1UK2A

Crystal structure of sars coronavirus main proteinase (3clpro) at ph8.0
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
302
structure length
302
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-LIKE PROTEINASE
publication title The crystal structures of severe acute respiratory syndrome virus main protease and its complex with an inhibitor
pubmed doi rcsb
source organism Sars coronavirus
total genus 76
structure length 302
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1uk2A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uk2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uk2A02
2C8YB 1RIWB 1H8IH 4AG1A 2FOAA 4K1TA 3A8DA 1H8DH 4Q7ZA 2BHGA 1RXPA 4DT7B 2BDGA 1NFUA 1QR3E 1V2KT 2O8LA 4UE7H 2EEKA 1PPCE 1MQ6A 1ZJKA 1P3EA 1HPGA 3FFGA 4B2CA 4E06H 4A1TA 1J17T 3UFAA 3LJJA 2O8TA 1MKXK 1HJ8A 4PROA 2ZPRA 1SGFG 4CREA 4JYVH 2VVVA 2O9QA 1BRCE 1YPGH 5DGJA 3VEQB 2OC0A 1S85A 3LJOA 1A2CH 2A2XH 1W3CA 2BD7A 1G36A 4FUEA 1SBWA 4Y8YA 1YC0A 2ZDLA 3PMBB 4ZKOU 1GBAA 1V3XA 3CS0A 4X0WU 3M36A 3FVFB 1W11U 3P8GA 4AX9H 1CA0B 1ZRKA 1Y3UA 2OUAA 2GV6A 1T8OA 4J1YA 2ZNKH 4YTAA 2JKHA 1CVWH 4D7GA 3O8RA 4IN2A 5LPFA 6GCHF 3D65E 3M37A 3HPTB 2JETC 2TGAA 4BAMB 3SO3A 3DD2H 1FIZA 1TYNA 3A7YA 1AWHB 3SU4A 1GVLA 5EXLA 1MCTA 1ELCA 1IQHA 3MO6A 1SC8U 1RTFB 1OWHA 1O3AA 1AU8A 3A80A 4O97A 1XUIA 3VXFH 3KQBA 4WMFA 4FVDA 1AQ7A 3RXCA 1O5DH 1W12U 5DP7A 1DVAH 1TNHA 2XBWA 1Z8RA 3LIWA 4Y10E 3SN8A 1SLWB 2A7CA 4VGCC 4RKOB 1C5WB 4J2YB 4Y8ZA 3OSYA 2Y5GA 5I46H 2FLRH 1O2LA 1D3QB 2R2WU 2VIWA 3L33A 2VWOA 1GJDB 3BN9A 1O30A 5A09A 3Q3YA 1E0FD 1WUNH 1O39A 4CBOA 4LZ4B 3L6PA 1VCWA 3RMLH 4BAOB 1MBQA 1P3CA 2VH0A 1MQ5A 3LPRA 1QA7A 2ZGJA 4NSYA 8LPRA 2FTMA 1YPMH 1IQFA 3ZV8A 1P2OA 2FEQH 4H6TA 3ZZ8A 4YOIA 1MKWK 2OC7A 1T4VH 2VJ1A 2BD5A 3RMOH 1ZPBA 1FXYA 1V2TT 1CU1A 5FXLA 1DOJA 5EG4A 1NFXA 1P03A 2QY0B 3AVZA 1TMUH 1HJAC 1HV7A 1THPB 3A7WA 2UWOA 1SFQB 1L1JA 5JBBS 1Y5UT 4UFDH 1PPHE 3RU4D 5EXMA 1UTNA 1UTPA 1ZZZA 1JMOH 5K0HA 1O2QA 2GVFA 1LCYA 3RLYH 4B73A 2G4TA 4BANB 1O2XA 2GZ9A 2I6QA 1C1TA 3JZ1B 3ZZ3A 3SUGA 1LHFH 1TBZH 2HGTH 4GVUA 3RXEA 1LTOA 1TX7A 2XC4A 3TK6A 1Y5AT 4SGBE 3S69A 5LPEA 5C5OA 2XCFA 4X2WA 1TPOA 2LNCA 1ANCA 1IQMA 3A8AA 4ZROA 1HAXB 1N1LA 1AIXH 1AN1E 1KXBA 1SLUB 1OPHB 4INHA 1HAZB 3B23B 2ESTE 2ZGCA 3SJKA 4ABGA 3A86A 1BB0B 1ZR0A 1YCPM 1IHTH 1HAGE 1BMLA 4TWWA 2Y81A 2AGGX 4K3JA 3GY3A 3T29A 3TK9A 1BUIA 1P11E 1CA8B 2R0LA 3UQVA 1L4DA 1FI8A 3STJA 1FAKH 1RJXB 1SGTA 4I8GA 1NN6A 2SNVA 4JK5A 1A0LA 1GBTA 3PO1B 5LPRA 3SUEA 1V2JT 2ZPSA 1G2MA 1E37B 1G30B 1VGCC 2XRCA 3M7TA 2Z7FE 3LC3A 3I77A 3G01A 2ZHEH 1GL0E 2JH0D 1ACBE 1Y8TA 2C4FH 2VIQA 1AD8H 3EGKH 1BRAA 2VVCA 3S9CA 1THSH 3BEIB 2HOBA 1GI7B 2M5TA 3SV7A 1BTZA 1P05A 1GJ4H 5DP6A 1GHZA 1GBJA 3AAUA 3GYMA 1VJ9U 4Y76A 3RXMA 3TVJB 3V3MA 1O2TA 1GJCB 2PW8H 1NT1A 1EB1H 3NWUA 1FPHH 1HAHH 5FAHA 4ABAA 4ABHA 2J34A 4FUCA 5DK1A 2BQ6B 2CHAB 5CHAC 1C5ZB 2YNBA 2F83A 2XXLA 2QXGA 4MPXA 2GV7A 2FS8A 1YBWA 3T62A 1L1GA 1GBKA 1SHYA 4GHQA 2ZI2H 5HM2A 2OBOA 1O5AB 3NXPA 3EA7A 4B1TA 4HTCH 1C5VA 1GHAF 1GI0A 3SJOA 2CXVA 1TQ7B 1LPGB 2XWBI 1P2JA 1DXPA 4X8TH 2LIZA 3RXTA 1SGYE 1XXFA 3BG4B 4AYVB 3RXDA 1F0TA 1GMHF 1ZGVA 3ZZ6A 2ZTZA 1A0HB 1YPKH 4K1SA 3JZ2B 2O8UA 1BMNH 5GWZA 3ZVEA 2NU0E 1NESE 3HKIB 1GBIA 1XM1A 2PFEA 1AE8H 1NM6A 3QWCH 3N7OA 4X8SH 3TH4H 4K8YA 2A0QB 1DS2E 2YOLA 3QLPH 2A31A 3QDZB 4ZKRU 5FHTA 3QZQA 2PKAB 2P3TB 3UWIA 2J2UA 2Z9IA 1O5GH 3KL6A 1AVWA 1C5LH 4E7RG 3BV9B 3T2NA 2VGCB 2BDBA 4UDWH 3RXIA 1WQVH 3U8TH 2PUQH 4INLA 4YZUA 4D76A 2ZEBA 5GXPA 1ELBA 1SGIB 4U01A 1UCYK 4B75A 1P01A 4CHAB 1HFDA 1VJAU 2H5DA 3TGIE 4DY7B 2FI5E 1U6QA 4BTUB 1G3CA 4XOJA 5A8YA 1DE7H 2AFQB 1DX5M 3O8BA 1AB9B 3GY2A 2BB4A 3QGJA 1RFNA 3U1IB 1MKXH 4DGJA 4FXGH 1O2KA 1QURH 1ETSH 2GMTC 4JMYA 3UNSA 1K1IA 2VIVA 1PYTC 8GCHF 2A5IA 1YPJH 1RIWC 4RSPA 1QL7A 3M5MA 1GHVH 1K1MA 4KKDA 2QYIA 1ABJH 1Z6EA 3SV8A 3TJNA 1AUTC 1FY1A 3RDZA 3CENA 1XUGA 3RUOA 2A2QH 1ZTLA 2BLOA 4MVNA 5AHGH 1AVXA 1AHTH 1C1MA 1YM0A 4NZLA 3VGCB 1BJUA 1P04A 5C2ZA 3SNBA 2ZU2A 1EX3A 1BHXB 1UCYE 1MTUA 4ZAEA 1TA2A 3LU9B 5GCHF 5DP3A 2ZHDA 3TK5A 3RLWH 5EQSA 1CT0E 3MU1A 2FOHA 5AF9H 4CRAA 2ZFTA 4XBCA 5HYOA 1FN8A 2G5NA 2G8TA 6CHAB 2BX3A 4I33A 4IGDA 1CO7E 1CA0C 1C1QA 2CV3A 3OYPA 2BY8X 3A84A 2ANKH 1KTTB 1IHSH 2ZWLH 5F8XA 1TALA 2BM2A 1Z8JB 1EXFA 2FM2A 2PR3A 1WYKA 2Y80A 2ZCKP 2VIPA 3RXUA 3K65B 4Y71A 2Z3DA 1P10A 2FI3E 2I6SA 1UTMA 4XSKU 2FLBH 2ZDVH 1F2SE 2ZHWH 3A81A 1C1UH 1GJ8B 1YYY1 1WQSA 1EASA 4WMDA 3TITA 2TGTA 4AFUA 1ESAA 2FYRA 1O3HA 2FMJA 3LC5A 2ZGBH 1O2SA 4X8VH 2GX4A 3EE0B 2Y7ZA 5EXNA 3EAJA 4GUXA 5EPNA 2OCVB 1O2HA 4O3UA 2KAIB 4OS5A 2A5AA 2FESH 3MOCA 3MO3A 3GDUA 2UWLA 1KDQB 1AI8H 2ZQ1A 3LKWA 2A5KA 3GY4A 1P2QA 1WTGH 2GKVE 1K2I1 1O35A 2AGIX 3ZVAA 1EJNA 4I31A 2F3CE 2WYGA 5JPMH 1FV9A 3VPKA 3MFJA 2ZKSA 2PTCE 1W8BH 1Z71A 4F49A 2BTCE 1V2ST 3A85A 2BOKA 1KYNA 3AW0A 4GCHG 2IN2A 3QZRA 2JH6D 3TJOA 1JWTA 3A7ZA 2TPIZ 4JZDH 1HGTH 4K1EA 4UFGH 1BHXF 3HGNA 1HB0B 1OWIA 5DP8A 2H2ZA 1GBEA 4ZXYH 4YOJA 4HFPB 2G55A 4K69A 4ZHAA 4NA7A 1OXGA 1TNLA 3P95A 2WPMS 1OWEA 1O31A 1O2PA 1Y3WA 1VCQA 4YM9A 1ANEA 3RC6A 