4AFZA

Human chymase - fynomer complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
226
structure length
224
Chain Sequence
b'IIGGTECKPHSRPYMAYLEIVTGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMASE
publication title Generation, Characterization and Structural Data of Chymase Binding Proteins Based on the Human Fyn Kinase SH3 Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 51
structure length 224
sequence length 226
chains with identical sequence B
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4afzA02
1SSXA 2G52A 3GCTF 4Z6AH 2HWLB 3A7XA 1AD8H 2WPMS 3P92A 1DWDH 3HGNA 2HLCA 1TLDA 2UWLA 2GMTC 1P01A 4MPXA 1FIWA 6GCHG 3VGCB 4YLUA 1EZUC 3GCNA 1UTOA 3A89A 8ESTE 1ANEA 3UNRA 4UFEH 1LVBA 1GPZA 2C3SA 2QAAA 5IYTA 4BXSA 1K1MA 2VJ1A 1AU8A 5L2YH 2ZHWH 1D3DB 3RXOA 1DOJA 5T3HA 1UVOA 4OGXA 2ZI2H 2Y81A 5E8EH 1ABIH 3PYHA 1OXGA 2ANKH 2GZ7A 4MNVA 2STBE 1XM1A 2XBVA 2J94A 5EXMA 4CRBA 1QY6A 2V6NA 4ZHMU 3RC6A 2VIQA 1DX5M 2ZKSA 1TABE 1NFYA 4JMYA 5AVDA 3UREA 4JK6A 1MQ6A 4B71A 1V3XA 1K2I1 5EODA 1ZGVA 1FAXA 3TGIE 4MDSA 1OX1A 1P3EA 2J2UA 1O3EA 1WQSA 1YCPK 5HYOA 1KXCA 5EU8A 1WSSH 5DP7A 1MH0A 4FUJA 1QTFA 3RC4A 2FDAA 4B2BA 3LONA 1A0LA 1DWCH 2FOFA 2ZU4A 5JBBS 4LZ1H 3O8DA 2BY5X 3M3SA 1UTJA 5EGMA 1O5CB 3AASA 5DP3A 1PFXC 2ZPSA 5GCHG 3DHKH 1L1NA 5ESTE 1F2SE 4K1EA 1AVGH 4AFUA 2BLWA 1BTUA 3MU8A 2G51A 3EQ0H 4AYYB 2BZAA 3M35A 1HDTH 1ZTKA 1YPJH 2QF3A 4XBBA 5E2PA 2YNAA 2XBWA 2BY8X 3SJKA 3UPEA 2ASUB 3A7WA 5HXFA 3AW0A 3RU4D 1MKWK 3MH4A 2VVUA 1GBHA 3LOXA 1P8VC 2Y5HA 4MLFB 4NGAH 3BTEE 3ATKA 1W13U 1AB9B 1FLEE 4Y0YE 2ANMH 3UQOA 2XC0A 1AIXH 1O31A 1GJ9B 1W7XH 2D26C 3SJ9A 3K2UA 3RXSA 2AMPA 4KKDA 4MPWA 1XUJA 1JRTA 5DJ7A 4LOYH 1SOZA 4A1TA 4B76A 3KQDA 1T4UH 3M5NA 1LVMA 4GUXA 2C8ZB 2BD8A 1OSSA 3LPRA 3TNSA 5K0HA 1V2WT 1UHBB 1ETTH 1D3TB 1S0RA 3PLBA 1ZRBA 1XVOA 5LGOA 1O2HA 1GHWH 2C8XB 3MO6A 2C90B 1MBMA 3P8NA 4ISLA 3T62A 3IITA 3SNBA 3A86A 1W0ZU 2AS9A 1O3AA 4X2WA 3BSQA 1ELEE 3VB5A 1C5RA 1DM4B 1HIAB 1TGTA 2FOGA 1ZSKA 4D8NA 4U30A 1HJ8A 2Z9JA 1PPGE 4JYTA 1FMGA 1C2EA 1HAZB 1TQ7B 1O3DA 4WWYA 2BY9X 4U2WA 5A2MH 3ZVCA 2BD5A 2XCNA 2R3UA 2ZEBA 2J38A 2ZGXH 1YGCH 3URDA 6GCHF 1SI5H 1BMLA 3SBKA 1M9UA 2I6QA 2BD2A 1J9CH 1A0HB 1GBIA 1EKBB 5AFYH 1T8LA 4ZH8A 4YT7H 4FUHA 4ZHLU 1V2PT 3LGYA 3SO3A 1GHXH 1CSOE 1O2TA 4Y11E 3UR6A 4OS6A 1NU9A 2G4UA 2FEQH 3B23B 4CRDA 4Y8YA 1BITA 4I8KA 1TNGA 3GY6A 3LKWA 1QRXA 3RU4E 2CN0H 2ZCLP 1PPFE 4ABBA 4K1TA 1ANBA 4TWYA 1Y3XA 4MQAA 3A8DA 1CA0B 4IS5A 1F0RA 1RTLA 3A85A 2ZGHA 3AAVA 1A61H 1JWTA 1AFQC 1MAXA 1YLDA 1G30B 2ZF0H 4E7NA 3ZZ3A 2FI3E 4DIHH 1EAXA 3SU2A 1A7SA 3QTOH 4AB9A 1W8BH 1IQJA 2WV5A 4K1SA 2J34A 1SQTA 2VIVA 1G3EA 2OQ5A 1YCPM 4DOQA 5GCHF 1P2QA 4X1PU 3VB3A 1K21H 1IHSH 1PPBH 2P8OB 4MPVA 4AB8A 1H9LB 2AIQA 3UNQA 3GY4A 2STAE 1LHGH 1O2RA 1FY8E 4GHTA 1LDTT 3UNSA 1QB6A 2QY0B 2TIOA 1C9PA 5SGAE 2Q6FA 3E91A 4ISHH 4WXIA 1GL0E 2OBOA 1MD8A 3ZVEA 1HAHH 2ULLA 1O2SA 3K6YA 1GDQA 4Y6DA 2ZC9H 3T2NA 3SUEA 2V35A 1AZ8A 4NZQA 3SGBE 3U9AH 3ZVAA 2AIPA 3A84A 1GDNA 1BBRH 1U6QA 3GDVA 3MMGA 4D76A 2VWLA 4ZMAH 1TB6H 1V2KT 2Z9IA 1AY6H 5FHTA 5J4SA 1H8IH 4ZXYH 2A7CA 2ANWA 1G32B 3TLOA 1MTNC 1C1MA 4CRGA 5FPTA 4JYVH 1D6WA 3RXCA 5E0GA 2FI4E 1SGTA 2C4FH 2ESTE 4GVUA 2XW9A 4XSKU 2FMJA 1UTPA 3M7UA 1YYY1 3BTTE 1W14U 1GHBF 5C1YA 1GJ8B 2WPKS 2WYJA 4OGYA 4RN6A 4X6PA 4E7RG 2BXUH 3FANA 4NCYA 1TPPA 3ZVFA 2GVFA 1P04A 2A4QA 3A7YA 3EDXB 1IQFA 3B8JA 1GI8B 4JK5A 5BPEA 3UQVA 2A5AA 3W94A 1T32A 4AFZA 3SORA 2KAIA 3Q00A 1ANCA 3LH1A 2QIQA 2SGQE 4BTTB 4Y0ZE 1MD7A 5FX6A 3P17H 1C5SA 2CHAC 5E0HA 3U1IB 3E90B 1OWKA 4SGAE 2OBQA 2ZZUH 4MVNA 1LTOA 5FCRA 2SFAA 3W95A 1S84A 2G5VA 3BG4C 1O2ZA 1HAOH 3TVJB 2ZO3H 1GI6A 3PB1E 1F5LA 4OS5A 1A4WH 1V2RT 4J1YA 2IPHA 4MTBA 3LT3A 3K65B 1BRCE 1GHZA 1E0FD 1CO7E 2SGPE 1AVWA 2GCTC 1UHBA 1XKBC 2UWPA 4WH6A 1F0SA 2W7UA 1B0EA 3KCGH 4IC5A 1Z7KA 1C1WH 2O8WA 1SLUB 5IDKA 1AVXA 2EI8A 3GICB 3DUXH 3P70B 4WMFA 4B75A 1TNIA 4FUEA 2ODPA 1EUFA 2OC7A 4IMZA 1QR3E 1C5OH 4I31A 4NA9H 2Y5FA 2R2WU 1O0DH 2BVSH 5DO4H 2VIDA 4GPGA 3LC3A 5JDUB 3S7KB 5HM9A 2C8YB 3BN9A 2BHGA 4KP0A 1MU8B 5T6FA 5LPRA 3OYPA 2A45B 4ESTE 1TX7A 1C1SA 7GCHG 2FP7B 1V2MT 1MKXK 4OS2A 3VFEA 3H7TA 3PWCA 1HXFH 2DE9A 1TA6A 3Q3YA 1DVAH 3GCOA 5FXLA 1T7CA 2ZP0H 1F0TA 2GDDA 4NWKA 1N8OC 4NA7A 3BEFB 1LPZB 3HKJB 3D62A 4YO9A 3TH4H 1GMHG 3SU6A 3P8GA 1S82A 2FM2A 4BAMB 3AAUA 3KEEA 4BANB 4ABDA 4A1XA 1GJDB 4DW2U 3R3GB 1WUNH 1AZZA 3VXFH 2XYAA 4WXVA 3PMHB 1A1RA 4NFFA 4NSYA 5L30H 1PYTD 3MFJA 1YP9A 2IJOB 4CH8B 4DVAU 5DPAA 3Q77A 1LKAA 1W12U 3SW2B 1C1PA 1G9IE 2O8MA 1QBVH 2R9PA 3GY5A 2A4RA 3A7ZA 1BMAA 1BJVA 2OLGA 1TRNA 5A09A 3NCLA 1SGYE 1B5GH 2FLBH 4YM9A 3F9FA 3ZZ9A 4JZFH 1EOLA 5DGJA 1O2JA 2JH5D 4UFFH 3SU1A 2A4OA 4NWLA 5A0BA 4GLYA 4TY6A 2A5KA 1SLXB 5T6GA 1RTFB 2OQUA 2A32A 3BEUA 4X2YA 1CBWC 7LPRA 4B2AA 1V2NT 3L3TA 1V2QT 3ODDA 1K28D 5HM2A 1T31A 1SB1H 2RA0A 1IQHA 1TX6A 3SNCA 3PLKA 1MCTA 4ABHA 3U8OH 1UVSH 2VH0A 3TGJE 2P95A 2WPLS 2Y80A 2B9LA 4WY3A 1CU1A 1K9OE 1S0QA 1BHXB 1IQKA 3BV9B 4O9VA 1L4ZA 1K1OA 1LO6A 2IOTA 1LPKB 2FPZA 2OCVB 4YESB 5FPSA 3UFAA 1TMTH 4I8HA 1NRQH 1O2QA 