4AFZA

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
224
Chain Sequence
IIGGTECKPHSRPYMAYLEIVTGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 224
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afzA02
1XUIA 2W26A 4HI3A 1BITA 5DJ7A 4K1TA 1AHTH 3LU9B 3SU5A 4Y10E 1C5MD 3MHWU 2OC1A 3DFJA 1DUAA 1J9CH 4FXGH 1O35A 2Y82A 1GBJA 3ZV8A 2A7CA 1BRUP 1A3EH 1CT4E 3SJOA 4CH8B 1AZZA 1ZR0A 1TX7A 2PTCE 3QGNB 1GBAA 2V3HH 4NSYA 3EDXB 1O2HA 5L2YH 1F0SA 1BTUA 1ZZZA 4XOJA 1SGCA 3LC5A 1A61H 3NXPA 1GBKA 1XUFA 2RA0A 4KGAA 4OGYA 1CHGA 2ALVA 2Q6FA 3VGCB 4AZ2B 5FCKA 5EPNA 1P2KA 1FPCH 1GJAB 2ZTYA 3PO1B 4M7GA 3BTWE 1IAUA 2ZHFH 2LPRA 3T29A 3P8NA 3MNCA 1O34A 2QF0A 3LJJA 2Z3CA 1ZYOA 1SQOA 2J38A 1XUHA 4FUHA 1GI2A 4AFZA 2FEQH 3M37A 1W2KH 1F5RA 1AFQC 2Y7XA 1GCDA 1C5WB 1RIWB 1BZXE 2ZGJA 1JWTA 4TY6A 2W7SA 1C1SA 3TJVA 1TGNA 4CBOA 1FIZA 1ORFA 5BPEA 2FOBA 2R0LA 3RXOA 2ZECA 4AFUA 1O3AA 2GZ8A 2QIQA 4WY3A 1T8NA 2D1JA 1NRSH 2VH0A 1L1JA 3ZYEA 3VEQB 3VXEH 2C8YB 1CU1A 3HK3B 3MU0A 4Y7BA 3S7KB 2XNIA 3GY4A 4FUGA 1JIMA 3TH2H 2TRMA 1DE7H 2ZDKA 1TFXA 1SQAA 4Y71A 1VITH 4JZDH 1O2UA 4OS2A 1OS8A 1SGQE 1UO6A 1O31A 4SGBE 1N8OB 1W7GH 1D9IA 1SR5C 1TABE 1TRMA 1YM0A 2QXJA 5GIBA 1BIOA 2A5AA 2ZZUH 3W94A 2VJ1A 1MTNB 1NESE 2ZP0H 2FODA 4X1QU 2BQ6B 1W10U 1P11E 4ZHMU 1BJUA 1EKBB 1WQVH 3UNQA 1MCVA 1MD8A 3SV7A 1IQIA 1G30B 1F0RA 3FANA 4AN7A 2JETB 3VFEA 1Y3UA 5A0BA 1GMHF 6GCHF 5C1UA 2QF3A 2BY9X 1KXAA 1PPBH 1Z6EA 4D8NA 1C1NA 1YPEH 3KCGH 2UWOA 3SQHE 4NA8A 1IQLA 3UR6A 1S0RA 2JKHA 2HPPH 2VIOA 2G55A 4I8JA 3I29A 1MU6B 3A7YA 1QIXB 1PYTD 3T27A 2A31A 2ZCHP 5DKMA 4NFEA 2ZPSA 1GHBF 1AI8H 1BJVA 2BZ6H 4IMQA 1C2FA 1GI9B 1EB2A 2GDEH 3IITA 4ZHLU 2OC7A 1MKXH 2Z9JA 2G4TA 5FBEA 1AFEH 2AS9A 1NO9H 1TYNA 2ILNA 1FDPA 3QZQA 1GBCA 2QC2A 3LIWA 3MH5A 3RC4A 4I32A 2EEKA 2ZHDA 2OD3B 1GJ7B 1MTUA 3RXLA 4X1PU 5FCRA 3HK6B 2ZNKH 1GPZA 3RU4D 1VITF 2XBXA 3A7VA 2BVXH 2G51A 5C67A 1GDUA 1CA0C 2Z9GA 2P3FH 3RXFA 3FP8E 4ABAA 1UCYH 4NIWA 1K1LA 4X2YA 1GJ4H 4GLYA 4ZUHA 2VWOA 3SHCH 1CQQA 1OXGA 3UREA 1CHOG 3BIVH 4I8GA 2GMTC 1INCA 1BT7A 4AOQA 3UQOA 1H8DH 4THNH 3TGKE 3PWBA 5GCHG 1BRBE 2BDIA 3BTKE 3NZIA 1GHXH 4NIVA 4MNXA 1LVMA 3ATIA 4WXVA 1O3LA 2ASUB 1C1TA 4FUDA 1MTWA 3CS0A 4H4FA 1F5KU 2ZU5A 4I8LA 1QR3E 3SORA 4CR5A 1D6RA 8LPRA 2PW8H 3TK5A 1OX1A 3BTHE 1O3BA 1GBFA 1DX5M 2Z9IA 3LC3A 2D2DA 3RMLH 1SGYE 1IHTH 3LT3A 3Q3YA 4K8BA 1Y5UT 2ZIQH 1A5IA 4HTCH 2P8OC 2QA9E 1T31A 2Y5FA 1HAYB 4RKOB 3E90B 1YBWA 1P10A 1PPEE 5DP9A 4O97A 4D9RA 2FOFA 4JZFH 4Y6DA 3KQEA 1GHYH 3C27B 5TCAA 2V6NA 3HATH 1FIWA 2R0KA 3GY3A 2AGEX 1K2I1 1HAOH 1TALA 1DOJA 3GCHB 2HPQH 3TNSA 1ANEA 1TBZH 2DE9A 3F9FA 1RTKA 3UIRA 1C1RA 5JDUB 2C8XB 3ATKA 2G81E 1O5GH 1S5SA 3L33A 3DT0H 1BBRE 2WUCA 4UE7H 3ZV9A 1C5UA 4B2CA 5AHGH 1MTSA 1W0ZU 3Q3XA 2QAAA 1SVPA 5CHAB 1FY4A 1EPTB 2QCYA 1GG6C 2HLCA 1HUTH 1JXPA 1C2MA 1SBWA 3ZVEA 2PHBA 1EQ9A 1BHXB 3SU1A 1W0YH 4K1SA 4NA7A 1YCPK 2Y5HA 3BV9B 3PWCA 2ANKH 4CBNA 1T8MA 1UTPA 1OWIA 3A81A 3FP7E 1IHSH 7GCHF 1DFPA 2A4OA 2H9EH 1EPTA 1NTPA 3D65E 2ZU1A 1LQEA 1JBUH 2ZTXA 1S6FA 1ANCA 3KF2A 4ZMAH 1TRNA 1C5TA 1EZSC 5IDKA 1FJSA 1O5AB 2CF9H 2OQ5A 2VU8E 3FAOA 5T6GA 3S7HB 4U01A 5JPMH 2GCHF 1G32B 1TNKA 2GV6A 1ANBA 1A5HA 5BRRE 1H1BA 1K1NA 4AB9A 2PGBB 3UFAA 2FIRH 1T8LA 6CHAB 1PPGE 4IN1A 1GHAF 1HAVB 1KY9A 3KN2A 1RTFB 1L1GA 3BG4B 1SGRE 2BY8X 1O2WA 1DWCH 1C2KA 4AORA 2ZGHA 1TGBA 2BMGB 1NRQH 1UVOA 3NUMA 3QTOH 3A85A 1E36B 1UHBB 3SJ9A 3PMHB 3B23B 4X8UH 1GDNA 1J16A 3E8LA 3RM2H 4ESTE 3MU1A 1HAVA 1DWBH 2ZC9H 5JBBS 1C5SA 1GCTB 2H5DA 1OP0A 3EYDA 2QXGA 1OYTH 5FBIA 3TK6A 5C2ZA 4A1XA 3OY6U 3RC6A 1AMHA 1CBWB 1O2ZA 2C8WB 1WOFA 1GVKB 1FMGA 1DVAH 1O3MA 1P09A 1SPJA 4IS5A 2FOCA 1H9IE 2FWWA 1G3EA 3RXBA 2PGQB 1KTSB 1ZPBA 2BDAA 2GX4A 2ZFRH 3SJIA 2ZDAH 2ZU2A 4X6MA 1OWKA 3RP2A 3G01A 2EI7A 2J92A 4A7IB 5DK1A 1K1OA 3AASA 3Q3KA 1W14U 1P8VC 3NCLA 1BRCE 4ZROA 5DP8A 4BOHA 5DP5A 1MCTA 1P01A 3K65B 1XKBC 3RMMH 3BEIB 1UTQA 3MOCA 5A09A 1O2PA 3T26A 2Y7ZA 1IQGA 3FZZA 4AYVB 1K1IA 2C8ZB 4ZH8A 1SGTA 1LHEH 1KTTB 1NRRH 4AG2A 1O3IA 1HJ9A 2PKSB 2RG3A 2TBSA 1A3BH 1V2NT 3VXFH 2FESH 4ZXYH 1DT2A 1N6XA 4TWYA 3QX5H 4AGKA 1S83A 3GY5A 3MO6A 3T2NA 2IN2A 5T6DA 3QO6A 1LHDH 3LKWA 1P2OA 2CN0H 4ABEA 1ELEE 1MQ5A 1JRSA 1TGSZ 4Y8YA 3KQCA 2CHAB 5EG4A 2C90B 2BYAX 1HV7A 2P3TB 2TGPZ 2GCTC 1S82A 3EGKH 1C2HA 3U9AH 4X2WA 3UNRA 1H8IH 2WYJA 3SZNA 3RXQA 4UONA 4A6LA 1FY5A 4CRFA 1GMHG 1MMJN 1K22H 4JZIA 1IOEA 4GHTA 3QK1A 1ZMNA 1S81A 4X6NA 2OQUA 4FVDA 2BDCA 2FZZA 3DUXH 2J2UA 3V7TA 3TITA 5TJXA 2QV1A 3M5LA 1ZTKA 8KME2 4DOQA 3EQ0H 2FYQA 3MU4A 1GHZA 2JH6D 1SGNE 2CJIA 2FXRA 4MPUA 1O2RA 2BXUH 2V35A 1FUJA 1C2IA 1D6WA 1GHBG 4PROA 3B9FH 2XC5A 3ZZAA 4B75A 5ETXA 3E6PH 2NU3E 1ZOMA 1EB1H 1MQ6A 1TX6A 1O3HA 1QB1A 1XKAC 2B0FA 2TIOA 2VVCA 2W3IA 3IG6B 1M9UA 1W7XH 1S6HA 3HGPA 4GUXA 2BLWA 1O2VA 4Y8XA 2WV5A 2WPIS 3QN7A 1QBOA 2FS9A 1AY6H 1MAYA 3S0NA 3PLPA 5E2PA 4JK6A 3PROA 1O2LA 1DXWA 1GMDF 2BDHA 3LH1A 2ESTE 4Z6AH 1ZPCA 1HJ8A 4R0IA 3PLKA 4CHAC 4ABJA 1K1JA 1VGCB 1YC0A 1P3EA 1VITG 4WXIA 3U1JB 1XXDA 2ZFPH 5C1YA 4DG4A 1LPZB 2OINA 2H5CA 3PM3A 