABJH 1UK2A 5HM9A 4F49A 1G32B 4HTCH 1MQ6A 5DP4A 3E3TA 5C2ZA 4M9FA 2XWBI 4MNXA 1V2QT 1WU1A 1TYNA 2K8IA 1TA2A 3T2NA 1EQ9A 2Z9KA 1EJMA 4YO9A 3MU5A 3A8BA 2XOKD 4WMDA 1KSNA 1ELBA 1Z71A 1GGDC 2CF8H 2ZZUH 1SR5C 3RLWH 3MOCA 3HATH 1UK4A 4MVNA 1IQLA 1UTLM 2ZA5A 4KP0A 1O3DA 3MI4A 5HMAA 1DITH 3GICB 4GVUA 2SGEE 2XC0A 4JZEH 2OQUA 3RXGA 1NFYA 2VWOA 4ABDA 1SGYE 1EPTC 4ZHMU 3RU4T 3SV9A 5IDKA 2F91A 1SGFG 4AX9H 4Y7BA 1TBRH 1NPMA 1W8BH 3MYWA 4AZ2B 3DUXH 5FPTA 2VJ1A 1GBEA 1ZHMA 3F2HA 3E8LA 1Z6JH 2ZI2H 1DVAH 3ZZ3A 5AFYH 4FOUC 3D49H 1JMOH 1YPHE 3FVFB 5L2ZH 1V2JT 4OS6A 3TNTA 2JH6D 1A1RA 1AIXH 1P09A 4MQAA 1GHBG 3TGIE 2BZAA 3PWCA 3GDVA 5IK2D 1N8OB 3A89A 3E90B 3WY8A 1ABIH 2O9QA 3S9AA 3TJNA 1CA0B 1HCGA 3SU6A 3LGVA 5B6LA 2GKVE 1XM1A 3ZVEA 5LPFA 1Q31A 4TY6A 4ZCNA 4AN7A 1EAUA 1RFNA 4GHTA 1AWHB 1K22H 1GBFA 2Z7FE 2F9UA 4RT0A 2HNTE 3KF2A 5E0JA 1SI5H 7GCHF 2OXSA 3OSYA 4X6MA 4FUGA 1V2UT 1F0TA 3HKIB 1UCYE 1Q3XA 2H1UA 1ESAA 2F9VA 1O5DH 1JBUH 2OBQA 3FP8E 2HPPH 1JRSA 1P9UA 1LHCH 1KXCA 4BANB 2J95A 2G5VA 3I29A 2AERH 2GCTC 3AW1A 2OP9A 1FDPA 3A7XA 4YT6H 4Y6DA 3TJOA 1WXRA 1LHEH 2ANKH 1VCPA 2Z3EA 3TJUA 2HGTH 4X2WA 2W3KA 1VITH 1BDAA 1P2OA 5LPEA 2VGCB 1C1QA 2KZ4A 1ELDE 5DK1A 1GL1A 3A85A 3RXFA 5A09A 2XBXA 4ZROA 1FN6A 2AS9A 1NM6A 4AG2A 1DPOA 1MBQA 2THFB 2V7QD 1HAPH 3QN7A 3VEQB 1ELFA 2GCHF 1GI3A 1ZGVA 1THSH 2BLWA 1ZR0A 3PLPA 1ZRKA 3FFGA 2CXVA 5EGMA 3RMMH 2ZWLH 3GDSA 1GBLA 5F8XA 4AFZA 2GDDA 2ZTYA 1QY6A 2PUQH 1Y59T 4X0WU 3DHKH 5CDFE 8KME2 2BY9X 4X1PU 1CT0E 7GCHG 3BG4C 4KTSA 1YLDA 2ZFSA 4Q7ZA 3Q00A 3MTYA 1O2UA 1SLXB 2J5UA 1FI8A 1BTZA 1L1GA 1NU7B 2BXTH 2ZTXA 1W0ZU 3H5CB 2ZGCA 4IC6A 1O2QA 1MKWH 1MTVA 1C5LH 2CV3A 1AFQC 2BDYA 3JZ2B 2FYRA 2H6MA 3PB1E 2FOHA 2CHAB 2ZP0H 4X8VH 4XBDA 1HPGA 1BMMH 2DUCA 2I6SA 3LU9B 4X1SU 4BOHA 1C4V2 1P11E 2QF4A 2A2QH 1WQVH 2AMPA 3H7TA 1SHYA 3SUFA 1TA6A 3SUDA 4LZ4B 1J15A 3QGNB 3V7TA 4NWLA 2SGPE 5C0UA 1EOLA 1HDTH 2HRVA 5HM2A 2G4UA 4IN1A 4OGXA 1C5WB 1YPEH 2FOEA 4IBLH 3LIWA 3KL6A 2KCYA 1TAWA 1C1WH 4BXWA 1JIRA 1QA7A 5ABWA 5GPIB 2FOGA 2QE7D 4X8SH 3W1EA 3UPEA 1MMJN 3SI4H 3K6YA 3SJOA 2GT7A 2XBWA 4DIIH 1GCTB 1AE5A 4FUJA 4R8TB 4WJG2 3B23B 1FLEE 4BNRA 2FMJA 3DD2H 