3DFJA

Crystal structure of human prostasin
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
248
structure length
248
Chain Sequence
ITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPISLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNALYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Prostasin
publication title Structure of human prostasin, a target for the regulation of hypertension.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3dfjA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3dfjA01
4ZXXH 1BIOA 1TB6H 7LPRA 7KMEH 1YC0A 1GJ5H 1C1PA 3BTQE 2QXHA 1Q3XA 2C3SA 1L1JA 2LPRA 4R8TB 1ANCA 1GJBB 5FPSA 2ZA5A 5A2MH 3NKKA 3V13A 3LU9B 5J4QA 5FCRA 1O3DA 2B7DH 2P3UB 3TJOA 1GBKA 5LPEA 4FU9A 1ELEE 3RDZA 2NU4E 3GDSA 1W7XH 1EOJA 2ZGCA 1T8MA 4CRBA 1O3LA 1SGEE 1G32B 2Q6FA 1YGCH 2C8WB 1NZQH 1C5LH 2QV1A 1KTSB 1KSNA 2V3OH 4ABBA 1C4Y2 1MZAA 4LZ4B 1FI8A 1WBGB 3KNXA 2J38A 2ZCHP 1C5NH 1G3BA 1O3AA 2GDDA 4I8LA 1YKTA 4NSYA 1O2KA 9ESTA 1ZHRA 1PPHE 4A5TS 4X2XA 1W13U 4Q7ZA 2FI4E 5C3NA 1HGTH 3E0NB 1HAVB 1G9IE 3LC5A 3Q00A 2O8TA 3UUZA 1UMAH 1BRCE 4K8YA 4JZ1A 3BN9A 2ZDNA 4MDSA 2TGPZ 4DY7B 2BDYA 1HAZB 2QGRA 1TQ0B 2Y7ZA 1GDUA 1A61H 2VWOA 1GBLA 4A92A 3QDZB 1P2OA 1WSSH 1CHOF 2FDAA 3SGQE 1Y3UA 5ABWA 3PROA 4UFGH 1S82A 1NU9A 1SI5H 1Y59T 2A4GA 2A0QB 1OWDA 3QUMP 4AN7A 3QTVH 1C2HA 2FOGA 1NFWA 1T4VH 4DOQA 3HGNA 1EAUA 2GT7A 1HAGE 3FFGA 4WY3A 1C2KA 1AO5A 1KXEA 3STIA 1AZZA 3O8RA 3T62A 3K6YA 3KQCA 1E36B 1TGTA 3FZDA 1LVOA 1O31A 5EXLA 1OWHA 4E7NA 3FP8E 2AFQB 2FOBA 1FY3A 4A6LA 2GTBA 1O2WA 2BX3A 4WWYA 1OSSA 2ZP0H 2GCTC 3M7UA 2BY6X 1TRMA 1CBWC 1ESBA 3KN2A 3V0XA 3SNEA 1C1WH 3A84A 5JPMH 4XBBA 4B2CA 2OLGA 3DD2H 3LH1A 1GL1A 3EA7A 1PQ7A 2QCYA 2XBWA 3NCLA 1S6HA 1ZSKA 2TRMA 1F5LA 1S0RA 2THFB 4OS7A 1KXCA 1ZMLA 1JBUH 4D7GA 1XVMA 3ZZ7A 4I8GA 3LDXH 4ZKRU 3TGJE 2ZQ2A 1C9PA 3I77A 4K3JA 4Q80A 4CR9A 2AMPA 1L4ZA 2Y5HA 2ZTYA 3Q3KA 2VWMA 4H42U 1J14A 1BTUA 1DICA 1P05A 1EQ9A 1V2VT 1HRTH 4DCDA 1C9TA 3HKJB 4ASHA 2BVSH 2CN0H 4O97A 1O30A 1ELDE 2H5DA 5BRRE 3PMHB 2TGDA 2VIOA 1O5CB 1P2NA 1UTLM 1GVZA 1UK4A 1F0SA 1O2UA 4AYVB 3LC3A 3NUMA 2ZPQA 1TBQH 1P3CA 5E0JA 2V35A 4AYYB 1G36A 4R0IA 2HRVA 3E8LA 4RKOB 1Z1IA 2QXGA 4CBNA 3NK8A 1MUEB 1F5RA 4AORA 4Y8YA 1LPGB 1SLUB 1SLXB 1BTYA 3LJJA 4MLFB 3PTBA 3UFAA 3UNRA 1OYQA 3TK5A 5E2OA 1MU6B 1S0QA 2K1QA 1NRQH 1TAWA 1GJ9B 3P8NA 5C5NA 1P9SA 1FQ3A 1O2MA 2W3KA 3SGBE 1INCA 1LHEH 3MH7A 1O2PA 3K9XB 1WYKA 1GCTB 1A5GH 1V2OT 1XVOA 3BV9B 3AVZA 2F9PA 1B7XB 2OXSA 1GHBF 1V2JT 4UFFH 1MD8A 1OP2A 1EZXC 3Q3XA 1AE5A 1HV7A 3SHAH 1P10A 1HPGA 2H6MA 2VNTA 3ATIA 4WF8A 3QZRA 1GBBA 2FEQH 1TABE 1Z71A 1H9HE 5FBEA 2FO9A 1UVPA 2Z9KA 3ZZDA 2VIDA 4BAQB 1UO6A 3BF6H 4M7GA 3LH3A 3F9FA 3QK1A 