1RIWC 2BM2A 5DP9A 2XWAA 1HBTH 5C67A 3RC5A 3V12A 3GCHC 1DS2E 3P95A 4FU9A 1HAVB 4MG3A 1QL9A 8GCHG 1EASA 3UOUA 1TPSA 2LPRA 1TFXA 4AGKA 4GHQA 1FI8A 3AW1A 4J2YB 5DKMA 1LQEA 3E6PH 4Y7BA 2ZCHP 4CH2B 2A4GA 3SV7A 1TRYA 4K60A 1JRSA 4NZLA 1QHRB 4X2VA 2BY6X 1SL3A 2ZCKP 1FY5A 2VVCA 3MU0A 1CA8B 1GBEA 3RMLH 4R8TB 3SU0A 3V0XA 4A92A 1C5NH 1TPAE 4AX9H 1CQQA 1C1RA 1UCYE 1P2OA 4CRCA 2BVXH 3VB6A 2BX3A 1PPHE 2PKAA 2PTNA 1TGNA 1G2MA 1G37A 3RUOA 5EG4A 4D7FA 1WAYB 2F91A 1AKSB 1DFPA 1GG6B 4UD9H 2WPHS 5GJ4B 3KF2A 1NN6A 1TNHA 3E0NB 1ELTA 1WOFA 5EPNA 2ZFFH 1GMHF 1TONA 2PHBA 1C1QA 4O3UA 4IN2A 5FCKA 1O2UA 2BQ7B 1TGSZ 1NROH 2TPIZ 3RXKA 4YTAA 4CBNA 4ISOA 4AFQA 1C2JA 3HATH 1GBMA 1FXYA 1V2TT 1NO9H 2H2ZA 1A46H 1VCQA 5FAHA 2FWWA 2A7HA 1SGDE 5C3NA 3TITA 4F4OC 4FUIA 3I77A 1HLTH 1IOEA 6LPRA 3LGWA 1YCPH 3ELAH 3MTYA 3E16B 2W7SA 5FBEA 1SGFG 3QZRA 1X7AC 3U1JB 2SGEE 3A7VA 2ZA5A 1YPMH 1OS8A 1YPEH 1HAIH 3TJVA 1T8NA 2ZDAH 1EPTA 1HAGE 3A8BA 3M7QA 4H6TA 3OX7U 1AMHA 3FVFB 1O2WA 1FQ3A 3ZYDA 1HAPH 3MH5A 2H9EH 9LPRA 1VR1H 1BOQA 2G4TA 3RLYH 2PLXA 2GGVB 1A5GH 4X1RU 1GI1A 1H4WA 1KLJH 1H9HE 3T5FH 1SGRE 2D8WA 3ZZ4A 3HPTB 3PM3A 4BXWA 4AG2A 2QYIA 5DP8A 4LK4A 3M37A 4X2XA 1SGNE 2A1DB 3ESTA 1QBOA 1BTXA 3MNCA 2BDBA 4KTUA 2M5TA 2ZU1A 1GMDG 2NU3E 1TOCB 2NU4E 2ZTZA 5T6DA 2Z3DA 3T28A 3BIUH 4XBCA 1MTVA 3LC5A 2ANYA 3RXLA 4X8UH 1IAUA 2Y82A 4MNXA 2H5CA 1P57B 4MNYA 3LH3A 2ZHDA 4BTIB 3ATMA 1C5TA 1SHYA 3FP7E 3BTME 1VJAU 2GD4B 2CV3A 4AGJA 4UEHH 1KTTB 1B0FA 2CF8H 3ZZDA 1P9SA 5LPEA 2BDCA 1A2CH 1TBQH 3Q3KA 3JZ1B 5JYIA 4X6NA 1Z8IB 1DDJA 3A83A 2HVXA 2ZDNA 1FONA 1VJ9U 3EA7A 3MHWU 3Q76A 3S9CA 2ZHFH 1BRBE 2W3IA 4ZUHA 1SFIA 2BB4A 1VITF 1K1PA 1SQOA 5GXPA 2JH0D 2ZPRA 4H6SB 1GJ4H 3QUMP 1ELVA 1P02A 1LHDH 1K1NA 2J95A 1THPB 1UJ1A 1PJPA 1O3MA 1GDUA 1FDPA 1NPMA 3FAOA 2ALPA 3UOPA 2WPIS 4IBLH 1DUEA 2BTCE 5GDSH 1O2XA 1C1VH 2AMDA 2Z9LA 3A81A 3ZZ8A 4FUFA 1FV9A 1DICA 1O5EH 1DXPA 1FPCH 1CT4E 1UMAH 1AB9C 1C1NA 2VIWA 3CS0A 1GI3A 2FOHA 2QF0A 1DY9A 1ELFA 5C5NA 1B7XB 3GISB 3FFGA 1C5YB 2JETC 2HRVA 2SGDE 3UWIA 1KLTA 1THRH 2ZQ2A 1ABJH 1P2IA 5GPIB 1VGCB 1S5SA 2FI5E 4GSOA 1Y3WA 1C2GA 1NRSH 1NT1A 2SGFE 3H7OA 2GT7A 1EJNA 3LJJA 1XXFA 1SGPE 2P59A 1WV7H 3S9AA 1ZJDA 2PW8H 3BTDE 3O8CA 1ELGA 1F92A 2AGIX 3G01A 1C5MD 4O97A 3L33A 4ZROA 1GJ7B 3BTFE 2XC4A 3MI4A 4HFPB 4K2YA 1Z8RA 5I25A 1AN1E 1GVKB 1BCUH 2ZWLH 1QJ1B 4B2CA 1K1JA 2VGCC 4LZ4B 1GCDA 3JZ2B 4I8JA 2AEIH 1BMMH 4I8LA 2FIRH 1UK4A 1O2OA 4NIVA 3GYLB 6ESTA 3KQBA 3ZZBA 1ELAA 1OP8A 2WUBA 1H1BA 1MTNB 2R2MB 3GY8A 3ZVBA 1LHEH 4Q80A 1EAUA 3NWUA 4ZXXH 1P3CA 4BOHA 1O2KA 3RM0H 2FESH 5G4BA 3O8BA 5EQSA 5AF9H 4CRFA 1AUTC 5A0CA 1BZXE 2HGTH 2JKHA 3D49H 4X8SH 2VB0A 2Y6TA 1O33A 1O36A 1ZSJA 1BTWA 1GMDF 1UK2A 2O8LA 3ITIA 4XBDA 1ZHRA 4I32A 4NA8A 1MMJN 1OP0A 1LVYA 1XXDA 5PTPA 3SJOA 4UFDH 3OY5U 2FS8A 1L1JA 1V2OT 2A7JA 1O3FA 1AWFH 2Q6GA 1C2HA 2ZPQA 1HYLA 2FOBA 2V3HH 1PQ5A 4ABJA 4AYVB 3HGPA 5TCCA 5FX5A 1O3HA 4KGAA 4X0WU 2NU0E 1FIZA 3NXPA 1A5HA 3I78A 2BY7X 5DK1A 1O37A 1DUAA 1ZOMA 3FP8E 4XE4A 1RFNA 1C1TA 1H8DH 1SGCA 2XRCA 2FOMB 4MPUA 4FXGH 3P8FA 1BBRK 1FJSA 2OC1A 3BG4B 3KNXA 1E34B 2VWMA 2A5IA 4VGCC 3EA8A 1PPEE 1ZJKA 2YOLA 4INKA 4O03A 5B6OA 1UTMA 2LNCA 1O3GA 1C5WB 5LH8A 1O39A 4XDEA 4ZKNU 2Z3CA 1TMBH 1C2DA 1O34A 3DT0H 2BDIA 2UWOA 3UY9A 2F3CE 1O3LA 1C5PA 3RXUA 1FY3A 2BQ6B 2QV1A 3IG6B 3QDZB 1GJBB 2BDAA 5H4IB 4DT7B 5C1XA 3S7HB 3GOVB 2PWXA 1KYNA 1Y5AT 1YKTA 4IW4E 1SR5C 2TGPZ 1XUKA 4K69A 3TK9A 4PROA 1KDQB 2GCHG 3U8TH 4UE7H 1P09A 1ZMJA 2UUKB 1SGEE 2P3UB 1HJ9A 3BF6H 4X1QU 2F9UA 1C4V2 3SNAA 3LGVA 1L4DA 3ODFA 1TX8A 4JCNA 4CBOA 4FUGA 3RLWH 2H1UA 4KTSA 5F8XA 1F0UA 1N8OB 1AO5A 1ELCA 1YLCA 4XOJA 1ZGIA 2FODA 1WCZA 1OYQA 1O3PB 4Z0KA 3FZDA 1Y3VA 1ARBA 3QO6A 1PQ7A 1RXPA 3CENA 1ZLRA 3TH3H 3F68H 3GY3A 2NU1E 3FZZA 4YLQH 3NKKA 4ISNA 1T4VH 2ZG0H 1ZPZA 4NFEA 1CVWH 1GBAA 1UVTH 2Y7ZA 3TIUA 5GWZA 3QLPH 1ID5H 1O5BB 3QX5H 1HIAA 1BIOA 2D1JA 2DUCA 3RU4T 1BTYA 1L2EA 2FTMA 2GV6A 1O32A 4Y76A 3MWIU 1C5LH 3CP7A 1LVOA 1J15A 1IHTH 4INLA 2OD3B 5DP6A 5E0JA 3TK6A 3TJNA 1HJAB 3HK6B 1GI9B 3T25A 1XX9A 4AOQA 1QA0A 3OY6U 1NC6A 4TY7A 4NIWA 1K1IA 3KN2A 4UONA 1S81A 4ABFA 3VB4A 1O5FH 1O3NA 5GIBA 1GI5A 2BMGB 1ZMNA 4JZ1A 1W2KH 2CJIA 2FO9A 1Z71A 2AGEX 1ESTA 2ZU2A 1SMFE 3TPIZ 2O9QA 4BNRA 1ESBA 2C8WB 1O2NA 1O5DH 1P2JA 1W11U 2B0FA 1GBKA 1VCPA 1GBCA 1IQEA 1C2FA 1EAIA 2FLRH 3GCTG 2GX4A 1FY1A 3A88A 2QXJA 3MNSA 4K8BA 2BZ6H 1VZQH 6CHAC 1HUTH 1UCYH 3KHVA 3RXQA 4OS4A 1QRZA 1LPGB 1W3CA 4A1VA 3O8RA 3F1SB 3Q3XA 2FX6A 3U98H 3SV9A 1MTUA 1O2LA 4Y71A 3R0FA 1SBWA 1TOMH 1O35A 2Y5GA 1ZHMA 1NTPA 3ZV9A 1FUJA 2EA3A 3KGPA 5DG6A 3F9GA 1Y8TA 1P05A 1DT2A 4YOGA 4CREA 3GCHB 1EPTC 1GI0A 5C1UA 3SUFA 1XUIA 1SGFA 4IC6A 1UK3A 3K9XB 2ZIQH 1P2KA 1GJ6A 2P16A 3KL6A 8LPRA 2GDEH 2PTCE 3VXEH 1KXEA 1C5ZB 5AFZH 5ETXA 4ISIH 5C20A 3QWCH 1KXBA 5HMAA 3SNDA 3RP2A 1QJ6B 4FU8A 1BTZA 4CHAC 1NRRH 2ZGBH 1CHGA 3RXRA 4X1NU 3RXIA 3UTUH 2RDLA 2PV9B 2FOCA 4QT8C 2PKSB 2NU2E 4TYDA 1O30A 2VINA 2BLOA 2ZHQH 1P2NA 1EX3A 3PMJA 1CHOG 4TWWA 4X8TH 4KTCA 1ZZZA 2BQWB 5CHAC 1OWIA 2QN5T 4YT6H 1GGDC 1PQ8A 1YM0A 2GCHF 2HPQH 2GT8A 1LHCH 2FYRA 2QXHA 