3DFJA

Crystal structure of human prostasin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
248
structure length
248
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNALYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostasin
publication title Structure of human prostasin, a target for the regulation of hypertension.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3dfjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3dfjA01
4LOYH 1EPTA 2F3CE 1OPHB 1UTJA 2BQ7B 3IITA 2ZHDA 3S7KB 3STJA 3B23B 4X8TH 1QA0A 3NCLA 2A1DB 4AG1A 1O5CB 3U9AH 1EATA 1YGCH 2J2UA 1CT4E 4B2AA 1UVOA 1Y8TA 1IQNA 2BY9X 1K1LA 1G2MA 4IN1A 3SU1A 1F5RA 1JOUB 1GGDC 2HNTF 2OC0A 4DW2U 2TGTA 2W7UA 1XUHA 1RTLA 4Y8YA 4NWLA 1V2QT 1C4V2 2UWLA 4OS5A 3RXJA 2WV5A 2FIRH 1EX3A 1A5GH 2ZCHP 1ARCA 5FX5A 1O3GA 1G32B 1SSXA 4X6PA 1UTKA 1C1SA 3ZZ7A 4BXWA 1WUNH 4K8BA 1MTSA 2VIDA 1ABIH 1NROH 1AVWA 1J17T 5A8ZA 1BTWA 4INLA 2GP9B 1V2RT 4GVUA 4NIWA 1GDQA 3PV4A 3UWIA 2VNTA 1VCQA 1T7CA 4MPVA 3A86A 4ABIA 2EI6A 3WY8A 3UIRA 1HRTH 3C27B 1AWHB 4E7NA 2G8TA 2VINA 2R2MB 4K60A 3O8CA 1TBZH 4XE4A 1PQAA 4UFEH 1J15A 4Q7YA 3ZZ8A 3RXOA 1CA0B 3M5MA 1JIMA 1ANBA 3A87A 3SJKA 1FIZA 1TE0A 3ELAH 1C5NH 3LH3A 1OP8A 4K3JA 4E7RG 1QL9A 1ZJDA 3T2NA 1HAYB 2EC9H 2ODQA 2HGTH 2BZAA 1YF4A 3PMAB 1BTPA 4Y0ZE 3V12A 1C1NA 3LC5A 1O2JA 1WAYB 3ODDA 3VB4A 3RXEA 2Y80A 4Y8XA 1O3AA 1DUEA 4I8KA 2QXGA 4NFFA 3NPSA 4AB8A 1SR5C 4WVPE 2DE9A 4KTSA 1ELCA 2A2QH 1KTSB 3UNQA 2H1UA 2OBQA 4FUIA 1D6RA 1HAOH 1GMCF 1ANEA 4R8TB 1BBRE 1GI1A 3QK1A 1JIRA 2FX4A 4XBBA 4IN2A 2Q6DA 1SLWB 4CRFA 3MNXA 3NK8A 2AMDA 2BDHA 1ZOMA 2WINI 4MDSA 4X2YA 5GCHF 4QT8C 2FEQH 3MI4A 5A09A 5B6OA 4DOQA 5EODA 3UUZA 4YOIA 3MO6A 1GBHA 1SVPA 1J8AA 1F92A 1GHXH 2FOBA 2Z9IA 2WUCA 1O3CA 1G3CA 1OWDA 5F8ZA 1O3LA 1O3KA 4YOGA 1BCUH 4YT7H 1GJ8B 3GISB 1CBWC 4X1NU 2AIQA 1F2SE 1QR3E 1KSNA 4D76A 2H2ZA 3A83A 1O38A 4O3UA 4LZ1H 1L2EA 1FY5A 2ZQ2A 1SBWA 1KXAA 1LHFH 5GWZA 2Y7ZA 1TMBH 3GDSA 2BX3A 3GCHC 1K22H 2F9UA 2ZGXH 4FUBA 1GI0A 1VITG 4MLFB 5DG6A 1F0RA 2UUKB 1UJ1A 1EKBB 1L1JA 4AORA 2BDGA 1AKSB 2GV6A 4ABJA 2D8WA 3UFAA 1GPZA 3DUXH 2F9OA 2Y81A 1T8NA 2PSYA 2H5DA 4MQAA 3BG4C 3ZVEA 1GBIA 1DUAA 1H9LB 1V2OT 1BRBE 4ZKSU 3UR6A 1G3DA 4FUHA 1BRUP 1A2CH 1CT2E 4NA7A 3VPKA 3LU9B 2BD3A 2JETB 3DHKH 5FPTA 2BD8A 4NIXA 2FO9A 1AHTH 5JPMH 1O2MA 3U1JB 4IC6A 2O8WA 1XMNB 1EJMA 4U2WA 4NG9H 3KQDA 1ZMNA 3TK9A 1O5DH 5A0CA 1GBTA 1AMHA 1SI5H 3SZNA 4FVDA 5GXPA 1TOCB 8KME2 3MTYA 3RDZA 1UVSH 1DPOA 1KLIH 3CENA 2OXSA 4DIHH 4MTBA 4INHA 1THRH 3SORA 1C2DA 3TNTA 1BDAA 2AYWA 1AD8H 1QIXB 1GHBG 5EXNA 4HI3A 5HMAA 4JZFH 3RC4A 5DKMA 1BHXB 3H7OA 3ATWA 1C1VH 2FZZA 1AGJA 4X1SU 1O5AB 1GI8B 1LHEH 2XCFA 4D9QA 2W3KA 1DLEA 3ZV9A 2ZO3H 1SB1H 3RXLA 4AZ2B 1CE5A 1D9IA 4BXSA 4Y11E 2BX4A 3F68H 1YPMH 4VGCB 2A32A 1OS8A 1IQIA 1BA8B 3PROA 3PMJA 1Z1IA 1O5GH 4Y10E 3A88A 1YPKH 4CHAB 3E91A 1YLCA 4JYTA 1HXFH 2WPMS 1YLDA 5CE1A 1T8LA 3PO1B 1DDJA 4ASHA 3PTNA 1P09A 1H9IE 1ZPBA 2FOGA 1WYKA 5FAHA 3KCGH 1ELDE 3A7ZA 5LPFA 1RD3B 2BB4A 1UCYE 2BDAA 3M7QA 1ANDA 5GJ4B 1KXFA 1YKTA 1HXEH 3M7UA 2Y5HA 1L0ZA 1ZHRA 2DUCA 2J4IA 4X6MA 2XBYA 2F83A 3F1SB 3BIVH 2J95A 4YZUA 2G81E 1BMMH 1FPCH 4TWYA 1A7SA 2VVCA 1P05A 1C2KA 1K1MA 2AEIH 4NA9H 3OY5U 1HIAA 1MTVA 2C8YB 5EG4A 1C2GA 2FS8A 1SC8U 3ZZCA 1MZAA 4RN6A 1Z8JB 3ATMA 2NU0E 4XOJA 4DIIH 1O2XA 1TGTA 1O3HA 2ZIQH 2H5CA 1MTWA 4CBNA 1GHZA 1AVGH 1GJDB 1GL1A 1MUEB 2ALPA 3U1IB 1K28D 7GCHF 1AQ7A 1WV7H 3BEFB 1BTXA 1G3BA 4CR5A 1GI9B 1O5EH 1EZXC 2G55A 2QF0A 1AO5A 2ZU2A 4O9VA 4ISOA 2OQUA 2V3HH 1CGJE 2QC2A 4RSPA 4ZMAH 3TJVA 2G51A 4SGAE 1FPHH 1BBRH 2ZGJA 1MH0A 1NM6A 2FP7B 1N8OB 4JK6A 4CRCA 5EW2H 1A46H 1O2PA 2Z6BD 5E0GA 1ZHPA 2BDIA 4H4FA 1OX1A 2GTBA 3NZIA 3RM0H 1S85A 5JYIA 1P2QA 4X6NA 4ISIH 3H7TA 3KQBA 3QO6A 4NSYA 1C1OA 4AG2A 1VITF 1SFQB 1C2FA 3GCOA 2B9LA 1EAWA 1LHDH 3LDXH 2BQWB 5E0HA 3O8RA 1S82A 3E6PH 2Y82A 4FU7A 1Q2WA 3ESTA 2ANWA 5BRRE 1QNJA 1SLXB 1LMWB 2QAAA 2O8MA 2FXRA 1O3NA 1HUTH 1ELVA 1UMAH 1NFXA 3M5NA 4B2CA 2QCYA 4DJZB 1QJ1B 4LXBH 4ZHAA 5K0HA 1HJAB 4MNXA 1TNIA 2V3OH 4I32A 4E06H 6LPRA 4TPIZ 1RGQA 2XTTB 3ZZ4A 1ANCA 1CO7E 1CGIE 1SGPE 2A7CA 1TYNA 1T8MA 2P3TB 2UUFB 1FONA 5EW1H 1VZQH 2ZTXA 1ID5H 3L6PA 1D6WA 1OWHA 5CHAC 4ABBA 3KHVA 2AFQB 4HGCA 1EB2A 3EGKH 1B5GH 4TWWA 4A1TA 2FOEA 1CGHA 2BMGB 1NT1A 3A8DA 2CV3A 2YNAA 3F9FA 3KNXA 4FUDA 5H4IB 4A5TS 2RDLA 8GCHF 5K7RA 3K6YA 1HAIH 1AB9B 2ODPA 2ZQ1A 4UEHH 4ZH8A 2ZU5A 1KXDA 4XFQA 3SHAH 5DP7A 1PPFE 1TRYA 4MNVA 2BYAX 4K2YA 3S9BA 1GHBF 2P59A 7KMEH 3LIWA 3GICB 4YT6H 1GBFA 1S0RA 3UOPA 1EOLA 1C2JA 1UHBB 5SGAE 4BAOB 4GUXA 1BTZA 3BEUA 4I8HA 1TPSA 2BDYA 2PGQB 3GY4A 1A5IA 1IOEA 2OC7A 3LGTA 4F49A 7ESTE 2RG3A 3RC5A 4UONA 1LTOA 2UWPA 3E16B 2XBWA 1P01A 3GDVA 5DP8A 3ZZ9A 1DSTA 1RIWB 3KF2A 2W26A 3HGNA 4JMYA 5C1UA 1TMUH 5L2YH 1O2WA 4I7YH 4DG4A 8ESTE 3LONA 2H9TH 4NZLA 4Y0YE 1C2IA 1WCZA 1D3PB 1FQ3A 3ITIA 1GMHF 1QBNA 4X0WU 2ZFFH 2IOTA 3UQVA 4X2VA 3MH4A 3RXVA 4FU9A 2J34A 4UFDH 2VIVA 5CMXH 4ABDA 2RA3A 4AGKA 1W11U 5J4SA 1G3EA 2A2XH 4JK5A 1MBMA 3SUEA 2WUBA 2K1QA 4ZKNU 1EZUC 1L1GA 4U32A 1AUJA 3BTFE 4YOJA 1EAUA 1LQEA 3MU1A 