3RXLA 1EP6A 2C8WB 2RA3A 1YPKH 3W94A 4CHAB 3F2GA 1CGJE 3TNSA 3S7KB 3QGJA 1YYY1 5AF9H 3SW2B 5GCHG 2TGTA 4QT8C 3T25A 1G2LA 3DFLA 1EASA 2PR3A 4RSPA 1AB9B 3LGTA 5FPSA 2J34A 4GHQA 1Z1IA 1OP2A 2J9NA 3ZZ5A 1AD8H 1BJVA 2FP7B 4YOGA 5GXPA 3SU2A 2RA0A 1GDQA 4I31A 1HJ9A 1KLIH 1XXFA 1BTWA 2BDHA 1UTOA 3K65B 2R0KA 5A2MH 1GJ5H 1ETTH 3RXCA 3U1JB 1CE5A 2UUYA 3BTME 1GI8B 1TNJA 2G55A 1GVKB 1VKYA 2FO9A 2ODQA 1GL0E 2ODYB 3LH1A 5T6FA 1ANCA 2PHBA 2PKAA 4YM9A 2SGFE 3KCGH 1P2NA 3SUEA 2KAIA 1HAOH 1SHHB 1NFUA 1O3NA 2G81E 5FBEA 5A8ZA 1EJAA 2BMGB 1RIWB 1EP5A 2XNIA 4K1TA 4CR9A 1F5RA 2BD9A 2Z6BD 2H5DA 1B0FA 4XRNA 3GY6A 1BMAA 1YPMH 1GI7B 3QLPH 1GHAG 3HPTB 2PSXA 1DE7H 8ESTE 1IHTH 1TGBA 1KXBA 1LQDB 3AK5A 1F0SA 1O5BB 2GVFA 1H9LB 3TU7H 4GPGA 2H9HA 1XUGA 1IHSH 3PMBB 9ESTA 2ANYA 5CHAB 1E36B 1EJNA 4ABAA 1GI5A 2ZHQH 1CBWB 2VIWA 3QTVH 1MTSA 2JH5D 2TPIZ 3VB4A 4UDWH 3BTQE 3PRBA 1TX6A 1AZZA 1D3PB 2G5NA 1F0RA 2KCAA 2A5AA 5LPRA 3N99A 2W26A 4WY3A 1KXAA 1RTFB 4INLA 1CHOF 4ZXYH 4WH6A 5JYIA 1O5EH 1E38B 6ESTA 1PFXC 1YPLH 1HXEH 1K2I1 1SVPA 3MQKC 1HJAB 3UR6A 5DP6A 4F4OC 1E37B 1L4ZA 3B9FH 3MH7A 4FUFA 2VNTA 1THPB 4HG6A 1QFKH 5L2YH 1HV7A 1LTOA 3BV9B 1EB1H 3TIUA 4I32A 3PTBA 5AFZH 1G30B 2PTCE 1LHFH 3GISB 3RMLH 4CR5A 2XYAA 3EA8A 5AHGH 3SO3A 2GV7A 2AH4X 4ABBA 2KX4A 3EE7A 3P17H 1ORFA 3FP6E 1JOUB 2ODPA 1WTGH 1AB9C 4A1XA 2EI6A 3GY3A 2HVYB 2ESTE 1DSTA 1OP0A 1YLNA 2DE9A 1BHXB 1ZLRA 4ZXXH 2A5IA 4ABIA 2H5CA 5F03A 3ITIA 2ZNKH 2C8XB 3EA9A 1KDQA 3F6UH 4DVAU 1O3GA 2AGGX 3K6ZA 2R3UA 1YCPK 3LGWA 4X2YA 2QA9E 3PV5A 1DICA 3RLYH 2A5KA 1DFPA 6CHAB 1QNJA 6GCHG 5FBIA 1GJ6A 1Z1JA 2QYIA 2VH6A 3BTTE 3EE0B 2Z9IA 3P92A 1VJAU 1G9IE 2Z3CA 1ZSLA 2BDGA 1K1LA 4GCHF 5DO4H 1A0LA 2JJ2D 3N7OA 4U32A 4B2BA 1CSOE 2ZIQH 2JETC 1C1RA 2EY4C 3RXHA 3M3VA 1EFRD 1T8NA 3PTNA 1O33A 2SNVA 4GSOA 2FOAA 5ESTE 1C5OH 3SGBE 3SV8A 2ZO3H 1GHXH 1O3IA 1TNKA 3Q3YA 4B75A 2YNAA 4Y0YE 2BB4A 1Y8TA 4CRAA 4IMZA 4DCDA 3F0PA 1IQKA 4TT3D 1QB9A 1MH0A 4F48B 1J9CH 3U1IB 4K1SA 1C4U2 2YMSC 4LZ1H 2XBYA 1MKXK 2PGBB 1F2SE 1TRMA 2ZECA 1NRPH 3P8NA 3ZIAD 1V6DA 1LVOA 2BXUH 4X2XA 5FXLA 1LHGH 4JK5A 3O8BA 1K28D 5E8EH 4ABFA 4B74A 5I46H 1WOFA 1C1PA 3SHAH 4Y7AA 1GMCF 