3BSQA

Crystal structure of human kallikrein 7 produced as a secretion protein in e.coli
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
IIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-7
publication title Crystal structure of human epidermal kallikrein 7 (hK7) synthesized directly in its native state in E. coli: insights into the atomic basis of its inhibition by LEKTI domain 6 (LD6)
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 223
sequence length 223
chains with identical sequence B, C
ec nomenclature ec 3.4.21.117: Stratum corneum chymotryptic enzyme.
pdb deposition date 2007-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bsqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3bsqA02
1TIOA 1C1MA 4WVPE 1H1BA 1GBFA 3GCTG 3C27B 1RD3B 2ANKH 1H8DH 4K1TA 2BDBA 1CSOE 5E2PA 4A1XA 1F5KU 1TALA 1TGCA 2V0BA 4ZXXH 1A3EH 4NIYA 1PPCE 1GI0A 2EEKA 1ELTA 1HPGA 6ESTA 1TX6A 1E36B 1DFPA 1O5FH 1PPFE 3SV8A 1YPGH 1WYKA 2PKSC 2SNWA 3HKIB 1W8BH 1YGCH 1TYNA 1DSUA 1S5SA 1RTKA 4AFZA 4YM9A 1DLEA 1ANEA 1UTPA 4A92A 1VCPA 3V13A 2C90B 2PGBB 5DP4A 4B1TA 2K1QA 2SGPE 4GUXA 1DWCH 2Z94A 4CREA 3BTHE 4BAHB 3RXBA 3S69A 1AN1E 4DT7B 3F6UH 1FI8A 1AI8H 1SFQB 1JBUH 4AB8A 1C4Y2 2FOEA 3BN9A 4I7YH 1YCPH 1GBLA 5EOKA 1P04A 1C2IA 4Y0YE 1ZJDA 2P8OB 1X7AC 2VGCB 2PGQB 2FI4E 3K6ZA 1T4UH 3OTJE 3KHVA 2FXRA 1SVPA 3LONA 1N1LA 5F03A 3SU6A 3GOVB 5J4QA 2WYGA 1QJ7B 3GY6A 5T6DA 4LXBH 3TVJB 4HGCA 1O3CA 5DP9A 1JMOH 5FHTA 4B2BA 1G3CA 3SUGA 1SHYA 1SGEE 1Q2WA 1DE7H 1C2GA 1A0JA 3TGJE 4NIXA 4OS5A 3SQEE 1NM6A 1UTOA 2GTBA 3ODDA 4IGDA 2Z9KA 4O97A 2A5KA 2OLGA 1A4WH 5EQQA 1O3OA 1QFKH 1W3CA 1BRCE 2A7CA 2RG3A 3LIWA 3A8AA 2ZGBH 3MNBA 1UHBA 3D62A 3EE0B 3P8FA 4BOHA 4IS5A 3EYDA 4I8GA 1QL9A 1OWEA 2VINA 1C1OA 4CH2B 1TRYA 1HJAC 2BX3A 2BXUH 3SNEA 1TRNA 4XDEA 1MU8B 1GG6C 3M3SA 3GY2A 1C1WH 2PKSB 1K21H 2VWLA 3LGUA 2ZNKH 2BDGA 3RXHA 3UNQA 4X0WU 2FEQH 3V3MA 1MQ6A 1G3BA 2NU4E 1QNJA 4BTUB 2BZ6H 2ZTZA 4ZKRU 3S9AA 3NUMA 4Z0KA 1K22H 2VIPA 1UTMA 3D49H 5CHAC 2QXJA 1YPKH 4X1SU 3W94A 2VU8E 2THFB 4WXVA 3A86A 3UR6A 3RXMA 1UVPA 3UNSA 2HRVA 3H7TA 1C1PA 1K28D 3FANA 4ABEA 2J2UA 5JBTA 1YLDA 1ZR0A 2I6QA 2BOKA 2Y81A 3LH1A 3F9GA 1ZPBA 4GHTA 2FIRH 1AU8A 1VITF 5C2ZA 3M5LA 1NN6A 4ISNA 3P70B 1GGDB 5HMAA 2FX4A 1C5XB 4JZFH 4ISHH 5DKMA 4NCYA 2P59A 4AFQA 5F6MA 3TITA 3NXPA 1F2SE 3TJVA 8GCHF 1NESE 3BTKE 3K6YA 4I8KA 5DK1A 1Z8IB 1BBRH 2AFQB 1AFEH 2VWOA 1PPHE 2R0KA 4O9VA 2HWLB 2BX4A 2PW8H 2O8UA 1AVGH 2EC9H 4NSYA 1EZUC 1C1SA 4YESB 1W0ZU 4WMFA 3RXFA 2D1JA 1FN6A 2H5CA 5DP8A 2SGFE 5K7RA 1HAPH 1JIRA 1P3EA 1H9HE 3STJA 3DFLA 4RKJB 4CHAC 3ZZ3A 1EP6A 3EAJA 1HJAB 1HDTH 1LVBA 4BAOB 1ZHRA 1ABIH 1MZDA 3BTME 1GG6B 1Z6EA 3MU4A 3PMJA 3ZVCA 5HYOA 3QWCH 1NU9A 4H4FA 2BDYA 1O2ZA 1KY9A 5ESTE 2Z9GA 2A4RA 4CBOA 2R9PA 4AYVB 1DITH 3G01A 1S84A 2QYIA 3ATMA 3PV4A 4Y8XA 5GXPA 2VIQA 3TJNA 1F0UA 4NFEA 1TNGA 1UTKA 1WQSA 3SHCH 2ZHWH 1O2QA 1ZTLA 4TPYA 3AW1A 1EZSC 1LTOA 2NU0E 4CH8B 5EQSA 1FV9A 8GCHG 1BJUA 2P3FH 1Y5BT 1INCA 1SFIA 2CF9H 3VPKA 3M5NA 4LOYH 1EZQA 1P2QA 2BDAA 1O0DH 1JRSA 1V2UT 4YOJA 2FS9A 1GBIA 1ANDA 2CGAA 4JZDH 2YNAA 1XX9A 5ABWA 2BVXH 3A80A 1SMFE 1HUTH 2GDEH 3RXIA 4BAKB 3MU8A 1P05A 2ZGJA 3TGKE 1E38B 1ZTKA 4NWKA 2BY6X 4Z6AH 1P2JA 3AASA 1P8VC 3RXKA 2BLVA 3LKWA 3S9CA 1EJMA 3PLKA 3RXOA 2GMTC 1O33A 4D7GA 1OWIA 1W12U 1TMTH 3SU3A 1AE8H 3GY8A 1HAIH 1OWHA 2G4UA 5JB8S 3MMGA 4UDWH 4XBDA 2F9PA 2SGDE 1G37A 4X2WA 3HK6B 4I8HA 3P6ZB 1MD8A 4BXWA 4H42U 1BIOA 2EI6A 2ZDMA 2FP7B 1GJ8B 1MZAA 1VCQA 3GCHB 2QV1A 1JXPA 1C1RA 3HATH 4UONA 1O2VA 3ZZDA 4U2WA 4BAQB 5IYTA 1C2HA 1O5EH 1E37B 2G52A 1DICA 1UJ1A 4QT8C 1BDAA 3MFJA 3PO1C 4JK5A 3DFJA 3SN8A 3TNTA 3E0PB 2A45B 3QZQA 3DA9B 3VB5A 2PSXA 1J17T 3DHKH 4MTBA 3ZZ7A 3M7UA 3ZZBA 1A5HA 1NRQH 4ABAA 2GZ7A 3F1SB 1C2JA 2FO9A 4INLA 4K8YA 1ZMJA 5HM2A 1DOJA 4YO9A 2VWNA 3V7TA 1WV7H 1JOUB 3T28A 2ZU4A 1PQ7A 1ZTJA 1EUFA 2BM2A 2J38A 1V2OT 2PFEA 4NG9H 2QY0B 2IOTA 4U30A 3E3TA 1TPOA 4DIHH 1JRTA 4UFEH 1EB1H 1C4V2 1IQKA 1O2KA 3VB7A 2GV6A 1EXFA 2WUCA 2Y82A 2A31A 3SU0A 2TGPZ 1BTPA 3LT3A 3F9HA 3Q3KA 4BTTB 3O8CA 3RM0H 4SGAE 1BBRE 3ATIA 2B8OH 1CT4E 3T2NA 2Q6GA 1NRRH 1EPTA 5L6NH 2GMTB 4NIVA 1LQEA 5TCCA 1GI9B 1GBMA 2ZC9H 1W7XH 1S0QA 3P8OA 2HNTC 2TPIZ 1NFUA 4D76A 2ZQ1A 4K69A 1EKBB 1NTPA 2WV5A 3CS7A 2ANMH 5AF9H 3RDZA 5EQRA 1N8OB 5A0BA 4U32A 1GBHA 1L4ZA 2PUXB 1IOEA 1D3DB 1OX1A 3OY5U 5DO4H 3FFGA 3VFEA 1V2QT 2V6NA 5LPEA 3KN2A 1CA8B 1JIMA 2F9NA 3TK9A 1D9IA 1QHRB 4X1PU 3R3GB 5K0HA 1BRBE 1TNHA 3BF6H 3TLOA 3MOCA 3URDA 2FLRH 3F9EA 4X8TH 1O2RA 2RDLA 2TGTA 3D23A 2ANWA 3A7TA 2A0QB 4ZKNU 3MH7A 3RU4D 1P9UA 1W11U 2Y5GA 4ZROA 2Y5HA 2XBWA 4K8BA 5A09A 4A1TA 1FY4A 2R3UA 3E8LA 1PPBH 3FAOA 4H6TA 1C9PA 2H6MA 2UWLA 5HXFA 2G5VA 1CHGA 1O2PA 1KTSB 5LH8A 4GLYA 1BZXE 1O5DH 4JYTA 4NZQA 2B7DH 3MU1A 2QCYA 1VR1H 1O3JA 1ZZZA 1BTWA 1ELCA 3BG4C 4WMEA 1V3XA 2ZFPH 4UD9H 1O32A 2XC4A 1P3CA 2PTCE 1SG8B 4ABJA 2D2DA 5DG6A 4AYYB 3SORA 1L2EA 3PTBA 2DE8A 1YP9A 2FMJA 1AY6H 5JB9S 4JMYA 4Q80A 1OYTH 1QTFA 3BEUA 3PMBB 1XKAC 1CA0B 4CRCA 2FTMA 5E8EH 1GJ4H 2OTVA 3LJOA 4YLQH 1GHVH 2XWBI 1MBQA 4K5ZA 1HB0B 3VEQB 1UHBB 2W26A 4XBCA 