2P16A 1UCYH 4XSKU 1ETSH 1GI6A 1GJ7B 4Y71A 4RKJB 1SL3A 1ZMJA 5G4BA 2QXHA 4DY7B 3TH3H 1BBRK 2P8OB 2XXLA 1SQTA 1GWAA 1GHVH 3T29A 1QFKH 3ZVFA 3ZZBA 1HAXB 3L33A 1A5HA 1PQ8A 2PKSC 1OYTH 2NWNA 3MH5A 1BJVA 1CA8B 1LDTT 2VIQA 3KQCA 3NWUA 2VH0A 2WPKS 4B73A 2WPIS 1QQUA 5GPIB 3SNDA 1V2WT 1TBRH 4Z6AH 3ZZAA 1Y5AT 1C2MA 3SBKA 5I25A 2OTVA 1WBGB 3UWJH 1NS3A 3LGWA 2EI8A 1TQ0B 2GT8A 1O2KA 3A8AA 2A4QA 3UTUH 1C1QA 3TH4H 1SGFA 4AFQA 4KTUA 1GI2A 1H1BA 2GZ8A 3E3TA 4H42U 1MCVA 2UUYA 1O31A 2GCHF 1TGCA 3SGAE 4WXIA 4XBCA 1Z8GA 3RC6A 1ZLRA 2G4TA 2ZTYA 1GHAG 1HAVB 1OOKB 1PPBH 4B71A 1ABJH 1GJ6A 1T4VH 6ESTA 1V2JT 1MKXH 1P9SA 2CJIA 1LKAA 2P95A 2JH6D 1IHSH 1PPGE 2UWOA 3Q3KA 1V2NT 2FYQA 1CA0C 3IWMA 2EEKA 2FTMA 1NTPA 1IHTH 2ZECA 5A2MH 3ZZ3A 2W5EA 2OD3B 3RU4T 1C1UH 5T6DA 1TIOA 4WMFA 4AGJA 4WXVA 1XUGA 3BTTE 2BD7A 3QZQA 4MPUA 2CHAC 3ZZ6A 3BSQA 1HJ8A 1XX9A 3BTDE 3SNEA 1GBAA 2OINA 4HZHA 1GBEA 3LJJA 1KDQB 2AGIX 3SU4A 1MMJN 5AHGH 4KP0A 1AIXH 1QL8A 1PJPA 3W95A 2ZU4A 3T26A 2STBE 3MNSA 3TGJE 4CH8B 1O2GH 2QYIA 2ZPQA 1TWXB 1GCTC 1YPLH 2GZ9A 3A8CA 2ZFPH 2ZG0H 2ZGHA 2TRMA 2ZU1A 2FM2A 1KLTA 1CHOG 3MH7A 4D7FA 3SN8A 2HOBA 1MAXA 2SNWA 5L6NH 3RXFA 1RFNA 1G2LA 2OC1A 3EYDA 1TPPA 3KQEA 1JXPA 2R2WU 2HNTE 1DX5M 2C3SA 3CS7A 2FMJA 2ZP0H 4WH8A 1PYTD 1UVTH 2PGBB 3Q00A 3QTVH 3ZVCA 5A8YA 3CP7A 4GSOA 1V2TT 3Q3YA 5E2OA 1IQLA 1S5SA 1OWKA 2TIOA 2VB0A 5FXLA 1LQDB 3S0NA 1GGDB 1A1RA 2R0KA 3SUFA 3M5OA 3SHCH 3AW0A 2G00A 1E36B 3QWCH 4ZHMU 1W7XH 1NFUA 2C4FH 1FNIA 3BTKE 1UCYK 1Z71A 3U8TH 3KN2A 4JYVH 1NRRH 2ZDVH 2ZTZA 1TNLA 1S84A 4CRGA 1O3MA 1ZGVA 1FAXA 2Z3CA 7GCHG 1ZSKA 1NC6A 4WMDA 3DT0H 1O37A 3URCA 1BITA 2H9EH 2ZKSA 2SFAA 2FDAA 3P95A 1XXFA 1Z6EA 3M3TA 2JETC 2NU1E 3UREA 3T62A 2QIQA 5L30H 1PQ5A 1FN8A 1BTYA 2PTCE 3IG6B 5FPSA 3P17H 3ENSB 3P8FA 1UTMA 3VXFH 4MNWA 3JZ1B 4O03A 5HGGA 1F0UA 5F03A 3TJNA 5GDSH 4BTTB 1QB1A 1P04A 4IMZA 2FI5E 4O97A 4X8UH 2HALA 4ISLA 1UVUH 1H9HE 2D26C 5F6MA 2VVVA 1FJSA 1TGNA 3I78A 1DS2E 1K1JA 3NXPA 3OU0A 4CRDA 1P02A 1Q31A 2GDEH 2Y7XA 2LNCA 1C5UA 1GBBA 1SOTA 3GCNA 3TVJB 4OS6A 2BY6X 3HPTB 1LO6A 1V2PT 1P57B 1O34A 2XC4A 3MO3A 1UTQA 2FOHA 3GY8A 1RTKA 1KTTB 1TQ7B 2VWLA 3T5FH 5C2ZA 3K6ZA 3SU0A 1FAKH 4WWYA 1QRXA 1HAZB 1C5OH 1ETTH 3RXSA 1W12U 1P2OA 3UR9A 1B7XB 3ZYDA 3BTQE 1QBOA 1O5FH 3RXKA 1HLTH 3HK3B 3SU5A 1AZ8A 1HB0B 2FOMB 3Q3XA 4BAQB 3BN9A 4ZKRU 1D3DB 4YLUA 1GHAF 5F8XA 4FVBA 2STAE 4UE7H 6CHAC 1K9OE 2EI7A 3E8LA 1TA2A 8GCHG 1SQAA 2VIWA 2Y6TA 2CXVA 1MAYA 3SV6A 3SJ9A 1VCPA 1ACBE 1DY9A 1XXDA 1PPZA 3MU0A 3R3GB 5TJXA 1LPZB 3F6UH 1AY6H 1P2IA 1QB9A 2PKAB 2HNTC 3A82A 1GG6B 1ESBA 4O3TA 2ALVA 4ZHLU 2GD4B 1AKSA 1CBWB 4MG3A 1ZYOA 1C5XB 1XUFA 2BZ6H 3NUMA 2XRCA 3MO9A 2G4UA 1BOQA 1TX8A 2P3UB 2ZHWH 3LC3A 1GBMA 2AH4X 1XM1A 3GDUA 2FODA 3GYLB 1SFIA 3GY3A 2QA9E 1SLUB 1F5KU 1Y5UT 2ZC9H 3GCHB 2QXJA 1T4UH 1UTNA 3BTGE 4I31A 2CMYA 2ULLA 1O3IA 1GMDG 3KGPA 2ZWLH 1N6YA 4FUCA 2V6NA 4RKOB 5FCRA 3FVFB 1AFQC 3BG4B 2FTLE 1UK3A 1NY22 1QA7A 2AS9A 3RXAA 5HYOA 1U6QA 1HIAB 5FBIA 2R0LA 1GMHG 3A7TA 2BD9A 1CHOF 1DFPA 4JZDH 3TU7H 4ISNA 1GBCA 3SJ8A 2BLOA 1TLDA 2AGGX 1CHGA 2O8UA 3M3VA 4KELA 4WF8A 1EOJA 4A92A 3HKIB 1T8OA 1GVZA 1W0YH 3VB6A 2C8ZB 3U8RH 4X2WA 2A7JA 3VXEH 2OP9A 2KAIA 1P11E 2ZDLA 2R3YA 1MQ5A 1ZMLA 2ZCLP 2ZFQH 1O3JA 2D2DA 1JRTA 4JZ1A 2WPJS 1TNHA 1K2I1 4INKA 5EU8A 1P06A 2GMTC 1ZSLA 1ZPCA 1YPHE 3A84A 2VWOA 1NRNH 4AYYB 3M37A 3RXQA 5HM2A 2JH5D 1EUFA 5JBTA 3RP2A 1PPHE 3M3SA 1ZGIA 3RMOH 1TABE 1C5PA 2SGEE 4MVNA 3MMGA 1EAXA 1TNJA 2Q6FA 4K1TA 2GGVB 2FS9A 3NKKA 1UO6A 1W7GH 2Z9LA 4I8GA 3VGCB 4GHQA 1Z1JA 1V2VT 3PB1E 1OWIA 2OQ5A 1B0FA 5C1XA 2ZFRH 1QQ4A 1TA6A 1V2KT 2BXUH 2W7SA 2UUJB 3LJOA 1JRSA 4BTIB 1BTHH 4YESB 1QJ7B 4BAHB 3RLYH 2SGFE 1QB6A 5C5OA 1LVBA 3QX5H 1C1RA 2XWAA 2GCHG 1ELFA 1VGCB 3S9CA 4FUJA 3MFJA 1YPGH 2GZ7A 1DWEH 2PSXA 4FXGH 2C8XB 1O32A 3MU8A 1GI5A 1C2LA 1BMNH 1TPOA 4BOHA 1OP2A 1BMAA 1G30B 4NIVA 1FY4A 3M7TA 1G37A 2PTNA 3PMBB 1W13U 1C1PA 3DFLA 3BG8A 5C20A 4Q7ZA 3QGJA 4TYDA 1RS0A 2BLWA 5JB8S 2RCEA 1QTFA 3ODFA 4GAWA 4D9RA 1UTPA 4U01A 4YTAA 1DITH 1LVOA 2LPRA 1C5YB 1YM0A 2VU8E 2FWWA 1A0JA 1SG8B 1EZQA 2WYJA 3FP7E 1QHRB 2ZHQH 2DE8A 4IGDA 4ABHA 5LH8A 4JCNA 5DP9A 2F91A 2XC0A 2VIOA 1W10U 1P3EA 1O3PB 1A0LA 2QV1A 3GOVB 2SGPE 1W3CA 4TY7A 1WTGH 3MYWA 4ZXXH 1LVMA 1EJNA 2ZFTA 1LPKB 1AWFH 1YBWA 1D4PB 8LPRA 1BB0B 1EJAA 3EA9A 2F9BH 4X8SH 3MU4A 2PV9B 1AE5A 3RXHA 3TK5A 1E34B 3P92A 3DA9B 1AI8H 1GJCB 1GDUA 2VWMA 4MNYA 4XBDA 4ZKOU 2YOLA 4Y6DA 1NFWA 1C9PA 1FIWA 4OS7A 2Y5GA 1QCPA 2VWNA 3BEIB 2FYRA 3D23A 4THNH 3BTEE 2GCTC 1O5BB 2XCNA 1ELEE 4WJG2 3E0PB 5A8XA 1WQSA 3D65E 2NU4E 3ZYEA 1FY8E 1EAIA 5DJ7A 1LHGH 5C1YA 4WY3A 1SGQE 1YPHC 1S83A 4ABAA 4FU8A 1ARBA 4D8NA 1GMDF 1SMFE 1TALA 1HJ9A 5ESBA 4DCDA 1SGIB 1H8DH 1S6HA 4K1SA 4ZUHA 3SV2H 1FV9A 1PPCE 2PLXA 1QRZA 2OBOA 2BDCA 2PHBA 2FOAA 1O3BA 3HATH 2BY7X 4YM9A 3A7XA 3AAVA 3AAUA 1N6XA 2O8LA 1J9CH 4B74A 2GX4A 2WPHS 3SU6A 1PYTC 2VGCB 1FLEE 2ZGCA 1EXFA 3EQ0H 5CHAB 3SUDA 2BY8X 3RXRA 4XDEA 3UQOA 1TB6H 2Z3DA 4CR9A 3QZRA 5BPEA 2G5VA 5FBEA 1C5LH 4OS4A 3RXTA 3FP6E 1UHBA 3HKJB 4JZEH 1FY3A 4B2BA 1A3BH 2OCVB 3K9XB 3A89A 