1O2RA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2rA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2rA02
3ENSB 5K7RA 2HALA 1D9IA 2VU8E 1DUAA 4ABGA 3O8DA 2AMQA 2BLWA 1OYQA 3VGCB 1O3PB 2JH5D 4AORA 3FVFB 2Y5GA 2SGFE 1ZMJA 4Y8XA 2ZO3H 1MH0A 1ETRH 1TPSA 5SGAE 1HXEH 2GKVE 2XTTB 2ANWA 1G36A 2P16A 5DK1A 5L6NH 1C1MA 2BQ7B 2BVSH 3WY8A 3FZZA 1SGFA 2AIPA 1C5XB 2IJOB 1FV9A 1V2UT 1RFNA 3IG6B 2Z9JA 1A4WH 1P11E 4X1QU 5HXFA 5E8EH 4TYDA 2ASUB 4NA9H 1C2DA 3M3VA 1O2RA 2Q6DA 2QY0B 3FP8E 2XWBI 4KTUA 1C5LH 1HAIH 1NPMA 3URCA 3QZRA 3SU2A 3BEIB 1FUJA 2GZ9A 5IYTA 2I6QA 3T62A 1FIZA 1NFUA 1SVPA 3D49H 3A81A 2FS8A 1W10U 1PPFE 2ZGHA 2ZTXA 3DFLA 3SU3A 2AGGX 1MTNB 1D3QB 1RD3B 1YCPH 2W7SA 1C2HA 2ZU3A 4CR5A 1CE5A 3SNEA 3L33A 4A1TA 3TJNA 3MWIU 5HMAA 1QFKH 1A3EH 1HBTH 1NFXA 3LU9B 4XE4A 1ELFA 4WJG2 3ZYDA 1Y3UA 3LGTA 1BTYA 2WINI 2FOMB 2A4QA 3BEUA 3KF2A 2C8ZB 1AFQC 2WV4A 2BDCA 3M35A 1P03A 1YGCH 1BTPA 3BG4C 1DVAH 4Q2KA 5F6MA 2A7HA 1ZOMA 2OLGA 2BYAX 1NO9H 1NC6A 1GI6A 2P3UB 2YOLA 1S0QA 1ZJDA 1HJ8A 1EQ9A 1PYTD 2F9OA 4CRFA 3D23A 2H6MA 1GVZA 1C1OA 1T8MA 1ZTKA 2WPKS 1TGBA 2PSXA 4IMZA 2ILNA 2UWPA 1GHVH 2G4UA 2C8WB 5A09A 1GBHA 4MNYA 1L1NA 2AEIH 1NU9A 1ELCA 2TGDA 5GJ4B 1KLTA 1EB1H 1P9SA 1L0ZA 1VCPA 5DG6A 1NRSH 2HGTH 4X2YA 5CHAC 1FI8A 3BTKE 4A1VA 1ANEA 1GJ8B 2ZPQA 2V3HH 1O2JA 1BB0B 4NFFA 3QLPH 5C20A 1V2LT 1FLEE 1V2ST 1DITH 2IN2A 2WUBA 1ZHPA 4Q80A 4HZHA 3TIUA 4GVUA 1P2OA 1ZJKA 3SJ8A 2NU1E 2BD9A 1BQYA 4K5ZA 1KXCA 2Q6FA 1TYNA 1DT2A 1QA7A 2R0KA 1O5FH 3RMOH 7ESTE 3SQEE 1JIMA 3SU4A 6LPRA 3ZZ3A 1MKXK 1UTOA 1P2MA 3BTQE 2SGPE 7GCHG 5F03A 3EDXB 1DS2E 2AFQB 3EE0B 1EJAA 2HRVA 1O38A 1OS8A 1KDQA 1T8LA 2BXTH 1YBWA 1SLWB 2JETC 1EPTC 1THSH 1GCDA 3OYPA 1YYY1 3SJ9A 1G3EA 3TPIZ 2A0QB 2O8MA 1V2QT 1O3JA 1O3HA 1TX7A 3RXUA 3Q3YA 1XKBC 1GBKA 3RXDA 2Q1JA 3W95A 1FAXA 5BPEA 3PV4A 3VB5A 2H1UA 2QYIA 3SI3H 1BHXB 2FZZA 1A61H 1TBZH 3EAJA 1AVGH 4XSKU 2G52A 3SNDA 4OS5A 1GI2A 2DE9A 1B0FA 1UTQA 1O2SA 2J38A 1ANBA 1VJ9U 1YPGH 1MTVA 1S83A 1MD8A 1PQ8A 1A5HA 3S9CA 1NRRH 2FXRA 3BEFB 1G3BA 2STBE 3SUDA 5FX6A 3A88A 2ZTZA 1K1NA 5GXPA 4A7IB 1AIXH 3TK5A 4TWWA 1O31A 3OSYA 1K21H 1XUJA 4Y7BA 1TMBH 3RM2H 1IQLA 1NRNH 4D76A 1ETSH 3RXHA 1AD8H 2F9UA 1ZRKA 1DANH 1VITF 4X6NA 4DW2U 4INKA 4I8JA 1BRUP 2F3CE 3M5NA 3KGPA 4E7RG 1DFPA 1ETTH 3SJKA 1C5RA 3AASA 4CRDA 1HAVA 3RC5A 3ATMA 2FLBH 1YCPM 3U69H 1OWJA 4J2YB 1IHSH 1ZSLA 3RXAA 2XC0A 1O5AB 4JK5A 2VIQA 5EXMA 1PPHE 1UMAH 1O2MA 1OP8A 2QXIA 1T32A 1GGDB 3GCTF 2Y5HA 3TGKE 1VZQH 1T31A 5DP6A 3SGBE 1O39A 4BXWA 2A1DB 4YM9A 1D6RA 1SL3A 3NKKA 2Y7XA 3E16B 1IQIA 1FZZA 1SLUB 2BOKA 1SBWA 2PR3A 1QBVH 2GX4A 1L2EA 4B2BA 4DCDA 2P3TB 2TRMA 4NIYA 1JRTA 1QRXA 1O2LA 2PSYA 1OXGA 2PKSC 1GMCG 1ANCA 4YOJA 2ZF0H 2BDBA 1RS0A 1UVTH 2R3UA 3FZDA 1CHOG 1C5QA 2V35A 3H7TA 1GBBA 1EPTA 1C2KA 3LH3A 5EQSA 4YT7H 4RN6A 4BAMB 1ELDE 4R0IA 2OTVA 4RKOB 2WPIS 3PMBB 1TX6A 2BY6X 1LKBA 1K2I1 1M9UA 1TABE 3T27A 4D9QA 1Y5BT 1UO6A 2CJIA 1YM0A 1TRNA 3ZZDA 3KCGH 5GPIB 2XC4A 1H8IH 8KME2 2GP9B 1DLKB 3V12A 4ESTE 4XBDA 4ABEA 2CHAB 1G32B 5LPEA 1DSTA 2ZHFH 3P92A 2GV7A 2ZDKA 5JDUB 3SNCA 5T6GA 2OBQA 1O2NA 4E05H 2FIRH 1CT0E 1P01A 2Z9IA 1C1TA 1J16A 1F0TA 1O32A 1EAUA 3M3TA 4CRBA 3ITIA 1AU8A 3O8BA 3PO1B 3ESTA 2NU2E 1HJAC 4B2AA 4ZXXH 3QDZB 3FFGA 1DWBH 1A5IA 2ZFTA 3PWBA 3ATWA 1RTLA 1A7SA 3FAOA 2VIWA 1C1NA 2GCTB 2B7DH 2BX4A 1PPZA 1A1RA 1O34A 1HCGA 4YT6H 1CVWH 1WQSA 2GCHF 2J9NA 2P8OB 2OC7A 2OC1A 3P8FA 3M61U 1ZPCA 2ANKH 1AB9B 1IQFA 2Q6GA 3MNCA 4H6SB 2IPHA 1MD7A 3DHKH 3QX5H 1AN1E 1QBOA 3VPKA 5DKMA 1N8OB 1C1QA 3LOXA 2LPRA 4ZKOU 1YPJH 5EW1H 1DWEH 4I33A 2ZFSA 1KY9A 2ZC9H 1AKSA 2Z6BD 4FXGH 4R8TB 2RCEA 1LCYA 3ATKA 1E36B 1MMJN 3U98H 1PPEE 1SB1H 1CGJE 3NUMA 4I31A 1BMAA 4X8SH 1MCVA 4K3JA 1QNJA 3SV2H 1HFDA 2G51A 2C93B 3SUEA 5FX5A 3PYHA 4ABBA 1CA0B 1JBUH 2HPQH 4I7YH 1C4V2 4HI3A 1O30A 5DJ7A 1O3CA 3DFJA 3M36A 1CU1A 1HIAA 1BTXA 4OS7A 5LH8A 2YNAA 1NESE 2VGCC 1SGRE 1GBFA 1EOLA 1UJ1A 1ANDA 4SGAE 1E34B 1K1JA 1DY8A 1LHFH 3GYMA 1SLXB 1GBDA 3NXPA 1UCYH 5DPAA 4NWLA 1MZDA 1H4WA 1O2IA 2ZDVH 4OS6A 1Z8GA 1O5EH 2V0BA 2VNTA 1NM6A 3ZV8A 2O8WA 3BTHE 3GY7A 4AFQA 2OBOA 5F8ZA 1S81A 2CN0H 1Y3WA 3NPSA 5L30H 2VJ1A 2ZQ2A 2J95A 3MNBA 8ESTE 3L3TA 1K9OE 1W3CA 2VIDA 1XVOA 2PKAA 1A46H 3KQDA 2GZ7A 2BM2A 2UWOA 3PM3A 1YC0A 5A8ZA 1D3TB 1KXBA 3RMMH 3VGCC 5TCAA 1AE5A 4NCYA 1H8DH 4FUFA 2IOTA 4MQAA 2QXJA 5C1XA 2D2DA 2G5VA 2ALPA 2R2MB 1DX5M 4AGKA 3MI4A 2UWLA 5C5OA 4JZIA 1NRQH 4I8KA 5ESBA 2TGTA 2HLCA 3U8OH 1TOMH 1BBRH 3BTWE 5EGMA 4YOGA 3JZ1B 1GHBG 4K1EA 1V2TT 3STIA 3K6ZA 3MH4A 1GCTB 5E0GA 2BDYA 1LVYA 1HYLA 1L4ZA 4CRGA 3SHCH 8GCHG 3UOPA 2WUCA 3GY4A 3MH7A 1HAYB 3SU5A 4OGYA 1TNHA 2SNVA 1UCYE 6ESTA 3W94A 2EA3A 1DSUA 1SGCA 4E7NA 1QB9A 1OP0A 1SHHB 1W12U 3TNTA 1C5TA 1TONA 1XKAC 4WVPE 2G55A 1L1GA 3TJUA 3E6PH 1QA0A 1SGDE 1UK4A 4MNVA 4XBCA 1QY6A 3ZZ8A 1OWIA 5EU8A 3LIWA 1EZSC 1ESBA 1PYTC 3RXCA 2FODA 6GCHF 1HAXB 1EAWA 5GDSH 4WWYA 4U2WA 4JCNA 1G3CA 1ID5H 1TGCA 1Y3VA 5AF9H 1BMLA 1C5MD 1PPBH 3A83A 3KN2A 5GCHG 4WH8A 2YNBA 3SORA 4YOIA 1C2MA 1MBMA 1YPMH 2ZFRH 3BIUH 4HTCH 