2J95A 4AYYB 3VB5A 8ESTE 2WV4A 2SGQE 4WMEA 1GI6A 1P03A 2FMJA 7ESTE 4NG9H 1O37A 5IYTA 1FV9A 1KDQB 5G4BA 1AZ8A 1GBEA 5EW1H 4XFQA 3RXCA 1V3XA 1YP9A 3RXPA 2B9LA 4X8SH 2W3KA 1THSH 2Z3DA 4TPIZ 2R2WU 1QL8A 1MBMA 1O5EH 1ZHMA 5FX5A 4ISNA 1E35B 1TPOA 3U69H 2HVXA 1PPZA 3LH3A 1CGJE 1THRH 2QXHA 1PFXC 2C3SA 2V3OH 4GVUA 1LVBA 1P04A 2SGEE 3UOPA 3OSYA 1TMBH 1P9SA 5JB8S 1CO7E 1KDQA 1O3DA 2FOEA 5AFYH 4MNVA 4INHA 3ZVDA 1P06A 1P12E 1RRKA 3LDXH 1LPGB 5AVDA 4O3TA 1PQAA 1P02A 3SNDA 3QZRA 1DWEH 4X8TH 2BQWB 2A2XH 1GI5A 1D3QB 2ZDNA 4BXWA 3RXSA 1T4VH 1DDJA 1RFNA 1G3BA 3M7TA 2J9NA 4X6PA 1TNIA 2CXVA 1BMNH 2OC0A 1KXDA 1GGDB 2WPLS 5JYIA 3UQVA 2WPHS 3BEFB 4U30A 3MNBA 1QJ1B 2CV3A 4E06H 1MKWH 1X7AC 1MKXK 1SOTA 2ZHEH 4INKA 1HB0B 2ZKSA 1OP8A 4IC5A 2FI3E 4RN6A 2HNTF 2FLRH 3A8BA 2NU4E 1L4ZA 1HXFH 1V2PT 4KKDA 2PFEA 1O30A 4DY7B 2VIWA 1AO5A 2A4RA 3M5MA 3KL6A 5J4QA 4BAMB 2Z94A 1F2SE 4XBDA 4SGAE 1G36A 2I6SA 4Y0ZE 1VR1H 1P2JA 2WINI 3M3TA 3M3VA 1RJXB 1UCYK 1UVTH 4DIHH 5EU8A 1YGCH 1QB6A 5A2MH 1LHFH 1HXEH 1XUGA 1AVXA 3TJNA 5FPSA 3ZZ7A 1T32A 3SUFA 1UTJA 3VGCC 2XCFA 3Q77A 1O5DH 1NRNH 3MH4A 3PO1C 1JOUB 3BN9A 3VB7A 1C4U2 2H9HA 4UFEH 3BTEE 1AVWA 4LZ4B 3R3GB 2ZGXH 1QURH 4B71A 1BMMH 1HPGA 4I33A 2A0QB 1NFWA 2J4IA 1JIRA 1IQFA 3CS7A 1HAZB 2BZAA 1ZTLA 1IQNA 1RIWC 4MVNA 2FOGA 1C2JA 1KXFA 2HNTC 3U98H 1Q3XA 3ZVAA 3PMAB 2QN5T 2ZWLH 3RXKA 3HGNA 1GJ5H 1GHAG 1B0EA 3SUGA 2DUCA 2HALA 1SB1H 1WSSH 2J34A 4NZQA 4Y0YE 3RXGA 4BXSA 1TQ0B 1FY8E 3QWCH 2XYAA 1TIOA 3SOSA 3UTUH 1WYKA 2AGIX 1UJ1A 2PV9B 2BD7A 4Q7XA 4YESB 3BTDE 3M5NA 1E37B 3QDZB 3PLBA 1SMFE 3DA9B 3FP6E 2CGAA 1TLDA 2F91A 1A4WH 1ZPZA 1A1RA 2IJOB 3EA9A 1TNHA 1DWDH 1F5LA 4Y79A 1NU7B 5C1XA 4E7NA 1LQDB 3HKIB 1N8OC 4ZXXH 1QJ7B 4WJG2 3TIUA 1AU8A 1C5YB 2ZDVH 2AIPA 1T4UH 2SGAA 1WCZA 4E05H 2ZDLA 1B0FA 1Q31A 2C4FH 2P95A 2OC8A 4MPVA 1MTNC 1ZGIA 2RCEA 4YLUA 2Z6BD 1CGIE 4TYDA 2D26C 1HIAB 1GI4A 2Y81A 4J1YA 3E0NB 1JRTA 1KLIH 1C5VA 3KEEA 2XC4A 4ZHAA 5HYOA 4XE4A 1OKXA 1V2JT 1W8BH 5FX6A 1UK2A 2JETC 1O38A 2Z9LA 3PYHA 1C1PA 2ZFQH 2IOTA 2VIVA 3P70B 3MNXA 1GJCB 1LVOA 2P93A 3TJOA 1HIAA 3SU6A 1OWDA 2CMYA 4X6OA 4X2XA 1EUFA 1SGEE 1Z8JB 1OWEA 4YOGA 2THFB 3SNCA 3B8JA 1J15A 1Z6JH 3BTME 1UTOA 6LPRA 3H7TA 1SGIB 2FM2A 4BAQB 3GDVA 4ZKNU 1KYNA 2WPMS 1PQ7A 3MH6A 1E34B 4D76A 2QXIA 4WWYA 3KQBA 3L6PA 1O33A 5A8YA 1P2QA 3ZZCA 1UTMA 3A80A 7LPRA 4ISHH 2OXSA 2AEIH 3ZZDA 2BDBA 4K8YA 1C5OH 1ZMLA 1BUIA 2SGPE 4AB8A 2VWMA 3PTNA 4E7RG 2A4QA 1TA2A 1ELCA 1DLKB 2ULLA 1DS2E 2EA3A 4AGJA 1J17T 4K1EA 4KTCA 2WPJS 1W12U 3Q76A 2W7UA 3K9XB 4R8TB 1TB6H 1QFKH 1AE8H 1QTFA 5AFZH 1GVZA 4CR9A 3NKKA 1OPHB 1B5GH 5K7RA 3AW0A 1ZTJA 1WV7H 1A7SA 3GDSA 1P3CA 4AFSA 1KXCA 5GJ4B 3SN8A 2BD5A 3ZVGA 3EA8A 3GCNA 1EAWA 2OUAA 1KXBA 1YLDA 1YKTA 3ZYDA 1O2NA 3FFGA 4Y76A 5GWZA 3C1KA 4K69A 1ZRKA 2Z7FE 1C5ZB 1GMCG 4B1TA 1GJ9B 2JH0D 2AH4X 3A86A 2F83A 1Z71A 1O3NA 4HZHA 2Y5GA 1BHXF 2BX3A 1O3FA 5FAHA 3V12A 2UWPA 1HAGE 3E3TA 1C1WH 3GISB 2ZTZA 3CP7A 5FHTA 1C5RA 4ABGA 2AYWA 5F8ZA 1BDAA 1UVSH 1TE0A 1ID5H 4XBBA 1THPB 1LTOA 1XXFA 3GICB 2H6MA 3UUZA 1OP2A 1QRZA 4ABHA 3LJOA 4AFQA 1TX8A 1TPPA 5ESTE 1P05A 2YOLA 1ELTA 1QA0A 1N1LA 2EI8A 3H5CB 3LOXA 1FY3A 2GGVB 2D8WA 3MYWA 4NSVA 3SW2B 3GCHC 4RSPA 3SJ8A 2PKAB 1ELVA 3SGBE 3O8RA 2HWLB 1A46H 1C5NH 5EPYA 2VVUA 1NROH 5E0HA 2BHGA 1FY1A 1HJAB 3A87A 4OS4A 1G9IE 1OWJA 1PPCE 4H6SB 1EAIA 5EGMA 1YCPM 3A84A 2I6QA 5I46H 1UK3A 2ZFSA 1CT2E 5CHAC 1EPTC 2PKAA 4IW4E 5CE1A 1C1MA 4U2WA 4YTAA 1HDTH 2ZA5A 4INLA 2XCNA 1PPHE 1AGJA 3E16B 4UDWH 3KQDA 3TH4H 4JYUH 2FX6A 1UK4A 5E0JA 1C9TA 4IGDA 1AB9B 1LDTT 4NA9H 3JZ1B 1ETSH 3EA7A 1SSXA 4B2BA 1EOJA 1O5BB 1GL0E 1G2LA 2Z9KA 2VB0A 1SFQB 5C5NA 1G37A 4BAOB 2GDDA 4LXBH 1C4V2 3UNSA 4HGCA 4VGCB 2QGRA 3ZVCA 3GY8A 4CRCA 1F0TA 3A88A 4ISLA 4UEHH 1U6QA 2BM2A 3ZVFA 3TLOA 2FYRA 1TRYA 5C20A 3M35A 1Z8GA 1RXPA 5LGOA 4BANB 1AWHB 1BA8B 1DXPA 1AQ7A 1YYY1 1EATA 1ELAA 2AFQB 1V2RT 4B2AA 6CHAC 2BDYA 3SUDA 5ABWA 3BG4C 5DP6A 3O8CA 2G00A 3BSQA 1GBBA 1OYQA 3F9HA 1ZSKA 2A45B 2AGGX 1FNIA 3P95A 3QLPH 5HMAA 1ESBA 4NZLA 1TQ7B 5GCHF 1BTHH 1QL7A 4K5ZA 3KGPA 4NWKA 1D3TB 1HYLA 3RUOA 1GCTC 2BD9A 5LPFA 1UTLM 4FUIA 1XVOA 5DP7A 2W5EA 1A0HB 4OS7A 2ZFTA 1DY8A 4JCNA 3MH7A 3R0FA 3RU4E 3NK8A 4IMZA 2BD8A 4WF8A 1CBWC 3ZZ4A 3SNAA 1NS3A 1GBIA 4RKJB 1P2MA 2FS8A 4NCYA 1SQTA 2BB4A 1B7XB 1BQYA 1GBLA 4OS1A 2Q6GA 2BLVA 3OTJE 3SV2H 2PUQH 5A0AE 1WAYB 1ZHRA 2BY6X 6GCHG 3WY8A 1PJPA 1C1QA 1D3PB 1ESTA 2XWAA 1EP5A 4LK4A 2VGCB 4X1NU 2ZGBH 1V2ST 2ZI2H 1UTNA 3N7OA 1WU1A 1ABJH 1P9UA 1C5PA 5EW2H 2FOMB 3A8CA 1J14A 1KSNA 3DFLA 1GJ6A 3AW1A 1YPHE 1MKWK 3D23A 3S9CA 5JB9S 1D3DB 1H9LB 4Q7ZA 2PKSC 2M5TA 3DD2H 4XDEA 1WBGB 4KP0A 1P0SH 1UCYE 2G5VA 4JZ1A 5EXLA 2GZ7A 1QGFA 5DP3A 3PMBB 2BDGA 5A0CA 1KXEA 4WVPE 5A8ZA 1BBRH 1BMLA 1FN6A 1QBNA 1SC8U 3K2UA 4MDSA 1HGTH 2HRVA 1ESAA 1EJAA 4DURA 2CHAC 1P2NA 4YT7H 1ELFA 1LKBA 2SFAA 1O39A 1G3DA 1QJ6B 4Q80A 3ZZ9A 1V2QT 2H1UA 2XBWA 1C4Y2 5GPIB 2BD4A 2WPKS 1A2CH 1AFQB 1FQ3A 1TOMH 2Y6TA 2LNCA 4DJZB 1GI1A 3RMOH 2Y80A 2TGTA 1QBVH 1EX3A 2ZG0H 2STBE 2G5NA 1TBQH 2BOHB 3QUMP 1SLXB 4ZKRU 3EAJA 