1NFYA 1TOCB 1GJ7B 3UTUH 1DANH 1ZHPA 1C5YB 1D3QB 3V3MA 1GCDA 1C1MA 1GJ6A 1DUEA 2A7CA 2A1DB 4DJZB 1VGCB 2A5KA 3VFEA 2G51A 3GY7A 1SGYE 2XCFA 3CENA 2G00A 5DP7A 1BBRK 4FUHA 2QXIA 5GDSH 2IOTA 1LKBA 1OWEA 5EPYA 2YOLA 1THSH 5A8XA 2J94A 3RXPA 5A0AE 3TH2H 2XWBI 3F9HA 1TA6A 5AVDA 1BRBE 2JKHA 3SJ8A 4Y76A 3UR6A 3SZNA 4TWWA 1GI1A 1JRTA 3DFLA 2YNBA 2ASUB 2BDIA 1NROH 1UVUH 2D1JA 2H9EH 1YCPH 4K5ZA 2Y5FA 1FNIA 5EXNA 1IQIA 1HAHH 1EZSC 1T32A 4AOQA 1DDJA 3AW1A 1AN1E 3UREA 3SJKA 1FN8A 1CHGA 1CT0E 4WH8A 2FP7B 3RUOA 4AGJA 3A86A 1Z6JH 1P04A 4K60A 3QLPH 6ESTA 3LT3A 1Z8GA 2HWLB 1NRRH 2WPKS 2OUAA 1IQMA 1TX6A 7GCHF 3MU5A 4KTSA 2CGAA 3BEUA 2OC0A 2A7JA 2WPIS 1NC6A 1DWBH 3A83A 2ZDVH 3SW2B 1SGPE 3E91A 2XBYA 5JYIA 2BOKA 4MTBA 2H5CA 3TJUA 3AAUA 1X7AC 1F92A 1HNEE 2PKSC 5L30H 2PFEA 3SU2A 2VGCB 5DP4A 4GVUA 3ZVDA 1GBAA 2QN5T 4X6OA 1RS0A 1ESTA 4AZ2B 4AFUA 3AAVA 2EI6A 3PV4A 4AG1A 1BHXF 1MBMA 1SMFE 2QA9E 4TPYA 1FPHH 1CT4E 4NA7A 4ABIA 4CHAC 2I6QA 1GGDB 2G55A 2HNTF 3KIDU 3M36A 1F2SE 3MH4A 3KHVA 3UY9A 2A7HA 1TONA 1BMMH 1WCZA 2ZHFH 4GHQA 1XUKA 2BQ7B 2G8TA 3S9BA 4D8NA 1G3CA 1AUJA 3GY8A 3RXMA 4DG4A 4TYDA 3OX7U 4KTUA 2OCVB 4MNVA 1K1MA 1RJXB 3P8OA 1O2QA 3P70B 4NA9H 1GBDA 2HLCA 2UWPA 4JMYA 3L6PA 1GI9B 1ZYOA 5L2YH 1QJ1B 1MQ6A 2BY9X 2ZU2A 2TBSA 4UONA 1QURH 5C1YA 1P2JA 1P8VC 1LVMA 1MKWK 1YLDA 4DW2U 1SGRE 2Y81A 6GCHG 1GMHG 1QJ7B 2UUYA 1XXFA 4BNRA 2GMTB 3KEEA 1MKXH 2PWXA 1T7CA 1QNJA 2ALPA 1LCYA 4JYUH 1W3CA 1AIXH 5H4IB 1SOTA 2OP9A 3FZZA 1K1NA 1AU8A 4CRGA 1QY6A 4NIWA 3URCA 1EX3A 1EASA 1BTZA 1PPZA 2ZFRH 1AD8H 2BTCE 4BAKB 4FU7A 4OS5A 5A0CA 4ZUHA 4MPVA 2UUKB 1NFXA 2P93A 3BSQA 3SO3A 3EGKH 1QIXB 1YF4A 3U1IB 4XOJA 3MO6A 4NIYA 4ZHMU 4JZEH 1W7GH 1QL9A 1O3EA 2ZPRA 1DY9A 2VH0A 4Z6AH 3PM3A 3ZVEA 2QF0A 5T6FA 1AKSB 1RIWC 1C1TA 1EXFA 1ZLRA 1BOQA 1CA0C 1ELFA 4XBDA 1ARCA 1UCYH 9LPRA 1IHTH 3RXVA 5T6DA 1V2PT 2Q6GA 1L4DA 1A3BH 5C2ZA 1BCUH 3GYLB 2Z9JA 1Z1JA 2F83A 5HMAA 1UTPA 2ANWA 3SN8A 1DVAH 1MTVA 3LGWA 1TGNA 1P3EA 4FUGA 3LJOA 1UTMA 4INHA 3MFJA 1ZPZA 3PO1B 5HXFA 4X2VA 2P3TB 3Q77A 2HNTC 1SFIA 1P2QA 3HK6B 3RM0H 1WTGH 3KL6A 4I8JA 2FODA 1O2GH 2W5EA 1O2IA 1K1OA 5K7RA 5F6MA 3MH6A 1SC8U 1A5HA 2FLRH 4D9QA 4YZUA 2R2WU 1TALA 1C5TA 4B2AA 2BVXH 2R0LA 1THRH 2V6NA 1L1GA 1Z8RA 2VWNA 3SNCA 4AX9H 2Z9IA 1G3DA 4Y10E 1F7ZA 4ABAA 1DLEA 4CH8B 3SBKA 1CGJE 4FVBA 4UFEH 3RC5A 1OWKA 2FYRA 3LPRA 2EC9H 2CJIA 1A7SA 2DE9A 4ISHH 3HPTB 1UVTH 3PMAB 3PYHA 1GJDB 3VXEH 3SJIA 6GCHF 1CT2E 1AFEH 2ULLA 3E3TA 2WUCA 2Q6DA 3SV2H 5EODA 2GDEH 3AASA 2A45B 3I29A 5ESBA 4GSOA 1MD7A 1D6RA 2VWLA 3A7VA 1K1PA 5IYTA 2BOHB 4Y7BA 1Q2WA 4HGCA 3GY6A 5JBBS 4GCHF 1RTKA 1XUGA 3D49H 1MAYA 2AIPA 2FI5E 4A7IB 2B8OH 1UVSH 3GCOA 1C2IA 3DT0H 3VGCC 3ZYEA 2P95A 2VU8E 2SGFE 1HJ8A 4CRCA 4UEHH 