3RC4A 3A8DA 1P9SA 3UNRA 2JKHA 1TPOA 2R9PA 3P8GA 2FX6A 3T26A 1A5GH 2DE8A 4WWYA 5FAHA 1H8ED 2BYAX 1VJ9U 3BF6H 4ACAA 1ZYOA 1TNLA 1ELAA 3Q77A 5LGOA 2AEIH 1HB0B 2HWLB 4OS1A 1OKXA 5ESBA 1QIXB 5EQQA 1O5AB 4BXSA 1GMDG 1THRH 4OS4A 1ZTJA 1S0RA 2BY7X 3S9BA 1WQSA 4K5ZA 1SL3A 1ACBE 3VG8A 1TGNA 4OS7A 1ZJDA 3SV6A 2HNTF 3VGCC 1CT2E 1A3EH 1C5XB 5DN6D 5EXLA 1WYKA 4E06H 1SLUB 3M35A 6CHAC 1QTFA 3FANA 2CJIA 4JYVH 2OLGA 1YPHC 5BPEA 1XKAC 1Y5BT 5GJ4B 2VIDA 1GMHF 3U8RH 1C2EA 3AW0A 3UUZA 4U01A 2HLDD 1SPJA 2ZU5A 3RXOA 5T6DA 3OFND 2ZFRH 3OE7D 1QJ6B 1TQ0B 2Q1JA 1GHWH 3BTFE 1AO5A 3MHWU 4Y8ZA 1SFQB 2J98A 2Y5FA 3NCLA 1P57B 2NU0E 1GJ9B 1V2VT 3GYLB 5DP3A 2J98B 1CA0C 1GMDF 1HAGE 5JBAS 5PTPA 3ATIA 3SQEE 2A7JA 1HFDA 5C94A 4ISHH 2L74A 3TPIZ 5EIYA 2UWPA 1DM4B 3BEFB 1FONA 1ETRH 1O2ZA 2VH0A 1O2MA 1WBGB 2GV6A 1T31A 2A4GA 2P3TB 2WPHS 1NRSH 1RGQA 2CF9H 4ZKOU 2PKSB 2XCFA 2UUFB 3KNXA 3PMJA 2Q6DA 5EU8A 1NRNH 1ZPZA 2W7UA 2K0QA 2Y7XA 3M7TA 1RIWC 3PO1C 5EODA 1GBCA 2YMSD 1O2RA 2Y80A 1ZPCA 2FI4E 1C9TA 2YMSB 1OWHA 1ARCA 4MDSA 1ZGIA 1CBWC 3SOSA 4B1TA 2JH0D 1MTWA 4A7IB 1ZPBA 2NU3E 2FOBA 1V2KT 5GCHF 4D8NA 1LKAA 2VINA 3GS9A 4JCNA 2J38A 4K60A 1TFXA 4YOIA 3NKKA 4HFPB 2A1DB 3ZZ6A 1B7XB 1KMHB 2HALA 1BOQA 1MU8B 2OD3B 2OC0A 3QUMP 4SGBE 1ZTLA 5C3NA 5FCKA 2OQ5A 3BIUH 1X7AC 2P8OC 3AVZA 5DP9A 5HGGA 1NRRH 3GCOA 5DSFA 1L0ZA 4ZKRU 2F9NA 5JBBS 2ZGXH 1IQFA 1YBWA 1GBTA 4I8GA 3PYHA 1O0DH 2HVXA 1W0YH 2ZGHA 5EG4A 1O5CB 2OC1A 1O3CA 5KEDA 1SMFE 1NBME 1C5TA 3GCNA 5C5OA 4NSVA 3U28C 4AB8A 1ARBA 1HAVA 3FZDA 1LCYA 1XUJA 5ETXA 2GDEH 3FN8A 1D9IA 1WSSH 1TOCB 2P95A 2FM2A 1DOJA 1A0HB 3LH3A 2JETB 3SQHE 1W0KD 2ZG0H 3TLOA 2RFKC 1JIMA 2OINA 2HNTC 1CGIE 3CS0A 4HGCA 4O3TA 4Y10E 3HGNA 5GDSH 1D6WA 3A7YA 4CRGA 1QRWA 3VB7A 4X6OA 1DLEA 1HLTH 1ZOMA 1C1MA 2BD3A 1O2IA 3F9GA 1FMGA 3A7ZA 1AWFH 1C5YB 2ZU3A 3MNBA 3KEEA 1GPZA 4XOJA 4Z0KA 4HZHA 2YOLA 1AY6H 4NA9H 5FL7D 4XD7D 1XVOA 4ABHA 1O3FA 4XBBA 3M5OA 3A8CA 2CMYA 1TNGA 2STBE 3ZVAA 2FPZA 3SNDA 2FIRH 1C1VH 1T8OA 4AB9A 1DWBH 3ESTA 3RC5A 1BTXA 1EX3A 2PUXB 1GI1A 1LQEA 1EZSC 1DT2A 1BMFD 2GMTC 3BTWE 3CS7A 2ZDAH 1YWUA 4D7GA 1V2NT 2PFEA 1TOMH 1N8OC 1GI2A 2W3IA 4ZAEA 1CVWH 2AYWA 4E7NA 