8GCHF 1YPMH 4WMDA 1QB9A 3STJA 1IQHA 1O2JA 2ZQ1A 3S69A 1EP6A 5F6MA 1YF4A 2XRCA 2F9NA 2GT8A 1V2MT 2A7HA 4IN2A 1QA7A 3RDZA 4A5TS 1T8OA 3BTTE 1ELDE 1SLWB 3RU4T 1NC6A 1AUTC 3BG8A 2Z3EA 1ETTH 2TGAA 1DSUA 3ATMA 2ZU4A 3SJKA 4I8KA 1C5XB 1ACBE 3TPIZ 4QT8C 3GCTF 1O2YA 1ZMJA 4IC6A 4J2YB 4YT6H 1T7CA 3BEUA 3A8DA 1ELGA 4HFPB 3KNXA 3MTYA 2XTTB 2XBYA 2OBOA 2SGDE 2B7DH 4NIYA 1SGFG 1YPKH 3V3MA 1UMAH 1VGCC 2WUBA 2WYGA 5ESBA 4H6TA 3U1IB 2F9VA 1QQUA 3M61U 1NZQH 1Z1IA 3H7OA 4GCHF 2DE8A 3TJUA 1C1UH 2P3UB 3MI4A 3MMGA 3A89A 3MNSA 3RM0H 2A2QH 3O8DA 3RXRA 3ZZ5A 1O36A 3M3SA 1ZJDA 3M5OA 3SQEE 3VPKA 4A1TA 1EOLA 1C2GA 2XW9A 1BB0B 3F9EA 3GCOA 2A1DB 1EAUA 2BXTH 1EXFA 2O8UA 4WMFA 3MWIU 1TA6A 3GY6A 1DITH 3LGYA 3RXAA 5L30H 2IPHA 1K1PA 3D49H 3KHVA 2A5IA 1CE5A 1BTXA 4Y7AA 1MZAA 1AE5A 2OCVB 1DUEA 4MPWA 2K1QA 3HKJB 1O2XA 3ODFA 4UFFH 3TGJE 1E38B 1NFXA 3OY5U 3SGAE 3A7XA 1N6YA 4ZAEA 1V6DA 1O3KA 2NU0E 4JMYA 1LCYA 4DVAU 4YOJA 3A83A 3PB1E 2EI6A 7GCHG 1EJNA 2UUYA 4XSKU 1DPOA 4UFGH 4H42U 1BMAA 1QHRB 2VH6A 2HOBA 1GDQA 1ZHPA 2JH5D 3U8OH 4BAHB 1V2TT 3SU3A 3K6YA 1Y3VA 1SGDE 2P94A 5T6FA 1ELBA 3ZZ6A 1TGTA 3SNBA 2PTNA 2B8OH 4F4OC 2UUKB 2BY7X 2ZPRA 3F9GA 1GGDC 1E0FD 1SHHB 2GCHG 3SUEA 5HXFA 3NWUA 5A8XA 1V2LT 1ZRBA 3ELAH 1CA0B 1A0LA 2ZHWH 1CVWH 5CMXH 2FOAA 2KAIB 2ZCLP 2BD2A 1BTYA 1C5LH 3M7UA 5TCCA 1IQJA 1MZDA 2PR3A 4X0WU 2G8TA 5GDSH 4YZUA 3TNTA 1Y5BT 4DGJA 2A5KA 4ABFA 3A7ZA 1HNEE 3MO3A 3BTFE 2OLGA 3LONA 3UWIA 4TWWA 1WTHD 4AG1A 3SU2A 3P8GA 1O5CB 3P6ZB 1NM6A 3T28A 2GMTB 1K21H 2PUXB 4CRBA 2BY5X 4TY7A 1O2QA 5F8TA 2KAIA 2GTBA 1W3CA 1GBHA 5EQSA 1C2DA 4MNWA 3BIUH 1PQ8A 2BQ7B 2TGDA 3OX7U 5LPEA 1UVUH 1GL1A 2O8LA 2FI5E 2ODYB 2P59A 2ZHQH 2FDAA 3LGVA 3TU7H 5DO4H 1GWAA 3OYPA 4IBLH 4A92A 1V2KT 1IQEA 1EASA 1TNGA 2VWLA 9LPRA 2CF8H 1TMTH 3IWMA 2BOKA 3ESTA 1L1NA 2A7JA 3M7QA 4CH2B 2P8OB 2F9PA 2BVSH 4DT7B 4FU7A 1FZZA 1DM4B 1H4WA 1HBTH 2FP7B 1VCWA 5FXLA 4FU9A 4I31A 5EOKA 3RLYH 5K0HA 1HFDA 2FPZA 3F68H 4FU8A 4YOIA 1QCPA 2R3YA 2ANMH 2UUJB 3AVZA 3F1SB 3LGWA 1ZLRA 1NFYA 1WTGH 5L6NH 1GHWH 2TPIZ 1TGCA 1KLTA 1BCUH 4D9QA 3V0XA 1AWFH 2ANWA 2SNWA 5E8EH 1GBMA 4A1VA 2ZQ2A 3GOVB 2VWNA 3SV8A 3I78A 3URCA 3QTVH 1CGHA 1Y3XA 3P92A 1EJMA 1BTPA 1WQSA 1NPMA 1XM1A 3A7WA 3E0PB 3VB3A 1FXYA 5C5OA 1Y8TA 1F0UA 5C3NA 1QRXA 3UOUA 2C93B 2ZPQA 5HM9A 2ZU3A 4DCDA 3AAVA 2VIDA 3P8FA 2BLQA 2XWBI 1GG6B 1MH0A 4XBCA 1NRPH 4K60A 3A8AA 2RDLA 1K9OE 1K1MA 1Q2WA 5EXNA 1GI8B 1NU9A 1ABIH 3T25A 4GPGA 1BRAA 4O3UA 3M36A 1FLEE 4MQAA 1TWXB 3SGQE 2ZO3H 1GBTA 1HCGA 5HGGA 1V2VT 3U8TH 1LHCH 3RXJA 1SFIA 3W95A 1GI0A 2J94A 2BD3A 3RC5A 3VB6A 1TMUH 4NIXA 1MUEB 5HM2A 2GV7A 1O3PB 1EZQA 1GJBB 3HPTB 5E0GA 2OP9A 1LKAA 1D4PB 1VJAU 1YPGH 2GVFA 1AN1E 5H4IB 1BTZA 4D7FA 4MPXA 1AUJA 1O2OA 2ZF0H 3MU8A 1QRWA 1MD7A 2BLOA 3BTQE 1PYTC 4BTTB 3FVFB 1C1OA 2ODPA 1TAWA 1O2GH 3ATLA 1V2WT 1LO6A 3TVJB 2H2ZA 4X1RU 3SBKA 2QY0B 2O8WA 2FO9A 1PPFE 1CA8B 1S0QA 5FPTA 4ZKSU 1ARBA 2VNTA 3RXVA 1FONA 2FTLE 1CSOE 1SGFA 3A7TA 5L2ZH 2GP9B 2HNTE 4X8VH 3RXIA 1SOZA 3RXDA 3T62A 3I77A 5B6OA 4CREA 1TNJA 1HAPH 4JYTA 3T5FH 2Q6DA 1ZSJA 3JZ2B 4UD9H 1W11U 3KIDU 1OOKB 2STAE 1XUKA 3ATWA 4I7YH 1A5GH 3DHKH 1GMDG 4ABIA 1KIGH 6ESTA 1TPSA 3ITIA 7KMEH 1MTVA 1SG8B 2NU1E 1G3CA 3ZVBA 3ENSB 4MTBA 2QYIA 1O2SA 1HAHH 2XBVA 1GI7B 1NY22 3RXEA 1RS0A 1OSSA 4TPYA 5DGJA 4YLQH 4NWLA 1GI3A 4ASHA 1V2UT 3GDUA 4D7GA 1O3GA 1FI8A 5T3HA 1QNJA 1P2IA 4BTIB 4CRAA 4DIIH 1SL3A 2G52A 2FI4E 2AMPA 3QGJA 1ZJKA 1O2KA 3SV6A 1C5QA 1O3OA 3GY7A 4LOYH 5SGAE 4AX9H 2OTVA 1RTLA 4I8HA 1HLTH 9ESTA 3UPEA 1J8AA 1YPHC 4FUCA 1HAXB 2ZGCA 8GCHG 1LHGH 2PSYA 1AD8H 5PTPA 4KTUA 1O5FH 5EQRA 1TPAE 4Q2KA 2ZEBA 3TH3H 3A82A 3CENA 3ODDA 3SO3A 3LGUA 2FX4A 2A4GA 4WH6A 4CRDA 1F92A 2B5TB 1AVGH 2BX4A 1TONA 2RA3A 1O3JA 1WUNH 2NWNA 5DPAA 4BNRA 3F6UH 3MU5A 4BTUB 1HAIH 4ABBA 1NT1A 4MG3A 5F03A 2PSXA 2G4UA 1P57B 3GCTG 2R2MB 3SV9A 4FUFA 1G2MA 3GYMA 1YPLH 1RD3B 1QY6A 4Z0KA 1ZGVA 3MO9A 2HGTH 1ANDA 1ZSLA 3P8OA 3BTGE 3Q00A 1C9PA 4MLFB 4ZKOU 3E1XB 1Z1JA 1O2IA 2ZCKP 1H9HE 2AMDA 2AMQA 2GD4B 3RXUA 4LZ1H 1GJDB 1QQ4A 3FZDA 1ETRH 1DLEA 4GCHG 3AAUA 1UHBA 2P16A 1UTKA 2GCTB 2ALPA 3K6ZA 4JZEH 1IQKA 3O8BA 2ZFFH 3SI4H 1Z8RA 1K28D 1W13U 1VJ9U 1YCPH 3LPRA 1BBRK 4ISOA 2ZDMA 4KELA 4F49A 3RXMA 2O8MA 5EXMA 3SI3H 5JBAS 1Z8IB 1HJAC 1O2MA 2F9OA 2Q1JA 2BTCE 1CHOF 1NFUA 2GZ9A 2BVRH 4FUBA 4JYVH 1PQ5A 1C2EA 3OU0A 4YM9A 2YNAA 2GKVE 4NFFA 2VINA 1EZXC 1Y3YA 4FUEA 1DY9A 4YO9A 1S85A 1Y3WA 5DG6A 3EE0B 1AIXH 3SNEA 3ZZ8A 1FPHH 1TOCB 1YPJH 5LH8A 3LGTA 5DP4A 1O2TA 1DSTA 1EAXA 4GAWA 2F9BH 3U8RH 1Y5AT 2AERH 3TK9A 1AKSB 2FLBH 1AB9C 2VIPA 1EZUC 2PLXA 1VCPA 2GT7A 1IQMA 1DICA 2H9TH 4O9VA 5LPRA 1SHYA 4Y8ZA 5F8XA 3ZZBA 2YNBA 3S9BA 3TGIE 4X1SU 1QL9A 4B76A 4GHQA 3SU0A 1SGPE 1SLUB 5EQQA 4CHAB 1A0JA 1UVPA 4NGAH 2R3UA 1LVYA 4VGCC 1BTWA 3LGIA 1GJ8B 1MBQA 4ISIH 3STIA 1L2EA 1AKSA 1OWHA 5J4SA 2ANYA 3PTBA 1C1VH 1GVLA 3VB4A 1O3CA 4MNYA 1O0DH 1GHVH 1V2OT 3MFJA 1Y59T 4X2VA 5EODA 3RXTA 1ARCA 1XVMA 1TBRH 2SGFE 2F3CE 3GYLB 3GY2A 1MAXA 3PV4A 4K2YA 1FAXA 3UR9A 5I25A 4Q7YA 1F7ZA 4UFDH 2XXLA 2PWXA 1GBDA 1O3EA 1JMOH 5E2OA 1LMWB 2ODQA 3PMJA 3S9AA 1FN8A 3NPSA 3UY9A 3E91A 2O8TA 3D62A 5JBCS 3P17H 1GMCF 4K3JA 1VZQH 2V0BA 1MU8B 5JBTA 1LPKB 5AF9H 4O03A 4OGXA 4U32A 1BOQA 2UWLA 3RXHA 5FPYA 4Y11E 1YLCA 2VIQA 5GXPA 1HRTH 1TNLA 2OBQA 4OS6A 3URDA 1S84A 4FVBA 1XMNB 2A32A 1XUJA 2AIQA 4DW2U 4BAKB 1L0ZA 3BF6H 1NN6A 2EC9H 3L3TA 3SHAH 1KLJH 2FTMA 4CRGA 3RMNH 4B73A 4FUJA 1XX9A 4KTSA 1CT0E 1FAKH 1DANH 2O9QA 4OS5A 2FOHA 4ABDA 1SLVB 1Z7KA 4WH8A 3RLWH 3ZZ3A 2XC0A 1RGQA 4B74A 1SI5H 2VVVA 1VCQA 1O32A 3SU4A 1L4DA 4GSOA 1C2LA 2NU2E 2VGCC 3UWJH 2UUFB 2SNVA 3V13A 2R9PA 4JK5A 2F9UA