1GI4A 4DGJA 2ZDMA 4WF8A 1S6HA 2GP9B 4U32A 1W0YH 3PWBA 3SJ8A 3RXFA 2ZTXA 1QBNA 3T26A 1PQAA 2EEKA 3GDSA 3L6PA 5DP5A 3RXDA 4I33A 1HAYB 2BOHB 1RTKA 2GMTB 1OWDA 1XKAC 2Z7FE 2PR3A 3PO1C 4F49A 1J14A 1AE8H 1D4PB 1GBFA 2DE8A 1GBTA 4FUDA 1T8MA 1YPLH 2W26A 1MU6B 1IQMA 3TGKE 1C5UA 2BDHA 2EC9H 5JBCS 1LKBA 1Y5BT 1QQUA 1TWXB 3M3VA 4CRAA 1ETRH 2F9OA 1P11E 1VITH 2ZDLA 3LGUA 2IN2A 3RM2H 5JBTA 1SHHB 1BB0B 1UTKA 1NM6A 3NZIA 2QGRA 3M5OA 3LJOA 4AORA 3SZNA 7GCHF 4HGCA 3LDXH 1FPHH 4FVBA 1O3IA 4FUBA 3M5LA 3EGKH 2HOBA 1WU1A 3M36A 2H6MA 4BTUB 3BG8A 1WTGH 3BEIB 4HZHA 1LHFH 1HV7A 2BD4A 3D65E 2Y7XA 3ENSB 3MNXA 2P93A 4Y79A 1FZZA 1GCTC 3OTJE 1TBRH 1Z6JH 3AVZA 1PPCE 1N1LA 1GBJA 1TNJA 3MO3A 3QK1A 2CXVA 4DCDA 2W3KA 1SG8B 2ZDVH 4NG9H 1J17T 2C93B 2XBXA 4X1SU 3LGTA 1KSNA 1P06A 3RMMH 3GDUA 2BXTH 4Y7AA 1ZMLA 4H42U 3TH2H 1P0SH 1XVMA 1HNEE 1C5XB 2OTVA 5E2OA 3TJOA 2VWOA 1DPOA 1AUJA 2O8UA 1NFWA 1O2MA 1Y5UT 2ZHEH 1ZR0A 1SFQB 3SV2H 1FY4A 4A5TS 1G36A 1SLWB 2Z6BD 4ZKOU 1XUHA 1NRPH 2GKVE 1KXDA 5F8ZA 4RSPA 1K22H 4Y10E 4K8YA 1GHYH 4RKJB 1INCA 1RD3B 2XTTB 1IQLA 1HGTH 1TGBA 2WYGA 1RRKA 3MU5A 1DE7H 3E3TA 4NSVA 1YC0A 1O38A 1IQGA 4CR9A 1GVZA 4YOIA 1GMCG 3SU4A 2Z9GA 3ZV8A 1CGJE 4RKOB 1QL8A 4D9RA 4A7IB 3PTNA 2I6SA 1GWAA 1Y3YA 2ALVA 1QJ7B 1QQ4A 2ZQ1A 1GG6C 1Z1IA 3ATWA 3M7TA 1BA8B 1RJXB 1MKWH 4Q7ZA 1V2LT 3A7TA 1XMNB 3STJA 1SC8U 1NS3A 1D9IA 1JXPA 1W10U 2PFEA 2WINI 3U8RH 3VGCC 1CHOF 2TGDA 1OYTH 4NIYA 1O3CA 2GTBA 1C4Y2 3WY8A 2P3FH 1F5KU 1O2YA 2B8OH 1Y3UA 1TNKA 2OP9A 3HKIB 3NK8A 2PSXA 1O2GH 5CMXH 1A3EH 3SHAH 1RGQA 3SU3A 3QTVH 3NUMA 2BVRH 2KAIB 3QGNB 2J92A 4U01A 4X8VH 4HTCH 1AQ7A 1MAYA 3F9EA 4LXBH 1DXWA 1YPGH 2ZFQH 8GCHF 2F9NA 1PYTC 3M61U 3B9FH 5A0AE 1HXEH 1KIGH 2G81E 1O3JA 1TYNA 3DD2H 1C9TA 2BLQA 4TPIZ 1ZTLA 2F9BH 4AG1A 5EQQA 3NPSA 5CE1A 4KELA 1DWEH 2HALA 1GL1A 1L1GA 1OWHA 3TK5A 2H9HA 2JETB 1O3OA 3K6ZA 1G3DA 5I46H 2SNWA 2VNTA 4FUCA 3SU5A 2TBSA 1SPJA 3RXMA 4SGBE 1QFKH 1DSUA 1QURH 1ZRKA 3BTGE 1YBWA 2A31A 2V3OH 4BAQB 3MH6A 2W5EA 1VCWA 2XC5A 1QB9A 2FOAA 2Q1JA 1P10A 1JMOH 4K5ZA 3DFJA 3PMBB 3ZZ6A 2WPJS 4R0IA 2CF9H 1KLIH 3S0NA 1HAXB 3VB7A 1NRNH 2J9NA 4DG4A 2FYQA 2ZU3A 3C1KA 1EP6A 1AFQB 2TRMA 2B7DH 2PUXB 4B1TA 5TJXA 2OINA 1GHBG 3UIRA 2VGCB 1P9UA 4IMQA 1V2VT 2RG3A 2ZU5A 1CGIE 3GY7A 2Z3EA 3LIWA 2VH6A 1MQ5A 1L0ZA 1OWEA 4JZDH 2BLVA 4TPYA 1YPKH 2BD3A 3SNEA 1S85A 4BAKB 2G5NA 2QXIA 1GJAB 3BTHE 4ABIA 3S69A 4WH8A 1HAVA 2BOKA 4AZ2B 2R3YA 1P12E 1W7GH 5L2ZH 1D3PB 3S9BA 2FXRA 5FBIA 1D6RA 1K1LA 1WYKA 3SQEE 4OS1A 2ZFTA 4ASHA 1EZQA 2RCEA 2VIOA 1OPHB 1THSH 3URCA 2VIPA 3F9HA 1QGFA 5A8YA 1ELBA 2F9VA 2Z94A 5JBAS 1GMCF 4BAOB 2BD9A 1Z8GA 2EI6A 1GHAG 1TPOA 1EB2A 2ZNKH 3F6UH 1MBQA 1NY22 2UUYA 5F8TA 3M3TA 2P3TB 4YZUA 3HK3B 1BT7A 1O2IA 1C1UH 1AKSA 5FPYA 2TGAA 1H9IE 5EW1H 2R0KA 1G2LA 1C2LA 5F03A 1DY8A 2H9TH 2ZGCA 3T29A 4VGCB 1D3QB 1A3BH 1UVPA 1ZTJA 3D23A 4B73A 1EZXC 1DLEA 9ESTA 1ELDE 3STIA 4AN7A 1SVPA 4ABGA 2O8TA 3ZZ7A 2GZ9A 2ZECA 4I7YH 1UVUH 3E0PB 4ZKRU 4UDWH 1ESAA 2FOEA 1BTHH 5K7RA 5AHGH 1VGCC 1T8OA 1AI8H 1P03A 2ILNA 1DWBH 2YNBA 1HPGA 2XNIA 3CS7A 2XCFA 1C2MA 3A8CA 3ZZCA 1TMUH 1BQYA 2BDGA 2QC2A 1UTNA 1CA0C 4WJG2 1YPHE 4E05H 2QCYA 3SHCH 1F5RA 2R0LA 2CHAB 4I8GA 3RMNH 3MOCA 5A8XA 1OOKB 4IGDA 5EXNA 1HB0B 3SN8A 3QN7A 1PPZA 1N6XA 1TAWA 1NFXA 1DLKB 2SNVA 1V2ST 1C1OA 5ABWA 2XBYA 2AGGX 3BTKE 1TBZH 2WUCA 5TCAA 3GYMA 3RDZA 2P8OC 1QIXB 4NIXA 3UR9A 3SOSA 2GCTB 4THNH 2ODQA 3RXGA 4ZKSU 4DIIH 1MZDA 1DSTA 4B74A 1GHVH 1KY9A 3A80A 2EI7A 3TNTA 1NESE 1GJCB 2A2QH 3EYDA 3EA9A 3GY2A 3SGAE 2GV7A 3M5MA 1ACBE 5HGGA 4WVPE 1P2MA 2PUQH 5EOKA 3A8AA 1TE0A 1TIOA 4OS7A 4WMDA 3P6ZB 2AYWA 1ARCA 1XUGA 1Q2WA 2UUJB 3ZVDA 3PROA 3QGJA 2P94A 1MTWA 1SGIB 3DA9B 3EE0B 1E36B 2PKAB 1BRUP 1OP2A 3ZZAA 2G8TA 2VWNA 3RXAA 1WTHD 3V3MA 4JZEH 1DANH 4X6OA 1E35B 2B5TB 2FZZA 1FN6A 4INHA 3KIDU 1JIMA 3T27A 2BYAX 2NWNA 1YF4A 3RXEA 3IWMA 1E38B 1J16A 1LQDB 2G00A 2FTLE 2FS9A 3UUZA 1MUEB 3RMOH 1BJUA 1ZPCA 1XUFA 3RXJA 1Z1JA 3BIVH 2OXSA 1ZYOA 1Q3XA 2OUAA 4JYUH 1ZHPA 4GCHG 3I29A 3SV8A 5A8ZA 5EPYA 1BDAA 6CHAB 1OKXA 2GZ8A 2H5DA 3V7TA 1GHAF 5J4QA 3SUGA 4DY7B 2HNTE 1MKXH 1SOTA 3QZQA 3U69H 3TJUA 5F6MA 4WMEA 1MCVA 2TGTA 2OC8A 3OSYA 2A2XH 3VEQB 3SV6A 1QNJA 3LGIA 1O5AB 4H4FA 4D7GA 1EB1H 2CMYA 1V2JT 3RXVA 1BBRE 2AMQA 3ATIA 3PTBA 1BRAA 1J8AA 1HRTH 4Q2KA 2UUFB 3RXPA 1EJAA 2G55A 1EPTB 1MZAA 1EQ9A 3ZVGA 2BD7A 3SI4H 1G3CA 1UO6A 2ZFRH 3MNBA 1QA7A 1CBWB 1EJMA 2PSYA 3MH7A 1ZPBA 1EP5A 3SI3H 1WBGB 2OC0A 4D9QA 2ZFPH 2D2DA 5EW2H 2V0BA 5LPFA 3MU4A 1YPHC 4Y8ZA 1WQVH 2CGAA 2HNTF 4CHAB 1KTSB 5DP4A 3SJIA 5L6NH 2ZFSA 1UTLM 4CR5A 1C2KA 1LMWB 3SUDA 4ZHAA 3PV4A 1NZQH 1QL7A 4MNWA 1C2IA 1AFEH 1GI2A 3ATLA 3MYWA 2HPPH 4DJZB 2THFB 1C5VA 5CHAB 1GGDB 7ESTE 4A6LA 3RXTA 3MU1A 1RIWB 1O2PA 8KME2 2XWBI 2JH6D 2SGAA 3V13A 1BUIA 2AFQB 3TU7H 3C27B 2ODYB 2VVVA 3FP6E 1O5GH 1IQNA 1BHXF 2J4IA 3EAJA 5ESBA 1O3BA 1ANDA 3E8LA 1O2VA 2FX4A 1DITH 5EQRA 1LCYA 1UCYK 3PO1B 4O3TA 7KMEH 2XXLA 1OWJA 4ZAEA 1HJAC 2ZDKA 1EAWA 1EXFA 1Q31A 2AH4X 3MO9A 1TA2A 4Y8XA 1QCPA 1NFUA 2BDYA 3OU0A 2PGBB 2PGQB 3ZZ5A 1ZSLA 3LU9B 3DFLA 1CT0E 5JPMH 1EOJA 1AWHB 3H5CB 1E37B 