4AX9H 1Y3UA 1XUKA 3OYPA 4IMQA 1EAUA 5GIBA 2WPHS 4ABDA 1NS3A 5FCKA 2AYWA 1L4DA 1GI8B 4YOGA 1QY6A 1TNJA 1VGCC 3T26A 1TRMA 2ZZUH 2VH6A 2XW9A 3BTWE 4NGAH 1GJBB 1BRUP 1ZSKA 2ZCLP 1H9IE 3U8RH 2GX4A 1O3LA 1J9CH 1O2OA 1SC8U 1V6DA 2V3HH 2FDAA 1XUFA 1LKAA 3TJOA 1L1GA 3PWCA 3EDXB 1L1JA 2ZI2H 2GT8A 2ZDKA 2TGAA 1PQ8A 1T8LA 1B7XB 2ZPSA 1D3PB 2PLXA 1GDUA 5AFYH 1G2MA 1GJDB 1GHBF 5C20A 2C8WB 4HFPB 2W7SA 2P16A 1P09A 2F91A 1GJ7B 2NU3E 2F9VA 1D3TB 4MLFB 1AIXH 2VIOA 3M7QA 2R2MB 1QQUA 3ZZ6A 4Y7AA 5JYIA 1NZQH 4FUFA 2QAAA 1SR5C 1DY8A 4Y71A 5FX6A 2OC1A 2HPPH 2ZFTA 3MO6A 1C5MD 1OWKA 4IN1A 4CRBA 1S6FA 3U8OH 1P11E 2FESH 3SU4A 4OS7A 3FZZA 3MH4A 2EI8A 1T8NA 1DUEA 1YF4A 2VH0A 2ZDNA 3SUDA 4GSOA 1HBTH 3RU4T 3PWBA 1GI2A 4WH6A 3UWJH 3STIA 1TA2A 1A46H 1DDJA 1NRSH 1PFXC 1OP2A 4K3JA 2GV7A 3TK5A 2ZHEH 2P3UB 2TIOA 1VZQH 2AMPA 1AZZA 3SV7A 4XBBA 4TY6A 6LPRA 1DS2E 2AS9A 2NU2E 3UQOA 1VGCB 1PJPA 3CENA 2BY8X 3ODFA 1SLXB 1GHBG 2CMYA 1TB6H 3O8DA 4X1RU 2PR3A 4KELA 3ZZAA 1GL0E 1WCZA 1ORFA 1SGRE 1YPMH 3EQ0H 1O3EA 2ZFFH 3GICB 4ABIA 1J8AA 2VVUA 2UUFB 3E90B 3BEFB 1F5LA 4X2VA 2BVSH 7ESTE 3PTNA 1ACBE 1O2SA 2SNVA 1IQIA 1AFQC 1EAXA 3SZNA 4RN6A 2ZP0H 1LVMA 2PSYA 1ARBA 1GI7B 4OGYA 3VGCB 5GWZA 1GHWH 1HAXB 1GGDC 1GHAF 4K60A 1BHXB 3R0FA 4YZUA 1BRAA 2BB4A 2J34A 3BTTE 3UFAA 4GHQA 1ELEE 2GCHF 6GCHF 5F8ZA 3EA8A 4FUEA 1SLWB 3M37A 2BD3A 1ZSJA 2KAIA 3ZYEA 2YOLA 3NKKA 1A2CH 4A5TS 1SGPE 3DT0H 2BDHA 4CRGA 1LDTT 3BIUH 5AVDA 1FJSA 1ESBA 1CT0E 3TK6A 1DM4B 1C5PA 2Z3DA 1D3QB 1EP5A 3U8TH 2FS8A 2FYRA 3UREA 2J94A 1DWBH 3Q76A 3CS0A 1GBTA 1RTLA 2R2WU 2WPMS 1LHDH 4WF8A 3QZRA 4AFUA 4IC5A 3NK8A 3ZVDA 1H9LB 1FPHH 3SNAA 4YOIA 1WOFA 4Q7YA 4THNH 1FUJA 2FOFA 1GHAG 1NRPH 2FI5E 2VIDA 5ESBA 1FMGA 2ZFQH 1BUIA 3RXRA 5C67A 2DUCA 1TNIA 4Y8ZA 1Y3YA 1J15A 1IHSH 2A2XH 1O2MA 3DUXH 2ZHFH 1P03A 1P10A 1PYTD 2GCHG 6GCHG 4CRAA 1Y8TA 1HAVA 2BTCE 1Z71A 1ESAA 3T5FH 2A5IA 1C5TA 3OX7U 2OP9A 3ZV8A 5C1UA 1AWHB 3EGKH 4INKA 2VB0A 1EATA 1PQAA 1AFQB 1EAWA 4X1NU 4AN7A 1ZRKA 1Z8GA 1YPLH 5B6OA 3TPIZ 1A61H 2R0LA 2ZU3A 2HVXA 2FOGA 3V0XA 1QJ6B 3RC5A 2FODA 4XFQA 3SHAH 2FZZA 3QK1A 4B2CA 1MCVA 1TONA 3D65E 1LO6A 1C5SA 1ABJH 3QX5H 3A88A 4Y10E 1GPZA 1O2XA 1QQ4A 4TY7A 5GCHF 4DCDA 1O38A 1IQNA 3E0NB 3KQCA 1KXBA 1ETTH 1O2IA 4AZ2B 1NFYA 1ELAA 4E06H 2ZGCA 1EZXC 2H2ZA 1HAYB 1O2HA 5EG4A 1QL8A 5FBEA 1C2KA 3SO3A 2OBOA 1XUHA 1DUAA 1TABE 2GVFA 2OD3B 1AZ8A 4DG4A 1EPTB 3GCHC 4MQAA 5BPEA 2BLWA 4FUIA 1FY5A 1K1LA 1SHHB 5FXLA 1GVLA 4KP0A 4JZ1A 1SQOA 2Q1JA 4ZAEA 3QLPH 1S6HA 2Y7XA 3L6PA 1SPJA 3GCOA 4B74A 2PWXA 3TJUA 2ZTXA 3P8NA 2F9BH 4NIWA 2G55A 3MH5A 5EGMA 1EOJA 3S7KB 3RXJA 2ZFRH 5LPFA 2FWWA 3LPRA 5AHGH 1ZSLA 4I31A 1N6YA 2WYJA 2HPQH 2BLQA 4FU9A 2AIPA 8ESTE 1TGSZ 5ETXA 3RXPA 5GJ4B 3LDXH 2AERH 1EJNA 5GCHG 2BVRH 5LPRA 4NWLA 4LK4A 1HLTH 3PB1E 1BTXA 1LPZB 1P57B 1KXAA 1VCWA 4UFGH 1GBBA 2HALA 4F4OC 3SV9A 1HJ8A 4DW2U 1TX8A 2ASUB 1SOZA 1BQYA 1CGHA 4WY3A 3VB3A 4CBNA 1QB9A 1TBRH 1UCYK 2CJIA 3RXTA 1MTUA 1GCTB 4XOJA 2F3CE 3A81A 1MKXK 3QTOH 4MVNA 3A7ZA 5A8YA 3A7XA 1BTUA 1GJCB 4KKDA 1XUIA 4ABFA 3SJIA 4E7NA 1G3DA 2H9HA 1TQ7B 1KXFA 3TH4H 1GJ6A 1P2MA 3A8BA 3BTFE 1S0RA 1W13U 1BJVA 1N8OC 1IAUA 1P9SA 3BTQE 3BIVH 1FZZA 2FOBA 4NSVA 3UOUA 1O3FA 1AB9C 3HPTB 3IITA 3AAUA 1K2I1 1GWAA 3QGJA 2Y6TA 3QDZB 1SOTA 3UIRA 3FP7E 2XTTB 1THSH 1L1NA 3AAVA 1K1MA 1T31A 2WV4A 1RS0A 3ZYDA 2ZDLA 3SUEA 4MNVA 3LGWA 4DIIH 3ELAH 2I6SA 1UTQA 5L30H 1EQ9A 1GJ5H 1O35A 3HGNA 4FUBA 5A2MH 4JK6A 4GVUA 4KGAA 2FX6A 2BMGB 4OGXA 2QF3A 3KCGH 3ZZ4A 3N7OA 3A89A 1XXFA 2HOBA 5LGOA 1O37A 1BITA 1UVOA 3BTEE 2FYQA 1ZOMA 1MBMA 1QJ1B 1IQFA 1LHEH 1O2NA 3UNRA 1FAKH 4Y0ZE 4KTCA 1B0FA 1O2JA 1ZHPA 4A1VA 3L33A 1ZGIA 3K9XB 1ZHMA 3A82A 3BEIB 1HCGA 2O8LA 4KTSA 1QR3E 2P95A 1Y3VA 1KDQA 2ZCKP 1AHTH 1O3AA 1FNIA 1PPZA 3MTYA 1O3IA 1OXGA 1HIAA 2OC0A 2B9LA 1Z8RA 1Z1IA 1H8IH 2Z9IA 3ATKA 5JBBS 1ANCA 4WH8A 2BQWB 1QB6A 3ZZ8A 4AG1A 1NFXA 1TMBH 2Y80A 3M35A 4GAWA 3ATWA 2HNTE 3TH3H 4CRDA 4INHA 3GDVA 1CA0C 1LHCH 1XM1A 2GZ8A 1QBOA 6CHAC 3GYLB 5C3NA 1Z7KA 4R0IA 1O2LA 4NA7A 1AVWA 5JPMH 2CF8H 4BTIB 5E2OA 1AB9B 2BD9A 3RXQA 4F49A 4ZMAH 1PQ5A 3UWIA 1P2KA 2BDIA 1TNKA 3SGBE 2Z6BD 2F83A 1ETSH 1O3NA 1GBKA 1O3MA 1BCUH 3GISB 4H6SB 3QUMP 4AFSA 1ELDE 3F68H 1FDPA 1RGQA 3A8DA 1HJ9A 3SOSA 4I33A 3L3TA 2CHAC 2J9NA 1CQQA 1O3PB 2AMDA 4B2AA 3JZ2B 1SQTA 3BTDE 1L0ZA 1V2NT 3ZV9A 5BRRE 1CO7E 5EXMA 2JH5D 3SU5A 4E7RG 1UMAH 1H4WA 1A5IA 1BTZA 4ISLA 1YPHC 2G81E 1YPHE 3E91A 4ISIH 2O8MA 4MPVA 3I77A 1K1IA 2XRCA 3PLBA 2HNTF 2UUJB 1QB1A 2G00A 3A83A 4JZEH 1WTGH 1RIWC 4Y76A 2ZFSA 3BV9B 3SV2H 3SJKA 1MMJN 4X6MA 3SNDA 5J4SA 4LZ4B 4FUJA 1OOKB 4K2YA 4FUCA 2BD4A 2QC2A 1MKWH 1UCYH 1W0YH 1AKSA 1RTFB 4DURA 4ESTE 6CHAB 1QL7A 3NZIA 5PTPA 1WTHD 5FAHA 1MKXH 3SNCA 1F0SA 1THPB 2A2QH 2YNBA 2ZCHP 1OS8A 1HFDA 2KAIB 4IC6A 1GHYH 2BYAX 3SW2B 1MTVA 1TMUH 4WXIA 1S81A 4ZHLU 8LPRA 1C2MA 1C4U2 3MNCA 4X8VH 3U1IB 2H9EH 1XUGA 3LGTA 1JWTA 2D26C 3ITIA 1OP0A 2IPHA 3ZVEA 1DWDH 4X6NA 4GCHF 2FLBH 5T6GA 1GVKB 3P17H 1MUEB 1O5BB 2SGEE 1MTNC 1V2LT 2GD4B 4RSPA 1C5VA 4NFFA 1RRKA 4FVDA 3M3VA 4B73A 5A0CA 2UWPA 1O3DA 2SFAA 3SQHE 4O03A 2HLCA 2CHAB 1AUTC 2STAE 3UUZA 2JKHA 1ZYOA 