2WINI 1GJ4H 3TITA 2BHGA 1C2IA 1QZ8A 2TGDA 3RXBA 2EEKA 1SOTA 1D6RA 4Y76A 1FY1A 1D3TB 3LGIA 2KCPA 2O8WA 2EQNA 3LJOA 1Y5AT 1AQ7A 1TPSA 3IWMA 2P93A 1DANH 3GCTF 1GCDA 2Z9JA 4WVPE 2OK5A 1O35A 5C1UA 4IC5A 1G2MA 3UB0A 4AYVB 2C8YB 4RI0A 4NCYA 3H7OA 1K9OE 2GTBA 3ZYEA 3ODDA 4NZQA 1NC6A 1UTNA 2QF3A 4CRDA 3E0NB 1EPTA 4ASUD 4Y71A 8GCHG 2XBVA 2F3CE 4AOQA 4X6NA 3Q3KA 1ZMNA 1C1TA 3RU4D 3FAOA 2FI5E 2WV4A 5EPYA 3SJ8A 1HXFH 1O2VA 3UOPA 2A4OA 4P02A 1GG6B 2WPDD 3ZV9A 3FKSD 3NXPA 5G4BA 4X6PA 4DG4A 3SU1A 1YPJH 3EGKH 1PYTD 2Y5HA 1IOEA 2ALVA 4ABJA 4AGKA 2QF5A 5DKMA 1S5SA 3BEUA 2J2UA 1SLWB 3GCHC 4D9QA 1ANEA 1NTPA 3TGJE 2SFAA 5JBTA 1CQQA 2BM2A 2EI8A 3MNXA 1GHAF 4JZDH 1E35B 1Y3WA 3F0OA 3TK6A 1CA8B 2LNCA 2WPJS 2Q6GA 2B8OH 2TGPZ 3MO3A 3D23A 3M3SA 3KQCA 2JJ1D 4XBCA 4YZUA 2ZDMA 4B2CA 2XTTB 4MPVA 5FPYA 2PP6A 1KTSB 4DGJA 4FU8A 2M5TA 1QHRB 1AUJA 3TH3H 1HJAC 3BTKE 3BSQA 3SV2H 3SNEA 1EPTB 1TB6H 1XUIA 3RMOH 3ATWA 1LDTT 3M5LA 1UVTH 3T27A 1TMUH 1UVPA 1Y3UA 3V13A 3O8RA 9LPRA 2ZC9H 5IYTA 1SBWA 3KQDA 2ANMH 3N7EA 2B7DH 4FUIA 1O3AA 3OEHD 3GY5A 1PQ8A 1T4VH 2G00A 2FYQA 1C5NH 2ZU2A 2D26C 1IQJA 1F92A 5I25A 3ATLA 1ZZZA 2VB0A 1MKWK 5F8TA 4UE7H 2ULLA 4B73A 5JDUB 2Z9LA 2BVSH 1MZAA 2HOBA 3BTHE 5DP8A 4THNH 3ZVGA 4RN6A 1WV7H 2BY5X 2XRCA 1O2HA 1LVYA 2QGRA 2TGAA 3LC5A 3SU3A 1BIOA 1UO6A 5HXFA 1W13U 4D7FA 1ETSH 3KGPA 5H4IB 1FY5A 1WUNH 1PPZA 3TH2H 2AGIX 1VITF 1MD7A 1Q2WA 4MNVA 4FXGH 1A5HA 1ESTA 1PQAA 3LC3A 3MU4A 3JZ1B 4K69A 1GDUA 1O2YA 1XUFA 3BG8A 1UK3A 3HK3B 3WWBA 3PLKA 1FQ3A 3GDUA 1O3BA 1OYQA 3OU0A 4ZMAH 1ZMLA 4RKOB 5JPMH 2ZFPH 1GMHG 4RT1A 3ZZ4A 4KTCA 1SB1H 2GCTB 2H9TH 2ZU1A 3STJA 2O8LA 4ZUHA 3QZRA 1P01A 1PPEE 2GMTB 3PRDA 3UR9A 4ISNA 1YKTA 1NESE 3B8JA 3PWBA 4K1EA 1DSUA 2ZHEH 1ELGA 4H42U 3HKJB 2Z9GA 1UTMA 4J1YA 2V3HH 3A83A 2GT8A 4MTBA 3UREA 1BTYA 3ZVFA 2IPQX 3STIA 1HAIH 2UWOA 1S6FA 3U9AH 3RUOA 1VZQH 1DX5M 2BVRH 1TBZH 1DWDH 4Y8YA 1LVMA 2ZFTA 1DDJA 3MNCA 1MAXA 2VIQA 1IQIA 2BDBA 2AIPA 1T8LA 1O31A 3SU0A 4DT7B 1KDQB 3CENA 4ISIH 1QQ4A 3KIDU 4AGJA 1LVBA 3KYGA 4E7RG 3OY5U 5HIYA 1BB0B 3ZZ9A 1EAIA 3T62A 1P2MA 3E1XB 3LONA 1UMAH 2WPKS 1EZQA 5L30H 3RXIA 4X8TH 1XX9A 5JB9S 1XKBC 4O9VA 1UTJA 