3UPEA

Bovine trypsin variant x(triplephe227) in complex with small molecule inhibitor
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGFYTKLCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3upeA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3upeA02
3SJOA 2G5NA 1AO5A 1YCPH 3QLPH 8LPRA 4BAKB 1ZPCA 1CGHA 4ZKSU 1PPGE 3A88A 4I31A 2P95A 1P3CA 2H5DA 3M37A 3MU4A 2PFEA 5DP4A 4MNYA 1THSH 2FI4E 2ZNKH 4H42U 1SGPE 1T8LA 4Y7BA 1EP5A 1BCUH 2THFB 2WPKS 1IQKA 5FCRA 1EOJA 5JBAS 3T2NA 1QQ4A 1Z8IB 1BT7A 4BTUB 3ODFA 3PMHB 2GVFA 3UQVA 1LKAA 3QK1A 4I8LA 3SOSA 1O2TA 1KY9A 4AGKA 5K0HA 1A46H 2ANMH 4X1QU 2ZGBH 1SQAA 4SGBE 3P6ZB 1VZQH 2R3UA 4ISLA 5K7RA 7ESTE 1YM0A 2OTVA 3Q00A 3LONA 3K6ZA 3SQEE 1EPTA 1C1RA 1J9CH 1RTLA 1P03A 1XUJA 4X2XA 4R8TB 3URDA 1OWJA 1EX3A 2ZO3H 3H7TA 2HOBA 2A1DB 1HAIH 4B2AA 1QB1A 2QA9E 4D8NA 3SO3A 1O33A 1RGQA 2GT8A 1AKSB 1TGSZ 1HAVA 2BY7X 1IQEA 3DA9B 5I46H 1GHBF 1GDUA 2TIOA 1P11E 1MTWA 5DKMA 1VITF 3LT3A 1YPJH 3NK8A 2UUYA 2UWLA 4JZDH 4TWWA 1TQ0B 3EE0B 3JZ2B 2VJ1A 2B9LA 4FXGH 1WQVH 1Y5AT 3ZZ3A 1GG6B 1SOZA 1NY22 4Q7ZA 2FTLE 4IMQA 1EZUC 4VGCC 4CRFA 1M9UA 4AFUA 2O8WA 1TX8A 2SGPE 3ZZ4A 1GJ7B 5GXPA 2O9QA 3SHCH 4SGAE 3I29A 3SNEA 1HJAC 3RXQA 1NZQH 2PKAB 1F0RA 2GZ9A 8GCHF 4WH8A 2H6MA 4UDWH 1C5TA 1ANBA 2A2XH 4YOJA 4MDSA 3MNSA 2AYWA 3SU4A 1AZZA 2R3YA 2TGDA 1WU1A 2P93A 1H8IH 1C1VH 2GMTB 1LCYA 2PR3A 2K1QA 1EATA 1OWEA 4LK4A 1EJAA 1O2YA 1W12U 4BAMB 4B73A 1GCTB 3UWIA 4AB8A 4OGXA 2XBWA 4DIHH 4ISOA 1BTZA 1C9TA 3M5NA 3MYWA 2GCTB 3M3TA 1BMLA 3M5OA 2XW9A 1DOJA 4UFGH 1ZHRA 1LDTT 1GCDA 4Y0YE 2ZHDA 1RS0A 3U9AH 2OBQA 2ZDLA 1MTNB 4A92A 4FUCA 3KN2A 4D76A 1A0LA 2BDAA 3RP2A 1KXCA 4IN2A 3UR6A 5ESTE 1HIAA 1VR1H 3RMOH 5T6DA 1PQ5A 3SUDA 1EXFA 2ZQ1A 5FBIA 5L30H 3FFGA 1MD8A 4FUHA 1C4Y2 4ISHH 1HDTH 1W3CA 2Q6DA 2W7UA 4Z0KA 2ZDVH 1QIXB 4BTTB 4MTBA 1SR5C 1NESE 1A5IA 3V13A 1NRRH 3RLYH 3A8AA 2I6QA 2HPPH 2NU4E 1XXFA 1C5SA 1DUEA 3LGYA 2AIQA 1GBKA 1GGDC 3S0NA 1O2QA 3VGCC 2PUXB 1WCZA 3B8JA 3GY6A 1O5CB 3E90B 3TNSA 2R2WU 3QX5H 5A0CA 2BD8A 3I77A 4NSVA 3T27A 2UUKB 1FJSA 5BRRE 3TH2H 1F0TA 1A1RA 3TNTA 1TA2A 2ANYA 1B7XB 1GBIA 1CU1A 3DT0H 2DE8A 3BTME 3BTEE 3M7UA 5JDUB 3NCLA 1P2OA 2VVCA 3BTHE 1DSTA 3KQEA 5DGJA 3KGPA 3UNRA 1MCVA 4D9QA 3UPEA 5LGOA 5A09A 3S69A 1K2I1 2F9VA 3DD2H 2GCHF 1KTTB 2ZHEH 2ZTXA 3E0PB 3PMBB 4FU9A 2RDLA 4X6OA 1XMNB 1KXEA 4I8KA 4FVDA 2BDCA 5E8EH 4JZEH 1EZQA 1AGJA 1GJ5H 1RJXB 2ZWLH 5FAHA 4WF8A 1O5AB 3EAJA 1PQ8A 1L1NA 4U2WA 3D65E 3GCHC 1GL0E 2BD9A 5A8XA 1VJAU 5LPRA 2HNTC 4NA9H 1AQ7A 2P16A 3V0XA 1QGFA 2ODYB 3P92A 1GWAA 5E2OA 2BVSH 1E37B 5EQQA 2VH6A 2VIOA 3HKIB 1TPAE 3SBKA 3SU1A 1TGTA 1MKXK 2AGIX 3ZZ6A 2ASUB 1HGTH 1LTOA 1RTKA 2A45B 3GCTF 4K2YA 2VIVA 2Y7ZA 3EGKH 4YT7H 2PHBA 2TBSA 2OC1A 2WPIS 5IDKA 4WXIA 1FPHH 5TCAA 1O3DA 2SNWA 2CF8H 2EI6A 1V2VT 2RA3A 1YLCA 1HCGA 4X6NA 1SG8B 1P57B 1D3PB 3SGBE 1O3PB 4WWYA 4X6PA 1O2SA 4JZ1A 3O8DA 2HVXA 1ZR0A 1E38B 3A7VA 3MU1A 3GDVA 2DE9A 1QA7A 1VCPA 1CBWB 4IC6A 1XM1A 2QXIA 2CF9H 1LQEA 1UCYH 1QRWA 2FOFA 3UWJH 1HAYB 2BD4A 4MLFB 3QUMP 1AVGH 3MNXA 1MBMA 1K1LA 1O2VA 3K2UA 1NROH 3LH3A 1GI9B 1V2NT 1YKTA 4GHQA 3BG4B 3PM3A 4AG1A 4E7NA 2P59A 2CXVA 3GCOA 1UK4A 1SQOA 2QXGA 1GBEA 1HAVB 1WOFA 1SHHB 4ZAEA 5AF9H 4OS7A 2BD7A 1G2MA 4BTIB 4MNWA 3HK6B 3I78A 1S0QA 1O2XA 2BM2A 4WMDA 3KF2A 1AB9B 4UFEH 2R9PA 1BOQA 2BX4A 3T25A 1UK2A 2BXUH 2FOMB 3FVFB 2H9HA 1TABE 2AMDA 2FOGA 3DFLA 3F9EA 2ILNA 3TITA 2STBE 2BQ7B 4U01A 5IYTA 5DK1A 3VPKA 1C1PA 3TK6A 2BDYA 4DT7B 1XVOA 1ZLRA 1P2IA 4NIVA 1E35B 1GDQA 1QTFA 4KKDA 2BVRH 1BB0B 4DG4A 2HPQH 3ENSB 5F6MA 1SGEE 2BLQA 5EQSA 1GHYH 5AVDA 2OXSA 2VINA 1CGIE 1MU6B 1ZOMA 3QWCH 1O2OA 2WINI 2KAIA 3BEFB 1OPHB 4H6SB 4BAQB 1OKXA 2OC0A 3MH4A 1AHTH 3RXVA 3RLWH 2A7HA 1C1OA 1G32B 3P70B 3E0NB 1G3CA 2A2QH 3G01A 1D3QB 4RKJB 2OBOA 4FUEA 2OINA 2J2UA 3QGJA 1P10A 2UUFB 3UREA 1RIWC 2QXHA 3ATWA 1CA0B 4UE7H 2JH5D 1SGTA 3MO9A 3URCA 4X6MA 3RXMA 2ZU4A 1AIXH 2WPJS 2ZGJA 2QCYA 3VB4A 5L2YH 1JXPA 1O37A 8ESTE 4MPUA 4O97A 3PLPA 3GDUA 1C1TA 1MAYA 1GHBG 2VGCC 1LPGB 2GD4B 1MKWH 1SMFE 1Z71A 2CJIA 3TGIE 2D2DA 1P2KA 1VITG 5JBBS 1SGYE 3IWMA 1HAHH 1ORFA 1GI6A 2A4GA 5GDSH 1HIAB 1SHYA 2PV9B 2ZFPH 3LGIA 3KQBA 3ODDA 1SQTA 1V3XA 4O03A 2OP9A 2HWLB 1SL3A 3M5MA 1TNHA 4HI3A 1VCWA 3RXRA 4CRCA 2BDIA 4Y8ZA 1TBQH 1SGDE 4JYTA 2FOBA 4X2VA 3RXOA 1NT1A 2CGAA 4D9RA 2BDBA 3SJIA 3V12A 4TWYA 2XBXA 3A81A 1DY8A 3RXFA 8GCHG 1GHZA 1SGIB 3T5FH 4A1TA 2NWNA 4AFZA 1J17T 2AIPA 4I33A 2C4FH 3P95A 1CT2E 3HK3B 2V0BA 2AMQA 4IC5A 1AMHA 2W26A 3P8OA 4BNRA 1O30A 3LGUA 1YPHE 1DWEH 1O34A 4YOGA 1W10U 1Z1IA 4ABBA 3AAUA 1KDQA 1FN6A 1U6QA 1IQHA 4X1RU 1AFQC 2ZFQH 4AX9H 1P2MA 5DG6A 3UUZA 1WYKA 3A7XA 1YCPM 2QXJA 1FUJA 3PMJA 2Y7XA 2H9TH 3A7WA 1TBZH 1SI5H 1QJ1B 1GI5A 1FLEE 2XBYA 2W3IA 3KHVA 2FX4A 2ZCHP 4Y11E 3LGTA 3STJA 1VJ9U 2SGEE 4OS6A 3ZYEA 1GBAA 3MTYA 1CE5A 1SGFA 1FPCH 4R0IA 4WXVA 4XBCA 1ZPZA 3SV9A 4Q80A 1TGNA 3RXCA 1GBJA 2C8WB 5AFZH 1GJ8B 2D1JA 3SQHE 4FUGA 3GISB 1GJDB 4I8GA 5HMAA 5F8TA 2TGAA 3GY7A 1CO7E 1EOLA 1F5LA 4NFEA 2FS8A 3GICB 1QFKH 3MOCA 4AORA 1H8DH 4A5TS 1C2EA 3GY3A 