chains in the Genus database with same CATH superfamily
1XUIA 2W26A 4HI3A 1BITA 5DJ7A 4K1TA 1AHTH 3LU9B 3SU5A 4Y10E 1C5MD 3MHWU 2YMSC 2OC1A 3DFJA 1DUAA 1J9CH 4FXGH 1O35A 2Y82A 4OM9A 1GBJA 3ZV8A 2A7CA 1BRUP 1A3EH 1CT4E 3SJOA 4CH8B 1AZZA 1ZR0A 1TX7A 2PTCE 3QGNB 1GBAA 2V3HH 4NSYA 3EDXB 1O2HA 5L2YH 1F0SA 4M9FA 1BTUA 1ZZZA 4XOJA 1SGCA 3LC5A 1A61H 3NXPA 1GBKA 1XUFA 2RA0A 4KGAA 4OGYA 1CHGA 2ALVA 2VBCA 2Q6FA 3VGCB 4AZ2B 5FCKA 5EPNA 1P2KA 1FPCH 1GJAB 2ZTYA 3PO1B 4M7GA 3BTWE 1IAUA 2ZHFH 2LPRA 3T29A 3P8NA 3MNCA 1O34A 2QF0A 3LJJA 2Z3CA 1ZYOA 1SQOA 2J38A 1XUHA 4FUHA 1GI2A 4AFZA 2FEQH 3M37A 1W2KH 1F5RA 1AFQC 4Q63A 2Y7XA 1GCDA 1C5WB 1RIWB 1BZXE 2ZGJA 1JWTA 4TY6A 2W7SA 1C1SA 3TJVA 1TGNA 3FKSD 4CBOA 2F4LA 1FIZA 4RT1A 1ORFA 5BPEA 2FOBA 2R0LA 3RXOA 2ZECA 4AFUA 1O3AA 2GZ8A 2QIQA 4WY3A 1T8NA 2D1JA 1NRSH 2VH0A 1L1JA 3ZYEA 3VEQB 3VXEH 2C8YB 2HVYB 1CU1A 3SYJA 3HK3B 3MU0A 4Y7BA 3S7KB 2XNIA 3GY4A 4FUGA 1JIMA 3TH2H 2TRMA 1DE7H 2ZDKA 1TFXA 1SQAA 4Y71A 1VITH 4JZDH 1O2UA 5CHBA 4OS2A 1OS8A 1SGQE 1UO6A 1O31A 4SGBE 1N8OB 1W7GH 1D9IA 1SR5C 1TABE 1TRMA 1YM0A 2QXJA 5GIBA 1BIOA 2A5AA 2ZZUH 5DSFA 3W94A 2VJ1A 1MTNB 1FX0B 1NESE 2ZP0H 2FODA 2L74A 4X1QU 2BQ6B 1W10U 1P11E 4ZHMU 1BJUA 1EKBB 1WQVH 3UNQA 1MCVA 3OAAD 1MD8A 3SV7A 1IQIA 1G30B 1F0RA 3FANA 4AN7A 2JETB 3VFEA 1Y3UA 5A0BA 1GMHF 6GCHF 5C1UA 4ASUD 2QF3A 2BY9X 1KXAA 1PPBH 1Z6EA 4D8NA 1C1NA 1YPEH 3KCGH 2UWOA 3SQHE 4NA8A 1IQLA 3UR6A 1S0RA 2JKHA 2HPPH 2VIOA 2G55A 4I8JA 3I29A 1MU6B 3A7YA 1QIXB 1PYTD 3T27A 2A31A 2ZCHP 5DKMA 4NFEA 2ZPSA 1GHBF 1AI8H 1BJVA 2BZ6H 4IMQA 1C2FA 1GI9B 1EB2A 2KCPA 2KCYA 2GDEH 3IITA 4ZHLU 2OC7A 1MKXH 2Z9JA 2G4TA 5FBEA 1AFEH 2AS9A 1NO9H 1TYNA 2ILNA 1FDPA 3QZQA 1GBCA 2QC2A 3LIWA 3MH5A 3RC4A 4I32A 2EEKA 2ZHDA 2OD3B 1GJ7B 1MTUA 3RXLA 4X1PU 5FCRA 3HK6B 2ZNKH 1GPZA 3RU4D 1VITF 2XBXA 3A7VA 2BVXH 2G51A 5C67A 1GDUA 1CA0C 2Z9GA 2P3FH 3RXFA 3FP8E 4ABAA 1UCYH 4NIWA 1K1LA 4X2YA 1GJ4H 4GLYA 4ZUHA 2VWOA 3SHCH 1CQQA 2K8IA 1OXGA 3UREA 1CHOG 3BIVH 3GS9A 4I8GA 4XRNA 4TSFD 2GMTC 1INCA 1BT7A 4AOQA 3UQOA 1H8DH 4THNH 3TGKE 3PWBA 5GCHG 1BRBE 4AC9A 2BDIA 3BTKE 3NZIA 1GHXH 4NIVA 4MNXA 2F43B 1LVMA 3ATIA 4WXVA 1O3LA 2ASUB 1C1TA 4FUDA 1MTWA 1W0JD 3CS0A 4H4FA 3WWBA 1F5KU 2ZU5A 4I8LA 1QR3E 3SORA 4CR5A 1D6RA 8LPRA 2PW8H 3TK5A 1OX1A 3BTHE 1O3BA 1GBFA 1DX5M 2Z9IA 3LC3A 2D2DA 3RMLH 1SGYE 1IHTH 3LT3A 3Q3YA 4K8BA 1Y5UT 2ZIQH 1A5IA 4HTCH 2P8OC 2QA9E 1T31A 2Y5FA 1HAYB 4RKOB 3E90B 1YBWA 1P10A 1PPEE 5DP9A 4O97A 4D9RA 2FOFA 4JZFH 4Y6DA 3KQEA 1GHYH 3C27B 5TCAA 2V6NA 3HATH 1FIWA 2R0KA 3GY3A 2AGEX 1K2I1 1HAOH 1TALA 1DOJA 3GCHB 3DSGA 2HPQH 3TNSA 1ANEA 1TBZH 2DE9A 3F9FA 1RTKA 3UIRA 1C1RA 5JDUB 1W0KD 2C8XB 3ATKA 2G81E 1O5GH 1S5SA 3L33A 3DT0H 1BBRE 2WUCA 4UE7H 3ZV9A 1C5UA 4B2CA 2WPDD 5AHGH 1MTSA 1W0ZU 3Q3XA 2QAAA 1SVPA 5CHAB 1FY4A 1EPTB 2QCYA 4RI0A 1GG6C 2HLCA 1HUTH 1JXPA 1C2MA 1SBWA 3ZVEA 2PHBA 1EQ9A 1BHXB 3SU1A 1W0YH 4K1SA 4NA7A 1YCPK 2Y5HA 3BV9B 3PWCA 2ANKH 4CBNA 1T8MA 1UTPA 1OWIA 3A81A 3FP7E 1IHSH 7GCHF 4I86A 1DFPA 2A4OA 2H9EH 1EPTA 1NTPA 3D65E 2ZU1A 1LQEA 1JBUH 2ZTXA 1S6FA 2V3MA 1ANCA 3KF2A 4ZMAH 1TRNA 1C5TA 1EZSC 5IDKA 1FJSA 1O5AB 2CF9H 2OQ5A 2VU8E 3FAOA 5T6GA 3S7HB 4U01A 1UW7A 5JPMH 2GCHF 2M2AA 1G32B 1TNKA 2GV6A 1ANBA 1A5HA 4TT3D 5BRRE 1H1BA 1K1NA 4AB9A 2PGBB 3UFAA 2FIRH 1T8LA 6CHAB 1PPGE 4IN1A 1GHAF 1HAVB 1KY9A 3KN2A 1RTFB 1L1GA 3BG4B 4F55A 1SGRE 2BY8X 1O2WA 1DWCH 1C2KA 4AORA 2ZGHA 1TGBA 2BMGB 1NRQH 1UVOA 3NUMA 3W1EA 3QTOH 5C0UA 3A85A 1E36B 1UHBB 3SJ9A 3PMHB 3B23B 4X8UH 1GDNA 1J16A 3E8LA 3RM2H 4ESTE 3MU1A 1HAVA 1DWBH 2ZC9H 5JBBS 1C5SA 1GCTB 2H5DA 1OP0A 3EYDA 2QXGA 1OYTH 2CK3D 5FBIA 3TK6A 5C2ZA 4A1XA 3OY6U 3RC6A 1AMHA 1CBWB 1O2ZA 2C8WB 1WOFA 1GVKB 1FMGA 1DVAH 1O3MA 1P09A 1SPJA 4IS5A 2FOCA 1H9IE 2FWWA 1G3EA 3RXBA 2PGQB 1KTSB 1ZPBA 2BDAA 2GX4A 2ZFRH 3SJIA 2ZDAH 2ZU2A 2EQNA 4X6MA 1OWKA 3RP2A 3G01A 4B6FA 2EI7A 2J92A 4A7IB 5DK1A 1K1OA 3AASA 3Q3KA 1W14U 1P8VC 3NCLA 1BRCE 4ZROA 3N7DA 5DP8A 4BOHA 5DP5A 1MCTA 1P01A 3K65B 1XKBC 3RMMH 3BEIB 1UTQA 3MOCA 5A09A 1O2PA 3T26A 2Y7ZA 1IQGA 3FZZA 4AYVB 1K1IA 2C8ZB 4ZH8A 1SGTA 1LHEH 1KTTB 1NRRH 4AG2A 1O3IA 4Z1MD 1HJ9A 2PKSB 2RG3A 2EY4C 2TBSA 1A3BH 1V2NT 3VXFH 2FESH 4ZXYH 1DT2A 1YWUA 1N6XA 4TWYA 3QX5H 4AGKA 1S83A 3GY5A 3MO6A 3T2NA 2IN2A 5T6DA 3QO6A 1LHDH 3LKWA 1P2OA 2CN0H 4ABEA 1ELEE 1MQ5A 2WV9A 1JRSA 1TGSZ 4Y8YA 3KQCA 2CHAB 5EG4A 2C90B 2BYAX 1HV7A 2P3TB 2TGPZ 2GCTC 1S82A 3EGKH 1C2HA 3U9AH 4X2WA 3UNRA 1H8IH 2WYJA 3SZNA 3RXQA 4UONA 4A6LA 1FY5A 