5GJ4B 1S84A 4MNWA 2G4TA 4FUEA 4ZROA 1GHAG 3SU0A 3OYPA 3RP2A 3OY6U 1D6WA 4ABEA 2ZFTA 3TU7H 1UTKA 1YPHE 4A1TA 1TNLA 1YPHC 3MHWU 2ZPSA 5EXMA 3MNXA 4Y6DA 4MVNA 3PWCA 2ODQA 3LIWA 3SI3H 1DLKB 1GWAA 1SGNE 2NU2E 5HGGA 1AWFH 3VB7A 1IQLA 1EZQA 2FMJA 1TNIA 4NA8A 3MO3A 1RTFB 1QB6A 5B6OA 2BXTH 1GI2A 5A09A 3SNBA 1DS2E 1O39A 1RXPA 2R9PA 3V12A 1HBTH 4FUJA 2H1UA 3ZZAA 1GMCG 5CMXH 2PV9B 2BY5X 2Y6TA 4KELA 3U8RH 5F8XA 1BJVA 3VPKA 5EW2H 2ZF0H 1K1JA 1C5ZB 5EW1H 1O35A 3RXEA 3U9AH 4BOHA 3A7YA 1PYTC 1SOZA 1ANDA 1PPEE 2XRCA 2RA0A 3Q76A 1MTNC 3M5LA 3SJOA 2UUJB 4XSKU 1SPJA 3RC6A 1PFXC 1V2RT 1QA7A 1OP8A 2GCHG 1O3FA 2SGQE 1FUJA 4H6TA 4ISLA 2FS8A 3A88A 1K21H 3KQEA 1HFDA 2M5TA 2XYAA 1DITH 1GMDG 2FOAA 2QYIA 5ETXA 5DP6A 4Y11E 1BMLA 1N1LA 2FPZA 3W95A 1C5PA 1F0TA 2ZNKH 4B73A 2NU0E 4ISNA 1SL3A 1NFUA 1O5EH 1D4PB 4WMDA 4WVPE 2EI8A 1D3DB 2C93B 1C2JA 1BBRE 2RG3A 1EPTA 5HM2A 4AG2A 2HALA 3QZQA 5J4SA 4D76A 1VJAU 1C1SA 1DY8A 1MCVA 1DPOA 3LGYA 4K2YA 1O3CA 2ILNA 2XC0A 3EDXB 3URDA 1GHZA 3ZZBA 3ZVGA 1LDTT 5FBIA 3LGTA 3RXAA 1HJ9A 1V3XA 3CS7A 2P8OC 1LQDB 3CS0A 3PB1E 5GXPA 1PPBH 1CGIE 1O3HA 2Z6BD 1YYY1 4IC6A 3EE0B 5FPTA 5DK1A 1BTPA 1KLIH 2ZFQH 2FOFA 3LKWA 4WJG2 1Z7KA 3F68H 1ETRH 1TPOA 4HZHA 1RIWB 3KGPA 1RGQA 2Z9LA 1O36A 2BLOA 1NY22 3SGAE 2PTNA 1VCQA 1AY6H 1QTFA 1AFQB 2JETC 1EJAA 2BLWA 1C2FA 2ZHDA 3DA9B 3PLKA 1YP9A 1TMTH 1ZPCA 1G2MA 1KLJH 2GZ9A 1IQGA 2PGQB 2V3HH 5GCHG 3QGNB 3SU5A 3STJA 3VB4A 2Y7XA 1AMHA 2GZ8A 1SQAA 2FOHA 4D7FA 1KXAA 5LPFA 3M5OA 1TX8A 1MCTA 3RXBA 3OY5U 4KP0A 3SV8A 4OGXA 4ZKOU 4X0WU 2VVUA 2BLQA 4ZKNU 4YLUA 3T26A 1A3EH 4YO9A 1N6XA 4ABGA 1GI5A 1MTSA 1O5GH 3F9EA 2O8WA 3GCNA 5FPYA 1GG6B 3GCHC 3BTFE 3BTKE 1SQOA 1W11U 3RLWH 2FOMB 4B74A 1ORFA 5K0HA 2BD4A 3LONA 1IQFA 2WV4A 4INLA 2J4IA 1LHFH 4K1SA 3U8OH 1GMDF 4IBLH 1ABIH 2VINA 4VGCC 4Y0YE 3RXIA 3T27A 1GJCB 5TCCA 6CHAC 1AB9C 1JXPA 3SU1A 3UWIA 1HJAC 1SG8B 3U8TH 2GV6A 4U30A 1BZXE 3LOXA 4X6MA 1UK3A 3PTNA 4HTCH 2ZGBH 1FY5A 2BMGB 4BTTB 3P8GA 1SVPA 3BTDE 2FIRH 4AB8A 1BITA 5JBTA 4X8VH 1V2MT 1QB1A 2Z7FE 1O3OA 1EPTB 3EA8A 1GBEA 5F8TA 4A1XA 3ZZ8A 2FLBH 1BTHH 4U01A 3DFJA 1XKAC 1TMBH 2HOBA 3LGVA 2ZDLA 1UTOA 1QCPA 1YPKH 1H9LB 4OS4A 1D3PB 1JWTA 3K6ZA 3TNSA 2FI3E 1TPPA 3TJVA 2GX4A 2PLXA 3GCTG 5C5OA 1F0UA 4U2WA 4UDWH 1GI4A 2W3IA 3ENSB 1ZMJA 3UR9A 1FDPA 1ZRKA 2PSXA 2VVCA 5C1UA 1UJ1A 1QA0A 1NPMA 3GYMA 2VH6A 4XBCA 2BQWB 1PYTD 3IG6B 2J95A 4AFZA 2BDAA 1KTTB 2ZQ1A 5A8ZA 4X1RU 4YTAA 1XKBC 1YBWA 1ZGIA 1QB9A 1SGFA 1C2LA 1W10U 1O2TA 3SUEA 3SUFA 1GVKB 2AGGX 1T4UH 3A89A 1O2LA 5EQSA 2OC8A 2V0BA 1QL7A 1E0FD 2ZDKA 1C1QA 3A8DA 4GAWA 2A5AA 2AEIH 1H1BA 3L3TA 4IN2A 1ID5H 1L1NA 1G2LA 3DUXH 2CF8H 2D2DA 1ZPBA 2QXJA 5IDKA 2Z3CA 3IITA 4OGYA 1P01A 3RXUA 1QRZA 1D3TB 2DE8A 1KXFA 