4HI3A 1ORFA 3BTWE 3RXBA 1AHTH 1G3BA 1F7ZA 3BTQE 1KXFA 4ABEA 1FNIA 2QA9E 4DURA 2A0QB 3UWJH 1N6YA 2QXGA 1AGJA 1GVLA 2F83A 3PMAB 2VU8E 1O3KA 1EZSC 1Z6EA 5EXLA 1GBDA 1TRMA 4FVDA 4X6MA 1HCGA 1JIRA 4FU7A 1AE5A 1CT2E 1S6FA 1S83A 4Q7YA 1A5IA 4AFSA 1Y59T 1SGQE 1GCTB 1TNLA 4K3JA 1C5QA 2ZGJA 1KXAA 1TQ0B 3PLPA 1CGHA 3N7OA 3RXHA 1SLVB 2HNTC 3KQCA 1QRWA 1TGCA 5JB9S 5C2ZA 4GCHF 4BAHB 3A82A 3ZYEA 2Q6DA 1GBBA 1FN8A 2ZTYA 2BX4A 1GI7B 3P8OA 4IN1A 1A0JA 1V6DA 3SGQE 4M7GA 1QB1A 4Q7XA 2AERH 3KQEA 4UFGH 3SQHE 1IQIA 5JB8S 5C5OA 4E06H 1GJ5H 2PKSC 1SQAA 3VPKA 2WV4A 4XFQA 1NU7B 4YOJA 1ETSH 2Z9KA 1RS0A 1GBLA 1V2UT 1TALA 1VITG 1JBUH 2F9PA 2K1QA 3A87A 1Z8JB 1JOUB 4GAWA 1UTQA 1C4U2 5BRRE 4JZIA 1HFDA 1KDQA 4ABAA 1CE5A 1FAKH 1EATA 1MTSA 1BMNH 2RA3A 1BTPA 3E1XB
chains in the Genus database with same CATH superfamily
1SSXA 2G52A 3GCTF 4Z6AH 2HWLB 3A7XA 1AD8H 2WPMS 3P92A 1DWDH 3HGNA 2HLCA 1TLDA 2UWLA 2GMTC 1P01A 2IJD1 4MPXA 1FIWA 6GCHG 3VGCB 4YLUA 3F3BA 1EZUC 3GCNA 1UTOA 3A89A 8ESTE 1ANEA 3UNRA 4UFEH 1LVBA 1GPZA 2C3SA 5IK2D 2QAAA 5IYTA 4BXSA 1K1MA 2VJ1A 1AU8A 5L2YH 2ZHWH 1D3DB 3RXOA 1DOJA 4AC9A 5T3HA 1UVOA 4OGXA 2ZI2H 2Y81A 5E8EH 1ABIH 3PYHA 1OXGA 2ANKH 2GZ7A 2W6JD 4MNVA 2STBE 1XM1A 2XBVA 2J94A 5EXMA 1E1RD 4CRBA 1QY6A 2V6NA 4ZHMU 3RC6A 2VIQA 1DX5M 2ZKSA 1TABE 1NFYA 4JMYA 5AVDA 3SYJA 4JK6A 1MQ6A 3UREA 4B71A 1V3XA 1K2I1 5EODA 1ZGVA 1FAXA 3TGIE 4MDSA 1OX1A 1P3EA 2J2UA 1O3EA 1WQSA 1YCPK 5HYOA 1KXCA 5EU8A 1WSSH 2W6ID 5DP7A 1MH0A 4FUJA 1QTFA 3RC4A 2FDAA 4B2BA 3LONA 1A0LA 1DWCH 2FOFA 2ZU4A 5JBBS 4LZ1H 3O8DA 2BY5X 3M3SA 1UTJA 5EGMA 1O5CB 3AASA 5DP3A 1PFXC 2ZPSA 5GCHG 3DHKH 2J98A 1L1NA 5ESTE 1F2SE 4K1EA 1AVGH 4AFUA 2BLWA 1BTUA 3MU8A 3F2FA 2G51A 3EQ0H 4AYYB 2BZAA 3M35A 1HDTH 2JJ1D 5CDFE 1ZTKA 1YPJH 2QF3A 4XBBA 5E2PA 2YNAA 2XBWA 2BY8X 3SJKA 3UPEA 2ASUB 3A7WA 5HXFA 3AW0A 3RU4D 1MKWK 3MH4A 2VVUA 4TSFD 1GBHA 3LOXA 1P8VC 2Y5HA 4MLFB 4NGAH 3BTEE 4XD7D 3ATKA 1W13U 1AB9B 1FLEE 4Y0YE 2ANMH 3UQOA 2XC0A 1AIXH 1O31A 1GJ9B 1W7XH 2D26C 3SJ9A 3K2UA 3RXSA 2AMPA 4KKDA 4MPWA 1XUJA 1JRTA 5DJ7A 4LOYH 1SOZA 4ASUD 4A1TA 4B76A 3KQDA 1T4UH 3M5NA 1LVMA 4GUXA 2C8ZB 2BD8A 1OSSA 3LPRA 3TNSA 5K0HA 1V2WT 1UHBB 1ETTH 1D3TB 1S0RA 3PLBA 1ZRBA 1XVOA 2KZ4A 5LGOA 1O2HA 1GHWH 2C8XB 3MO6A 2C90B 1MBMA 3PRBA 3P8NA 4ISLA 3T62A 3IITA 3SNBA 3A86A 5EIYA 1W0ZU 2AS9A 1O3AA 4X2WA 3BSQA 1ELEE 3VB5A 1C5RA 1DM4B 1HIAB 1TGTA 2FOGA 1ZSKA 4D8NA 4U30A 1HJ8A 2Z9JA 1PPGE 4JYTA 1FMGA 2K8IA 3DSPA 1C2EA 1HAZB 1TQ7B 1O3DA 4WWYA 2BY9X 4U2WA 5A2MH 3ZVCA 2BD5A 2XCNA 2R3UA 2ZEBA 2J38A 2ZGXH 1YGCH 3URDA 6GCHF 1SI5H 1OHHD 1BMLA 3SBKA 1M9UA 2I6QA 3FOAA 2BD2A 1J9CH 1A0HB 1GBIA 1EKBB 2KCYA 5AFYH 1T8LA 4ZH8A 3VG8A 4FUHA 4YT7H 4ZHLU 1V2PT 3LGYA 3SO3A 1GHXH 1CSOE 1O2TA 4Y11E 3UR6A 2QF4A 4OS6A 1EFRD 1NU9A 2G4UA 1UW7A 2FEQH 3B23B 4CRDA 4Y8YA 1BITA 4I8KA 1TNGA 3GY6A 3LKWA 1QRXA 3N7EA 3RU4E 2CN0H 2ZCLP 1PPFE 4ABBA 4K1TA 1ANBA 1MABB 4TWYA 1Y3XA 4MQAA 3A8DA 1CA0B 4IS5A 1F0RA 1RTLA 3A85A 2ZGHA 3AAVA 1A61H 1JWTA 1AFQC 1MAXA 1YLDA 1G30B 2ZF0H 4E7NA 3ZZ3A 4P02A 2FI3E 4DIHH 1EAXA 3SU2A 1A7SA 3QTOH 4AB9A 1W8BH 1IQJA 2WV5A 4K1SA 2J34A 1SQTA 2VIVA 1G3EA 2OQ5A 1YCPM 4DOQA 5GCHF 5T1VA 1P2QA 4X1PU 3VB3A 1K21H 1IHSH 1PPBH 2P8OB 4MPVA 4AB8A 1H9LB 2AIQA 3UNQA 3GY4A 2STAE 1LHGH 1O2RA 1FY8E 4GHTA 1LDTT 3UNSA 1QB6A 2QY0B 2TIOA 1C9PA 5SGAE 2Q6FA 3E91A 4ISHH 4WXIA 1GL0E 2OBOA 1MD8A 3ZVEA 2YMSD 1HAHH 2ULLA 1O2SA 3K6YA 1GDQA 4Y6DA 2ZC9H 3T2NA 3SUEA 2V35A 1AZ8A 4NZQA 3SGBE 3U9AH 3ZVAA 2AIPA 3A84A 1GDNA 1BBRH 1U6QA 3GDVA 3MMGA 4D76A 2VWLA 4ZMAH 2V3MA 1TB6H 1V2KT 2Z9IA 1AY6H 5FHTA 5B6LA 5J4SA 1H8IH 4ZXYH 2A7CA 4B6FA 2ANWA 1G32B 3KYGA 3TLOA 1MTNC 1C1MA 4CRGA 5FPTA 4JYVH 1D6WA 3RXCA 5E0GA 2FI4E 1SGTA 2C4FH 2ESTE 4GVUA 2XW9A 4XSKU 2FMJA 1UTPA 3M7UA 1YYY1 3BTTE 1W14U 1GHBF 5C1YA 1GJ8B 2WPKS 2WYJA 4OGYA 4RN6A 4X6PA 3OAAD 4E7RG 2BXUH 3FANA 4NCYA 1TPPA 3ZVFA 2GVFA 1P04A 2RFKC 2A4QA 3A7YA 3EDXB 1IQFA 3B8JA 1GI8B 4JK5A 5BPEA 5DSFA 3UQVA 2A5AA 3W94A 1T32A 4AFZA 3SORA 2KAIA 3Q00A 1ANCA 3LH1A 2QIQA 2SGQE 4BTTB 4Y0ZE 1MD7A 5EJ1A 5FX6A 3P17H 1C5SA 2CHAC 5E0HA 3U1IB 3E90B 1OWKA 4SGAE 2OBQA 2ZZUH 4MVNA 1LTOA 5FCRA 2SFAA 3W95A 1S84A 2G5VA 3BG4C 1O2ZA 1HAOH 3TVJB 2ZO3H 1GI6A 5EJLA 3PB1E 1F5LA 4OS5A 1A4WH 1V2RT 4J1YA 2IPHA 4MTBA 3LT3A 3K65B 1BRCE 1GHZA 1E0FD 1CO7E 2SGPE 1AVWA 2GCTC 1UHBA 1XKBC 2UWPA 4WH6A 1F0SA 2W7UA 1B0EA 3KCGH 4IC5A 1Z7KA 1C1WH 2O8WA 1SLUB 5IDKA 1AVXA 2EI8A 3GICB 3DUXH 3P70B 4WMFA 4B75A 1TNIA 4FUEA 2ODPA 1EUFA 2OC7A 4IMZA 1QR3E 1C5OH 4I31A 4NA9H 2Y5FA 2R2WU 1O0DH 2BVSH 5DO4H 2VIDA 4GPGA 3LC3A 5JDUB 3S7KB 3DSOA 5HM9A 2C8YB 3BN9A 2BHGA 4KP0A 1MU8B 5T6FA 4ACBA 5LPRA 3OYPA 2A45B 4ESTE 1TX7A 1C1SA 2HLDD 7GCHG 3PV5A 2FP7B 1V2MT 1MKXK 4OS2A 3VFEA 3H7TA 3PWCA 1HXFH 2DE9A 1TA6A 3Q3YA 1DVAH 3GCOA 5FXLA 3F2HA 1T7CA 2ZP0H 1F0TA 2GDDA 4NWKA 1N8OC 4NA7A 3BEFB 1LPZB 3HKJB 3D62A 4YO9A 2JIZD 3TH4H 1GMHG 3SU6A 3P8GA 1S82A 2FM2A 4BAMB 3AAUA 3KEEA 4BANB 4ABDA 4A1XA 2M2AA 1GJDB 4DW2U 3R3GB 1WUNH 1FX0B 1AZZA 3VXFH 2XYAA 3KYFA 4WXVA 3PMHB 1A1RA 4NFFA 4NSYA 5L30H 1E1QD 2WPDD 1PYTD 3MFJA 1YP9A 2IJOB 