2BD2A 1HAXB 3A8DA 2QV1A 4Y8YA 2AH4X 1C5LH 3MO6A 4YLUA 5FX6A 1DWBH 1K1MA 3AAVA 1ANEA 1AVXA 4BAOB 1SLXB 3GYLB 2CHAC 5HXFA 4OS5A 4Y7AA 1OYTH 1RFNA 3BEIB 1JRSA 3TJUA 1AU8A 3BV9B 2P8OC 1ARCA 4J2YB 4X1SU 1QJ7B 4X2YA 1V2OT 1BQYA 3IG6B 2R0KA 1DLKB 2NU2E 4YM9A 2Z9LA 1FI8A 3ZVGA 2C8XB 1WQSA 3A86A 3M35A 1LMWB 4ASHA 1BITA 1QURH 1TWXB 3MU5A 4RSPA 2A4QA 3EDXB 1G37A 1P2QA 1QHRB 2ZCLP 2XC0A 1LPKB 1MZAA 1OWKA 2Z9JA 3ATIA 4MPVA 1Y3WA 4FUBA 1EP6A 1ZPBA 4ABDA 1DXWA 1YPHC 1S83A 1BMMH 2GCHG 4D7FA 1A0HB 1BDAA 1C1MA 1C2MA 1Y5UT 1O2IA 1BRBE 1TLDA 3E1XB 2GCTC 1DE7H 1NN6A 1GI3A 2Y5FA 1N8OC 2BD5A 2JETC 4WMEA 4DURA 4H4FA 4AN7A 2FM2A 5F03A 1K1PA 5CHAC 5EQRA 1FNIA 1Z6EA 3Q77A 5EU8A 3HGPA 2WUCA 1EJNA 1ETTH 1NFWA 1C2LA 1ZRKA 2CV3A 3BTGE 3S9CA 4HGCA 1O3NA 3KEEA 2VIWA 3B23B 4FUFA 1EZXC 1G2LA 3GCTG 1RTFB 4DY7B 2YNAA 4E05H 3LJOA 1T31A 2ZDAH 5ETXA 5LPEA 1ESTA 3DHKH 1BIOA 2BYAX 3SNAA 3GY5A 2Z9GA 3SJ8A 4GUXA 3E91A 1P05A 2BTCE 2KAIB 5PTPA 1AVWA 5JPMH 1KXDA 4XBBA 2TGPZ 3FZZA 3T28A 1G3DA 3W94A 2W5EA 3LPRA 1C4V2 5GIBA 1DWDH 1H9IE 5L2ZH 2F9NA 1DX5M 2PW8H 3U8OH 1NO9H 5GCHG 1CHOF 5AFYH 1T4VH 3A7TA 1LHEH 2FDAA 1NU9A 1XVMA 1EAIA 5DP6A 1HXFH 1TQ7B 4YLQH 1QBVH 3RXHA 4NWLA 1QNJA 1GHXH 1NPMA 2BQWB 2H1UA 1HNEE 3RM2H 4Y71A 1O5FH 2A7CA 5E0JA 3KIDU 1C5YB 1KYNA 3V3MA 1ZJDA 4ABEA 2XRCA 3QDZB 1KSNA 3PB1E 1P2JA 4AB9A 3F9FA 4NFFA 2GP9B 3HATH 4WVPE 1Y3VA 4I32A 4NGAH 3KCGH 3KNXA 2R2MB 1EQ9A 1SGCA 3LJJA 1UVTH 1ELGA 1Y5BT 1A3EH 1BZXE 1TE0A 3RM0H 2C8YB 3M3SA 4QT8C 3LU9B 3MO3A 1MH0A 1NRPH 3W95A 3D49H 1SGNE 1UK3A 1MZDA 1VGCC 2FS9A 2HNTE 2NU1E 4JYUH 1TMBH 2B5TB 1O39A 1TPSA 1ELFA 4Q7XA 2O8TA 2J38A 5E0HA 1J16A 1AE8H 3LC5A 3LKWA 2I6SA 3NKKA 3SNBA 1C5RA 2BZ6H 2A5IA 1GJCB 2QY0B 3SJ9A 2OQUA 1WSSH 1RD3B 2XTTB 2BY5X 3ATKA 1NRQH 1UCYE 1W2KH 2FOHA 1XKAC 1ARBA 1SGQE 1N1LA 3TPIZ 1KLJH 4YTAA 3A8CA 1UTKA 3EQ0H 1UVSH 1AY6H 2FTMA 3NPSA 1BTWA 2WUBA 3LH1A 1FMGA 1UMAH 4XSKU 1FAXA 2VVUA 2Y5GA 3OYPA 1SPJA 5DP3A 1F0SA 1K1JA 3RXLA 1PQ7A 2ZU2A 1KDQB 1S81A 1T8NA 1F5KU 2PTNA 1UVPA 2EI7A 4ISIH 1HFDA 3ZZ9A 4AOQA 4CREA 1NFXA 2ODQA 3ZZBA 1O2GH 1QB6A 1MUEB 2F9OA 1TPPA 4JYVH 6LPRA 1GPZA 1FY4A 1ZRBA 3A82A 3L6PA 2Y82A 1QL8A 3OX7U 5EODA 2FWWA 2G8TA 1VCQA 2BDGA 4IW4E 5DPAA 4JZFH 4UFDH 2ZQ2A 1P04A 2XC5A 4NCYA 1TRNA 2GGVB 1BBRH 3BN9A 3O8BA 4Q2KA 1PPEE 1UTJA 1J15A 3BIVH 3LGWA 1PJPA 2ULLA 3F6UH 3ZZ5A 3QN7A 3SV7A 3O8RA 1T32A 1DPOA 4JCNA 1HJAB 3GY4A 2Z94A 2A4OA 3AVZA 1GBMA 2D8WA 1TNLA 1LHGH 3R3GB 3DUXH 1KLIH 5C5NA 4MQAA 1FY1A 4WJG2 1YP9A 3UOPA 4UFFH 1FY5A 3BTFE 3ZVBA 3VXEH 1AWHB 3RXIA 3T26A 4GPGA 5TJXA 1AFEH 3SUGA 1D4PB 3QZRA 3BTTE 1SLWB 1ZTLA 2Y80A 3D62A 4K1SA 3MH6A 1EB2A 1ZTKA 4U30A 1JWTA 1DM4B 2FMJA 1C4U2 3Q76A 4LOYH 4YZUA 1S85A 1TGBA 3BG8A 1IQIA 1MKXH 1GBTA 2PGQB 4CR9A 1GVLA 1UTNA 4K8YA 5GJ4B 2WPLS 5DP8A 4CRAA 1KLTA 2ZPQA 3PO1C 3S7KB 2WV4A 3SNCA 3P8NA 1CA8B 2J9NA 3U98H 5A2MH 1UTMA 2ZPRA 1AN1E 1F2SE 2O8UA 1W14U 1IQJA 1H1BA 1YPEH 4KGAA 4MG3A 1GBLA 2GV6A 1Q2WA 1V2LT 4NA8A 4XE4A 3QGNB 2VU8E 1AWFH 1ELBA 3MWIU 1BTXA 1H4WA 4WY3A 5SGAE 1C5OH 2J94A 4ZKOU 3M3VA 4X1PU 1QRZA 3M61U 1C5XB 1DT2A 1Q31A 1BMAA 5C1YA 1UHBA 5GCHF 5A8ZA 3RXBA 3SORA 2Z3EA 1EAUA 3AW1A 2ZDKA 2OQ5A 3UQOA 4CHAC 2Z7FE 1EPTB 1HAZB 1IHSH 1UTLM 3GY2A 5FHTA 1DXPA 3PLKA 8KME2 3SU3A 1C1QA 1AUJA 1O35A 1K28D 2FOCA 1V2ST 3S9AA 1RRKA 1W0YH 2ZHWH 3MHWU 1LQDB 1A4WH 2FX6A 1ZTJA 1GGDB 3ATLA 4ISNA 3VB5A 2G51A 4NSYA 3VGCB 3TH3H 1W11U 1O36A 2O8MA 3A85A 2GZ8A 1B5GH 1PPCE 1S6FA 4GHTA 1QA0A 1EUFA 3MNBA 4B71A 5L6NH 1L0ZA 4CRBA 4X8VH 3U8RH 1CSOE 3Q3XA 2TPIZ 1O5BB 3B9FH 1GBBA 5JYIA 4INKA 4ZMAH 5DJ7A 3SN8A 1O2PA 1YPMH 3PROA 4M7GA 1ABJH 1W13U 5JBCS 3SV8A 3U1JB 5EW2H 1QB9A 6ESTA 4ZHMU 3OTJE 1XXDA 1MTUA 1P0SH 4ABHA 1VITH 3GCNA 3TJNA 1C5VA 1HAPH 1UO6A 1AKSA 2XWAA 3ATMA 5AHGH 1C5NH 1PFXC 3NXPA 1TNJA 2A31A 1C5MD 1DUAA 5C20A 3LOXA 4U32A 5G4BA 1V2TT 1GHAF 1TNGA 2H5CA 1GDNA 1KIGH 3GCHB 1RXPA 1P09A 1C2IA 3F9GA 1ZSLA 5BPEA 3KQCA 1PYTD 2A7JA 1C2KA 5C3NA 4JK5A 5FCKA 7GCHF 2PKSB 2P3UB 3LC3A 4Y10E 6CHAC 2FLRH 3SU0A 1YPLH 2PGBB 4KP0A 1LVOA 1G30B 1IQNA 3JZ1B 3OU0A 1YYY1 2HLCA 1K1IA 2FI5E 4K8BA 1LVBA 3ZV9A 4F49A 3TH4H 3P8FA 1A61H 4ZH8A 2SFAA 1O3HA 1TAWA 2PLXA 4FU8A 1AD8H 1INCA 5HM2A 3RC6A 1SLUB 1WUNH 4NWKA 1EASA 2FO9A 2ZTZA 3PMAB 2HGTH 4H6TA 1TGCA 1JBUH 2JH6D 5JB9S 1GMHF 1FQ3A 1MCTA 4I7YH 3ZVAA 2ZPSA 1LPZB 5T6GA 1O5GH 2ODPA 4NG9H 2PUQH 3EA9A 1HLTH 1BHXF 4XDEA 2EA3A 2BB4A 4BXSA 5J4QA 4XOJA 3MU0A 4FVBA 1TX6A 1UVUH 2ZKSA 1GI7B 4AG2A 5DO4H 1ZJKA 4GAWA 4B1TA 1S84A 1O3CA 3CS7A 4OS2A 4X8TH 1P01A 1SOTA 1DANH 1HV7A 2V3HH 3LDXH 2Q6GA 1WTGH 1TMTH 2F9PA 1JRTA 2ZEBA 3D23A 1W7GH 1GBCA 1HBTH 1L1GA 9ESTA 1OP2A 3N7OA 2TRMA 1CHOG 4CBOA 4B74A 1LHDH 3RXTA 3OY6U 3M7QA 1ELCA 1PQAA 1TA6A 4DVAU 1KTSB 4FUDA 1O2WA 1GBDA 1SFIA 2RCEA 2GTBA 4UEHH 1J14A 2QN5T 2C3SA 4X2WA 4DGJA 2XXLA 1WAYB 2J34A 1O3EA 2F83A 1S6HA 3UIRA 3ZZAA 2FYQA 1S0RA 3RC4A 1TIOA 2UUJB 3GDSA 3PWCA 2BQ6B 1F92A 3TU7H 3ZZ7A 1L2EA 1AE5A 4Y0ZE 2Z9KA 1OX1A 1ACBE 1THPB 1HYLA 2GKVE 2W3KA 2YNBA 1A7SA 2SGAA 4I8HA 2BLVA 5HGGA 2FYRA 1TOMH 2ZIQH 1O0DH 2JKHA 3UTUH 