1KYNA 1N8OC 4NIVA 3TH4H 4THNH 1GI0A 1MBQA 1O38A 1QBNA 2SNWA 2ZHQH 3BEFB 3QX5H 1SSXA 3M3TA 2DUCA 1TFXA 3RMOH 3UIRA 1B5GH 2XNIA 3DHKH 5C67A 1K22H 4ESTE 4KGAA 1GVLA 3D62A 3MNSA 1MKXK 2ZU1A 3QTOH 8ESTE 3JZ2B 2ANMH 2ZU4A 1XUHA 1DE7H 1EJMA 3B9FH 4I8KA 1V6DA 1OP0A 1NU7B 1P03A 1TIOA 5CHAC 1TX7A 1XX9A 3ZVFA 2ANYA 1FIZA 1C5XB 4BAMB 1QHRB 2PSYA 3BTME 3ESTA 3P8FA 3UQVA 2QC2A 1AGJA 1P0SH 3MMGA 3O8CA 4X6NA 5EU8A 3RMMH 4Q2KA 4FUIA 3ODDA 1K1LA 1WAYB 2BD5A 1LQEA 2FYQA 3MU8A 2VVVA 4X1NU 5JDUB 5EQQA 3E1XB 3F1SB 1UCYK 1GDQA 1E37B 1WQVH 3ZZ5A 1UHBA 3PMBB 1GDNA 1BRUP 1AI8H 1DXPA 1H4WA 1NT1A 2WYGA 4NWLA 2CV3A 1O2JA 1O2ZA 5E0HA 1WU1A 1T31A 1XUIA 1OYTH 2J9NA 2SGEE 1CE5A 2OBQA 1ANBA 2GCTB 1S5SA 1W12U 3VB6A 1NRPH 3LGIA 4E05H 1THPB 3ZZ9A 1CBWB 3S7HB 2P3FH 3OSYA 1S85A 1KXBA 2ZU5A 3SOSA 1ELTA 3RXDA 2J2UA 1PQAA 2O8UA 2AH4X 3ODFA 5G4BA 4B76A 3MH5A 2B9LA 5EGMA 3KCGH 4HI3A 3QGJA 1IHSH 2XC4A 4JK6A 1OWJA 1O2HA 2GD4B 3BTTE 4ABHA 1RD3B 3RXHA 2UUFB 4BAOB 2YNAA 1VITH 4DIIH 2KAIA 4SGBE 4YT7H 1AHTH 1EAIA 4YM9A 3W94A 3GY4A 4Z0KA 1LTOA 2FTLE 1BT7A 2BHGA 2F9UA 3SUDA 4FUBA 3MU0A 4JZFH 1DSTA 2XTTB 4YLQH 1EP6A 1HAOH 1C5OH 3RXRA 3P6ZB 3QO6A 2BVRH 1A0HB 4O03A 6LPRA 4JZIA 1UTJA 2A4RA 4OS6A 5SGAE 3QWCH 1OXGA 1FAKH 3NWUA 1V2LT 4IC5A 1AB9B 1TQ7B 1EOLA 1VITG 4FXGH 1HJAB 3SU6A 1O3NA 3EA9A 1O5FH 1U6QA 1W14U 4X2WA 1J16A 1A4WH 4MNYA 4WMFA 4ZHAA 1LHCH 1ELCA 1TRYA 4CRDA 3IWMA 3RXKA 1V2WT 1H8DH 2I6SA 1CU1A 1RFNA 3GOVB 2ZCLP 3ZYDA 2GT8A 5EQRA 3A8CA 1V2UT 4CRFA 3RU4T 3TJNA 5ESTE 3A8BA 2O8MA 1BTXA 1BA8B 2AERH 2ZGXH 3TGIE 5T6GA 2Y80A 4E06H 1FY1A 3BTEE 4X8UH 3SNDA 4RSPA 1WQSA 5DKMA 2A4QA 8GCHG 1C1NA 2GP9B 1MU8B 2NWNA 4OS1A 3M61U 1N6YA 1Z6EA 1A1RA 4YESB 1YM0A 4NWKA 2ZCKP 1O3PB 2F9OA 3ZVCA 2TGTA 1PJPA 1OX1A 2G52A 3RXOA 1UHBB 1SGCA 4H6SB 4PROA 4DVAU 3CP7A 4BANB 4YT6H 2CMYA 3ATLA 2FZZA 1UK2A 2CXVA 4UE7H 2ODPA 1SGFG 1J17T 1QRXA 1TGSZ 1QQ4A 3MU1A 2XBXA 3O8BA 3TIUA 1VR1H 4Y7AA 1V2TT 5BPEA 1C5MD 1Y5UT 1FIWA 1ELBA 4GLYA 4ZHLU 1HB0B 4DIHH 4I33A 3BIVH 1TE0A 1LHGH 2ZGHA 2FXRA 4AFQA 2OC7A 2Y82A 2KAIB 1K2I1 2QIQA 4AB9A 1GMHF 5PTPA 2G4UA 4NCYA 4FUDA 2ZGJA 4NFFA 3K2UA 1E35B 3TNTA 2FS9A 2R3YA 1KDQA 1YCPM 2VIWA 1MTUA 1AVGH 3BG4C 1B0FA 4MPUA 1NS3A 4J1YA 2ANKH 4AFSA 1DX5M 3SORA 3A7TA 2F9BH 1FV9A 4ZMAH 2HVXA 1CHOG 1P06A 4F49A 3HKIB 1S81A 1BTWA 1VZQH 5DP5A 2ZO3H 3S9CA 3N7OA 4IMZA 3RXFA 1LPKB 1G30B 3MWIU 4Y79A 1IQJA 2BY7X 1ELGA 4JCNA 2BQ6B 5DP9A 3H5CB 3EQ0H 5LGOA 1W2KH 2Z3DA 2WPJS 2PTCE 4RN6A 1ZTKA 1GCTC 3RXTA 1CA8B 2ZKSA 4NSVA 4NZLA 2ZIQH 1DWEH 1AUTC 2PKSB 4TWYA 2OQ5A 2PUQH 1WTHD 1HAPH 1KY9A 4YOJA 3RU4D 1Y5BT 3RMLH 5JB8S 1GBIA 2P59A 3A82A 3ZZCA 2B5TB 4O9VA 1EATA 3GDUA 1MAXA 4Y0ZE 5DP8A 3SJ9A 1C2EA 2P94A 3A85A 3TK9A 2BM2A 3SI4H 1JMOH 