3UNSA 3SO3A 3PWCA 2PUQH 2B8OH 3RXDA 1UVPA 2P93A 3BTME 3Q77A 1MU8B 1EPTB 4HFPB 1ZHMA 1WSSH 1YPJH 2A45B 4NA8A 2Z9GA 1SGCA 2P94A 4BNRA 1EP6A 1P10A 2SGDE 1NU7B 1EASA 1SQOA 2A4RA 2GDDA 1Y3VA 3FZZA 2JH0D 5EPNA 2ZCKP 5GIBA 1L4ZA 3V7TA 4Y7BA 1OSSA 3M36A 1TGSZ 1ESAA 3SUGA 5EOKA 2ZDAH 3ZVDA 1F0SA 3SJIA 1KLJH 2BD5A 1TPAE 5PTPA 1C2HA 1O2ZA 3RLWH 5J4QA 4Q7XA 1JMOH 1P8VC 2PW8H 2ZU3A 1KXEA 3R0FA 5F8TA 1E35B 3ZZDA 3ATIA 1NN6A 3PLBA 2ZGBH 3S9AA 1O39A 1MTNB 2QY0B 3B9FH 1V2UT 2BD4A 3LGVA 1E38B 1XUKA 2TGDA 1VR1H 2ESTE 2B7DH 1O30A 1DWDH 1AZZA 3V0XA 1HFDA 2F9NA 1LHCH 1O2SA 3MNCA 1YC0A 1IQGA 1C1MA 1DM4B 4BTUB 1O2HA 3M61U 2A31A 3SNBA 3U98H 2AIPA 1GBLA 1AU8A 3D62A 4X2XA 1OWEA 1ZPZA 3PYHA 3P6ZB 2XC5A 1VJ9U 3OYPA 5HM9A 1O2UA 1UK4A 1P03A 1YPEH 1TBQH 1BRAA 1E0FD 1INCA 1SGFG 2ZHFH 1ZRKA 1ELAA 1AN1E 1DICA 1JBUH 2PKSB 1NESE 1HDTH 2QXIA 5ESTE 1P9UA 3M35A 1HAGE 1O3OA 4OS1A 1K1IA 1ORFA 1BUIA 2ZPRA 4AOQA 3TPIZ 1UTLM 1HAVA 1BMLA 1NZQH 3V3MA 3V13A 1KXBA 1S81A 4TY6A 1YCPH 1TRMA 4X6OA 3OX7U 4ESTE 1RTFB 5ABWA 1FI8A 1A61H 1ZRBA 3RM2H 1OYQA 2O9QA 1SHYA 2SGAA 6GCHG 1QURH 2D1JA 3PMHB 3TITA 1Z8RA 1PPEE 2A4GA 4IS5A 4B75A 5TCAA 3U8OH 3AW1A 3H5CB 3EE0B 1C2EA 2FLRH 1G9IE 1FUJA 4GLYA 4F4OC 2ZA5A 4WH6A 2Y5FA 1DVAH 1YCPM 1FDPA 3PLKA 2ZDKA 3AASA 3AVZA 4AYVB 5JB9S 1MCTA 1B0EA 1GJAB 3P70B 3RU4E 2Z9JA 3QN7A 1KDQA 1O2OA 1HGTH 1VITH 1O2LA 1WQVH 5A0BA 4A1VA 1NFYA 1GI3A 1W14U 1WOFA 2TPIZ 2Z3EA 3FP8E 3I77A 1V6DA 4D7GA 1O2IA 4ABEA 4ZROA 4CBOA 1TGBA 1TX6A 4I8LA 4K1EA 1IQMA 1GVLA 3RXCA 3MU5A 1QGFA 1WU1A 2CHAB 1RJXB 1Z8IB 4AB9A 1NPMA 4E05H 1C5WB 1LCYA 3TH2H 4GPGA 2A5IA 3GY7A 1P2MA 2NU3E 1SPJA 2XW9A 2A5KA 1KYNA 1SHHB 4ZXYH 2GVFA 4DGJA 5DP6A 2Z7FE 1N1LA 1Y5BT 2QF3A 9ESTA 2XNIA 3DD2H 3BTWE 1GCTB 2R3UA 3BIUH 4CH2B 1DOJA 1H8IH 1C9TA 2G52A 2HWLB 1MTUA 3BTHE 2GV7A 1ELTA 5EQSA 2J38A 1DANH 1OXGA 2ZPSA 1V2LT 2ZDMA 3Q76A 3RXBA 1RRKA 5IYTA 5C67A 1C4Y2 1FXYA 5EXMA 2OC8A 4UD9H 1ZJKA 1AVXA 2ZF0H 3F9EA 1C4U2 2VH6A 3BF6H 4U30A 3RMMH 5L2ZH 4Y8ZA 3E0NB 2CGAA 2YNBA 1GL0E 5LPEA 4H6TA 1SGDE 1GG6C 2FI3E 4CRAA 1A4WH 3CS0A 1D3QB 1S6FA 4FUFA 4H6SB 2Z9KA 3A81A 3TK6A 1MKXK 1C5RA 3ZVAA 4ABFA 4JYUH 2VIPA 3ZVGA 5T3HA 3URDA 3VB5A 1BRCE 3LOXA 1K21H 4BAKB 4K5ZA 5FCKA 3MOCA 1CQQA 2ANYA 1IAUA 3OTJE 1XUIA 2BVRH 1O3FA 3K65B 5JBAS 1THSH 2OLGA 4GCHF 3UNRA 1HAPH 1IQJA 1ELGA 1MKWH 1IQFA 1T32A 3O8BA 4HTCH 1ZTJA 3S7HB 1Y3YA 3EA7A 4VGCC 3VEQB 5A0AE 3SW2B 4AFZA 4I33A 2XWBI 1GJ5H 4CHAC 5HXFA 4BANB 2A7HA 1DE7H 1SGEE 2IJOB 3UPEA 1BIOA 1S0QA 3LGIA 2IPHA 3A80A 1AFEH 3PO1C 2B0FA 5LGOA 1L4DA 1C1WH 1DWCH 1HNEE 2SGQE 1UK2A 2QGRA 3SQHE 1PFXC 1M9UA 2BY5X 4UDWH 4GHTA 3E90B 4BAMB 2CF9H 3RXIA 5LPRA 1MZDA 3T25A 3VB3A 5TCCA 1QJ6B 4PROA 3RXUA 5DO4H 1YCPK 3DFJA 3SV7A 4NFEA 2FESH 3QUMP 2BQ6B 9LPRA 3OSYA 1GDNA 3LT3A 4Y76A 3QTOH 2V35A 3KIDU 3S69A 3ZVBA 1Y3XA 2CN0H 5DP3A 1C5QA 1CVWH 2C8WB 3UOUA 2BDBA 1C5VA 1HPGA 1NRPH 1HBTH 2KAIB 4FUEA 1SGRE 3O8DA 1GCDA 1F0TA 3MWIU 4B1TA 1OKXA 1GBKA 1EP5A 4IC5A 5EQRA 3SOSA 1ZTKA 1C5SA 3VB7A 1AE8H 1BT7A 4X1PU 2HPPH 5EXLA 1XKAC 1K1NA 3T27A 1P0SH 5T6FA 3W94A 1DXPA 4NSVA 2J9NA 3VGCC 4OS2A 2WYGA 3SU2A 3SU3A 5IDKA 2ZHEH 2WPLS 4MPXA 2BTCE 3SQEE 4ABGA 6GCHF 1SGNE 5DP4A 3GY2A 2PKAA 3LGUA 1Z7KA 4YO9A 3L3TA 4AFSA 2BLVA 5DGJA 1P3CA 6CHAB 1EQ9A 1QBVH 5DP5A 2ANKH 5E8EH 1VGCC 1N8OC 3HK6B 5JBBS 1IQEA 1Q3XA 4OGYA 2B5TB 2RA0A 1HAHH 1ZR0A 5AF9H 3G01A 3TGKE 1BZXE 3SNAA 3LPRA 3GCTG 1YYY1 4UFFH 2FX6A 1C5ZB 1GI4A 1J16A 1TNGA 3RUOA 5DPAA 4AN7A 3SNCA 1ELBA 1GHWH 3MNBA 1G36A 2PWXA 2XYAA 4R0IA 4SGBE 1DXWA 1FY1A 1GBJA 3SGQE 2R9PA 2ZDNA 2FI4E 4CREA 1YP9A 3P8NA 1MBQA 2A4OA 5AFYH 2I6QA 3PTBA 4LK4A 1TRNA 3A85A 4I8JA 5EQQA 1CU1A 1V2MT 2GT7A 3OY6U 4B76A 1HJAC 1TOMH 4KKDA 1GBDA 4NZQA 3SJOA 1THPB 1XVOA 4LZ4B 1ZSJA 1K1PA 1NRSH 2AGEX 2G5NA 2Q1JA 1AFQB 1RXPA 5C3NA 3TGIE 1LPGB 4Z0KA 2PR3A 2TGPZ 5E0JA 1QY6A 1NO9H 1NRQH 1O0DH 3TIUA 5C5NA 1DY8A 3FFGA 1P12E 1Z6JH 1TFXA 4IMQA 2EA3A 1WTHD 1MKWK 1MD7A 3RMLH 3TLOA 3KL6A 1FZZA 3EDXB 3C1KA 2AERH 1AB9C 2AMQA 2BHGA 2ZFSA 4NIYA 5FX6A 2J94A 1CT0E 4X1QU 4JZIA 1L1NA 1EB1H 1GJ9B 1MU6B 1MD8A 4CRBA 1TNKA 1LKBA 3EAJA 4KGAA 1ETRH 3N7OA 3PWBA 2GMTB 2CF8H 1P2KA 2GKVE 1W2KH 3TJOA 1V3XA 1VJAU 1T31A 2BD2A 3ATLA 2OUAA 1PQ7A 1OP0A 2PFEA 4Y7AA 1IQKA 5AVDA 1C5MD 1HCGA 3SGBE 3EA8A 1Y3WA 5I46H 2HLCA 1RIWC 1DLKB 3JZ2B 3RU4D 2BVSH 1O2RA 1BQYA 1W0ZU 2ANMH 2FOFA 5EGMA 2AMPA 1UTOA 3ATKA 1QL7A 2THFB 1BJUA 2SNVA 3B8JA 3F9GA 1E37B 1A0HB 2F9VA 1ESTA 3LKWA 1C5TA 2ZEBA 1P2NA 1SLVB 2VGCC 5FPYA 3SI3H 3UY9A 1K1OA 1ZTLA 2HPQH 3LH1A 4J1YA 4A1XA 1W8BH 2Z94A 1DT2A 3K2UA 2ODYB 3HGPA 2F9PA 4Y79A 3A7YA 2XBVA 3QDZB 5ETXA 2BOKA 2VJ1A 2PUXB 2BOHB 2FPZA 1O2NA 3M5LA 2NU2E 1F7ZA 1SOZA 2H9HA 4ISHH 3U69H 1AUTC 3A7WA 1TONA 1O35A 4YLQH 2ASUB 2QN5T 2P8OC 1O2VA 3SV9A 1HV7A 7LPRA 4X1RU 3I29A 5JBCS 1XVMA 1J14A 1EPTC 1CSOE 3PLPA 1Y59T 1FMGA 1O33A 3T28A 1KXCA 4Q2KA 1MQ6A 1O3DA 1QRWA 1GI7B 4FUGA 3LGYA 1V2ST 2JKHA 4DURA 2J92A 1C1TA 3FANA 1O2YA 4KTCA 2A0QB 1GJBB 3F9HA 3TJUA 1SGYE 1HYLA 1EZSC 4WMEA 5T6GA 2H6MA 5E2PA 1DSUA 3GYMA 2ILNA 3STIA 2ZI2H 4NWKA 2BM2A 4J2YB 4A6LA 2TBSA 3FAOA 2HRVA 1GMCG 3GY6A 1Y3UA 2A5AA 5FHTA 2FOCA 5AFZH 1D3TB 2W3IA 4X8VH 3A7VA 4UFGH 3MH6A 4IBLH 3MHWU 5DK1A 1MTNC 2VVUA 1VCWA 3FZDA 4DT7B 1O2QA 1OWJA 5GCHG 3D49H 2TGAA 3SI4H 1O3EA 3GCTF 1ZZZA 4DVAU 2ZNKH 1TMTH 4AFUA 2BVXH 1O2TA 5JDUB 4OGXA 1IQHA 2WV4A 3RXMA 3ZV8A 4IW4E 1GVKB 3VFEA 2HVXA 1TX7A 2M5TA 2O8TA 3P8OA 4TPYA 3QLPH 2GCTB 1O36A 3SV8A 1H4WA 3RXPA 3RMNH 1BTUA 4Q80A 1F5LA 4ZAEA 1P2JA 1A3EH 3GY5A 4NCYA 4AX9H 2C90B 2BLQA 1JWTA 1X7AC 2V0BA 1KY9A 2ZZUH 3A8BA 2IN2A 2Q6GA 1GHYH 4GCHG 3E1XB 4K69A 3ZZ5A 4A7IB 1FN6A 1BHXF 2FLBH 1XUJA 4MPWA 1TAWA 2C93B 2BXTH 5EPYA 3P8GA 3TNSA 1SGTA 3QGNB 1DWBH 3KEEA 2P3FH 4M7GA 3RXGA 1GJ4H 1XKBC 2I6SA 2XBXA 4K8YA 1KIGH 1NU9A 1LVYA 3BV9B 3PM3A 4NGAH