2F91A 4ABIA 2ESTE 3F68H 2VWLA 1QCPA 3SU6A 3MI4A 5FPSA 2B8OH 1GMCF 1SVPA 1MTSA 1RIWB 1FONA 1HAOH 2VWOA 1IQGA 3BTWE 1LHFH 1GJ4H 1GG6C 1OSSA 1V2MT 3TK5A 1GBFA 3KQDA 4FUJA 1BUIA 1P02A 1Z6JH 1DY9A 1A0JA 2CN0H 3QZQA 5HM9A 1P06A 1O32A 3TLOA 1F0UA 2QGRA 3CS0A 4IGDA 3TK9A 3WY8A 4DJZB 1ZMJA 2VGCB 1ETSH 2TGTA 3FP8E 3S9BA 2EI8A 1TNIA 3A84A 3EA8A 3R0FA 3PYHA 1C2FA 1O2UA 3MNCA 3S7HB 2Y6TA 2CMYA 3ZZDA 3PLBA 3A83A 1X7AC 3RXSA 2GZ7A 2HNTF 1A3BH 1GJ9B 5FPYA 4TY6A 1YCPK 2GMTC 1UHBB 3IITA 1CHGA 2G00A 3QTOH 3E8LA 3SZNA 3RU4D 2B0FA 2SGDE 1GCTC 5EXLA 1GHVH 2WPHS 2EEKA 1EKBB 1O2NA 1O2MA 1OWHA 1EAWA 2QC2A 2VIPA 2VNTA 5EXNA 1GI8B 4AYYB 1ZGVA 1C2JA 4XBDA 5GWZA 2Q6FA 1TNKA 1AI8H 1FAKH 1JOUB 4TPIZ 1ZGIA 2OC7A 1MTNC 1O5EH 1NTPA 3VXFH 2H9EH 1DVAH 1C2GA 1XUFA 1B0EA 3FP7E 1SGRE 1AFQB 1JMOH 1ZZZA 2OC8A 3M7TA 1MQ6A 3RXKA 1IQFA 2FESH 1GJAB 3NZIA 2XYAA 1UVOA 4HTCH 1KXBA 4Y79A 3TGKE 1O3BA 4J1YA 1OS8A 4IBLH 1C2DA 1V2PT 2ZGHA 4HFPB 1Z1JA 1ESBA 1HAGE 1ABIH 3PWBA 3CENA 4A7IB 1CQQA 4K69A 4OGYA 1JIRA 2PWXA 5FX5A 1NM6A 4X1NU 3F9HA 1QBNA 2P3FH 2D26C 2P3TB 4AZ2B 2NU3E 4YESB 5EXMA 3ZV8A 1GL1A 1BTPA 1BBRE 1BRAA 1BJUA 2XNIA 3E16B 1DITH 1TOCB 1D3TB 4NIYA 5DP5A 4FUIA 2ZU5A 1EB1H 3A87A 5EPYA 1PPFE 2J92A 2ZZUH 3A7YA 3BSQA 3Q3YA 2LNCA 5DP9A 1GVKB 1TONA 2G55A 2FLBH 3SUFA 3DFJA 4CR5A 4B2BA 3M36A 1TRMA 2ZECA 2ZFRH 1MU8B 2ANWA 3ITIA 2ZTYA 3QO6A 3K6YA 3RXGA 2A0QB 3SGAE 1YBWA 2CHAB 4MNVA 2VH0A 1GMDF 1DWCH 2VWNA 4GLYA 1BTHH 3ZZCA 4Y6DA 3ZYDA 2OLGA 2Y81A 1T8MA 1O3LA 1TRYA 2P8OB 3RXAA 1FY3A 1AUTC 1J8AA 1O3AA 1SSXA 5LH8A 3SW2B 4NIXA 1ANDA 1K9OE 4KTUA 1THRH 1HB0B 1HRTH 4YT6H 2XCNA 4WMFA 1IHTH 1ELDE 1ETRH 4RN6A 2PTCE 2GDDA 3U8TH 1ELAA 4GCHF 3FZDA 4K1EA 1YPGH 5FPTA 1NC6A 3SI4H 4CRDA 1Z7KA 5J4SA 1BTYA 4MVNA 4CH8B 1HUTH 1KXFA 1OP8A 2BHGA 1C5QA 2AGEX 1V2QT 3RXPA 1O3JA 2VIQA 1GI4A 2ANKH 4DIIH 5EOKA 2GX4A 4K1TA 2V3OH 1N8OB 3RXDA 2JETB 2JH0D 2XBVA 6GCHF 3TJVA 1GHAG 1V2WT 1DFPA 2FIRH 1C5PA 2BX3A 3MU8A 2IOTA 4TY7A 4LZ1H 5CHAB 3RMLH 1O3KA 4TYDA 1MQ5A 2G81E 2ZDNA 1GJBB 1ZSJA 1LKBA 4Y76A 1BMNH 3AASA 1CT4E 7GCHG 1O2JA 3OSYA 1ZYOA 1B0FA 1PPBH 2BY9X 4O9VA 4AFSA 5GPIB 3MH5A 1CBWC 5JB8S 2IJOB 2ZGXH 2OD3B 4NZLA 1GI2A 1OWIA 2O8LA 1EPTC 1SGFG 4JZIA 4OS4A 2Z3CA 1K21H 3UOUA 4ZHAA 1TPOA 2DUCA 5A8YA 1YPKH 3PTNA 1QR3E 3STIA 5ABWA 3BG4C 3MFJA 4RKOB 1NRNH 3NWUA 1D6RA 2GT7A 4KTSA 3SI3H 2Y5HA 2F9BH 3VFEA 2HALA 4VGCB 1P9UA 2STAE 1LO6A 2FZZA 3UNQA 2ZC9H 1YGCH 4Z6AH 2ZHFH 1IQMA 1GMHG 4B76A 1C2HA 1ELTA 3SV6A 1AB9C 1GBHA 3SV2H 3VB6A 4MPWA 1FXYA 2C90B 2QIQA 3K65B 2WPMS 2IN2A 1O3GA 1UTOA 2EC9H 1ELVA 1CGJE 2VWMA 4A6LA 4AFQA 1BHXB 3E3TA 1BBRK 1H9HE 4BAHB 2FOEA 5EG4A 5EGMA 3RMNH 4ABAA 4UONA 1HJ9A 4LXBH 1MAXA 1DICA 3F1SB 2XCFA 3FP6E 2Q1JA 1C1WH 1CT0E 3MH7A 4ABFA 1SB1H 1G3BA 1LVYA 1UTPA 3SU5A 2BOKA 1OWDA 1TYNA 3RU4T 2UWOA 3UR9A 2C8ZB 1ESAA 5E2PA 4ABGA 3U1IB 2ZCKP 3FANA 5T6FA 1P8VC 4ESTE 1C1NA 4KTCA 3K9XB 3Q3KA 1WTHD 2BOHB 1VGCB 3UY9A 3L3TA 1Y59T 5C67A 2B7DH 3ZVEA 5CMXH 1T8OA 2Z6BD 3T62A 5C2ZA 2PKSC 2BDHA 1O3MA 2WYJA 3H7OA 3BTKE 4NA7A 4CH2B 1CA0C 1DSUA 1C5ZB 1O3IA 3RXUA 1XUIA 1P12E 2FODA 1G36A 3BIUH 1ZMLA 2ZDMA 4GVUA 1V2UT 1AZ8A 1ZHPA 1O38A 3SNDA 1W8BH 1PPHE 1P9SA 5H4IB 4B75A 4D7GA 3BTQE 1T4UH 1MBQA 3VEQB 4KELA 2YOLA 2QF0A 1N6YA 3TVJB 1T7CA 2ZFSA 3RXJA 1HPGA 2NU0E 3TGJE 4F4OC 4XFQA 3RUOA 3EYDA 3U69H 4BOHA 2OUAA 5B6OA 1F7ZA 2ZHQH 3VB7A 1EZSC 1GMCG 2LPRA 4NZQA 3UNSA 1UCYK 4CBNA 3ZVCA 1C5UA 1TX7A 1WV7H 4IN1A 2ZA5A 1K22H 2FPZA 1D6WA 1P2NA 1BTUA 2XC4A 2VVVA 4IS5A 3SHAH 1BJVA 2ZP0H 4FU7A 3TJOA 1EAXA 1UTQA 2BXTH 1NS3A 1Y8TA 1Z8JB 4NIWA 5F8ZA 4GSOA 4ZKRU 4JMYA 4MNXA 2SGQE 1QY6A 3C1KA 1ZMNA 1FV9A 3RC5A 3A8BA 4AGJA 2ZF0H 1IAUA 1GI0A 4OS1A 4IMZA 1D3DB 3L33A 1W0ZU 3RMMH 1TBRH 1QL9A 2M5TA 1ANCA 2V35A 2HRVA 5LPFA 1LHCH 1Z8GA 1TB6H 5C1XA 1A5HA 1O2ZA 2ZFFH 1NRSH 1H9LB 7KMEH 4LZ4B 1D9IA 5DP7A 3T29A 4ZXXH 1CVWH 4X0WU 2AS9A 4K5ZA 1SC8U 3RXEA 4DCDA 1O2HA 2V6NA 1IOEA 4Q7YA 2FI3E 1C5WB 1BRCE 2ALVA 3EA7A 4A1XA 1O31A 2XWBI 2BZAA 1L1JA 2OCVB 3VB3A 2AFQB 2WV5A 1QRXA 1S82A 3BF6H 4K3JA 3ELAH 1YF4A 1GVZA 1F5RA 1LVMA 4E06H 1L4ZA 2A4RA 3PO1B 3P17H 5C1UA 1V2RT 2R0LA 3E6PH 3RDZA 1GI1A 3ZZ8A 1YC0A 1Y3YA 1GJ6A 2BD3A 4JK6A 2F3CE 4TPYA 1O2RA 3LGVA 1Y3UA 1PYTC 3AW0A 4UD9H 3A80A 2UWPA 2P94A 2PKAA 3O8CA 2J95A 1HXEH 4A1VA 5I25A 2ALPA 1SFQB 1PPZA 2QYIA 2IPHA 5EW1H 3HGNA 1KXAA 1C1UH 1XX9A 2VIDA 4HZHA 2RG3A 2FXRA 4ZHLU 3A7ZA 1P3EA 2GDEH 3M5LA 1MTVA 3HKJB 1OXGA 2BLWA 1G9IE 1WBGB 3SU2A 4CHAB 4PROA 1NFUA 1O3FA 2J4IA 5TCCA 4YO9A 1NFYA 1TMUH 3CP7A 9LPRA 1QL7A 1O2LA 1XKBC 1E36B 1K1OA 2GV7A 1MKWK 2G4TA 1MMJN 2H2ZA 4DOQA 5FBEA 2ZU1A 1Z8RA 2ZI2H 3GYMA 1FIWA 2A5KA 2A5AA 1XUKA 1UJ1A 1W7XH 2C93B 1JIMA 2G52A 2WYGA 2QAAA 4ZKNU 1Y3XA 2W7SA 4CRGA 4Y8XA 1TALA 1O5DH 5A0BA 2Z9IA 4BANB 5A0AE 2G4UA 3QTVH 4DW2U 1A2CH 5CE1A 1DS2E 3SGQE 2QF3A 2FEQH 1GMDG 3BEUA 4B2CA 1S5SA 2FOAA 1EJMA 2F9UA 4MPXA 1FDPA 3ZVFA 1FN8A 4INHA 4YOIA 3UFAA 2ZG0H 1YLDA 1ZSKA 4X8SH 1BRUP 5ESBA 2G5VA 1O3OA 2BY6X 1OYQA 1FY8E 5E0GA 1G3EA 2RA0A 1GHWH 1O2KA 1OP0A 5C5OA 2Z3DA 2PSYA 3TIUA 1TFXA 1FZZA 3RU4E 4WH6A 4O3UA 3C27B 1XUGA 4K60A 1N6XA 1NU7B 4GCHG 1Q3XA 3SUEA 3A89A 1FIZA 3FAOA 3P8GA 4BXWA 3LIWA 5JBTA 1MD7A 3BTDE 3ZVDA 3KL6A 3H5CB 1DLEA 1A5GH 3MMGA 1E34B 1K1NA 6CHAB 1QBOA 2SGFE 5FXLA 3PV4A 1ZHMA 2ZU3A 4E7RG 1ELEE 2AGGX 5T3HA 1V2JT 1SBWA 2SNVA 2ZFTA 2BLOA 1IQLA 1C9PA 1XUHA 4ABJA 1BA8B 3HPTB 4ZXYH 2BY8X 3NUMA 2VB0A 6GCHG 1C1SA 2PSXA 4ZUHA 1QQUA 1HJ8A 2FP7B 1SLVB 1QJ6B 1E0FD 2BVXH 4THNH 1V2KT 3GOVB 4AYVB 3OY5U 3GY8A 1OOKB 4O3TA 3ESTA 2AERH 2A32A 2AEIH 5HYOA 7LPRA 5F8XA 4X8UH 4I8JA 3PTBA 2AMPA 2ZGCA 4INLA 1L4DA 1DDJA 1V6DA 2BMGB 3V7TA 3SJKA 5EPNA 4ZROA 1ID5H