3RXAA 1OWDA 1VGCC 2O8TA 4LK4A 4BTIB 1C1OA 3M5NA 1XMNB 4VGCC 1EB2A 3UNQA 5KECA 1S81A 3FOAA 1OS8A 5CHBA 4TYDA 2P94A 1BBRK 3HK6B 5CHAC 3UNSA 1EXFA 2V3OH 3BEIB 4NFEA 3GOVB 3TVJB 2QIQA 3T5FH 1GBJA 1GGDB 2P8OB 3A87A 4R0IA 4AG1A 1GBHA 3I78A 1TALA 1T4UH 3S0NA 1KYNA 1W7GH 3ZZBA 5T1VA 4CH2B 5SGAE 1TWXB 4OS2A 1E0FD 2P59A 1YPGH 2WUCA 4Z6AH 5K0HA 1HUTH 3ZZ7A 3DCLA 2ZGJA 1J14A 1BRCE 2STAE 1V2RT 2ZPRA 1BBRH 1TGCA 1KIGH 4O03A 1SGDE 4FVDA 1RTKA 2FZZA 2PGQB 1O2NA 1LPZB 2BLQA 1O3JA 3VB3A 1WCZA 3UQVA 1AI8H 1ZHPA 3S69A 1ESBA 1OXGA 5LH8A 2P3FH 3TJVA 1B5GH 4YTAA 2RDEA 2GCHG 4I8JA 1J17T 5EQSA 2TRMA 2BLOA 1A2CH 1O2GH 1O36A 2VVCA 1BITA 1GHBF 2QCYA 4Q7XA 1Z8GA 3LOXA 1O39A 1OHHD 1QR3E 4Q63A
chains in the Genus database with same CATH topology
1H9IE 4UFGH 1H8IH 2ZCKP 3T28A 1O2OA 4WMFA 1CHOG 3FP7E 1D4PB 2PKSC 1YLCA 1L4DA 4CBNA 2ZTZA 4ABGA 1GMCG 1P2JA 3SN8A 4CRBA 2QAAA 5T6GA 1YCPH 3IITA 4ZHLU 3IG6B 4AORA 5A0BA 3L3TA 3U69H 3LDXH 2BQWB 5CMXH 3ZZCA 1C2LA 5FX5A 1KLJH 1O5FH 3MH5A 2WYGA 1GJ7B 3BIVH 1C1SA 3HGPA 5JB8S 1MCTA 2BOKA 1AKSA 2C4FH 1C5SA 3NPSA 1QRZA 1QBNA 1Y3YA 2ZDVH 3MWIU 4CH8B 1H4WA 1PPBH 1WAYB 3TGKE 1O3KA 2EC9H 1C2FA 3A86A 3RMNH 2HPQH 4I8LA 2K1QA 2OCVB 3RXTA 1NN6A 1O3MA 1O32A 3EQ0H 4JZ1A 3QZQA 3A88A 1QA0A 3CP7A 3BN9A 1GBDA 3ZZAA 4B2AA 1MKXH 1P05A 3PLBA 4DURA 1S85A 5EQRA 1SG8B 2F9PA 3D62A 1QJ1B 2ZFFH 4YLUA 2ZGBH 4IGDA 2BD5A 1NS3A 1QCPA 3M36A 3ZVCA 2FTMA 2P3UB 1MBMA 2PKAB 2O8MA 4DW2U 1SSXA 2EI7A 2ZKSA 1S82A 1SGNE 1QQUA 4UD9H 3BG4B 3QO6A 3U8OH 1S6HA 3TK9A 8LPRA 1SGEE 4MLFB 3NK8A 1NO9H 1BMNH 2VIPA 3ENSB 1OWEA 3F9HA 3RC6A 4A1VA 1N1LA 3C1KA 5J4SA 3PV4A 2FI3E 1UTPA 1AGJA 2QXJA 1EAXA 4DJZB 4TWYA 1P03A 2D8WA 1Z6EA 8GCHF 3NWUA 4O3UA 2GZ9A 5EW2H 4JYTA 4X1NU 1C5PA 1EOJA 1IQNA 2Y7ZA 1QJ7B 1FNIA 5J4QA 4HI3A 1DUAA 2C8ZB 2W5EA 3MO9A 2ZQ2A 4ZKNU 1SQTA 2J94A 1GI6A 2F9OA 1BCUH 3KN2A 1F7ZA 1M9UA 5EPNA 3M7QA 1J8AA 3ZYDA 2B5TB 2VVVA 4OGYA 1V2PT 1O2XA 1BT7A 4PROA 3SNAA 1AMHA 2PV9B 1DWCH 4KGAA 4X8UH 1ZMJA 2QY0B 5T3HA 1MQ5A 5C5NA 4ABEA 1SQOA 6GCHF 2Z3DA 4B76A 1RS0A 1UHBB 4XDEA 3RXQA 4DY7B 1DUEA 4FUBA 2G51A 1MTUA 1FXYA 3T29A 2BY8X 1QBVH 4TY7A 3MFJA 1V2TT 1EATA 5A8XA 2C90B 