3RXCA 3LGUA 3UQOA 1YPLH 2GKVE 4MQAA 3S9AA 4CHAB 2OINA 3T5FH 1ETTH 1O3GA 1OWIA 2XC5A 5E2PA 5GIBA 3WY8A 2AGIX 1VGCC 2ZHEH 1YPMH 1O0DH 2BZ6H 4F4OC 1EJNA 1BRAA 1FJSA 1Q31A 2O9QA 2RDLA 2C8XB 5AHGH 2A5IA 1TNGA 3I78A 2WPLS 3OU0A 2ZDAH 2ZWLH 3UOPA 4GHTA 2A2QH 2AMDA 1FPCH 1ZMNA 1EZUC 2QAAA 4JYTA 1ABJH 3F6UH 4DT7B 4K69A 3BG8A 3P17H 3RXLA 1A0LA 2AMQA 2FWWA 2HGTH 2C8ZB 3A80A 1O34A 1C2MA 1C5WB 1JRSA 1PPCE 2EEKA 2SGPE 1C4U2 5DGJA 1GHWH 1XXDA 1DWCH 3RXGA 3G01A 2F9NA 3SHCH 1WUNH 3ELAH 3FP6E 8KME2 2BXUH 1HAIH 4FUFA 4ABFA 3M3VA 1WOFA 2PHBA 3SQHE 1T8NA 1EUFA 1NO9H 5T3HA 4Y8XA 5I46H 4BXWA 1O3KA 1Z8JB 1QL8A 5I25A 1KIGH 4E7RG 1O3JA 1BQYA 3VEQB 1AZ8A 3RC4A 1EKBB 1O37A 2BDBA 1IOEA 2SFAA 3A8AA 1SHHB 2HPQH 5AFYH 3A7XA 1Z8IB 1LHDH 1KDQB 2NU3E 3ATMA 3ITIA 1A0JA 1ZSLA 1FY4A 2H9HA 1TYNA 4ISOA 2BX4A 4ABDA 4MG3A 1EB1H 1FXYA 1CA0B 4BXSA 1GHBG 4WXIA 1GHAF 2OC1A 3GY3A 4Y71A 1ZR0A 4JK5A 3OTJE 2FESH 4IS5A 3P92A 2J92A 1HXEH 4BTUB 3RXJA 7ESTE 1O2YA 2VGCC 3MNBA 3E16B 1P2MA 1HIAA 2BD8A 1E34B 1C1UH 1ZRBA 3E90B 2OQUA 2A2XH 5HM9A 3D65E 2PR3A 1MMJN 1NESE 4MPWA 1FN6A 1TRNA 2AS9A 1BHXB 1L0ZA 4FUCA 1FONA 1GGDC 1AVXA 2CF9H 1HAXB 3S69A 1LMWB 4H4FA 1GBHA 1GMCF 3M7TA 5AFZH 2JH5D 5C1XA 2BDCA 4ISIH 1DM4B 1TBZH 1CO7E 4XE4A 2NU1E 3H7OA 2VIPA 4I32A 1UCYE 1A46H 2OD3B 3B23B 2XWAA 1ZJKA 2PKAA 2XXLA 1J15A 1PPFE 2ZI2H 3EYDA 2D8WA 5L2ZH 1HLTH 4UFDH 2GCHF 3A7ZA 2F91A 2OBOA 5FX5A 3S0NA 4CRAA 2GVFA 2A4OA 3D23A 2QY0B 3VB3A 1V2ST 1E38B 1GI3A 1HUTH 2BD9A 2ZFSA 1DFPA 1S83A 3AW0A 1B0EA 1YCPK 2TGAA 2AIQA 1P9UA 3C27B 1P02A 3T29A 2GMTC 1MQ5A 1ZTLA 1Y3XA 2FX4A 1GHYH 2BDHA 3ATKA 4INKA 5AF9H 1GJ4H 1C4V2 2UWLA 1O3BA 1A2CH 4KKDA 1QBOA 1PQ8A 5DP3A 1K9OE 5JBAS 1MH0A 3FANA 2F3CE 1SR5C 7GCHG 2RA3A 2WINI 2ZEBA 1EP5A 4MNXA 1CVWH 4Y8ZA 1F0RA 2JH6D 1M9UA 3BG4B 3T2NA 4CR5A 5C20A 5LH8A 5FHTA 1BMAA 3SV6A 3VGCB 5DO4H 2RCEA 3UNQA 3TITA 1OPHB 1TPSA 1C1RA 1W0ZU 1QGFA 3ATWA 1G37A 4TY7A 2IJOB 1S6FA 3GISB 1O2RA 4NG9H 4LZ1H 1NRSH 3F9GA 1SLVB 1C1VH 4QT8C 1AVWA 2ZC9H 1P11E 3KQBA 4NZQA 4B2BA 3RLYH 2SGAA 3R3GB 2AGEX 4K1TA 2FOEA 2VIVA 3FP7E 1O5BB 2BDGA 1SGTA 3ZZ6A 1KXDA 1W0YH 1TGBA 1SQTA 3KQDA 2EA3A 1WV7H 1C2GA 3MI4A 1P57B 1ZHMA 4ZAEA 4D9RA 3KF2A 1TLDA 3NZIA 3PO1C 2Z94A 3O8DA 2ZFFH 3PWBA 5EOKA 4X1SU 4ZH8A 1BJUA 2EI7A 2TIOA 1HIAB 2CHAC 5DPAA 4IMQA 1C5SA 4CH2B 5GCHF 5FXLA 4X6PA 1EAXA 1BUIA 1NTPA 3BTHE 1K28D 3U69H 4AGKA 1SLWB 1A5IA 1Y8TA 1MTNB 4Q7YA 2STBE 1P12E 3ZVAA 1TMUH 4GPGA 4HFPB 4X8TH 2FOCA 1Y3VA 1EB2A 1MZDA 3E6PH 1SHYA 2D26C 4JYVH 2A31A 3UPEA 1C5RA 1FAXA 1ZZZA 1LKAA 5GWZA 1Y3WA 2PKAB 4UD9H 1XMNB 1IAUA 1TOMH 2WV5A 3HGPA 4ZXYH 2G5VA 1MTWA 5EPNA 1EAWA 1O3IA 1GL0E 1BB0B 1GBMA 1O2SA 3TK6A 5JB9S 4X1QU 4XDEA 1O5DH 3MTYA 3SU3A 1L2EA 1YPJH 4LK4A 