chains in the Genus database with same CATH superfamily
3SJOA 2G5NA 1AO5A 1YCPH 3QLPH 8LPRA 4BAKB 1ZPCA 1CGHA 4ZKSU 1PPGE 3A88A 4I31A 2P95A 1P3CA 2H5DA 3M37A 3MU4A 2PFEA 5DP4A 4MNYA 1THSH 2FI4E 2ZNKH 4H42U 1QZ8A 1SGPE 1T8LA 4Y7BA 1EP5A 4ZCNA 1BCUH 2THFB 2WPKS 1IQKA 5FCRA 1EOJA 5JBAS 3T2NA 1QQ4A 1Z8IB 1BT7A 4BTUB 3ODFA 3PMHB 2GVFA 3UQVA 1LKAA 3QK1A 4I8LA 3SOSA 1O2TA 1KY9A 3OEED 4AGKA 2M2AA 1A46H 5K0HA 2ANMH 4X1QU 2ZGBH 1SQAA 4SGBE 3P6ZB 1VZQH 2R3UA 4P02A 4ISLA 5K7RA 7ESTE 1YM0A 2OTVA 3Q00A 3LONA 3K6ZA 3SQEE 1EPTA 1C1RA 1J9CH 1RTLA 1P03A 1XUJA 4X2XA 4R8TB 3URDA 1OWJA 1EX3A 2ZO3H 3H7TA 5KGOA 1WXRA 2HOBA 2A1DB 1HAIH 4B2AA 5EJ1A 1QB1A 2QA9E 4D8NA 5EJZA 3SO3A 1O33A 1RGQA 2F43B 5CDFE 2LP6A 2GT8A 1AKSB 1TGSZ 1HAVA 2BY7X 1IQEA 3DA9B 5I46H 1GHBF 2YMSB 4FOUC 1GDUA 2TIOA 1P11E 1MTWA 5DKMA 1VITF 3LT3A 1YPJH 3NK8A 2UUYA 2UWLA 4JZDH 4TWWA 1TQ0B 3EE0B 3JZ2B 2VJ1A 2B9LA 4FXGH 1WQVH 1Y5AT 3PRDA 3ZZ3A 1GG6B 1SOZA 2KM0A 1NY22 4Q7ZA 2FTLE 4IMQA 1EZUC 4VGCC 4CRFA 1M9UA 4AFUA 2O8WA 1TX8A 2SGPE 3ZZ4A 1GJ7B 5GXPA 2O9QA 4F55A 3SHCH 4SGAE 3I29A 2V3MA 3SNEA 1HJAC 3RXQA 1NZQH 2PKAB 1F0RA 2GZ9A 8GCHF 4WH8A 2H6MA 4UDWH 1C5TA 1ANBA 2A2XH 4YOJA 4MDSA 3MNSA 2AYWA 3SU4A 1AZZA 2R3YA 2TGDA 1WU1A 2P93A 1H8IH 1C1VH 2GMTB 1LCYA 2PR3A 2K1QA 1EATA 1OWEA 4LK4A 1EJAA 3KYGA 1O2YA 1W12U 4BAMB 4B73A 1GCTB 3UWIA 4AB8A 4OGXA 2XBWA 4DIHH 4ISOA 3DSPA 1BTZA 1C9TA 3M5NA 3MYWA 2GCTB 3M3TA 1BMLA 3M5OA 2XW9A 1DOJA 4UFGH 2J97A 1ZHRA 1LDTT 1GCDA 5B6LA 4Y0YE 2ZHDA 1RS0A 3U9AH 2OBQA 2ZDLA 1MTNB 4A92A 4FUCA 3KN2A 4D76A 1A0LA 2BDAA 3RP2A 1KMHB 1KXCA 4IN2A 3F2FA 3UR6A 5ESTE 1HIAA 1VR1H 3RMOH 5T6DA 1PQ5A 3SUDA 1EXFA 3FKSD 2ZQ1A 5FBIA 5L30H 3FFGA 1MD8A 4FUHA 1C4Y2 4ISHH 1HDTH 1W3CA 2Q6DA 2W7UA 4Z0KA 3F0OA 2ZDVH 1QIXB 4BTTB 4MTBA 1SR5C 1NESE 1A5IA 3V13A 1NRRH 3RLYH 3A8AA 2I6QA 2HPPH 2NU4E 1XXFA 1C5SA 1DUEA 3LGYA 2AIQA 1GBKA 1GGDC 3S0NA 1O2QA 3VGCC 2PUXB 1WCZA 3B8JA 3GY6A 1O5CB 3E90B 3TNSA 2R2WU 3QX5H 5A0CA 2BD8A 3I77A 4NSVA 3T27A 2UUKB 1FJSA 5BRRE 3TH2H 1F0TA 1A1RA 3TNTA 1TA2A 2ANYA 1B7XB 1GBIA 1CU1A 3DT0H 2DE8A 3BTME 3BTEE 3M7UA 5JDUB 3NCLA 1P2OA 2VVCA 3BTHE 1DSTA 3KQEA 5DGJA 3KGPA 3UNRA 1MCVA 2K8IA 4D9QA 3UPEA 5LGOA 1VKYA 2KCYA 5A09A 3S69A 1K2I1 2F9VA 1FX0B 2GCHF 1KTTB 2ZHEH 2ZTXA 3E0PB 3DD2H 3PMBB 4FU9A 2RDLA 4X6OA 1XMNB 1KXEA 4I8KA 4FVDA 2BDCA 5E8EH 4JZEH 1EZQA 1AGJA 1GJ5H 1RJXB 1SKYE 2ZWLH 5FAHA 4WF8A 1O5AB 5DN6D 3F2HA 3EAJA 1PQ8A 1L1NA 4U2WA 3D65E 3GCHC 1GL0E 2BD9A 5A8XA 1VJAU 5LPRA 2HNTC 4NA9H 1AQ7A 2P16A 3V0XA 1QGFA 2ODYB 3P92A 1GWAA 5E2OA 2BVSH 1E37B 5EQQA 2VH6A 2VIOA 3HKIB 1TPAE 1COWD 3SBKA 3SU1A 1TGTA 1MKXK 2AGIX 3ZZ6A 2ASUB 1HGTH 1LTOA 1RTKA 2A45B 3GCTF 4K2YA 2VIVA 2Y7ZA 3EGKH 4YT7H 2PHBA 2TBSA 2OC1A 2WPIS 5IDKA 4WXIA 1FPHH 5TCAA 1O3DA 2SNWA 2CF8H 2KFWA 2EI6A 1V2VT 2RA3A 1YLCA 1HCGA 4X6NA 1SG8B 1P57B 1D3PB 3SGBE 1O3PB 4WWYA 4X6PA 1O2SA 4JZ1A 3O8DA 2HVXA 1ZR0A 1E38B 3A7VA 3MU1A 3GDVA 2DE9A 1QA7A 1VCPA 1CBWB 4IC6A 1XM1A 4XD7D 2QXIA 2CF9H 1LQEA 1UCYH 1QRWA 2FOFA 3UWJH 1HAYB 2BD4A 4MLFB 3QUMP 1AVGH 3MNXA 1MBMA 1K1LA 1O2VA 3K2UA 1NROH 3LH3A 1GI9B 1V2NT 1YKTA 4GHQA 3BG4B 3PM3A 4AG1A 4E7NA 2P59A 2CXVA 3GCOA 1UK4A 1SQOA 2QXGA 1GBEA 1HAVB 1WOFA 1SHHB 2WHXA 4ZAEA 5AF9H 4OS7A 2BD7A 1G2MA 4BTIB 4MNWA 3HK6B 1YLNA 3I78A 1S0QA 1O2XA 2BM2A 4WMDA 3KF2A 1AB9B 4UFEH 2R9PA 1BOQA 2BX4A 3T25A 1UK2A 2BXUH 2FOMB 3FVFB 4B6FA 2H9HA 1TABE 2AMDA 2FOGA 3DFLA 3F9EA 2ILNA 3TITA 2STBE 2BQ7B 4U01A 5FL7D 5IYTA 5DK1A 3VPKA 1C1PA 3TK6A 5KECA 2BDYA 4DT7B 1XVOA 1ZLRA 1P2IA 4NIVA 1E35B 1GDQA 1QTFA 4KKDA 2BVRH 1BB0B 4DG4A 2HPQH 3ENSB 5F6MA 1SGEE 2BLQA 5EQSA 1GHYH 5AVDA 2RFKC 2OXSA 2VINA 1CGIE 1MU6B 1ZOMA 3QWCH 4F48B 1O2OA 2WINI 2KAIA 3BEFB 3FO8D 1OPHB 4H6SB 4BAQB 3CNRA 1OKXA 2L74A 2OC0A 1AHTH 3MH4A 3RLWH 3RXVA 2A7HA 2EY4C 1C1OA 1G32B 3P70B 3E0NB 1G3CA 2A2QH 3G01A 1D3QB 4RKJB 2OBOA 4FUEA 2OINA 2J2UA 3QGJA 1P10A 2UUFB 3UREA 1RIWC 2QXHA 3ATWA 1CA0B 4UE7H 2JH5D 2JIZD 1SGTA 3MO9A 3URCA 4X6MA 3RXMA 2ZU4A 1AIXH 2WPJS 2ZGJA 2QCYA 3VB4A 5L2YH 1JXPA 1O37A 3OAAD 8ESTE 4MPUA 4O97A 3PLPA 3GDUA 1C1TA 1MAYA 4ACAA 3GS9A 1GHBG 2VGCC 1LPGB 2GD4B 1MKWH 2RDEA 1SMFE 1Z71A 2CJIA 3TGIE 2D2DA 1P2KA 1VITG 5JBBS 1SGYE 3IWMA 1HAHH 1ORFA 1GI6A 2A4GA 5GDSH 1HIAB 1SHYA 2PV9B 2ZFPH 3LGIA 3KQBA 3ODDA 1SQTA 1V3XA 4O03A 2OP9A 2HWLB 1SL3A 3M5MA 1TNHA 4HI3A 1VCWA 3RXRA 4CRCA 2BDIA 4Y8ZA 3FOAA 1TBQH 1SGDE 4JYTA 2FOBA 4X2VA 3RXOA 1NT1A 2CGAA 4D9RA 2BDBA 3SJIA 3V12A 4TWYA 