1Z1JA 3SU2A 1ANBA 1XKBC 1O30A 1ZJKA 1O2TA 2RCEA 1HAHH 4TWWA 5JBCS 4FU8A 1KLJH 2PTNA 3P92A 1GHZA 4Y8YA 3KQEA 3VGCC 1BMMH 1NU7B 3PMAB 1Y3WA 2FTLE 1GBAA 1GL1A 2RA3A 3MWIU 3RMOH 2ZDAH 1K1OA 5E0JA 3RUOA 1HAVB 1WUNH 1SGNE 1K1PA 2A7JA 3MNSA 1PYTC 5SGAE 3KQDA 2VVCA 1KXEA 3QGNB 2IJOB 3K65B 5I25A 1GI1A 1A0LA 4K1SA 1RIWB 3RMNH 1T8OA 1UTJA 2A5AA 7LPRA 1SL3A 4GCHG 2CXVA 3RLYH 2VJ1A 2LNCA 5DP5A 1OKXA 1DANH 3RXGA 1YM0A 2A4QA 3FP6E 5T3HA 3RXAA 2GCTC 2GKVE 1CT2E 2ZG0H 1GBEA 3BSQA 5EW1H 1ELBA 4TYDA 3MNXA 3KQBA 2PUQH 2R3YA 1MAXA 2ZHDA 1ARCA 4YT7H 1W14U 4AB9A 1YYY1 5I46H 3U69H 1C5WB 5DP3A 1SGFG 4J2YB 2ZQ2A 2FOCA 3A7VA 1HXEH 1C5NH 1V2RT 2AIQA 1AD8H 2FPZA 2PKAA 2ZA5A 3SUFA 4ABGA 1A3BH 1V2VT 1YC0A 1O36A 1MTNB 1IQGA 1FXYA 2H5DA 1HAGE 2XBVA 3Q3YA 1DXWA 5H4IB 2GP9B 5FBIA 3Q00A 1QIXB 4Q7XA 2WPLS 3GCNA 1C1UH 1IHTH 1UVTH 2BD8A 2XNIA 1DLKB 2PV9B 1S83A 5EXLA 1G32B 4A6LA 4FUHA 1Y3XA 1GBCA 1BHXF 4SGBE 4DOQA 1KXCA 3LC3A 4Q2KA 1NO9H 3E16B 2Z7FE 4UEHH 2W3KA 4TPIZ 3MO9A 1E0FD 1N6XA 3AVZA 1DPOA 1GI6A 3IG6B 2Q6FA 4JYUH 3S9BA 1C5ZB 1OPHB 2WPKS 1XVOA 2RA0A 3RMLH 3RXDA 1FY1A 2F9UA 2FOHA 3Q3XA 2A32A 1QRZA 1XVMA 1TE0A 3M5OA 2G51A 1K9OE 3M61U 2XCNA 3VXEH 1CGJE 1F92A 1GBJA 1FONA 1RXPA 2ZHQH 5HGGA 1QBVH 5TCAA 1GMHF 4X1QU 4FXGH 4AGJA 1UCYE 2ESTE 2ZGHA 1NC6A 2VIWA 3ENSB 3ESTA 4MNYA 4OS4A 1CGIE 2XC0A 1LPGB 2QXGA 2GCTB 5EODA 3PROA 4DY7B 1ELFA 4FUDA 1GMCF 1EPTC 4J1YA 1ZLRA 4DJZB 4UFFH 2WPIS 4VGCC 1NPMA 4IN2A 4PROA 5DPAA 1TA6A 3E6PH 2GZ9A 3B23B 1W2KH 1O34A 2G4TA 1RFNA 4DVAU 1SGDE 1DY9A 1M9UA 1A7SA 2SGAA 2VNTA 4YLUA 1SQAA 4WMDA 1G9IE 4YT6H 1KTTB 1O3GA 1B0EA 3RXLA 4AGKA 3RP2A 1KLTA 1LHGH 3KL6A 2QXHA 1EAIA 4X8SH 2ZIQH 4UE7H 2F9OA 1IQLA 1QGFA 1ID5H 3SJOA 1O3BA 3RLWH 2QA9E 3LGIA 1TWXB 1J16A 5F8XA 2ZDVH 3PMHB 1C5LH 1KSNA 2O9QA 2BDCA 1YPEH 1IQHA 1O3HA 4WWYA 1DT2A 4I32A 3QO6A 2O8TA 2ZKSA 1CVWH 2XCFA 4HTCH 1P2NA 1FPCH 1GDQA 1SB1H 3SJ8A 2BOHB 2UUYA 1K1JA 1GMHG 1SGQE 4MPUA 3P8GA 3QN7A 3P95A 4NA8A 1P2IA 1TAWA 4Y7BA 3ZZ5A 4LZ1H 2JH6D 3U9AH 3TIUA 3LOXA 1ESTA 1E35B 2XXLA 5DP7A 1EX3A 1WQVH 2H9TH 2HGTH 1TFXA 3MU5A 5FPTA 3TU7H 1GMCG 1W10U 1D6RA 2QIQA 1YKTA 4ZUHA 1GMDF 1ELGA 1GCTC 1SGFA 3F9FA 1A5GH 1SSXA 1WU1A 2BD7A 3VB4A 2VVVA 2O8WA 4NA9H 2QF0A 3OSYA 1UTLM 2BXTH 3KEEA 4CR9A 1FQ3A 1NY22 1C1QA 3BG8A 5T6FA 5C1YA 1ZRBA 2G5NA 1KDQB 5GPIB 1YPJH 5EU8A 1IQMA 1HYLA 1HIAB 1O2WA 1B5GH 2JH0D 2FOAA 1LHFH 1SBWA 3H5CB 5L2YH 3FP8E 4IMZA 4ABBA 3RM2H 1HAOH 3S7HB 1ETRH 2SGQE 4WJG2 3GYMA 4VGCB 2JETC 1G30B 3MO3A 3SU1A 4B75A 4D9QA 1DSTA 3GY3A 3M7TA 1O2YA 4IBLH 2BY5X 1OWDA 1BMNH 2VWMA 1ZGVA 3GDUA 5G4BA 1HGTH 3CP7A 4OS2A 4D9RA 2D8WA 2ZU1A 1ZMLA 1SGYE 2Y7ZA 3AW0A 3NCLA 4FVBA 1MAYA 3GY5A 3LGVA 3T29A 1Y59T 1F5RA 3QTVH 3EA7A 4AORA 1V2PT 2OQ5A 1GMDG 1AO5A 1O2UA 2B0FA 3I29A 1GJAB 4FUGA 2XWAA 1P2OA 1C2EA 1G36A 1UVSH 3LJJA 2ZTYA 4B71A 4Y6DA 1D6WA 1CBWC 1TQ0B 1FN8A 1VITG 1WAYB 1C1TA 2ZPQA 2QGRA 2C8ZB 1LKBA 1C1NA 3KF2A 2GGVB 3JZ1B 1GDNA 5CHAB 1QCPA 4AOQA 1TBZH 4ZKSU 3VB6A 1MTSA 3KNXA 1V2TT 2Q6DA 1UK4A 4X2YA 3UQVA 4Y11E 3RU4E 1NROH 4U01A 5C5OA 1QURH 1TGBA 4E05H 1MKWK 4O3TA 3I78A 4HZHA 2Z9LA 1UK2A 1ELVA 1FLEE 7GCHF 1MH0A 4AG2A 4BANB 1BMAA 1VJAU 4BAMB 1O3KA 5EPNA 4R8TB 4BXSA 2C8YB 3PLPA 2ULLA 1D4PB 1T32A 2AEIH 4MNXA 3U98H 4YTAA 2ODYB 1FIZA 3EA9A 1T4VH 1Z8JB 1GBDA 1LVYA 2LPRA 4TWYA 2C3SA 3Q77A 1LVOA 1Y5AT 1DX5M 1GI5A 2OCVB 4GPGA 4Y79A 2PHBA 1SI5H 3TNSA 2BQ6B 4I8LA 4ISOA 4ZHMU 4CRFA 2BY7X 2ZGXH 3FVFB 3M36A 1KXDA 3SGAE 3UY9A 2JETB 1TPSA 1HAZB 4UFDH 3SJ9A 4A7IB 1AKSB 1QA7A 1GJ9B 3BTGE 2C8XB 4MPXA 3A8CA 3TGIE 2AGIX 1SGCA 5F8TA 3MYWA 4CHAB 3MI4A 1TPAE 2ZECA 3RMMH 4MDSA 1WSSH 1LPKB 1EJAA 4MNWA 1O5CB 1AMHA 1C2FA 2P93A 1ZMNA 5EXNA 3M5MA 1E34B 1QRXA 1C9TA 3RC6A 3UOPA 1DWEH 7GCHG 1OSSA 5EPYA 3RXSA 2ALVA 4X6PA 1KIGH 1CBWB 3SGQE 1IQJA 3UPEA 7KMEH 2WUBA 3RXEA 1DXPA 2Z9JA 4O3UA 1U6QA 1YLCA 2G8TA 1SLUB 2Z3EA 1T7CA 1O2GH 3LGYA 2BQ7B 3GY4A 1FY3A 1LQDB 2A4OA 4CR5A 1C2DA 1SGIB 4ABHA 5C1XA 1V2KT 5HM9A 3GDSA 1P0SH 2BD2A 2J4IA 2QN5T 1P12E 2ANYA 1C5YB 1UVUH 1V2JT 2ZU5A 2BD5A 2B5TB 3PM3A 3U1JB 1G2LA 3E1XB 2V3OH 5E0HA 4XSKU 3T62A 2A7HA 3RXUA 2UWOA 1Y5UT 3A87A 2J95A 4HI3A 3SI3H 3A7WA 1QRWA 1ZPCA 2FM2A 4FU7A 1TOMH 2AGEX 1BT7A 1GCDA 1ZPZA 3FZDA 3KGPA 3NWUA 2W7UA 3T25A 3VXFH 1FY8E 1XUJA 3IWMA 2ZWLH 1NRNH 5L2ZH 1C5RA 2A1DB 2TGDA 2ZEBA 1LCYA 1RJXB 3SI4H 2QXIA 3B8JA 1TNLA 2ZO3H 5AFZH 1V2WT 5FX5A 2OINA 4IW4E 2FOMB 2TBSA 5IDKA 1V2ST 1F0TA 2ODQA 3MH6A 3ZZ9A 1TOCB 3ZVGA 1MTWA 1SLVB 2BY9X 1XMNB 1BTHH 2STBE 3S0NA 2H1UA 1CHOF 1C1VH 1GI4A 1CE5A 4ZH8A 3A7YA 3K2UA 5JDUB 3M3TA 3RXVA 1TX7A 1KLIH 4BNRA 1O5AB 5FCRA 3KIDU 1C5OH 3H7OA 1YCPK 3UR9A 1C2LA 3NPSA 1Q31A 8KME2 3W95A 3UTUH 1O5GH 4JYVH 1EB2A 1MCTA 5EW2H 4RKOB 2PKAB 1VJ9U 4M7GA 3PO1B 5CMXH 1PPEE 2ILNA 9ESTA 3SV6A 4JCNA 2NU1E 3SNBA 1IQEA 3URCA 2Y5FA 1A1RA 2BLOA 2OC8A 3RC4A 4D8NA 3T27A 5TJXA 1F7ZA 1AGJA 2OQUA 2OUAA 4ZHAA 4ZKOU 1WBGB 2TRMA 3HGPA 2DE9A 1FAXA 4DGJA 5A8XA 3DD2H 1BB0B 3OU0A 3HKJB 1EOLA 2IN2A 1MD7A 1P01A 2VIVA 4KTUA 4Q7ZA 4X6OA 1UK3A 2BZAA 1W7GH 2OBQA 2AGGX 3C1KA 3B9FH 2AMQA 1QA0A 1OWJA 4XE4A 1O39A 1O31A 2XBXA 1MQ5A 4OS6A 1CHOG 3SBKA 1HXFH 