4MLFB 2THFB 1XM1A 1SHYA 4ZKRU 1QL7A 3SUGA 1KLJH 1ZTLA 1VGCB 2I6SA 3P6ZB 1MQ6A 2B8OH 1T4UH 1THPB 2SGDE 1BBRE 4BTUB 1TIOA 2CF9H 4I8GA 5JBCS 1CBWC 3ZVEA 3VB4A 1H9IE 1EZUC 1QR3E 4IGDA 4FUEA 1AZ8A 4WF8A 2VWOA 1BTHH 1OWEA 5LPRA 1C5WB 1C9TA 7LPRA 1V2NT 1E37B 3V0XA 1GBLA 4ABFA 2F9VA 5F8TA 1GG6B 4HFPB 1T7CA 1P2NA 4KP0A 9ESTA 4I8LA 3SGQE 1W7XH 1F7ZA 1MTWA 3PB1E 1GI4A 2XCFA 1EZXC 3LJOA 1P2IA 2VIOA 1GBTA 1INCA 4FUBA 1W8BH 3M5MA 3ODFA 4ISNA 4X1NU 3TH4H 3MMGA 5L2ZH 1GMHG 1BOQA 1FN8A 1W14U 2BD2A 1SLVB 1ELGA 2DE8A 1GJAB 2H5CA 4WMFA 2PLXA 1EAXA 1ZYOA 2BD5A 2FX6A 2ZZUH 1GBIA 4JZFH 4YO9A 1YCPK 4BANB 2UUFB 2Z7FE 2PTCE 2JH6D 5LPFA 3UNRA 3NZIA 1B5GH 2FOFA 2WYJA 1EP6A 3RMLH 4INHA 2A32A 1HDTH 1LPZB 2SNWA 1NFYA 1FN6A 1O2TA 2GGVB 2G8TA 2QIQA 2ZG0H 3NK8A 4K1TA 3S9AA 1O3LA 2P95A 4B73A 5JBTA 2ZDLA 2ZGJA 1F0SA 3KQBA 4WY3A 2FWWA 4LK4A 2H5DA 4LXBH 1TMTH 1KXFA 2G5NA 1BTZA 3GY5A 1OX1A 1JXPA 1LHDH 3A7VA 4AFSA 1KDQB 1O3AA 1F5LA 3BV9B 1F2SE 3IWMA 2BD7A 2Y80A 3E91A 4K60A 4UD9H 1UVSH 4Q7YA 1WOFA 2ZGCA 4UE7H 3SO3A 2J2UA 2QC2A 1GI8B 5EOKA 1FY8E 5TCCA 3BTDE 1CHGA 3QGJA 1C2FA 1OWHA 4GSOA 1D3PB 2H9EH 1O3NA 1MUEB 1AGJA 2VIPA 3QWCH 3A80A 3TITA 1HAHH 2AERH 2B0FA 1O35A 3T26A 5I25A 1WUNH 2R0LA 4KKDA 2J34A 3LONA 3SOSA 4O03A 1P0SH 1O3OA 1AVWA 4AYYB 2VINA 3VEQB 1GVLA 2ZCLP 4E06H 1QCPA 7GCHF 1AFQB 3RXBA 1W0ZU 3PMHB 4B75A 5C1UA 1G3DA 1O2PA 1GJCB 1XX9A 1JIRA 3HGNA 2BY8X 3TK6A 3SNBA 4UEHH 1OPHB 4K69A 1YPHC 1RGQA 3BF6H 2Z9LA 1O3KA 3MU0A 2FM2A 1V2RT 3SHAH 1P02A 2VWNA 4ABDA 4Y11E 1SC8U 3U1JB 1GGDC 1C5SA 3CS7A 1Z71A 3P8NA 1Y5UT 3ZZ9A 1Y5AT 1GVKB 1H1BA 2A4OA 3C1KA 3ZZAA 4BAHB 5C1YA 1MKWH 5PTPA 2ZU1A 1NN6A 4AX9H 1PPCE 2XBVA 3SN8A 1HAVB 2FOGA 1YPLH 1QQ4A 3GY3A 2GMTC 1MAYA 1AWHB 3A85A 1GHWH 1Z1IA 2BX3A 1P12E 2ULLA 5CHAB 2ZHEH 2RG3A 2J92A 1EOJA 2WPJS 3LGYA 1SG8B 5FHTA 3F6UH 2FESH 3MU8A 1MU6B 9LPRA 1AFEH 1MAXA 1XXFA 3U8TH 3ZZ6A 1TQ0B 2AMDA 2GVFA 1SQOA 5A8YA 1A0LA 4ZXYH 2ZU2A 6CHAC 2FOAA 3ZYEA 1O2QA 2QGRA 5HM9A 4UDWH 3ZVGA 3TGIE 4DG4A 3S9BA 4JMYA 1O3GA 1O5CB 4X1SU 1UHBA 1A3BH 1AE8H 2FI3E 5HYOA 3F68H 4B76A 1FY4A 2FX4A 2GT8A 4CRCA 2XWAA 3T29A 1BRCE 2A2QH 1FMGA 4FUIA 1AZZA 3A7WA 4YTAA 3D65E 5EPNA 4XFQA 4WXVA 1QL9A 4IN1A 1LO6A 4FUJA 2GT7A 1GI3A 2PGBB 2O8LA 4Y6DA 5DP3A 1F5RA 3UOUA 2A5KA 1P10A 2CHAC 1P3EA 1G9IE 4ZAEA 2V6NA 1P57B 3NCLA 5TJXA 1E0FD 1CT4E 2OQ5A 3VB3A 3SBKA 1UK3A 3GCTG 3FP7E 1AUJA 1SQAA 2J94A 3LC5A 2H9TH 3QTVH 3RXEA 3H7OA 1GBMA 1ZSJA 2Z3CA 1FIWA 1EB2A 1UTNA 3E0NB 4YESB 2V3OH 2W5EA 2GDEH 2Z94A 1FAKH 1ZR0A 3RC6A 2ZHDA 4JYVH 3LPRA 5EQQA 5FCKA 1IQHA 1DE7H 1GMCF 2F91A 1CGIE 1OSSA 3UY9A 1DWCH 1W0YH 3I29A 3MO3A 2D8WA 2P8OC 3IITA 5FXLA 1O2ZA 3M3SA 2BQ6B 1AB9C 1LHGH 3MU4A 1MTUA 2F9NA 3RU4D 5FAHA 3Q3XA 1FDPA 2R3YA 5EG4A 4NSVA 3TJVA 1T4VH 2ZIQH 1GI0A 3TVJB 2F9BH 2A45B 3LC3A 5DO4H 5J4QA 4O3UA 3CENA 4DJZB 3RXRA 3S7KB 1L4DA 4GCHG 3SJIA 2NU0E 4NSYA 1QJ1B 3PTNA 1IOEA 1Q2WA 4DVAU 3MO6A 2XRCA 3AAUA 1BDAA 2W26A 1BCUH 4UONA 2QV1A 4IC6A 2HNTF 4FUGA 3M5LA 1QBNA 3HK3B 2BDIA 4X8TH 3T5FH 4K2YA 4AB9A 4FU7A 1V3XA 1C2IA 1QL8A 2ZEBA 3LGVA 1TNLA 2ZU5A 1S6FA 1S82A 1XMNB 4K1SA 4B2CA 1V6DA 1XUGA 2UUYA 4MG3A 3QGNB 1GMDG 1TA2A 4FVDA 1AKSB 3GISB 3ATLA 1EASA 2ZGBH 4AYVB 1C2EA 1XUIA 1TLDA 4NIVA 2XNIA 1O2KA 1C5YB 1HNEE 4X6OA 2ZHQH 1UVOA 4RKJB 1RIWB 3GICB 3I78A 1Y3YA 4U30A 4D7GA 1AQ7A 1IQGA 3V13A 1C1RA 4ISHH 5FPYA 2A2XH 2A4GA 2QA9E 1SGFG 3U8RH 1GI9B 1QQUA 1OKXA 3RLWH 4X2WA 1O2HA 2JKHA 4F49A 1CGHA 3GY6A 4WMEA 1TBQH 1C5UA 3A7YA 3CP7A 1ORFA 3GCHC 4NFEA 2EC9H 3VB6A 1HIAB 1K1LA 5T6FA 1SQTA 4Y7AA 4A5TS 3DT0H 5DP4A 4IC5A 5EPYA 2WPHS 1UTJA 4JYTA 1XXDA 1OOKB 4IN2A 3T25A 1CQQA 1ELVA 5A0AE 1WTGH 1MZAA 1N1LA 2G81E 1GDUA 3AVZA 1YLCA 4JYUH 3MHWU 1FONA 1EXFA 4JZDH 2PV9B 5G4BA 2HNTC 3QUMP 3EA9A 2UUKB 1HPGA 1SGIB 4MTBA 4THNH 4A92A 3P8OA 2BD8A 4K8YA 2Z3EA 4X6MA 1KTSB 2PHBA 2XCNA 4KGAA 4SGBE 2A7CA 1J14A 1Y59T 2WPMS 4Y0ZE 4X1RU 3P95A 3M7TA 3A7ZA 2PKAB 3SW2B 4XOJA 3TK9A 1V2PT 1ABIH 1LHEH 1C2LA 3PLPA 3C27B 1NY22 2BY7X 1KTTB 5ESTE 3LGWA 3SU6A 2KAIA 3B23B 2B5TB 1J17T 4MNXA 1C9PA 1GBCA 1IAUA 4GHTA 3MOCA 3Q77A 1BITA 3ZVFA 1E35B 2BOHB 4KTCA 2DUCA 1H9HE 3GDVA 3PMJA 1HUTH 2QF0A 3KEEA 1DXPA 3VB7A 3A86A 2VVCA 2A5AA 3U1IB 2ZQ1A 1JMOH 5IDKA 5E0HA 1YPKH 3UNSA 3F9FA 1THRH 3RXKA 2ZCKP 2OXSA 2XYAA 3O8RA 2ZA5A 1XUKA 1A5GH 1GI5A 1SOZA 4UFDH 1P04A 1SGYE 4ISLA 1YF4A 3OTJE 1PJPA 1TGTA 1SSXA 5A8XA 1ZHRA 1YPHE 4UFEH 2OQUA 1GHAG 3RC4A 5J4SA 1GJDB 4DT7B 1FXYA 1TALA 2ZFQH 5EXNA 1X7AC 1QJ7B 2G00A 2FTMA 4NZLA 1DOJA 1KXAA 2OCVB 5DP9A 1HGTH 3UTUH 1OYTH 2FI4E 2RA0A 1LHCH 3RXPA 1GHBF 5H4IB 5E2PA 2ANMH 3RXVA 1LDTT 2J4IA 1C2GA 1NT1A 1E38B 3SV6A 2CF8H 3LDXH 4MNWA 3JZ2B 4TPIZ 8GCHF 4K8BA 1RTKA 1A0HB 1F0RA 1GG6C 2PUQH 4CHAB 1P05A 2VH0A 2XBWA 3Q00A 5EW2H 1S84A 1MTNC 1GBJA 1Q3XA 1Z8RA 1C5PA 4OS1A 3KHVA 1O5BB 3GCOA 3MO9A 2TPIZ 3EGKH 3E0PB 1VITH 3E3TA 2ZPRA 2EI7A 4VGCB 1P2QA 1SOTA 2FPZA 2WPLS 1G2MA 1O3BA 4U01A 1V2OT 2PW8H 1NZQH 2NU4E 1O33A 6GCHG 1QHRB 2FI5E 4A6LA 1MBQA 7KMEH 1D3DB 2TBSA 3K6YA 5E2OA 1C4Y2 4FU9A 1YKTA 1QRWA 2CGAA 1C1UH 1WV7H 