2XBXA 3A81A 1DY8A 3RXFA 3H09A 8GCHG 1GHZA 1SGIB 3T5FH 1BMFD 2NWNA 4A1TA 4AFZA 1J17T 2AIPA 4I33A 3DSOA 2C4FH 3P95A 1CT2E 5DSFA 3HK3B 2V0BA 2AMQA 4IC5A 1AMHA 2W26A 3P8OA 4BNRA 3N7EA 3WW7A 1O30A 3LGUA 1YPHE 1DWEH 1O34A 2CK3D 4YOGA 1W10U 1Z1IA 4ABBA 3AAUA 1KDQA 1FN6A 1U6QA 1IQHA 2YMSD 4X1RU 1AFQC 2ZFQH 4AX9H 1P2MA 5DG6A 3UUZA 1WYKA 3A7XA 1EFRD 1YCPM 2QXJA 1FUJA 3PMJA 2Y7XA 2H9TH 3A7WA 1TBZH 1SI5H 1QJ1B 3F2GA 2KCPA 1GI5A 1FLEE 2XBYA 2W3IA 3KHVA 2FX4A 2ZCHP 4Y11E 3LGTA 3STJA 1VJ9U 2SGEE 4OS6A 3ZYEA 1GBAA 3MTYA 1CE5A 1SGFA 1FPCH 4R0IA 4WXVA 4XBCA 1ZPZA 3SV9A 4Q80A 1TGNA 3RXCA 1GBJA 2C8WB 5AFZH 4ASUD 1GJ8B 2YMSC 2D1JA 3SQHE 4FUGA 3GISB 1GJDB 4I8GA 5HMAA 5F8TA 2TGAA 3GY7A 1CO7E 1EOLA 1F5LA 4NFEA 2FS8A 3GICB 1QFKH 3MOCA 4AORA 1H8DH 4A5TS 1C2EA 3GY3A 2BD2A 1HAXB 3A8DA 2QV1A 4Y8YA 2AH4X 4I86A 1C5LH 3MO6A 4YLUA 5FX6A 1DWBH 1K1MA 3AAVA 1ANEA 1AVXA 4BAOB 1SLXB 3GYLB 2CHAC 4Z1MD 5HXFA 4OS5A 1K0HA 4Y7AA 1OYTH 1RFNA 3BEIB 1JRSA 2J5UA 3TJUA 1AU8A 3BV9B 2P8OC 1ARCA 2LELA 4J2YB 4X1SU 1QJ7B 4X2YA 1V2OT 1BQYA 3IG6B 2R0KA 1DLKB 2NU2E 4YM9A 2Z9LA 1FI8A 3ZVGA 2C8XB 1WQSA 3A86A 3M35A 1LMWB 4ASHA 4RT1A 1BITA 1QURH 1TWXB 3MU5A 4RSPA 2A4QA 3EDXB 1G37A 1P2QA 1QHRB 2XOKD 2ZCLP 2XC0A 1LPKB 1MZAA 1OWKA 2Z9JA 3ATIA 4MPVA 1Y3WA 4FUBA 1EP6A 1ZPBA 4ABDA 1DXWA 1YPHC 1S83A 1BMMH 2GCHG 4D7FA 1A0HB 1BDAA 1C1MA 1C2MA 1Y5UT 1O2IA 1BRBE 1TLDA 3E1XB 3U28C 2GCTC 3OE7D 1DE7H 1NN6A 1GI3A 2Y5FA 1N8OC 2BD5A 2JETC 4WMEA 4DURA 4H4FA 4AN7A 2FM2A 5F03A 1K1PA 5CHAC 5EQRA 1FNIA 1Z6EA 3Q77A 5EU8A 3HGPA 2WUCA 1EJNA 1ETTH 1NFWA 1C2LA 1ZRKA 2CV3A 3BTGE 3S9CA 3NRLA 4HGCA 1O3NA 3KEEA 2VIWA 3B23B 4FUFA 1EZXC 1G2LA 3GCTG 1RTFB 4DY7B 2YNAA 4E05H 3LJOA 1T31A 2ZDAH 5ETXA 5LPEA 1ESTA 3DHKH 1BIOA 2BYAX 4TT3D 3SNAA 3GY5A 2Z9GA 3SJ8A 4GUXA 3E91A 1P05A 2BTCE 2KAIB 5PTPA 1AVWA 5JPMH 1KXDA 4XBBA 1NBME 2TGPZ 3FZZA 3T28A 1G3DA 3W94A 2W5EA 3LPRA 1C4V2 5GIBA 1DWDH 1H9IE 5L2ZH 2F9NA 1DX5M 2PW8H 3U8OH 1NO9H 5GCHG 1CHOF 1WDIA 5AFYH 1T4VH 3A7TA 1LHEH 2FDAA 1NU9A 1XVMA 1EAIA 5DP6A 1HXFH 1TQ7B 4YLQH 1QBVH 3RXHA 4NWLA 1QNJA 1GHXH 1NPMA 2BQWB 2H1UA 1HNEE 3RM2H 4Y71A 1O5FH 2A7CA 5E0JA 3KIDU 1C5YB 3OTPA 1KYNA 3V3MA 1ZJDA 4ABEA 2XRCA 3FN8A 3QDZB 1KSNA 3PB1E 1P2JA 4AB9A 3F9FA 4NFFA 2GP9B 3HATH 4WVPE 1Y3VA 4I32A 4NGAH 3KCGH 3KNXA 2R2MB 1EQ9A 1SGCA 3LJJA 1UVTH 1ELGA 1Y5BT 1A3EH 2WZQA 1BZXE 1TE0A 3RM0H 2C8YB 3M3SA 4QT8C 3LU9B 3MO3A 1MH0A 1NRPH 3W95A 3D49H 1SGNE 1UK3A 1MZDA 1VGCC 2FS9A 2HNTE 5EIYA 3UB0A 2NU1E 4JYUH 3SZEA 1TMBH 2PP6A 2B5TB 1O39A 2GJGA 1TPSA 1ELFA 4Q7XA 2O8TA 2J38A 5E0HA 1J16A 1AE8H 3LC5A 3LKWA 2I6SA 3NKKA 3SNBA 1C5RA 2BZ6H 3EE7A 2A5IA 1GJCB 2QY0B 3SJ9A 2OQUA 1WSSH 1RD3B 2XTTB 2BY5X 3ATKA 1NRQH 1UCYE 1W2KH 2FOHA 1XKAC 1ARBA 1SGQE 1N1LA 3TPIZ 1KLJH 4YTAA 3A8CA 1UTKA 3EQ0H 1UVSH 1AY6H 2FTMA 3NPSA 1BTWA 2WUBA 3LH1A 1FMGA 1UMAH 4XSKU 1FAXA 2VVUA 2Y5GA 3OYPA 1SPJA 5DP3A 1F0SA 1K1JA 3RXLA 1PQ7A 2ZU2A 1KDQB 1S81A 1T8NA 1F5KU 2PTNA 1UVPA 2EI7A 4ISIH 1HFDA 3ZZ9A 4AOQA 4CREA 1NFXA 2ODQA 3ZZBA 2V7QD 1O2GH 1QB6A 1MUEB 2F9OA 1TPPA 4JYVH 6LPRA 1GPZA 1FY4A 1ZRBA 3A82A 3L6PA 2Y82A 1QL8A 3OX7U 5EODA 2FWWA 2G8TA 1VCQA 2BDGA 4IW4E 5DPAA 4JZFH 4UFDH 2ZQ2A 1P04A 2XC5A 4NCYA 1TRNA 2GGVB 1BBRH 3KQ5A 3BN9A 3O8BA 4Q2KA 1PPEE 1UTJA 1J15A 3BIVH 3LGWA 2EQNA 1PJPA 2ULLA 3F6UH 3ZZ5A 3QN7A 3SV7A 3O8RA 1T32A 1DPOA 4JCNA 1HJAB 3GY4A 2Z94A 2A4OA 3AVZA 1GBMA 2D8WA 1TNLA 1LHGH 3R3GB 3DUXH 1KLIH 5C5NA 4MQAA 1FY1A 4WJG2 1YP9A 3UOPA 4UFFH 1FY5A 3BTFE 3ZVBA 3VXEH 1AWHB 3RXIA 3T26A 4GPGA 5TJXA 1AFEH 3SUGA 1D4PB 3QZRA 3BTTE 1SLWB 1ZTLA 2Y80A 3D62A 4K1SA 3MH6A 1EB2A 1ZTKA 4U30A 1JWTA 1DM4B 2FMJA 1C4U2 3Q76A 4LOYH 4YZUA 1S85A 1TGBA 3BG8A 2QE7D 1IQIA 1MKXH 5EJLA 1GBTA 2PGQB 4CR9A 1GVLA 1UTNA 4K8YA 5GJ4B 2WPLS 5DP8A 4CRAA 1KLTA 2ZPQA 3PO1C 3S7KB 2WV4A 3SNCA 3P8NA 1CA8B 2J9NA 3U98H 5A2MH 1UTMA 2ZPRA 1AN1E 1F2SE 2O8UA 1W14U 1IQJA 1H1BA 1YPEH 4KGAA 4MG3A 5C0UA 1GBLA 2GV6A 1Q2WA 1V2LT 4NA8A 4XE4A 3QGNB 2VU8E 1AWFH 1ELBA 3MWIU 1BTXA 1H4WA 4WY3A 5SGAE 1C5OH 2J94A 4ZKOU 3M3VA 4ACBA 4X1PU 1H8ED 2W6ID 1QRZA 3M61U 1C5XB 1DT2A 1Q31A 1BMAA 2XNDD 5C1YA 1UHBA 5GCHF 5A8ZA 3RXBA 3SORA 2Z3EA 1W0KD 1EAUA 3AW1A 2ZDKA 2OQ5A 3UQOA 4CHAC 2Z7FE 5GNDA 1EPTB 1HAZB 1IHSH 1UTLM 3GY2A 2KZ4A 5FHTA 1DXPA 3PLKA 8KME2 3SU3A 1C1QA 1AUJA 1O35A 2JJ2D 1K28D 2FOCA 1V2ST 3S9AA 1RRKA 1W0YH 2ZHWH 3MHWU 1LQDB 1A4WH 2FX6A 1ZTJA 1GGDB 3ATLA 4ISNA 3VB5A 2G51A 4NSYA 3VGCB 3TH3H 1W11U 1O36A 2O8MA 3A85A 2GZ8A 1B5GH 1PPCE 1S6FA 4GHTA 1QA0A 1EUFA 3MNBA 4B71A 5L6NH 1L0ZA 4CRBA 4X8VH 3F3BA 3U8RH 1CSOE 3Q3XA 2TPIZ 1O5BB 3B9FH 1GBBA 5JYIA 4INKA 4ZMAH 5DJ7A 3SN8A 1O2PA 2WPDD 1YPMH 3PROA 4M7GA 1ABJH 1W13U 5JBCS 3SV8A 3U1JB 5EW2H 1QB9A 6ESTA 4ZHMU 3OTJE 1XXDA 1MTUA 1P0SH 4ABHA 1VITH 3GCNA 3TJNA 1C5VA 1HAPH 1UO6A 4M9FA 1AKSA 2XWAA 3ATMA 5AHGH 1C5NH 1PFXC 3NXPA 1TNJA 2A31A 1C5MD 1DUAA 5C20A 3LOXA 4U32A 5G4BA 1V2TT 1GHAF 1TNGA 2H5CA 1GDNA 1KIGH 2K0QA 3GCHB 1RXPA 1P09A 1C2IA 3F9GA 1ZSLA 5BPEA 3KQCA 1PYTD 2A7JA 1C2KA 5C3NA 4JK5A 2KX4A 5FCKA 7GCHF 2PKSB 2P3UB 3LC3A 4Y10E 6CHAC 2FLRH 