2F9NA 4TYDA 2P8OC 3LONA 2H9HA 5TCAA 1NZQH 1TMBH 5EOKA 2FXRA 2HVXA 7GCHG 2Z6BD 1PYTD 5EU8A 2ZA5A 4HI3A 3SNEA 1OS8A 1SHHB 1BA8B 3H7OA 2IPHA 1YPHE 3QTOH 5JB9S 3NUMA 2CGAA 3E91A 3KEEA 1V2WT 1YPEH 4FUGA 2B5TB 1EAXA 2FX6A 4FUFA 2HRVA 2HWLB 3S9AA 2ILNA 2SNWA 1FIWA 3KGPA 1Z7KA 3RU4T 1FN6A 1F5RA 2VH6A 3A82A 1WSSH 3MHWU 1AZZA 3B8JA 2D1JA 1O5EH 1HXFH 2VWLA 3RXAA 3KNXA 3O8DA 1P2IA 1ZGIA 5IDKA 3KQDA 1YCPK 2SGPE 2ZQ2A 3RXQA 2BQ7B 2IJOB 1GI1A 1L1NA 2FODA 4BXWA 1LVYA 1IAUA 3ZZAA 2XNIA 4I8HA 2ZG0H 2RA0A 2TBSA 1QJ1B 4XBDA 3RC4A 1ZYOA 1DT2A 1ZRBA 2OXSA 3PM3A 1GHBF 3PWBA 1XVOA 3PB1E 4MNWA 1GCTB 1UVSH 4NGAH 2QF3A 5ESBA 2Y5FA 5EQRA 4K2YA 1O3EA 3S9BA 1BMMH 1YLDA 3MMGA 4NIVA 4YT7H 1C1SA 1MZAA 1OWJA 5TCCA 3A83A 2O8WA 3RXRA 1LQEA 3GDVA 4NCYA 3RM0H 1C1NA 1O3MA 2J9NA 4TY6A 2ZCHP 3SBKA 2F9OA 4ABBA 1DM4B 1IQKA 2BY9X 4CR9A 3ZVCA 1F0UA 2B7DH 4B71A 5L6NH 1O2NA 3LOXA 1O2VA 1TGCA 2BOHB 1JRSA 1MTNB 1MU6B 3PLBA 1KLTA 1N8OB 2PSYA 4A1VA 4B2AA 5L30H 1BTWA 1FQ3A 2THFB 1QRZA 3TJUA 1K1PA 4DIHH 4X1PU 1C2IA 1DANH 1GI2A 3KIDU 4OGXA 3RC5A 2VU8E 2CHAC 4I32A 2Y7XA 3OY5U 3PMJA 1GMDG 1NRSH 3SJ8A 4JZ1A 1SL3A 4MLFB 1YPLH 3M7UA 1SGDE 1V2OT 3DUXH 1V2UT 1SQAA 1TE0A 4JK6A 1ARCA 1HIAA 1UO6A 2H1UA 3T26A 3H5CB 1L2EA 1EOLA 1UK4A 1EKBB 1VZQH 4BNRA 1CGHA 4AN7A 5L2ZH 4BAHB 3BG4C 1GBCA 3U69H 3P8FA 2WPIS 4XFQA 3UUZA 1N6XA 4Y0ZE 2QXHA 4RN6A 1GJ5H 4NZQA 5GDSH 2ZDNA 1AFQB 3GISB 3MNXA 2A7HA 1BDAA 2BD3A 2AERH 1FMGA 3BTGE 3SZNA 3DFLA 2ZGXH 1UCYH 1OYQA 1HJ9A 1K9OE 1D3DB 4R0IA 1GI9B 1AZ8A 1O2OA 5E0JA 1S0RA 2Z9JA 3GDSA 3ZVFA 1GCDA 1GJ6A 5C1UA 1ELAA 4JCNA 2ODPA 1O3IA 1LHGH 4Q2KA 2VIDA 1GVKB 1C1OA 3B9FH 3BTEE 3F68H 3FZZA 2W3IA 1D3PB 3RXSA 2A7JA 2BDCA 2VGCC 1BT7A 1HYLA 1ETRH 1SGFA 2HALA 4XE4A 1E34B 2BXTH 2P3UB 3SGAE 4HGCA 4CHAC 3M5NA 4AFZA 4ABDA 1V2PT 1W2KH 1UVPA 5T6GA 1TGNA 1O3FA 1E35B 4MDSA 1GWAA 3CP7A 4DVAU 1C9PA 2CN0H 4WXIA 1C5RA 1FY8E 2BVXH 1T4UH 3P8NA 2KAIA 1F0SA 1FY5A 3PWCA 1EP5A 1KDQA 1TMTH 1RD3B 3EA9A 2ZU5A 1V2RT 2AGEX 2BDHA 4CH8B 2ZDAH 2CMYA 1CHOF 2ZFPH 1OKXA 1O2IA 1QA0A 4LXBH 2NWNA 1O3GA 5SGAE 1ORFA 2CF9H 2BY6X 4LK4A 3VGCC 2K1QA 1IOEA 1SGRE 1XKBC 1ZTKA 4BTIB 1JRTA 2ANWA 1LO6A 1O3PB 3QX5H 1D6RA 1RTLA 4BAKB 3TIUA 3SQEE 1FONA 3F1SB 1QQ4A 1C1WH 1C2DA 1XUJA 2EI6A 1BMAA 4Y6DA 1OYTH 1PPEE 2G5VA 1C9TA 1TBRH 3SJIA 2BY5X 1MCVA 3U9AH 1C5SA 4A92A 4DURA 6CHAC 1DXWA 2EC9H 3SQHE 3M61U 4A1XA 1UK2A 1QB1A 4IS5A 1QJ7B 3TGJE 4O3TA 4OGYA 3T5FH 5E2OA 1ZHMA 3QN7A 3EYDA 1TGSZ 2RG3A 3GY8A 1G37A 3KQEA 1W10U 2V3HH 5AVDA 1UVOA 1A1RA 3MH7A 1WU1A 3TNTA 1FAXA 2RDLA 3KF2A 3NPSA 2Y6TA 2QF0A 2XTTB 5JYIA 1SOZA 5C5NA 3LDXH 3IG6B 2ANMH 2GD4B 1QNJA 1UVUH 4WVPE 5JDUB 2AEIH 5DP5A 1UVTH 2FP7B 1BRUP 3EA8A 3AW1A 1Q31A 3E0PB 4UD9H 1GBFA 1C5TA 3W95A 4JZFH 1T8MA 1LVOA 1UHBA 3IWMA 2ULLA 4CRDA 2OINA 1O3JA 1PQ5A 1S5SA 1JOUB 5FX6A 3T25A 1HAIH 3RXJA 1OP0A 1EZUC 1K1NA 2ASUB 2FI4E 2FWWA 1BBRK 3FZDA 1GG6B 3GCTF 1Q2WA 5A8ZA 3K2UA 2ZC9H 4FVBA 1SLVB 1O2ZA 1O33A 2WV4A 5BPEA 1CT2E 1SQOA 2W7UA 3MU4A 4Z0KA 2VB0A 1A61H 3RXPA 2K7XA 1SSXA 1SGQE 3PROA 3SGBE 4CH2B 1LMWB 2FS9A 1T8LA 4GPGA 1XKAC 1OOKB 1KLIH 3ATKA 1UTQA 2AMPA 1PQAA 1EPTB 2ZFSA 1VR1H 1ELVA 1A4WH 1ZMLA 4TPIZ 4AG2A 3K6YA 4NFEA 3BTWE 1DWDH 1ZOMA 3M5LA 3TH2H 4DG4A 2WV5A 2G4UA 3C27B 1SPJA 1BBRE 4Q7YA 3PMHB 4ASHA 5JB8S 5H4IB 3VXEH 1GBBA 4IMZA 2BXUH 3ZV9A 4CBNA 2H5CA 2CF8H 4ABJA 1SLXB 5EW2H 1H9HE 5F8TA 1ID5H 1RGQA 2FZZA 4JYUH 2JETB 3SUDA 2Q6FA 4FU8A 1MH0A 1BZXE 1A7SA 4Y8XA 5L2YH 1TRMA 1O2GH 2AS9A 1BTXA 1NPMA 1Q3XA 3NKKA 3A8CA 2C93B 1QBNA 3QTVH 3RXBA 3S0NA 2BD2A 1DPOA 4IC6A 4JZEH 4ABFA 4XDEA 3D62A 4NIYA 1ZPZA 4D9RA 3RXKA 1LDTT 4OS2A 2SGQE 1GJ9B 1DFPA 3BF6H 4HZHA 2NU3E 4JZIA 4BAQB 1BQYA 3T27A 2Q1JA 3F9HA 4E05H 1MTSA 2GGVB 4NWKA 2H6MA 1GCTC 2SGEE 3FP7E 4CRCA 1E36B 1NROH 2EI8A 4IW4E 3BEFB 3BTKE 1TX6A 1ARBA 1C4V2 4ABEA 3LH1A 2WPKS 1YP9A 1K21H 1TRYA 4ZMAH 1O32A 3ODDA 4NIWA 4WH6A 3ELAH 1KXDA 5DG6A 3M5OA 2DUCA 3ATIA 1C2KA 4WH8A 3SI3H 2BD4A 4H42U 1C5QA 1BTHH 1UTJA 5JBAS 4NA8A 1QIXB 1GHAG 1MTNC 3SORA 1N8OC 1P09A 1G3EA 2HPPH 4LOYH 2ZFQH 5C67A 3LH3A 4BOHA 1P9SA 4GCHF 4ZKNU 1BTYA 1OX1A 3HGPA 3MO9A 3FANA 1D9IA 4X8UH 3FAOA 3M7QA 4FUIA 4SGAE 3RM2H 3P8OA 1AKSB 4K8BA 3UNQA 1GMHG 1O2MA 4WMEA 2R3YA 2XYAA 5ETXA 3UTUH 3HATH 5IYTA 2Z3CA 1BTUA 4X6NA 2R3UA 2D2DA 5EQQA 3VB5A 2HLCA 2VVUA 2BYAX 3ATLA 2GT7A 1N6YA 5JBCS 3UR9A 3A89A 4MPVA 1GGDB 4CRGA 3MI4A 3UIRA 4ISNA 3F9FA 3UNRA 2BMGB 1C2FA 1TFXA 4ISOA 1O0DH 1LHCH 1O3CA 3ZVGA 2AYWA 1QTFA 3ZZCA 3GCOA 3PV4A 1ESBA 3M35A 3QK1A 1C5XB 2GZ7A 1B0EA 1OSSA 1ELFA 3MH4A 1HNEE 2BZ6H 2BZAA 3SNCA 2NU1E 1AFQC 3A88A 1SI5H 4KELA 1HXEH 4FU7A 5BRRE 1FPCH 1UMAH 2BX4A 1Z1JA 1CGIE 1C4Y2 1A3BH 2XWAA 3U8OH 2OTVA 1LQDB 1UTOA 1O2UA 1BIOA 1SQTA 1S82A 9LPRA 1XVMA 3HKJB 4MNYA 1NS3A 4K5ZA 1FJSA 1AY6H 3D49H 1A46H 1ETTH 1MKWH 1KXCA 1PQ8A 2SGAA 1P0SH 1NY22 2ZZUH 1DSUA 1PQ7A 5I25A 2W5EA 2ZF0H 3SU1A 3DHKH 3H7TA 3BIUH 4YOGA 4U30A 3MNSA 1F7ZA 1C2LA 2GT8A 1AFEH 5F8ZA 4DCDA 1DUEA 4MPUA 2TGDA 1PFXC 1C1PA 4NIXA 2RA3A 1TABE 3BTHE 3P6ZB 5EPYA 3EDXB 2OBQA 3GICB 1E38B 1S81A 2HNTE 3V13A 1HAPH 1O3OA 1LPZB 2V6NA 4R8TB 1WV7H 2XC0A 1C4U2 4D9QA 