chains in the Genus database with same CATH superfamily
4LOYH 1EPTA 2F3CE 1OPHB 1UTJA 2BQ7B 3IITA 2ZHDA 3S7KB 3STJA 3OTPA 3B23B 4X8TH 1QA0A 3NCLA 1WXRA 2A1DB 4AG1A 1O5CB 3U9AH 1EATA 1YGCH 2J2UA 1CT4E 4B2AA 1UVOA 1Y8TA 1IQNA 2BY9X 1K1LA 1G2MA 4IN1A 3SU1A 1F5RA 1JOUB 1GGDC 2HNTF 2OC0A 4DW2U 2TGTA 2W7UA 1XUHA 1RTLA 4Y8YA 4NWLA 2LELA 3F2GA 1V2QT 1C4V2 2UWLA 4OS5A 3RXJA 2WV5A 2FIRH 1EX3A 1A5GH 2ZCHP 5DSFA 1ARCA 5FX5A 1O3GA 1G32B 2XOKD 1SSXA 4X6PA 1UTKA 1C1SA 3ZZ7A 4BXWA 1WUNH 4K8BA 1MTSA 2VIDA 1ABIH 1NROH 1AVWA 1J17T 2QF5A 1BTWA 4INLA 5A8ZA 2GP9B 2YMSC 1V2RT 4HG6A 4GVUA 4NIWA 1GDQA 3PV4A 3UWIA 2VNTA 1VCQA 1T7CA 4MPVA 3A86A 4ABIA 2EI6A 3WY8A 3UIRA 1HRTH 3C27B 1AWHB 4E7NA 2G8TA 2VINA 3WWFA 1E1RD 2R2MB 4K60A 3O8CA 1TBZH 4XE4A 1PQAA 4UFEH 1J15A 4Q7YA 3ZZ8A 3RXOA 1CA0B 3M5MA 1JIMA 1ANBA 1UW7A 3A87A 3SJKA 1FIZA 4XD7D 1TE0A 2RFKC 3ELAH 4FETA 1C5NH 3LH3A 1OP8A 4K3JA 4E7RG 1QL9A 1ZJDA 3T2NA 1HAYB 2EC9H 2ODQA 2HGTH 2BZAA 1YF4A 3PMAB 1BTPA 4Y0ZE 3V12A 1C1NA 3LC5A 1O2JA 1WAYB 3ODDA 3VB4A 3SZEA 3RXEA 3UAIC 2Y80A 4Y8XA 1O3AA 1DUEA 4I8KA 2QXGA 3AK5A 4NFFA 3NPSA 3FOAA 4AB8A 1SR5C 4WVPE 2DE9A 4KTSA 5EJZA 1ELCA 2A2QH 1KTSB 3UNQA 2H1UA 2OBQA 4FUIA 1D6RA 1HAOH 1GMCF 1ANEA 4R8TB 1BBRE 1GI1A 3QK1A 1JIRA 2FX4A 4XBBA 4IN2A 2Q6DA 1SLWB 4CRFA 3MNXA 4F55A 3NK8A 2AMDA 2BDHA 1ZOMA 2WINI 4MDSA 4X2YA 5GCHF 4QT8C 2FEQH 3MI4A 5A09A 5B6OA 4DOQA 5EODA 3UUZA 4YOIA 3MO6A 3OFND 1GBHA 1SVPA 1J8AA 1F92A 1GHXH 2FOBA 2Z9IA 2WUCA 1O3CA 1G3CA 1OWDA 5F8ZA 1O3LA 1O3KA 3OE7D 2JIZD 2KCAA 4YOGA 1BCUH 4YT7H 1GJ8B 4ASUD 3GISB 1CBWC 4X1NU 2AIQA 1F2SE 1QR3E 1KSNA 4D76A 2H2ZA 3A83A 1O38A 4O3UA 4LZ1H 1L2EA 2HLDD 1FY5A 2ZQ2A 1SBWA 1KXAA 1LHFH 2VBCA 2Y7ZA 1TMBH 5GWZA 3GDSA 2BX3A 3GCHC 1K22H 2F9UA 2ZGXH 4FUBA 1GI0A 1VITG 4MLFB 5DG6A 1F0RA 2UUKB 1UJ1A 1EKBB 1L1JA 4AORA 2BDGA 2KX4A 1AKSB 2GV6A 4ABJA 2D8WA 3UFAA 1GPZA 3DUXH 2F9OA 2Y81A 1T8NA 2PSYA 2H5DA 4MQAA 3BG4C 3ZVEA 1GBIA 1DUAA 1H9LB 1V2OT 1BRBE 4ZKSU 3UR6A 1G3DA 4FUHA 1BRUP 1A2CH 1CT2E 4NA7A 3VPKA 3LU9B 2BD3A 2JETB 3DHKH 5FPTA 2BD8A 4NIXA 2KCPA 2FO9A 2PP6A 1AHTH 5JPMH 1O2MA 3U1JB 4IC6A 2O8WA 1XMNB 1EJMA 4U2WA 4NG9H 3KQDA 1ZMNA 3TK9A 1O5DH 5A0CA 1GBTA 1AMHA 1SI5H 3SZNA 4FVDA 5GXPA 1TOCB 8KME2 3MTYA 3RDZA 1UVSH 1DPOA 1EFRD 1KLIH 3CENA 2OXSA 4DIHH 4MTBA 4INHA 1THRH 3SORA 1C2DA 3TNTA 1BDAA 2AYWA 1AD8H 1QIXB 1GHBG 5EXNA 4HI3A 5HMAA 4JZFH 3RC4A 5DKMA 1BHXB 3H7OA 4TT3D 3ATWA 1C1VH 2FZZA 1AGJA 4X1SU 4B6FA 1O5AB 1GI8B 1LHEH 2XCFA 4D9QA 2W3KA 1DLEA 3ZV9A 2ZO3H 1SB1H 3RXLA 4AZ2B 1CE5A 1D9IA 4BXSA 3GS9A 4Y11E 2BX4A 3F68H 1YPMH 4VGCB 2A32A 1OS8A 2WHXA 1IQIA 1BA8B 3PROA 5C0TA 3PMJA 1Z1IA 1O5GH 4Y10E 3A88A 1YPKH 4CHAB 3E91A 1YLCA 4JYTA 1HXFH 2WPMS 1YLDA 5CE1A 1T8LA 3PO1B 1DDJA 4ASHA 3PTNA 1P09A 1H9IE 1ZPBA 2FOGA 1WYKA 5FAHA 3KCGH 1ELDE 3A7ZA 2JDID 5LPFA 1RD3B 2BB4A 1UCYE 2BDAA 3M7QA 1ANDA 5GJ4B 1KXFA 1YKTA 1HXEH 3M7UA 2Y5HA 1L0ZA 1ZHRA 2DUCA 2J4IA 4X6MA 2XBYA 2F83A 3F1SB 3BIVH 2J95A 4YZUA 2G81E 1BMMH 1FPCH 4TWYA 1A7SA 2VVCA 1P05A 1C2KA 1K1MA 2AEIH 4NA9H 3OY5U 1HIAA 1MTVA 2C8YB 5EG4A 1C2GA 2FS8A 1SC8U 2L74A 2JJ2D 1MZAA 4RN6A 3ZZCA 1Z8JB 3ATMA 2NU0E 4XOJA 4DIIH 1O2XA 1TGTA 2LP6A 1O3HA 2ZIQH 2H5CA 5EJLA 1MTWA 4CBNA 1GHZA 1AVGH 1GJDB 1GL1A 1MUEB 2ALPA 3U1IB 1K28D 7GCHF 1AQ7A 1WV7H 3BEFB 1BTXA 5F53A 1G3BA 4CR5A 1GI9B 1O5EH 1EZXC 2G55A 2QF0A 1AO5A 2ZU2A 4O9VA 4ISOA 2OQUA 2V3HH 1CGJE 2QC2A 4RT0A 4RSPA 4ZMAH 3TJVA 2G51A 4SGAE 1FPHH 1BBRH 2ZGJA 1MH0A 1NM6A 2FP7B 1N8OB 4JK6A 4CRCA 1KMHB 1A46H 5EW2H 1O2PA 2WZQA 2Z6BD 5E0GA 1ZHPA 2BDIA 2M2AA 4H4FA 1OX1A 2GTBA 3NZIA 3RM0H 1S85A 5JYIA 1P2QA 4X6NA 4ISIH 3H7TA 3KQBA 3QO6A 4NSYA 1C1OA 4AG2A 1VITF 1SFQB 1C2FA 3GCOA 2B9LA 1EAWA 1LHDH 3LDXH 2BQWB 5E0HA 3O8RA 1S82A 3E6PH 2Y82A 4FU7A 1Q2WA 3ESTA 2ANWA 5BRRE 1QNJA 1SLXB 1LMWB 2QAAA 2O8MA 2FXRA 1O3NA 1HUTH 1ELVA 1UMAH 1NFXA 3M5NA 4B2CA 2QCYA 4DJZB 1QJ1B 4LXBH 4ZHAA 5K0HA 1HJAB 4MNXA 1TNIA 2V3OH 4I32A 4E06H 6LPRA 4TPIZ 1RGQA 2XTTB 3ZZ4A 5HKKD 1ANCA 1CO7E 1CGIE 1SGPE 2A7CA 1TYNA 1T8MA 2P3TB 2UUFB 1FONA 5EW1H 3DSPA 2J97A 1VZQH 2ZTXA 1ID5H 3L6PA 1D6WA 1OWHA 5CHAC 4ABBA 3KHVA 2AFQB 4HGCA 1EB2A 3EGKH 1B5GH 4TWWA 4A1TA 2FOEA 1CGHA 2BMGB 1NT1A 3A8DA 2CV3A 2YNAA 3F9FA 3KNXA 4FUDA 5H4IB 4A5TS 2RDLA 5KEDA 2J5UA 8GCHF 5K7RA 3K6YA 1HAIH 1AB9B 2ODPA 2ZQ1A 4UEHH 4ZH8A 2ZU5A 1KXDA 4XFQA 3SHAH 5DP7A 4FOUC 1PPFE 1TRYA 4MNVA 