4CRFA 1GMHG 1MMJN 1K22H 4JZIA 1IOEA 4GHTA 3QK1A 1ZMNA 1S81A 4X6NA 2OQUA 4FVDA 2BDCA 2FZZA 3DUXH 2J2UA 3V7TA 3TITA 5TJXA 2QV1A 4Q4LA 3M5LA 1ZTKA 8KME2 4DOQA 3EQ0H 2FYQA 3MU4A 1GHZA 2JH6D 1SGNE 2CJIA 2FXRA 4MPUA 1O2RA 2BXUH 2V35A 1FUJA 1C2IA 1D6WA 1GHBG 4PROA 3B9FH 2XC5A 3ZZAA 4B75A 5ETXA 3E6PH 2NU3E 1ZOMA 1EB1H 1MQ6A 1TX6A 1O3HA 1QB1A 1XKAC 2B0FA 2TIOA 2VVCA 2W3IA 3IG6B 1M9UA 1W7XH 1S6HA 2JJ1D 3HGPA 4GUXA 2BLWA 1O2VA 4Y8XA 2WV5A 2WPIS 3QN7A 1QBOA 2FS9A 1SQRA 1AY6H 1MAYA 3S0NA 3PLPA 2QF5A 5E2PA 4JK6A 3PROA 1O2LA 5EJZA 1DXWA 1GMDF 2BDHA 3LH1A 4ACBA 2ESTE 4Z6AH 1ZPCA 1HJ8A 4R0IA 3PLKA 4CHAC 4ABJA 1K1JA 3WWFA 1VGCB 1YC0A 1P3EA 1VITG 4WXIA 3U1JB 3F0OA 1XXDA 2ZFPH 5C1YA 4DG4A 1LPZB 2OINA 2H5CA 3PM3A 2J95A 4AYYB 5EJ1A 3VB5A 8ESTE 2WV4A 2SGQE 4WMEA 1GI6A 1P03A 2FMJA 3H09A 7ESTE 4NG9H 1O37A 5IYTA 1FV9A 1KDQB 5G4BA 1AZ8A 1GBEA 5EW1H 4XFQA 3RXCA 1V3XA 1YP9A 1BMFD 3RXPA 2B9LA 4X8SH 2W3KA 1THSH 2Z3DA 4TPIZ 2R2WU 1QL8A 1MBMA 1O5EH 1ZHMA 5FX5A 4ISNA 1E35B 1TPOA 3U69H 2HVXA 1PPZA 3LH3A 1CGJE 1THRH 2QXHA 1PFXC 2C3SA 2V3OH 4GVUA 1LVBA 1P04A 2SGEE 3UOPA 3OSYA 1TMBH 1P9SA 5JB8S 1CO7E 1KDQA 1O3DA 2FOEA 5AFYH 4MNVA 4INHA 2KX4A 3ZVDA 1P06A 1P12E 1RRKA 3LDXH 1LPGB 2HLDD 4O3TA 1PQAA 1P02A 5AVDA 3SNDA 3QZRA 1DWEH 4X8TH 2BQWB 2A2XH 1GI5A 1H8ED 1D3QB 2ZDNA 4BXWA 3RXSA 1T4VH 1DDJA 1RFNA 1G3BA 3M7TA 2J9NA 4X6PA 1TNIA 2CXVA 1BMNH 1KXDA 2OC0A 1GGDB 2WPLS 5JYIA 3UQVA 2WPHS 3BEFB 4U30A 3MNBA 1QJ1B 2CV3A 4E06H 2RFKC 1MKWH 1X7AC 1WXRA 1MKXK 1SOTA 2ZHEH 4INKA 1HB0B 2ZKSA 1OP8A 4IC5A 2FI3E 4RN6A 2HNTF 3MQKC 2KR7A 2FLRH 3A8BA 2NU4E 1L4ZA 1HXFH 1V2PT 4KKDA 2PFEA 1O30A 4DY7B 2VIWA 1AO5A 2A4RA 3M5MA 3F0PA 3KL6A 5J4QA 4BAMB 2Z94A 1F2SE 4XBDA 4SGAE 1G36A 2I6SA 4Y0ZE 1VR1H 1P2JA 2WINI 3M3TA 3M3VA 1RJXB 1UCYK 1UVTH 4DIHH 5EU8A 1YGCH 1QB6A 5A2MH 4ZCNA 1LHFH 1HXEH 1XUGA 2LP6A 1AVXA 3TJNA 5FPSA 3ZZ7A 1T32A 3DCLA 1UTJA 3SUFA 3VGCC 2XCFA 3Q77A 5KEDA 1O5DH 1NRNH 3MH4A 3PO1C 1JOUB 3BN9A 2OK5A 3VB7A 1C4U2 2H9HA 4UFEH 3BTEE 1AVWA 4LZ4B 3R3GB 2ZGXH 1QURH 4B71A 1BMMH 5C94A 1HPGA 4I33A 2A0QB 1NFWA 2J4IA 1JIRA 1IQFA 3CS7A 1HAZB 2BZAA 1ZTLA 1IQNA 1RIWC 4MVNA 2FOGA 1C2JA 1KXFA 2HNTC 3U98H 1Q3XA 3ZVAA 3PMAB 2QN5T 2ZWLH 3RXKA 3HGNA 1GJ5H 1GHAG 1B0EA 3SUGA 2DUCA 3NRLA 2HALA 3ZIAD 1SB1H 1WSSH 2J34A 2L6OA 4NZQA 4Y0YE 3RXGA 4BXSA 1TQ0B 1FY8E 3QWCH 2XYAA 1TIOA 3SOSA 3UTUH 1WYKA 2KFWA 2AGIX 1UJ1A 2PV9B 2BD7A 4Q7XA 4YESB 1KMHB 3BTDE 3M5NA 1E37B 3QDZB 3PLBA 1SMFE 3DA9B 3FP6E 2CGAA 1TLDA 2F91A 1A4WH 1ZPZA 1A1RA 2IJOB 3EA9A 1TNHA 1DWDH 1F5LA 4Y79A 1NU7B 5C1XA 4E7NA 1LQDB 3HKIB 1N8OC 4ZXXH 1QJ7B 5T1VA 4WJG2 3TIUA 1AU8A 1C5YB 2ZDVH 2AIPA 1T4UH 2SGAA 1WCZA 4E05H 2ZDLA 1B0FA 1Q31A 2C4FH 2V7QD 2P95A 2OC8A 4MPVA 1MTNC 1ZGIA 2RCEA 4YLUA 2Z6BD 1CGIE 4TYDA 2D26C 1HIAB 2J5UA 1GI4A 2Y81A 4J1YA 3E0NB 1JRTA 1KLIH 1C5VA 3KEEA 2XC4A 4ZHAA 5HYOA 4XE4A 1OKXA 1V2JT 1W8BH 5FX6A 1UK2A 2JETC 1O38A 2Z9LA 3PYHA 1C1PA 2ZFQH 2IOTA 2VIVA 3P70B 3MNXA 1GJCB 1LVOA 2P93A 3TJOA 1HIAA 3SU6A 1OWDA 2CMYA 4X6OA 4X2XA 1EUFA 1SGEE 1Z8JB 1OWEA 1SKYE 4YOGA 2THFB 3SNCA 3B8JA 1J15A 5IK2D 1Z6JH 3BTME 1UTOA 6LPRA 3H7TA 1SGIB 2FM2A 4BAQB 3GDVA 4ZKNU 1KYNA 2WPMS 1PQ7A 3MH6A 1E34B 4D76A 2QXIA 4WWYA 3KQBA 3L6PA 1O33A 5A8YA 1P2QA 3ZZCA 1UTMA 3A80A 7LPRA 4ISHH 2OXSA 2AEIH 3ZZDA 2BDBA 4K8YA 1C5OH 1ZMLA 5DN6D 1BUIA 3F2HA 2SGPE 4AB8A 2VWMA 3PTNA 4E7RG 2A4QA 1TA2A 1ELCA 1NBMD 1DLKB 2ULLA 1DS2E 2EA3A 4AGJA 1J17T 4K1EA 4KTCA 2WPJS 1W12U 3Q76A 2W7UA 3K9XB 4R8TB 1TB6H 1QFKH 1AE8H 5EIYA 1QTFA 5AFZH 1GVZA 4CR9A 3NKKA 1OPHB 1B5GH 5K7RA 3AW0A 1ZTJA 1WV7H 1A7SA 3GDSA 1P3CA 4AFSA 1KXCA 5GJ4B 3SN8A 2BD5A 3ZVGA 3EA8A 3GCNA 1EAWA 2WZQA 2OUAA 1KXBA 1YLDA 1YKTA 3ZYDA 1O2NA 3FFGA 4Y76A 5GWZA 2WSSD 3C1KA 4K69A 1ZRKA 2Z7FE 1C5ZB 1GMCG 4B1TA 1GJ9B 5B6LA 2JH0D 2AH4X 3A86A 2F83A 1Z71A 1O3NA 4HZHA 2Y5GA 1BHXF 2BX3A 1O3FA 5FAHA 3V12A 2UWPA 5HIZA 1HAGE 3E3TA 1C1WH 3GISB 2ZTZA 3CP7A 5FHTA 1C5RA 4ABGA 2AYWA 5F8ZA 1BDAA 1UVSH 1TE0A 1ID5H 4XBBA 1THPB 1LTOA 1XXFA 2QE7D 3GICB 2H6MA 3UUZA 1OP2A 1QRZA 1WDIA 4ABHA 5HIYA 3LJOA 4AFQA 1TX8A 1TPPA 5ESTE 1P05A 1E1QD 2YOLA 1ELTA 1QA0A 1N1LA 2EI8A 3H5CB 3LOXA 1FY3A 2GGVB 2D8WA 3MYWA 4NSVA 3SW2B 3GCHC 4RSPA 3SJ8A 1COWD 1ELVA 2PKAB 3SGBE 3O8RA 2HWLB 1A46H 1C5NH 5EPYA 2VVUA 1NROH 5E0HA 2BHGA 1FY1A 1HJAB 3A87A 4OS4A 4DT4A 1G9IE 1OWJA 1PPCE 4H6SB 1EAIA 5EGMA 1YCPM 3A84A 2I6QA 5I46H 1UK3A 2ZFSA 1CT2E 5CHAC 1EPTC 2PKAA 4IW4E 5CE1A 1C1MA 4U2WA 4YTAA 1HDTH 2ZA5A 4INLA 2XCNA 1PPHE 1AGJA 3E16B 4UDWH 3KQDA 3TH4H 4JYUH 2FX6A 1UK4A 5E0JA 1C9TA 4IGDA 1AB9B 1LDTT 4NA9H 3JZ1B 1ETSH 3EA7A 1SSXA 4B2BA 1EOJA 1O5BB 1GL0E 1G2LA 2Z9KA 2VB0A 5HKKD 1SFQB 5C5NA 2KCAA 1G37A 4BAOB 2GDDA 4LXBH 1C4V2 3UNSA 4HGCA 4VGCB 2QGRA 3ZVCA 3GY8A 4CRCA 1F0TA 3A88A 4ISLA 4UEHH 1U6QA 2BM2A 3ZVFA 3TLOA 2FYRA 1TRYA 5C20A 3M35A 1Z8GA 2W6ID 1RXPA 5LGOA 4BANB 1AWHB 1BA8B 1DXPA 1AQ7A 1YYY1 1EATA 1ELAA 2AFQB 1V2RT 4B2AA 6CHAC 2BDYA 3SUDA 5ABWA 3BG4C 5DP6A 3O8CA 2G00A 2XNDD 3OTPA 3BSQA 3OEED 3WW7A 1GBBA 1OYQA 3F9HA 1ZSKA 2A45B 2AGGX 1FNIA 3P95A 3QLPH 5HMAA 