1G32B 4I8JA 4MQAA 2WPJS 1D3TB 2XBYA 1Y3YA 2ODYB 5HMAA 4ZH8A 1K28D 1ELTA 2GCHG 3HK6B 4NFFA 1F5KU 3BSQA 1GI8B 2UUKB 2ZO3H 3SU2A 2VWNA 4JYTA 3ZZDA 3S7HB 1OWKA 1LKAA 3PTNA 3MYWA 3AASA 2FOCA 2BVRH 2ZU4A 4KGAA 2D8WA 4ZHLU 1HCGA 1NFWA 1BJVA 1O36A 1YGCH 4X1NU 2PV9B 1QJ6B 1SGCA 4TY7A 1D4PB 2ZDKA 1SMFE 1B7XB 3SI4H 1NTPA 1Y3XA 1P9UA 2VIOA 1F92A 1VITG 3UQOA 3Q76A 2F9BH 1GI5A 1A3EH 1GHYH 3M3TA 1Y5BT 1KXAA 4IMQA 3BTQE 1LVMA 1ELGA 1T8NA 1EPTA 2YNAA 5C3NA 3URCA 1AWFH 2V3OH 1PPFE 1GMDF 1KSNA 3UR6A 4DIIH 1T31A 2PTNA 4WJG2 1INCA 5HM9A 1O2WA 1GMCG 4THNH 3SNDA 2ZFFH 1UK3A 4NWLA 1L4ZA 4UFEH 3P92A 4H6SB 1AE5A 5AFZH 4A7IB 4ESTE 1TNGA 4Y7AA 4I8LA 5EW1H 3K9XB 1HRTH 4FU9A 8KME2 2ZTXA 4WWYA 1IQGA 2BLQA 4Z6AH 5B6OA 1LVBA 3ITIA 1EUFA 3I78A 2FO9A 3PO1C 3PYHA 2TRMA 1AVGH 3BTME 3GY6A 1C2HA 1P2NA 2D26C 1HAOH 4ZUHA 1A5HA 1TPSA 1V2MT 2FX4A 1A5GH 3R3GB 1O38A 3ZZ7A 5T3HA 1GJBB 4GHTA 2OP9A 3VB6A 1S6FA 1TQ0B 1P2KA 2FOFA 3ZYDA 2PSXA 3OU0A 3P70B 1O34A 1HAVB 2PKAA 1GBDA 2BDIA 1KY9A 3SHCH 2LPRA 4X1RU 1GBMA 1GG6C 1TNJA 1QRXA 4ISHH 1GHXH 4X2VA 2R0KA 1THRH 2W26A 1XXDA 2QXIA 5DP4A 1ZHPA 1ANDA 5C1XA 3PLKA 3A7TA 2ZU3A 1KLJH 5FPTA 1SVPA 4AORA 1UJ1A 1J15A 1NRRH 1C5MD 4IN1A 2BDYA 1O3BA 1EPTC 2ZPQA 5EODA 3UREA 2PUXB 2J95A 2FOBA 1MZDA 3VB7A 1MAXA 1RS0A 3MTYA 2AIPA 4AOQA 1YPHC 1O5BB 3RMNH 8ESTE 1BTPA 3E0NB 2Q6DA 1OWDA 1QRWA 4FUDA 3KQCA 1QBVH 4D7FA 3VB4A 4GAWA 1XUKA 2PWXA 1CBWB 1W0ZU 1EJAA 4AB9A 1XMNB 3A7XA 2UUJB 2QCYA 3LGIA 1GDUA 2JH5D 5TJXA 3WY8A 4QT8C 3ESTA 1F0RA 1O2JA 5ESTE 1M9UA 1GI3A 1J14A 1SGNE 1W13U 2P93A 2P94A 3LT3A 3MU0A 1V6DA 1C2EA 1AKSA 3UWJH 1GHBG 1DY8A 4X6MA 3SHAH 2PHBA 1XUFA 3U98H 2BLWA 1EAWA 1AO5A 1C2GA 4MNXA 1EJMA 1SB1H 5A0AE 1EAIA 1G3BA 2ZECA 1C1VH 4I8KA 4KTUA 1YKTA 1O3KA 4X2XA 4OS6A 2GCTB 5DP9A 3C1KA 3ODFA 2EI7A 1NC6A 4Y7BA 2QC2A 1ELDE 1GJAB 1O3DA 1TIOA 1TONA 2A1DB 3SNAA 1IQNA 5DKMA 1TNIA 3BEUA 1HUTH 1AB9C 4UEHH 1QFKH 2GDDA 3SU5A 2PKSB 1J9CH 1P2MA 3RXFA 3F6UH 2VNTA 1TX8A 1S84A 2J4IA 2B9LA 5FCRA 4OS4A 4Y79A 4YO9A 2XW9A 4UONA 3FP6E 2OD3B 1GBHA 5ABWA 6LPRA 2F91A 1DITH 1TPAE 1TNKA 2G52A 6GCHG 1DWBH 3AAVA 3OY6U 1TWXB 2UUYA 2G81E 4H4FA 2A4RA 2ZDMA 1ELEE 1RTKA 2QA9E 3LGTA 4A5TS 3Q77A 2P8OB 1WAYB 2AIQA 5C20A 1A5IA 1ZHRA 5A2MH 4AB8A 1YF4A 5DO4H 3QGNB 2ANYA 2C3SA 3BTTE 3V7TA 1KIGH 4B2BA 4D8NA 2OQ5A 1KXFA 7LPRA 1MBMA 1C2MA 1EAUA 2NU4E 1RRKA 3E3TA 3E16B 2H9EH 1G2LA 1MD7A 1ESTA 3TJVA 3KCGH 1GGDC 2XCNA 1CQQA 2FYQA 3BIVH 2WPLS 1T32A 1HLTH 4MPWA 3GCHB 1JIMA 1GL1A 2ZCLP 4WXVA 1O3LA 3RXLA 1EB2A 2ZFRH 3DT0H 1TAWA 1FLEE 4X6PA 3BG8A 1IQIA 2F9PA 1EOJA 2F9UA 3ENSB 3ATWA 3MU8A 1MAYA 4LZ1H 1W7XH 3SUFA 5HXFA 4DOQA 1LKBA 2QXJA 3UOPA 4GSOA 2QV1A 2RCEA 2Z94A 4CRBA 3T28A 1BRBE 1FDPA 4CR5A 3W94A 4Q7XA 2FPZA 3RXOA 4INKA 1ZSLA 1H9IE 3DA9B 3PLPA 1IQEA 1SG8B 4FUHA 4KTCA 1TOMH 4BXSA 2ODQA 2Y5HA 1AUJA 3MH5A 4GLYA 5LGOA 1X7AC 3SGQE 1K1JA 2H9TH 1FUJA 1CHOG 1WOFA 1O37A 1BOQA 4AZ2B 4AFQA 1QB9A 2BDAA 1ANBA 1Z1IA 4FUBA 2STAE 1C5YB 3QUMP 2QIQA 3URDA 2BVSH 2BY7X 3SV6A 3D23A 1TLDA 4ABIA 2FIRH 3A87A 2W7SA 1IQJA 2A32A 5PTPA 1EATA 1W14U 3SV2H 2DE8A 3RXVA 5GJ4B 2HPQH 1HAVA 1PJPA 3R0FA 4Y0YE 1GI6A 3SJ9A 1NU9A 1OP8A 2A45B 1DICA 3E90B 5E2PA 1QHRB 5A0CA 2XBXA 1JBUH 2J94A 4AGJA 1VITH 4I7YH 1QGFA 4NA9H 4O03A 1YCPH 1OP2A 4ZHMU 3UPEA 1SGPE 2ALPA 1GJ7B 4BTTB 2G00A 2R9PA 4DW2U 2FTLE 1S83A 1LPKB 4IBLH 3NCLA 1TOCB 1TRNA 2TGPZ 1TBQH 3V12A 4IC5A 5LH8A 1C5PA 1L0ZA 1FY4A 2FOGA 2ALVA 4KTSA 3Q00A 4NSVA 2P59A 5GIBA 5FX5A 2UWPA 1H1BA 2ZIQH 1CGJE 5FCKA 3M3VA 4MNVA 4U2WA 5FBEA 4MTBA 1FY3A 1LHDH 1TGBA 1H4WA 1J8AA 1TA6A 3BTFE 3O8CA 1QBOA 4VGCB 4Y11E 5A0BA 2ZHQH 3MH6A 2HNTF 2Z9LA 5F6MA 3TGKE 4MG3A 1ABIH 1S0QA 1DDJA 3GCTG 7KMEH 3GOVB 2Z9KA 4A6LA 2G51A 2ZP0H 3ATMA 3U1JB 2SGDE 4B74A 2C8WB 2BD9A 1PPZA 1CHGA 4KP0A 2Y82A 3TH3H 2OC8A 3E1XB 2FDAA 1MMJN 3RMMH 2AH4X 4X1QU 3SU6A 1Z8IB 5CE1A 3U8RH 1Y3VA 1Z6JH 1ZMJA 3GY7A 3TNSA 1MD8A 1SFIA 4TPYA 3RXGA 3ZZBA 1TGTA 2BLVA 3V0XA 1HBTH 2OQUA 3LGVA 1PPGE 2P95A 1UTKA 2PGQB 4YLQH 4YT6H 3ZZ5A 4TWYA 4YESB 1V2QT 5C1YA 1ZMNA 1GI4A 2W3KA 1S6HA 1HJAB 1SR5C 3STIA 1DY9A 5J4SA 1HIAB 1G9IE 2J92A 1NU7B 2GTBA 1DSTA 1P12E 1V2LT 2V35A 4FUJA 1ZTJA 1DWEH 1P8VC 2P3FH 2SFAA 2BD8A 1CE5A 3SW2B 1ZLRA 3IITA 4X2YA 1MTVA 1C5NH 1WCZA 2A4OA 1GHWH 3ZZ4A 1O2YA 1QB6A 1HDTH 1QL8A 1V2NT 1NFYA 5E0GA 1W7GH 3MNBA 2UUFB 2GCHF 1ZJDA 4YLUA 3SV9A 2AMQA 5FBIA 2WYJA 3L3TA 1XUHA 2PGBB 2A4GA 1CSOE 1CBWC 3A8BA 4E7NA 1AMHA 3I29A 4F4OC 4CRFA 3OTJE 7GCHF 3PTBA 4O9VA 3HK3B 3VFEA 3ZVDA 4B76A 2C90B 1O5CB 1ZPCA 2GZ8A 2WINI 3BTDE 3FP8E 3Q3XA 2F9VA 1UTLM 5E0HA 3NK8A 1VITF 3F9EA 1C2JA 1GDQA 5A8XA 5J4QA 1O3NA 3F9GA 1WTHD 3LGYA 3MU5A 1QY6A 1V2VT 1C5UA 2V0BA 4U32A 1BCUH 2GP9B 4ZKSU 8GCHG 3GY5A 3S7KB 1VGCB 1EZQA 3RXHA 1AGJA 1GMCF 2FOEA 3M3SA 1H9LB 1KXEA 1QL9A 2Z3EA 2XC5A 4OS7A 5DJ7A 2P16A 1P02A 4K60A 1MTWA 2GCTC 1DLKB 1K1OA 5GPIB 5FPSA 1XX9A 5EGMA 4OS1A 3OX7U 2C8ZB 1ZSJA 1FNIA 3RU4E 1F5LA 2ZTYA 1SGEE 1EZSC 1P57B 1D6WA 2A4QA 2XBVA 3SOSA 2ZHFH 2WPHS 4ZXXH 2PKSC 3SU3A 3GYLB 1NO9H 1TB6H 5GCHG 1T7CA 1QCPA 4NG9H 3DFJA 3GCNA 1CT4E 1DLEA 1GBLA 2TIOA 2B0FA 4ISIH 1W0YH 7ESTE 5T6DA 4AGKA 