3SU0A 1YPLH 2PGBB 4KP0A 1LVOA 1G30B 1IQNA 3JZ1B 3OU0A 1YYY1 2HLCA 1K1IA 2FI5E 4K8BA 1LVBA 3ZV9A 4F49A 3TH4H 3P8FA 5C0TA 1A61H 4ZH8A 2SFAA 1O3HA 1TAWA 2PLXA 4FU8A 1AD8H 1INCA 5HM2A 3RC6A 1SLUB 1WUNH 4NWKA 1EASA 2FO9A 2ZTZA 3PMAB 2HGTH 4H6TA 1TGCA 1JBUH 1YWUA 2JH6D 5JB9S 1GMHF 1FQ3A 1MCTA 4I7YH 3ZVAA 2ZPSA 1LPZB 5T6GA 1O5GH 2ODPA 1E1RD 2PUQH 3EA9A 4NG9H 1HLTH 1BHXF 4XDEA 2EA3A 2BB4A 4BXSA 5J4QA 4XOJA 3MU0A 4FVBA 1TX6A 1UVUH 2ZKSA 1GI7B 4AG2A 5DO4H 1ZJKA 4GAWA 4B1TA 1S84A 1O3CA 3CS7A 4OS2A 4X8TH 1P01A 1SOTA 1DANH 1HV7A 2V3HH 3LDXH 2Q6GA 1WTGH 1TMTH 2F9PA 1JRTA 2ZEBA 3D23A 1W7GH 1GBCA 1HBTH 1L1GA 9ESTA 1OP2A 1W0JD 3N7OA 2TRMA 1CHOG 4CBOA 4B74A 1LHDH 3RXTA 3OY6U 2WV9A 3M7QA 1ELCA 1PQAA 1TA6A 4DVAU 1KTSB 4FUDA 1O2WA 3SYJA 2HLDD 1GBDA 1SFIA 2RCEA 2GTBA 4UEHH 1J14A 2QN5T 2C3SA 4X2WA 4DGJA 2XXLA 1WAYB 2J34A 1O3EA 2F83A 4HG6A 1S6HA 3UIRA 3ZZAA 2FYQA 1S0RA 3RC4A 1TIOA 2UUJB 3GDSA 3PWCA 2BQ6B 1F92A 3TU7H 3ZZ7A 1L2EA 1AE5A 4Y0ZE 2Z9KA 1OX1A 1ACBE 1THPB 1HYLA 2GKVE 2W3KA 2YNBA 1A7SA 2SGAA 4I8HA 2BLVA 5HGGA 2FYRA 1TOMH 2ZIQH 1O0DH 2JKHA 3UTUH 2F91A 4ABIA 2ESTE 3F68H 2VWLA 1QCPA 3SU6A 3UAIC 3MI4A 5FPSA 2B8OH 1GMCF 1SVPA 1MTSA 1RIWB 1FONA 1HAOH 2VWOA 1IQGA 3BTWE 1LHFH 1GJ4H 1GG6C 1OSSA 1V2MT 3TK5A 1GBFA 3KQDA 4FUJA 1BUIA 1P02A 1Z6JH 1DY9A 1A0JA 4B6EA 2CN0H 3QZQA 5HM9A 1P06A 1O32A 3TLOA 1F0UA 2QGRA 3CS0A 4IGDA 3TK9A 3WY8A 4DJZB 1ZMJA 2VGCB 2IJD1 3WWBA 1ETSH 2TGTA 3FP8E 3S9BA 2EI8A 1TNIA 3A84A 3EA8A 3R0FA 3PYHA 1C2FA 1O2UA 3MNCA 3S7HB 2Y6TA 2CMYA 2QF5A 3ZZDA 3PLBA 2F4LA 3A83A 1X7AC 3RXSA 2GZ7A 3VG8A 1UW7A 2HNTF 1A3BH 1GJ9B 5FPYA 4TY6A 1YCPK 2GMTC 1UHBB 3IITA 1CHGA 1YY3A 2G00A 3QTOH 3E8LA 3SZNA 3RU4D 2B0FA 2SGDE 1GCTC 5EXLA 1GHVH 2WPHS 2EEKA 1EKBB 1O2NA 1O2MA 1OWHA 1EAWA 2QC2A 2VIPA 2VNTA 5EXNA 1E1QD 3PRBA 1GI8B 4AYYB 1ZGVA 1C2JA 4XBDA 5GWZA 4XRNA 2Q6FA 1TNKA 1AI8H 1FAKH 1JOUB 4TPIZ 1ZGIA 2OC7A 1MTNC 1O5EH 1NTPA 3VXFH 1S6LA 2H9EH 1DVAH 1C2GA 1XUFA 1B0EA 4TSFD 3FP7E 1SGRE 1AFQB 1JMOH 1ZZZA 2OC8A 3M7TA 1MQ6A 3RXKA 1IQFA 4AC9A 2FESH 1GJAB 3NZIA 2XYAA 1UVOA 4HTCH 1KXBA 4Y79A 3TGKE 1O3BA 4J1YA 1OS8A 4IBLH 1C2DA 1V2PT 2ZGHA 4HFPB 1Z1JA 1ESBA 1HAGE 1ABIH 3PWBA 3CENA 4A7IB 1CQQA 1MABB 4K69A 4OGYA 1JIRA 2PWXA 5FX5A 1NM6A 4X1NU 3F9HA 1QBNA 2P3FH 2D26C 2P3TB 4AZ2B 2NU3E 4YESB 5EXMA 3ZV8A 1GL1A 1BTPA 1BBRE 1BRAA 1BJUA 2XNIA 3E16B 1DITH 1TOCB 1D3TB 4NIYA 5DP5A 4FUIA 2ZU5A 1EB1H 3A87A 5EPYA 1PPFE 2J92A 2ZZUH 3A7YA 3BSQA 3Q3YA 2LNCA 5DP9A 1GVKB 1TONA 2G55A 2FLBH 3SUFA 3DFJA 4CR5A 5KEDA 4B2BA 3M36A 1TRMA 2KR7A 2ZECA 2ZFRH 1MU8B 2ANWA 3ITIA 2ZTYA 3QO6A 3K6YA 3RXGA 2A0QB 3SGAE 1YBWA 2CHAB 4MNVA 2VH0A 1GMDF 1DWCH 3DCLA 2VWNA 4GLYA 1BTHH 3ZZCA 4Y6DA 3ZYDA 2OLGA 2Y81A 1T8MA 3W1EA 5C94A 1O3LA 1TRYA 2P8OB 3RXAA 1FY3A 1AUTC 1J8AA 1O3AA 1OHHD 1SSXA 5LH8A 3SW2B 4NIXA 1ANDA 1K9OE 4KTUA 1THRH 1HB0B 1HRTH 4YT6H 2XCNA 4WMFA 1IHTH 1ELDE 1ETRH 4RN6A 2PTCE 1SQRA 2GDDA 3U8TH 1ELAA 4GCHF 5T1VA 3FZDA 4K1EA 3PV5A 1YPGH 5FPTA 1NC6A 3SI4H 4Q63A 4CRDA 1Z7KA 5J4SA 1BTYA 4MVNA 4CH8B 1HUTH 1KXFA 1OP8A 2BHGA 1C5QA 2AGEX 1V2QT 3RXPA 1O3JA 2VIQA 1GI4A 5CHBA 2ANKH 4DIIH 5EOKA 2GX4A 4K1TA 2V3OH 1N8OB 3RXDA 2JETB 2JH0D 2XBVA 6GCHF 3TJVA 1GHAG 1V2WT 3N99A 1DFPA 2FIRH 1C5PA 2BX3A 3MU8A 2IOTA 4TY7A 4LZ1H 5CHAB 3RMLH 2QF4A 1O3KA 4TYDA 1MQ5A 2G81E 2ZDNA 1GJBB 1ZSJA 1LKBA 4Y76A 1BMNH 3AASA 1CT4E 4RI0A 7GCHG 1O2JA 3OSYA 1ZYOA 1B0FA 1PPBH 2BY9X 4O9VA 4AFSA 5GPIB 3MH5A 1CBWC 1NBMD 5JB8S 2IJOB 2ZGXH 2OD3B 4NZLA 1GI2A 1OWIA 2O8LA 1EPTC 1SGFG 4JZIA 4OS4A 2Z3CA 1K21H 3UOUA 4ZHAA 1TPOA 2DUCA 5A8YA 1YPKH 3PTNA 1QR3E 3STIA 5ABWA 3BG4C 3MFJA 3OEHD 4RKOB 1NRNH 3NWUA 1D6RA 2GT7A 4KTSA 3SI3H 2Y5HA 2F9BH 3VFEA 2HALA 4VGCB 1P9UA 2STAE 1LO6A 2FZZA 3UNQA 2ZC9H 1YGCH 4Z6AH 2ZHFH 1IQMA 1GMHG 4B76A 1C2HA 1ELTA 3SV6A 1AB9C 1GBHA 3SV2H 3VB6A 4MPWA 1FXYA 2C90B 2QIQA 3K65B 2WPMS 4YXWD 2IN2A 1O3GA 1UTOA 2EC9H 1ELVA 1CGJE 2VWMA 5IK2D 4A6LA 4AFQA 1BHXB 3E3TA 1BBRK 2OK5A 1H9HE 4BAHB 2FOEA 5EG4A 5EGMA 3RMNH 4ABAA 4UONA 1HJ9A 4LXBH 1MAXA 1DICA 3F1SB 2J98A 2XCFA 3FP6E 2Q1JA 1C1WH 1CT0E 3MH7A 4ABFA 1SB1H 1G3BA 1LVYA 1UTPA 3SU5A 2BOKA 1OWDA 1TYNA 3RU4T 2UWOA 3UR9A 2C8ZB 1ESAA 5E2PA 4ABGA 3U1IB 2ZCKP 3FANA 5T6FA 1P8VC 3N7DA 4ESTE 1C1NA 4KTCA 3K9XB 3Q3KA 1WTHD 2BOHB 1VGCB 3UY9A 3L3TA 1Y59T 5C67A 2B7DH 3ZVEA 5CMXH 1T8OA 2Z6BD 3T62A 2W6JD 5C2ZA 2PKSC 2BDHA 1O3MA 2WYJA 3H7OA 3BTKE 4NA7A 4CH2B 1CA0C 1DSUA 1C5ZB 1O3IA 3RXUA 1XUIA 1P12E 2FODA 3AK5A 1G36A 3BIUH 1ZMLA 2ZDMA 4GVUA 1V2UT 1AZ8A 1ZHPA 1O38A 3SNDA 1W8BH 1PPHE 1P9SA 5H4IB 4B75A 4D7GA 3BTQE 1T4UH 1MBQA 3VEQB 4KELA 2YOLA 2QF0A 1N6YA 3TVJB 2L6OA 1T7CA 2ZFSA 3RXJA 1HPGA 2NU0E 3TGJE 4F4OC 4XFQA 5C17A 3RUOA 3EYDA 3U69H 4BOHA 2OUAA 5B6OA 1F7ZA 2ZHQH 3VB7A 4DT4A 1EZSC 1GMCG 2LPRA 4NZQA 3UNSA 1UCYK 4CBNA 3KYFA 3ZVCA 1C5UA 1TX7A 1WV7H 4IN1A 2ZA5A 1K22H 2FPZA 1D6WA 1P2NA 1BTUA 2VBCA 2XC4A 2VVVA 4IS5A 3SHAH 1BJVA 2KCOA 2ZP0H 4FU7A 3TJOA 1EAXA 1UTQA 2BXTH 1NS3A 1Y8TA 1Z8JB 3PV2A 4NIWA 5F8ZA 4GSOA 4ZKRU 4JMYA 2WSSD 4MNXA 2SGQE 5HIZA 1QY6A 3C1KA 1ZMNA 3F0PA 1FV9A 3RC5A 