4CBOA 1XUHA 3HK6B 4MDSA 3A87A 3BG8A 4AZ2B 5A2MH 3TGJE 1KSNA 1K28D 1BMMH 3ZZBA 1B7XB 4OS4A 2GD4B 1T8OA 1FY3A 5F8XA 1IQEA 1QURH 2O8TA 4FUDA 1P8VC 2ZI2H 1BTWA 4IW4E 8LPRA 4LOYH 2XW9A 1WU1A 2C90B 1BHXF 3ZZCA 1CT2E 3OY6U 3SU0A 1O2VA 2ZFFH 1FY5A 1OWDA 3RMNH 3CS0A 4KTSA 3I77A 3E1XB 2LNCA 3A8CA 3HKJB 4H6TA 2FEQH 4GHQA 1LQEA 1TNIA 2BZAA 1RJXB 1FQ3A 1F0UA 2BDAA 1OWKA 5BRRE 1GMHF 3F1SB 1AMHA 4Y76A 4ZMAH 3LKWA 2AH4X 1PQAA 1KXEA 3MH6A 2VWMA 2R9PA 2C8XB 3M7QA 1T8NA 2OD3B 1V2JT 1JWTA 1HB0B 1WYKA 4ABJA 2P3FH 4CRAA 4DIHH 1EX3A 1K22H 1UTPA 1Y3XA 3ODDA 1LMWB 2Y82A 1C5VA 2FDAA 3B8JA 5I46H 3QO6A 3GDSA 5E0JA 1VJAU 1ZMLA 4DURA 4LZ1H 2ESTE 1SR5C 3S7HB 1TPPA 1Z6EA 1IQNA 2HPPH 2XXLA 1F92A 3DA9B 2ZDAH 1P3CA 1GDNA 2BY5X 4TY6A 1SGPE 2FYRA 5FCRA 3R3GB 1SFIA 1BA8B 4AFUA 4AG2A 5JBAS 1HAZB 1EZQA 1SMFE 2CXVA 4FU8A 4ZKSU 4TWYA 3HGPA 3P8GA 2ODQA 1LVOA 5FBIA 1LVMA 1CBWB 1U6QA 5CE1A 3RUOA 2BY9X 5EODA 2FP7B 3EYDA 1O3IA 5C5NA 4X0WU 3VFEA 2PWXA 3UIRA 2AIQA 3AW0A 1V2MT 1NRPH 2BDGA 5JYIA 1AWFH 1ZMNA 4ZUHA 1CSOE 4GUXA 3QTOH 1TQ7B 1QJ6B 1QB1A 2Y5FA 4AB8A 1D4PB 3LJJA 2UUJB 3ZVDA 1SPJA 2GDDA 1ZPZA 5JPMH 1AVXA 4MVNA 2W3IA 1O36A 1MKXH 1FJSA 2PUXB 1O2XA 3BTTE 3MNXA 4AG1A 1TWXB 1GJ6A 2FS9A 4J1YA 4WMDA 1L1JA 3QZQA 4NZQA 5DP7A 2NU3E 1UTLM 1O2GH 2C3SA 2ZU4A 1SGQE 1P2KA 4Z0KA 1C1WH 1KIGH 1NFWA 3RDZA 4ISOA 1QTFA 4OGXA 1BRAA 1EATA 2VH6A 3OY5U 4X2VA 3KQCA 2CMYA 3BG4B 3DD2H 1SGEE 2TIOA 3A7XA 2TGAA 1XVMA 4Y71A 1O3DA 2STAE 2TGPZ 1DICA 2XC5A 3A82A 3HKIB 4B1TA 1Y8TA 2HNTE 5GWZA 1WTHD 1S85A 4M7GA 3QN7A 1KYNA 4IMQA 2SGEE 4PROA 1ELTA 3MH5A 1AY6H 3GY8A 1GJ9B 1ELAA 2PTNA 1ACBE 1NTPA 3GDUA 1GWAA 1Q31A 2WV5A 2HWLB 1UHBB 2OC0A 2PGQB 4XDEA 3ZZ5A 3BTGE 1TRYA 4Q7XA 3ZZ4A 1XUFA 4MPVA 3HATH 1IQKA 3LT3A 1C4U2 3RLYH 1GHZA 2M5TA 4O97A 3V7TA 1MU8B 1BJUA 2BMGB 2ZDMA 1QIXB 1DPOA 3SI4H 1RRKA 5C2ZA 1QB6A 1Z8IB 4ISIH 2HVXA 3VXEH 4FUCA 1MKWK 1ZHMA 2P94A 3NWUA 1YLDA 1VCQA 4TY7A 3RXSA 1EUFA 1J9CH 4WXIA 1TGSZ 3UR6A 1NS3A 4D7FA 2AGIX 1FPCH 2OINA 3SZNA 1BTUA 4NWKA 3VXFH 2O9QA 3N7OA 4BAOB 1P9UA 1SGNE 1JRSA 4ZH8A 2BHGA 1C5ZB 5ABWA 5A0BA 4AGJA 2ZKSA 1VITG 2BLQA 1ZZZA 2SFAA 1DM4B 1VR1H 1G30B 3AAVA 4TPYA 2EI6A 3HPTB 4Q7ZA 1GDQA 2AMPA 2A7JA 3UWJH 1GL0E 1UK2A 3RXLA 1IHTH 1K1MA 2K1QA 1O3MA 1TPAE 3F9GA 2ZPSA 1AO5A 1TNJA 4ABAA 2JETB 5DP5A 1EPTB 1UTMA 4X6PA 1J8AA 1AUTC 4XBBA 4ZHMU 5JBBS 1JOUB 2NWNA 2FLRH 3EA7A 3KNXA 3SU1A 1HAGE 4DOQA 4AN7A 3BTEE 1C5OH 3LGUA 2BD4A 4H4FA 4DIIH 1BUIA 2GV6A 5C67A 1K1IA 3UQVA 3GY2A 3MYWA 1HV7A 4JZ1A 2FO9A 4Y79A 3BTME 1ARBA 3PO1C 5JB8S 2PFEA 3LH1A 2WYGA 1SI5H 3PROA 2SGQE 1ELEE 3K9XB 1G37A 1O0DH 1S5SA 1UVUH 3E90B 1DDJA 3V3MA 2OP9A 1PQ5A 4DY7B 3BSQA 1B0EA 2FOCA 1TMUH 1O2YA 2D26C 1EJNA 3UFAA 1O3EA 1W13U 1ZSKA 3U9AH 5FPTA 1ESTA 3SQHE 5DP8A 2ANYA 1HJ9A 2GMTB 3EQ0H 3R0FA 1A2CH 1DUEA 2EEKA 2GCTC 3M5OA 5AFYH 5GIBA 3T28A 5FPSA 1RIWC 4AOQA 5B6OA 4B71A 5EXLA 3E8LA 1CHOF 3TH3H 4ABIA 1Z1JA 2P93A 3KQEA 1GJ7B 1Z7KA 1LPGB 1BJVA 4NIXA 3KIDU 3DUXH 1TBRH 3O8CA 4MPUA 3URDA 4A1XA 1ABJH 1ZPBA 1P06A 3MNSA 1N8OC 3ZV9A 6CHAB 4BTTB 4NA8A 3K65B 2ZTYA 1WSSH 3UUZA 1IQMA 2R2WU 4CH8B 1YP9A 4Z6AH 1ZTJA 1TA6A 4D8NA 3P70B 1GL1A 3RXGA 4BXSA 1D6WA 3PTBA 2FMJA 4MPXA 3PLBA 4GCHF 1GBAA 2A5IA 3UR9A 3UQOA 3A8AA 1ZRBA 1CO7E 1W2KH 1H9LB 3EA8A 2ALVA 3RXOA 3A89A 1LKAA 2F9PA 2Z9KA 1DWDH 1FY1A 2JH0D 2ZWLH 4GAWA 3RXIA 1BIOA 4DGJA 1TOCB 3UREA 5L2YH 4ZHAA 1WCZA 1LPKB 1CA0C 3F9EA 2BQWB 4X8UH 1PQ7A 3A8BA 2Y81A 1EP5A 1A0JA 2O8UA 3PMAB 4Y8ZA 5ETXA 2G4TA 3MU5A 2BTCE 3BN9A 4YLUA 3GCNA 1WBGB 4MPWA 1W11U 1GMDF 1S6HA 3AW1A 1V2KT 1GI7B 1ZLRA 1GJ5H 3OU0A 3PWCA 4U32A 3TLOA 2Z3DA 1KXDA 3RXFA 2C4FH 2PKSB 4YZUA 1HAOH 2H9HA 3D62A 2QN5T 2SGAA 3B9FH 1ELBA 4NIWA 5C3NA 3UNQA 1ARCA 4H42U 2GCHG 1NROH 1ZGVA 2QXHA 2ZFPH 2FOEA 1EAIA 3QK1A 1N6XA 3RXTA 4JZEH 4RSPA 3TH2H 2C8YB 4QT8C 3GOVB 2RA3A 3BTFE 4ASHA 3ZVCA 4ZKNU 1P2JA 3RM0H 2F83A 2OUAA 3MFJA 1TPOA 2KAIB 3RU4T 3SUFA 1Z8JB 2FOBA 2FOHA 3TJOA 2QCYA 1DLEA 1S0RA 3PLKA 1TE0A 2ZDNA 4UFGH 3S69A 3RP2A 4F4OC 2H2ZA 2Y7ZA 5AVDA 3P17H 2GZ8A 1GBEA 1NU7B 4INLA 1HAPH 1UTKA 3MU1A 3G01A 3RXMA 3TNSA 1ESAA 4IS5A 1GPZA 4I8HA 2ZP0H 5FBEA 1C5NH 1LVBA 1O2OA 1V2WT 2ODPA 3UPEA 4X8VH 1BRBE 4UFFH 1HLTH 1BZXE 2W7UA 2OC8A 1GCTC 2XBXA 1BT7A 3ATIA 2BXUH 4GPGA 5AFZH 2EI8A 4Y8YA 1O37A 1IQJA 1TRMA 5LGOA 1TB6H 3F9HA 2ZHWH 1HJAB 4IBLH 4AFZA 2P59A 3K2UA 1O5DH 1GHYH 1KLIH 1UVPA 2AGEX 1O5GH 4CHAC 2XBYA 4NA7A 4CR9A 1HRTH 3SV9A 1G2LA 2ODYB 3LGIA 5JB9S 3KL6A 1K1PA 5T6DA 1SGTA 1C2JA 5EQRA 4ZHLU 1WAYB 1HXFH 2VIVA 1FNIA 4OS2A 2A4RA 1PPGE 1TX8A 2RDLA 1J15A 1LQDB 1C1VH 1MCTA 1PFXC 2VWLA 1O2WA 4O3TA 2ZNKH 3ZVBA 1BMNH 4JK6A 1UCYK 2BVRH 4LZ4B 1N6YA 4VGCC 1AI8H 1C1PA 2B9LA 3RXJA 3GCHB 5T3HA 1DXWA 4FVBA 1DY9A 1EJMA 1GJBB 2VVUA 2QXGA 3GYLB 2ZGXH 3S0NA 1OP2A 1SFQB 4CREA 5CMXH 2BLOA 4X2XA 2BB4A 1TAWA 3Q3KA 2A31A 1TNGA 4Y0YE 4YLQH 1VGCC 1VCWA 2QAAA 3SV8A 5AHGH 1O3FA 1V2VT 3T2NA 1GHAF 1RXPA 1GI1A 2W3KA 1GJ4H 4HGCA 3ZZ7A 4ABHA 1LTOA 4ZROA 1F5KU 2BDHA 3SGAE 3SV7A 1QRZA 3FANA 5HGGA 4BNRA 1TNKA 3A8DA 2Y6TA 4D9RA 1O2UA 4FUHA 2BLVA 4WH6A 2GTBA 1TFXA 1RTFB 3OX7U 2CV3A 5DGJA 1CA8B 1GHXH 1Z6JH 2HOBA 1ZGIA 3RU4E 2D1JA 1BBRK 4BOHA 2FTLE 2QF3A 2BZ6H 4BAKB 1EKBB 2AYWA 2VGCB 4Y10E 3STJA 5A0CA 4CH2B 2BVXH 5HM2A 4BTIB 3UWIA 2BD3A 4I32A 4CBNA 2Z9GA 1YPEH 1AHTH 3SNAA 4O9VA 2FYQA 4NG9H 3A7TA 1W7GH 5K0HA 1QGFA 3RXQA 2VB0A 1WQVH 3TU7H 4B74A 4KELA 3Q76A 1MQ5A 2VVVA 3ZVAA 1FPHH 3L6PA 3A84A 3SJOA 3M37A 3FP6E 3MTYA 1MTSA 1TGNA 1K1OA 4X1PU 3M7UA 2ZCHP 4BAQB 2AS9A 1C1SA 5GCHF 2ZECA 1P09A 3H5CB 3BIVH 4NGAH 3ELAH 4GLYA