5CHAB 4ISLA 2J38A 3Q3KA 1TPPA 1NRPH 2ZU1A 1K1LA 2WUCA 2QN5T 3CS7A 1C5OH 3LGWA 1A0JA 1Z8GA 1YLCA 1J16A 3PMAB 5HGGA 2FOMB 1GPZA 1DUAA 2VWMA 3QO6A 3EBNA 1P06A 5AFYH 1KTSB 4WY3A 4XBBA 2Q6GA 1GDNA 1EZXC 3UY9A 2R2MB 2STBE 5E8EH 1JXPA 1MUEB 1B5GH 1VCPA 5JBTA 4X1SU 1K22H 5F03A 1Y59T 1O2RA 2B8OH 3VB3A 3RP2A 1GVZA 1NRNH 1WBGB 1NRQH 3EQ0H 3TLOA 2AMDA 2IOTA 2PLXA 1MU8B 5T6FA 3NZIA 4DJZB 2SGFE 3A7VA 5FPYA 2WUBA 3MNCA 2CJIA 4X6OA 1IQLA 1UHBB 3MWIU 5DPAA 6ESTA 3GCHC 3K6ZA 1C1RA 1JIRA 1ZSKA 3TU7H 5K7RA 2OC1A 1G3DA 4Q80A 4RKJB 3E6PH 1BBRH 2QAAA 5G4BA 5CMXH 3TPIZ 1FZZA 2OLGA 2EA3A 1QQUA 2ZGHA 9ESTA 4UFFH 3LGUA 3KN2A 3KHVA 1LHEH 1O5FH 1BITA 1EQ9A 4WF8A 2O8MA 3UOUA 3ZZ9A 1EP6A 1HAYB 1B0FA 3ZYEA 2NU2E 2VINA 2QGRA 2C8XB 4AFSA 3ZVBA 1DWCH 2BQWB 1PPBH 3SU0A 3P17H 4M7GA 2GDEH 2DE9A 3E8LA 4AYYB 2HNTC 2Z9GA 1SOTA 2GMTB
chains in the Genus database with same CATH superfamily
2C8YB 1RIWB 1H8IH 4AG1A 2FOAA 4K1TA 3A8DA 1H8DH 4Q7ZA 2BHGA 1RXPA 4DT7B 2BDGA 1NFUA 1QR3E 1V2KT 2O8LA 4UE7H 2EEKA 1PPCE 1MQ6A 1ZJKA 1P3EA 1HPGA 3FFGA 4B2CA 4E06H 4A1TA 1J17T 3UFAA 3LJJA 2O8TA 1MKXK 1HJ8A 4PROA 2ZPRA 1SGFG 4CREA 4JYVH 2VVVA 2O9QA 1BRCE 1YPGH 5DGJA 3VEQB 2OC0A 1S85A 3LJOA 1A2CH 2A2XH 4XRNA 1W3CA 2BD7A 1G36A 4FUEA 1SBWA 4Y8YA 1YC0A 2ZDLA 3PMBB 4ZKOU 1GBAA 1V3XA 3CS0A 4X0WU 3M36A 3FVFB 1W11U 3P8GA 4AX9H 1CA0B 1ZRKA 1Y3UA 2OUAA 2GV6A 1T8OA 4J1YA 2KFWA 2ZNKH 4YTAA 2JKHA 3PRBA 1CVWH 4D7GA 3O8RA 4IN2A 5LPFA 6GCHF 3D65E 3M37A 3HPTB 2JETC 2TGAA 4BAMB 3SO3A 3DD2H 1FIZA 1TYNA 3A7YA 1AWHB 3SU4A 1GVLA 5EXLA 1MCTA 1ELCA 1IQHA 3MO6A 1SC8U 1RTFB 1OWHA 1O3AA 1AU8A 3A80A 4O97A 1XUIA 3VXFH 3KQBA 4WMFA 4FVDA 1AQ7A 3RXCA 1O5DH 1W12U 5DP7A 1DVAH 1TNHA 2XBWA 1Z8RA 3LIWA 4Y10E 3SN8A 1SLWB 2A7CA 4VGCC 4RKOB 1C5WB 4J2YB 4Y8ZA 1E1RD 3OSYA 2Y5GA 5I46H 2FLRH 1O2LA 1D3QB 2R2WU 2VIWA 3L33A 2VWOA 1GJDB 3BN9A 1O30A 5A09A 3Q3YA 1E0FD 1WUNH 1O39A 4CBOA 4LZ4B 3L6PA 1VCWA 3RMLH 1W0JD 4BAOB 1MBQA 1P3CA 4Z1MD 2VH0A 1MQ5A 3LPRA 1QA7A 1SKYE 2ZGJA 4NSYA 8LPRA 2FTMA 3F0OA 1YPMH 1IQFA 3ZV8A 1P2OA 2FEQH 5CDFE 4H6TA 3ZZ8A 4YOIA 2AHME 1MKWK 2OC7A 1T4VH 2VJ1A 2BD5A 3RMOH 1ZPBA 3UB0A 1FXYA 1V2TT 1CU1A 5FXLA 1DOJA 5EG4A 1NFXA 1P03A 2QY0B 3AVZA 1TMUH 1HJAC 1HV7A 1THPB 3A7WA 2UWOA 1SFQB 1L1JA 5JBBS 1Y5UT 4UFDH 1PPHE 3RU4D 5EXMA 1UTNA 1UTPA 1ZZZA 1JMOH 5K0HA 1O2QA 2GVFA 1LCYA 3RLYH 2QF5A 4B73A 2XOKD 2G4TA 4BANB 2GZ9A 2I6QA 1C1TA 3JZ1B 3ZZ3A 3SUGA 1LHFH 1TBZH 2HGTH 2KCYA 4GVUA 3RXEA 1LTOA 1TX7A 2XC4A 4XD7D 3TK6A 1Y5AT 4SGBE 3S69A 5T1VA 5LPEA 5C5OA 2XCFA 4X2WA 1TPOA 2LNCA 1ANCA 1IQMA 3A8AA 4ZROA 1HAXB 1N1LA 1AIXH 1AN1E 1KXBA 1SLUB 1OPHB 4INHA 1HAZB 3B23B 2ESTE 2ZGCA 3SJKA 4ABGA 3A86A 1BB0B 1ZR0A 1YCPM 1IHTH 1HAGE 1BMLA 4TWWA 2Y81A 2AGGX 4K3JA 3GY3A 3T29A 3TK9A 2KZ4A 1BUIA 4ACBA 1P11E 1CA8B 2R0LA 3UQVA 1L4DA 1FI8A 3STJA 1FAKH 1RJXB 1SGTA 4I8GA 1NN6A 2SNVA 4JK5A 1A0LA 1GBTA 3PO1B 5LPRA 3SUEA 1V2JT 3GS9A 2ZPSA 1G2MA 1E37B 1G30B 1YY3A 4FETA 4F48B 1VGCC 2XRCA 3M7TA 2Z7FE 3LC3A 3I77A 3G01A 2ZHEH 1GL0E 2JH0D 1ACBE 1Y8TA 2C4FH 3FN8A 2VIQA 2KR7A 1SQRA 1AD8H 3N7DA 3EGKH 1BRAA 2VVCA 3S9CA 1THSH 3BEIB 2HOBA 1GI7B 2M5TA 3SV7A 1BTZA 1P05A 1GJ4H 5DP6A 1GHZA 1GBJA 3AAUA 3GYMA 1VJ9U 4Y76A 3RXMA 3TVJB 3V3MA 1O2TA 1GJCB 2PW8H 1NT1A 2KCAA 1EB1H 3NWUA 1FPHH 1HAHH 5FAHA 4ABAA 4ABHA 2J34A 4FUCA 5DK1A 2BQ6B 2CHAB 5CHAC 1C5ZB 2YNBA 2F83A 2XXLA 2QXGA 4MPXA 2GV7A 2FS8A 1YBWA 3T62A 1L1GA 1GBKA 1SHYA 4GHQA 2ZI2H 5HM2A 2OBOA 1O5AB 3NXPA 3EA7A 4B1TA 4HTCH 2GJGA 1C5VA 1GHAF 1GI0A 3SJOA 2CXVA 1TQ7B 1LPGB 2XWBI 1P2JA 1DXPA 4X8TH 2LIZA 3RXTA 1SGYE 1XXFA 3BG4B 4AYVB 3RXDA 1F0TA 1GMHF 1ZGVA 3ZZ6A 2ZTZA 2J97A 1A0HB 1YPKH 4K1SA 3JZ2B 2O8UA 1BMNH 5GWZA 5DN6D 3ZVEA 2NU0E 2EQNA 1NESE 3HKIB 1GBIA 1XM1A 2PFEA 1AE8H 1NM6A 3QWCH 3N7OA 4X8SH 3TH4H 4K8YA 2A0QB 1DS2E 2YOLA 3QLPH 2A31A 3QDZB 4ZKRU 5FHTA 3QZQA 2PKAB 2P3TB 3UWIA 2J2UA 2Z9IA 1O5GH 3KL6A 1AVWA 1C5LH 4E7RG 3BV9B 3T2NA 2VGCB 2BDBA 4UDWH 3RXIA 2V3MA 1WQVH 3U8TH 2PUQH 4INLA 4YZUA 4D76A 2ZEBA 5GXPA 1ELBA 1SGIB 4U01A 1UCYK 4B75A 1P01A 4CHAB 1HFDA 1VJAU 2H5DA 3TGIE 4DY7B 2FI5E 1U6QA 4BTUB 1G3CA 4XOJA 5A8YA 1DE7H 2AFQB 1DX5M 3O8BA 1AB9B 3GY2A 2BB4A 3QGJA 1RFNA 3U1IB 1MKXH 4DGJA 4FXGH 1O2KA 1QURH 1ETSH 2GMTC 4JMYA 3UNSA 1K1IA 2VIVA 1PYTC 8GCHF 2A5IA 1YPJH 1RIWC 4RSPA 1QL7A 3M5MA 1GHVH 1K1MA 4KKDA 2W6JD 2QYIA 1ABJH 1Z6EA 3SV8A 3TJNA 1AUTC 1FY1A 3RDZA 3CENA 1XUGA 3RUOA 2A2QH 1ZTLA 2BLOA 2CK3D 4MVNA 1AVXA 1AHTH 1C1MA 1YM0A 4NZLA 5AHGH 3VGCB 1BJUA 1NBME 1P04A 5C2ZA 2F43B 3SNBA 2ZU2A 1EX3A 5EJZA 1BHXB 1UCYE 1MTUA 4ZAEA 1TA2A 3LU9B 5GCHF 5B6LA 5DP3A 2ZHDA 3TK5A 3RLWH 5EQSA 1CT0E 3MU1A 2FOHA 5AF9H 4CRAA 2WPDD 2ZFTA 4XBCA 5HYOA 1FN8A 2G5NA 2G8TA 6CHAB 2BX3A 4I33A 4IGDA 1CO7E 1CA0C 1C1QA 2CV3A 3OYPA 2BY8X 3A84A 2ANKH 1KTTB 1IHSH 2ZWLH 5F8XA 1TALA 2BM2A 1Z8JB 1EXFA 2FM2A 2PR3A 1WYKA 2Y80A 2ZCKP 2VIPA 3RXUA 3K65B 4Y71A 2Z3DA 1E1QD 1P10A 2FI3E 2I6SA 1UTMA 4XSKU 2FLBH 2ZDVH 1F2SE 2ZHWH 3A81A 1C1UH 1GJ8B 1YYY1 1WQSA 1EASA 4WMDA 3TITA 2TGTA 4AFUA 1ESAA 2FYRA 1O3HA 2FMJA 3LC5A 2ZGBH 1O2SA 4X8VH 2GX4A 3EE0B 2Y7ZA 5EXNA 3EAJA 4GUXA 5EPNA 2OCVB 