1AN1E 3R3GB 3OY6U 1FIZA 3SI3H 1IQEA 1OP8A 1C2DA 2ALPA 2WPLS 1GI9B 2FX4A 3VB6A 2XWAA 1NRQH 3M3TA 3OYPA 2RDLA 4Y11E 2UUKB 3RXEA 2PLXA 1PPHE 3ODFA 3UOUA 5GWZA 3W95A 1XVMA 1LKBA 3G01A 1A3BH 4ZH8A 1GBAA 3VPKA 2FXRA 2NU2E 2OUAA 1RRKA 3A84A 5DG6A 2A7CA 1ZTKA 2WYJA 1YGCH 2TIOA 1O2SA 3F9FA 1GHZA 1ZRBA 1GBKA 1SGTA 4XFQA 3L6PA 3RM0H 4NIWA 4WF8A 1B0EA 4UONA 4MPUA 5DP7A 1HBTH 1PJPA 1K1NA 1FY8E 5TCCA 2GZ8A 2ZPSA 1V2MT 2A31A 3O8CA 3L33A 1GI0A 3QX5H 1O3OA 2O8UA 3URDA 5F6MA 2ZF0H 2PWXA 1KXFA 5EXMA 1WTHD 1JXPA 4BTUB 2ASUB 4BAOB 2GP9B 1MTNB 7LPRA 2ZCHP 2ZDKA 1L2EA 2R3YA 4KELA 1VCQA 1XXDA 1S84A 1OX1A 1IQHA 1TNIA 2Z94A 1O3PB 3Q3XA 1G3DA 4JYUH 3RP2A 4O97A 2GD4B 4BTTB 4D76A 2ZHDA 1BQYA 1CT4E 1BRAA 1KLTA 2XC4A 3A7WA 3R0FA 5BRRE 1ID5H 2ZPQA 4K3JA 1XUHA 1GJ8B 2BX4A 4ZHAA 1V2ST 2V0BA 2VWLA 2WV5A 2IN2A 1ZSJA 4FU7A 3QDZB 1AZ8A 1OWJA 2UWLA 3MU0A 1P2KA 2BQ6B 2BVXH 4YESB 5GIBA 2A32A 2AIQA 4CBOA 3SNBA 2BOHB 1BMLA 4MPXA 1FAXA 2G8TA 2VVUA 4BAKB 1P2IA 3RXJA 2A0QB 4AFQA 3K9XB 4U2WA 3OTJE 1U6QA 4BAQB 1MU6B 1TIOA 2Y6TA 4FUDA 5EOKA 4NFFA 3PROA 1FZZA 1TX7A 2PSYA 3C27B 2C3SA 4GAWA 2BD4A 3P95A 3OX7U 4TPIZ 3VB5A 1DY8A 3UQOA 1NT1A 1ELEE 3K2UA 4Q2KA 3V12A 3FZZA 2ZEBA 5A0AE 2NU1E 1BRBE 2FTLE 4AYYB 1Z8RA 4CRFA 1VITG 3S9CA 1HAXB 1C2KA 5TJXA 1DXPA 2BD2A 3KHVA 1C4Y2 2FOMB 1JRTA 3GCHB 3SGQE 2A2XH 1QURH 4IMQA 3ZVDA 1EZUC 2VIVA 2CGAA 4ISOA 1V3XA 1GCTC 1C2GA 3GY7A 1UVUH 1GWAA 3E16B 4Q80A 1AHTH 5FHTA 1SQAA 4CHAC 3DT0H 1BA8B 4KKDA 1T7CA 2R0LA 2WPIS 2IPHA 3ATKA 1RTLA 1A61H 3U8TH 1UTQA 2A4RA 2PW8H 4AFUA 1NROH 2J4IA 4ASHA 1UCYK 2QXGA 3ZZ8A 2FLBH 2BX3A 1OSSA 2H9EH 1P04A 3QWCH 1BBRE 1BHXF 2H2ZA 2B0FA 2ZDNA 5B6OA 4ESTE 2G52A 4Y0ZE 1C5MD 4ISLA 3ZZDA 1MUEB 3A82A 1G3EA 5C67A 3F1SB 5CE1A 2TBSA 1AVGH 2V35A 4A1TA 2VWNA 3RXRA 3GY4A 2FS8A 1IQGA 1K21H 3MMGA 1YP9A 1O2LA 1D3DB 3VXFH 3A7TA 1K1PA 3PO1B 4IW4E 3PMHB 1EAWA 1N6YA 1TMTH 4INKA 2I6QA 4M7GA 1Y5UT 1Y3VA 4KTUA 1UJ1A 1H8DH 3SNCA 3VFEA 2OBOA 1BJUA 1TPPA 2KAIB 2NU4E 1V2OT 3EAJA 1TGSZ 1EUFA 1IAUA 1HNEE 2FOCA 1PPFE 1PQ5A 2EA3A 3LGYA 1GJCB 3RXMA 1TGTA 4B71A 1MD8A 2BTCE 3MNSA 4Y8XA 1G3CA 2BY6X 2VGCC 3V0XA 3P6ZB 4WH8A 1ELVA 1FV9A 4K8YA 3NZIA 1F5KU 