chains in the Genus database with same CATH superfamily
3ENSB 5K7RA 2HALA 1D9IA 2VU8E 1DUAA 4ABGA 3O8DA 2AMQA 2BLWA 1OYQA 3VGCB 1O3PB 2JH5D 4AORA 3FVFB 2Y5GA 2SGFE 1ZMJA 4Y8XA 2OK5A 2ZO3H 1MH0A 2XOKD 1ETRH 1TPSA 2J97A 5SGAE 1HXEH 2GKVE 2XTTB 5IK2D 2ANWA 1G36A 2P16A 5DK1A 5L6NH 1C1MA 2BQ7B 2BVSH 3WY8A 3FZZA 1SGFA 2AIPA 1C5XB 2IJOB 1FV9A 1V2UT 1RFNA 3IG6B 2Z9JA 1A4WH 1P11E 4X1QU 5HXFA 5E8EH 4TYDA 2ASUB 4NA9H 4OM9A 1C2DA 3M3VA 1O2RA 2Q6DA 2QY0B 3FP8E 2XWBI 4FOUC 2IPQX 2KR7A 4KTUA 1C5LH 1HAIH 1NPMA 3URCA 3N7DA 3QZRA 3SU2A 3BEIB 1FUJA 2GZ9A 5IYTA 2I6QA 3T62A 1FIZA 1NFUA 1SVPA 3D49H 3A81A 2FS8A 3PV2A 1W10U 1PPFE 2ZGHA 2ZTXA 3DFLA 3SU3A 2AGGX 1MTNB 1D3QB 1RD3B 1YCPH 2W7SA 1C2HA 2ZU3A 4CR5A 1CE5A 3SNEA 3L33A 4A1TA 3TJNA 3MWIU 5HMAA 1QFKH 1A3EH 1HBTH 1NFXA 3LU9B 4XE4A 1ELFA 4WJG2 3ZYDA 1Y3UA 3LGTA 1BTYA 2WINI 2FOMB 2A4QA 3BEUA 3KF2A 2C8ZB 1AFQC 2WV4A 2BDCA 4P02A 3M35A 1P03A 1YGCH 1BTPA 3BG4C 1DVAH 4Q2KA 5F6MA 2A7HA 1ZOMA 2OLGA 2BYAX 5HKKD 1NO9H 1NC6A 1GI6A 2P3UB 2YOLA 1S0QA 5GNDA 1ZJDA 1HJ8A 1EQ9A 1PYTD 2F9OA 4HG6A 4CRFA 3D23A 2H6MA 1GVZA 1C1OA 1T8MA 2JIZD 1ZTKA 2WPKS 1TGBA 2PSXA 4IMZA 2ILNA 2UWPA 1GHVH 2G4UA 2C8WB 5A09A 1GBHA 4MNYA 1L1NA 2AEIH 1NU9A 1ELCA 2TGDA 5GJ4B 1KLTA 1EB1H 1P9SA 1L0ZA 1VCPA 5DG6A 1NRSH 2HGTH 4X2YA 5CHAC 1FI8A 3BTKE 4A1VA 1ANEA 1GJ8B 2ZPQA 2V3HH 1O2JA 1BB0B 4NFFA 3QLPH 1W0JD 5C20A 1V2LT 1FLEE 1V2ST 2WV9A 1DITH 2IN2A 2WUBA 1ZHPA 4Q80A 4HZHA 3TIUA 4GVUA 1P2OA 1ZJKA 3SJ8A 2NU1E 2BD9A 1BQYA 2W6JD 4K5ZA 1KXCA 2Q6FA 1TYNA 1DT2A 1QA7A 2R0KA 1O5FH 3RMOH 7ESTE 2KZ4A 3SQEE 1JIMA 3SU4A 6LPRA 3ZZ3A 2AHME 1MKXK 1UTOA 1P2MA 3BTQE 2SGPE 5DN6D 7GCHG 4I86A 5F03A 3EDXB 1DS2E 2AFQB 3EE0B 1EJAA 2HRVA 1O38A 1OS8A 1KDQA 1T8LA 2BXTH 1YBWA 1SLWB 2JETC 1EPTC 1THSH 1GCDA 3OYPA 1YYY1 3SJ9A 3MQKC 1G3EA 3TPIZ 2A0QB 2O8MA 1V2QT 1O3JA 1O3HA 1TX7A 3RXUA 3Q3YA 1XKBC 1GBKA 3RXDA 2Q1JA 3W95A 1FAXA 5BPEA 2YMSD 3PV4A 3VB5A 2H1UA 2QYIA 3SI3H 1BHXB 2FZZA 1A61H 1TBZH 3EAJA 1AVGH 4XSKU 2G52A 3SNDA 4OS5A 1GI2A 2DE9A 1B0FA 1UTQA 1O2SA 2J38A 1ANBA 1VJ9U 1YPGH 1MTVA 1S83A 3H09A 1MD8A 1PQ8A 3WW7A 1A5HA 2XNDD 3S9CA 1NRRH 2FXRA 3BEFB 1G3BA 2STBE 3SUDA 5FX6A 3A88A 2ZTZA 1K1NA 5GXPA 4A7IB 1AIXH 3TK5A 4TWWA 1O31A 1OHHD 3OSYA 1K21H 1H8ED 1XUJA 4Y7BA 1TMBH 3RM2H 1IQLA 1NRNH 4D76A 1ETSH 4XRNA 3RXHA 1AD8H 2F9UA 1ZRKA 1DANH 1VITF 4X6NA 4DW2U 4INKA 4I8JA 2WZQA 1BRUP 2JJ2D 2F3CE 3M5NA 3KGPA 4E7RG 1DFPA 1ETTH 3SJKA 1C5RA 3AASA 4CRDA 1HAVA 1NBME 3RC5A 3ATMA 2FLBH 1YCPM 3U69H 1OWJA 4J2YB 1IHSH 1ZSLA 3RXAA 3PRDA 2XC0A 1O5AB 4JK5A 2VIQA 5EXMA 1PPHE 1UMAH 1O2MA 1OP8A 2QXIA 1T32A 1GGDB 3GCTF 2Y5HA 3TGKE 1VZQH 1T31A 5DP6A 3F0PA 3SGBE 1O39A 4BXWA 2A1DB 4YM9A 1D6RA 1SL3A 3NKKA 2Y7XA 3E16B 1IQIA 1FZZA 1SLUB 2BOKA 1SBWA 2IJD1 2PR3A 1QBVH 2GX4A 1L2EA 4B2BA 4DCDA 2WHXA 2P3TB 2TRMA 4NIYA 1JRTA 1QRXA 1O2LA 2PSYA 1OXGA 2PKSC 1GMCG 1ANCA 4YOJA 2ZF0H 4Z1MD 2BDBA 1RS0A 1UVTH 2R3UA 1YY3A 3FZDA 1CHOG 1C5QA 3OEHD 2V35A 3H7TA 1GBBA 1EPTA 1C2KA 3LH3A 5EQSA 4YT7H 4RN6A 3AK5A 4BAMB 1ELDE 4R0IA 2OTVA 4RKOB 2WPIS 3PMBB 1TX6A 2BY6X 1LKBA 1K2I1 1M9UA 1TABE 3T27A 4D9QA 1Y5BT 1UO6A 2CJIA 1YM0A 1TRNA 3ZZDA 3KCGH 5GPIB 2XC4A 5C94A 1H8IH 8KME2 2GP9B 1DLKB 3V12A 4ESTE 4XBDA 4ABEA 2CHAB 2KCYA 1G32B 5LPEA 1DSTA 2ZHFH 3P92A 2GV7A 2ZDKA 5JDUB 3SNCA 5T6GA 2OBQA 1O2NA 4E05H 2FIRH 1CT0E 1P01A 2Z9IA 1C1TA 1J16A 3NRLA 1F0TA 1O32A 1EAUA 2W6ID 3M3TA 4CRBA 3ITIA 1AU8A 3O8BA 3PO1B 3ESTA 2NU2E 1HJAC 2QF5A 4B2AA 4ZXXH 3QDZB 3FFGA 1YLNA 1DWBH 1A5IA 2ZFTA 3PWBA 3ATWA 1RTLA 1A7SA 3FAOA 2VIWA 1C1NA 2GCTB 2B7DH 2BX4A 1PPZA 2V7QD 1A1RA 1O34A 1HCGA 4YT6H 1CVWH 1WQSA 2GJGA 2GCHF 2J9NA 2P8OB 2OC7A 2OC1A 3P8FA 3M61U 1ZPCA 2ANKH 1AB9B 1IQFA 2Q6GA 3MNCA 4H6SB 2IPHA 1MD7A 3DHKH 3QX5H 1AN1E 1QBOA 3VPKA 4B6FA 5DKMA 5EJLA 1N8OB 1C1QA 3LOXA 2LPRA 3N7EA 4ZKOU 1YPJH 5EW1H 1DWEH 4I33A 2ZFSA 1KY9A 2ZC9H 1AKSA 2Z6BD 4FXGH 4R8TB 2RCEA 1LCYA 3ATKA 1E36B 1MMJN 3U98H 1PPEE 1SB1H 1CGJE 3NUMA 4I31A 1BMAA 4X8SH 1MCVA 4K3JA 1QNJA 3SV2H 1HFDA 2G51A 2C93B 3SUEA 1UW7A 5FX5A 3PYHA 4ABBA 1CA0B 1JBUH 2HPQH 4I7YH 1C4V2 4HI3A 1O30A 5DJ7A 1O3CA 3DFJA 3M36A 1CU1A 1HIAA 1BTXA 4OS7A 5LH8A 2YNAA 1NESE 2VGCC 5EJ1A 1E79D 1SGRE 1GBFA 1EOLA 1UJ1A 1ANDA 4SGAE 1E34B 1K1JA 1DY8A 1LHFH 3GYMA 1SLXB 1GBDA 3NXPA 1UCYH 5DPAA 4NWLA 1MZDA 1H4WA 1O2IA 2ZDVH 4OS6A 1Z8GA 1O5EH 2V0BA 2VNTA 1NM6A 3ZV8A 2O8WA 3BTHE 3GY7A 4AFQA 2OBOA 5F8ZA 1S81A 2CN0H 1Y3WA 3NPSA 5L30H 2VJ1A 2ZQ2A 2J95A 3MNBA 8ESTE 3L3TA 1K9OE 1W3CA 2VIDA 1XVOA 2PKAA 1A46H 3KQDA 2KM0A 2GZ7A 2BM2A 2UWOA 3PM3A 1YC0A 