3A8BA 4AGJA 2ZF0H 1IAUA 1GI0A 4OS1A 4IMZA 1D3DB 3L33A 1W0ZU 3RMMH 1TBRH 1QL9A 2M5TA 1ANCA 2V35A 2HRVA 5LPFA 1LHCH 1Z8GA 1TB6H 5C1XA 1A5HA 1O2ZA 2ZFFH 1NRSH 1H9LB 3MQKC 7KMEH 4LZ4B 1D9IA 5DP7A 3T29A 4ZXXH 1CVWH 4X0WU 2AS9A 4K5ZA 1SC8U 3RXEA 4DCDA 1O2HA 2V6NA 1IOEA 4Q7YA 2FI3E 1C5WB 1H8HD 1BRCE 2ALVA 3EA7A 4A1XA 1O31A 2XWBI 2BZAA 1L1JA 2OCVB 3VB3A 2AFQB 2WV5A 1QRXA 1S82A 3DSGA 3BF6H 4K3JA 3WWFA 3ELAH 1YF4A 1GVZA 1F5RA 1LVMA 4E06H 1L4ZA 2A4RA 3PO1B 3P17H 5C1UA 1V2RT 2R0LA 3E6PH 3RDZA 1GI1A 3ZZ8A 1YC0A 1Y3YA 1GJ6A 2BD3A 4JK6A 2F3CE 4TPYA 1O2RA 3LGVA 1Y3UA 1PYTC 3AW0A 4UD9H 3A80A 2UWPA 2P94A 2PKAA 2AHME 2J95A 1HXEH 4A1VA 5I25A 2ALPA 1SFQB 3O8CA 1PPZA 2QYIA 2IPHA 5EW1H 3HGNA 1KXAA 1C1UH 1XX9A 2VIDA 4HZHA 2RG3A 2FXRA 2KCAA 4ZHLU 3A7ZA 1P3EA 2GDEH 3M5LA 1MTVA 2JJ1D 3HKJB 1OXGA 2BLWA 1G9IE 1WBGB 3SU2A 4CHAB 4OM9A 4PROA 1NFUA 1O3FA 2J4IA 5TCCA 4YO9A 1NFYA 1TMUH 3CP7A 9LPRA 1QL7A 1O2LA 1XKBC 1E36B 1K1OA 2GV7A 1MKWK 2G4TA 1MMJN 2H2ZA 4DOQA 5FBEA 2ZU1A 1Z8RA 2ZI2H 3GYMA 1FIWA 2A5KA 2A5AA 1XUKA 1UJ1A 1W7XH 2C93B 1JIMA 2G52A 2WYGA 2QAAA 4ZKNU 1Y3XA 2W7SA 4CRGA 4Y8XA 1TALA 1O5DH 5A0BA 2Z9IA 4BANB 5A0AE 2G4UA 2IPQX 3QTVH 4DW2U 1A2CH 5CE1A 1DS2E 3SGQE 2QF3A 2FEQH 1GMDG 4Q4LA 5HIYA 5F53A 3BEUA 4B2CA 1S5SA 2FOAA 1EJMA 2F9UA 4MPXA 1FDPA 4RT0A 3ZVFA 1FN8A 4INHA 4YOIA 3UFAA 2ZG0H 1YLDA 1ZSKA 4X8SH 1BRUP 5ESBA 2G5VA 1O3OA 2BY6X 1OYQA 1FY8E 5E0GA 1G3EA 2RA0A 1GHWH 1O2KA 1OP0A 5C5OA 2Z3DA 2PSYA 3TIUA 1TFXA 1FZZA 3RU4E 4WH6A 3OFND 4O3UA 3C27B 5HKKD 1XUGA 4K60A 1N6XA 1NU7B 4GCHG 4FETA 1Q3XA 3SUEA 3A89A 1FIZA 3FAOA 3P8GA 4BXWA 4P00A 3LIWA 5JBTA 1MD7A 3BTDE 3ZVDA 3KL6A 3H5CB 1DLEA 1A5GH 3MMGA 1E34B 1K1NA 2HVYB 6CHAB 1QBOA 2SGFE 5FXLA 3PV4A 1ZHMA 2J98B 2JDID 2ZU3A 4E7RG 1ELEE 2AGGX 5T3HA 1V2JT 1SBWA 2SNVA 2ZFTA 2BLOA 1IQLA 1C9PA 1XUHA 4ABJA 1BA8B 3HPTB 4ZXYH 2BY8X 3NUMA 2VB0A 6GCHG 1C1SA 2PSXA 4ZUHA 1QQUA 1HJ8A 2FP7B 1SLVB 1QJ6B 1E0FD 2BVXH 4THNH 1V2KT 3GOVB 4AYVB 3OY5U 3GY8A 1OOKB 4O3TA 3ESTA 2AERH 2A32A 2AEIH 5HYOA 7LPRA 5F8XA 4X8UH 4I8JA 3PTBA 2AMPA 2ZGCA 4INLA 1L4DA 3ZIAD 1DDJA 1V6DA 2BMGB 3V7TA 3SJKA 5EPNA 4ZROA 1ID5H 1E79D
chains in the Genus database with same CATH topology
3SJOA 2G5NA 1AO5A 1YCPH 3QLPH 8LPRA 4BAKB 1ZPCA 1CGHA 4ZKSU 1PPGE 3A88A 4I31A 2P95A 1P3CA 2H5DA 3M37A 3MU4A 2PFEA 5DP4A 4MNYA 1THSH 2FI4E 2ZNKH 4H42U 1SGPE 1T8LA 4Y7BA 1EP5A 1BCUH 2THFB 2WPKS 1IQKA 5FCRA 1EOJA 5JBAS 3T2NA 1QQ4A 1Z8IB 1BT7A 4BTUB 3ODFA 3PMHB 2GVFA 3UQVA 1LKAA 3QK1A 4I8LA 3SOSA 1O2TA 1KY9A 4AGKA 5K0HA 1A46H 2ANMH 4X1QU 2ZGBH 1SQAA 4SGBE 3P6ZB 1VZQH 2R3UA 4ISLA 5K7RA 7ESTE 1YM0A 2OTVA 3Q00A 3LONA 3K6ZA 3SQEE 1EPTA 1C1RA 1J9CH 1RTLA 1P03A 1XUJA 4X2XA 4R8TB 3URDA 1OWJA 1EX3A 2ZO3H 3H7TA 2HOBA 2A1DB 1HAIH 4B2AA 1QB1A 2QA9E 4D8NA 3SO3A 1O33A 1RGQA 2GT8A 1AKSB 1TGSZ 1HAVA 2BY7X 1IQEA 3DA9B 5I46H 1GHBF 1GDUA 2TIOA 1P11E 1MTWA 5DKMA 1VITF 3LT3A 1YPJH 3NK8A 2UUYA 2UWLA 4JZDH 4TWWA 1TQ0B 3EE0B 3JZ2B 2VJ1A 2B9LA 4FXGH 1WQVH 1Y5AT 3ZZ3A 1GG6B 1SOZA 1NY22 4Q7ZA 2FTLE 4IMQA 1EZUC 4VGCC 4CRFA 1M9UA 4AFUA 2O8WA 1TX8A 2SGPE 3ZZ4A 1GJ7B 5GXPA 2O9QA 3SHCH 4SGAE 3I29A 3SNEA 1HJAC 3RXQA 1NZQH 2PKAB 1F0RA 2GZ9A 8GCHF 4WH8A 2H6MA 4UDWH 1C5TA 1ANBA 2A2XH 4YOJA 4MDSA 3MNSA 2AYWA 3SU4A 1AZZA 2R3YA 2TGDA 1WU1A 2P93A 1H8IH 1C1VH 2GMTB 1LCYA 2PR3A 2K1QA 1EATA 1OWEA 4LK4A 1EJAA 1O2YA 1W12U 4BAMB 4B73A 1GCTB 3UWIA 4AB8A 4OGXA 2XBWA 4DIHH 4ISOA 1BTZA 1C9TA 3M5NA 3MYWA 2GCTB 3M3TA 1BMLA 3M5OA 2XW9A 1DOJA 4UFGH 1ZHRA 1LDTT 1GCDA 4Y0YE 2ZHDA 1RS0A 3U9AH 2OBQA 2ZDLA 1MTNB 4A92A 4FUCA 3KN2A 4D76A 1A0LA 2BDAA 3RP2A 1KXCA 4IN2A 3UR6A 5ESTE 1HIAA 1VR1H 3RMOH 5T6DA 1PQ5A 3SUDA 1EXFA 2ZQ1A 5FBIA 5L30H 3FFGA 1MD8A 4FUHA 1C4Y2 4ISHH 1HDTH 1W3CA 2Q6DA 2W7UA 4Z0KA 2ZDVH 1QIXB 4BTTB 4MTBA 1SR5C 1NESE 1A5IA 3V13A 1NRRH 3RLYH 3A8AA 2I6QA 2HPPH 2NU4E 1XXFA 1C5SA 1DUEA 3LGYA 2AIQA 1GBKA 1GGDC 3S0NA 1O2QA 3VGCC 2PUXB 1WCZA 3B8JA 3GY6A 1O5CB 3E90B 3TNSA 2R2WU 3QX5H 5A0CA 2BD8A 3I77A 4NSVA 3T27A 2UUKB 1FJSA 5BRRE 3TH2H 1F0TA 1A1RA 3TNTA 1TA2A 2ANYA 1B7XB 1GBIA 1CU1A 3DT0H 2DE8A 3BTME 3BTEE 3M7UA 5JDUB 3NCLA 1P2OA 2VVCA 3BTHE 1DSTA 3KQEA 5DGJA 3KGPA 3UNRA 1MCVA 4D9QA 3UPEA 5LGOA 5A09A 3S69A 1K2I1 2F9VA 3DD2H 2GCHF 1KTTB 2ZHEH 2ZTXA 3E0PB 3PMBB 4FU9A 2RDLA 4X6OA 1XMNB 1KXEA 4I8KA 4FVDA 2BDCA 5E8EH 4JZEH 1EZQA 1AGJA 1GJ5H 1RJXB 2ZWLH 5FAHA 4WF8A 1O5AB 3EAJA 1PQ8A 1L1NA 4U2WA 3D65E 3GCHC 1GL0E 2BD9A 5A8XA 1VJAU 5LPRA 2HNTC 4NA9H 1AQ7A 2P16A 3V0XA 1QGFA 2ODYB 3P92A 1GWAA 5E2OA 2BVSH 1E37B 5EQQA 2VH6A 2VIOA 3HKIB 1TPAE 3SBKA 3SU1A 1TGTA 1MKXK 2AGIX 3ZZ6A 2ASUB 1HGTH 1LTOA 1RTKA 2A45B 3GCTF 4K2YA 2VIVA 2Y7ZA 3EGKH 4YT7H 2PHBA 2TBSA 2OC1A 2WPIS 5IDKA 4WXIA 1FPHH 5TCAA 1O3DA 2SNWA 2CF8H 2EI6A 1V2VT 2RA3A 1YLCA 1HCGA 4X6NA 1SG8B 1P57B 1D3PB 3SGBE 1O3PB 4WWYA 4X6PA 1O2SA 4JZ1A 3O8DA 2HVXA 1ZR0A 1E38B 3A7VA 3MU1A 3GDVA 2DE9A 1QA7A 1VCPA 1CBWB 4IC6A 1XM1A 2QXIA 2CF9H 1LQEA 1UCYH 1QRWA 2FOFA 3UWJH 1HAYB 2BD4A 4MLFB 3QUMP 1AVGH 3MNXA 1MBMA 1K1LA 1O2VA 3K2UA 1NROH 3LH3A 1GI9B 1V2NT 1YKTA 4GHQA 3BG4B 3PM3A 