1O2HA 4O3UA 2KAIB 4OS5A 2A5AA 2FESH 3MOCA 3MO3A 3GDUA 2UWLA 1KDQB 1AI8H 2ZQ1A 3LKWA 2A5KA 3GY4A 1P2QA 1WTGH 2GKVE 1K2I1 1O35A 2AGIX 2JJ2D 3ZVAA 1EJNA 4I31A 2F3CE 2WYGA 5JPMH 1FV9A 3VPKA 3MFJA 2ZKSA 2PTCE 1W8BH 1Z71A 4F49A 2BTCE 1V2ST 3A85A 2BOKA 1KYNA 3AW0A 1BMFD 4GCHG 2IN2A 3QZRA 2JH6D 3TJOA 1JWTA 3A7ZA 2TPIZ 4JZDH 1HGTH 4K1EA 4UFGH 1BHXF 3F0PA 3HGNA 1HB0B 1OWIA 5DP8A 2H2ZA 1GBEA 4ZXYH 4YOJA 4HFPB 2IJD1 2G55A 4K69A 4ZHAA 1K0HA 4NA7A 3SZEA 1OXGA 1TNLA 3P95A 2WPMS 1OWEA 1O31A 1O2PA 1Y3WA 1VCQA 4YM9A 1ANEA 3RC6A 2F9NA 4TYDA 2P8OC 3LONA 2H9HA 5TCAA 1NZQH 1TMBH 5EOKA 2FXRA 2HVXA 7GCHG 2Z6BD 1PYTD 5EU8A 2ZA5A 4HI3A 3SNEA 1OS8A 1SHHB 1BA8B 3H7OA 2IPHA 1YPHE 3QTOH 5JB9S 3NUMA 2CGAA 3E91A 3KEEA 1V2WT 1YPEH 4FUGA 2B5TB 1EAXA 2FX6A 4FUFA 2HRVA 2HWLB 2WZQA 3S9AA 2ILNA 2SNWA 1FIWA 3KGPA 1Z7KA 3RU4T 1FN6A 1F5RA 2VH6A 3A82A 1WSSH 2LP6A 3MHWU 5C0TA 1AZZA 3B8JA 2D1JA 1O5EH 1HXFH 2VWLA 3RXAA 3KNXA 3O8DA 1P2IA 1ZGIA 5IDKA 3KQDA 1YCPK 2SGPE 2ZQ2A 3RXQA 2BQ7B 2IJOB 1GI1A 1L1NA 2FODA 2HVYB 3KYGA 1LVYA 4BXWA 1IAUA 3ZZAA 2XNIA 4I8HA 2ZG0H 2RA0A 2TBSA 1QJ1B 4XBDA 3RC4A 1ZYOA 1DT2A 1ZRBA 2OXSA 3PM3A 1GHBF 3PWBA 1XVOA 3PB1E 4MNWA 1GCTB 1UVSH 4NGAH 2QF3A 5ESBA 2Y5FA 3W1EA 5EQRA 4K2YA 1O3EA 3S9BA 1BMMH 1YLDA 3MMGA 4NIVA 4YT7H 1C1SA 1MZAA 1OWJA 5TCCA 3A83A 2O8WA 3RXRA 1LQEA 3GDVA 4NCYA 3RM0H 1C1NA 1O3MA 2J9NA 4TY6A 2ZCHP 3SBKA 2F9OA 4ABBA 1DM4B 1IQKA 2BY9X 4CR9A 3ZVCA 1F0UA 2B7DH 4B71A 5L6NH 1O2NA 3LOXA 1O2VA 1TGCA 2BOHB 1JRSA 1MTNB 1MU6B 3PLBA 1KLTA 1N8OB 2PSYA 4A1VA 4B2AA 5L30H 1BTWA 1FQ3A 2THFB 1QRZA 3TJUA 1K1PA 4DIHH 4X1PU 1C2IA 1DANH 1GI2A 3KIDU 4OGXA 3RC5A 2VU8E 2CHAC 4I32A 2Y7XA 3OY5U 4RT0A 3PMJA 1GMDG 1NRSH 3SJ8A 4JZ1A 1SL3A 4MLFB 1YPLH 3M7UA 1SGDE 1V2OT 3DUXH 1V2UT 1SQAA 1TE0A 4JK6A 1ARCA 1HIAA 1UO6A 2H1UA 3T26A 3H5CB 1L2EA 1EOLA 1UK4A 1EKBB 1VZQH 4BNRA 1CGHA 4AN7A 5L2ZH 4BAHB 3BG4C 1GBCA 3U69H 1NBMD 3P8FA 2WPIS 5C94A 4XFQA 1WDIA 3UUZA 1N6XA 4Y0ZE 2QXHA 5DSFA 4RN6A 1GJ5H 4NZQA 5GDSH 2K8IA 2ZDNA 1AFQB 3GISB 3MNXA 2A7HA 1BDAA 2BD3A 2AERH 1FMGA 3BTGE 3SZNA 3DFLA 2ZGXH 1UCYH 1OYQA 1HJ9A 1K9OE 1D3DB 4R0IA 1GI9B 1AZ8A 1O2OA 5E0JA 1S0RA 2Z9JA 3GDSA 3ZVFA 1GCDA 1GJ6A 5C1UA 1ELAA 4JCNA 2ODPA 1O3IA 1LHGH 4Q2KA 2VIDA 1GVKB 1C1OA 3B9FH 3BTEE 3F68H 3FZZA 2W3IA 1D3PB 3RXSA 2A7JA 2BDCA 2VGCC 1BT7A 1HYLA 1ETRH 1SGFA 2HALA 4XE4A 3PV2A 1E34B 2BXTH 4HG6A 2P3UB 3SGAE 4HGCA 4CHAC 3M5NA 4AFZA 4ABDA 1V2PT 1W2KH 1UVPA 5T6GA 1TGNA 1O3FA 1E35B 4MDSA 1GWAA 3CP7A 4DVAU 1C9PA 2CN0H 4WXIA 1C5RA 1FY8E 2BVXH 1T4UH 3P8NA 2KAIA 1F0SA 1FY5A 3PWCA 1EP5A 1KDQA 1TMTH 1RD3B 5IK2D 3EA9A 2ZU5A 4I86A 1V2RT 2AGEX 2BDHA 4CH8B 2ZDAH 2CMYA 1CHOF 2ZFPH 1OKXA 1O2IA 1QA0A 4LXBH 2NWNA 1O3GA 5SGAE 1ORFA 2CF9H 2BY6X 4LK4A 3VGCC 2K1QA 1IOEA 1SGRE 1XKBC 1ZTKA 3DSOA 4BTIB 1JRTA 2ANWA 1LO6A 1O3PB 3QX5H 1D6RA 1RTLA 4BAKB 3TIUA 3SQEE 1FONA 3F1SB 1QQ4A 1C1WH 1C2DA 1XUJA 1FX0B 3N7EA 4TT3D 2EI6A 1BMAA 4Y6DA 1OYTH 1PPEE 2G5VA 1C9TA 1TBRH 3SJIA 2BY5X 1MCVA 3U9AH 1C5SA 4A92A 4DURA 6CHAC 1DXWA 2EC9H 3SQHE 3M61U 2J5UA 4A1XA 1UK2A 1QB1A 4IS5A 1QJ7B 3TGJE 4O3TA 4OGYA 3T5FH 5E2OA 1ZHMA 3QN7A 3WW7A 3EYDA 1TGSZ 2RG3A 3GY8A 1G37A 3KQEA 1W10U 3U28C 2V3HH 5AVDA 1UVOA 1A1RA 3MH7A 1WU1A 3OE7D 3TNTA 1FAXA 2RDLA 3KF2A 3NPSA 2Y6TA 2QF0A 1S6LA 2XTTB 5JYIA 1SOZA 5C5NA 3LDXH 3IG6B 2ANMH 2GD4B 1QNJA 3UAIC 3OFND 1UVUH 4WVPE 5JDUB 2AEIH 5DP5A 1UVTH 2FP7B 1BRUP 3EA8A 3AW1A 1Q31A 3E0PB 4UD9H 1GBFA 1C5TA 3W95A 4JZFH 1T8MA 1LVOA 1UHBA 3IWMA 2ULLA 4CRDA 2OINA 1O3JA 1PQ5A 1S5SA 1JOUB 5FX6A 3T25A 1HAIH 3RXJA 1OP0A 1EZUC 1K1NA 2ASUB 2FI4E 2FWWA 2KCOA 1BBRK 3FZDA 1GG6B 3GCTF 1Q2WA 5A8ZA 2KM0A 2ZC9H 3K2UA 4FVBA 1SLVB 1O2ZA 1EFRD 1O33A 2WV4A 5BPEA 1CT2E 1SQOA 2W7UA 3MU4A 4Z0KA 2VB0A 1A61H 3RXPA 2K7XA 1SSXA 1SGQE 3PROA 3SGBE 4CH2B 1LMWB 2FS9A 1T8LA 4GPGA 1XKAC 1OOKB 1KLIH 3ATKA 1UTQA 2AMPA 1PQAA 1EPTB 2ZFSA 1VR1H 1ELVA 1A4WH 1ZMLA 4TPIZ 4AG2A 3K6YA 4NFEA 3BTWE 1DWDH 1ZOMA 3M5LA 2V7QD 3TH2H 4DG4A 2WV5A 2G4UA 3C27B 1SPJA 1BBRE 4Q7YA 3PMHB 4ASHA 5JB8S 5H4IB 3VXEH 1GBBA 4IMZA 2BXUH 3ZV9A 4CBNA 2H5CA 2CF8H 4ABJA 1SLXB 5EW2H 1H9HE 5F8TA 1ID5H 1RGQA 2FZZA 4JYUH 2JETB 3SUDA 2Q6FA 4M9FA 4FU8A 1MH0A 1BZXE 1A7SA 4Y8XA 5L2YH 1TRMA 1O2GH 2AS9A 1BTXA 1NPMA 1Q3XA 3NKKA 3A8CA 2C93B 1QBNA 3QTVH 3RXBA 3S0NA 2BD2A 1DPOA 4IC6A 4JZEH 4ABFA 2PP6A 4XDEA 3D62A 4NIYA 1ZPZA 4D9RA 3RXKA 1LDTT 4OS2A 2SGQE 1GJ9B 4F55A 1DFPA 3BF6H 3PV5A 4HZHA 2NU3E 4JZIA 4BAQB 1BQYA 3T27A 2Q1JA 3F9HA 4E05H 1MTSA 2GGVB 4NWKA 2H6MA 1GCTC 2SGEE 3FP7E 4CRCA 1E36B 1NROH 2RFKC 2EI8A 4IW4E 3BEFB 3BTKE 1TX6A 1ARBA 1C4V2 4ABEA 3LH1A 2WPKS 1YP9A 1K21H 1TRYA 4ZMAH 1O32A 3ODDA 4NIWA 4WH6A 3ELAH 1KXDA 5DG6A 3M5OA 2DUCA 3ATIA 1C2KA 4WH8A 3SI3H 2BD4A 4H42U 1C5QA 1BTHH 1UTJA 5JBAS 4NA8A 1QIXB 1GHAG 1MTNC 3SORA 1N8OC 1P09A 1COWD 1G3EA 2HPPH 4LOYH 2ZFQH 5C67A 3LH3A 4BOHA 1P9SA 4GCHF 4ZKNU 1BTYA 1OX1A 3HGPA 3MO9A 3FANA 1D9IA 4X8UH 3FAOA 3M7QA 4FUIA 4SGAE 3RM2H 3P8OA 1AKSB 4K8BA 3UNQA 1GMHG 1O2MA 4WMEA 2J98B 2R3YA 2XYAA 5ETXA 3UTUH 3HATH 5IYTA 2Z3CA 1BTUA 4X6NA 2R3UA 2D2DA 5EQQA 3VB5A 2HLCA 2VVUA 2BYAX 3ATLA 2GT7A 1N6YA 