1DY9A 1P12E 1QRXA 2XW9A 2SGQE 1QB1A 3A80A 2BDCA 2VU8E 4H6TA 1W10U 1HJ8A 3E0PB 4GCHG 1C1UH 4YOJA 1YF4A 3A81A 1P3EA 2BQ7B 5FX6A 1G36A 4A6LA 4Q7YA 1PYTC 1TRYA 2AMQA 1HIAB 5HYOA 4UFDH 2A4QA 4VGCB 4H4FA 1TBQH 5A8YA 1ANDA 1MAYA 2VWMA 4FUHA 1GBBA 1L1NA 1LMWB 2ZHFH 4YLQH 2PTNA 3KQBA 4XSKU 3S7HB 2ZHWH 3NUMA 4BAHB 1NY22 2ILNA 1GJDB 1HIAA 1S83A 3SU4A 1ZJKA 4CREA 1F5LA 1H1BA 4XE4A 1DWEH 1QGFA 1SFIA 1GI4A 1A46H 4CRCA 1BZXE 2QV1A 1P0SH 1O3HA 1SGPE 3QTOH 1SGFA 4TPYA 3V3MA 2XC5A 1W11U 1A0JA 1CO7E 3RXPA 4DIHH 4MPWA 1SOZA 1C5ZB 3BTGE 1K1MA 1QL7A 1J16A 1P8VC 2BDAA 3I77A 3UTUH 2NWNA 2FEQH 1LO6A 3UWIA 1CGHA 1O2TA 1RXPA 1GG6C 3E91A 2D1JA 1TPAE 4U30A 1LPKB 1V2LT 4K2YA 3RXDA 4AFSA 2QN5T 3UFAA 3A7VA 3ZVBA 3QK1A 1TNHA 2FESH 1TRNA 2ZDLA 1DLKB 1TLDA 1TABE 1DXWA 1O2PA 2ZFQH 1K1JA 1TONA 2B9LA 2ZCLP 3A8AA 1S0QA 2AGEX 2Q6FA 3GCTG 1V2WT 3SV7A 1O2KA 3SJKA 1MTNC 2XCNA 3P8FA 5E0GA 1NFXA 2OTVA 1JWTA 2WUBA 4TWWA 3PM3A 2VIOA 4IN2A 4UFEH 4MNYA 4LOYH 1N6XA 1AKSB 3EDXB 2SGDE 2FLRH 1HRTH 2GGVB 1YC0A 3M37A 3AAUA 4OS5A 1ZHRA 3EA7A 1AFQB 3RXUA 4NGAH 2OC7A 4GLYA 1FPHH 1E34B 1C5QA 1KXDA 1TMBH 1RD3B 2GZ7A 2Y81A 5DPAA 4FU9A 5JBCS 1HGTH 1GHYH 2AFQB 3ATMA 5L6NH 1YM0A 3P8OA 1UCYH 1AUTC 1A5IA 1O3LA 4RKJB 3LGUA 3URCA 1OOKB 3KQEA 1RJXB 2IJOB 1UVSH 4NG9H 4MNWA 1O3EA 1F0UA 2GX4A 1W12U 2FS9A 3AASA 4X1QU 2A45B 1EKBB 1GBMA 3RDZA 4WMEA 1OWKA 1HAZB 4JK6A 3RXVA 1MCVA 3D65E 2R2MB 3DA9B 3MU1A 2BD7A 1C5UA 2ANWA 3MO6A 4FUCA 1ELCA 2CN0H 3LJJA 1GJBB 5EXNA 1G3BA 2FOFA 5EW1H 1KY9A 2SNWA 1LHDH 4WXIA 1MZDA 1OWIA 1KXEA 1FY3A 2OC8A 1KTTB 1HAYB 1QL8A 1UTKA 1BRUP 3RM2H 4NA8A 3SZNA 2BZ6H 3SHCH 1GDNA 1C2HA 2FODA 4I8KA 3TK5A 3MH6A 1C5RA 1YCPM 1AVWA 2F9BH 1VCWA 3GYMA 1W7XH 1FIWA 2FDAA 4MG3A 5DGJA 1BUIA 3VGCB 4JZFH 3BTDE 3F9EA 4X2VA 2R2WU 1IQMA 1A4WH 1XUKA 3AAVA 1P06A 3SU5A 1SGQE 4A5TS 2FWWA 1D3QB 1QB6A 4LXBH 7ESTE 4JMYA 5E2OA 1QL9A 4GUXA 1ELTA 4NA7A 3SBKA 3UIRA 1QBOA 6LPRA 3LKWA 1CU1A 1BTPA 1PPCE 3SUGA 1O34A 5C1XA 3ELAH 1PQ7A 2Y82A 1FY4A 1HAVB 1GHVH 1EZXC 1NFWA 4H6SB 3M61U 3TH4H 4DOQA 1GVLA 4E05H 3PMAB 1K1OA 1W2KH 1FAKH 4I8HA 3U98H 4I33A 1AE8H 2CHAC 1BTUA 7KMEH 1NU9A 1HYLA 5F8ZA 2BLVA 1W14U 2YNBA 4JZIA 