1ESBA 4NZLA 1TQ7B 5GCHF 1BTHH 5C0TA 1QL7A 4K5ZA 3KGPA 4NWKA 1D3TB 1HYLA 3RUOA 1YLNA 1GCTC 2BD9A 5LPFA 1UTLM 4FUIA 1XVOA 5DP7A 2W5EA 1A0HB 4OS7A 2ZFTA 1DY8A 4JCNA 3MH7A 3R0FA 3RU4E 3NK8A 2JJ2D 4IMZA 2BD8A 4WF8A 1CBWC 3ZZ4A 3SNAA 1NS3A 1GBIA 4RKJB 1P2MA 2FS8A 4NCYA 3VG8A 1SQTA 2BB4A 1B7XB 1BQYA 1GBLA 4OS1A 2Q6GA 2BLVA 3OTJE 3SV2H 2PUQH 5A0AE 1WAYB 1ZHRA 2BY6X 6GCHG 3WY8A 1YY3A 1PJPA 1C1QA 1D3PB 1ESTA 5GNDA 2XWAA 1EP5A 4LK4A 2VGCB 4X1NU 2ZGBH 1V2ST 2ZI2H 4F48B 1UTNA 3N7OA 1WU1A 1ABJH 1P9UA 1C5PA 2KCOA 5EW2H 2FOMB 3A8CA 1J14A 1KSNA 3DFLA 2YMSB 1GJ6A 3AW1A 1YPHE 1MKWK 3D23A 3S9CA 5JB9S 1D3DB 2J98A 1H9LB 4Q7ZA 2PKSC 2M5TA 3DD2H 2IJD1 4XDEA 1WBGB 3DSPA 4KP0A 1P0SH 1UCYE 2G5VA 4JZ1A 5EXLA 2GZ7A 2AHME 1QGFA 5DP3A 3PMBB 2BDGA 3EE7A 5A0CA 1KXEA 4WVPE 5A8ZA 1BBRH 1BMLA 1FN6A 1QBNA 1SC8U 3K2UA 4MDSA 1HGTH 2HRVA 1ESAA 1EJAA 4DURA 2CHAC 1P2NA 4YT7H 1ELFA 1LKBA 3CNRA 2SFAA 1O39A 1G3DA 1QJ6B 4Q80A 3ZZ9A 1V2QT 2H1UA 2XBWA 1C4Y2 5GPIB 2BD4A 2WPKS 1A2CH 1AFQB 1FQ3A 1TOMH 2Y6TA 2LNCA 4DJZB 1GI1A 3KQ5A 3RMOH 2Y80A 2TGTA 2PP6A 1QBVH 1EX3A 2ZG0H 2STBE 2G5NA 2K0QA 1TBQH 2BOHB 3QUMP 1SLXB 2RDEA 4ZKRU 3EAJA 3KYGA 8GCHF 1YPMH 4WMDA 1QB9A 3STJA 1IQHA 1O2JA 2ZQ1A 3S69A 1EP6A 3N7EA 5F6MA 1YF4A 2XRCA 2F9NA 2GT8A 1V2MT 2A7HA 4IN2A 1QA7A 3RDZA 3OEHD 4A5TS 1T8OA 3BTTE 1ELDE 1SLWB 3OE7D 3RU4T 1NC6A 1AUTC 3BG8A 2Z3EA 1ETTH 2TGAA 1DSUA 3ATMA 2ZU4A 3SJKA 4I8KA 1C5XB 1ACBE 3TPIZ 4QT8C 3GCTF 1O2YA 1ZMJA 4IC6A 4YXWD 1E79D 4J2YB 4YT6H 1T7CA 3BEUA 3A8DA 1ELGA 2QF4A 4HFPB 3KNXA 3MTYA 2XTTB 4ACAA 2XBYA 2OBOA 2SGDE 2B7DH 4NIYA 1SGFG 1YPKH 3V3MA 1UMAH 1VGCC 2WUBA 2WYGA 5ESBA 5C17A 4H6TA 3U1IB 2F9VA 1QQUA 3M61U 1NZQH 1Z1IA 1VKYA 3H7OA 4GCHF 2DE8A 3TJUA 1C1UH 2P3UB 3MI4A 3MMGA 3A89A 3MNSA 3RM0H 2A2QH 3O8DA 3RXRA 3ZZ5A 1O36A 3M3SA 1ZJDA 3M5OA 3SQEE 3VPKA 4A1TA 1EOLA 3PRBA 2JIZD 1C2GA 2XW9A 1BB0B 3F9EA 3GCOA 2A1DB 1EAUA 2BXTH 1EXFA 2O8UA 4WMFA 3MWIU 1TA6A 3GY6A 1DITH 3LGYA 3RXAA 2KZ4A 5L30H 2IPHA 1K1PA 3D49H 3KHVA 2A5IA 1CE5A 1BTXA 4Y7AA 1MZAA 1AE5A 2OCVB 1DUEA 4MPWA 2K1QA 3HKJB 1O2XA 3ODFA 4UFFH 3TGJE 1E38B 1NFXA 3OY5U 3SGAE 3A7XA 1N6YA 4ZAEA 1V6DA 1O3KA 5KGOA 2NU0E 4JMYA 1LCYA 4DVAU 4YOJA 3A83A 3PB1E 2EI6A 7GCHG 1EJNA 2UUYA 4XSKU 1DPOA 4UFGH 4H42U 1BMAA 1QHRB 2VH6A 2HOBA 1GDQA 1ZHPA 2JH5D 3U8OH 4BAHB 1V2TT 3SU3A 3K6YA 1Y3VA 1SGDE 2P94A 3PRDA 5T6FA 1ELBA 3ZZ6A 1E1RD 1TGTA 3SNBA 2PTNA 2B8OH 4F4OC 2UUKB 2BY7X 2ZPRA 3F9GA 1GGDC 1E0FD 1SHHB 2GCHG 5EJLA 3SUEA 5HXFA 3NWUA 5A8XA 1V2LT 1ZRBA 3ELAH 1CA0B 3UAIC 1A0LA 2ZHWH 1CVWH 5CMXH 2FOAA 5F53A 2KAIB 2ZCLP 2BD2A 1BTYA 1C5LH 3M7UA 5TCCA 1IQJA 1MZDA 2PR3A 4X0WU 2G8TA 5GDSH 4YZUA 3TNTA 1Y5BT 1OHHD 4DGJA 2A5KA 4ABFA 3A7ZA 1HNEE 3MO3A 3BTFE 2OLGA 3LONA 3UWIA 4TWWA 1WTHD 4AG1A 3SU2A 3P8GA 1O5CB 3P6ZB 1NM6A 2JDID 2GMTB 3T28A 1K21H 2PUXB 4CRBA 2BY5X 4TY7A 1O2QA 5F8TA 2KAIA 2GTBA 1W3CA 1GBHA 5EQSA 1C2DA 4MNWA 3BIUH 1PQ8A 2BQ7B 2TGDA 3OX7U 2J97A 5LPEA 1UVUH 1GL1A 2O8LA 2FI5E 2ODYB 2P59A 2ZHQH 2FDAA 3LGVA 3KYFA 3TU7H 5DO4H 1GWAA 3OYPA 4IBLH 4A92A 1V2KT 1IQEA 1EASA 1TNGA 2VWLA 9LPRA 2CF8H 1TMTH 3IWMA 2BOKA 3ESTA 1L1NA 2A7JA 3M7QA 4CH2B 2P8OB 2F9PA 2BVSH 4DT7B 4FU7A 1FZZA 1DM4B 1H4WA 1HBTH 2FP7B 1VCWA 5FXLA 4FU9A 4I31A 5EOKA 3RLYH 5K0HA 1HFDA 2FPZA 3F68H 4FU8A 4YOIA 1QCPA 2R3YA 2ANMH 2UUJB 3AVZA 3F1SB 3LGWA 1ZLRA 1NFYA 1WTGH 5L6NH 1GHWH 2TPIZ 1TGCA 1KLTA 1BCUH 4D9QA 3V0XA 1AWFH 2LELA 2ANWA 2SNWA 5E8EH 1GBMA 4A1VA 2ZQ2A 3GOVB 2VWNA 3SV8A 3I78A 3URCA 3QTVH 1CGHA 1Y3XA 3P92A 1EJMA 1BTPA 1WQSA 1NPMA 1XM1A 3A7WA 3E0PB 3VB3A 1FXYA 2W6JD 5C5OA 1Y8TA 1F0UA 2KM0A 5C3NA 1QRXA 3UOUA 2C93B 2ZPQA 5HM9A 2ZU3A 4DCDA 3AAVA 3FO8D 2VIDA 3P8FA 2BLQA 2XWBI 1GG6B 1MH0A 4XBCA 1NRPH 4K60A 3A8AA 2RDLA 1K9OE 1K1MA 1Q2WA 5EXNA 1GI8B 1NU9A 1ABIH 3T25A 4GPGA 1BRAA 4O3UA 3M36A 1FLEE 4MQAA 1TWXB 3SGQE 2ZO3H 1GBTA 1HCGA 5HGGA 1V2VT 3F2FA 3U8TH 1LHCH 3RXJA 1SFIA 3W95A 1GI0A 2J94A 2BD3A 1K0HA 3RC5A 3VB6A 1TMUH 4NIXA 1MUEB 5HM2A 2GV7A 1O3PB 1EZQA 1GJBB 3HPTB 3PV5A 5E0GA 2OP9A 1LKAA 1D4PB 1VJAU 1YPGH 2GVFA 1AN1E 2IPQX 1BTZA 5H4IB 4D7FA 4MPXA 1AUJA 1O2OA 2ZF0H 3MU8A 1QRWA 5CDFE 1MD7A 2BLOA 3BTQE 1PYTC 4BTTB 3FVFB 1C1OA 2ODPA 1TAWA 1O2GH 3ATLA 1V2WT 1LO6A 3TVJB 2H2ZA 4X1RU 3SBKA 2QY0B 2O8WA 2FO9A 1PPFE 1CA8B 1S0QA 1S6LA 5FPTA 4ZKSU 1ARBA 2VNTA 3RXVA 1FONA 2FTLE 1CSOE 1SGFA 3A7TA 5L2ZH 2GP9B 2HNTE 4X8VH 3RXIA 1SOZA 3RXDA 3T62A 3I77A 5B6OA 4P02A 4CREA 1TNJA 1HAPH 4JYTA 3T5FH 2Q6DA 1ZSJA 3JZ2B 4UD9H 1W11U 3KIDU 1OOKB 2STAE 4B6EA 1XUKA 3ATWA 4I7YH 1A5GH 3DHKH 1GMDG 4ABIA 1KIGH 6ESTA 1TPSA 3ITIA 7KMEH 1MTVA 1SG8B 2NU1E 1G3CA 3ZVBA 3ENSB 4MTBA 2QYIA 1O2SA 1HAHH 2XBVA 1GI7B 1NY22 3RXEA 1RS0A 1OSSA 4TPYA 5DGJA 4YLQH 4NWLA 1GI3A 4ASHA 1V2UT 3GDUA 4D7GA 1O3GA 1FI8A 5T3HA 1QNJA 1P2IA 4BTIB 4CRAA 4DIIH 1SL3A 2G52A 2FI4E 2AMPA 3QGJA 1ZJKA 1O2KA 3SV6A 2XOKD 1C5QA 1O3OA 3GY7A 4XD7D 4LOYH 5SGAE 4AX9H 2OTVA 1RTLA 4I8HA 1HLTH 9ESTA 3UPEA 1J8AA 1YPHC 4FUCA 1HAXB 2ZGCA 8GCHG 1LHGH 2PSYA 1AD8H 5PTPA 4KTUA 1O5FH 5EQRA 1TPAE 4Q2KA 2ZEBA 3TH3H 3A82A 3CENA 3ODDA 3SO3A 