5JBCS 3UR9A 3A89A 4MPVA 1GGDB 4CRGA 3MI4A 3UIRA 4ISNA 3DCLA 3F9FA 3UNRA 2BMGB 1C2FA 3WWBA 1TFXA 4ISOA 1O0DH 1LHCH 1O3CA 3ZVGA 2AYWA 1QTFA 3ZZCA 5FL7D 3GCOA 3PV4A 1ESBA 3M35A 3QK1A 1C5XB 2GZ7A 1B0EA 1OSSA 1ELFA 3MH4A 1HNEE 2BZ6H 2BZAA 2YMSB 3SNCA 2NU1E 1AFQC 3A88A 1SI5H 4KELA 1HXEH 4FU7A 5BRRE 1FPCH 1UMAH 2BX4A 1Z1JA 1CGIE 1C4Y2 1A3BH 2XWAA 4ACAA 3U8OH 2OTVA 1LQDB 1UTOA 1O2UA 1VKYA 1BIOA 1SQTA 1S82A 9LPRA 1XVMA 3HKJB 4MNYA 1NS3A 4K5ZA 1FJSA 1AY6H 3D49H 1A46H 1ETTH 1MKWH 1KXCA 1PQ8A 2SGAA 1P0SH 1NY22 2ZZUH 1DSUA 1PQ7A 5I25A 2W5EA 2ZF0H 3SU1A 3DHKH 3H7TA 3BIUH 4YOGA 5EIYA 4U30A 3MNSA 1F7ZA 1C2LA 2GT8A 1AFEH 5F8ZA 4DCDA 1DUEA 4MPUA 2TGDA 1PFXC 1C1PA 4NIXA 2RA3A 1TABE 3BTHE 3P6ZB 5EPYA 3EDXB 2OBQA 3GICB 1E38B 1S81A 2HNTE 3V13A 1HAPH 1O3OA 1OHHD 1LPZB 2V6NA 4R8TB 1WV7H 2XC0A 1C4U2 4D9QA 1G32B 4I8JA 4MQAA 2WPJS 1D3TB 2XBYA 1Y3YA 2ODYB 5HMAA 4ZH8A 1K28D 1ELTA 2GCHG 3HK6B 4NFFA 1F5KU 3BSQA 1GI8B 2UUKB 2ZO3H 3SU2A 2VWNA 4Q63A 4JYTA 3ZZDA 3S7HB 1OWKA 1LKAA 3PTNA 3MYWA 3AASA 2FOCA 3ZIAD 2BVRH 2ZU4A 4KGAA 2D8WA 4ZHLU 1HCGA 1NFWA 1BJVA 1O36A 1YGCH 4X1NU 3WWFA 2PV9B 1QJ6B 1SGCA 4TY7A 1D4PB 2ZDKA 1SMFE 1B7XB 3SI4H 1NTPA 1Y3XA 2IPQX 1P9UA 2VIOA 1F92A 1VITG 3UQOA 3Q76A 2F9BH 1GI5A 1A3EH 1GHYH 3M3TA 1Y5BT 1KXAA 4IMQA 1QZ8A 3BTQE 1LVMA 1ELGA 2L74A 4FOUC 4RI0A 1T8NA 1EPTA 2YNAA 5C3NA 3URCA 1AWFH 2V3OH 1PPFE 1GMDF 1KSNA 3UR6A 4DIIH 1T31A 2PTNA 4WJG2 1INCA 5HM9A 1O2WA 1GMCG 4THNH 3SNDA 2ZFFH 1UK3A 4NWLA 1L4ZA 4UFEH 3P92A 5F53A 4H6SB 1AE5A 5AFZH 4A7IB 4ESTE 1TNGA 4Y7AA 4I8LA 5EW1H 3K9XB 1HRTH 4FU9A 8KME2 2ZTXA 4WWYA 1IQGA 2BLQA 4Z6AH 5B6OA 1LVBA 3ITIA 1EUFA 3I78A 2FO9A 3PO1C 3PYHA 2TRMA 1AVGH 3BTME 3GY6A 1C2HA 1YWUA 1P2NA 2D26C 1HAOH 4ZUHA 1A5HA 1TPSA 1V2MT 2FX4A 1A5GH 3R3GB 1O38A 3ZZ7A 5T3HA 1GJBB 4GHTA 2OP9A 3VB6A 1S6FA 1TQ0B 1P2KA 2FOFA 3ZYDA 2PSXA 3OU0A 3P70B 1O34A 1HAVB 2PKAA 1GBDA 2BDIA 1KY9A 3SHCH 2LPRA 4X1RU 1GBMA 1GG6C 1TNJA 1QRXA 4ISHH 1GHXH 4X2VA 2R0KA 1THRH 2W26A 1XXDA 3N99A 2QXIA 5DP4A 1ZHPA 1ANDA 5C1XA 3PLKA 3A7TA 2ZU3A 1KLJH 5FPTA 1SVPA 4AORA 1UJ1A 1J15A 1NRRH 3FOAA 1C5MD 2RDEA 4IN1A 2BDYA 2GMTB 1O3BA 1EPTC 2ZPQA 5EODA 3UREA 2PUXB 2J95A 2FOBA 1MZDA 3VB7A 1MAXA 1RS0A 3MTYA 2AIPA 4AOQA 1YPHC 1O5BB 3RMNH 8ESTE 1BTPA 3E0NB 2Q6DA 1OWDA 1QRWA 4FUDA 3KQCA 1QBVH 4D7FA 3VB4A 4GAWA 1XUKA 2PWXA 1CBWB 1W0ZU 1EJAA 4AB9A 1XMNB 3A7XA 2UUJB 2QCYA 3LGIA 1GDUA 3F3BA 2JH5D 5TJXA 3WY8A 4QT8C 3ESTA 1F0RA 1O2JA 5ESTE 1M9UA 1GI3A 1J14A 1SGNE 1W13U 2P93A 2P94A 3LT3A 3MU0A 1V6DA 1C2EA 1AKSA 3UWJH 1GHBG 3OTPA 2J98A 1DY8A 4X6MA 3SHAH 2PHBA 1XUFA 3U98H 2BLWA 1EAWA 1AO5A 1C2GA 4MNXA 1EJMA 1SB1H 5A0AE 1EAIA 4ZCNA 1G3BA 2ZECA 1C1VH 4I8KA 4KTUA 1YKTA 1O3KA 4X2XA 4OS6A 2GCTB 5DP9A 3C1KA 3ODFA 4DT4A 2EI7A 1NC6A 4Y7BA 2QC2A 1ELDE 1GJAB 1O3DA 1TIOA 1TONA 2A1DB 3SNAA 1IQNA 5DKMA 4B6FA 1TNIA 3BEUA 1HUTH 1AB9C 4UEHH 1QFKH 2GDDA 3SU5A 1WXRA 3DSPA 2PKSB 1J9CH 1E79D 1P2MA 3RXFA 3F6UH 2VNTA 1TX8A 1S84A 2J4IA 2B9LA 5FCRA 4OS4A 4Y79A 4YO9A 2XW9A 2JIZD 4UONA 3FP6E 3OEED 2OD3B 1GBHA 3KQ5A 5ABWA 6LPRA 2F91A 1DITH 1TPAE 1TNKA 2G52A 6GCHG 1DWBH 4OM9A 3AAVA 3OY6U 1TWXB 2UUYA 2G81E 4H4FA 2A4RA 2ZDMA 1ELEE 1RTKA 2VBCA 2QA9E 3LGTA 4A5TS 3Q77A 2P8OB 1WAYB 2AIQA 5C20A 1A5IA 1ZHRA 5A2MH 4AB8A 1YF4A 5DO4H 3QGNB 2ANYA 2C3SA 3BTTE 3V7TA 3FO8D 1KIGH 4B2BA 4D8NA 2OQ5A 1KXFA 7LPRA 1MBMA 1C2MA 1EAUA 2NU4E 2F4LA 1RRKA 3E3TA 3E16B 2H9EH 1G2LA 4B6EA 1MD7A 1ESTA 3TJVA 3KCGH 1GGDC 2XCNA 1CQQA 2FYQA 3BIVH 2WPLS 1T32A 1HLTH 4MPWA 3GCHB 1JIMA 3CNRA 2EY4C 1GL1A 2ZCLP 4WXVA 1O3LA 3RXLA 1EB2A 2ZFRH 3DT0H 1TAWA 1FLEE 4X6PA 3BG8A 1IQIA 2F9PA 1EOJA 2F9UA 3ENSB 3ATWA 3MU8A 1MAYA 4LZ1H 1W7XH 2YMSC 3SUFA 5HXFA 4DOQA 1LKBA 2QXJA 3UOPA 4GSOA 2QV1A 2RCEA 2Z94A 5GNDA 4CRBA 3T28A 1BRBE 1FDPA 4CR5A 3W94A 4Q7XA 2FPZA 4ASUD 3RXOA 4INKA 1ZSLA 1H9IE 3DA9B 3PLPA 1IQEA 1SG8B 4FUHA 4KTCA 5KGOA 1TOMH 4BXSA 2ODQA 2Y5HA 1AUJA 3MH5A 4GLYA 5LGOA 2WHXA 1X7AC 3SGQE 1K1JA 2H9TH 1FUJA 3H09A 3F2FA 1CHOG 1WOFA 1O37A 1BOQA 4AZ2B 4AFQA 1QB9A 5KECA 2BDAA 1ANBA 1Z1IA 4FUBA 2STAE 1C5YB 3QUMP 2QIQA 3URDA 2BVSH 2BY7X 4AC9A 3SV6A 3D23A 1TLDA 5EJ1A 4ABIA 2FIRH 3A87A 1YLNA 4RT1A 2W7SA 1IQJA 2A32A 5PTPA 1EATA 1W14U 3SV2H 2DE8A 3RXVA 5GJ4B 2HPQH 1HAVA 1PJPA 2K0QA 3R0FA 1GI6A 4Y0YE 1NU9A 1OP8A 3SJ9A 2A45B 1DICA 3E90B 5E2PA 1QHRB 5HKKD 3SYJA 5A0CA 2XBXA 1JBUH 3FKSD 2J94A 4AGJA 1VITH 4I7YH 1QGFA 4NA9H 4O03A 1YCPH 1OP2A 4ZHMU 3UPEA 1SGPE 2ALPA 1GJ7B 2KCPA 4BTTB 2G00A 2R9PA 4DW2U 2FTLE 1S83A 1LPKB 4IBLH 3NCLA 2OK5A 1TOCB 1TRNA 4P02A 2TGPZ 1TBQH 3V12A 4IC5A 5LH8A 1H8HD 1C5PA 1L0ZA 1FY4A 2QE7D 2FOGA 2ALVA 2XNDD 4KTSA 3VG8A 3Q00A 4NSVA 2P59A 5GIBA 2W6ID 5FX5A 2UWPA 1H1BA 2ZIQH 3EE7A 1CGJE 5FCKA 1W0KD 3M3VA 4MNVA 3F2HA 4U2WA 5FBEA 4MTBA 1FY3A 1LHDH 1TGBA 1H4WA 1J8AA 1TA6A 3BTFE 3O8CA 1QBOA 4VGCB 4Y11E 5A0BA 2ZHQH 3MH6A 2HNTF 2Z9LA 5F6MA 3TGKE 4MG3A 1ABIH 1S0QA 1DDJA 3GCTG 7KMEH 3GOVB 2Z9KA 4A6LA 2G51A 2ZP0H 3ATMA 3U1JB 2SGDE 4B74A 2C8WB 2BD9A 1PPZA 1CHGA 4KP0A 2JDID 2Y82A 3TH3H 2OC8A 3E1XB 2FDAA 1MMJN 3RMMH 2AH4X 4X1QU 3SU6A 4P00A 1Z8IB 5CE1A 3U8RH 1Y3VA 1Z6JH 1ZMJA 3GY7A 