5A8ZA 1D3TB 1KXBA 3RMMH 3VGCC 5TCAA 1AE5A 4NCYA 1H8DH 3KQ5A 4FUFA 2IOTA 4MQAA 2QXJA 5C1XA 2D2DA 2G5VA 2ALPA 2R2MB 1DX5M 4AGKA 3MI4A 2UWLA 1QZ8A 5C5OA 4JZIA 1NRQH 4I8KA 5ESBA 2TGTA 2HLCA 3U8OH 1TOMH 1BBRH 3BTWE 5EGMA 4YOGA 3JZ1B 1GHBG 4K1EA 1V2TT 3STIA 3K6ZA 3MH4A 1GCTB 5E0GA 2BDYA 1LVYA 1HYLA 1L4ZA 4CRGA 3SHCH 8GCHG 3UOPA 2WUCA 3GY4A 3MH7A 1HAYB 3SU5A 4OGYA 1TNHA 2SNVA 1UCYE 6ESTA 3W94A 2EA3A 1DSUA 1SGCA 4E7NA 1QB9A 1OP0A 1SHHB 1W12U 2M2AA 3TNTA 1C5TA 1TONA 1XKAC 4WVPE 2G55A 1L1GA 3TJUA 3E6PH 1QA0A 1SGDE 1UK4A 4MNVA 4XBCA 1QY6A 3ZZ8A 1OWIA 5EU8A 3LIWA 1EZSC 1ESBA 1PYTC 3RXCA 2FODA 6GCHF 1HAXB 1EAWA 5GDSH 4WWYA 4U2WA 4JCNA 1G3CA 1ID5H 1TGCA 1Y3VA 5AF9H 1BMLA 1C5MD 1PPBH 3KYGA 3A83A 3KN2A 5GCHG 4WH8A 2YNBA 3SORA 4YOIA 1C2MA 1MBMA 1YPMH 2ZFRH 3SYJA 2V3MA 3BIUH 4HTCH 4MLFB 2THFB 1XM1A 3EE7A 1SHYA 4ZKRU 1QL7A 3SUGA 1KLJH 1ZTLA 1VGCB 2I6SA 3P6ZB 1MQ6A 2B8OH 1W0KD 1T4UH 1THPB 2SGDE 1BBRE 4BTUB 1TIOA 2CF9H 4I8GA 5JBCS 1CBWC 2L74A 3ZVEA 3VB4A 1H9IE 1EZUC 1QR3E 4IGDA 4FUEA 5C0UA 1AZ8A 4WF8A 2VWOA 1BTHH 1OWEA 5LPRA 1C5WB 1C9TA 7LPRA 1V2NT 1E37B 3V0XA 1GBLA 4ABFA 2F9VA 5F8TA 1GG6B 4HFPB 1T7CA 1P2NA 4KP0A 9ESTA 4I8LA 3SGQE 1W7XH 2KCOA 1F7ZA 1MTWA 3PB1E 1GI4A 2XCFA 1EZXC 3LJOA 1P2IA 2VIOA 1GBTA 1INCA 4FUBA 1W8BH 3M5MA 3ODFA 4ISNA 4X1NU 3TH4H 3MMGA 5L2ZH 1GMHG 2LELA 1BOQA 1FN8A 1W14U 2BD2A 1SLVB 1ELGA 2DE8A 1GJAB 2H5CA 4WMFA 2PLXA 1EAXA 1ZYOA 2BD5A 2FX6A 2ZZUH 1GBIA 4JZFH 2YMSC 4YO9A 1YCPK 4BANB 2UUFB 2Z7FE 2PTCE 2JH6D 5LPFA 3UNRA 3NZIA 1B5GH 2FOFA 2WYJA 1BMFD 1EP6A 3RMLH 4INHA 2A32A 1HDTH 1LPZB 2SNWA 1NFYA 1FN6A 1O2TA 2GGVB 2G8TA 5C0TA 2QIQA 2ZG0H 3NK8A 4K1TA 3S9AA 1O3LA 2P95A 4B73A 5JBTA 2ZDLA 2ZGJA 1F0SA 3KQBA 4WY3A 2FWWA 4LK4A 2H5DA 4LXBH 1TMTH 1KXFA 2G5NA 1BTZA 3GY5A 1OX1A 1JXPA 1LHDH 3A7VA 4AFSA 1KDQB 1O3AA 1F5LA 3BV9B 1F2SE 3IWMA 2BD7A 2Y80A 3E91A 4K60A 4UD9H 1UVSH 4Q7YA 1WOFA 2ZGCA 4UE7H 3SO3A 2J2UA 2QC2A 5C17A 1GI8B 4FETA 5EOKA 1FY8E 5TCCA 3BTDE 1CHGA 3QGJA 1C2FA 1OWHA 4GSOA 1D3PB 2H9EH 4TSFD 1O3NA 1MUEB 1AGJA 2VIPA 3PRBA 3ZIAD 3QWCH 3A80A 3TITA 4ZCNA 1HAHH 2AERH 2B0FA 3F2FA 1O35A 3T26A 5I25A 1WUNH 2R0LA 4KKDA 3F2GA 2J34A 3LONA 3SOSA 4O03A 1P0SH 1O3OA 1AVWA 4AYYB 2VINA 3VEQB 1GVLA 2ZCLP 4E06H 1QCPA 7GCHF 1AFQB 3RXBA 1W0ZU 3PMHB 4B75A 5C1UA 1G3DA 1O2PA 1GJCB 1XX9A 1JIRA 3HGNA 2BY8X 3TK6A 3SNBA 4UEHH 1OPHB 2JJ1D 1YPHC 1RGQA 3BF6H 4K69A 2Z9LA 1O3KA 3MU0A 2FM2A 1V2RT 3SHAH 1P02A 1SKYE 2VWNA 4ABDA 4Y11E 1SC8U 3U1JB 1GGDC 1C5SA 4P00A 3CS7A 1Z71A 3P8NA 1Y5UT 3ZZ9A 1Y5AT 1GVKB 1H1BA 2A4OA 3C1KA 3ZZAA 4BAHB 5C1YA 1MKWH 5PTPA 2ZU1A 1NN6A 4AX9H 1PPCE 2XBVA 3SN8A 1HAVB 2FOGA 1YPLH 1QQ4A 3GY3A 2GMTC 1MAYA 2F43B 1AWHB 3A85A 1GHWH 1Z1IA 3U28C 2BX3A 1P12E 2ULLA 5CHAB 2ZHEH 2RG3A 2J92A 1EOJA 2WPJS 3LGYA 4AC9A 1SG8B 5FHTA 3F6UH 2FESH 3MU8A 1MU6B 9LPRA 1AFEH 1MAXA 1XXFA 3U8TH 3ZZ6A 1TQ0B 2AMDA 2GVFA 1SQOA 5A8YA 1A0LA 4ZXYH 2ZU2A 6CHAC 2FOAA 3ZYEA 2L6OA 5T1VA 1O2QA 2QGRA 5HM9A 4UDWH 3ZVGA 3TGIE 4DG4A 3S9BA 4JMYA 1O3GA 1O5CB 4X1SU 1UHBA 1A3BH 1AE8H 2FI3E 5HYOA 3F68H 4B76A 1FY4A 4XD7D 2FX4A 2GT8A 4CRCA 2XWAA 3T29A 1BRCE 2A2QH 1FMGA 4FUIA 1AZZA 3OEED 3A7WA 4YTAA 1WXRA 3D65E 5EPNA 4XFQA 4WXVA 1QL9A 4IN1A 1LO6A 4FUJA 2GT7A 1GI3A 2PGBB 2O8LA 4Y6DA 5DP3A 1F5RA 3UOUA 2A5KA 1P10A 2CHAC 1P3EA 1G9IE 4ZAEA 2V6NA 1P57B 3NCLA 5TJXA 1E0FD 1CT4E 2OQ5A 3VB3A 3SBKA 1UK3A 3GCTG 3FP7E 1AUJA 1SQAA 2J94A 3LC5A 2H9TH 3QTVH 3RXEA 3H7OA 1GBMA 1ZSJA 2Z3CA 1FIWA 2CK3D 4Q63A 1EB2A 1UTNA 3E0NB 4YESB 2V3OH 2W5EA 2GDEH 2Z94A 1FAKH 1ZR0A 3RC6A 2ZHDA 4JYVH 3LPRA 5EQQA 5FCKA 1IQHA 1DE7H 1GMCF 1COWD 2F91A 1CGIE 3F0OA 1OSSA 3UY9A 1DWCH 1W0YH 1YWUA 3I29A 3MO3A 2D8WA 2P8OC 3IITA 5FXLA 1O2ZA 3M3SA 2BQ6B 1AB9C 1LHGH 3GS9A 1MTUA 3MU4A 2F9NA 3RU4D 5FAHA 3Q3XA 2J98A 1FDPA 2R3YA 5EG4A 4NSVA 4RT0A 5EJZA 3TJVA 1T4VH 2ZIQH 1GI0A 3TVJB 2F9BH 2A45B 3LC3A 5EIYA 5DO4H 5J4QA 4O3UA 3CENA 4DJZB 3RXRA 3S7KB 1L4DA 4GCHG 3SJIA 2NU0E 4NSYA 1QJ1B 3PTNA 1IOEA 1Q2WA 4DVAU 3MO6A 2XRCA 3AAUA 1BDAA 3DCLA 2W26A 1BCUH 4UONA 2QV1A 4IC6A 2HNTF 4FUGA 5KEDA 3M5LA 1QBNA 3HK3B 2BDIA 4X8TH 3T5FH 4K2YA 4AB9A 4FU7A 1V3XA 4Q4LA 1C2IA 1QL8A 2ZEBA 3LGVA 1TNLA 3W1EA 2ZU5A 1S6FA 1K0HA 1S82A 1XMNB 4K1SA 4B2CA 1V6DA 1XUGA 2UUYA 4MG3A 3QGNB 1GMDG 1TA2A 4FVDA 1AKSB 3GISB 3ATLA 1EASA 2ZGBH 4AYVB 1C2EA 1XUIA 1TLDA 4NIVA 2XNIA 1O2KA 1C5YB 1HNEE 4X6OA 2ZHQH 1UVOA 2HVYB 4RKJB 1RIWB 3GICB 3I78A 1Y3YA 4U30A 4D7GA 1AQ7A 1IQGA 3V13A 1C1RA 4ISHH 5FPYA 2A2XH 2A4GA 2QA9E 1SGFG 3U8RH 1GI9B 1QQUA 1OKXA 3RLWH 4X2WA 4ACAA 1O2HA 2JKHA 4F49A 2KX4A 1CGHA 3GY6A 4WMEA 1TBQH 1C5UA 3A7YA 3CP7A 1ORFA 3GCHC 4NFEA 2EC9H 3VB6A 1H8HD 1HIAB 1K1LA 5T6FA 1SQTA 4Y7AA 4A5TS 3DT0H 5DP4A 4IC5A 5EPYA 3F2HA 2WPHS 1UTJA 4JYTA 1XXDA 1OOKB 4IN2A 3T25A 1CQQA 1ELVA 2QE7D 5A0AE 1WTGH 1MZAA 1N1LA 2G81E 1GDUA 3AVZA 1YLCA 4JYUH 3MHWU 1FONA 1EXFA 4JZDH 2PV9B 5G4BA 2HNTC 3QUMP 3EA9A 2UUKB 1HPGA 1SGIB 4MTBA 4THNH 2WSSD 4A92A 3P8OA 3UB0A 2BD8A 4K8YA 2Z3EA 3DSPA 4X6MA 1KTSB 2PHBA 2XCNA 4KGAA 4SGBE 2A7CA 1J14A 4RI0A 1Y59T 2WPMS 4Y0ZE 4X1RU 