3LGUA 2FX4A 2A4GA 4WH6A 3F2GA 1F92A 4CRDA 2B5TB 1AVGH 2BX4A 1TONA 2RA3A 1O3JA 1WUNH 2NWNA 5DPAA 4BNRA 3F6UH 3MU5A 4BTUB 1HAIH 4ABBA 1NT1A 4MG3A 5F03A 2PSXA 2G4UA 1P57B 3GCTG 2R2MB 3SV9A 4FUFA 1G2MA 3GYMA 1YPLH 1RD3B 1QY6A 4Z0KA 1ZGVA 3MO9A 2HGTH 1ANDA 1ZSLA 3P8OA 3BTGE 3Q00A 1C9PA 4MLFB 4ZKOU 1H8HD 3E1XB 1Z1JA 1O2IA 4FETA 2ZCKP 1H9HE 2AMDA 2AMQA 2GD4B 3RXUA 4LZ1H 1GJDB 1QQ4A 3FZDA 1ETRH 1DLEA 3DSOA 4GCHG 3AAUA 1UHBA 2P16A 1UTKA 2GCTB 2ALPA 3K6ZA 4JZEH 1IQKA 3O8BA 2ZFFH 3SI4H 1Z8RA 1K28D 1W13U 1VJ9U 1EFRD 2WHXA 1YCPH 3LPRA 1BBRK 3FN8A 2ZDMA 4ISOA 4F49A 4KELA 3RXMA 2O8MA 5EXMA 3SI3H 5JBAS 1Z8IB 1HJAC 1O2MA 2F9OA 2Q1JA 2BTCE 1CHOF 1NFUA 2GZ9A 5KECA 2BVRH 4FUBA 4JYVH 1PQ5A 1C2EA 3OU0A 4YM9A 2YNAA 2GKVE 4NFFA 2VINA 1EZXC 1Y3YA 4FUEA 1DY9A 4YO9A 1S85A 1Y3WA 5DG6A 3OFND 3EE0B 1AIXH 3SNEA 3ZZ8A 3AK5A 1FPHH 1TOCB 1YPJH 5LH8A 3LGTA 5DP4A 1O2TA 1DSTA 1EAXA 4GAWA 2F9BH 3U8RH 1Y5AT 2AERH 3TK9A 1AKSB 2FLBH 1AB9C 2VIPA 1EZUC 2PLXA 1VCPA 2GT7A 1IQMA 1DICA 2H9TH 4O9VA 5LPRA 1SHYA 4Y8ZA 5F8XA 3ZZBA 3UB0A 2YNBA 2YMSD 3S9BA 3TGIE 4X1SU 1QL9A 4B76A 2GJGA 4GHQA 3SU0A 1SGPE 1SLUB 5EQQA 4CHAB 1A0JA 1UVPA 4NGAH 2R3UA 1LVYA 4VGCC 1BTWA 3LGIA 1GJ8B 1MBQA 4ISIH 3STIA 1L2EA 1AKSA 1OWHA 5J4SA 2ANYA 3PTBA 1C1VH 2J98B 1GVLA 3VB4A 1O3CA 4MNYA 1O0DH 1GHVH 1V2OT 4FOUC 3MFJA 1Y59T 4X2VA 5EODA 3RXTA 1ARCA 1XVMA 1TBRH 2SGFE 2F3CE 3GYLB 3SZEA 3GY2A 1MAXA 3F3BA 3PV4A 4K2YA 4RT0A 1FAXA 3UR9A 5I25A 4Q7YA 1F7ZA 4UFDH 2XXLA 2PWXA 1GBDA 4HG6A 1O3EA 4P00A 1JMOH 5E2OA 1LMWB 2ODQA 3PMJA 3S9AA 1FN8A 3NPSA 3UY9A 3E91A 2O8TA 3D62A 5JBCS 3P17H 1GMCF 4K3JA 1VZQH 2V0BA 1MU8B 5JBTA 1NBME 1LPKB 5AF9H 4O03A 4OGXA 4U32A 1BOQA 2UWLA 3FOAA 5FPYA 3RXHA 4Y11E 5FL7D 1YLCA 2VIQA 5GXPA 1HRTH 1TNLA 2OBQA 4OS6A 3URDA 1S84A 3PV2A 4FVBA 1XMNB 2A32A 1XUJA 2AIQA 4DW2U 1QZ8A 1MABB 4BAKB 1L0ZA 3BF6H 1NN6A 2EC9H 3L3TA 3SHAH 1KLJH 2FTMA 4CRGA 3RMNH 4B73A 4FUJA 1XX9A 4KTSA 1CT0E 1FAKH 1DANH 2O9QA 4OS5A 2FOHA 4ABDA 1SLVB 1Z7KA 4WH8A 3RLWH 3ZZ3A 2XC0A 1RGQA 4B74A 1SI5H 3N99A 2VVVA 1VCQA 1O32A 3SU4A 3U28C 1L4DA 4GSOA 1C2LA 2NU2E 2VGCC 3UWJH 2UUFB 2SNVA 3V13A 2R9PA 4JK5A 2F9UA
chains in the Genus database with same CATH topology
1XUIA 2W26A 4HI3A 1BITA 5DJ7A 4K1TA 1AHTH 3LU9B 3SU5A 4Y10E 1C5MD 3MHWU 2OC1A 3DFJA 1DUAA 1J9CH 4FXGH 1O35A 2Y82A 1GBJA 3ZV8A 2A7CA 1BRUP 1A3EH 1CT4E 3SJOA 4CH8B 1AZZA 1ZR0A 1TX7A 2PTCE 3QGNB 1GBAA 2V3HH 4NSYA 3EDXB 1O2HA 5L2YH 1F0SA 1BTUA 1ZZZA 4XOJA 1SGCA 3LC5A 1A61H 3NXPA 1GBKA 1XUFA 2RA0A 4KGAA 4OGYA 1CHGA 2ALVA 2Q6FA 3VGCB 4AZ2B 5FCKA 5EPNA 1P2KA 1FPCH 1GJAB 2ZTYA 3PO1B 4M7GA 3BTWE 1IAUA 2ZHFH 2LPRA 3T29A 3P8NA 3MNCA 1O34A 2QF0A 3LJJA 2Z3CA 1ZYOA 1SQOA 2J38A 1XUHA 4FUHA 1GI2A 4AFZA 2FEQH 3M37A 1W2KH 1F5RA 1AFQC 2Y7XA 1GCDA 1C5WB 1RIWB 1BZXE 2ZGJA 1JWTA 4TY6A 2W7SA 1C1SA 3TJVA 1TGNA 4CBOA 1FIZA 1ORFA 5BPEA 2FOBA 2R0LA 3RXOA 2ZECA 4AFUA 1O3AA 2GZ8A 2QIQA 4WY3A 1T8NA 2D1JA 1NRSH 2VH0A 1L1JA 3ZYEA 3VEQB 3VXEH 2C8YB 1CU1A 3HK3B 3MU0A 4Y7BA 3S7KB 2XNIA 3GY4A 4FUGA 1JIMA 3TH2H 2TRMA 1DE7H 2ZDKA 1TFXA 1SQAA 4Y71A 1VITH 4JZDH 1O2UA 4OS2A 1OS8A 1SGQE 1UO6A 1O31A 4SGBE 1N8OB 1W7GH 1D9IA 1SR5C 1TABE 1TRMA 1YM0A 2QXJA 5GIBA 1BIOA 2A5AA 2ZZUH 3W94A 2VJ1A 1MTNB 1NESE 2ZP0H 2FODA 4X1QU 2BQ6B 1W10U 1P11E 4ZHMU 1BJUA 1EKBB 1WQVH 3UNQA 1MCVA 1MD8A 3SV7A 1IQIA 1G30B 1F0RA 3FANA 4AN7A 2JETB 3VFEA 1Y3UA 5A0BA 1GMHF 6GCHF 5C1UA 2QF3A 2BY9X 1KXAA 1PPBH 1Z6EA 4D8NA 1C1NA 1YPEH 3KCGH 2UWOA 3SQHE 4NA8A 1IQLA 3UR6A 1S0RA 2JKHA 2HPPH 2VIOA 2G55A 4I8JA 3I29A 1MU6B 3A7YA 1QIXB 1PYTD 3T27A 2A31A 2ZCHP 5DKMA 4NFEA 2ZPSA 1GHBF 1AI8H 1BJVA 2BZ6H 4IMQA 1C2FA 1GI9B 1EB2A 2GDEH 3IITA 4ZHLU 2OC7A 1MKXH 2Z9JA 2G4TA 5FBEA 1AFEH 2AS9A 1NO9H 1TYNA 2ILNA 1FDPA 3QZQA 1GBCA 2QC2A 3LIWA 3MH5A 3RC4A 4I32A 2EEKA 2ZHDA 2OD3B 1GJ7B 1MTUA 3RXLA 4X1PU 5FCRA 3HK6B 2ZNKH 1GPZA 3RU4D 1VITF 2XBXA 3A7VA 2BVXH 2G51A 5C67A 1GDUA 1CA0C 2Z9GA 2P3FH 3RXFA 3FP8E 4ABAA 1UCYH 4NIWA 1K1LA 4X2YA 1GJ4H 4GLYA 4ZUHA 2VWOA 3SHCH 1CQQA 1OXGA 3UREA 1CHOG 3BIVH 4I8GA 2GMTC 1INCA 1BT7A 4AOQA 3UQOA 1H8DH 4THNH 3TGKE 3PWBA 5GCHG 1BRBE 2BDIA 3BTKE 3NZIA 1GHXH 4NIVA 4MNXA 1LVMA 3ATIA 4WXVA 1O3LA 2ASUB 1C1TA 4FUDA 1MTWA 3CS0A 4H4FA 1F5KU 2ZU5A 4I8LA 1QR3E 3SORA 4CR5A 1D6RA 8LPRA 2PW8H 3TK5A 1OX1A 3BTHE 1O3BA 1GBFA 1DX5M 2Z9IA 3LC3A 2D2DA 3RMLH 1SGYE 1IHTH 3LT3A 3Q3YA 4K8BA 1Y5UT 2ZIQH 1A5IA 4HTCH 2P8OC 2QA9E 1T31A 2Y5FA 1HAYB 4RKOB 3E90B 1YBWA 1P10A 1PPEE 5DP9A 4O97A 4D9RA 2FOFA 4JZFH 4Y6DA 3KQEA 1GHYH 3C27B 5TCAA 2V6NA 3HATH 1FIWA 2R0KA 3GY3A 2AGEX 1K2I1 1HAOH 1TALA 1DOJA 3GCHB 2HPQH 3TNSA 1ANEA 1TBZH 2DE9A 3F9FA 1RTKA 3UIRA 1C1RA 5JDUB 2C8XB 3ATKA 2G81E 1O5GH 1S5SA 3L33A 3DT0H 1BBRE 2WUCA 4UE7H 3ZV9A 1C5UA 4B2CA 5AHGH 1MTSA 1W0ZU 3Q3XA 2QAAA 1SVPA 5CHAB 1FY4A 1EPTB 2QCYA 1GG6C 2HLCA 1HUTH 1JXPA 1C2MA 1SBWA 3ZVEA 2PHBA 1EQ9A 1BHXB 3SU1A 1W0YH 4K1SA 4NA7A 1YCPK 2Y5HA 3BV9B 3PWCA 2ANKH 4CBNA 1T8MA 1UTPA 1OWIA 3A81A 3FP7E 1IHSH 7GCHF 1DFPA 2A4OA 2H9EH 1EPTA 1NTPA 3D65E 2ZU1A 1LQEA 1JBUH 2ZTXA 1S6FA 1ANCA 3KF2A 4ZMAH 1TRNA 