2AH4X 1THRH 3ZVBA 3A85A 1OP8A 2ODPA 5FPYA 1PPGE 3ZZCA 1VITH 2Z3CA 2FI3E 1BOQA 5A8ZA 4X8UH 1C5QA 2BHGA 3RXCA 1AE5A 2UUKB 1BMLA 2P3TB 1UO6A 1GVZA 5CE1A 1NT1A 4ZXYH 1DVAH 1AUJA 5JBAS 1TPPA 5E0GA 2ALPA 3ZVFA 1AQ7A 1XXDA 1YCPM 1A0HB 3ZVAA 1C5UA 1AVXA 5GDSH 2W5EA 5A0AE 3PYHA 3GCTF 2C4FH 1BTYA 2CV3A 3O8BA 1NFWA 1GHXH 2WINI 3V12A 2OC7A 1TGNA 3A84A 1V2MT 2XC5A 2M5TA 5DP6A 1J14A 2W3IA 2XBYA 1YBWA 1S82A 1G3EA 2GT7A 2ZU2A 1GI3A 5FPSA 1TBQH 1TLDA 1P06A 2EA3A 1K1NA 1S85A 5DJ7A 1OYQA 1LMWB 3LC5A 1F0RA 2P94A 2V35A 3LU9B 3TH2H 9LPRA 3MHWU 1FIWA 4B76A 2P8OC 2EI7A 2VGCC 2J92A 1T8MA 3MU0A 2NWNA 4NZLA 1SGTA 3WY8A 5DGJA 1CU1A 4D7FA 2WPJS 2C93B 1EASA 4I8JA 4ASHA 2OXSA 2A4GA 4MG3A 3GY7A 4OS1A 3O8RA 1BBRK 3HK3B 4K1EA 1P02A 2GDDA 3ATLA 1TGTA 3LH3A 1HV7A 1MU6B 2ZPRA 1AWFH 4X2XA 2XYAA 1QBNA 5C5NA 1HRTH 1KYNA 1Z6JH 2CN0H 3OY6U 1HNEE 4JZIA 1BA8B 2ZF0H 3BG4B 1Q3XA 4MPWA 1UTNA
chains in the Genus database with same CATH superfamily
1TIOA 1C1MA 4WVPE 1H1BA 1GBFA 3GCTG 3C27B 1RD3B 3WWBA 2ANKH 1COWD 1H8DH 4K1TA 2BDBA 1CSOE 2WZQA 5E2PA 4A1XA 5F53A 1F5KU 1TALA 1TGCA 2V0BA 4Q63A 4ZXXH 1A3EH 4NIYA 1PPCE 1EFRD 1GI0A 2EEKA 1ELTA 1HPGA 6ESTA 1TX6A 1E36B 1DFPA 3FN8A 1O5FH 1PPFE 3SV8A 1YPGH 1WYKA 2PKSC 2SNWA 3HKIB 1W8BH 1YGCH 1TYNA 1DSUA 1S5SA 2XNDD 1RTKA 4AFZA 4YM9A 1DLEA 1ANEA 1UTPA 4A92A 1VCPA 3V13A 2C90B 2PGBB 5DP4A 4B1TA 2K1QA 2SGPE 4GUXA 1DWCH 2Z94A 4CREA 3BTHE 4BAHB 3RXBA 3S69A 1AN1E 4ACBA 4DT7B 3F6UH 1FI8A 1AI8H 1SFQB 1JBUH 4AB8A 1C4Y2 2FOEA 3BN9A 4I7YH 1YCPH 1GBLA 5EOKA 1P04A 1C2IA 4Y0YE 1ZJDA 2P8OB 1X7AC 2VGCB 2PGQB 2FI4E 3K6ZA 1T4UH 3OTJE 3KHVA 2FXRA 1SVPA 3LONA 1N1LA 5F03A 3SU6A 3GOVB 5J4QA 2WYGA 1QJ7B 3GY6A 5T6DA 4LXBH 3TVJB 4HGCA 1O3CA 5DP9A 1JMOH 5FHTA 4B2BA 1G3CA 3SUGA 1SHYA 1SGEE 1Q2WA 4ZCNA 1DE7H 1C2GA 1A0JA 3TGJE 4NIXA 5IK2D 4OS5A 3SQEE 1NM6A 1UTOA 2GTBA 3ODDA 4IGDA 2Z9KA 4O97A 2A5KA 2OLGA 1A4WH 5EQQA 1O3OA 1QFKH 1W3CA 1BRCE 2A7CA 2RG3A 3LIWA 3A8AA 2ZGBH 3MNBA 1UHBA 3D62A 3EE0B 3P8FA 4BOHA 4IS5A 3EYDA 4I8GA 1QL9A 1OWEA 2VINA 1C1OA 4CH2B 1TRYA 1HJAC 2BX3A 2BXUH 3SNEA 1TRNA 4XDEA 1MU8B 1GG6C 3M3SA 3GY2A 1C1WH 2PKSB 1K21H 2VWLA 3LGUA 3DSOA 4P00A 2ZNKH 2BDGA 3RXHA 3UNQA 4X0WU 2FEQH 3V3MA 1MQ6A 1G3BA 2NU4E 1QNJA 4BTUB 2BZ6H 2ZTZA 4ZKRU 3S9AA 3NUMA 4Z0KA 1K22H 3PRDA 2VIPA 1UTMA 3D49H 5CHAC 2QXJA 1YPKH 4X1SU 3W94A 2VU8E 2THFB 4WXVA 3A86A 3UR6A 3RXMA 1UVPA 3UNSA 2HRVA 3H7TA 1C1PA 1K28D 3FANA 4ABEA 2J2UA 1VKYA 5JBTA 1YLDA 4XD7D 1ZR0A 2I6QA 2BOKA 3F0OA 2Y81A 3LH1A 2L74A 1ZPBA 3F9GA 4GHTA 2FIRH 1AU8A 1VITF 5C2ZA 3M5LA 3U28C 1NN6A 4ISNA 3P70B 1GGDB 3F0PA 5HMAA 2FX4A 1C5XB 4JZFH 4ISHH 5DKMA 4NCYA 2P59A 4AFQA 5F6MA 3TITA 3NXPA 1F2SE 3TJVA 8GCHF 1NESE 3BTKE 3K6YA 4I8KA 5DK1A 1Z8IB 1BBRH 2AFQB 1AFEH 2VWOA 1PPHE 2R0KA 4O9VA 2HWLB 2BX4A 2PW8H 2O8UA 1AVGH 2EC9H 3DCLA 4NSYA 1EZUC 1C1SA 4YESB 1W0ZU 4WMFA 3RXFA 2D1JA 1FN6A 2H5CA 5DP8A 2SGFE 5K7RA 1HAPH 1JIRA 1P3EA 1H9HE 3STJA 3DFLA 4RKJB 4CHAC 1H8HD 4I86A 3ZZ3A 1EP6A 3EAJA 1HJAB 1HDTH 1LVBA 4BAOB 2KX4A 1ZHRA 1ABIH 1MZDA 3BTME 1GG6B 1Z6EA 2YMSC 3MU4A 3PMJA 3ZVCA 5HYOA 3QWCH 1NU9A 4H4FA 2BDYA 1O2ZA 1KY9A 5ESTE 2Z9GA 2A4RA 2KCOA 3UB0A 4CBOA 2R9PA 4AYVB 1DITH 3G01A 1S84A 2QYIA 3ATMA 3PV4A 4Y8XA 5GXPA 2VIQA 3TJNA 1F0UA 4NFEA 1TNGA 1UTKA 1WQSA 3SHCH 2ZHWH 1O2QA 1ZTLA 4TPYA 3AW1A 1EZSC 1LTOA 2NU0E 4CH8B 5EQSA 1FV9A 8GCHG 1BJUA 2P3FH 1Y5BT 1INCA 1SFIA 2CF9H 3VPKA 3M5NA 4LOYH 1EZQA 1P2QA 2BDAA 1O0DH 1JRSA 1V2UT 4YOJA 2FS9A 1GBIA 1ANDA 2CGAA 4JZDH 2YNAA 1XX9A 5ABWA 2BVXH 3A80A 1SMFE 1HUTH 3F2FA 2GDEH 3RXIA 4BAKB 3MU8A 1P05A 2ZGJA 3TGKE 1E38B 1ZTKA 4NWKA 2BY6X 4Z6AH 1P2JA 3AASA 1P8VC 3RXKA 2BLVA 3LKWA 3S9CA 1EJMA 3PLKA 3RXOA 2GMTC 1O33A 4D7GA 1OWIA 1W12U 1TMTH 3SU3A 1AE8H 3GY8A 1HAIH 1OWHA 2G4UA 5JB8S 3MMGA 4UDWH 4XBDA 2F9PA 2SGDE 1G37A 4X2WA 3HK6B 4I8HA 3P6ZB 1MD8A 4BXWA 4H42U 1BIOA 2EI6A 2ZDMA 2FP7B 1GJ8B 1MZAA 1VCQA 3GCHB 2QV1A 1JXPA 1C1RA 3HATH 4UONA 1O2VA 3ZZDA 4U2WA 4BAQB 5IYTA 1C2HA 1O5EH 1E37B 2G52A 4B6EA 1DICA 1UJ1A 4QT8C 1BDAA 3MFJA 3PO1C 4JK5A 2JJ2D 3DFJA 3SN8A 3TNTA 3E0PB 2A45B 3QZQA 3DA9B 3VB5A 2PSXA 1J17T 3DHKH 4MTBA 3ZZ7A 3M7UA 3ZZBA 1A5HA 1NRQH 4ABAA 2GZ7A 3F1SB 1C2JA 2FO9A 4INLA 4K8YA 1ZMJA 5HM2A 1DOJA 4YO9A 2VWNA 3V7TA 1WV7H 1JOUB 3T28A 2ZU4A 1PQ7A 1W0KD 1ZTJA 1EUFA 2BM2A 2V3MA 2J38A 1V2OT 2PFEA 4NG9H 2QY0B 2IOTA 4U30A 3E3TA 1TPOA 4DIHH 1JRTA 4UFEH 1EB1H 1C4V2 1IQKA 1O2KA 4OM9A 3VB7A 2GV6A 1EXFA 2WUCA 2Y82A 2A31A 3SU0A 2TGPZ 1BTPA 3LT3A 3F9HA 3Q3KA 4BTTB 3O8CA 3RM0H 4SGAE 1BBRE 3ATIA 2B8OH 1CT4E 3T2NA 2Q6GA 1NRRH 2XOKD 1EPTA 5L6NH 2GMTB 4NIVA 1LQEA 5TCCA 5C94A 1GI9B 1GBMA 2ZC9H 1W7XH 1S0QA 3P8OA 2HNTC 2TPIZ 2QF4A 1NFUA 4D76A 2ZQ1A 4K69A 1EKBB 1NTPA 2WV5A 3CS7A 2ANMH 5FL7D 5AF9H 3RDZA 5EQRA 1N8OB 5A0BA 4U32A 1GBHA 1L4ZA 2PUXB 2PP6A 1IOEA 1D3DB 1OX1A 3OY5U 5DO4H 3FFGA 3VFEA 1V2QT 2CK3D 2V6NA 5LPEA 3KN2A 1CA8B 1JIMA 2F9NA 3TK9A 1D9IA 1QHRB 4X1PU 3OEED 3R3GB 5CHBA 5K0HA 1BRBE 1TNHA 3BF6H 3TLOA 3MOCA 3URDA 2FLRH 3F9EA 4X8TH 1O2RA 2RDLA 2TGTA 2L6OA 3D23A 2ANWA 3A7TA 2A0QB 4ZKNU 3MH7A 3RU4D 1P9UA 1W11U 2Y5GA 4ZROA 2Y5HA 2XBWA 4K8BA 5A09A 4A1TA 1FY4A 