4CH8B 3N7DA 4DVAU 5DPAA 2PP6A 1LKAA 3Q77A 1W12U 3SW2B 1C1PA 1G9IE 2O8MA 1QBVH 2R9PA 3GY5A 2A4RA 5KECA 3A7ZA 1BMAA 1BJVA 2OLGA 1TRNA 5A09A 1S6LA 3NCLA 1SGYE 1B5GH 2FLBH 4YM9A 3F9FA 3ZZ9A 4JZFH 1EOLA 5DGJA 1O2JA 2JH5D 4UFFH 3SU1A 2A4OA 4NWLA 5A0BA 4GLYA 2WV9A 4TY6A 2A5KA 1SLXB 5T6GA 1RTFB 2OQUA 2A32A 3BEUA 4X2YA 1CBWC 7LPRA 4B2AA 1V2NT 3L3TA 1V2QT 3ODDA 1K28D 5HM2A 1T31A 1SB1H 2RA0A 1IQHA 1TX6A 3SNCA 3PLKA 1MCTA 4ABHA 3U8OH 1UVSH 2VH0A 3TGJE 2P95A 2WPLS 2Y80A 2B9LA 4WY3A 1CU1A 1K9OE 1S0QA 1BHXB 1IQKA 3BV9B 4O9VA 2YMSC 1L4ZA 1K1OA 4Q63A 1LO6A 2IOTA 1LPKB 2FPZA 2OCVB 4YESB 5FPSA 3UFAA 1TMTH 4I8HA 1NRQH 1O2QA 1RIWC 2BM2A 5DP9A 2XWAA 1HBTH 5C67A 3RC5A 3V12A 3GCHC 1DS2E 3P95A 4FU9A 1HAVB 4MG3A 1QL9A 8GCHG 1EASA 3UOUA 1TPSA 2LPRA 3FN8A 1TFXA 4AGKA 4GHQA 1FI8A 3AW1A 4J2YB 5DKMA 4P00A 1LQEA 3E6PH 4Y7BA 2ZCHP 4CH2B 2A4GA 3SV7A 1TRYA 4K60A 4M9FA 1JRSA 4NZLA 1QHRB 4X2VA 2BY6X 1SL3A 2ZCKP 1FY5A 2VVCA 3MU0A 3OFND 1CA8B 1GBEA 3RMLH 2QE7D 4R8TB 3SU0A 3V0XA 4A92A 1C5NH 1TPAE 2KCAA 4AX9H 1CQQA 1C1RA 1UCYE 1P2OA 4CRCA 2BVXH 3VB6A 2BX3A 1PPHE 2PKAA 2PTNA 1TGNA 1G2MA 1G37A 3RUOA 5EG4A 4D7FA 1WAYB 2F91A 1AKSB 1DFPA 1GG6B 4UD9H 2WPHS 5GJ4B 3KF2A 1NN6A 1TNHA 3E0NB 1ELTA 4F48B 2OK5A 1WOFA 5EPNA 2ZFFH 1GMHF 1TONA 2PHBA 1C1QA 4O3UA 4IN2A 5FCKA 1O2UA 2BQ7B 1TGSZ 1NROH 2TPIZ 3RXKA 4YTAA 4CBNA 4ISOA 4AFQA 1C2JA 3HATH 3MQKC 1GBMA 5EJZA 1FXYA 1V2TT 1NO9H 2H2ZA 1A46H 1VCQA 5FAHA 2FWWA 2A7HA 1SGDE 5C3NA 3TITA 3OTPA 4FUIA 4F4OC 3I77A 1HLTH 1IOEA 3EE7A 6LPRA 3LGWA 1YCPH 3ELAH 3MTYA 5C17A 3E16B 2W7SA 3FKSD 1SGFG 3QZRA 5FBEA 1X7AC 3U1JB 2SGEE 3A7VA 2ZA5A 2RDEA 1YPMH 1OS8A 1YPEH 1HAIH 3TJVA 2CK3D 1T8NA 2ZDAH 1EPTA 1HAGE 3A8BA 3M7QA 4H6TA 3OX7U 1AMHA 3FVFB 1O2WA 1YY3A 4OM9A 1FQ3A 3ZYDA 1HAPH 3MH5A 2H9EH 9LPRA 1VR1H 1BOQA 2G4TA 3RLYH 2PLXA 2GGVB 1A5GH 4X1RU 1GI1A 1H4WA 1KLJH 1H9HE 3T5FH 1SGRE 2D8WA 3ZZ4A 3HPTB 3PM3A 4BXWA 4AG2A 2QYIA 5DP8A 4LK4A 3M37A 4X2XA 1SGNE 2A1DB 3ESTA 1QBOA 1QZ8A 1BTXA 3MNCA 2BDBA 4KTUA 2M5TA 2ZU1A 1GMDG 2NU3E 1TOCB 2NU4E 2ZTZA 5T6DA 2Z3DA 3T28A 3BIUH 4XBCA 3F0PA 1MTVA 3LC5A 2VBCA 2ANYA 3RXLA 4X8UH 1IAUA 2J97A 2Y82A 4MNXA 2H5CA 1P57B 4MNYA 3LH3A 2ZHDA 4BTIB 3ATMA 1C5TA 1SHYA 3FP7E 3BTME 1VJAU 2GD4B 2CV3A 4AGJA 4UEHH 1KTTB 1B0FA 2CF8H 3ZZDA 1P9SA 5LPEA 2BDCA 1A2CH 1TBQH 3Q3KA 3JZ1B 5JYIA 1SKYE 1Z8IB 4X6NA 1DDJA 2AHME 3A83A 2HVXA 2ZDNA 1FONA 1VJ9U 3EA7A 3MHWU 3Q76A 3S9CA 2ZHFH 1BRBE 2W3IA 4ZUHA 1SFIA 2BB4A 1VITF 1K1PA 1SQOA 5GXPA 4YXWD 2JH0D 2ZPRA 4H6SB 1GJ4H 3QUMP 1ELVA 1P02A 1LHDH 1K1NA 2J95A 1THPB 1UJ1A 1PJPA 1O3MA 1GDUA 1FDPA 1NPMA 3FAOA 2ALPA 3UOPA 2WPIS 4IBLH 1DUEA 2BTCE 5GDSH 1O2XA 1C1VH 2AMDA 2Z9LA 3A81A 3ZZ8A 4FUFA 5DN6D 1FV9A 1DICA 1O5EH 1DXPA 1FPCH 1CT4E 1UMAH 1AB9C 1C1NA 2VIWA 3CS0A 1GI3A 2FOHA 2QF0A 1DY9A 1ELFA 5C5NA 1B7XB 3GISB 3FFGA 1C5YB 2JETC 2HRVA 2SGDE 3UWIA 1KLTA 1THRH 2ZQ2A 1ABJH 1P2IA 5GPIB 1VGCB 1S5SA 2FI5E 4GSOA 1Y3WA 3NRLA 1C2GA 1NRSH 1NT1A 2SGFE 3W1EA 3H7OA 2GT7A 1EJNA 3LJJA 1XXFA 1SGPE 2P59A 5GNDA 1WV7H 3S9AA 1ZJDA 2PW8H 3BTDE 3O8CA 1ELGA 1F92A 2AGIX 3G01A 1C5MD 4O97A 3L33A 4ZROA 1GJ7B 3BTFE 2XC4A 3MI4A 4HFPB 4K2YA 1Z8RA 5I25A 1AN1E 1GVKB 1BCUH 2ZWLH 1QJ1B 4B2CA 1K1JA 2VGCC 4LZ4B 1GCDA 3JZ2B 4I8JA 2AEIH 1BMMH 4I8LA 2FIRH 1UK4A 1O2OA 4NIVA 3U28C 3GYLB 6ESTA 3KQBA 3ZZBA 1ELAA 1OP8A 2WUBA 1H1BA 1MTNB 2R2MB 3GY8A 3ZVBA 1LHEH 4Q80A 1EAUA 3NWUA 4ZXXH 1P3CA 4BOHA 1O2KA 1YWUA 3RM0H 2FESH 5G4BA 3O8BA 5EQSA 5AF9H 4FETA 4CRFA 1AUTC 5A0CA 1BZXE 2HGTH 2JKHA 3D49H 4X8SH 2EY4C 2VB0A 2Y6TA 1O33A 1O36A 1ZSJA 1BTWA 1GMDF 1UK2A 2O8LA 3ITIA 4XBDA 1ZHRA 4I32A 4NA8A 1MMJN 2K0QA 4RT1A 1OP0A 1LVYA 1XXDA 5PTPA 3SJOA 4UFDH 3OY5U 2FS8A 1L1JA 5KGOA 1V2OT 2A7JA 1O3FA 1AWFH 2Q6GA 1C2HA 2ZPQA 1HYLA 2FOBA 2V3HH 1PQ5A 4ABJA 4AYVB 3HGPA 5TCCA 5FX5A 1O3HA 4KGAA 4X0WU 2NU0E 1FIZA 3NXPA 1A5HA 3I78A 2BY7X 3PRDA 5DK1A 1O37A 1DUAA 1ZOMA 3FP8E 4XE4A 1RFNA 1C1TA 4Q4LA 1H8DH 1SGCA 2XRCA 2FOMB 4MPUA 4FXGH 3P8FA 1BBRK 1FJSA 2OC1A 3BG4B 3KNXA 1E34B 2VWMA 2A5IA 4VGCC 3EA8A 1PPEE 1ZJKA 2YOLA 4INKA 4O03A 5B6OA 1UTMA 2LNCA 1O3GA 1C5WB 5LH8A 1O39A 4XDEA 4ZKNU 2Z3CA 1TMBH 1C2DA 1O34A 3DT0H 2BDIA 2UWOA 3UY9A 2F3CE 1O3LA 1C5PA 3RXUA 1FY3A 2BQ6B 2QV1A 3IG6B 3QDZB 1GJBB 2BDAA 5H4IB 4DT7B 5C1XA 3S7HB 3PV2A 2KX4A 3GOVB 1COWD 2PWXA 2XOKD 1KYNA 1Y5AT 1YKTA 4IW4E 1SR5C 2TGPZ 1XUKA 4K69A 3TK9A 4PROA 1KDQB 2GCHG 3U8TH 4UE7H 1P09A 1ZMJA 2UUKB 1SGEE 2P3UB 1HJ9A 3BF6H 4X1QU 2F9UA 4ZCNA 1C4V2 5F53A 3SNAA 3LGVA 1L4DA 3ODFA 1TX8A 4JCNA 4CBOA 2KCOA 2KM0A 4FUGA 3RLWH 2H1UA 4KTSA 5F8XA 1F0UA 1N8OB 1AO5A 1ELCA 1YLCA 4XOJA 1ZGIA 2FODA 1WCZA 1OYQA 4RI0A 1O3PB 4Z0KA 3FZDA 1Y3VA 1ARBA 3QO6A 1PQ7A 1RXPA 3CENA 1ZLRA 2F43B 1BMFD 1WXRA 3TH3H 3F68H 3GY3A 2NU1E 3FZZA 4YLQH 3NKKA 4ISNA 1T4VH 2ZG0H 1ZPZA 2L6OA 4NFEA 1CVWH 1GBAA 1UVTH 2Y7ZA 3TIUA 5GWZA 3QLPH 1ID5H 1O5BB 3QX5H 1HIAA 1BIOA 2D1JA 2DUCA 3RU4T 1BTYA 1L2EA 2FTMA 2GV6A 1O32A 4Y76A 3MWIU 1C5LH 3CP7A 1LVOA 1J15A 1IHTH 4INLA 2OD3B 5DP6A 5E0JA 3TK6A 3TJNA 1HJAB 3HK6B 1GI9B 3T25A 1XX9A 4AOQA 1QA0A 3OY6U 1NC6A 4TY7A 4NIWA 1K1IA 3KN2A 4UONA 1S81A 3WW7A 