4AG1A 4E7NA 2P59A 2CXVA 3GCOA 1UK4A 1SQOA 2QXGA 1GBEA 1HAVB 1WOFA 1SHHB 4ZAEA 5AF9H 4OS7A 2BD7A 1G2MA 4BTIB 4MNWA 3HK6B 3I78A 1S0QA 1O2XA 2BM2A 4WMDA 3KF2A 1AB9B 4UFEH 2R9PA 1BOQA 2BX4A 3T25A 1UK2A 2BXUH 2FOMB 3FVFB 2H9HA 1TABE 2AMDA 2FOGA 3DFLA 3F9EA 2ILNA 3TITA 2STBE 2BQ7B 4U01A 5IYTA 5DK1A 3VPKA 1C1PA 3TK6A 2BDYA 4DT7B 1XVOA 1ZLRA 1P2IA 4NIVA 1E35B 1GDQA 1QTFA 4KKDA 2BVRH 1BB0B 4DG4A 2HPQH 3ENSB 5F6MA 1SGEE 2BLQA 5EQSA 1GHYH 5AVDA 2OXSA 2VINA 1CGIE 1MU6B 1ZOMA 3QWCH 1O2OA 2WINI 2KAIA 3BEFB 1OPHB 4H6SB 4BAQB 1OKXA 2OC0A 3MH4A 1AHTH 3RXVA 3RLWH 2A7HA 1C1OA 1G32B 3P70B 3E0NB 1G3CA 2A2QH 3G01A 1D3QB 4RKJB 2OBOA 4FUEA 2OINA 2J2UA 3QGJA 1P10A 2UUFB 3UREA 1RIWC 2QXHA 3ATWA 1CA0B 4UE7H 2JH5D 1SGTA 3MO9A 3URCA 4X6MA 3RXMA 2ZU4A 1AIXH 2WPJS 2ZGJA 2QCYA 3VB4A 5L2YH 1JXPA 1O37A 8ESTE 4MPUA 4O97A 3PLPA 3GDUA 1C1TA 1MAYA 1GHBG 2VGCC 1LPGB 2GD4B 1MKWH 1SMFE 1Z71A 2CJIA 3TGIE 2D2DA 1P2KA 1VITG 5JBBS 1SGYE 3IWMA 1HAHH 1ORFA 1GI6A 2A4GA 5GDSH 1HIAB 1SHYA 2PV9B 2ZFPH 3LGIA 3KQBA 3ODDA 1SQTA 1V3XA 4O03A 2OP9A 2HWLB 1SL3A 3M5MA 1TNHA 4HI3A 1VCWA 3RXRA 4CRCA 2BDIA 4Y8ZA 1TBQH 1SGDE 4JYTA 2FOBA 4X2VA 3RXOA 1NT1A 2CGAA 4D9RA 2BDBA 3SJIA 3V12A 4TWYA 2XBXA 3A81A 1DY8A 3RXFA 8GCHG 1GHZA 1SGIB 3T5FH 4A1TA 2NWNA 4AFZA 1J17T 2AIPA 4I33A 2C4FH 3P95A 1CT2E 3HK3B 2V0BA 2AMQA 4IC5A 1AMHA 2W26A 3P8OA 4BNRA 1O30A 3LGUA 1YPHE 1DWEH 1O34A 4YOGA 1W10U 1Z1IA 4ABBA 3AAUA 1KDQA 1FN6A 1U6QA 1IQHA 4X1RU 1AFQC 2ZFQH 4AX9H 1P2MA 5DG6A 3UUZA 1WYKA 3A7XA 1YCPM 2QXJA 1FUJA 3PMJA 2Y7XA 2H9TH 3A7WA 1TBZH 1SI5H 1QJ1B 1GI5A 1FLEE 2XBYA 2W3IA 3KHVA 2FX4A 2ZCHP 4Y11E 3LGTA 3STJA 1VJ9U 2SGEE 4OS6A 3ZYEA 1GBAA 3MTYA 1CE5A 1SGFA 1FPCH 4R0IA 4WXVA 4XBCA 1ZPZA 3SV9A 4Q80A 1TGNA 3RXCA 1GBJA 2C8WB 5AFZH 1GJ8B 2D1JA 3SQHE 4FUGA 3GISB 1GJDB 4I8GA 5HMAA 5F8TA 2TGAA 3GY7A 1CO7E 1EOLA 1F5LA 4NFEA 2FS8A 3GICB 1QFKH 3MOCA 4AORA 1H8DH 4A5TS 1C2EA 3GY3A 2BD2A 1HAXB 3A8DA 2QV1A 4Y8YA 2AH4X 1C5LH 3MO6A 4YLUA 5FX6A 1DWBH 1K1MA 3AAVA 1ANEA 1AVXA 4BAOB 1SLXB 3GYLB 2CHAC 5HXFA 4OS5A 4Y7AA 1OYTH 1RFNA 3BEIB 1JRSA 3TJUA 1AU8A 3BV9B 2P8OC 1ARCA 4J2YB 4X1SU 1QJ7B 4X2YA 1V2OT 1BQYA 3IG6B 2R0KA 1DLKB 2NU2E 4YM9A 2Z9LA 1FI8A 3ZVGA 2C8XB 1WQSA 3A86A 3M35A 1LMWB 4ASHA 1BITA 1QURH 1TWXB 3MU5A 4RSPA 2A4QA 3EDXB 1G37A 1P2QA 1QHRB 2ZCLP 2XC0A 1LPKB 1MZAA 1OWKA 2Z9JA 3ATIA 4MPVA 1Y3WA 4FUBA 1EP6A 1ZPBA 4ABDA 1DXWA 1YPHC 1S83A 1BMMH 2GCHG 4D7FA 1A0HB 1BDAA 1C1MA 1C2MA 1Y5UT 1O2IA 1BRBE 1TLDA 3E1XB 2GCTC 1DE7H 1NN6A 1GI3A 2Y5FA 1N8OC 2BD5A 2JETC 4WMEA 4DURA 4H4FA 4AN7A 2FM2A 5F03A 1K1PA 5CHAC 5EQRA 1FNIA 1Z6EA 3Q77A 5EU8A 3HGPA 2WUCA 1EJNA 1ETTH 1NFWA 1C2LA 1ZRKA 2CV3A 3BTGE 3S9CA 4HGCA 1O3NA 3KEEA 2VIWA 3B23B 4FUFA 1EZXC 1G2LA 3GCTG 1RTFB 4DY7B 2YNAA 4E05H 3LJOA 1T31A 2ZDAH 5ETXA 5LPEA 1ESTA 3DHKH 1BIOA 2BYAX 3SNAA 3GY5A 2Z9GA 3SJ8A 4GUXA 3E91A 1P05A 2BTCE 2KAIB 5PTPA 1AVWA 5JPMH 1KXDA 4XBBA 2TGPZ 3FZZA 3T28A 1G3DA 3W94A 2W5EA 3LPRA 1C4V2 5GIBA 1DWDH 1H9IE 5L2ZH 2F9NA 1DX5M 2PW8H 3U8OH 1NO9H 5GCHG 1CHOF 5AFYH 1T4VH 3A7TA 1LHEH 2FDAA 1NU9A 1XVMA 1EAIA 5DP6A 1HXFH 1TQ7B 4YLQH 1QBVH 3RXHA 4NWLA 1QNJA 1GHXH 1NPMA 2BQWB 2H1UA 1HNEE 3RM2H 4Y71A 1O5FH 2A7CA 5E0JA 3KIDU 1C5YB 1KYNA 3V3MA 1ZJDA 4ABEA 2XRCA 3QDZB 1KSNA 3PB1E 1P2JA 4AB9A 3F9FA 4NFFA 2GP9B 3HATH 4WVPE 1Y3VA 4I32A 4NGAH 3KCGH 3KNXA 2R2MB 1EQ9A 1SGCA 3LJJA 1UVTH 1ELGA 1Y5BT 1A3EH 1BZXE 1TE0A 3RM0H 2C8YB 3M3SA 4QT8C 3LU9B 3MO3A 1MH0A 1NRPH 3W95A 3D49H 1SGNE 1UK3A 1MZDA 1VGCC 2FS9A 2HNTE 2NU1E 4JYUH 1TMBH 2B5TB 1O39A 1TPSA 1ELFA 4Q7XA 2O8TA 2J38A 5E0HA 1J16A 1AE8H 3LC5A 3LKWA 2I6SA 3NKKA 3SNBA 1C5RA 2BZ6H 2A5IA 1GJCB 2QY0B 3SJ9A 2OQUA 1WSSH 1RD3B 2XTTB 2BY5X 3ATKA 1NRQH 1UCYE 1W2KH 2FOHA 1XKAC 1ARBA 1SGQE 1N1LA 3TPIZ 1KLJH 4YTAA 3A8CA 1UTKA 3EQ0H 1UVSH 1AY6H 2FTMA 3NPSA 1BTWA 2WUBA 3LH1A 1FMGA 1UMAH 4XSKU 1FAXA 2VVUA 2Y5GA 3OYPA 1SPJA 5DP3A 1F0SA 1K1JA 3RXLA 1PQ7A 2ZU2A 1KDQB 1S81A 1T8NA 1F5KU 2PTNA 1UVPA 2EI7A 4ISIH 1HFDA 3ZZ9A 4AOQA 4CREA 1NFXA 2ODQA 3ZZBA 1O2GH 1QB6A 1MUEB 2F9OA 1TPPA 4JYVH 6LPRA 1GPZA 1FY4A 1ZRBA 3A82A 3L6PA 2Y82A 1QL8A 3OX7U 5EODA 2FWWA 2G8TA 1VCQA 2BDGA 4IW4E 5DPAA 4JZFH 4UFDH 2ZQ2A 1P04A 2XC5A 4NCYA 1TRNA 2GGVB 1BBRH 3BN9A 3O8BA 4Q2KA 1PPEE 1UTJA 1J15A 3BIVH 3LGWA 1PJPA 2ULLA 3F6UH 3ZZ5A 3QN7A 3SV7A 3O8RA 1T32A 1DPOA 4JCNA 1HJAB 3GY4A 2Z94A 2A4OA 3AVZA 1GBMA 2D8WA 1TNLA 1LHGH 3R3GB 3DUXH 1KLIH 5C5NA 4MQAA 1FY1A 4WJG2 1YP9A 3UOPA 4UFFH 1FY5A 3BTFE 3ZVBA 3VXEH 1AWHB 3RXIA 3T26A 4GPGA 5TJXA 1AFEH 3SUGA 1D4PB 3QZRA 3BTTE 1SLWB 1ZTLA 2Y80A 3D62A 4K1SA 3MH6A 1EB2A 1ZTKA 4U30A 1JWTA 1DM4B 2FMJA 1C4U2 3Q76A 4LOYH 4YZUA 1S85A 1TGBA 3BG8A 1IQIA 1MKXH 1GBTA 2PGQB 4CR9A 1GVLA 1UTNA 4K8YA 5GJ4B 2WPLS 5DP8A 4CRAA 1KLTA 2ZPQA 3PO1C 3S7KB 2WV4A 3SNCA 3P8NA 1CA8B 2J9NA 3U98H 5A2MH 1UTMA 2ZPRA 1AN1E 1F2SE 2O8UA 1W14U 1IQJA 1H1BA 1YPEH 4KGAA 4MG3A 1GBLA 2GV6A 1Q2WA 1V2LT 4NA8A 4XE4A 3QGNB 2VU8E 1AWFH 1ELBA 3MWIU 1BTXA 1H4WA 4WY3A 5SGAE 1C5OH 2J94A 4ZKOU 3M3VA 4X1PU 1QRZA 3M61U 1C5XB 1DT2A 1Q31A 1BMAA 5C1YA 1UHBA 5GCHF 5A8ZA 3RXBA