4F55A 2R3UA 3E8LA 1PPBH 3FAOA 4H6TA 1C9PA 2H6MA 2UWLA 3SYJA 5HXFA 2G5VA 1CHGA 1O2PA 1KTSB 5LH8A 4GLYA 1BZXE 4RI0A 1O5DH 4JYTA 3WW7A 4NZQA 2B7DH 3MU1A 2QCYA 1VR1H 1O3JA 1ZZZA 1BTWA 1ELCA 3BG4C 4WMEA 4AC9A 1V3XA 2ZFPH 4UD9H 1O32A 2XC4A 1P3CA 2PTCE 1SG8B 4ABJA 2D2DA 5DG6A 4AYYB 3SORA 1L2EA 3PTBA 2DE8A 1YP9A 2FMJA 1AY6H 5JB9S 4JMYA 4Q80A 1OYTH 1QTFA 3BEUA 3PMBB 1XKAC 1CA0B 4CRCA 2FTMA 5E8EH 1GJ4H 2OTVA 3LJOA 4YLQH 1GHVH 2XWBI 1MBQA 4K5ZA 1HB0B 3VEQB 1UHBB 2W26A 4XBCA 4AX9H 1Y3UA 1XUKA 3OYPA 4IMQA 1EAUA 5GIBA 2WPHS 4ABDA 1NS3A 5FCKA 4DT4A 2AYWA 1L4DA 1GI8B 4YOGA 1QY6A 1TNJA 1VGCC 3T26A 1TRMA 2ZZUH 2VH6A 2XW9A 3BTWE 4NGAH 1GJBB 1BRUP 1ZSKA 2ZCLP 1H9IE 3U8RH 2GX4A 1O3LA 1J9CH 1O2OA 2J97A 1SC8U 1V6DA 2V3HH 2FDAA 1XUFA 1LKAA 3TJOA 1L1GA 3PWCA 3EDXB 1L1JA 2ZI2H 2JJ1D 2GT8A 2ZDKA 2TGAA 1PQ8A 1T8LA 2JIZD 1B7XB 2ZPSA 1D3PB 2PLXA 1GDUA 5AFYH 2OK5A 3EE7A 1G2MA 1GJDB 1GHBF 5C20A 2C8WB 4HFPB 2W7SA 2P16A 1P09A 1YY3A 2F91A 1GJ7B 2NU3E 2F9VA 1D3TB 4MLFB 1AIXH 2GJGA 2QE7D 2VIOA 3M7QA 3FOAA 2R2MB 1QQUA 3ZZ6A 4Y7AA 5JYIA 1NZQH 4FUFA 3VG8A 2QAAA 1SR5C 1DY8A 4Y71A 5FX6A 2OC1A 2HPPH 2ZFTA 3MO6A 1C5MD 1OWKA 4IN1A 4CRBA 1S6FA 3U8OH 1P11E 2FESH 3SU4A 4OS7A 3FZZA 3MH4A 2EI8A 1T8NA 1DUEA 1YF4A 3F2HA 2VH0A 2ZDNA 3SUDA 4GSOA 1HBTH 3RU4T 3PWBA 1GI2A 2QF5A 4F48B 4WH6A 3UWJH 3STIA 1TA2A 1A46H 1DDJA 1NRSH 1PFXC 1OP2A 1YLNA 4K3JA 2GV7A 3TK5A 2ZHEH 2P3UB 2TIOA 1VZQH 2AMPA 1AZZA 2WHXA 4XBBA 4TY6A 3SV7A 6LPRA 1DS2E 2AS9A 2NU2E 3UQOA 1VGCB 1PJPA 3CENA 2BY8X 3ODFA 1SLXB 3GS9A 1GHBG 2CMYA 1TB6H 3O8DA 4X1RU 2PR3A 4KELA 3ZZAA 1GL0E 1WCZA 1ORFA 1SGRE 1YPMH 3EQ0H 1O3EA 2ZFFH 3GICB 4ABIA 1J8AA 2VVUA 2K8IA 3PV2A 2UUFB 3E90B 3BEFB 1F5LA 4X2VA 2BVSH 7ESTE 3PTNA 1ACBE 1O2SA 2SNVA 1IQIA 1AFQC 1EAXA 3SZNA 4RN6A 2ZP0H 1LVMA 2PSYA 1ARBA 1GI7B 4OGYA 3VGCB 4ASUD 5GWZA 1GHWH 1HAXB 1GGDC 1GHAF 4K60A 1BHXB 3R0FA 4YZUA 1BRAA 2BB4A 2J34A 3BTTE 3UFAA 4GHQA 1ELEE 2GCHF 6GCHF 5F8ZA 3EA8A 4FUEA 1SLWB 5DSFA 3M37A 2BD3A 1ZSJA 2AHME 2KAIA 3ZYEA 2YOLA 3NKKA 1A2CH 5B6LA 4A5TS 1SGPE 3DT0H 2BDHA 4CRGA 1LDTT 3BIUH 5AVDA 1FJSA 1ESBA 1CT0E 3TK6A 5DN6D 1DM4B 1C5PA 2Z3DA 1D3QB 1EP5A 3U8TH 2FS8A 2FYRA 3UREA 2J94A 1DWBH 3Q76A 3CS0A 1GBTA 1YWUA 1RTLA 2R2WU 2WPMS 1LHDH 4WF8A 3QZRA 4AFUA 4IC5A 3NK8A 3ZVDA 1H9LB 1FPHH 4RT1A 3SNAA 4YOIA 1WOFA 4Q7YA 4THNH 1FUJA 2FOFA 1GHAG 1NRPH 2FI5E 2VIDA 5ESBA 1FMGA 4FETA 2ZFQH 1BUIA 4TSFD 3RXRA 5C67A 2DUCA 1TNIA 4Y8ZA 1Y3YA 1J15A 1IHSH 2A2XH 1O2MA 3DUXH 2ZHFH 1P03A 1P10A 1PYTD 2GCHG 6GCHG 4CRAA 1Y8TA 1HAVA 2BTCE 1Z71A 1ESAA 2KCAA 3T5FH 2A5IA 1C5TA 3OX7U 2OP9A 3ZV8A 5C1UA 1AWHB 3EGKH 4INKA 2VB0A 1EATA 1PQAA 3FKSD 1AFQB 1EAWA 4X1NU 4AN7A 1ZRKA 1Z8GA 1YPLH 5B6OA 3TPIZ 1A61H 5HKKD 2R0LA 2ZU3A 2HVXA 2FOGA 3V0XA 1QJ6B 2JDID 3RC5A 2FODA 4XFQA 1FX0B 3SHAH 2FZZA 3QK1A 1QZ8A 4B2CA 1MCVA 1TONA 3D65E 1LO6A 1C5SA 1ABJH 3QX5H 3A88A 4Y10E 1GPZA 1O2XA 1QQ4A 4TY7A 5GCHF 4DCDA 1O38A 1IQNA 3E0NB 1NBME 3KQCA 1KXBA 1ETTH 1O2IA 4AZ2B 1NFYA 1ELAA 4E06H 2ZGCA 1EZXC 2H2ZA 1K0HA 1HAYB 1O2HA 5EG4A 1QL8A 2K0QA 5FBEA 1C2KA 3SO3A 2OBOA 1XUHA 1DUAA 1TABE 2GVFA 2OD3B 1AZ8A 4DG4A 1EPTB 3GCHC 4MQAA 5BPEA 2BLWA 4FUIA 1E1RD 1FY5A 1K1LA 1SHHB 5FXLA 1GVLA 4KP0A 4JZ1A 3AK5A 1SQOA 2Q1JA 3DSPA 4ZAEA 3QLPH 1S6HA 2Y7XA 3L6PA 1SPJA 3GCOA 4B74A 2PWXA 2J5UA 3TJUA 2ZTXA 3P8NA 2F9BH 4NIWA 2G55A 3MH5A 5EGMA 1EOJA 3S7KB 3RXJA 2ZFRH 5LPFA 2FWWA 3LPRA 5AHGH 1ZSLA 4I31A 1N6YA 2WYJA 2HPQH 2BLQA 4FU9A 2AIPA 8ESTE 1TGSZ 5ETXA 3RXPA 5GJ4B 5C17A 2VBCA 2AERH 3LDXH 1EJNA 5GCHG 2BVRH 5LPRA 4HG6A 4NWLA 4LK4A 1HLTH 3PB1E 2WSSD 1BTXA 1LPZB 1P57B 1KXAA 1VCWA 4UFGH 1GBBA 2HALA 4F4OC 3SV9A 1HJ8A 4DW2U 1TX8A 2ASUB 1SOZA 1BQYA 1CGHA 4WY3A 3VB3A 4CBNA 1QB9A 1TBRH 1UCYK 2CJIA 3RXTA 5EIYA 3UAIC 1MTUA 1GCTB 4XOJA 2F3CE 3A81A 1MKXK 3QTOH 4MVNA 2KCPA 3A7ZA 5A8YA 3A7XA 1BTUA 1GJCB 4KKDA 1XUIA 4ABFA 3SJIA 4E7NA 1G3DA 2H9HA 1TQ7B 3ZIAD 1KXFA 3TH4H 5T1VA 1GJ6A 1P2MA 3A8BA 3BTFE 1S0RA 1W13U 1BJVA 1N8OC 1IAUA 1P9SA 3BTQE 3BIVH 1FZZA 2FOBA 3MQKC 4NSVA 2KM0A 3UOUA 1O3FA 1AB9C 3HPTB 5EJZA 3IITA 3AAUA 1K2I1 1GWAA 3QGJA 2Y6TA 3QDZB 1SOTA 3UIRA 3FP7E 2XTTB 1THSH 1L1NA 3AAVA 1K1MA 1T31A 2WV4A 1RS0A 3ZYDA 2ZDLA 3SUEA 4MNVA 3LGWA 4DIIH 3ELAH 2I6SA 1UTQA 5L30H 1EQ9A 1GJ5H 1O35A 3HGNA 4FUBA 5A2MH 4JK6A 4GVUA 4KGAA 2FX6A 2BMGB 4OGXA 2QF3A 3KCGH 3ZZ4A 3N7OA 3A89A 1XXFA 2HOBA 5LGOA 4RT0A 1O37A 1BITA 1UVOA 3BTEE 2FYQA 1ZOMA 1MBMA 1QJ1B 1IQFA 1LHEH 1O2NA 3UNRA 1FAKH 4Y0ZE 4KTCA 1B0FA 1O2JA 1ZHPA 4A1VA 3L33A 1ZGIA 3K9XB 1ZHMA 3A82A 3BEIB 1HCGA 2O8LA 4KTSA 1QR3E 2P95A 1Y3VA 1KDQA 2ZCKP 1AHTH 1O3AA 1FNIA 1PPZA 3MTYA 1O3IA 1OXGA 1HIAA 2OC0A 1MABB 2B9LA 1Z8RA 1Z1IA 1H8IH 2Z9IA 3ATKA 5JBBS 1ANCA 4WH8A 3SZEA 2BQWB 1QB6A 3ZZ8A 4AG1A 1NFXA 1TMBH 2Y80A 3M35A 4GAWA 3ATWA 2HNTE 3TH3H 4CRDA 4INHA 3GDVA 1CA0C 1LHCH 1XM1A 2GZ8A 1QBOA 6CHAC 3GYLB 5C3NA 1Z7KA 4R0IA 1O2LA 4NA7A 1AVWA 5JPMH 2CF8H 4BTIB 5E2OA 1AB9B 2BD9A 3RXQA 4F49A 4ZMAH 1PQ5A 2KZ4A 3UWIA 3PRBA 1P2KA 2BDIA 1TNKA 3SGBE 2Z6BD 2F83A 1ETSH 1O3NA 1GBKA 1O3MA 1BCUH 3GISB 4H6SB 3QUMP 4AFSA 1ELDE 3F68H 1FDPA 1RGQA 3A8DA 1HJ9A 3SOSA 4I33A 3L3TA 2CHAC 2J9NA 