4B6EA 4ABFA 3VB4A 1O5FH 1O3NA 5GIBA 1GI5A 2BMGB 1ZMNA 4JZ1A 1W2KH 2CJIA 2FO9A 1Z71A 2AGEX 1ESTA 2ZU2A 1SMFE 3TPIZ 2O9QA 2J98B 4BNRA 1ESBA 2C8WB 1O2NA 1O5DH 1P2JA 1W11U 2B0FA 3F2GA 1GBKA 1VCPA 1GBCA 1IQEA 1C2FA 1EAIA 2FLRH 3GCTG 2GX4A 1FY1A 3A88A 2QXJA 3MNSA 4K8BA 2BZ6H 1VZQH 6CHAC 1HUTH 1UCYH 3KHVA 3CNRA 3RXQA 4OS4A 1QRZA 1YLNA 1LPGB 1W3CA 4A1VA 3O8RA 2YMSB 3F1SB 3Q3XA 2FX6A 3U98H 3SV9A 1MTUA 1O2LA 4Y71A 3R0FA 1SBWA 1TOMH 1O35A 2Y5GA 2WZQA 1ZHMA 1NTPA 3GS9A 3ZV9A 1FUJA 2EA3A 3KGPA 5DG6A 3F9GA 1Y8TA 1P05A 1DT2A 4YOGA 4CREA 3GCHB 1EPTC 1GI0A 5C1UA 3SUFA 1XUIA 1SGFA 4IC6A 1UK3A 3K9XB 2ZIQH 1P2KA 1GJ6A 2P16A 3KL6A 8LPRA 2GDEH 2PTCE 3VXEH 1KXEA 1C5ZB 5AFZH 5ETXA 4ISIH 5C20A 3QWCH 1KXBA 5HMAA 3SNDA 3RP2A 1QJ6B 4FU8A 1BTZA 2EQNA 4CHAC 1NRRH 2ZGBH 1CHGA 3RXRA 4X1NU 3RXIA 3UTUH 2RDLA 2PV9B 2FOCA 4QT8C 2PKSB 2NU2E 4TYDA 4ACAA 1O30A 2VINA 2BLOA 2ZHQH 1P2NA 1EX3A 3PMJA 1CHOG 4TWWA 4X8TH 4KTCA 1ZZZA 2BQWB 5CHAC 1OWIA 2QN5T 4FOUC 4YT6H 1GGDC 1PQ8A 1YM0A 2GCHF 2HPQH 2GT8A 1LHCH 2FYRA 2QXHA 1GI4A 4DGJA 2ZDMA 4WF8A 1S6HA 2GP9B 4U32A 1W0YH 3PWBA 3SJ8A 3RXFA 2ZTXA 1QBNA 3T26A 1PQAA 2EEKA 3GDSA 3L6PA 5DP5A 3RXDA 4I33A 1HAYB 2BOHB 1RTKA 2GMTB 1OWDA 1XKAC 2J5UA 2Z7FE 2PR3A 3PO1C 4F49A 1J14A 1AE8H 1D4PB 1GBFA 1WDIA 2DE8A 1GBTA 4FUDA 1T8MA 2WSSD 1YPLH 2W26A 1MU6B 1IQMA 3TGKE 1C5UA 2BDHA 2EC9H 5JBCS 1LKBA 1Y5BT 1QQUA 1TWXB 3M3VA 4CRAA 1ETRH 2F9OA 1P11E 1VITH 2ZDLA 3LGUA 2IN2A 3H09A 3RM2H 5JBTA 1SHHB 1BB0B 1UTKA 1NM6A 3NZIA 2QGRA 3M5OA 3LJOA 4AORA 3SZNA 7GCHF 4HGCA 3LDXH 1FPHH 4FVBA 1O3IA 4FUBA 3M5LA 3EGKH 2HOBA 1WU1A 3M36A 2H6MA 4BTUB 3BG8A 1WTGH 3BEIB 4HZHA 1LHFH 1HV7A 2BD4A 3D65E 2Y7XA 3ENSB 3MNXA 2P93A 1VKYA 4Y79A 1FZZA 1GCTC 3OTJE 1TBRH 1Z6JH 3AVZA 1PPCE 5C0TA 1N1LA 1GBJA 1TNJA 3MO3A 3QK1A 2CXVA 4DCDA 2W3KA 1SG8B 2ZDVH 4NG9H 1J17T 2C93B 2XBXA 4X1SU 3LGTA 1KSNA 1P06A 3AK5A 3RMMH 3GDUA 2BXTH 4Y7AA 1ZMLA 4H42U 3TH2H 1P0SH 1XVMA 1HNEE 1C5XB 2OTVA 5E2OA 3TJOA 2VWOA 1DPOA 1AUJA 2O8UA 1NFWA 1O2MA 1Y5UT 2ZHEH 1ZR0A 1SFQB 3SV2H 1FY4A 4A5TS 1G36A 1SLWB 2Z6BD 4ZKOU 1XUHA 1NRPH 2GKVE 1KXDA 5F8ZA 4RSPA 1K22H 4Y10E 4K8YA 1GHYH 1W0JD 1INCA 4RKJB 1RD3B 2XTTB 1IQLA 1HGTH 1TGBA 2WYGA 1RRKA 3MU5A 1DE7H 3E3TA 4NSVA 1YC0A 1O38A 1IQGA 4CR9A 1GVZA 4YOIA 1GMCG 5CHBA 3SU4A 2Z9GA 3ZV8A 1CGJE 4RKOB 1QL8A 4D9RA 4A7IB 3PTNA 2I6SA 1GWAA 1Y3YA 5FL7D 2ALVA 1QJ7B 1QQ4A 2ZQ1A 1GG6C 2KFWA 5HIZA 1H8ED 5C94A 1Z1IA 3ATWA 3M7TA 1BA8B 1RJXB 1MKWH 4Q7ZA 1V2LT 3A7TA 1XMNB 3STJA 1SC8U 1NS3A 1D9IA 1JXPA 1W10U 2PFEA 2WINI 3U8RH 3VGCC 1CHOF 2XNDD 2TGDA 3ZIAD 1OYTH 4NIYA 1O3CA 2GTBA 1C4Y2 3WY8A 2P3FH 1F5KU 1O2YA 2B8OH 1Y3UA 1TNKA 3DCLA 2OP9A 3HKIB 2L74A 3NK8A 3N99A 2F4LA 2PSXA 1O2GH 5CMXH 1A3EH 3SHAH 1RGQA 3SU3A 3QTVH 3NUMA 2BVRH 2KAIB 3QGNB 2J92A 2QF5A 4U01A 4X8VH 4HTCH 1AQ7A 1MAYA 3F9EA 4LXBH 1DXWA 1YPGH 2ZFQH 8GCHF 2F9NA 1PYTC 3M61U 3B9FH 3OEED 5A0AE 1HXEH 1KIGH 2G81E 1O3JA 1TYNA 3DD2H 1C9TA 2BLQA 4TPIZ 1ZTLA 2F9BH 3UB0A 4AG1A 5EQQA 3NPSA 5CE1A 4KELA 1DWEH 2HALA 1GL1A 1L1GA 1OWHA 3TK5A 2H9HA 2JETB 1O3OA 3K6ZA 1G3DA 5I46H 2SNWA 2VNTA 4FUCA 3SU5A 2TBSA 1SPJA 3RXMA 4SGBE 1QFKH 1DSUA 1QURH 1ZRKA 3BTGE 1YBWA 2A31A 2V3OH 4BAQB 3MH6A 2W5EA 1VCWA 2XC5A 1QB9A 2FOAA 2Q1JA 1P10A 3FO8D 1JMOH 4K5ZA 3DFJA 3PMBB 3ZZ6A 2WPJS 4R0IA 2CF9H 1KLIH 3S0NA 1HAXB 3VB7A 2HVYB 1NRNH 2J9NA 4DG4A 2FYQA 2ZU3A 3C1KA 1EP6A 1AFQB 2TRMA 2B7DH 2PUXB 4B1TA 4HG6A 5TJXA 2OINA 1GHBG 3UIRA 2VGCB 1P9UA 4IMQA 1V2VT 2RG3A 2ZU5A 1CGIE 3GY7A 2Z3EA 3LIWA 2VH6A 1MQ5A 1L0ZA 1OWEA 3KQ5A 4JZDH 2BLVA 4TPYA 1YPKH 2BD3A 3SNEA 1S85A 4BAKB 2G5NA 2QXIA 1GJAB 3BTHE 4ABIA 3S69A 4WH8A 1HAVA 2BOKA 4AZ2B 2R3YA 1P12E 1W7GH 5L2ZH 1D3PB 3S9BA 2FXRA 5FBIA 1D6RA 1K1LA 1WYKA 3SQEE 4OS1A 2ZFTA 4ASHA 1EZQA 2RCEA 2VIOA 1OPHB 1THSH 3URCA 2VIPA 3F9HA 1E79D 1QGFA 5A8YA 1ELBA 2F9VA 2Z94A 5JBAS 1GMCF 4BAOB 2BD9A 1Z8GA 2EI6A 2KR7A 1GHAG 1TPOA 1EB2A 2ZNKH 3F6UH 1MBQA 1NY22 2UUYA 5F8TA 3M3TA 2GJGA 2P3TB 4YZUA 3HK3B 1BT7A 1O2IA 1C1UH 1AKSA 5FPYA 2TGAA 1H9IE 5EW1H 2R0KA 1G2LA 1C2LA 5F03A 1DY8A 2H9TH 2ZGCA 3T29A 4VGCB 1D3QB 1A3BH 1UVPA 1ZTJA 3D23A 4B73A 4RT0A 3F0OA 1EZXC 1DLEA 9ESTA 1ELDE 2LP6A 3STIA 4AN7A 1SVPA 4ABGA 2O8TA 3ZZ7A 2GZ9A 3UAIC 2ZECA 4I7YH 1UVUH 3E0PB 4ZKRU 4UDWH 1ESAA 2FOEA 1BTHH 5K7RA 5AHGH 1VGCC 1T8OA 1AI8H 1P03A 2ILNA 1DWBH 2YNBA 1HPGA 2XNIA 3CS7A 2XCFA 1C2MA 1SQRA 3A8CA 3ZZCA 1TMUH 1BQYA 2BDGA 2QC2A 1UTNA 1CA0C 4WJG2 1YPHE 4E05H 2QCYA 3SHCH 1F5RA 2R0LA 2CHAB 4I8GA 3RMNH 3MOCA 5A8XA 1OOKB 4IGDA 5EXNA 1HB0B 3SN8A 3QN7A 1PPZA 1N6XA 1TAWA 1NFXA 1DLKB 2SNVA 1H8HD 1V2ST 1C1OA 5ABWA 2XBYA 2AGGX 3BTKE 1TBZH 2WUCA 5TCAA 3GYMA 3RDZA 2P8OC 1QIXB 4NIXA 3UR9A 3SOSA 2GCTB 4THNH 2ODQA 3RXGA 4ZKSU 4DIIH 1MZDA 2IPQX 1DSTA 4B74A 1GHVH 1KY9A 3A80A 2EI7A 3TNTA 1NESE 1GJCB 2A2QH 3EYDA 3EA9A 3GY2A 3SGAE 2GV7A 3M5MA 1ACBE 5HGGA 4WVPE 1P2MA 2PUQH 5EOKA 3A8AA 1TE0A 1TIOA 4OS7A 4WMDA 3P6ZB 2AYWA 1ARCA 1XUGA 1Q2WA 2UUJB 3ZVDA 3PROA 3QGJA 2LELA 2P94A 1MTWA 1SGIB 3DA9B 3EE0B 1E36B 2PKAB 1BRUP 1OP2A 3ZZAA 2G8TA 2VWNA 3RXAA 1WTHD 3V3MA 4JZEH 1DANH 4X6OA 1E35B 2B5TB 2FZZA 1FN6A 4INHA 