2BYAX 4K2YA 3S9BA 1GHBF 1H8ED 2P59A 7KMEH 3LIWA 3GICB 4YT6H 1GBFA 1S0RA 3UOPA 1EOLA 1C2JA 1UHBB 5SGAE 4BAOB 4GUXA 1BTZA 3BEUA 4I8HA 1TPSA 2BDYA 2PGQB 3GY4A 1A5IA 1IOEA 2OC7A 3LGTA 4F49A 7ESTE 2RG3A 3RC5A 4UONA 1LTOA 2UWPA 3E16B 2XBWA 1P01A 3GDVA 5DN6D 5DP8A 3ZZ9A 1DSTA 1RIWB 3KF2A 2W26A 3HGNA 4JMYA 5C1UA 1TMUH 5L2YH 1O2WA 4I7YH 4DG4A 4ACBA 8ESTE 3LONA 2H9TH 4NZLA 4Y0YE 1C2IA 1WCZA 1D3PB 1FQ3A 3ITIA 1GMHF 1QBNA 4X0WU 2ZFFH 2IOTA 3UQVA 4X2VA 3MH4A 3RXVA 4FU9A 2J34A 4UFDH 3PV2A 2VIVA 5CMXH 4OM9A 4ABDA 2RA3A 4AGKA 1W11U 5J4SA 1G3EA 2A2XH 4JK5A 1MBMA 3SUEA 2WUBA 2K1QA 4ZKNU 1EZUC 1L1GA 4U32A 1AUJA 3BTFE 4YOJA 1EAUA 1LQEA 3MU1A 2P16A 1UCYH 4XSKU 1ETSH 1GI6A 1GJ7B 4Y71A 4RKJB 1SL3A 1ZMJA 5G4BA 2QXHA 4DY7B 3TH3H 1BBRK 2P8OB 2XXLA 1SQTA 1GWAA 1NBME 2WPDD 1GHVH 3T29A 5HIZA 1QFKH 3ZVFA 3U28C 2QF4A 3ZZBA 2JJ1D 1HAXB 3L33A 1A5HA 1PQ8A 2PKSC 1OYTH 2NWNA 3MH5A 1BJVA 1CA8B 1LDTT 2VIQA 3KQCA 3NWUA 2VH0A 2WPKS 4B73A 2WPIS 1QQUA 4XRNA 5GPIB 3SNDA 1V2WT 1TBRH 4Z6AH 3ZZAA 1Y5AT 1C2MA 3SBKA 5I25A 2OTVA 1WBGB 3WWBA 3UWJH 1NS3A 3LGWA 2EI8A 1TQ0B 2GT8A 1O2KA 3A8AA 2A4QA 3UTUH 1C1QA 3TH4H 1SGFA 4AFQA 4KTUA 1GI2A 1H1BA 2GZ8A 3E3TA 4H42U 1MCVA 2UUYA 1O31A 1VKYA 2GCHF 1TGCA 3SGAE 4B6EA 4WXIA 4XBCA 1Z8GA 3RC6A 1ZLRA 1YY3A 2G4TA 2ZTYA 1GHAG 1HAVB 1OOKB 1PPBH 4B71A 1ABJH 1GJ6A 1T4VH 6ESTA 1V2JT 1MKXH 1P9SA 2K8IA 2CJIA 1LKAA 2P95A 2JH6D 1IHSH 1PPGE 2UWOA 3Q3KA 1V2NT 2FYQA 1CA0C 3IWMA 2EEKA 2FTMA 2V3MA 1NTPA 1IHTH 2ZECA 5A2MH 3ZZ3A 2W5EA 2OD3B 3RU4T 1C1UH 5T6DA 1TIOA 4WMFA 4AGJA 4WXVA 1XUGA 3BTTE 1YWUA 2BD7A 3QZQA 1OHHD 4MPUA 1H8HD 1SQRA 2CHAC 3ZZ6A 3BSQA 1HJ8A 1XX9A 3BTDE 3SNEA 1GBAA 2OINA 4HZHA 1GBEA 3LJJA 1KDQB 2AGIX 3SU4A 1MMJN 5AHGH 4KP0A 1AIXH 1QL8A 1PJPA 3W95A 2ZU4A 3T26A 2STBE 3MNSA 3TGJE 4CH8B 1O2GH 2QYIA 2ZPQA 1TWXB 1GCTC 1YPLH 2GZ9A 3A8CA 2ZFPH 2ZG0H 2ZGHA 2TRMA 2ZU1A 2FM2A 1KLTA 1CHOG 3MH7A 4D7FA 3SN8A 2HOBA 1MAXA 2SNWA 5L6NH 3RXFA 1RFNA 1G2LA 2OC1A 3EYDA 1TPPA 3KQEA 2QE7D 1JXPA 2R2WU 2HNTE 1DX5M 2C3SA 3CS7A 2FMJA 2ZP0H 4Z1MD 4WH8A 1PYTD 1UVTH 2PGBB 3Q00A 3QTVH 3ZVCA 5A8YA 3CP7A 4GSOA 1V2TT 3Q3YA 5E2OA 1IQLA 1S5SA 1OWKA 2TIOA 2VB0A 5FXLA 1LQDB 3S0NA 1GGDB 1A1RA 2R0KA 3SUFA 3M5OA 3SHCH 3AW0A 2G00A 1E36B 3QWCH 4ZHMU 1W7XH 1NFUA 2C4FH 1FNIA 3DCLA 3BTKE 1UCYK 1Z71A 3U8TH 3KN2A 4JYVH 1NRRH 2ZDVH 2ZTZA 1TNLA 1S84A 4CRGA 1O3MA 1ZGVA 1FAXA 2Z3CA 4P00A 2KCYA 7GCHG 1ZSKA 1NC6A 4WMDA 3DT0H 1O37A 3URCA 1BITA 2H9EH 1E79D 2YMSB 2SFAA 2ZKSA 2FDAA 3P95A 1XXFA 4DT4A 1Z6EA 3M3TA 2JETC 2NU1E 3UREA 3T62A 2QIQA 5L30H 1PQ5A 2F43B 3F0OA 1FN8A 1BTYA 2PTCE 3IG6B 5FPSA 3P17H 3ENSB 3P8FA 1UTMA 3VXFH 4MNWA 3JZ1B 4O03A 5HGGA 1F0UA 5F03A 3TJNA 5GDSH 4BTTB 1QB1A 1P04A 4IMZA 2FI5E 4O97A 3N7DA 4X8UH 2HALA 4ISLA 3PRBA 1UVUH 1H9HE 2D26C 5F6MA 2VVVA 1FJSA 1TGNA 3I78A 1DS2E 1K1JA 3NXPA 3FN8A 3OU0A 4CRDA 1P02A 1Q31A 2GDEH 2Y7XA 1C5UA 2LNCA 4ACAA 1GBBA 1SOTA 3GCNA 3TVJB 4OS6A 1W0JD 2HVYB 2BY6X 3HPTB 1LO6A 1V2PT 1P57B 1O34A 2XC4A 3MO3A 1UTQA 2FOHA 5B6LA 3GY8A 1RTKA 1KTTB 1TQ7B 2VWLA 3T5FH 5C2ZA 3K6ZA 3SU0A 1FAKH 4WWYA 1QRXA 1HAZB 1C5OH 1ETTH 3RXSA 1W12U 1P2OA 3UR9A 1B7XB 3ZYDA 3BTQE 1QBOA 1O5FH 3RXKA 4M9FA 1HLTH 3HK3B 3SU5A 1AZ8A 1HB0B 2FOMB 3Q3XA 4BAQB 3BN9A 4ZKRU 1D3DB 4YLUA 1GHAF 5F8XA 4FVBA 2STAE 4UE7H 6CHAC 1K9OE 2EI7A 3E8LA 1TA2A 8GCHG 1SQAA 2VIWA 2Y6TA 2CXVA 1MAYA 3SV6A 3SJ9A 1VCPA 1ACBE 1DY9A 1XXDA 1PPZA 3MU0A 3R3GB 5TJXA 1LPZB 3F6UH 1AY6H 1P2IA 1QB9A 3PV5A 2PKAB 2HNTC 3A82A 1GG6B 1ESBA 4O3TA 2ALVA 4ZHLU 2GD4B 1AKSA 1CBWB 4MG3A 1ZYOA 1C5XB 1XUFA 2BZ6H 3NUMA 2KFWA 2XRCA 3MO9A 2G4UA 3KQ5A 1BOQA 1TX8A 2P3UB 2ZHWH 3LC3A 1COWD 1GBMA 2OK5A 2AH4X 1XM1A 3GDUA 2FODA 3GYLB 1SFIA 3GY3A 2QA9E 1SLUB 1F5KU 1Y5UT 2ZC9H 3GCHB 2QXJA 1T4UH 1UTNA 3BTGE 4I31A 2CMYA 2ULLA 1O3IA 1WDIA 2K0QA 1GMDG 3KGPA 2ZWLH 1N6YA 4FUCA 2V6NA 5T1VA 4RKOB 5FCRA 3FVFB 1AFQC 1NBMD 3BG4B 2FTLE 1UK3A 1NY22 1QA7A 2AS9A 3RXAA 5HYOA 1U6QA 1HIAB 5FBIA 2R0LA 1GMHG 3A7TA 2BD9A 1CHOF 1DFPA 4JZDH 4RT1A 4ISNA 3TU7H 1GBCA 3SJ8A 2BLOA 1TLDA 2AGGX 1CHGA 2O8UA 3M3VA 4KELA 2EQNA 1EOJA 4WF8A 4A92A 3HKIB 1T8OA 1GVZA 1W0YH 3VB6A 2C8ZB 3U8RH 4X2WA 2A7JA 3VXEH 2OP9A 2KAIA 1P11E 2ZDLA 2R3YA 1MQ5A 1ZMLA 2ZCLP 2ZFQH 1O3JA 2D2DA 1JRTA 4JZ1A 2WPJS 1TNHA 1K2I1 4INKA 5EU8A 1P06A 2GMTC 1ZSLA 1ZPCA 1YPHE 2F4LA 3A84A 2VWOA 1NRNH 4AYYB 3M37A 3RXQA 5HM2A 2JH5D 1EUFA 5JBTA 3RP2A 1PPHE 3M3SA 1ZGIA 3RMOH 1TABE 1C5PA 2SGEE 4MVNA 3MMGA 1EAXA 1TNJA 2Q6FA 4K1TA 2GGVB 2FS9A 3NKKA 1UO6A 1W7GH 3N7EA 2Z9LA 4I8GA 3VGCB 4GHQA 1Z1JA 1V2VT 3PB1E 1OWIA 2OQ5A 1B0FA 5C1XA 2ZFRH 1QQ4A 1TA6A 1V2KT 2BXUH 2W7SA 2UUJB 3LJOA 1JRSA 4BTIB 1BTHH 4YESB 1QJ7B 4BAHB 3RLYH 2SGFE 1QB6A 5C5OA 1LVBA 3QX5H 1C1RA 2XWAA 2GCHG 1ELFA 1VGCB 3S9CA 4FUJA 3MFJA 1YPGH 2GZ7A 1DWEH 2PSXA 4FXGH 2C8XB 1O32A 3MU8A 1GI5A 1C2LA 1BMNH 1TPOA 4BOHA 1OP2A 1BMAA 1G30B 4NIVA 1FY4A 3M7TA 1G37A 2PTNA 3PMBB 5EIYA 1W13U 1C1PA 3DFLA 3BG8A 5C20A 4Q7ZA 3QGJA 4TYDA 1RS0A 2BLWA 3SYJA 5JB8S 2RCEA 1QTFA 3ODFA 4GAWA 4D9RA 1UTPA 4U01A 4YTAA 1DITH 1LVOA 2LPRA 1C5YB 1YM0A 2VU8E 2FWWA 1A0JA 1SG8B 1EZQA 2WYJA 3FP7E 