1ANEA 1FLEE 3A87A 1SB1H 1ELVA 3M35A 1J9CH 3SNAA 1P09A 1PPGE 2PGBB 3VXFH 1AKSA 2P8OB 2ZU3A 3T25A 2ZTXA 1LO6A 4X8SH 3ZV8A 2C90B 2BLVA 1TA2A 1TWXB 2OTVA 4A1VA 1BMNH 1AWHB 1O32A 2AYWA 1SFQB 4IGDA 4BTIB 5LPRA 1CSOE 2G81E 1HAYB 2ALVA 1GHXH 1QRWA 3GCTF 1VCWA 3MNCA 1XM1A 4NFEA 4SGAE 3TVJB 1GBTA 3BIUH 3ZV9A 1GI8B 2BZAA 2JETB 2ZECA 2XBVA 2PUXB 5E8EH 3TPIZ 4K8BA 3RU4E 3ZZ4A 3L33A 3M5NA 2VIQA 4WXVA 4IW4E 4WH6A 1J8AA 1CQQA 4GUXA 1GPZA 1XUJA 2ZDMA 1SGDE 3C1KA 1GHVH 1O3MA 4RKJB 5A0BA 4X2YA 1BBRH 2GGVB 4JZDH 1GI6A 2PW8H 1QBVH 1VCPA 1YPGH 2FX6A 3ZZ3A 2WYJA 2A32A 4BAHB 1HDTH 3U98H 2LNCA 1YLCA 1HCGA 1D9IA 1C2DA 1SGIB 5FAHA 3R0FA 1DSUA 2BD3A 1JOUB 2BD7A 1ZSJA 1T8LA 1LVBA 3GCHB 5L6NH 1TNJA 3PLPA 1DXWA 1GJ8B 2O8LA 1FZZA 3U1JB 1SGQE 3PLBA 2ODYB 3Q3YA 1V2NT 3T28A 3TLOA 4LOYH 1UVOA 2C8YB 2ZZUH 1DT2A 3VB5A 4VGCB 5F8ZA 5FX6A 6CHAB 2R0KA 4MPXA 1RRKA 2SNVA 4B71A 4YOIA 4U32A 2H2ZA 5GPIB 2STAE 1YPEH 2Q1JA 1GJAB 1Y5AT 1QR3E 4WMEA 3FVFB 4CBOA 4GCHG 4I31A 3K65B 3GY2A 1UTQA 1NRNH 1P2KA 1ACBE 1SBWA 3M3SA 2GZ7A 1GBJA 5E0GA 4NIXA 3M37A 2J34A 4OS2A 1V2QT 1TGCA 2BYAX 5DJ7A 2TPIZ 5TJXA 4DURA 2IPHA 1ZGVA 3HK3B 3MU4A 1ETSH 1XUFA 2HPPH 1O2VA 3SU4A 1QFKH 2GV7A 1F5KU 1HYLA 3E0PB 5F03A 3A7WA 1IQKA 3S7KB 1T8OA 1NM6A 1TNKA 3GDVA 4B75A 3NPSA 1IQNA 3HATH 1AFQC 4TY6A 5DG6A 2BD2A 4ABJA 2XW9A 1DWDH 1CGHA 4YOGA 1H8IH 1IQEA 1GI7B 1IQHA 1QJ6B 2ZG0H 3MO9A 4DGJA 1W8BH 1G3EA 4O3UA 1NN6A 2G5NA 3M7QA 1DUAA 3SUGA 2R3UA 2WUBA 2IN2A 2WPHS 3UWJH 1C5UA 1OKXA 1ZTJA 1AE8H 1TPAE 2HNTE 1P2IA 2CHAB 4XFQA 1C5QA 1O33A 3MYWA 5JBCS 2B0FA 1LVYA 2R2MB 4I7YH 3UOUA 3V7TA 3H7TA 3RMNH 2ZFPH 3BTGE 3BTWE 1GBCA 1UTNA 2VB0A 3RXSA 2Y5GA 2F9VA 1N8OB 2BB4A 3A81A 1V2KT 1LPZB 5HYOA 1GG6C 1K1IA 1MKWH 5EG4A 3ZVBA 2VJ1A 1HAVA 4KTCA 4I8HA 2Z3EA 1DOJA 2W26A 4LXBH 2ESTE 5TCAA 4NGAH 3RXQA 1JIRA 1O2XA 3SV9A 4CREA 1FY8E 1C5VA 3P95A 3PMJA 3GICB 1HXFH 1GBFA 4FVDA 1KLTA 1AQ7A 1TBRH 3EAJA 1ESAA 5CHAB 4ZKSU 2XCNA 1ZJDA 1VITF 1O5AB 4J2YB 3QN7A 1ELAA 2Z9GA 5A8YA 2SGDE 2QF3A 3RM2H 3UNSA 1EPTC 1FMGA 3TH3H 3JZ1B 3BEIB 2ZTZA 1OOKB 1PQ5A 4X1PU 3B8JA 4FU8A 4B1TA 1QQUA 8LPRA 2W7SA 1VJ9U 2FM2A 2BY8X 3SQEE 3SV7A 1BDAA 3NXPA 2FTMA 4IN1A 1JIMA 1Y3YA 3GY5A 4K1EA 1RTLA 1ARBA 1H9IE 3M5MA 2W7UA 2JH0D 4TPIZ 5FCKA 1ZOMA 2WPMS 4Q7XA 2H9TH 2ZHWH 1O2OA 2C4FH 4O3TA 1C1OA 2P16A 5CE1A 8GCHF 1OS8A 3FAOA 1TNHA 1O2NA 3TGKE 2UWOA 3MOCA
chains in the Genus database with same CATH superfamily