3P95A 3M7TA 3A7ZA 2PKAB 3SW2B 4XOJA 3TK9A 1V2PT 1ABIH 1LHEH 1C2LA 3PLPA 3C27B 1NY22 2BY7X 1KTTB 5ESTE 3LGWA 3SU6A 2KAIA 3B23B 2B5TB 1J17T 4MNXA 1C9PA 3OE7D 2HLDD 1GBCA 1IAUA 4GHTA 3MOCA 3Q77A 1BITA 3ZVFA 1E35B 2BOHB 4KTCA 2DUCA 1H9HE 3GDVA 3PMJA 1HUTH 2QF0A 3KEEA 1DXPA 3VB7A 3A86A 2VVCA 2A5AA 1WDIA 3U1IB 2ZQ1A 1JMOH 5IDKA 5E0HA 1YPKH 3UNSA 3F9FA 1THRH 3UAIC 3RXKA 2ZCKP 2OXSA 2XYAA 3O8RA 2ZA5A 1XUKA 1A5GH 1GI5A 1SOZA 4UFDH 1P04A 1SGYE 4ISLA 1YF4A 3OTJE 1PJPA 1TGTA 1SSXA 5A8XA 1ZHRA 1YPHE 4UFEH 2OQUA 1GHAG 3RC4A 5J4SA 1GJDB 4DT7B 1FXYA 1TALA 2ZFQH 5EXNA 5HIYA 1X7AC 1QJ7B 2G00A 2FTMA 4NZLA 1DOJA 1KXAA 2OCVB 5DP9A 1HGTH 3UTUH 1OYTH 2FI4E 2RA0A 1LHCH 3RXPA 1GHBF 5H4IB 5E2PA 2ANMH 3RXVA 1LDTT 2J4IA 1C2GA 1NT1A 1E38B 3SV6A 2CF8H 3LDXH 4MNWA 3JZ2B 4TPIZ 8GCHF 4K8BA 1RTKA 1A0HB 1F0RA 1GG6C 2PUQH 4CHAB 1P05A 2VH0A 2XBWA 3Q00A 5EW2H 1S84A 1MTNC 1GBJA 1Q3XA 1Z8RA 1C5PA 4OS1A 3KHVA 1O5BB 3GCOA 3MO9A 2J5UA 2TPIZ 3EGKH 3E0PB 1VITH 3E3TA 2ZPRA 2EI7A 4VGCB 1P2QA 1SOTA 2FPZA 2WPLS 1G2MA 1O3BA 2KCPA 4U01A 1V2OT 2PW8H 1NZQH 2NU4E 1O33A 6GCHG 1QHRB 2FI5E 4A6LA 1MBQA 7KMEH 1D3DB 2TBSA 3K6YA 5E2OA 1C4Y2 4FU9A 1YKTA 1QRWA 2CGAA 1C1UH 1WV7H 4CBOA 1XUHA 3HK6B 4MDSA 3A87A 3BG8A 4AZ2B 5A2MH 3TGJE 1KSNA 1K28D 5CHBA 1BMMH 3ZZBA 1B7XB 4OS4A 2GD4B 1T8OA 1FY3A 5F8XA 3VG8A 1IQEA 1QURH 2O8TA 4FUDA 1P8VC 2ZI2H 1BTWA 4IW4E 8LPRA 4LOYH 1NBMD 2XW9A 1WU1A 2C90B 1BHXF 3ZZCA 1CT2E 3OY6U 3SU0A 1O2VA 2ZFFH 1FY5A 1OWDA 3RMNH 3CS0A 4KTSA 3I77A 3E1XB 1SQRA 2LNCA 3A8CA 3HKJB 4H6TA 2FEQH 4GHQA 1LQEA 1TNIA 2BZAA 1RJXB 1FQ3A 1F0UA 2BDAA 1OWKA 5BRRE 1GMHF 3F1SB 1AMHA 4Y76A 4ZMAH 3LKWA 2AH4X 1PQAA 1KXEA 3MH6A 2VWMA 2R9PA 2C8XB 3M7QA 1T8NA 2OD3B 1V2JT 1JWTA 1HB0B 1WYKA 4ABJA 2P3FH 5KGOA 4RT1A 4CRAA 4DIHH 1EX3A 1K22H 1UTPA 1Y3XA 3ODDA 1LMWB 2Y82A 1C5VA 2FDAA 3B8JA 5I46H 3QO6A 3GDSA 5E0JA 1VJAU 1ZMLA 4DURA 4LZ1H 2ESTE 1SR5C 3S7HB 1TPPA 1Z6EA 1IQNA 2HPPH 2XXLA 1F92A 3DA9B 2ZDAH 1P3CA 1GDNA 2BY5X 4TY6A 1SGPE 2FYRA 5FCRA 3R3GB 1SFIA 1BA8B 4AFUA 4AG2A 5HIZA 1HAZB 5JBAS 1EZQA 1SMFE 3FN8A 2CXVA 4FU8A 4ZKSU 4TWYA 3HGPA 3P8GA 2ODQA 1LVOA 5FBIA 1LVMA 1CBWB 1U6QA 5CE1A 3RUOA 2BY9X 5EODA 2FP7B 3EYDA 5KECA 1O3IA 5C5NA 4X0WU 3VFEA 2PWXA 3OFND 3DSGA 3UIRA 2AIQA 3AW0A 1V2MT 1NRPH 2BDGA 5JYIA 1AWFH 1ZMNA 4ZUHA 4YXWD 1CSOE 4GUXA 3QTOH 1TQ7B 1QJ6B 1QB1A 2Y5FA 4AB8A 1D4PB 3LJJA 2UUJB 3ZVDA 1SPJA 2GDDA 1ZPZA 3KYFA 5JPMH 1AVXA 4MVNA 3OAAD 2W3IA 1O36A 1MKXH 1FJSA 2PUXB 1O2XA 3BTTE 3MNXA 4AG1A 1TWXB 1GJ6A 1MABB 2FS9A 4J1YA 4WMDA 1L1JA 3QZQA 4NZQA 5DP7A 2NU3E 1UTLM 1O2GH 2C3SA 2ZU4A 1SGQE 1P2KA 4Z0KA 1C1WH 1KIGH 1NFWA 3RDZA 4ISOA 5CDFE 1QTFA 4OGXA 1BRAA 1EATA 2VH6A 3OY5U 5DSFA 4X2VA 3KQCA 2CMYA 3BG4B 3DD2H 1SGEE 2YMSB 2TIOA 3A7XA 2TGAA 1XVMA 3FKSD 4Y71A 1O3DA 2STAE 2TGPZ 1DICA 2XC5A 3A82A 3HKIB 4B1TA 1Y8TA 2HNTE 5GWZA 1WTHD 1S85A 4M7GA 3QN7A 1KYNA 4IMQA 2SGEE 4PROA 1ELTA 3MH5A 1AY6H 5B6LA 3GY8A 1GJ9B 1ELAA 2PTNA 1ACBE 1NTPA 3GDUA 1GWAA 1Q31A 3FOAA 2WV5A 2HWLB 1UHBB 2OC0A 2PGQB 4XDEA 3ZZ5A 3BTGE 1TRYA 4Q7XA 3ZZ4A 1XUFA 4MPVA 3HATH 1IQKA 4ASUD 2VBCA 3LT3A 1C4U2 3RLYH 1GHZA 2M5TA 4O97A 3V7TA 1MU8B 2QF4A 1BJUA 2BMGB 2ZDMA 1QIXB 1DPOA 3SI4H 1RRKA 5C2ZA 1QB6A 1Z8IB 4ISIH 2HVXA 3VXEH 4FUCA 1MKWK 1ZHMA 2P94A 3NWUA 1YLDA 1VCQA 4TY7A 3RXSA 1EUFA 1J9CH 4WXIA 1TGSZ 3UR6A 1NS3A 4D7FA 2AGIX 1FPCH 2OINA 3SZNA 1BTUA 4NWKA 3VXFH 2O9QA 3N7OA 4BAOB 1P9UA 4M9FA 3OTPA 1SGNE 1JRSA 4ZH8A 2BHGA 1C5ZB 5ABWA 5A0BA 4AGJA 2ZKSA 1VITG 2BLQA 1ZZZA 2SFAA 1DM4B 1VR1H 1G30B 3AAVA 4TPYA 2EI6A 3HPTB 4Q7ZA 1GDQA 2AMPA 2A7JA 3UWJH 1GL0E 1UK2A 3RXLA 1IHTH 1K1MA 2K1QA 1O3MA 1TPAE 3F9GA 2ZPSA 1AO5A 1TNJA 4ABAA 2JETB 5DP5A 1EPTB 1UTMA 3FO8D 1J8AA 4X6PA 1AUTC 4XBBA 4ZHMU 5JBBS 1JOUB 2NWNA 2FLRH 3EA7A 3KNXA 1VKYA 1HAGE 3SU1A 4DOQA 4AN7A 3BTEE 1C5OH 3LGUA 2BD4A 4H4FA 4DIIH 1BUIA 2GV6A 5C67A 2J98B 1K1IA 3UQVA 3GY2A 3MYWA 1HV7A 4JZ1A 2FO9A 4Y79A 3BTME 1ARBA 3PO1C 5JB8S 2PFEA 3LH1A 2WYGA 2JDID 4F55A 1SI5H 3PROA 2SGQE 1ELEE 3K9XB 1G37A 1O0DH 1S5SA 1UVUH 3E90B 1DDJA 3V3MA 2OP9A 1PQ5A 4DY7B 3BSQA 1B0EA 2FOCA 1TMUH 1O2YA 2D26C 1EJNA 3UFAA 1O3EA 1W13U 1ZSKA 3U9AH 5FPTA 1ESTA 3SQHE 5DP8A 2ANYA 1HJ9A 2GMTB 3EQ0H 3R0FA 1A2CH 1DUEA 2EEKA 2GCTC 3M5OA 5AFYH 5GIBA 3T28A 5FPSA 1RIWC 4AOQA 2RDEA 4B71A 5B6OA 5EXLA 3E8LA 1CHOF 3TH3H 4ABIA 1Z1JA 2P93A 3KQEA 1GJ7B 1Z7KA 1LPGB 1BJVA 4NIXA 3KIDU 3DUXH 1TBRH 3O8CA 4MPUA 3URDA 4A1XA 1ABJH 1ZPBA 1P06A 3MNSA 1N8OC 2KCAA 3ZV9A 6CHAB 4BTTB 4NA8A 3K65B 2ZTYA 1WSSH 2F4LA 3UUZA 1IQMA 2R2WU 4TT3D 4CH8B 1YP9A 4Z6AH 1ZTJA 1TA6A 4D8NA 3P70B 1GL1A 3WWFA 3RXGA 4BXSA 2EY4C 1D6WA 1FX0B 3PTBA 2FMJA 4MPXA 3PLBA 4GCHF 1GBAA 2A5IA 3UR9A 3UQOA 3A8AA 1ZRBA 1CO7E 1W2KH 1H9LB 3EA8A 2ALVA 3RXOA 3A89A 1LKAA 2F9PA 2Z9KA 1DWDH 2RFKC 1FY1A 2JH0D 2ZWLH 4GAWA 3RXIA 1BIOA 4DGJA 1TOCB 3UREA 5L2YH 4ZHAA 1WCZA 1LPKB 1CA0C 3F9EA 2BQWB 4X8UH 1E1RD 1PQ7A 3A8BA 2Y81A 1EP5A 1A0JA 2O8UA 3PMAB 4Y8ZA 5ETXA 2G4TA 3MU5A 2BTCE 3BN9A 4YLUA 3GCNA 1WBGB 4MPWA 2LP6A 1W11U 1GMDF 1S6HA 3AW1A 1V2KT 1GI7B 1ZLRA 1GJ5H 3OU0A 3PWCA 