5C0TA 1CQQA 1O3PB 2AMDA 4B2AA 3JZ2B 1SQTA 3BTDE 1L0ZA 1V2NT 3ZV9A 5BRRE 1CO7E 5EXMA 3N99A 2JH5D 3SU5A 4E7RG 1UMAH 1H4WA 1WXRA 1A5IA 1BTZA 4ISLA 1YPHC 2G81E 1YPHE 3E91A 4YXWD 4ISIH 2O8MA 4MPVA 3I77A 2KCYA 1K1IA 2XRCA 3PLBA 2HNTF 2UUJB 1QB1A 2G00A 3A83A 4JZEH 2EQNA 2WV9A 1WTGH 1RIWC 4Y76A 2J98A 2ZFSA 3BV9B 3SV2H 3SJKA 1MMJN 4X6MA 3SNDA 5J4SA 4LZ4B 4FUJA 1OOKB 4K2YA 4FUCA 2BD4A 2QC2A 1MKWH 1UCYH 1W0YH 1AKSA 1RTFB 4DURA 4ESTE 6CHAB 1QL7A 3NZIA 5PTPA 1WTHD 5FAHA 1MKXH 3SNCA 1F0SA 1THPB 2A2QH 2YNBA 2ZCHP 1OS8A 1HFDA 2KAIB 4IC6A 1GHYH 2BYAX 3SW2B 1MTVA 1TMUH 4WXIA 1S81A 4ZHLU 8LPRA 1C2MA 1C4U2 3MNCA 4X8VH 3U1IB 2H9EH 1XUGA 3LGTA 1JWTA 2D26C 3ITIA 1OP0A 2IPHA 3ZVEA 1DWDH 4X6NA 4GCHF 2FLBH 5T6GA 1GVKB 3P17H 1MUEB 1O5BB 2SGEE 1MTNC 1V2LT 2GD4B 4RSPA 1C5VA 4NFFA 1RRKA 4FVDA 3M3VA 4B73A 5A0CA 2UWPA 1O3DA 2SFAA 3SQHE 4O03A 2HLCA 2CHAB 1AUTC 2STAE 3UUZA 2JKHA 1ZYOA 1Z1JA 3SU2A 1ANBA 1XKBC 1O30A 1ZJKA 1O2TA 2RCEA 1HAHH 4TWWA 5JBCS 4FU8A 1KLJH 2PTNA 3P92A 1GHZA 4Y8YA 3KQEA 3VGCC 1BMMH 1NU7B 3PMAB 1Y3WA 2FTLE 1GBAA 1GL1A 2RA3A 3MWIU 3RMOH 2ZDAH 1K1OA 1H8ED 5E0JA 3RUOA 1HAVB 1WUNH 1SGNE 1K1PA 2A7JA 3MNSA 1PYTC 5SGAE 3KQDA 2VVCA 1KXEA 3QGNB 2IJOB 1W0JD 3K65B 5I25A 1GI1A 1A0LA 4K1SA 1RIWB 3RMNH 1T8OA 1UTJA 2A5AA 7LPRA 1SL3A 4GCHG 2CXVA 3RLYH 2VJ1A 2LNCA 5DP5A 1OKXA 1DANH 3RXGA 1YM0A 2A4QA 2F4LA 3FP6E 5T3HA 3RXAA 2GCTC 2GKVE 1CT2E 5EJ1A 2ZG0H 1GBEA 3BSQA 5EW1H 2LP6A 1ELBA 4TYDA 3MNXA 3KQBA 2PUQH 2R3YA 1MAXA 2ZHDA 1ARCA 4YT7H 1W14U 4AB9A 5C0UA 1YYY1 5I46H 3U69H 1C5WB 5DP3A 1SGFG 4J2YB 2ZQ2A 2FOCA 3A7VA 1HXEH 1C5NH 1V2RT 2AIQA 1AD8H 2FPZA 2PKAA 2ZA5A 3SUFA 4ABGA 1A3BH 1V2VT 1YC0A 1O36A 2RDEA 1MTNB 1IQGA 1FXYA 2H5DA 1HAGE 2XBVA 3Q3YA 1DXWA 5H4IB 2GP9B 5FBIA 3Q00A 1QIXB 4Q7XA 3OFND 2WPLS 3GCNA 1C1UH 1IHTH 1UVTH 2BD8A 2XNIA 2IPQX 4FOUC 1DLKB 2PV9B 1S83A 5EXLA 1G32B 4A6LA 4FUHA 1Y3XA 1GBCA 3KYFA 1BHXF 4SGBE 4DOQA 1KXCA 3LC3A 4Q2KA 1NO9H 3E16B 2Z7FE 4UEHH 2W3KA 4TPIZ 3MO9A 1E0FD 2KFWA 1N6XA 3AVZA 1DPOA 1GI6A 3IG6B 2Q6FA 4JYUH 3S9BA 1C5ZB 1OPHB 2WPKS 1XVOA 2RA0A 3RMLH 3RXDA 1FY1A 2F9UA 2FOHA 3Q3XA 2A32A 1QRZA 1XVMA 1TE0A 3M5OA 2G51A 1K9OE 3M61U 2XCNA 3VXEH 1CGJE 1F92A 2RFKC 1GBJA 1FONA 1RXPA 2ZHQH 5HGGA 1QBVH 5TCAA 1GMHF 4X1QU 4FXGH 4AGJA 1UCYE 2ESTE 2ZGHA 1NC6A 2VIWA 3ENSB 2IJD1 3ESTA 4MNYA 4OS4A 1CGIE 2XC0A 1LPGB 2HLDD 3H09A 2QXGA 2GCTB 5EODA 3PROA 4DY7B 1ELFA 4FUDA 1GMCF 1EPTC 4J1YA 1ZLRA 4DJZB 4UFFH 2WPIS 4VGCC 1NPMA 4IN2A 4PROA 5DPAA 1TA6A 3E6PH 2GZ9A 3B23B 1W2KH 1O34A 2G4TA 1RFNA 4DVAU 2HVYB 1SGDE 1DY9A 1M9UA 1A7SA 2SGAA 2VNTA 4YLUA 1SQAA 4WMDA 1G9IE 4YT6H 1KTTB 1O3GA 1B0EA 3RXLA 4AGKA 3RP2A 1KLTA 1LHGH 3KL6A 2QXHA 1EAIA 4X8SH 2ZIQH 4UE7H 2F9OA 1IQLA 1QGFA 1ID5H 3SJOA 1O3BA 3RLWH 2QA9E 3LGIA 1TWXB 1J16A 5F8XA 2ZDVH 3PMHB 1C5LH 1KSNA 2O9QA 2BDCA 3KYGA 1YPEH 4M9FA 1IQHA 1O3HA 4WWYA 1DT2A 4I32A 3QO6A 2O8TA 2ZKSA 1CVWH 2XCFA 4HTCH 1P2NA 1FPCH 1GDQA 1SB1H 3SJ8A 2BOHB 2UUYA 1K1JA 1GMHG 1SGQE 4MPUA 3P8GA 3QN7A 3P95A 4NA8A 3DSGA 1P2IA 4ACAA 1TAWA 4Y7BA 3ZZ5A 4LZ1H 2JH6D 3U9AH 3TIUA 3LOXA 2KR7A 1ESTA 1E35B 2XXLA 5DP7A 1EX3A 1WQVH 2H9TH 2HGTH 1TFXA 3MU5A 5FPTA 3TU7H 1GMCG 1W10U 1D6RA 3KQ5A 2QIQA 1YKTA 4ZUHA 1E1QD 1GMDF 1ELGA 1GCTC 1SGFA 3F9FA 1A5GH 1SSXA 1WU1A 2BD7A 3PV5A 2VVVA 2O8WA 4NA9H 3VB4A 2QF0A 3OSYA 1UTLM 2BXTH 3KEEA 4CR9A 1FQ3A 1NY22 1C1QA 3BG8A 5T6FA 5C1YA 1ZRBA 2G5NA 1KDQB 5GPIB 1YPJH 5EU8A 1IQMA 1HYLA 1HIAB 1O2WA 1B5GH 2JH0D 2FOAA 1LHFH 1SBWA 3H5CB 5L2YH 3FP8E 4IMZA 2W6ID 4ABBA 3RM2H 1HAOH 3S7HB 1ETRH 2SGQE 4WJG2 5HIZA 3GYMA 4VGCB 2JETC 1G30B 3MO3A 3SU1A 4B75A 4D9QA 1DSTA 3GY3A 3M7TA 1O2YA 4IBLH 2BY5X 1OWDA 1BMNH 2VWMA 1ZGVA 3GDUA 5G4BA 1HGTH 3CP7A 4OS2A 4D9RA 2D8WA 2ZU1A 1ZMLA 1SGYE 2Y7ZA 3AW0A 3NCLA 4FVBA 1MAYA 3GY5A 3LGVA 3T29A 1Y59T 1F5RA 3OAAD 3QTVH 3EA7A 4AORA 1V2PT 2OQ5A 1GMDG 1AO5A 1O2UA 2B0FA 3I29A 1GJAB 4FUGA 2XWAA 1P2OA 1C2EA 1G36A 1UVSH 3LJJA 2ZTYA 4B71A 4Y6DA 1D6WA 1CBWC 1TQ0B 1FN8A 1VITG 1WAYB 1C1TA 2ZPQA 2QGRA 2C8ZB 1LKBA 1C1NA 3KF2A 2GGVB 3JZ1B 1GDNA 5CHAB 1QCPA 4AOQA 1TBZH 4ZKSU 3VB6A 1MTSA 3KNXA 1V2TT 2Q6DA 1UK4A 4X2YA 3UQVA 4Y11E 3RU4E 4Z1MD 1NROH 3FO8D 2EY4C 4U01A 5C5OA 1QURH 1TGBA 4E05H 1MKWK 4O3TA 3I78A 4HZHA 2Z9LA 1UK2A 1ELVA 1FLEE 7GCHF 1MH0A 4AG2A 4BANB 1BMAA 1VJAU 4BAMB 1O3KA 5EPNA 4R8TB 4BXSA 2C8YB 3PLPA 2ULLA 1D4PB 1T32A 2AEIH 1UW7A 4MNXA 3U98H 4YTAA 2ODYB 1FIZA 3EA9A 1T4VH 1Z8JB 1GBDA 1LVYA 2F43B 2LPRA 4TWYA 2C3SA 3Q77A 1LVOA 1Y5AT 1DX5M 3OEHD 1GI5A 2OCVB 4GPGA 4Y79A 2J98B 2PHBA 1SI5H 3TNSA 2BQ6B 4I8LA 4ISOA 4ZHMU 4CRFA 2BY7X 2ZGXH 3FVFB 3M36A 1KXDA 3SGAE 3UY9A 2JETB 1TPSA 1HAZB 4UFDH 3SJ9A 4A7IB 1AKSB 1QA7A 1GJ9B 3BTGE 2C8XB 4MPXA 3A8CA 3TGIE 2AGIX 1SGCA 1SKYE 5F8TA 3MYWA 4CHAB 3MI4A 1TPAE 2ZECA 3RMMH 4MDSA 1WSSH 1LPKB 1EJAA 4MNWA 1O5CB 1AMHA 1C2FA 2P93A 1ZMNA 5EXNA 3M5MA 1E34B 1QRXA 2YMSB 1C9TA 3RC6A 3UOPA 1DWEH 7GCHG 1OSSA 5EPYA 5EJLA 2ALVA 3RXSA 4X6PA 1KIGH 1CBWB 3SGQE 1IQJA 3UPEA 7KMEH 2WUBA 3RXEA 1DXPA 2Z9JA 4O3UA 1U6QA 1YLCA 2G8TA 1SLUB 2Z3EA 1T7CA 1OHHD 1O2GH 3LGYA 2BQ7B 3GY4A 1FY3A 1LQDB 2A4OA 4CR5A 1C2DA 1SGIB 4ABHA 5C1XA 1V2KT 5HM9A 