3KIDU 1JIMA 3T27A 2BYAX 2NWNA 1YF4A 3RXEA 3IWMA 1E38B 1J16A 1LQDB 2G00A 2FTLE 3OE7D 2FS9A 3UUZA 1MUEB 3RMOH 1BJUA 1ZPCA 1XUFA 3RXJA 1Z1JA 3BIVH 4I86A 2OXSA 1ZYOA 1Q3XA 2OUAA 4JYUH 1ZHPA 4GCHG 5HKKD 3I29A 3SV8A 5A8ZA 5EPYA 1BDAA 6CHAB 1OKXA 2GZ8A 2H5DA 3V7TA 1GHAF 5J4QA 4DT4A 3SUGA 4DY7B 2HNTE 1MKXH 1SOTA 3QZQA 3U69H 3TJUA 2V7QD 5F6MA 4WMEA 1MCVA 2TGTA 2OC8A 3OSYA 2A2XH 3VEQB 3SV6A 1QNJA 3LGIA 1K0HA 1O5AB 4H4FA 4D7GA 5KEDA 1EB1H 2CMYA 1V2JT 3RXVA 1BBRE 2AMQA 3ATIA 3PTBA 3DSGA 2JDID 1BRAA 1J8AA 1HRTH 4Q2KA 2UUFB 3RXPA 1EJAA 2G55A 1EPTB 1MZAA 1EQ9A 3ZVGA 2BD7A 3SI4H 1G3CA 4XRNA 1UO6A 2ZFRH 3MNBA 1NBMD 1QA7A 1CBWB 1EJMA 2PSYA 3MH7A 1ZPBA 2JJ2D 1EP5A 3SI3H 1WBGB 2OC0A 4D9QA 1W0KD 2ZFPH 2D2DA 5EW2H 2V0BA 5LPFA 3MU4A 1YPHC 4Y8ZA 1WQVH 2CGAA 2HNTF 4CHAB 1KTSB 5DP4A 3SJIA 5L6NH 2ZFSA 1UTLM 4CR5A 1C2KA 1LMWB 3SUDA 4ZHAA 3PV4A 1NZQH 1QL7A 4MNWA 1C2IA 1AFEH 1GI2A 3ATLA 3MYWA 2HPPH 4DJZB 2THFB 1C5VA 5CHAB 1GGDB 7ESTE 4A6LA 3RXTA 3MU1A 1RIWB 1O2PA 8KME2 2XWBI 2JH6D 2SGAA 3V13A 1BUIA 2AFQB 3TU7H 3C27B 2ODYB 5C0UA 2VVVA 3FP6E 1O5GH 1IQNA 1BHXF 2J4IA 3EAJA 5ESBA 1O3BA 1ANDA 3SZEA 3E8LA 1O2VA 2FX4A 1DITH 5EQRA 1LCYA 1UCYK 3PO1B 4O3TA 4Z1MD 3WWBA 7KMEH 2XXLA 1OWJA 4ZAEA 2WHXA 1HJAC 2ZDKA 1EAWA 1EXFA 2KCPA 1Q31A 2AH4X 3MO9A 1TA2A 4Y8XA 1QCPA 1NFUA 2BDYA 3OU0A 2PGBB 2PGQB 3ZZ5A 1ZSLA 3LU9B 3DFLA 1CT0E 5JPMH 1EOJA 1AWHB 3H5CB 1E37B 4HI3A 1ORFA 3BTWE 3RXBA 1AHTH 1G3BA 1F7ZA 3BTQE 1KXFA 4ABEA 1FNIA 2QA9E 4DURA 2A0QB 3UWJH 1N6YA 2QXGA 1AGJA 1GVLA 2F83A 3PMAB 2VU8E 1O3KA 1EZSC 1Z6EA 5EXLA 1GBDA 1TRMA 4FVDA 4X6MA 1HCGA 1JIRA 4FU7A 3OEHD 1AE5A 1CT2E 4TT3D 1NBME 1S6FA 1S83A 4Q7YA 1A5IA 4AFSA 1Y59T 1SGQE 1GCTB 1TNLA 4K3JA 1C5QA 2ZGJA 1KXAA 1TQ0B 3PLPA 1CGHA 3N7OA 3RXHA 1SLVB 2HNTC 3KQCA 1QRWA 1TGCA 5JB9S 5C2ZA 4GCHF 4BAHB 3A82A 3ZYEA 2Q6DA 1KMHB 1GBBA 1FN8A 2ZTYA 2BX4A 1GI7B 3P8OA 5HIYA 3WWFA 4IN1A 1A0JA 1V6DA 3SGQE 4M7GA 1QB1A 4Q7XA 2AERH 3KQEA 4UFGH 3SQHE 4F55A 1IQIA 5JB8S 5C5OA 4E06H 1GJ5H 2PKSC 1SQAA 3VPKA 2WV4A 4XFQA 1NU7B 4YOJA 1ETSH 2Z9KA 1RS0A 1GBLA 1V2UT 1TALA 1VITG 1JBUH 2F9PA 2K1QA 3A87A 1Z8JB 1JOUB 4GAWA 1UTQA 1C4U2 5BRRE 4JZIA 1HFDA 1KDQA 4ABAA 1CE5A 1FAKH 1EATA 1MTSA 1BMNH 2RA3A 1BTPA 3E1XB
chains in the Genus database with same CATH topology
1SSXA 2G52A 3GCTF 4Z6AH 2HWLB 3A7XA 1AD8H 2WPMS 3P92A 1DWDH 3HGNA 2HLCA 1TLDA 2UWLA 2GMTC 1P01A 4MPXA 1FIWA 6GCHG 3VGCB 4YLUA 1EZUC 3GCNA 1UTOA 3A89A 8ESTE 1ANEA 3UNRA 4UFEH 1LVBA 1GPZA 2C3SA 2QAAA 5IYTA 4BXSA 1K1MA 2VJ1A 1AU8A 5L2YH 2ZHWH 1D3DB 3RXOA 1DOJA 5T3HA 1UVOA 4OGXA 2ZI2H 2Y81A 5E8EH 1ABIH 3PYHA 1OXGA 2ANKH 2GZ7A 4MNVA 2STBE 1XM1A 2XBVA 2J94A 5EXMA 4CRBA 1QY6A 2V6NA 4ZHMU 3RC6A 2VIQA 1DX5M 2ZKSA 1TABE 1NFYA 4JMYA 5AVDA 3UREA 4JK6A 1MQ6A 4B71A 1V3XA 1K2I1 5EODA 1ZGVA 1FAXA 3TGIE 4MDSA 1OX1A 1P3EA 2J2UA 1O3EA 1WQSA 1YCPK 5HYOA 1KXCA 5EU8A 1WSSH 5DP7A 1MH0A 4FUJA 1QTFA 3RC4A 2FDAA 4B2BA 3LONA 1A0LA 1DWCH 2FOFA 2ZU4A 5JBBS 4LZ1H 3O8DA 2BY5X 3M3SA 1UTJA 5EGMA 1O5CB 3AASA 5DP3A 1PFXC 2ZPSA 5GCHG 3DHKH 1L1NA 5ESTE 1F2SE 4K1EA 1AVGH 4AFUA 2BLWA 1BTUA 3MU8A 2G51A 3EQ0H 4AYYB 2BZAA 3M35A 1HDTH 1ZTKA 1YPJH 2QF3A 4XBBA 5E2PA 2YNAA 2XBWA 2BY8X 3SJKA 3UPEA 2ASUB 3A7WA 5HXFA 3AW0A 3RU4D 1MKWK 3MH4A 2VVUA 1GBHA 3LOXA 1P8VC 2Y5HA 4MLFB 4NGAH 3BTEE 3ATKA 1W13U 1AB9B 1FLEE 4Y0YE 2ANMH 3UQOA 2XC0A 1AIXH 1O31A 1GJ9B 1W7XH 2D26C 3SJ9A 3K2UA 3RXSA 2AMPA 4KKDA 4MPWA 1XUJA 1JRTA 5DJ7A 4LOYH 1SOZA 4A1TA 4B76A 3KQDA 1T4UH 3M5NA 1LVMA 4GUXA 2C8ZB 2BD8A 1OSSA 3LPRA 3TNSA 5K0HA 1V2WT 1UHBB 1ETTH 1D3TB 1S0RA 3PLBA 1ZRBA 1XVOA 5LGOA 1O2HA 1GHWH 2C8XB 3MO6A 2C90B 1MBMA 3P8NA 4ISLA 3T62A 3IITA 3SNBA 3A86A 1W0ZU 2AS9A 1O3AA 4X2WA 3BSQA 1ELEE 3VB5A 1C5RA 1DM4B 1HIAB 1TGTA 2FOGA 1ZSKA 4D8NA 4U30A 1HJ8A 2Z9JA 1PPGE 4JYTA 1FMGA 1C2EA 1HAZB 1TQ7B 1O3DA 4WWYA 2BY9X 4U2WA 5A2MH 3ZVCA 2BD5A 2XCNA 2R3UA 2ZEBA 2J38A 2ZGXH 1YGCH 3URDA 6GCHF 1SI5H 1BMLA 3SBKA 1M9UA 2I6QA 2BD2A 1J9CH 1A0HB 1GBIA 1EKBB 5AFYH 1T8LA 4ZH8A 4YT7H 4FUHA 4ZHLU 1V2PT 3LGYA 3SO3A 1GHXH 1CSOE 1O2TA 4Y11E 3UR6A 4OS6A 1NU9A 2G4UA 2FEQH 3B23B 4CRDA 4Y8YA 1BITA 4I8KA 1TNGA 3GY6A 3LKWA 1QRXA 3RU4E 2CN0H 2ZCLP 1PPFE 4ABBA 4K1TA 1ANBA 4TWYA 1Y3XA 4MQAA 3A8DA 1CA0B 4IS5A 1F0RA 1RTLA 3A85A 2ZGHA 3AAVA 1A61H 1JWTA 1AFQC 1MAXA 1YLDA 1G30B 2ZF0H 4E7NA 3ZZ3A 2FI3E 4DIHH 1EAXA 3SU2A 1A7SA 3QTOH 4AB9A 1W8BH 1IQJA 2WV5A 4K1SA 2J34A 1SQTA 2VIVA 1G3EA 2OQ5A 1YCPM 4DOQA 5GCHF 1P2QA 4X1PU 3VB3A 1K21H 1IHSH 1PPBH 2P8OB 4MPVA 4AB8A 1H9LB 2AIQA 3UNQA 3GY4A 2STAE 1LHGH 1O2RA 1FY8E 4GHTA 1LDTT 3UNSA 1QB6A 2QY0B 2TIOA 1C9PA 5SGAE 2Q6FA 3E91A 4ISHH 4WXIA 1GL0E 2OBOA 1MD8A 3ZVEA 1HAHH 2ULLA 1O2SA 3K6YA 1GDQA 4Y6DA 2ZC9H 3T2NA 3SUEA 2V35A 1AZ8A 4NZQA 3SGBE 3U9AH 3ZVAA 2AIPA 3A84A 1GDNA 1BBRH 1U6QA 3GDVA 3MMGA 4D76A 2VWLA 4ZMAH 1TB6H 1V2KT 2Z9IA 1AY6H 5FHTA 5J4SA 1H8IH 4ZXYH 2A7CA 2ANWA 1G32B 3TLOA 1MTNC 1C1MA 4CRGA 5FPTA 4JYVH 1D6WA 3RXCA 5E0GA 2FI4E 1SGTA 2C4FH 2ESTE 4GVUA 2XW9A 4XSKU 2FMJA 1UTPA 3M7UA 1YYY1 3BTTE 1W14U 1GHBF 5C1YA 1GJ8B 2WPKS 2WYJA 4OGYA 4RN6A 4X6PA 4E7RG 2BXUH 3FANA 4NCYA 1TPPA 3ZVFA 