2W6ID 1QHRB 2V7QD 2ZHQH 2DE8A 4IGDA 4ABHA 5LH8A 4JCNA 5DP9A 3WW7A 2F91A 2XC0A 2VIOA 1W10U 1P3EA 1O3PB 1A0LA 2QV1A 3GOVB 2SGPE 1W3CA 4TY7A 1WTGH 3MYWA 4ZXXH 1LVMA 1EJNA 2ZFTA 1LPKB 1AWFH 1YBWA 1D4PB 8LPRA 1BB0B 1EJAA 3EA9A 2F9BH 4X8SH 3MU4A 2PV9B 1AE5A 3RXHA 3TK5A 1E34B 3P92A 3DA9B 1AI8H 1GJCB 1GDUA 2VWMA 4MNYA 4XBDA 4ZKOU 2YOLA 4Y6DA 1NFWA 1C9PA 1FIWA 2KCOA 4OS7A 1FX0B 2Y5GA 1QCPA 2VWNA 3BEIB 2FYRA 3D23A 4THNH 3BTEE 2GCTC 4AC9A 1O5BB 2XCNA 1ELEE 4WJG2 3E0PB 5A8XA 1WQSA 3D65E 2NU4E 3ZYEA 1FY8E 1EAIA 5DJ7A 1LHGH 5C1YA 4WY3A 1SGQE 1YPHC 3VG8A 1S83A 4ABAA 4FU8A 1ARBA 4D8NA 1GMDF 1SMFE 1TALA 1HJ9A 5ESBA 2KZ4A 4DCDA 1SGIB 1H8DH 1S6HA 4K1SA 4ZUHA 3SV2H 1FV9A 1PPCE 2GJGA 2PLXA 1QRZA 2OBOA 2BDCA 2IPQX 2PHBA 2FOAA 2J98B 1O3BA 3HATH 2BY7X 4YM9A 3A7XA 3AAVA 3NRLA 3AAUA 1N6XA 2O8LA 1J9CH 4B74A 2GX4A 2WPHS 3SU6A 1PYTC 2VGCB 1FLEE 2ZGCA 1EXFA 3EQ0H 5CHAB 3SUDA 2BY8X 3RXRA 4XDEA 3UQOA 1TB6H 2Z3DA 3FO8D 4CR9A 3QZRA 5BPEA 2G5VA 5FBEA 1C5LH 4OS4A 3RXTA 3FP6E 1UHBA 3FKSD 3HKJB 4JZEH 1FY3A 4B2BA 1A3BH 2OCVB 3K9XB 3A89A 2CK3D 3UNSA 3SO3A 3PWCA 2PUQH 2B8OH 3RXDA 1UVPA 2P93A 3BTME 3Q77A 1MU8B 1EPTB 4HFPB 1ZHMA 1WSSH 1YPJH 2A45B 4NA8A 2Z9GA 1SGCA 2P94A 4BNRA 1EP6A 1P10A 2SGDE 2GDDA 1NU7B 1EASA 1SQOA 2A4RA 1K0HA 1Y3VA 3FZZA 2JH0D 5EPNA 2ZCKP 5GIBA 1L4ZA 3KYFA 3V7TA 4Y7BA 1OSSA 3M36A 1TGSZ 1ESAA 3SUGA 5EOKA 2ZDAH 3ZVDA 1F0SA 3DSGA 3SJIA 1KLJH 2BD5A 1TPAE 5PTPA 1C2HA 1O2ZA 3RLWH 5J4QA 4Q7XA 1JMOH 1P8VC 2PW8H 2ZU3A 1KXEA 3R0FA 5F8TA 1E35B 3ZZDA 3ATIA 1NN6A 3PLBA 2ZGBH 3S9AA 1O39A 1MTNB 2QY0B 3B9FH 1V2UT 2BD4A 3LGVA 1E38B 1XUKA 2TGDA 1VR1H 2ESTE 2B7DH 1O30A 3EE7A 3F2HA 1DWDH 1AZZA 3V0XA 1HFDA 2F9NA 1LHCH 1O2SA 3MNCA 1YC0A 1IQGA 1C1MA 1DM4B 5KGOA 1O2HA 3M61U 4BTUB 2A31A 3SNBA 3U98H 2AIPA 1GBLA 1AU8A 3D62A 4X2XA 3H09A 1OWEA 1ZPZA 3PYHA 4YXWD 5IK2D 3P6ZB 2XC5A 1VJ9U 3OYPA 2W6JD 5HM9A 1O2UA 1UK4A 1P03A 1YPEH 1TBQH 1BRAA 1E0FD 5C0UA 1INCA 1SGFG 2ZHFH 1ZRKA 1ELAA 1AN1E 1DICA 1JBUH 2PKSB 1NESE 1HDTH 2QXIA 5ESTE 1QZ8A 1P9UA 3M35A 1HAGE 1O3OA 4OS1A 1K1IA 1ORFA 1BUIA 2ZPRA 4AOQA 5C94A 3TPIZ 1UTLM 1HAVA 1BMLA 1NZQH 4TSFD 3V3MA 3V13A 1KXBA 1S81A 4TY6A 1YCPH 1TRMA 1E1QD 4X6OA 3OX7U 4ESTE 1RTFB 5ABWA 1FI8A 1A61H 1ZRBA 3RM2H 1OYQA 2O9QA 1SHYA 2SGAA 2RDEA 6GCHG 1QURH 2D1JA 3PMHB 3TITA 1Z8RA 1PPEE 2A4GA 4IS5A 4B75A 5TCAA 3U8OH 3AW1A 3H5CB 3EE0B 1C2EA 2FLRH 1G9IE 1FUJA 4GLYA 4F4OC 2ZA5A 4WH6A 2Y5FA 1DVAH 1YCPM 1FDPA 3PLKA 2ZDKA 3AASA 3AVZA 4AYVB 3CNRA 5JB9S 1MCTA 1B0EA 1GJAB 3P70B 3RU4E 2Z9JA 3QN7A 1KDQA 1O2OA 1HGTH 1VITH 1O2LA 1WQVH 5A0BA 4A1VA 1NFYA 1GI3A 1W14U 1WOFA 2TPIZ 2Z3EA 3FP8E 3I77A 1V6DA 4D7GA 1O2IA 4ABEA 4ZROA 4CBOA 1TGBA 1TX6A 4I8LA 4K1EA 1IQMA 1GVLA 1YLNA 3RXCA 3MU5A 1QGFA 1WU1A 2CHAB 1RJXB 1Z8IB 4AB9A 1NPMA 4E05H 1C5WB 1LCYA 3TH2H 4GPGA 2A5IA 3GY7A 1P2MA 2NU3E 1SPJA 2XW9A 2A5KA 1KYNA 1SHHB 4ZXYH 2GVFA 4DGJA 5DP6A 2Z7FE 1N1LA 1Y5BT 2QF3A 1SKYE 9ESTA 2XNIA 3DD2H 3BTWE 1GCTB 2R3UA 3BIUH 4CH2B 1DOJA 1H8IH 1C9TA 2G52A 2HWLB 1MTUA 3BTHE 2GV7A 1ELTA 5EQSA 2J38A 1DANH 1OXGA 2ZPSA 1V2LT 3PRDA 2ZDMA 3F2FA 3Q76A 3RXBA 1RRKA 5IYTA 5C67A 1C4Y2 1FXYA 5EXMA 2OC8A 4UD9H 3OAAD 1ZJKA 1AVXA 2ZF0H 3F3BA 3F9EA 1C4U2 2VH6A 3BF6H 4U30A 3RMMH 5L2ZH 4Y8ZA 3E0NB 2CGAA 5C17A 2YNBA 1GL0E 5LPEA 4H6TA 1SGDE 1GG6C 2FI3E 4CRAA 1A4WH 3CS0A 1D3QB 1S6FA 2L6OA 4FUFA 4H6SB 2Z9KA 3A81A 2WV9A 3TK6A 1MKXK 1C5RA 3ZVAA 4ABFA 4JYUH 2VIPA 3ZVGA 4Q63A 5T3HA 4P02A 3URDA 3VB5A 1BRCE 3LOXA 1K21H 4BAKB 4K5ZA 5FCKA 3MOCA 1CQQA 2ANYA 1IAUA 3OTJE 1XUIA 2BVRH 1O3FA 3K65B 5JBAS 1THSH 2OLGA 4GCHF 3UNRA 1HAPH 1IQJA 1ELGA 1MKWH 1IQFA 1T32A 3O8BA 4HTCH 1ZTJA 3S7HB 1Y3YA 3EA7A 4VGCC 3VEQB 5A0AE 3SW2B 4AFZA 4I33A 3F0PA 2XWBI 1GJ5H 4CHAC 5HXFA 4BANB 2A7HA 1DE7H 1SGEE 2IJOB 3UPEA 1BIOA 1S0QA 3LGIA 2IPHA 3A80A 1AFEH 3PO1C 2B0FA 5LGOA 1L4DA 1C1WH 1DWCH 1HNEE 2SGQE 5CHBA 1UK2A 2QGRA 3SQHE 1PFXC 1M9UA 2BY5X 4UDWH 4GHTA 3E90B 4BAMB 2CF9H 4Q4LA 3RXIA 5LPRA 3DSOA 1MZDA 3T25A 2KR7A 3VB3A 5TCCA 2WSSD 1QJ6B 5GNDA 4PROA 4F48B 3RXUA 5DO4H 1YCPK 3MQKC 2YMSD 3DFJA 3SV7A 4NFEA 2FESH 3QUMP 2BQ6B 9LPRA 3OSYA 1GDNA 3LT3A 4Y76A 3QTOH 2V35A 3KIDU 3S69A 3ZVBA 1Y3XA 2CN0H 5DP3A 1C5QA 1CVWH 3OEED 2C8WB 3UOUA 2BDBA 1C5VA 1HPGA 1NRPH 1HBTH 2KAIB 4FUEA 1SGRE 3O8DA 1GCDA 1F0TA 3MWIU 4B1TA 1OKXA 3N99A 1GBKA 1EP5A 4IC5A 5EQRA 3SOSA 3OEHD 1W0KD 1ZTKA 1C5SA 3VB7A 1AE8H 1BT7A 4X1PU 2HPPH 5EXLA 1XKAC 1K1NA 3T27A 1P0SH 5T6FA 3W94A 1DXPA 4NSVA 2J9NA 3VGCC 4OS2A 2WYGA 3SU2A 3SU3A 5IDKA 2ZHEH 2WPLS 4MPXA 2BTCE 3SQEE 4ABGA 6GCHF 1SGNE 5DP4A 3GY2A 2PKAA 3LGUA 1Z7KA 4YO9A 3L3TA 4AFSA 2BLVA 5DGJA 1P3CA 6CHAB 1EQ9A 1QBVH 5DP5A 2ANKH 5E8EH 4I86A 1VGCC 1N8OC 3HK6B 5JBBS 1IQEA 1Q3XA 4OGYA 2B5TB 2RA0A 1HAHH 1ZR0A 5AF9H 3G01A 3TGKE 1BZXE 3ZIAD 3SNAA 2EY4C 3LPRA 3GCTG 1YYY1 4UFFH 2FX6A 1C5ZB 1GI4A 1J16A 1TNGA 3RUOA 5DPAA 4AN7A 5CDFE 3SNCA 1ELBA 1GHWH 3MNBA 1G36A 2PWXA 2XYAA 4R0IA 4SGBE 1DXWA 1FY1A 3KYGA 1GBJA 3SGQE 2R9PA 2ZDNA 2FI4E 4CREA 1YP9A 3P8NA 1MBQA 2A4OA 5AFYH 2I6QA 3PTBA 4LK4A 1TRNA 3A85A 4I8JA 5EQQA 1CU1A 1V2MT 2GT7A 3OY6U 4B76A 1HJAC 1TOMH 4KKDA 1GBDA 