4U32A 3TLOA 2Z3DA 1KXDA 3RXFA 2C4FH 2PKSB 4YZUA 1HAOH 2H9HA 3D62A 2QN5T 2SGAA 3B9FH 1ELBA 4NIWA 2K8IA 5C3NA 3UNQA 1ARCA 2PP6A 4H42U 2GCHG 1NROH 1ZGVA 2QXHA 2ZFPH 2FOEA 1EAIA 3QK1A 1N6XA 3RXTA 4JZEH 4RSPA 3TH2H 2EQNA 1S6LA 2C8YB 3DSOA 4QT8C 2WPDD 2RA3A 3GOVB 3BTFE 4ASHA 3ZVCA 4ZKNU 1P2JA 3RM0H 2F83A 2OUAA 3MFJA 1TPOA 2KAIB 3RU4T 3SUFA 1Z8JB 2FOBA 2FOHA 3TJOA 2QCYA 1DLEA 1S0RA 3PLKA 1TE0A 2ZDNA 4UFGH 3S69A 3RP2A 4F4OC 2KFWA 2H2ZA 2Y7ZA 5AVDA 3P17H 2GZ8A 1GBEA 4F48B 1NU7B 4INLA 1HAPH 1UTKA 3MU1A 3G01A 3RXMA 3TNSA 1ESAA 4IS5A 1GPZA 4I8HA 2ZP0H 5FBEA 1C5NH 1LVBA 1O2OA 1V2WT 2ODPA 3UPEA 4X8VH 1BRBE 4UFFH 1HLTH 1BZXE 1EFRD 2W7UA 2OC8A 1GCTC 2XBXA 1BT7A 3ATIA 2BXUH 4GPGA 5AFZH 2EI8A 4Y8YA 1O37A 1IQJA 1TRMA 5LGOA 1TB6H 3F9HA 2ZHWH 1HJAB 4IBLH 4AFZA 2P59A 3K2UA 1O5DH 5F53A 1GHYH 1KLIH 1UVPA 3F3BA 2AGEX 1O5GH 4CHAC 2XBYA 4NA7A 4CR9A 1HRTH 3WWBA 3SV9A 1G2LA 2ODYB 3LGIA 5JB9S 3KL6A 1K1PA 5T6DA 1SGTA 1C2JA 5EQRA 4ZHLU 1WAYB 1HXFH 2VIVA 5FL7D 1FNIA 4OS2A 2A4RA 1PPGE 1TX8A 2RDLA 1J15A 1LQDB 1C1VH 1MCTA 1PFXC 2VWLA 1O2WA 4O3TA 2ZNKH 3ZVBA 1BMNH 4JK6A 1UCYK 2BVRH 4LZ4B 1N6YA 4VGCC 1AI8H 1C1PA 2B9LA 3RXJA 3GCHB 5T3HA 1DXWA 4FVBA 3SZEA 1DY9A 1EJMA 1GJBB 2VVUA 2QXGA 3GYLB 2ZGXH 3S0NA 1OP2A 1SFQB 1E1QD 4CREA 5CMXH 2BLOA 4X2XA 2BB4A 1TAWA 3Q3KA 2A31A 1TNGA 4Y0YE 4YLQH 1VGCC 1VCWA 2QAAA 3SV8A 5AHGH 1O3FA 1V2VT 3T2NA 1GHAF 1RXPA 1GI1A 2W3KA 4DT4A 1GJ4H 4HGCA 3ZZ7A 4ABHA 1LTOA 4ZROA 1F5KU 2BDHA 3SGAE 3SV7A 1QRZA 3FANA 5HGGA 4BNRA 1TNKA 4ACBA 3A8DA 2Y6TA 3N99A 1O2UA 4D9RA 4B6EA 4FUHA 2BLVA 4WH6A 2GTBA 1TFXA 1RTFB 3OX7U 2CV3A 5DGJA 1CA8B 1GHXH 1Z6JH 2HOBA 1ZGIA 3RU4E 2D1JA 1BBRK 4BOHA 2FTLE 2QF3A 2BZ6H 4BAKB 1EKBB 2AYWA 2VGCB 4Y10E 3STJA 5A0CA 4CH2B 2BVXH 5HM2A 4BTIB 3UWIA 2BD3A 4I32A 4CBNA 2Z9GA 1YPEH 1AHTH 3PV5A 3SNAA 4O9VA 2K0QA 1KMHB 2FYQA 4NG9H 3A7TA 1W7GH 5K0HA 1QGFA 3RXQA 2VB0A 1WQVH 3TU7H 4B74A 4KELA 3Q76A 1MQ5A 2VVVA 3ZVAA 1FPHH 3L6PA 3A84A 3SJOA 3M37A 3FP6E 3MTYA 1MTSA 1TGNA 1K1OA 4X1PU 3M7UA 2ZCHP 4BAQB 3CNRA 2AS9A 1C1SA 5GCHF 2ZECA 1P09A 3H5CB 3BIVH 4NGAH 3ELAH 4GLYA
chains in the Genus database with same CATH topology
3ENSB 5K7RA 2HALA 1D9IA 2VU8E 1DUAA 4ABGA 3O8DA 2AMQA 2BLWA 1OYQA 3VGCB 1O3PB 2JH5D 4AORA 3FVFB 2Y5GA 2SGFE 1ZMJA 4Y8XA 2ZO3H 1MH0A 1ETRH 1TPSA 5SGAE 1HXEH 2GKVE 2XTTB 2ANWA 1G36A 2P16A 5DK1A 5L6NH 1C1MA 2BQ7B 2BVSH 3WY8A 3FZZA 1SGFA 2AIPA 1C5XB 2IJOB 1FV9A 1V2UT 1RFNA 3IG6B 2Z9JA 1A4WH 1P11E 4X1QU 5HXFA 5E8EH 4TYDA 2ASUB 4NA9H 1C2DA 3M3VA 1O2RA 2Q6DA 2QY0B 3FP8E 2XWBI 4KTUA 1C5LH 1HAIH 1NPMA 3URCA 3QZRA 3SU2A 3BEIB 1FUJA 2GZ9A 5IYTA 2I6QA 3T62A 1FIZA 1NFUA 1SVPA 3D49H 3A81A 2FS8A 1W10U 1PPFE 2ZGHA 2ZTXA 3DFLA 3SU3A 2AGGX 1MTNB 1D3QB 1RD3B 1YCPH 2W7SA 1C2HA 2ZU3A 4CR5A 1CE5A 3SNEA 3L33A 4A1TA 3TJNA 3MWIU 5HMAA 1QFKH 1A3EH 1HBTH 1NFXA 3LU9B 4XE4A 1ELFA 4WJG2 3ZYDA 1Y3UA 3LGTA 1BTYA 2WINI 2FOMB 2A4QA 3BEUA 3KF2A 2C8ZB 1AFQC 2WV4A 2BDCA 3M35A 1P03A 1YGCH 1BTPA 3BG4C 1DVAH 4Q2KA 5F6MA 2A7HA 1ZOMA 2OLGA 2BYAX 1NO9H 1NC6A 1GI6A 2P3UB 2YOLA 1S0QA 1ZJDA 1HJ8A 1EQ9A 1PYTD 2F9OA 4CRFA 3D23A 2H6MA 1GVZA 1C1OA 1T8MA 1ZTKA 2WPKS 1TGBA 2PSXA 4IMZA 2ILNA 2UWPA 1GHVH 2G4UA 2C8WB 5A09A 1GBHA 4MNYA 1L1NA 2AEIH 1NU9A 1ELCA 2TGDA 5GJ4B 1KLTA 1EB1H 1P9SA 1L0ZA 1VCPA 5DG6A 1NRSH 2HGTH 4X2YA 5CHAC 1FI8A 3BTKE 4A1VA 1ANEA 1GJ8B 2ZPQA 2V3HH 1O2JA 1BB0B 4NFFA 3QLPH 5C20A 1V2LT 1FLEE 1V2ST 1DITH 2IN2A 2WUBA 1ZHPA 4Q80A 4HZHA 3TIUA 4GVUA 1P2OA 1ZJKA 3SJ8A 2NU1E 2BD9A 1BQYA 4K5ZA 1KXCA 2Q6FA 1TYNA 1DT2A 1QA7A 2R0KA 1O5FH 3RMOH 7ESTE 3SQEE 1JIMA 3SU4A 6LPRA 3ZZ3A 1MKXK 1UTOA 1P2MA 3BTQE 2SGPE 7GCHG 5F03A 3EDXB 1DS2E 2AFQB 3EE0B 1EJAA 2HRVA 1O38A 1OS8A 1KDQA 1T8LA 2BXTH 1YBWA 1SLWB 2JETC 1EPTC 1THSH 1GCDA 3OYPA 1YYY1 3SJ9A 1G3EA 3TPIZ 2A0QB 2O8MA 1V2QT 1O3JA 1O3HA 1TX7A 3RXUA 3Q3YA 1XKBC 1GBKA 3RXDA 2Q1JA 3W95A 1FAXA 5BPEA 3PV4A 3VB5A 2H1UA 2QYIA 3SI3H 1BHXB 2FZZA 1A61H 1TBZH 3EAJA 1AVGH 4XSKU 2G52A 3SNDA 4OS5A 1GI2A 2DE9A 1B0FA 1UTQA 1O2SA 2J38A 1ANBA 1VJ9U 1YPGH 1MTVA 1S83A 1MD8A 1PQ8A 1A5HA 3S9CA 1NRRH 2FXRA 3BEFB 1G3BA 2STBE 3SUDA 5FX6A 3A88A 2ZTZA 1K1NA 5GXPA 4A7IB 1AIXH 3TK5A 4TWWA 1O31A 3OSYA 1K21H 1XUJA 4Y7BA 1TMBH 3RM2H 1IQLA 1NRNH 4D76A 1ETSH 3RXHA 1AD8H 2F9UA 1ZRKA 1DANH 1VITF 4X6NA 4DW2U 4INKA 4I8JA 1BRUP 2F3CE 3M5NA 3KGPA 4E7RG 1DFPA 1ETTH 3SJKA 1C5RA 3AASA 4CRDA 1HAVA 3RC5A 3ATMA 2FLBH 1YCPM 3U69H 1OWJA 4J2YB 1IHSH 1ZSLA 3RXAA 2XC0A 1O5AB 4JK5A 2VIQA 5EXMA 1PPHE 1UMAH 1O2MA 1OP8A 2QXIA 1T32A 1GGDB 3GCTF 2Y5HA 3TGKE 1VZQH 1T31A 5DP6A 3SGBE 1O39A 4BXWA 2A1DB 4YM9A 1D6RA 1SL3A 3NKKA 2Y7XA 3E16B 1IQIA 1FZZA 1SLUB 2BOKA 1SBWA 2PR3A 1QBVH 2GX4A 1L2EA 4B2BA 4DCDA 2P3TB 2TRMA 4NIYA 1JRTA 1QRXA 1O2LA 2PSYA 1OXGA 2PKSC 1GMCG 1ANCA 4YOJA 2ZF0H 2BDBA 1RS0A 1UVTH 2R3UA 3FZDA 1CHOG 1C5QA 2V35A 3H7TA 1GBBA 1EPTA 1C2KA 3LH3A 5EQSA 4YT7H 4RN6A 4BAMB 1ELDE 4R0IA 2OTVA 4RKOB 2WPIS 3PMBB 1TX6A 2BY6X 1LKBA 1K2I1 1M9UA 1TABE 3T27A 4D9QA 1Y5BT 1UO6A 2CJIA 1YM0A 1TRNA 3ZZDA 3KCGH 5GPIB 2XC4A 1H8IH 8KME2 2GP9B 1DLKB 3V12A 4ESTE 