1H9HE 1AU8A 1DS2E 1Z8IB 2QC2A 2QF0A 3MH4A 1L1JA 1P10A 1HAHH 2LPRA 1C5VA 4NIVA 1Z8JB 5K7RA 1O2WA 2IOTA 1UVOA 3DFJA 4IS5A 1Y3XA 2UUJB 2F83A 1FPCH 3EYDA 1K1IA 1T8MA 2C93B 2RCEA 1SC8U 3GY8A 4X1RU 3RXKA 1FUJA 4J2YB 4Y79A 4FVBA 4I7YH 3ZV8A 3LPRA 2P16A 1AVXA 1OYTH 1SGIB 2BDIA 2WPMS 1VGCB 1C9PA 1UHBA 2D2DA 5A0CA 2AMDA 2BD8A 3VXEH 5E0HA 1LPGB 2QXHA 3LT3A 1P02A 1T32A 3GY2A 1GJAB 1G37A 1P2QA 1TE0A 1AFEH 4SGAE 3SJ9A 4INHA 1PPGE 2Y5GA 1C1NA 1VR1H 3UWJH 3RU4E 1TQ7B 5C20A 2W7SA 1W3CA 3RXSA 4NIXA 3F68H 3Q76A 2XXLA 4D9RA 1O2JA 4NZLA 4YT7H 4WXVA 2SGAA 5FCRA 1OPHB 1BTHH 4NSYA 1GBIA 4UFFH 1CHGA 4FUEA 5AVDA 1O30A 2A7HA 1O37A 3M7UA 4BAMB 2J92A 3E6PH 1O5GH 4UEHH 4K8BA 4NIYA 1P3CA 5DP5A 4ZKSU 1ZSKA 5DJ7A 1FJSA 3M5MA 2RG3A 1C2JA 2HLCA 1NZQH 4NWKA 2V6NA 1FN8A 1O38A 2ZQ1A 1A7SA 4A92A 1TX8A 3SJIA 3SORA 1C2MA 1ANBA 2G4TA 1SGCA 1SGRE 5C1YA 5E2PA 1INCA 1SLVB 1Z7KA 2ZU4A 2QXIA 1GVZA 3O8DA 5TCAA 3MU8A 3SGAE 3P70B 3BTEE 3UY9A 1ABJH 1UK2A 5HM9A 4F49A 1G32B 4HTCH 1MQ6A 5DP4A 3E3TA 5C2ZA 2XWBI 4MNXA 1V2QT 1WU1A 1TYNA 1TA2A 3T2NA 1EQ9A 2Z9KA 1EJMA 4YO9A 3MU5A 3A8BA 4WMDA 1KSNA 1ELBA 1Z71A 1GGDC 2CF8H 2ZZUH 1SR5C 3RLWH 3MOCA 3HATH 1UK4A 4MVNA 1IQLA 1UTLM 2ZA5A 4KP0A 1O3DA 3MI4A 5HMAA 1DITH 3GICB 4GVUA 2SGEE 2XC0A 4JZEH 2OQUA 3RXGA 1NFYA 2VWOA 4ABDA 1SGYE 1EPTC 4ZHMU 3RU4T 3SV9A 5IDKA 2F91A 1SGFG 4AX9H 4Y7BA 1TBRH 1NPMA 1W8BH 3MYWA 4AZ2B 3DUXH 5FPTA 2VJ1A 1GBEA 1ZHMA 3E8LA 1Z6JH 2ZI2H 1DVAH 3ZZ3A 5AFYH 3D49H 1JMOH 1YPHE 3FVFB 5L2ZH 1V2JT 4OS6A 3TNTA 2JH6D 1A1RA 1AIXH 1P09A 4MQAA 1GHBG 3TGIE 2BZAA 3PWCA 3GDVA 1N8OB 3A89A 3E90B 3WY8A 1ABIH 2O9QA 3S9AA 3TJNA 1CA0B 1HCGA 3SU6A 3LGVA 2GKVE 1XM1A 3ZVEA 5LPFA 1Q31A 4TY6A 4AN7A 1EAUA 1RFNA 4GHTA 1AWHB 1K22H 1GBFA 2Z7FE 2F9UA 5E0JA 2HNTE 3KF2A 1SI5H 7GCHF 2OXSA 3OSYA 4X6MA 4FUGA 1V2UT 1F0TA 3HKIB 1UCYE 1Q3XA 2H1UA 1ESAA 2F9VA 1O5DH 1JBUH 2OBQA 3FP8E 2HPPH 1JRSA 1P9UA 1LHCH 1KXCA 4BANB 2J95A 2G5VA 3I29A 2AERH 2GCTC 3AW1A 2OP9A 1FDPA 3A7XA 4YT6H 4Y6DA 3TJOA 1LHEH 2ANKH 1VCPA 2Z3EA 3TJUA 2HGTH 4X2WA 2W3KA 1VITH 1BDAA 1P2OA 5LPEA 2VGCB 1C1QA 1ELDE 5DK1A 1GL1A 3A85A 3RXFA 5A09A 2XBXA 4ZROA 1FN6A 2AS9A 1NM6A 4AG2A 1DPOA 1MBQA