4NZQA 3SJOA 1THPB 1XVOA 4LZ4B 1ZSJA 1K1PA 1NRSH 2AGEX 2G5NA 2Q1JA 1AFQB 1RXPA 5C3NA 3TGIE 1LPGB 4Z0KA 2PR3A 2TGPZ 5E0JA 1QY6A 1NO9H 1NRQH 1O0DH 3TIUA 2KM0A 5C5NA 1DY8A 3FFGA 1P12E 1Z6JH 1TFXA 4IMQA 2EA3A 1WTHD 1MABB 1MKWK 1MD7A 3RMLH 3TLOA 3KL6A 1FZZA 3EDXB 3C1KA 2AERH 1AB9C 5HIYA 2AMQA 2BHGA 2ZFSA 4NIYA 5FX6A 4RI0A 2J94A 1CT0E 4X1QU 4JZIA 1L1NA 1EB1H 1GJ9B 1MU6B 1MD8A 4CRBA 1TNKA 1LKBA 3EAJA 4KGAA 1ETRH 3N7OA 3PWBA 2GMTB 2CF8H 1P2KA 2GKVE 1W2KH 3TJOA 1V3XA 1VJAU 1T31A 2BD2A 3ATLA 2OUAA 2AHME 1PQ7A 1OP0A 2PFEA 4Y7AA 1IQKA 5AVDA 1C5MD 1HCGA 3SGBE 3EA8A 5FL7D 5EJ1A 1Y3WA 5I46H 2HLCA 1RIWC 1DLKB 3JZ2B 3RU4D 2BVSH 1O2RA 1BQYA 1W0ZU 2ANMH 2FOFA 5EGMA 2AMPA 1UTOA 3ATKA 1QL7A 2THFB 1BJUA 2SNVA 3B8JA 3F9GA 1E37B 1A0HB 2F9VA 1ESTA 3LKWA 1C5TA 2ZEBA 1P2NA 1SLVB 2VGCC 5FPYA 3SI3H 3UY9A 1K1OA 1ZTLA 2HPQH 3LH1A 4J1YA 4A1XA 1W8BH 2Z94A 1DT2A 3K2UA 2ODYB 3HGPA 2F9PA 4Y79A 3A7YA 2XBVA 3QDZB 5ETXA 2BOKA 2VJ1A 2PUXB 2BOHB 2FPZA 1O2NA 3M5LA 2NU2E 1F7ZA 1SOZA 2H9HA 4ISHH 3U69H 1AUTC 3A7WA 1TONA 1O35A 4YLQH 2ASUB 2QN5T 2P8OC 1O2VA 3SV9A 1HV7A 7LPRA 4X1RU 3I29A 5JBCS 1XVMA 1J14A 1EPTC 1CSOE 3PLPA 1Y59T 1FMGA 1O33A 3T28A 1KXCA 4Q2KA 1MQ6A 1O3DA 1QRWA 1GI7B 4FUGA 3LGYA 1V2ST 2JKHA 4DURA 2J92A 1C1TA 3FANA 1O2YA 4KTCA 2A0QB 1GJBB 3F9HA 3TJUA 1SGYE 1HYLA 1EZSC 4WMEA 2IJD1 5T6GA 2H6MA 5E2PA 1DSUA 3GYMA 2ILNA 3STIA 1S6LA 2ZI2H 4NWKA 2BM2A 4J2YB 4A6LA 2TBSA 3FAOA 2HRVA 1GMCG 3GY6A 1Y3UA 2A5AA 5FHTA 2FOCA 5AFZH 1D3TB 2W3IA 4X8VH 3A7VA 4UFGH 3MH6A 4IBLH 3MHWU 5DK1A 1MTNC 2VVUA 5KECA 1VCWA 3FZDA 4DT7B 1O2QA 1OWJA 5GCHG 3D49H 2TGAA 3SI4H 1O3EA 3W1EA 3GCTF 1ZZZA 4DVAU 2ZNKH 1TMTH 4AFUA 2BVXH 1O2TA 5JDUB 4OGXA 1IQHA 2WV4A 3RXMA 3ZV8A 4IW4E 1GVKB 3VFEA 2HVXA 1TX7A 2M5TA 2O8TA 3P8OA 4TPYA 3QLPH 2GCTB 1O36A 3SV8A 1H4WA 3RXPA 4ZCNA 3RMNH 1BTUA 4Q80A 1F5LA 4ZAEA 1P2JA 1A3EH 3GY5A 4NCYA 4AX9H 2J98A 2C90B 2BLQA 1JWTA 1X7AC 2V0BA 1KY9A 2ZZUH 3A8BA 2IN2A 2Q6GA 3UB0A 1GHYH 4GCHG 3E1XB 4K69A 3ZZ5A 1BMFD 4A7IB 1FN6A 1BHXF 2FLBH 1XUJA 4MPWA 1TAWA 2C93B 2BXTH 5EPYA 3P8GA 3TNSA 1SGTA 3QGNB 1DWBH 3KEEA 2P3FH 4M7GA 3RXGA 1GJ4H 1XKBC 2I6SA 2XBXA 4K8YA 1KIGH 1NU9A 2XNDD 1LVYA 3BV9B 3PM3A 4NGAH
chains in the Genus database with same CATH topology
4LOYH 1EPTA 2F3CE 1OPHB 1UTJA 2BQ7B 3IITA 2ZHDA 3S7KB 3STJA 3B23B 4X8TH 1QA0A 3NCLA 2A1DB 4AG1A 1O5CB 3U9AH 1EATA 1YGCH 2J2UA 1CT4E 4B2AA 1UVOA 1Y8TA 1IQNA 2BY9X 1K1LA 1G2MA 4IN1A 3SU1A 1F5RA 1JOUB 1GGDC 2HNTF 2OC0A 4DW2U 2TGTA 2W7UA 1XUHA 1RTLA 4Y8YA 4NWLA 1V2QT 1C4V2 2UWLA 4OS5A 3RXJA 2WV5A 2FIRH 1EX3A 1A5GH 2ZCHP 1ARCA 5FX5A 1O3GA 1G32B 1SSXA 4X6PA 1UTKA 1C1SA 3ZZ7A 4BXWA 1WUNH 4K8BA 1MTSA 2VIDA 1ABIH 1NROH 1AVWA 1J17T 5A8ZA 1BTWA 4INLA 2GP9B 1V2RT 4GVUA 4NIWA 1GDQA 3PV4A 3UWIA 2VNTA 1VCQA 1T7CA 4MPVA 3A86A 4ABIA 2EI6A 3WY8A 3UIRA 1HRTH 3C27B 1AWHB 4E7NA 2G8TA 2VINA 2R2MB 4K60A 3O8CA 1TBZH 4XE4A 1PQAA 4UFEH 1J15A 4Q7YA 3ZZ8A 3RXOA 1CA0B 3M5MA 1JIMA 1ANBA 3A87A 3SJKA 1FIZA 1TE0A 3ELAH 1C5NH 3LH3A 1OP8A 4K3JA 4E7RG 1QL9A 1ZJDA 3T2NA 1HAYB 2EC9H 2ODQA 2HGTH 2BZAA 1YF4A 3PMAB 1BTPA 4Y0ZE 3V12A 1C1NA 3LC5A 1O2JA 1WAYB 3ODDA 3VB4A 3RXEA 2Y80A 4Y8XA 1O3AA 1DUEA 4I8KA 2QXGA 4NFFA 3NPSA 4AB8A 1SR5C 4WVPE 2DE9A 4KTSA 1ELCA 2A2QH 1KTSB 3UNQA 2H1UA 2OBQA 4FUIA 1D6RA 1HAOH 1GMCF 1ANEA 4R8TB 1BBRE 1GI1A 3QK1A 1JIRA 2FX4A 4XBBA 4IN2A 2Q6DA 1SLWB 4CRFA 3MNXA 3NK8A 2AMDA 2BDHA 1ZOMA 2WINI 4MDSA 4X2YA 5GCHF 4QT8C 2FEQH 3MI4A 5A09A 5B6OA 4DOQA 5EODA 3UUZA 4YOIA 3MO6A 1GBHA 1SVPA 1J8AA 1F92A 1GHXH 2FOBA 2Z9IA 2WUCA 1O3CA 1G3CA 1OWDA 5F8ZA 1O3LA 1O3KA 4YOGA 1BCUH 4YT7H 1GJ8B 3GISB 1CBWC 4X1NU 2AIQA 1F2SE 1QR3E 1KSNA 4D76A 2H2ZA 3A83A 1O38A 4O3UA 4LZ1H 1L2EA 1FY5A 2ZQ2A 1SBWA 1KXAA 1LHFH 5GWZA 2Y7ZA 1TMBH 3GDSA 2BX3A 3GCHC 1K22H 2F9UA 2ZGXH 4FUBA 1GI0A 1VITG 4MLFB 5DG6A 1F0RA 2UUKB 1UJ1A 1EKBB 1L1JA 4AORA 2BDGA 1AKSB 2GV6A 4ABJA 2D8WA 3UFAA 1GPZA 3DUXH 2F9OA 2Y81A 1T8NA 2PSYA 2H5DA 4MQAA 3BG4C 3ZVEA 1GBIA 1DUAA 1H9LB 1V2OT 1BRBE 4ZKSU 3UR6A 1G3DA 4FUHA 1BRUP 1A2CH 1CT2E 4NA7A 3VPKA 3LU9B 2BD3A 2JETB 3DHKH 5FPTA 2BD8A 4NIXA 2FO9A 1AHTH 5JPMH 1O2MA 3U1JB 4IC6A 2O8WA 1XMNB 1EJMA 4U2WA 4NG9H 3KQDA 1ZMNA 3TK9A 1O5DH 5A0CA 1GBTA 1AMHA 1SI5H 3SZNA 4FVDA 5GXPA 1TOCB 8KME2 3MTYA 3RDZA 1UVSH 1DPOA 1KLIH 3CENA 2OXSA 4DIHH 4MTBA 4INHA 1THRH 3SORA 1C2DA 3TNTA 1BDAA 2AYWA 1AD8H 1QIXB 1GHBG 5EXNA 4HI3A 5HMAA 4JZFH 3RC4A 5DKMA 1BHXB 3H7OA 3ATWA 1C1VH 2FZZA 1AGJA 4X1SU 1O5AB 1GI8B 1LHEH 2XCFA 4D9QA 2W3KA 1DLEA 3ZV9A 2ZO3H 1SB1H 3RXLA 4AZ2B 1CE5A 1D9IA 4BXSA 4Y11E 2BX4A 3F68H 1YPMH 4VGCB 2A32A 1OS8A 1IQIA 1BA8B 3PROA 3PMJA 1Z1IA 1O5GH 4Y10E 3A88A 1YPKH 4CHAB 3E91A 1YLCA 4JYTA 1HXFH 2WPMS 1YLDA 5CE1A 1T8LA 3PO1B 1DDJA 4ASHA 3PTNA 1P09A 1H9IE 1ZPBA 2FOGA 1WYKA 5FAHA 3KCGH 1ELDE 3A7ZA 5LPFA 1RD3B 2BB4A 1UCYE 2BDAA 3M7QA 1ANDA 5GJ4B 1KXFA 1YKTA 1HXEH 3M7UA 2Y5HA 1L0ZA 1ZHRA 2DUCA 2J4IA 4X6MA 2XBYA 2F83A 3F1SB 3BIVH 2J95A 4YZUA 2G81E 1BMMH 1FPCH 4TWYA 1A7SA 2VVCA 1P05A 1C2KA 1K1MA 2AEIH 4NA9H 3OY5U 1HIAA 1MTVA 2C8YB 5EG4A 1C2GA 2FS8A 1SC8U 3ZZCA 1MZAA 4RN6A 1Z8JB 3ATMA 2NU0E 