3TNSA 1MD8A 2YMSD 1SFIA 4TPYA 5EJLA 3RXGA 3ZZBA 1TGTA 2BLVA 3V0XA 1HBTH 2OQUA 3LGVA 1PPGE 2P95A 1UTKA 2PGQB 4YLQH 4YT6H 3ZZ5A 4TWYA 4YESB 5KEDA 1V2QT 5C1YA 1ZMNA 1GI4A 2W3KA 1S6HA 1HJAB 1SR5C 3STIA 1DY9A 5J4SA 1HIAB 1G9IE 2J92A 1NU7B 2GTBA 1DSTA 1P12E 1V2LT 2V35A 4FUJA 3AK5A 1ZTJA 1DWEH 1P8VC 2P3FH 2SFAA 2BD8A 1CE5A 3SW2B 1ZLRA 3IITA 4X2YA 1MTVA 1C5NH 1WCZA 2A4OA 3DSGA 1GHWH 3ZZ4A 1O2YA 1QB6A 1HDTH 1QL8A 1V2NT 1NFYA 5E0GA 1W7GH 1KMHB 3MNBA 2UUFB 2GCHF 1ZJDA 4YLUA 3SV9A 2AMQA 5FBIA 1UW7A 2M2AA 2WYJA 3L3TA 2JJ1D 1XUHA 2PGBB 2A4GA 1CSOE 1CBWC 3A8BA 4E7NA 1AMHA 3I29A 4F4OC 4CRFA 3OTJE 7GCHF 3PTBA 4O9VA 5C0UA 3HK3B 3VFEA 3ZVDA 4B76A 2C90B 4TSFD 1O5CB 1ZPCA 2GZ8A 2WINI 3BTDE 3FP8E 3Q3XA 2F9VA 1UTLM 5E0HA 3NK8A 1VITF 3F9EA 1C2JA 1GDQA 5A8XA 5J4QA 1O3NA 3F9GA 1WTHD 3LGYA 3MU5A 1QY6A 1V2VT 1C5UA 2V0BA 4YXWD 4U32A 1BCUH 2GP9B 3MQKC 4ZKSU 8GCHG 3GY5A 3S7KB 1VGCB 1EZQA 3RXHA 1AGJA 1GMCF 2FOEA 3M3SA 1H9LB 1KXEA 1QL9A 2Z3EA 2XC5A 4OS7A 5DJ7A 1H8ED 2P16A 1P02A 4K60A 1MTWA 2GCTC 1DLKB 1K1OA 5GPIB 5FPSA 1XX9A 5EGMA 4OS1A 3OX7U 2C8ZB 1ZSJA 1FNIA 3RU4E 1F5LA 2ZTYA 3OEHD 1SGEE 1EZSC 1P57B 1D6WA 2A4QA 2XBVA 3SOSA 2ZHFH 2WPHS 4ZXXH 2PKSC 2WSSD 3SU3A 3GYLB 1NO9H 1TB6H 5GCHG 1T7CA 1QCPA 4NG9H 3DFJA 3GCNA 1CT4E 1DLEA 1GBLA 2WV9A 2TIOA 2B0FA 4ISIH 1W0YH 7ESTE 5T6DA 4AGKA 5CHAB 4ISLA 2J38A 3NRLA 3Q3KA 1TPPA 1NRPH 2ZU1A 1K1LA 2WUCA 2QN5T 3PRDA 3CS7A 5C17A 1C5OH 3LGWA 3OAAD 1A0JA 1Z8GA 1YLCA 1J16A 3PMAB 5HGGA 2FOMB 1GPZA 1DUAA 2VWMA 3QO6A 3EBNA 1P06A 5AFYH 1KTSB 4WY3A 4XBBA 2Q6GA 1GDNA 1EZXC 3UY9A 2R2MB 2STBE 5E8EH 1JXPA 1MUEB 1B5GH 1VCPA 5JBTA 2LELA 4X1SU 2QF4A 1K22H 3KYFA 5F03A 1Y59T 1O2RA 2B8OH 3VB3A 3RP2A 1GVZA 1NRNH 1WBGB 1NRQH 3EQ0H 1MABB 2KX4A 3TLOA 2AMDA 2IOTA 2PLXA 1MU8B 5T6FA 3NZIA 5HIZA 4DJZB 2SGFE 2L6OA 3A7VA 5FPYA 2WUBA 3MNCA 2CJIA 4X6OA 1IQLA 1UHBB 3MWIU 5DPAA 6ESTA 3GCHC 2HLDD 3K6ZA 1C1RA 1JIRA 1ZSKA 3TU7H 5K7RA 2OC1A 1G3DA 4Q80A 4RKJB 3E6PH 1BBRH 2QAAA 5G4BA 5CMXH 3TPIZ 1FZZA 2OLGA 2EA3A 3F2GA 1QQUA 2ZGHA 9ESTA 4UFFH 3LGUA 3KN2A 3KHVA 1LHEH 1O5FH 1BITA 1EQ9A 4WF8A 2O8MA 3UOUA 3ZZ9A 5CHBA 1EP6A 1HAYB 1B0FA 3ZYEA 2NU2E 2VINA 2QGRA 2C8XB 4AFSA 3ZVBA 1DWCH 2BQWB 1PPBH 4Q4LA 5HIYA 3SU0A 3P17H 4M7GA 2GDEH 2DE9A 3E8LA 4AYYB 2HNTC 2Z9GA 1SOTA 1O2XA
chains in the Genus database with same CATH topology
2C8YB 1RIWB 1H8IH 4AG1A 2FOAA 4K1TA 3A8DA 1H8DH 4Q7ZA 2BHGA 1RXPA 4DT7B 2BDGA 1NFUA 1QR3E 1V2KT 2O8LA 4UE7H 2EEKA 1PPCE 1MQ6A 1ZJKA 1P3EA 1HPGA 3FFGA 4B2CA 4E06H 4A1TA 1J17T 3UFAA 3LJJA 2O8TA 1MKXK 1HJ8A 4PROA 2ZPRA 1SGFG 4CREA 4JYVH 2VVVA 2O9QA 1BRCE 1YPGH 5DGJA 3VEQB 2OC0A 1S85A 3LJOA 1A2CH 2A2XH 1W3CA 2BD7A 1G36A 4FUEA 1SBWA 4Y8YA 1YC0A 2ZDLA 3PMBB 4ZKOU 1GBAA 1V3XA 3CS0A 4X0WU 3M36A 3FVFB 1W11U 3P8GA 4AX9H 1CA0B 1ZRKA 1Y3UA 2OUAA 2GV6A 1T8OA 4J1YA 2ZNKH 4YTAA 2JKHA 1CVWH 4D7GA 3O8RA 4IN2A 5LPFA 6GCHF 3D65E 3M37A 3HPTB 2JETC 2TGAA 4BAMB 3SO3A 3DD2H 1FIZA 1TYNA 3A7YA 1AWHB 3SU4A 1GVLA 5EXLA 1MCTA 1ELCA 1IQHA 3MO6A 1SC8U 1RTFB 1OWHA 1O3AA 1AU8A 3A80A 4O97A 1XUIA 3VXFH 3KQBA 4WMFA 4FVDA 1AQ7A 3RXCA 1O5DH 1W12U 5DP7A 1DVAH 1TNHA 2XBWA 1Z8RA 3LIWA 4Y10E 3SN8A 1SLWB 2A7CA 4VGCC 4RKOB 1C5WB 4J2YB 4Y8ZA 3OSYA 2Y5GA 5I46H 2FLRH 1O2LA 1D3QB 2R2WU 2VIWA 3L33A 2VWOA 1GJDB 3BN9A 1O30A 5A09A 3Q3YA 1E0FD 1WUNH 1O39A 4CBOA 4LZ4B 3L6PA 1VCWA 3RMLH 4BAOB 1MBQA 1P3CA 2VH0A 1MQ5A 3LPRA 1QA7A 2ZGJA 4NSYA 8LPRA 2FTMA 1YPMH 1IQFA 3ZV8A 1P2OA 2FEQH 4H6TA 3ZZ8A 4YOIA 1MKWK 2OC7A 1T4VH 2VJ1A 2BD5A 3RMOH 1ZPBA 1FXYA 1V2TT 1CU1A 5FXLA 1DOJA 5EG4A 1NFXA 1P03A 2QY0B 3AVZA 1TMUH 1HJAC 1HV7A 1THPB 3A7WA 2UWOA 1SFQB 1L1JA 5JBBS 1Y5UT 4UFDH 1PPHE 3RU4D 5EXMA 1UTNA 1UTPA 1ZZZA 1JMOH 5K0HA 1O2QA 2GVFA 1LCYA 3RLYH 4B73A 2G4TA 4BANB 1O2XA 2GZ9A 2I6QA 1C1TA 3JZ1B 3ZZ3A 3SUGA 1LHFH 1TBZH 2HGTH 4GVUA 3RXEA 1LTOA 1TX7A 2XC4A 3TK6A 1Y5AT 4SGBE 3S69A 5LPEA 5C5OA 2XCFA 4X2WA 1TPOA 2LNCA 1ANCA 1IQMA 3A8AA 4ZROA 1HAXB 1N1LA 1AIXH 1AN1E 1KXBA 1SLUB 1OPHB 4INHA 1HAZB 3B23B 2ESTE 2ZGCA 3SJKA 4ABGA 3A86A 1BB0B 1ZR0A 1YCPM 1IHTH 1HAGE 1BMLA 4TWWA 2Y81A 2AGGX 4K3JA 3GY3A 3T29A 3TK9A 1BUIA 1P11E 1CA8B 2R0LA 3UQVA 1L4DA 1FI8A 3STJA 1FAKH 1RJXB 1SGTA 4I8GA 1NN6A 2SNVA 4JK5A 1A0LA 1GBTA 3PO1B 5LPRA 3SUEA 1V2JT 2ZPSA 1G2MA 1E37B 1G30B 1VGCC 2XRCA 3M7TA 2Z7FE 3LC3A 3I77A 3G01A 2ZHEH 1GL0E 2JH0D 1ACBE 1Y8TA 2C4FH 2VIQA 1AD8H 3EGKH 1BRAA 2VVCA 3S9CA 1THSH 3BEIB 2HOBA 1GI7B 2M5TA 3SV7A 1BTZA 1P05A 1GJ4H 5DP6A 1GHZA 1GBJA 3AAUA 3GYMA 1VJ9U 4Y76A 3RXMA 3TVJB 3V3MA 1O2TA 1GJCB 2PW8H 1NT1A 1EB1H 3NWUA 1FPHH 1HAHH 5FAHA 4ABAA 4ABHA 2J34A 4FUCA 5DK1A 2BQ6B 2CHAB 5CHAC 1C5ZB 2YNBA 2F83A 2XXLA 2QXGA 4MPXA 2GV7A 2FS8A 1YBWA 3T62A 1L1GA 1GBKA 1SHYA 4GHQA 2ZI2H 5HM2A 2OBOA 1O5AB 3NXPA 3EA7A 4B1TA 4HTCH 1C5VA 1GHAF 1GI0A 3SJOA 2CXVA 1TQ7B 1LPGB 2XWBI 1P2JA 1DXPA 4X8TH 2LIZA 3RXTA 1SGYE 1XXFA 3BG4B 4AYVB 3RXDA 1F0TA 1GMHF 1ZGVA 3ZZ6A 2ZTZA 1A0HB 1YPKH 4K1SA 3JZ2B 2O8UA 1BMNH 5GWZA 3ZVEA 2NU0E 1NESE 3HKIB 1GBIA 1XM1A 2PFEA 1AE8H 1NM6A 3QWCH 3N7OA 4X8SH 3TH4H 4K8YA 2A0QB 1DS2E 2YOLA 3QLPH 2A31A 3QDZB 4ZKRU 5FHTA 3QZQA 2PKAB 2P3TB 3UWIA 