3GDSA 1P0SH 2BD2A 2J4IA 2QN5T 1P12E 2ANYA 1C5YB 1UVUH 1V2JT 2ZU5A 2BD5A 2B5TB 3PM3A 3U1JB 1G2LA 3E1XB 2V3OH 5E0HA 4XSKU 3T62A 2A7HA 3RXUA 2UWOA 1Y5UT 3A87A 3OE7D 1NBMD 2J95A 4HI3A 3SI3H 3A7WA 2V7QD 1QRWA 1ZPCA 2FM2A 4FU7A 1TOMH 5KGOA 2AGEX 1BT7A 1GCDA 1ZPZA 3FZDA 3KGPA 3NWUA 2W7UA 3T25A 3VXFH 1FY8E 1XUJA 3IWMA 4B6FA 2ZWLH 1NRNH 5L2ZH 1C5RA 2A1DB 2TGDA 2ZEBA 5HIYA 4P02A 1LCYA 1RJXB 3SI4H 2QXIA 3B8JA 1TNLA 2ZO3H 5AFZH 1V2WT 5FX5A 2OINA 4IW4E 2YMSD 2FOMB 5GNDA 2TBSA 5IDKA 1V2ST 1F0TA 2ODQA 3MH6A 3ZZ9A 1TOCB 3ZVGA 1MTWA 1SLVB 2BY9X 1XMNB 1BTHH 2STBE 3S0NA 2H1UA 1CHOF 1C1VH 3N7DA 1GI4A 1CE5A 4ZH8A 3A7YA 3K2UA 5JDUB 3M3TA 3RXVA 1TX7A 1KLIH 4BNRA 1O5AB 5FCRA 3KIDU 1C5OH 3H7OA 1YCPK 3UR9A 1C2LA 3NPSA 1Q31A 3F3BA 8KME2 3W95A 3UTUH 1O5GH 2LELA 1EB2A 4JYVH 1MCTA 5EW2H 4RKOB 2PKAB 1VJ9U 4M7GA 3PO1B 5CMXH 1PPEE 2ILNA 9ESTA 3SV6A 4JCNA 2NU1E 3SNBA 1IQEA 3URCA 2Y5FA 1SQRA 1A1RA 2BLOA 2OC8A 3RC4A 4D8NA 3T27A 5TJXA 1F7ZA 1AGJA 2OQUA 2OUAA 4ZHAA 4ZKOU 1WBGB 2TRMA 3HGPA 2DE9A 1FAXA 4DGJA 5A8XA 1S6LA 3DD2H 1BB0B 3OU0A 3HKJB 1EOLA 2IN2A 1MD7A 1P01A 2M2AA 2VIVA 4KTUA 4Q7ZA 4X6OA 1WDIA 1UK3A 2BZAA 1W7GH 2AGGX 2OBQA 3C1KA 3B9FH 5KEDA 2AMQA 1QA0A 1OWJA 4XE4A 1O39A 1O31A 2XBXA 1MQ5A 4OS6A 1KMHB 1CHOG 3SBKA 1HXFH 2AH4X 2WPDD 1THRH 3ZVBA 3A85A 1OP8A 2ODPA 5FPYA 1PPGE 3ZZCA 1VITH 2Z3CA 2FI3E 1BOQA 2W6JD 4X8UH 5A8ZA 1C5QA 2BHGA 3RXCA 1AE5A 5KECA 3OTPA 2UUKB 3NRLA 1BMLA 2P3TB 1UO6A 1GVZA 5CE1A 1NT1A 4ZXYH 1DVAH 1AUJA 5JBAS 1TPPA 3W1EA 5E0GA 2ALPA 3ZVFA 1AQ7A 1XXDA 1YCPM 1A0HB 3ZVAA 1C5UA 1AVXA 5GDSH 2W5EA 4Q4LA 5A0AE 3PYHA 3GCTF 2C4FH 1BTYA 2CV3A 3O8BA 1NFWA 1GHXH 2WINI 3V12A 2OC7A 1TGNA 3A84A 1V2MT 2XC5A 2M5TA 3F2GA 5DP6A 1J14A 2W3IA 2XBYA 1YBWA 1S82A 1G3EA 2GT7A 2ZU2A 1GI3A 5FPSA 1TBQH 1TLDA 1BMFD 1P06A 2EA3A 1K1NA 1S85A 5DJ7A 1OYQA 1LMWB 3LC5A 1F0RA 2P94A 2V35A 3LU9B 3TH2H 9LPRA 3MHWU 1FIWA 4B76A 2P8OC 2EI7A 2VGCC 2J92A 3CNRA 1T8MA 3MU0A 4TT3D 2NWNA 4NZLA 1SGTA 4XRNA 5DGJA 3WY8A 1CU1A 4D7FA 2WPJS 2C93B 1EASA 4I8JA 4ASHA 2OXSA 2A4GA 4MG3A 5CDFE 3GY7A 4OS1A 3WWFA 3O8RA 1BBRK 3HK3B 4K1EA 1P02A 2GDDA 3ATLA 1TGTA 3N7EA 3LH3A 1HV7A 1MU6B 1E79D 2ZPRA 1AWFH 4X2XA 2XYAA 1QBNA 5C5NA 1HRTH 1KYNA 1Z6JH 2CN0H 3OY6U 1HNEE 4JZIA 1BA8B 2ZF0H 3BG4B 1Q3XA 4MPWA 1UTNA
chains in the Genus database with same CATH topology
1TIOA 1C1MA 4WVPE 1H1BA 1GBFA 3GCTG 3C27B 1RD3B 2ANKH 1H8DH 4K1TA 2BDBA 1CSOE 5E2PA 4A1XA 1F5KU 1TALA 1TGCA 2V0BA 4ZXXH 1A3EH 4NIYA 1PPCE 1GI0A 2EEKA 1ELTA 1HPGA 6ESTA 1TX6A 1E36B 1DFPA 1O5FH 1PPFE 3SV8A 1YPGH 1WYKA 2PKSC 2SNWA 3HKIB 1W8BH 1YGCH 1TYNA 1DSUA 1S5SA 1RTKA 4AFZA 4YM9A 1DLEA 1ANEA 1UTPA 4A92A 1VCPA 3V13A 2C90B 2PGBB 5DP4A 4B1TA 2K1QA 2SGPE 4GUXA 1DWCH 2Z94A 4CREA 3BTHE 4BAHB 3RXBA 3S69A 1AN1E 4DT7B 3F6UH 1FI8A 1AI8H 1SFQB 1JBUH 4AB8A 1C4Y2 2FOEA 3BN9A 4I7YH 1YCPH 1GBLA 5EOKA 1P04A 1C2IA 4Y0YE 1ZJDA 2P8OB 1X7AC 2VGCB 2PGQB 2FI4E 3K6ZA 1T4UH 3OTJE 3KHVA 2FXRA 1SVPA 3LONA 1N1LA 5F03A 3SU6A 3GOVB 5J4QA 2WYGA 1QJ7B 3GY6A 5T6DA 4LXBH 3TVJB 4HGCA 1O3CA 5DP9A 1JMOH 5FHTA 4B2BA 1G3CA 3SUGA 1SHYA 1SGEE 1Q2WA 1DE7H 1C2GA 1A0JA 3TGJE 4NIXA 4OS5A 3SQEE 1NM6A 1UTOA 2GTBA 3ODDA 4IGDA 2Z9KA 4O97A 2A5KA 2OLGA 1A4WH 5EQQA 1O3OA 1QFKH 1W3CA 1BRCE 2A7CA 2RG3A 3LIWA 3A8AA 2ZGBH 3MNBA 1UHBA 3D62A 3EE0B 3P8FA 4BOHA 4IS5A 3EYDA 4I8GA 1QL9A 1OWEA 2VINA 1C1OA 4CH2B 1TRYA 1HJAC 2BX3A 2BXUH 3SNEA 1TRNA 4XDEA 1MU8B 1GG6C 3M3SA 3GY2A 1C1WH 2PKSB 1K21H 2VWLA 3LGUA 2ZNKH 2BDGA 3RXHA 3UNQA 4X0WU 2FEQH 3V3MA 1MQ6A 1G3BA 2NU4E 1QNJA 4BTUB 2BZ6H 2ZTZA 4ZKRU 3S9AA 3NUMA 4Z0KA 1K22H 2VIPA 1UTMA 3D49H 5CHAC 2QXJA 1YPKH 4X1SU 3W94A 2VU8E 2THFB 4WXVA 3A86A 3UR6A 3RXMA 1UVPA 3UNSA 2HRVA 3H7TA 1C1PA 1K28D 3FANA 4ABEA 2J2UA 5JBTA 1YLDA 1ZR0A 2I6QA 2BOKA 2Y81A 3LH1A 3F9GA 1ZPBA 4GHTA 2FIRH 1AU8A 1VITF 5C2ZA 3M5LA 1NN6A 4ISNA 3P70B 1GGDB 5HMAA 2FX4A 1C5XB 4JZFH 4ISHH 5DKMA 4NCYA 2P59A 4AFQA 5F6MA 3TITA 3NXPA 1F2SE 3TJVA 8GCHF 1NESE 3BTKE 3K6YA 4I8KA 5DK1A 1Z8IB 1BBRH 2AFQB 1AFEH 2VWOA 1PPHE 2R0KA 4O9VA 2HWLB 2BX4A 2PW8H 2O8UA 1AVGH 2EC9H 4NSYA 1EZUC 1C1SA 4YESB 1W0ZU 4WMFA 3RXFA 2D1JA 1FN6A 2H5CA 5DP8A 2SGFE 5K7RA 1HAPH 1JIRA 1P3EA 1H9HE 3STJA 3DFLA 4RKJB 4CHAC 3ZZ3A 1EP6A 3EAJA 1HJAB 1HDTH 1LVBA 4BAOB 1ZHRA 1ABIH 1MZDA 3BTME 1GG6B 1Z6EA 3MU4A 3PMJA 3ZVCA 5HYOA 3QWCH 1NU9A 4H4FA 2BDYA 1O2ZA 1KY9A 5ESTE 2Z9GA 2A4RA 4CBOA 2R9PA 4AYVB 1DITH 3G01A 1S84A 2QYIA 3ATMA 3PV4A 4Y8XA 5GXPA 2VIQA 3TJNA 1F0UA 4NFEA 1TNGA 1UTKA 1WQSA 3SHCH 2ZHWH 1O2QA 1ZTLA 4TPYA 3AW1A 1EZSC 1LTOA 2NU0E 4CH8B 5EQSA 1FV9A 8GCHG 1BJUA 2P3FH 1Y5BT 1INCA 1SFIA 2CF9H 3VPKA 3M5NA 4LOYH 1EZQA 1P2QA 2BDAA 1O0DH 1JRSA 1V2UT 4YOJA 2FS9A 1GBIA 1ANDA 2CGAA 4JZDH 2YNAA 1XX9A 5ABWA 2BVXH 3A80A 1SMFE 1HUTH 2GDEH 3RXIA 4BAKB 3MU8A 1P05A 2ZGJA 3TGKE 1E38B 1ZTKA 4NWKA 2BY6X 4Z6AH 1P2JA 3AASA 1P8VC 3RXKA 2BLVA 3LKWA 3S9CA 1EJMA 3PLKA 3RXOA 2GMTC 1O33A 4D7GA 1OWIA 1W12U 1TMTH 3SU3A 1AE8H 3GY8A 1HAIH 1OWHA 2G4UA 5JB8S 3MMGA 4UDWH 4XBDA 2F9PA 2SGDE 1G37A 4X2WA 3HK6B 4I8HA 3P6ZB 1MD8A 4BXWA 4H42U 1BIOA 2EI6A 2ZDMA 2FP7B 1GJ8B 1MZAA 1VCQA 3GCHB 2QV1A 1JXPA 1C1RA 3HATH 