1C5TA 1EZSC 5IDKA 1FJSA 1O5AB 2CF9H 2OQ5A 2VU8E 3FAOA 5T6GA 3S7HB 4U01A 5JPMH 2GCHF 1G32B 1TNKA 2GV6A 1ANBA 1A5HA 5BRRE 1H1BA 1K1NA 4AB9A 2PGBB 3UFAA 2FIRH 1T8LA 6CHAB 1PPGE 4IN1A 1GHAF 1HAVB 1KY9A 3KN2A 1RTFB 1L1GA 3BG4B 1SGRE 2BY8X 1O2WA 1DWCH 1C2KA 4AORA 2ZGHA 1TGBA 2BMGB 1NRQH 1UVOA 3NUMA 3QTOH 3A85A 1E36B 1UHBB 3SJ9A 3PMHB 3B23B 4X8UH 1GDNA 1J16A 3E8LA 3RM2H 4ESTE 3MU1A 1HAVA 1DWBH 2ZC9H 5JBBS 1C5SA 1GCTB 2H5DA 1OP0A 3EYDA 2QXGA 1OYTH 5FBIA 3TK6A 5C2ZA 4A1XA 3OY6U 3RC6A 1AMHA 1CBWB 1O2ZA 2C8WB 1WOFA 1GVKB 1FMGA 1DVAH 1O3MA 1P09A 1SPJA 4IS5A 2FOCA 1H9IE 2FWWA 1G3EA 3RXBA 2PGQB 1KTSB 1ZPBA 2BDAA 2GX4A 2ZFRH 3SJIA 2ZDAH 2ZU2A 4X6MA 1OWKA 3RP2A 3G01A 2EI7A 2J92A 4A7IB 5DK1A 1K1OA 3AASA 3Q3KA 1W14U 1P8VC 3NCLA 1BRCE 4ZROA 5DP8A 4BOHA 5DP5A 1MCTA 1P01A 3K65B 1XKBC 3RMMH 3BEIB 1UTQA 3MOCA 5A09A 1O2PA 3T26A 2Y7ZA 1IQGA 3FZZA 4AYVB 1K1IA 2C8ZB 4ZH8A 1SGTA 1LHEH 1KTTB 1NRRH 4AG2A 1O3IA 1HJ9A 2PKSB 2RG3A 2TBSA 1A3BH 1V2NT 3VXFH 2FESH 4ZXYH 1DT2A 1N6XA 4TWYA 3QX5H 4AGKA 1S83A 3GY5A 3MO6A 3T2NA 2IN2A 5T6DA 3QO6A 1LHDH 3LKWA 1P2OA 2CN0H 4ABEA 1ELEE 1MQ5A 1JRSA 1TGSZ 4Y8YA 3KQCA 2CHAB 5EG4A 2C90B 2BYAX 1HV7A 2P3TB 2TGPZ 2GCTC 1S82A 3EGKH 1C2HA 3U9AH 4X2WA 3UNRA 1H8IH 2WYJA 3SZNA 3RXQA 4UONA 4A6LA 1FY5A 4CRFA 1GMHG 1MMJN 1K22H 4JZIA 1IOEA 4GHTA 3QK1A 1ZMNA 1S81A 4X6NA 2OQUA 4FVDA 2BDCA 2FZZA 3DUXH 2J2UA 3V7TA 3TITA 5TJXA 2QV1A 3M5LA 1ZTKA 8KME2 4DOQA 3EQ0H 2FYQA 3MU4A 1GHZA 2JH6D 1SGNE 2CJIA 2FXRA 4MPUA 1O2RA 2BXUH 2V35A 1FUJA 1C2IA 1D6WA 1GHBG 4PROA 3B9FH 2XC5A 3ZZAA 4B75A 5ETXA 3E6PH 2NU3E 1ZOMA 1EB1H 1MQ6A 1TX6A 1O3HA 1QB1A 1XKAC 2B0FA 2TIOA 2VVCA 2W3IA 3IG6B 1M9UA 1W7XH 1S6HA 3HGPA 4GUXA 2BLWA 1O2VA 4Y8XA 2WV5A 2WPIS 3QN7A 1QBOA 2FS9A 1AY6H 1MAYA 3S0NA 3PLPA 5E2PA 4JK6A 3PROA 1O2LA 1DXWA 1GMDF 2BDHA 3LH1A 2ESTE 4Z6AH 1ZPCA 1HJ8A 4R0IA 3PLKA 4CHAC 4ABJA 1K1JA 1VGCB 1YC0A 1P3EA 1VITG 4WXIA 3U1JB 1XXDA 2ZFPH 5C1YA 4DG4A 1LPZB 2OINA 2H5CA 3PM3A 2J95A 4AYYB 3VB5A 8ESTE 2WV4A 2SGQE 4WMEA 1GI6A 1P03A 2FMJA 7ESTE 4NG9H 1O37A 5IYTA 1FV9A 1KDQB 5G4BA 1AZ8A 1GBEA 5EW1H 4XFQA 3RXCA 1V3XA 1YP9A 3RXPA 2B9LA 4X8SH 2W3KA 1THSH 2Z3DA 4TPIZ 2R2WU 1QL8A 1MBMA 1O5EH 1ZHMA 5FX5A 4ISNA 1E35B 1TPOA 3U69H 2HVXA 1PPZA 3LH3A 1CGJE 1THRH 2QXHA 1PFXC 2C3SA 2V3OH 4GVUA 1LVBA 1P04A 2SGEE 3UOPA 3OSYA 1TMBH 1P9SA 5JB8S 1CO7E 1KDQA 1O3DA 2FOEA 5AFYH 4MNVA 4INHA 3ZVDA 1P06A 1P12E 1RRKA 3LDXH 1LPGB 5AVDA 4O3TA 1PQAA 1P02A 3SNDA 3QZRA 1DWEH 4X8TH 2BQWB 2A2XH 1GI5A 1D3QB 2ZDNA 4BXWA 3RXSA 1T4VH 1DDJA 1RFNA 1G3BA 3M7TA 2J9NA 4X6PA 1TNIA 2CXVA 1BMNH 2OC0A 1KXDA 1GGDB 2WPLS 5JYIA 3UQVA 2WPHS 3BEFB 4U30A 3MNBA 1QJ1B 2CV3A 4E06H 1MKWH 1X7AC 1MKXK 1SOTA 2ZHEH 4INKA 1HB0B 2ZKSA 1OP8A 4IC5A 2FI3E 4RN6A 2HNTF 2FLRH 3A8BA 2NU4E 1L4ZA 1HXFH 1V2PT 4KKDA 2PFEA 1O30A 4DY7B 2VIWA 1AO5A 2A4RA 3M5MA 3KL6A 5J4QA 4BAMB 2Z94A 1F2SE 4XBDA 4SGAE 1G36A 2I6SA 4Y0ZE 1VR1H 1P2JA 2WINI 3M3TA 3M3VA 1RJXB 1UCYK 1UVTH 4DIHH 5EU8A 1YGCH 1QB6A 5A2MH 1LHFH 1HXEH 1XUGA 1AVXA 3TJNA 5FPSA 3ZZ7A 1T32A 3SUFA 1UTJA 3VGCC 2XCFA 3Q77A 1O5DH 1NRNH 3MH4A 3PO1C 1JOUB 3BN9A 3VB7A 1C4U2 2H9HA 4UFEH 3BTEE 1AVWA 4LZ4B 3R3GB 2ZGXH 1QURH 4B71A 1BMMH 1HPGA 4I33A 2A0QB 1NFWA 2J4IA 1JIRA 1IQFA 3CS7A 1HAZB 2BZAA 1ZTLA 1IQNA 1RIWC 4MVNA 2FOGA 1C2JA 1KXFA 2HNTC 3U98H 1Q3XA 3ZVAA 3PMAB 2QN5T 2ZWLH 3RXKA 3HGNA 1GJ5H 1GHAG 1B0EA 3SUGA 2DUCA 2HALA 1SB1H 1WSSH 2J34A 4NZQA 4Y0YE 3RXGA 4BXSA 1TQ0B 1FY8E 3QWCH 2XYAA 1TIOA 3SOSA 3UTUH 1WYKA 2AGIX 1UJ1A 2PV9B 2BD7A 4Q7XA 4YESB 3BTDE 3M5NA 1E37B 3QDZB 3PLBA 1SMFE 3DA9B 3FP6E 2CGAA 1TLDA 2F91A 1A4WH 1ZPZA 1A1RA 2IJOB 3EA9A 1TNHA 1DWDH 1F5LA 4Y79A 1NU7B 5C1XA 4E7NA 1LQDB 3HKIB 1N8OC 4ZXXH 1QJ7B 4WJG2 3TIUA 1AU8A 1C5YB 2ZDVH 2AIPA 1T4UH 2SGAA 1WCZA 4E05H 2ZDLA 1B0FA 1Q31A 2C4FH 2P95A 2OC8A 4MPVA 1MTNC 1ZGIA 2RCEA 4YLUA 2Z6BD 1CGIE 4TYDA 2D26C 1HIAB 1GI4A 2Y81A 4J1YA 3E0NB 1JRTA 1KLIH 1C5VA 3KEEA 2XC4A 4ZHAA 5HYOA 4XE4A 1OKXA 1V2JT 1W8BH 5FX6A 1UK2A 2JETC 1O38A 2Z9LA 3PYHA 1C1PA 2ZFQH 2IOTA 2VIVA 3P70B 3MNXA 1GJCB 1LVOA 2P93A 3TJOA 1HIAA 3SU6A 1OWDA 2CMYA 4X6OA 4X2XA 1EUFA 1SGEE 1Z8JB 1OWEA 4YOGA 2THFB 3SNCA 3B8JA 1J15A 1Z6JH 3BTME 1UTOA 6LPRA 3H7TA 1SGIB 2FM2A 4BAQB 3GDVA 4ZKNU 1KYNA 2WPMS 1PQ7A 3MH6A 1E34B 4D76A 2QXIA 4WWYA 3KQBA 3L6PA 1O33A 5A8YA 1P2QA 3ZZCA 1UTMA 3A80A 7LPRA 4ISHH 2OXSA 2AEIH 3ZZDA 2BDBA 4K8YA 1C5OH 1ZMLA 1BUIA 2SGPE 4AB8A 2VWMA 3PTNA 4E7RG 2A4QA 1TA2A 1ELCA 1DLKB 2ULLA 1DS2E 2EA3A 4AGJA 1J17T 4K1EA 4KTCA 2WPJS 1W12U 3Q76A 2W7UA 3K9XB 4R8TB 1TB6H 1QFKH 1AE8H 1QTFA 5AFZH 1GVZA 4CR9A 3NKKA 1OPHB 1B5GH 5K7RA 3AW0A 1ZTJA 1WV7H 1A7SA 3GDSA 1P3CA 4AFSA 1KXCA 5GJ4B 3SN8A 2BD5A 3ZVGA 3EA8A 3GCNA 1EAWA 2OUAA 1KXBA 1YLDA 1YKTA 3ZYDA 1O2NA 3FFGA 4Y76A 5GWZA 3C1KA 4K69A 1ZRKA 2Z7FE 1C5ZB 1GMCG 4B1TA 1GJ9B 2JH0D 2AH4X 3A86A 2F83A 1Z71A 1O3NA 4HZHA 2Y5GA 1BHXF 2BX3A 1O3FA 5FAHA 3V12A 2UWPA 1HAGE 3E3TA 1C1WH 3GISB 2ZTZA 3CP7A 5FHTA 1C5RA 4ABGA 2AYWA 5F8ZA 1BDAA 1UVSH 1TE0A 1ID5H 4XBBA 1THPB 1LTOA 1XXFA 3GICB 2H6MA 3UUZA 1OP2A 1QRZA 4ABHA 3LJOA 4AFQA