2J2UA 2Z9IA 1O5GH 3KL6A 1AVWA 1C5LH 4E7RG 3BV9B 3T2NA 2VGCB 2BDBA 4UDWH 3RXIA 1WQVH 3U8TH 2PUQH 4INLA 4YZUA 4D76A 2ZEBA 5GXPA 1ELBA 1SGIB 4U01A 1UCYK 4B75A 1P01A 4CHAB 1HFDA 1VJAU 2H5DA 3TGIE 4DY7B 2FI5E 1U6QA 4BTUB 1G3CA 4XOJA 5A8YA 1DE7H 2AFQB 1DX5M 3O8BA 1AB9B 3GY2A 2BB4A 3QGJA 1RFNA 3U1IB 1MKXH 4DGJA 4FXGH 1O2KA 1QURH 1ETSH 2GMTC 4JMYA 3UNSA 1K1IA 2VIVA 1PYTC 8GCHF 2A5IA 1YPJH 1RIWC 4RSPA 1QL7A 3M5MA 1GHVH 1K1MA 4KKDA 2QYIA 1ABJH 1Z6EA 3SV8A 3TJNA 1AUTC 1FY1A 3RDZA 3CENA 1XUGA 3RUOA 2A2QH 1ZTLA 2BLOA 4MVNA 5AHGH 1AVXA 1AHTH 1C1MA 1YM0A 4NZLA 3VGCB 1BJUA 1P04A 5C2ZA 3SNBA 2ZU2A 1EX3A 1BHXB 1UCYE 1MTUA 4ZAEA 1TA2A 3LU9B 5GCHF 5DP3A 2ZHDA 3TK5A 3RLWH 5EQSA 1CT0E 3MU1A 2FOHA 5AF9H 4CRAA 2ZFTA 4XBCA 5HYOA 1FN8A 2G5NA 2G8TA 6CHAB 2BX3A 4I33A 4IGDA 1CO7E 1CA0C 1C1QA 2CV3A 3OYPA 2BY8X 3A84A 2ANKH 1KTTB 1IHSH 2ZWLH 5F8XA 1TALA 2BM2A 1Z8JB 1EXFA 2FM2A 2PR3A 1WYKA 2Y80A 2ZCKP 2VIPA 3RXUA 3K65B 4Y71A 2Z3DA 1P10A 2FI3E 2I6SA 1UTMA 4XSKU 2FLBH 2ZDVH 1F2SE 2ZHWH 3A81A 1C1UH 1GJ8B 1YYY1 1WQSA 1EASA 4WMDA 3TITA 2TGTA 4AFUA 1ESAA 2FYRA 1O3HA 2FMJA 3LC5A 2ZGBH 1O2SA 4X8VH 2GX4A 3EE0B 2Y7ZA 5EXNA 3EAJA 4GUXA 5EPNA 2OCVB 1O2HA 4O3UA 2KAIB 4OS5A 2A5AA 2FESH 3MOCA 3MO3A 3GDUA 2UWLA 1KDQB 1AI8H 2ZQ1A 3LKWA 2A5KA 3GY4A 1P2QA 1WTGH 2GKVE 1K2I1 1O35A 2AGIX 3ZVAA 1EJNA 4I31A 2F3CE 2WYGA 5JPMH 1FV9A 3VPKA 3MFJA 2ZKSA 2PTCE 1W8BH 1Z71A 4F49A 2BTCE 1V2ST 3A85A 2BOKA 1KYNA 3AW0A 4GCHG 2IN2A 3QZRA 2JH6D 3TJOA 1JWTA 3A7ZA 2TPIZ 4JZDH 1HGTH 4K1EA 4UFGH 1BHXF 3HGNA 1HB0B 1OWIA 5DP8A 2H2ZA 1GBEA 4ZXYH 4YOJA 4HFPB 2G55A 4K69A 4ZHAA 4NA7A 1OXGA 1TNLA 3P95A 2WPMS 1OWEA 1O31A 1O2PA 1Y3WA 1VCQA 4YM9A 1ANEA 3RC6A 2F9NA 4TYDA 2P8OC 3LONA 2H9HA 5TCAA 1NZQH 1TMBH 5EOKA 2FXRA 2HVXA 7GCHG 2Z6BD 1PYTD 5EU8A 2ZA5A 4HI3A 3SNEA 1OS8A 1SHHB 1BA8B 3H7OA 2IPHA 1YPHE 3QTOH 5JB9S 3NUMA 2CGAA 3E91A 3KEEA 1V2WT 1YPEH 4FUGA 2B5TB 1EAXA 2FX6A 4FUFA 2HRVA 2HWLB 3S9AA 2ILNA 2SNWA 1FIWA 3KGPA 1Z7KA 3RU4T 1FN6A 1F5RA 2VH6A 3A82A 1WSSH 3MHWU 1AZZA 3B8JA 2D1JA 1O5EH 1HXFH 2VWLA 3RXAA 3KNXA 3O8DA 1P2IA 1ZGIA 5IDKA 3KQDA 1YCPK 2SGPE 2ZQ2A 3RXQA 2BQ7B 2IJOB 1GI1A 1L1NA 2FODA 4BXWA 1LVYA 1IAUA 3ZZAA 2XNIA 4I8HA 2ZG0H 2RA0A 2TBSA 1QJ1B 4XBDA 3RC4A 1ZYOA 1DT2A 1ZRBA 2OXSA 3PM3A 1GHBF 3PWBA 1XVOA 3PB1E 4MNWA 1GCTB 1UVSH 4NGAH 2QF3A 5ESBA 2Y5FA 5EQRA 4K2YA 1O3EA 3S9BA 1BMMH 1YLDA 3MMGA 4NIVA 4YT7H 1C1SA 1MZAA 1OWJA 5TCCA 3A83A 2O8WA 3RXRA 1LQEA 3GDVA 4NCYA 3RM0H 1C1NA 1O3MA 2J9NA 4TY6A 2ZCHP 3SBKA 2F9OA 4ABBA 1DM4B 1IQKA 2BY9X 4CR9A 3ZVCA 1F0UA 2B7DH 4B71A 5L6NH 1O2NA 3LOXA 1O2VA 1TGCA 2BOHB 1JRSA 1MTNB 1MU6B 3PLBA 1KLTA 1N8OB 2PSYA 4A1VA 4B2AA 5L30H 1BTWA 1FQ3A 2THFB 1QRZA 3TJUA 1K1PA 4DIHH 4X1PU 1C2IA 1DANH 1GI2A 3KIDU 4OGXA 3RC5A 2VU8E 2CHAC 4I32A 2Y7XA 3OY5U 3PMJA 1GMDG 1NRSH 3SJ8A 4JZ1A 1SL3A 4MLFB 1YPLH 3M7UA 1SGDE 1V2OT 3DUXH 1V2UT 1SQAA 1TE0A 4JK6A 1ARCA 1HIAA 1UO6A 2H1UA 3T26A 3H5CB 1L2EA 1EOLA 1UK4A 1EKBB 1VZQH 4BNRA 1CGHA 4AN7A 5L2ZH 4BAHB 3BG4C 1GBCA 3U69H 3P8FA 2WPIS 4XFQA 3UUZA 1N6XA 4Y0ZE 2QXHA 4RN6A 1GJ5H 4NZQA 5GDSH 2ZDNA 1AFQB 3GISB 3MNXA 2A7HA 1BDAA 2BD3A 2AERH 1FMGA 3BTGE 3SZNA 3DFLA 2ZGXH 1UCYH 1OYQA 1HJ9A 1K9OE 1D3DB 4R0IA 1GI9B 1AZ8A 1O2OA 5E0JA 1S0RA 2Z9JA 3GDSA 3ZVFA 1GCDA 1GJ6A 5C1UA 1ELAA 4JCNA 2ODPA 1O3IA 1LHGH 4Q2KA 2VIDA 1GVKB 1C1OA 3B9FH 3BTEE 3F68H 3FZZA 2W3IA 1D3PB 3RXSA 2A7JA 2BDCA 2VGCC 1BT7A 1HYLA 1ETRH 1SGFA 2HALA 4XE4A 1E34B 2BXTH 2P3UB 3SGAE 4HGCA 4CHAC 3M5NA 4AFZA 4ABDA 1V2PT 1W2KH 1UVPA 5T6GA 1TGNA 1O3FA 1E35B 4MDSA 1GWAA 3CP7A 4DVAU 1C9PA 2CN0H 4WXIA 1C5RA 1FY8E 2BVXH 1T4UH 3P8NA 2KAIA 1F0SA 1FY5A 3PWCA 1EP5A 1KDQA 1TMTH 1RD3B 3EA9A 2ZU5A 1V2RT 2AGEX 2BDHA 4CH8B 2ZDAH 2CMYA 1CHOF 2ZFPH 1OKXA 1O2IA 1QA0A 4LXBH 2NWNA 1O3GA 5SGAE 1ORFA 2CF9H 2BY6X 4LK4A 3VGCC 2K1QA 1IOEA 1SGRE 1XKBC 1ZTKA 4BTIB 1JRTA 2ANWA 1LO6A 1O3PB 3QX5H 1D6RA 1RTLA 4BAKB 3TIUA 3SQEE 1FONA 3F1SB 1QQ4A 1C1WH 1C2DA 1XUJA 2EI6A 1BMAA 4Y6DA 1OYTH 1PPEE 2G5VA 1C9TA 1TBRH 3SJIA 2BY5X 1MCVA 3U9AH 1C5SA 4A92A 4DURA 6CHAC 1DXWA 2EC9H 3SQHE 3M61U 4A1XA 1UK2A 1QB1A 4IS5A 1QJ7B 3TGJE 4O3TA 4OGYA 3T5FH 5E2OA 1ZHMA 3QN7A 3EYDA 1TGSZ 2RG3A 3GY8A 1G37A 3KQEA 1W10U 2V3HH 5AVDA 1UVOA 1A1RA 3MH7A 1WU1A 3TNTA 1FAXA 2RDLA 3KF2A 3NPSA 2Y6TA 2QF0A 2XTTB 5JYIA 1SOZA 5C5NA 3LDXH 3IG6B 2ANMH 2GD4B 1QNJA 1UVUH 4WVPE 5JDUB 2AEIH 5DP5A 1UVTH 2FP7B 1BRUP 3EA8A 3AW1A 1Q31A 3E0PB 4UD9H 1GBFA 1C5TA 3W95A 4JZFH 1T8MA 1LVOA 1UHBA 3IWMA 2ULLA 4CRDA 2OINA 1O3JA 1PQ5A 1S5SA 1JOUB 5FX6A 3T25A 1HAIH 3RXJA 1OP0A 1EZUC 1K1NA 2ASUB 2FI4E 2FWWA 1BBRK 3FZDA 1GG6B 3GCTF 1Q2WA 5A8ZA 3K2UA 2ZC9H 4FVBA 1SLVB 1O2ZA 1O33A 2WV4A 5BPEA 1CT2E 1SQOA 2W7UA 3MU4A 4Z0KA 2VB0A 1A61H 3RXPA 2K7XA 1SSXA 1SGQE 3PROA 3SGBE 4CH2B 1LMWB 2FS9A 1T8LA 4GPGA 1XKAC 1OOKB 1KLIH 3ATKA 1UTQA 2AMPA 1PQAA 1EPTB 2ZFSA 1VR1H 1ELVA 1A4WH 1ZMLA 4TPIZ 4AG2A 3K6YA 4NFEA 3BTWE 1DWDH 1ZOMA 3M5LA 3TH2H 4DG4A 2WV5A 2G4UA 3C27B 1SPJA 1BBRE 4Q7YA 3PMHB 4ASHA 5JB8S 5H4IB 3VXEH 1GBBA 4IMZA 2BXUH 3ZV9A 4CBNA 2H5CA 2CF8H 4ABJA 1SLXB 5EW2H 1H9HE 5F8TA 1ID5H 1RGQA 2FZZA 4JYUH 2JETB 3SUDA 2Q6FA