4XOJA 4DIIH 1O2XA 1TGTA 1O3HA 2ZIQH 2H5CA 1MTWA 4CBNA 1GHZA 1AVGH 1GJDB 1GL1A 1MUEB 2ALPA 3U1IB 1K28D 7GCHF 1AQ7A 1WV7H 3BEFB 1BTXA 1G3BA 4CR5A 1GI9B 1O5EH 1EZXC 2G55A 2QF0A 1AO5A 2ZU2A 4O9VA 4ISOA 2OQUA 2V3HH 1CGJE 2QC2A 4RSPA 4ZMAH 3TJVA 2G51A 4SGAE 1FPHH 1BBRH 2ZGJA 1MH0A 1NM6A 2FP7B 1N8OB 4JK6A 4CRCA 5EW2H 1A46H 1O2PA 2Z6BD 5E0GA 1ZHPA 2BDIA 4H4FA 1OX1A 2GTBA 3NZIA 3RM0H 1S85A 5JYIA 1P2QA 4X6NA 4ISIH 3H7TA 3KQBA 3QO6A 4NSYA 1C1OA 4AG2A 1VITF 1SFQB 1C2FA 3GCOA 2B9LA 1EAWA 1LHDH 3LDXH 2BQWB 5E0HA 3O8RA 1S82A 3E6PH 2Y82A 4FU7A 1Q2WA 3ESTA 2ANWA 5BRRE 1QNJA 1SLXB 1LMWB 2QAAA 2O8MA 2FXRA 1O3NA 1HUTH 1ELVA 1UMAH 1NFXA 3M5NA 4B2CA 2QCYA 4DJZB 1QJ1B 4LXBH 4ZHAA 5K0HA 1HJAB 4MNXA 1TNIA 2V3OH 4I32A 4E06H 6LPRA 4TPIZ 1RGQA 2XTTB 3ZZ4A 1ANCA 1CO7E 1CGIE 1SGPE 2A7CA 1TYNA 1T8MA 2P3TB 2UUFB 1FONA 5EW1H 1VZQH 2ZTXA 1ID5H 3L6PA 1D6WA 1OWHA 5CHAC 4ABBA 3KHVA 2AFQB 4HGCA 1EB2A 3EGKH 1B5GH 4TWWA 4A1TA 2FOEA 1CGHA 2BMGB 1NT1A 3A8DA 2CV3A 2YNAA 3F9FA 3KNXA 4FUDA 5H4IB 4A5TS 2RDLA 8GCHF 5K7RA 3K6YA 1HAIH 1AB9B 2ODPA 2ZQ1A 4UEHH 4ZH8A 2ZU5A 1KXDA 4XFQA 3SHAH 5DP7A 1PPFE 1TRYA 4MNVA 2BYAX 4K2YA 3S9BA 1GHBF 2P59A 7KMEH 3LIWA 3GICB 4YT6H 1GBFA 1S0RA 3UOPA 1EOLA 1C2JA 1UHBB 5SGAE 4BAOB 4GUXA 1BTZA 3BEUA 4I8HA 1TPSA 2BDYA 2PGQB 3GY4A 1A5IA 1IOEA 2OC7A 3LGTA 4F49A 7ESTE 2RG3A 3RC5A 4UONA 1LTOA 2UWPA 3E16B 2XBWA 1P01A 3GDVA 5DP8A 3ZZ9A 1DSTA 1RIWB 3KF2A 2W26A 3HGNA 4JMYA 5C1UA 1TMUH 5L2YH 1O2WA 4I7YH 4DG4A 8ESTE 3LONA 2H9TH 4NZLA 4Y0YE 1C2IA 1WCZA 1D3PB 1FQ3A 3ITIA 1GMHF 1QBNA 4X0WU 2ZFFH 2IOTA 3UQVA 4X2VA 3MH4A 3RXVA 4FU9A 2J34A 4UFDH 2VIVA 5CMXH 4ABDA 2RA3A 4AGKA 1W11U 5J4SA 1G3EA 2A2XH 4JK5A 1MBMA 3SUEA 2WUBA 2K1QA 4ZKNU 1EZUC 1L1GA 4U32A 1AUJA 3BTFE 4YOJA 1EAUA 1LQEA 3MU1A 2P16A 1UCYH 4XSKU 1ETSH 1GI6A 1GJ7B 4Y71A 4RKJB 1SL3A 1ZMJA 5G4BA 2QXHA 4DY7B 3TH3H 1BBRK 2P8OB 2XXLA 1SQTA 1GWAA 1GHVH 3T29A 1QFKH 3ZVFA 3ZZBA 1HAXB 3L33A 1A5HA 1PQ8A 2PKSC 1OYTH 2NWNA 3MH5A 1BJVA 1CA8B 1LDTT 2VIQA 3KQCA 3NWUA 2VH0A 2WPKS 4B73A 2WPIS 1QQUA 5GPIB 3SNDA 1V2WT 1TBRH 4Z6AH 3ZZAA 1Y5AT 1C2MA 3SBKA 5I25A 2OTVA 1WBGB 3UWJH 1NS3A 3LGWA 2EI8A 1TQ0B 2GT8A 1O2KA 3A8AA 2A4QA 3UTUH 1C1QA 3TH4H 1SGFA 4AFQA 4KTUA 1GI2A 1H1BA 2GZ8A 3E3TA 4H42U 1MCVA 2UUYA 1O31A 2GCHF 1TGCA 3SGAE 4WXIA 4XBCA 1Z8GA 3RC6A 1ZLRA 2G4TA 2ZTYA 1GHAG 1HAVB 1OOKB 1PPBH 4B71A 1ABJH 1GJ6A 1T4VH 6ESTA 1V2JT 1MKXH 1P9SA 2CJIA 1LKAA 2P95A 2JH6D 1IHSH 1PPGE 2UWOA 3Q3KA 1V2NT 2FYQA 1CA0C 3IWMA 2EEKA 2FTMA 1NTPA 1IHTH 2ZECA 5A2MH 3ZZ3A 2W5EA 2OD3B 3RU4T 1C1UH 5T6DA 1TIOA 4WMFA 4AGJA 4WXVA 1XUGA 3BTTE 2BD7A 3QZQA 4MPUA 2CHAC 3ZZ6A 3BSQA 1HJ8A 1XX9A 3BTDE 3SNEA 1GBAA 2OINA 4HZHA 1GBEA 3LJJA 1KDQB 2AGIX 3SU4A 1MMJN 5AHGH 4KP0A 1AIXH 1QL8A 1PJPA 3W95A 2ZU4A 3T26A 2STBE 3MNSA 3TGJE 4CH8B 1O2GH 2QYIA 2ZPQA 1TWXB 1GCTC 1YPLH 2GZ9A 3A8CA 2ZFPH 2ZG0H 2ZGHA 2TRMA 2ZU1A 2FM2A 1KLTA 1CHOG 3MH7A 4D7FA 3SN8A 2HOBA 1MAXA 2SNWA 5L6NH 3RXFA 1RFNA 1G2LA 2OC1A 3EYDA 1TPPA 3KQEA 1JXPA 2R2WU 2HNTE 1DX5M 2C3SA 3CS7A 2FMJA 2ZP0H 4WH8A 1PYTD 1UVTH 2PGBB 3Q00A 3QTVH 3ZVCA 5A8YA 3CP7A 4GSOA 1V2TT 3Q3YA 5E2OA 1IQLA 1S5SA 1OWKA 2TIOA 2VB0A 5FXLA 1LQDB 3S0NA 1GGDB 1A1RA 2R0KA 3SUFA 3M5OA 3SHCH 3AW0A 2G00A 1E36B 3QWCH 4ZHMU 1W7XH 1NFUA 2C4FH 1FNIA 3BTKE 1UCYK 1Z71A 3U8TH 3KN2A 4JYVH 1NRRH 2ZDVH 2ZTZA 1TNLA 1S84A 4CRGA 1O3MA 1ZGVA 1FAXA 2Z3CA 7GCHG 1ZSKA 1NC6A 4WMDA 3DT0H 1O37A 3URCA 1BITA 2H9EH 2ZKSA 2SFAA 2FDAA 3P95A 1XXFA 1Z6EA 3M3TA 2JETC 2NU1E 3UREA 3T62A 2QIQA 5L30H 1PQ5A 1FN8A 1BTYA 2PTCE 3IG6B 5FPSA 3P17H 3ENSB 3P8FA 1UTMA 3VXFH 4MNWA 3JZ1B 4O03A 5HGGA 1F0UA 5F03A 3TJNA 5GDSH 4BTTB 1QB1A 1P04A 4IMZA 2FI5E 4O97A 4X8UH 2HALA 4ISLA 1UVUH 1H9HE 2D26C 5F6MA 2VVVA 1FJSA 1TGNA 3I78A 1DS2E 1K1JA 3NXPA 3OU0A 4CRDA 1P02A 1Q31A 2GDEH 2Y7XA 2LNCA 1C5UA 1GBBA 1SOTA 3GCNA 3TVJB 4OS6A 2BY6X 3HPTB 1LO6A 1V2PT 1P57B 1O34A 2XC4A 3MO3A 1UTQA 2FOHA 3GY8A 1RTKA 1KTTB 1TQ7B 2VWLA 3T5FH 5C2ZA 3K6ZA 3SU0A 1FAKH 4WWYA 1QRXA 1HAZB 1C5OH 1ETTH 3RXSA 1W12U 1P2OA 3UR9A 1B7XB 3ZYDA 3BTQE 1QBOA 1O5FH 3RXKA 1HLTH 3HK3B 3SU5A 1AZ8A 1HB0B 2FOMB 3Q3XA 4BAQB 3BN9A 4ZKRU 1D3DB 4YLUA 1GHAF 5F8XA 4FVBA 2STAE 4UE7H 6CHAC 1K9OE 2EI7A 3E8LA 1TA2A 8GCHG 1SQAA 2VIWA 2Y6TA 2CXVA 1MAYA 3SV6A 3SJ9A 1VCPA 1ACBE 1DY9A 1XXDA 1PPZA 3MU0A 3R3GB 5TJXA 1LPZB 3F6UH 1AY6H 1P2IA 1QB9A 2PKAB 2HNTC 3A82A 1GG6B 1ESBA 4O3TA 2ALVA 4ZHLU 2GD4B 1AKSA 1CBWB 4MG3A 1ZYOA 1C5XB 1XUFA 2BZ6H 3NUMA 2XRCA 3MO9A 2G4UA 1BOQA 1TX8A 2P3UB 2ZHWH 3LC3A 1GBMA 2AH4X 1XM1A 3GDUA 2FODA 3GYLB 1SFIA 3GY3A 2QA9E 1SLUB 1F5KU 1Y5UT 2ZC9H 3GCHB 2QXJA 1T4UH 1UTNA 3BTGE 4I31A 2CMYA 2ULLA 1O3IA 1GMDG 3KGPA 2ZWLH 1N6YA 4FUCA 2V6NA 4RKOB 5FCRA 3FVFB 1AFQC 3BG4B 2FTLE 1UK3A 1NY22 1QA7A 2AS9A 3RXAA 5HYOA 1U6QA 1HIAB 5FBIA 2R0LA 1GMHG 3A7TA 2BD9A 1CHOF 1DFPA 4JZDH 3TU7H 4ISNA 1GBCA 3SJ8A 2BLOA 1TLDA 2AGGX 1CHGA 2O8UA 3M3VA 4KELA 4WF8A 1EOJA 4A92A 3HKIB 1T8OA 1GVZA 1W0YH 3VB6A 2C8ZB 3U8RH 4X2WA 2A7JA 3VXEH 2OP9A 2KAIA 1P11E 2ZDLA 2R3YA 1MQ5A 1ZMLA 2ZCLP 2ZFQH 1O3JA 2D2DA 1JRTA 4JZ1A 2WPJS 1TNHA 1K2I1 4INKA 5EU8A 1P06A 2GMTC