4ZXXH 1BIOA 1TB6H 7LPRA 7KMEH 1YC0A 1GJ5H 1C1PA 3BTQE 3U28C 2QXHA 1Q3XA 2C3SA 1L1JA 2LPRA 4R8TB 1ANCA 1GJBB 5FPSA 2ZA5A 5A2MH 3NKKA 3V13A 3LU9B 3ZIAD 5J4QA 5FCRA 1O3DA 2B7DH 2P3UB 3TJOA 1GBKA 5LPEA 4FU9A 1ELEE 3RDZA 2NU4E 3GDSA 1W7XH 1EOJA 2ZGCA 1T8MA 4CRBA 1O3LA 1SGEE 1G32B 2Q6FA 1YGCH 2C8WB 1NZQH 1C5LH 2QV1A 1KTSB 1KSNA 2V3OH 4ABBA 1C4Y2 1MZAA 4LZ4B 1FI8A 1WBGB 3KNXA 2J38A 2ZCHP 1C5NH 3DSPA 1G3BA 1O3AA 2GDDA 4I8LA 1YKTA 4NSYA 1O2KA 9ESTA 1ZHRA 1PPHE 4A5TS 4X2XA 1W13U 4Q7ZA 2FI4E 5C3NA 1HGTH 3E0NB 1HAVB 1G9IE 3LC5A 3Q00A 2O8TA 3UUZA 2CK3D 1UMAH 3KYFA 1BRCE 4K8YA 4JZ1A 3BN9A 2ZDNA 4MDSA 2TGPZ 4DY7B 2BDYA 1HAZB 2QGRA 3F2FA 1TQ0B 2Y7ZA 1GDUA 1A61H 2VWOA 1GBLA 4A92A 4RT1A 3QDZB 1P2OA 1WSSH 1CHOF 2FDAA 3SGQE 1Y3UA 5ABWA 3PROA 4UFGH 1S82A 1NU9A 1SI5H 1Y59T 2A4GA 2A0QB 1OWDA 3QUMP 4AN7A 1VKYA 3QTVH 1C2HA 2FOGA 1NFWA 1T4VH 4DOQA 3HGNA 1EAUA 2GT7A 1HAGE 3FFGA 4WY3A 1C2KA 1AO5A 1KXEA 5KGOA 3STIA 1AZZA 3O8RA 3T62A 3K6YA 3KQCA 1E36B 1TGTA 3FZDA 1LVOA 5EIYA 1O31A 5EXLA 1OWHA 4E7NA 3FP8E 5FL7D 2AFQB 2FOBA 1FY3A 4A6LA 2W6JD 2GTBA 1O2WA 2BX3A 4WWYA 1OSSA 2ZP0H 2GCTC 3M7UA 2BY6X 3PRDA 1TRMA 3MQKC 1CBWC 1ESBA 3KN2A 3V0XA 3SNEA 1C1WH 3A84A 5JPMH 4XBBA 4B2CA 2OLGA 3DD2H 2AHME 3LH1A 1GL1A 3EA7A 1PQ7A 2QCYA 2XBWA 3NCLA 1S6HA 1ZSKA 2TRMA 1F5LA 1S0RA 2THFB 4OS7A 1KXCA 1ZMLA 2J98B 2XOKD 1JBUH 4D7GA 1XVMA 3ZZ7A 4I8GA 3LDXH 4ZKRU 3TGJE 2ZQ2A 1C9PA 3I77A 4K3JA 4Q80A 4CR9A 2AMPA 1L4ZA 2Y5HA 2RFKC 2ZTYA 3Q3KA 2VWMA 4H42U 1J14A 4ASUD 1BTUA 1DICA 1P05A 1EQ9A 1V2VT 1HRTH 4DCDA 4Q63A 1C9TA 3HKJB 4ASHA 2BVSH 2CN0H 4O97A 1O30A 1ELDE 2H5DA 5BRRE 3PMHB 2TGDA 2VIOA 1O5CB 1P2NA 1UTLM 1GVZA 1UK4A 3F3BA 1F0SA 1O2UA 4AYVB 1E1QD 3LC3A 3NUMA 2ZPQA 1TBQH 1P3CA 5E0JA 2V35A 4AYYB 1G36A 4R0IA 2HRVA 3E8LA 4RKOB 1Z1IA 2QXGA 4CBNA 3NK8A 3WWBA 1MUEB 1F5RA 4AORA 4YXWD 4Y8YA 1LPGB 4B6FA 1SLUB 1SLXB 1BTYA 3LJJA 4MLFB 3PTBA 3UFAA 3UNRA 1OYQA 3TK5A 5E2OA 1MU6B 1S0QA 2K1QA 1NRQH 1TAWA 1GJ9B 3P8NA 5C5NA 1P9SA 1FQ3A 1O2MA 2W3KA 3SGBE 1INCA 1LHEH 3MH7A 1O2PA 3K9XB 1WYKA 3PV2A 1GCTB 3FN8A 1A5GH 1V2OT 4ACBA 1XVOA 3BV9B 3AVZA 2F9PA 1B7XB 2OXSA 1GHBF 1V2JT 4UFFH 1MD8A 1OP2A 1EZXC 3Q3XA 1AE5A 1HV7A 3SHAH 1P10A 1HPGA 2H6MA 2VNTA 3ATIA 4WF8A 3QZRA 1GBBA 2FEQH 1TABE 1Z71A 1H9HE 5FBEA 2FO9A 1UVPA 2Z9KA 3ZZDA 2VIDA 4BAQB 1UO6A 3BF6H 4M7GA 3LH3A 3F9FA 3QK1A 1NFYA 1TOCB 1GJ7B 3UTUH 1DANH 1ZHPA 1C5YB 1D3QB 3V3MA 1GCDA 1C1MA 1GJ6A 1DUEA 2A7CA 2A1DB 4DJZB 1VGCB 2A5KA 3VFEA 2G51A 3GY7A 1SGYE 2XCFA 3CENA 2G00A 5DP7A 1BBRK 4FUHA 2QXIA 5GDSH 2IOTA 1LKBA 1OWEA 5EPYA 2YOLA 1THSH 5A8XA 2J94A 3RXPA 3KYGA 5A0AE 3TH2H 2XWBI 3F9HA 1TA6A 5AVDA 1BRBE 2JKHA 3SJ8A 4Y76A 3UR6A 3SZNA 4TWWA 1GI1A 1JRTA 3DFLA 2YNBA 2ASUB 2BDIA 1NROH 1UVUH 2D1JA 2H9EH 1YCPH 4K5ZA 2Y5FA 1FNIA 2WZQA 5EXNA 1IQIA 1HAHH 1EZSC 2IJD1 1S6LA 1T32A 4AOQA 3OTPA 1DDJA 3AW1A 1AN1E 3N7EA 3UREA 3SJKA 1FN8A 1CHGA 1CT0E 4WH8A 2FP7B 3RUOA 4AGJA 3A86A 3DSOA 1Z6JH 1P04A 4K60A 3QLPH 6ESTA 3LT3A 2XNDD 1Z8GA 2HWLB 1NRRH 2WPKS 2OUAA 1IQMA 1TX6A 7GCHF 2JIZD 3MU5A 