4UONA 1O2VA 3ZZDA 4U2WA 4BAQB 5IYTA 1C2HA 1O5EH 1E37B 2G52A 1DICA 1UJ1A 4QT8C 1BDAA 3MFJA 3PO1C 4JK5A 3DFJA 3SN8A 3TNTA 3E0PB 2A45B 3QZQA 3DA9B 3VB5A 2PSXA 1J17T 3DHKH 4MTBA 3ZZ7A 3M7UA 3ZZBA 1A5HA 1NRQH 4ABAA 2GZ7A 3F1SB 1C2JA 2FO9A 4INLA 4K8YA 1ZMJA 5HM2A 1DOJA 4YO9A 2VWNA 3V7TA 1WV7H 1JOUB 3T28A 2ZU4A 1PQ7A 1ZTJA 1EUFA 2BM2A 2J38A 1V2OT 2PFEA 4NG9H 2QY0B 2IOTA 4U30A 3E3TA 1TPOA 4DIHH 1JRTA 4UFEH 1EB1H 1C4V2 1IQKA 1O2KA 3VB7A 2GV6A 1EXFA 2WUCA 2Y82A 2A31A 3SU0A 2TGPZ 1BTPA 3LT3A 3F9HA 3Q3KA 4BTTB 3O8CA 3RM0H 4SGAE 1BBRE 3ATIA 2B8OH 1CT4E 3T2NA 2Q6GA 1NRRH 1EPTA 5L6NH 2GMTB 4NIVA 1LQEA 5TCCA 1GI9B 1GBMA 2ZC9H 1W7XH 1S0QA 3P8OA 2HNTC 2TPIZ 1NFUA 4D76A 2ZQ1A 4K69A 1EKBB 1NTPA 2WV5A 3CS7A 2ANMH 5AF9H 3RDZA 5EQRA 1N8OB 5A0BA 4U32A 1GBHA 1L4ZA 2PUXB 1IOEA 1D3DB 1OX1A 3OY5U 5DO4H 3FFGA 3VFEA 1V2QT 2V6NA 5LPEA 3KN2A 1CA8B 1JIMA 2F9NA 3TK9A 1D9IA 1QHRB 4X1PU 3R3GB 5K0HA 1BRBE 1TNHA 3BF6H 3TLOA 3MOCA 3URDA 2FLRH 3F9EA 4X8TH 1O2RA 2RDLA 2TGTA 3D23A 2ANWA 3A7TA 2A0QB 4ZKNU 3MH7A 3RU4D 1P9UA 1W11U 2Y5GA 4ZROA 2Y5HA 2XBWA 4K8BA 5A09A 4A1TA 1FY4A 2R3UA 3E8LA 1PPBH 3FAOA 4H6TA 1C9PA 2H6MA 2UWLA 5HXFA 2G5VA 1CHGA 1O2PA 1KTSB 5LH8A 4GLYA 1BZXE 1O5DH 4JYTA 4NZQA 2B7DH 3MU1A 2QCYA 1VR1H 1O3JA 1ZZZA 1BTWA 1ELCA 3BG4C 4WMEA 1V3XA 2ZFPH 4UD9H 1O32A 2XC4A 1P3CA 2PTCE 1SG8B 4ABJA 2D2DA 5DG6A 4AYYB 3SORA 1L2EA 3PTBA 2DE8A 1YP9A 2FMJA 1AY6H 5JB9S 4JMYA 4Q80A 1OYTH 1QTFA 3BEUA 3PMBB 1XKAC 1CA0B 4CRCA 2FTMA 5E8EH 1GJ4H 2OTVA 3LJOA 4YLQH 1GHVH 2XWBI 1MBQA 4K5ZA 1HB0B 3VEQB 1UHBB 2W26A 4XBCA 4AX9H 1Y3UA 1XUKA 3OYPA 4IMQA 1EAUA 5GIBA 2WPHS 4ABDA 1NS3A 5FCKA 2AYWA 1L4DA 1GI8B 4YOGA 1QY6A 1TNJA 1VGCC 3T26A 1TRMA 2ZZUH 2VH6A 2XW9A 3BTWE 4NGAH 1GJBB 1BRUP 1ZSKA 2ZCLP 1H9IE 3U8RH 2GX4A 1O3LA 1J9CH 1O2OA 1SC8U 1V6DA 2V3HH 2FDAA 1XUFA 1LKAA 3TJOA 1L1GA 3PWCA 3EDXB 1L1JA 2ZI2H 2GT8A 2ZDKA 2TGAA 1PQ8A 1T8LA 1B7XB 2ZPSA 1D3PB 2PLXA 1GDUA 5AFYH 1G2MA 1GJDB 1GHBF 5C20A 2C8WB 4HFPB 2W7SA 2P16A 1P09A 2F91A 1GJ7B 2NU3E 2F9VA 1D3TB 4MLFB 1AIXH 2VIOA 3M7QA 2R2MB 1QQUA 3ZZ6A 4Y7AA 5JYIA 1NZQH 4FUFA 2QAAA 1SR5C 1DY8A 4Y71A 5FX6A 2OC1A 2HPPH 2ZFTA 3MO6A 1C5MD 1OWKA 4IN1A 4CRBA 1S6FA 3U8OH 1P11E 2FESH 3SU4A 4OS7A 3FZZA 3MH4A 2EI8A 1T8NA 1DUEA 1YF4A 2VH0A 2ZDNA 3SUDA 4GSOA 1HBTH 3RU4T 3PWBA 1GI2A 4WH6A 3UWJH 3STIA 1TA2A 1A46H 1DDJA 1NRSH 1PFXC 1OP2A 4K3JA 2GV7A 3TK5A 2ZHEH 2P3UB 2TIOA 1VZQH 2AMPA 1AZZA 3SV7A 4XBBA 4TY6A 6LPRA 1DS2E 2AS9A 2NU2E 3UQOA 1VGCB 1PJPA 3CENA 2BY8X 3ODFA 1SLXB 1GHBG 2CMYA 1TB6H 3O8DA 4X1RU 2PR3A 4KELA 3ZZAA 1GL0E 1WCZA 1ORFA 1SGRE 1YPMH 3EQ0H 1O3EA 2ZFFH 3GICB 4ABIA 1J8AA 2VVUA 2UUFB 3E90B 3BEFB 1F5LA 4X2VA 2BVSH 7ESTE 3PTNA 1ACBE 1O2SA 2SNVA 1IQIA 1AFQC 1EAXA 3SZNA 4RN6A 2ZP0H 1LVMA 2PSYA 1ARBA 1GI7B 4OGYA 3VGCB 5GWZA 1GHWH 1HAXB 1GGDC 1GHAF 4K60A 1BHXB 3R0FA 4YZUA 1BRAA 2BB4A 2J34A 3BTTE 3UFAA 4GHQA 1ELEE 2GCHF 6GCHF 5F8ZA 3EA8A 4FUEA 1SLWB 3M37A 2BD3A 1ZSJA 2KAIA 3ZYEA 2YOLA 3NKKA 1A2CH 4A5TS 1SGPE 3DT0H 2BDHA 4CRGA 1LDTT 3BIUH 5AVDA 1FJSA 1ESBA 1CT0E 3TK6A 1DM4B 1C5PA 2Z3DA 1D3QB 1EP5A 3U8TH 2FS8A 2FYRA 3UREA 2J94A 1DWBH 3Q76A 3CS0A 1GBTA 1RTLA 2R2WU 2WPMS 1LHDH 4WF8A 3QZRA 4AFUA 4IC5A 3NK8A 3ZVDA 1H9LB 1FPHH 3SNAA 4YOIA 1WOFA 4Q7YA 4THNH 1FUJA 2FOFA 1GHAG 1NRPH 2FI5E 2VIDA 5ESBA 1FMGA 2ZFQH 1BUIA 3RXRA 5C67A 2DUCA 1TNIA 4Y8ZA 1Y3YA 1J15A 1IHSH 2A2XH 1O2MA 3DUXH 2ZHFH 1P03A 1P10A 1PYTD 2GCHG 6GCHG 4CRAA 1Y8TA 1HAVA 2BTCE 1Z71A 1ESAA 3T5FH 2A5IA 1C5TA 3OX7U 2OP9A 3ZV8A 5C1UA 1AWHB 3EGKH 4INKA 2VB0A 1EATA 1PQAA 1AFQB 1EAWA 4X1NU 4AN7A 1ZRKA 1Z8GA 1YPLH 5B6OA 3TPIZ 1A61H 2R0LA 2ZU3A 2HVXA 2FOGA 3V0XA 1QJ6B 3RC5A 2FODA 4XFQA 3SHAH 2FZZA 3QK1A 4B2CA 1MCVA 1TONA 3D65E 1LO6A 1C5SA 1ABJH 3QX5H 3A88A 4Y10E 1GPZA 1O2XA 1QQ4A 4TY7A 5GCHF 4DCDA 1O38A 1IQNA 3E0NB 3KQCA 1KXBA 1ETTH 1O2IA 4AZ2B 1NFYA 1ELAA 4E06H 2ZGCA 1EZXC 2H2ZA 1HAYB 1O2HA 5EG4A 1QL8A 5FBEA 1C2KA 3SO3A 2OBOA 1XUHA 1DUAA 1TABE 2GVFA 2OD3B 1AZ8A 4DG4A 1EPTB 3GCHC 4MQAA 5BPEA 2BLWA 4FUIA 1FY5A 1K1LA 1SHHB 5FXLA 1GVLA 4KP0A 4JZ1A 1SQOA 2Q1JA 4ZAEA 3QLPH 1S6HA 2Y7XA 3L6PA 1SPJA 3GCOA 4B74A 2PWXA 3TJUA 2ZTXA 3P8NA 2F9BH 4NIWA 2G55A 3MH5A 5EGMA 1EOJA 3S7KB 3RXJA 2ZFRH 5LPFA 2FWWA 3LPRA 5AHGH 1ZSLA 4I31A 1N6YA 2WYJA 2HPQH 2BLQA 4FU9A 2AIPA 8ESTE 1TGSZ 5ETXA 3RXPA 5GJ4B 3LDXH 2AERH 1EJNA 5GCHG 2BVRH 5LPRA 4NWLA 4LK4A 1HLTH 3PB1E 1BTXA 1LPZB 1P57B 1KXAA 1VCWA 4UFGH 1GBBA 2HALA 4F4OC 3SV9A 1HJ8A 4DW2U 1TX8A 2ASUB 1SOZA 1BQYA 1CGHA 4WY3A 3VB3A 4CBNA 1QB9A 1TBRH 1UCYK 2CJIA 3RXTA 1MTUA 1GCTB 4XOJA 2F3CE 3A81A 1MKXK 3QTOH 4MVNA 3A7ZA 5A8YA 3A7XA 1BTUA 1GJCB 4KKDA 1XUIA 4ABFA 3SJIA 4E7NA 1G3DA 2H9HA 1TQ7B 1KXFA 3TH4H 1GJ6A 1P2MA 3A8BA 3BTFE 1S0RA 1W13U 1BJVA 1N8OC 1IAUA 1P9SA 3BTQE 3BIVH 1FZZA 2FOBA 4NSVA 3UOUA 1O3FA 1AB9C 3HPTB 3IITA 3AAUA 1K2I1 1GWAA 3QGJA 2Y6TA 3QDZB 1SOTA 3UIRA 3FP7E 2XTTB 1THSH 1L1NA 3AAVA 1K1MA 1T31A 2WV4A 1RS0A 3ZYDA 2ZDLA 3SUEA 4MNVA 3LGWA 4DIIH 3ELAH 2I6SA 1UTQA 5L30H 1EQ9A 1GJ5H 1O35A 3HGNA 4FUBA 5A2MH 4JK6A 4GVUA 4KGAA 2FX6A 2BMGB 4OGXA 2QF3A 3KCGH 3ZZ4A 3N7OA 3A89A 1XXFA 2HOBA 5LGOA 1O37A 1BITA 1UVOA 3BTEE