2GVFA 1P04A 2A4QA 3A7YA 3EDXB 1IQFA 3B8JA 1GI8B 4JK5A 5BPEA 3UQVA 2A5AA 3W94A 1T32A 4AFZA 3SORA 2KAIA 3Q00A 1ANCA 3LH1A 2QIQA 2SGQE 4BTTB 4Y0ZE 1MD7A 5FX6A 3P17H 1C5SA 2CHAC 5E0HA 3U1IB 3E90B 1OWKA 4SGAE 2OBQA 2ZZUH 4MVNA 1LTOA 5FCRA 2SFAA 3W95A 1S84A 2G5VA 3BG4C 1O2ZA 1HAOH 3TVJB 2ZO3H 1GI6A 3PB1E 1F5LA 4OS5A 1A4WH 1V2RT 4J1YA 2IPHA 4MTBA 3LT3A 3K65B 1BRCE 1GHZA 1E0FD 1CO7E 2SGPE 1AVWA 2GCTC 1UHBA 1XKBC 2UWPA 4WH6A 1F0SA 2W7UA 1B0EA 3KCGH 4IC5A 1Z7KA 1C1WH 2O8WA 1SLUB 5IDKA 1AVXA 2EI8A 3GICB 3DUXH 3P70B 4WMFA 4B75A 1TNIA 4FUEA 2ODPA 1EUFA 2OC7A 4IMZA 1QR3E 1C5OH 4I31A 4NA9H 2Y5FA 2R2WU 1O0DH 2BVSH 5DO4H 2VIDA 4GPGA 3LC3A 5JDUB 3S7KB 5HM9A 2C8YB 3BN9A 2BHGA 4KP0A 1MU8B 5T6FA 5LPRA 3OYPA 2A45B 4ESTE 1TX7A 1C1SA 7GCHG 2FP7B 1V2MT 1MKXK 4OS2A 3VFEA 3H7TA 3PWCA 1HXFH 2DE9A 1TA6A 3Q3YA 1DVAH 3GCOA 5FXLA 1T7CA 2ZP0H 1F0TA 2GDDA 4NWKA 1N8OC 4NA7A 3BEFB 1LPZB 3HKJB 3D62A 4YO9A 3TH4H 1GMHG 3SU6A 3P8GA 1S82A 2FM2A 4BAMB 3AAUA 3KEEA 4BANB 4ABDA 4A1XA 1GJDB 4DW2U 3R3GB 1WUNH 1AZZA 3VXFH 2XYAA 4WXVA 3PMHB 1A1RA 4NFFA 4NSYA 5L30H 1PYTD 3MFJA 1YP9A 2IJOB 4CH8B 4DVAU 5DPAA 3Q77A 1LKAA 1W12U 3SW2B 1C1PA 1G9IE 2O8MA 1QBVH 2R9PA 3GY5A 2A4RA 3A7ZA 1BMAA 1BJVA 2OLGA 1TRNA 5A09A 3NCLA 1SGYE 1B5GH 2FLBH 4YM9A 3F9FA 3ZZ9A 4JZFH 1EOLA 5DGJA 1O2JA 2JH5D 4UFFH 3SU1A 2A4OA 4NWLA 5A0BA 4GLYA 4TY6A 2A5KA 1SLXB 5T6GA 1RTFB 2OQUA 2A32A 3BEUA 4X2YA 1CBWC 7LPRA 4B2AA 1V2NT 3L3TA 1V2QT 3ODDA 1K28D 5HM2A 1T31A 1SB1H 2RA0A 1IQHA 1TX6A 3SNCA 3PLKA 1MCTA 4ABHA 3U8OH 1UVSH 2VH0A 3TGJE 2P95A 2WPLS 2Y80A 2B9LA 4WY3A 1CU1A 1K9OE 1S0QA 1BHXB 1IQKA 3BV9B 4O9VA 1L4ZA 1K1OA 1LO6A 2IOTA 1LPKB 2FPZA 2OCVB 4YESB 5FPSA 3UFAA 1TMTH 4I8HA 1NRQH 1O2QA 1RIWC 2BM2A 5DP9A 2XWAA 1HBTH 5C67A 3RC5A 3V12A 3GCHC 1DS2E 3P95A 4FU9A 1HAVB 4MG3A 1QL9A 8GCHG 1EASA 3UOUA 1TPSA 2LPRA 1TFXA 4AGKA 4GHQA 1FI8A 3AW1A 4J2YB 5DKMA 1LQEA 3E6PH 4Y7BA 2ZCHP 4CH2B 2A4GA 3SV7A 1TRYA 4K60A 1JRSA 4NZLA 1QHRB 4X2VA 2BY6X 1SL3A 2ZCKP 1FY5A 2VVCA 3MU0A 1CA8B 1GBEA 3RMLH 4R8TB 3SU0A 3V0XA 4A92A 1C5NH 1TPAE 4AX9H 1CQQA 1C1RA 1UCYE 1P2OA 4CRCA 2BVXH 3VB6A 2BX3A 1PPHE 2PKAA 2PTNA 1TGNA 1G2MA 1G37A 3RUOA 5EG4A 4D7FA 1WAYB 2F91A 1AKSB 1DFPA 1GG6B 4UD9H 2WPHS 5GJ4B 3KF2A 1NN6A 1TNHA 3E0NB 1ELTA 1WOFA 5EPNA 2ZFFH 1GMHF 1TONA 2PHBA 1C1QA 4O3UA 4IN2A 5FCKA 1O2UA 2BQ7B 1TGSZ 1NROH 2TPIZ 3RXKA 4YTAA 4CBNA 4ISOA 4AFQA 1C2JA 3HATH 1GBMA 1FXYA 1V2TT 1NO9H 2H2ZA 1A46H 1VCQA 5FAHA 2FWWA 2A7HA 1SGDE 5C3NA 3TITA 4F4OC 4FUIA 3I77A 1HLTH 1IOEA 6LPRA 3LGWA 1YCPH 3ELAH 3MTYA 3E16B 2W7SA 5FBEA 1SGFG 3QZRA 1X7AC 3U1JB 2SGEE 3A7VA 2ZA5A 1YPMH 1OS8A 1YPEH 1HAIH 3TJVA 1T8NA 2ZDAH 1EPTA 1HAGE 3A8BA 3M7QA 4H6TA 3OX7U 1AMHA 3FVFB 1O2WA 1FQ3A 3ZYDA 1HAPH 3MH5A 2H9EH 9LPRA 1VR1H 1BOQA 2G4TA 3RLYH 2PLXA 2GGVB 1A5GH 4X1RU 1GI1A 1H4WA 1KLJH 1H9HE 3T5FH 1SGRE 2D8WA 3ZZ4A 3HPTB 3PM3A 4BXWA 4AG2A 2QYIA 5DP8A 4LK4A 3M37A 4X2XA 1SGNE 2A1DB 3ESTA 1QBOA 1BTXA 3MNCA 2BDBA 4KTUA 2M5TA 2ZU1A 1GMDG 2NU3E 1TOCB 2NU4E 2ZTZA 5T6DA 2Z3DA 3T28A 3BIUH 4XBCA 1MTVA 3LC5A 2ANYA 3RXLA 4X8UH 1IAUA 2Y82A 4MNXA 2H5CA 1P57B 4MNYA 3LH3A 2ZHDA 4BTIB 3ATMA 1C5TA 1SHYA 3FP7E 3BTME 1VJAU 2GD4B 2CV3A 4AGJA 4UEHH 1KTTB 1B0FA 2CF8H 3ZZDA 1P9SA 5LPEA 2BDCA 1A2CH 1TBQH 3Q3KA 3JZ1B 5JYIA 4X6NA 1Z8IB 1DDJA 3A83A 2HVXA 2ZDNA 1FONA 1VJ9U 3EA7A 3MHWU 3Q76A 3S9CA 2ZHFH 1BRBE 2W3IA 4ZUHA 1SFIA 2BB4A 1VITF 1K1PA 1SQOA 5GXPA 2JH0D 2ZPRA 4H6SB 1GJ4H 3QUMP 1ELVA 1P02A 1LHDH 1K1NA 2J95A 1THPB 1UJ1A 1PJPA 1O3MA 1GDUA 1FDPA 1NPMA 3FAOA 2ALPA 3UOPA 2WPIS 4IBLH 1DUEA 2BTCE 5GDSH 1O2XA 1C1VH 2AMDA 2Z9LA 3A81A 3ZZ8A 4FUFA 1FV9A 1DICA 1O5EH 1DXPA 1FPCH 1CT4E 1UMAH 1AB9C 1C1NA 2VIWA 3CS0A 1GI3A 2FOHA 2QF0A 1DY9A 1ELFA 5C5NA 1B7XB 3GISB 3FFGA 1C5YB 2JETC 2HRVA 2SGDE 3UWIA 1KLTA 1THRH 2ZQ2A 1ABJH 1P2IA 5GPIB 1VGCB 1S5SA 2FI5E 4GSOA 1Y3WA 1C2GA 1NRSH 1NT1A 2SGFE 3H7OA 2GT7A 1EJNA 3LJJA 1XXFA 1SGPE 2P59A 1WV7H 3S9AA 1ZJDA 2PW8H 3BTDE 3O8CA 1ELGA 1F92A 2AGIX 3G01A 1C5MD 4O97A 3L33A 4ZROA 1GJ7B 3BTFE 2XC4A 3MI4A 4HFPB 4K2YA 1Z8RA 5I25A 1AN1E 1GVKB 1BCUH 2ZWLH 1QJ1B 4B2CA 1K1JA 2VGCC 4LZ4B 1GCDA 3JZ2B 4I8JA 2AEIH 1BMMH 4I8LA 2FIRH 1UK4A 1O2OA 4NIVA 3GYLB 6ESTA 3KQBA 3ZZBA 1ELAA 1OP8A 2WUBA 1H1BA 1MTNB 2R2MB 3GY8A 3ZVBA 1LHEH 4Q80A 1EAUA 3NWUA 4ZXXH 1P3CA 4BOHA 1O2KA 3RM0H 2FESH 5G4BA 3O8BA 5EQSA 5AF9H 4CRFA 1AUTC 5A0CA 1BZXE 2HGTH 2JKHA 3D49H 4X8SH 2VB0A 2Y6TA 1O33A 1O36A 1ZSJA 1BTWA 1GMDF 1UK2A 2O8LA 3ITIA 4XBDA 1ZHRA 4I32A 4NA8A 1MMJN 1OP0A 1LVYA 1XXDA 5PTPA 3SJOA 4UFDH 3OY5U 2FS8A 1L1JA 1V2OT 2A7JA 1O3FA 1AWFH 2Q6GA 1C2HA 2ZPQA 1HYLA 2FOBA 2V3HH 1PQ5A 4ABJA 4AYVB 3HGPA 5TCCA 5FX5A 1O3HA 4KGAA 4X0WU 2NU0E 1FIZA 3NXPA 1A5HA 3I78A 2BY7X 5DK1A 1O37A 1DUAA 1ZOMA 3FP8E 4XE4A 1RFNA 1C1TA 1H8DH 1SGCA 2XRCA 2FOMB 4MPUA 4FXGH 3P8FA 1BBRK 1FJSA 2OC1A 3BG4B 3KNXA 1E34B 2VWMA 2A5IA 4VGCC 3EA8A 1PPEE 1ZJKA 2YOLA 4INKA 4O03A 5B6OA 1UTMA 2LNCA 1O3GA 1C5WB 5LH8A 1O39A 4XDEA 4ZKNU 2Z3CA 1TMBH 1C2DA 1O34A 3DT0H 2BDIA 2UWOA 3UY9A 2F3CE 1O3LA 1C5PA 3RXUA 1FY3A 2BQ6B 2QV1A 3IG6B 3QDZB 1GJBB 2BDAA 5H4IB 4DT7B 5C1XA 3S7HB 3GOVB