4XBDA 4ABEA 2CHAB 1G32B 5LPEA 1DSTA 2ZHFH 3P92A 2GV7A 2ZDKA 5JDUB 3SNCA 5T6GA 2OBQA 1O2NA 4E05H 2FIRH 1CT0E 1P01A 2Z9IA 1C1TA 1J16A 1F0TA 1O32A 1EAUA 3M3TA 4CRBA 3ITIA 1AU8A 3O8BA 3PO1B 3ESTA 2NU2E 1HJAC 4B2AA 4ZXXH 3QDZB 3FFGA 1DWBH 1A5IA 2ZFTA 3PWBA 3ATWA 1RTLA 1A7SA 3FAOA 2VIWA 1C1NA 2GCTB 2B7DH 2BX4A 1PPZA 1A1RA 1O34A 1HCGA 4YT6H 1CVWH 1WQSA 2GCHF 2J9NA 2P8OB 2OC7A 2OC1A 3P8FA 3M61U 1ZPCA 2ANKH 1AB9B 1IQFA 2Q6GA 3MNCA 4H6SB 2IPHA 1MD7A 3DHKH 3QX5H 1AN1E 1QBOA 3VPKA 5DKMA 1N8OB 1C1QA 3LOXA 2LPRA 4ZKOU 1YPJH 5EW1H 1DWEH 4I33A 2ZFSA 1KY9A 2ZC9H 1AKSA 2Z6BD 4FXGH 4R8TB 2RCEA 1LCYA 3ATKA 1E36B 1MMJN 3U98H 1PPEE 1SB1H 1CGJE 3NUMA 4I31A 1BMAA 4X8SH 1MCVA 4K3JA 1QNJA 3SV2H 1HFDA 2G51A 2C93B 3SUEA 5FX5A 3PYHA 4ABBA 1CA0B 1JBUH 2HPQH 4I7YH 1C4V2 4HI3A 1O30A 5DJ7A 1O3CA 3DFJA 3M36A 1CU1A 1HIAA 1BTXA 4OS7A 5LH8A 2YNAA 1NESE 2VGCC 1SGRE 1GBFA 1EOLA 1UJ1A 1ANDA 4SGAE 1E34B 1K1JA 1DY8A 1LHFH 3GYMA 1SLXB 1GBDA 3NXPA 1UCYH 5DPAA 4NWLA 1MZDA 1H4WA 1O2IA 2ZDVH 4OS6A 1Z8GA 1O5EH 2V0BA 2VNTA 1NM6A 3ZV8A 2O8WA 3BTHE 3GY7A 4AFQA 2OBOA 5F8ZA 1S81A 2CN0H 1Y3WA 3NPSA 5L30H 2VJ1A 2ZQ2A 2J95A 3MNBA 8ESTE 3L3TA 1K9OE 1W3CA 2VIDA 1XVOA 2PKAA 1A46H 3KQDA 2GZ7A 2BM2A 2UWOA 3PM3A 1YC0A 5A8ZA 1D3TB 1KXBA 3RMMH 3VGCC 5TCAA 1AE5A 4NCYA 1H8DH 4FUFA 2IOTA 4MQAA 2QXJA 5C1XA 2D2DA 2G5VA 2ALPA 2R2MB 1DX5M 4AGKA 3MI4A 2UWLA 5C5OA 4JZIA 1NRQH 4I8KA 5ESBA 2TGTA 2HLCA 3U8OH 1TOMH 1BBRH 3BTWE 5EGMA 4YOGA 3JZ1B 1GHBG 4K1EA 1V2TT 3STIA 3K6ZA 3MH4A 1GCTB 5E0GA 2BDYA 1LVYA 1HYLA 1L4ZA 4CRGA 3SHCH 8GCHG 3UOPA 2WUCA 3GY4A 3MH7A 1HAYB 3SU5A 4OGYA 1TNHA 2SNVA 1UCYE 6ESTA 3W94A 2EA3A 1DSUA 1SGCA 4E7NA 1QB9A 1OP0A 1SHHB 1W12U 3TNTA 1C5TA 1TONA 1XKAC 4WVPE 2G55A 1L1GA 3TJUA 3E6PH 1QA0A 1SGDE 1UK4A 4MNVA 4XBCA 1QY6A 3ZZ8A 1OWIA 5EU8A 3LIWA 1EZSC 1ESBA 1PYTC 3RXCA 2FODA 6GCHF 1HAXB 1EAWA 5GDSH 4WWYA 4U2WA 4JCNA 1G3CA 1ID5H 1TGCA 1Y3VA 5AF9H 1BMLA 1C5MD 1PPBH 3A83A 3KN2A 5GCHG 4WH8A 2YNBA 3SORA 4YOIA 1C2MA 1MBMA 1YPMH 2ZFRH 3BIUH 4HTCH 4MLFB 2THFB 1XM1A 1SHYA 4ZKRU 1QL7A 3SUGA 1KLJH 1ZTLA 1VGCB 2I6SA 3P6ZB 1MQ6A 2B8OH 1T4UH 1THPB 2SGDE 1BBRE 4BTUB 1TIOA 2CF9H 4I8GA 5JBCS 1CBWC 3ZVEA 3VB4A 1H9IE 1EZUC 1QR3E 4IGDA 4FUEA 1AZ8A 4WF8A 2VWOA 1BTHH 1OWEA 5LPRA 1C5WB 1C9TA 7LPRA 1V2NT 1E37B 3V0XA 1GBLA 4ABFA 2F9VA 5F8TA 1GG6B 4HFPB 1T7CA 1P2NA 4KP0A 9ESTA 4I8LA 3SGQE 1W7XH 1F7ZA 1MTWA 3PB1E 1GI4A 2XCFA 1EZXC 3LJOA 1P2IA 2VIOA 1GBTA 1INCA 4FUBA 1W8BH 3M5MA 3ODFA 4ISNA 4X1NU 3TH4H 3MMGA 5L2ZH 1GMHG 1BOQA 1FN8A 1W14U 2BD2A 1SLVB 1ELGA 2DE8A 1GJAB 2H5CA 4WMFA 2PLXA 1EAXA 1ZYOA 2BD5A 2FX6A 2ZZUH 1GBIA 4JZFH 4YO9A 1YCPK 4BANB 2UUFB 2Z7FE 2PTCE 2JH6D 5LPFA 3UNRA 3NZIA 1B5GH 2FOFA 2WYJA 1EP6A 3RMLH 4INHA 2A32A 1HDTH 1LPZB 2SNWA 1NFYA 1FN6A 1O2TA 2GGVB 2G8TA 2QIQA 2ZG0H 3NK8A 4K1TA 3S9AA 1O3LA 2P95A 4B73A 5JBTA 2ZDLA 2ZGJA 1F0SA 3KQBA 4WY3A 2FWWA 4LK4A 2H5DA 4LXBH 1TMTH 1KXFA 2G5NA 1BTZA 3GY5A 1OX1A 1JXPA 1LHDH 3A7VA 4AFSA 1KDQB 1O3AA 1F5LA 3BV9B 1F2SE 3IWMA 2BD7A 2Y80A 3E91A 4K60A 4UD9H 1UVSH 4Q7YA 1WOFA 2ZGCA 4UE7H 3SO3A 2J2UA 2QC2A 1GI8B 5EOKA 1FY8E 5TCCA 3BTDE 1CHGA 3QGJA 1C2FA 1OWHA 4GSOA 1D3PB 2H9EH 1O3NA 1MUEB 1AGJA 2VIPA 3QWCH 3A80A 3TITA 1HAHH 2AERH 2B0FA 1O35A 3T26A 5I25A 1WUNH 2R0LA 4KKDA 2J34A 3LONA 3SOSA 4O03A 1P0SH 1O3OA 1AVWA 4AYYB 2VINA 3VEQB 1GVLA 2ZCLP 4E06H 1QCPA 7GCHF 1AFQB 3RXBA 1W0ZU 3PMHB 4B75A 5C1UA 1G3DA 1O2PA 1GJCB 1XX9A 1JIRA 3HGNA 2BY8X 3TK6A 3SNBA 4UEHH 1OPHB 4K69A 1YPHC 1RGQA 3BF6H 2Z9LA 1O3KA 3MU0A 2FM2A 1V2RT 3SHAH 1P02A 2VWNA 4ABDA 4Y11E 1SC8U 3U1JB 1GGDC 1C5SA 3CS7A 1Z71A 3P8NA 1Y5UT 3ZZ9A 1Y5AT 1GVKB 1H1BA 2A4OA 3C1KA 3ZZAA 4BAHB 5C1YA 1MKWH 5PTPA 2ZU1A 1NN6A 4AX9H 1PPCE 2XBVA 3SN8A 1HAVB 2FOGA 1YPLH 1QQ4A 3GY3A 2GMTC 1MAYA 1AWHB 3A85A 1GHWH 1Z1IA 2BX3A 1P12E 2ULLA 5CHAB 2ZHEH 2RG3A 2J92A 1EOJA 2WPJS 3LGYA 1SG8B 5FHTA 3F6UH 2FESH 3MU8A 1MU6B 9LPRA 1AFEH 1MAXA 1XXFA 3U8TH 3ZZ6A 1TQ0B 2AMDA 2GVFA 1SQOA 5A8YA 1A0LA 4ZXYH 2ZU2A 6CHAC 2FOAA 3ZYEA 1O2QA 2QGRA 5HM9A 4UDWH 3ZVGA 3TGIE 4DG4A 3S9BA 4JMYA 1O3GA 1O5CB 4X1SU 1UHBA 1A3BH 1AE8H 2FI3E 5HYOA 3F68H 4B76A 1FY4A 2FX4A 2GT8A 4CRCA 2XWAA 3T29A 1BRCE 2A2QH 1FMGA 4FUIA 1AZZA 3A7WA 4YTAA 3D65E 5EPNA 4XFQA 4WXVA 1QL9A 4IN1A 1LO6A 4FUJA 2GT7A 1GI3A 2PGBB 2O8LA 4Y6DA 5DP3A 1F5RA 3UOUA 2A5KA 1P10A 2CHAC 1P3EA 1G9IE 4ZAEA 2V6NA 1P57B 3NCLA 5TJXA 1E0FD 1CT4E 2OQ5A 3VB3A 3SBKA 1UK3A 3GCTG 3FP7E 1AUJA 1SQAA 2J94A 3LC5A 2H9TH 3QTVH 3RXEA 3H7OA 1GBMA 1ZSJA 2Z3CA 1FIWA 1EB2A 1UTNA 3E0NB 4YESB 2V3OH 2W5EA 2GDEH 2Z94A 1FAKH 1ZR0A 3RC6A 2ZHDA 4JYVH 3LPRA 5EQQA 5FCKA 1IQHA 1DE7H 1GMCF 2F91A 1CGIE 1OSSA 3UY9A 1DWCH 1W0YH 3I29A 3MO3A 2D8WA 2P8OC 3IITA 5FXLA 1O2ZA 3M3SA 2BQ6B 1AB9C 1LHGH 3MU4A 1MTUA 2F9NA 3RU4D 5FAHA 3Q3XA 1FDPA 2R3YA 5EG4A 4NSVA 3TJVA 1T4VH 2ZIQH 1GI0A 3TVJB 2F9BH 2A45B 3LC3A 5DO4H 5J4QA 4O3UA 3CENA 4DJZB 3RXRA 3S7KB 1L4DA 4GCHG 3SJIA 2NU0E 4NSYA 1QJ1B 3PTNA 1IOEA 1Q2WA 4DVAU 3MO6A 2XRCA 3AAUA 1BDAA 2W26A 1BCUH 4UONA 2QV1A 4IC6A 2HNTF 4FUGA 3M5LA 1QBNA 3HK3B 2BDIA 4X8TH 3T5FH