4KTSA 2CGAA 3BEUA 2OC0A 2A7JA 2WPIS 2JJ2D 1NC6A 1DWBH 3A83A 2ZDVH 3SW2B 1SGPE 3E91A 2XBYA 5JYIA 2L6OA 2BOKA 4MTBA 2H5CA 3TJUA 2YMSB 3AAUA 1FX0B 1X7AC 1F92A 1HNEE 2PKSC 5L30H 2PFEA 3SU2A 4B6EA 4ACAA 2VGCB 5DP4A 4GVUA 3ZVDA 1GBAA 2QN5T 4X6OA 1RS0A 1ESTA 4AZ2B 4AFUA 3AAVA 2EI6A 3PV4A 4AG1A 1BHXF 1MBMA 1SMFE 2QA9E 4TPYA 1FPHH 1CT4E 4NA7A 4ABIA 4CHAC 2I6QA 1GGDB 2G55A 2HNTF 3KIDU 3M36A 1F2SE 3MH4A 3KHVA 3UY9A 2A7HA 1TONA 1BMMH 2K8IA 1WCZA 2ZHFH 4GHQA 1XUKA 2BQ7B 2G8TA 3S9BA 4D8NA 1G3CA 1AUJA 3GY8A 1YLNA 3RXMA 4DG4A 5B6LA 4TYDA 3OX7U 4KTUA 2OCVB 4MNVA 1K1MA 1RJXB 3PV5A 3P8OA 1O2QA 3P70B 4NA9H 1GBDA 2HLCA 2UWPA 4JMYA 3L6PA 1GI9B 1ZYOA 5L2YH 1QJ1B 1MQ6A 2BY9X 2ZU2A 2TBSA 4UONA 1QURH 5C1YA 1P2JA 1P8VC 1LVMA 1MKWK 1YLDA 4DW2U 1SGRE 2Y81A 6GCHG 1GMHG 1QJ7B 2UUYA 4I86A 1XXFA 4BNRA 2GMTB 3KEEA 1MKXH 2PWXA 1T7CA 1QNJA 2ALPA 1LCYA 4JYUH 1W3CA 1AIXH 5H4IB 1SOTA 1NBME 2OP9A 2K0QA 3FZZA 1K1NA 1AU8A 4CRGA 1QY6A 2KCYA 4NIWA 1EX3A 3URCA 1EASA 1BTZA 3F2HA 1PPZA 2ZFRH 2WSSD 1AD8H 2BTCE 4BAKB 4FU7A 4OS5A 5A0CA 4ZUHA 4MPVA 2UUKB 1NFXA 2P93A 3BSQA 3SO3A 3EGKH 1QIXB 1YF4A 3U1IB 4XOJA 3MO6A 4NIYA 4ZHMU 4JZEH 1W7GH 1QL9A 1O3EA 2ZPRA 1DY9A 2VH0A 4Z6AH 3PM3A 3ZVEA 2QF0A 5T6FA 1AKSB 1RIWC 1C1TA 1EXFA 1ZLRA 1BOQA 1CA0C 1ELFA 4XBDA 1ARCA 1UCYH 9LPRA 1IHTH 3RXVA 5T6DA 1V2PT 2Q6GA 1L4DA 1A3BH 5C2ZA 1BCUH 3GYLB 2Z9JA 1Z1JA 2F83A 5HMAA 1UTPA 2ANWA 3SN8A 1DVAH 1MTVA 3LGWA 1TGNA 1P3EA 4FUGA 3LJOA 1UTMA 4INHA 3MFJA 1ZPZA 3PO1B 2F4LA 5HXFA 4X2VA 4Z1MD 2P3TB 3Q77A 2HNTC 1SFIA 1P2QA 3HK6B 5T1VA 3RM0H 1WTGH 3KL6A 4I8JA 2FODA 1O2GH 2W5EA 1O2IA 1K1OA 5K7RA 5F6MA 5GNDA 3MH6A 1SC8U 1A5HA 2FLRH 4D9QA 4YZUA 2R2WU 1TALA 1C5TA 4B2AA 2BVXH 2R0LA 1THRH 2V6NA 1L1GA 1Z8RA 2VWNA 3SNCA 4AX9H 2Z9IA 1G3DA 4Y10E 1F7ZA 4ABAA 1DLEA 4CH8B 3SBKA 2KR7A 1CGJE 4FVBA 4UFEH 3RC5A 1OWKA 2FYRA 3LPRA 2EC9H 2CJIA 1A7SA 2DE9A 4ISHH 3HPTB 1UVTH 3PMAB 3PYHA 1GJDB 3VXEH 3SJIA 6GCHF 1CT2E 1AFEH 2ULLA 3E3TA 2WUCA 2Q6DA 3SV2H 5EODA 2GDEH 3AASA 2A45B 3I29A 5ESBA 4GSOA 1MD7A 1D6RA 2VWLA 3A7VA 1K1PA 5IYTA 2BOHB 4Y7BA 1Q2WA 4HGCA 3OEED 3GY6A 5JBBS 4GCHF 1RTKA 1XUGA 3D49H 1MAYA 2AIPA 2FI5E 4A7IB 2B8OH 1OHHD 1UVSH 1C2IA 3GCOA 3DT0H 3VGCC 3ZYEA 2P95A 2VU8E 2SGFE 1HJ8A 4CRCA 4UEHH 4TSFD 5GJ4B 1S84A 4MNWA 2G4TA 4FUEA 4ZROA 1GHAG 3SU0A 3OYPA 3RP2A 3OY6U 1D6WA 4ABEA 2ZFTA 3TU7H 4ZCNA 1UTKA 1YPHE 4A1TA 1TNLA 1YPHC 3MHWU 2HLDD 2ZPSA 5EXMA 3MNXA 4Y6DA 4MVNA 3PWCA 2ODQA 3LIWA 3SI3H 1DLKB 1GWAA 1SGNE 2NU2E 5HGGA 1AWFH 3VB7A 1IQLA 1EZQA 2FMJA 1TNIA 4NA8A 3MO3A 1RTFB 1QB6A 5B6OA 2BXTH 1GI2A 5A09A 3SNBA 1DS2E 1O39A 1RXPA 2R9PA 3V12A 1HBTH 4FUJA 2H1UA 3ZZAA 1GMCG 5CMXH 2PV9B 2BY5X 2Y6TA 1WDIA 4KELA 5F8XA 3U8RH 1BJVA 3VPKA 5EW2H 2ZF0H 1K1JA 1C5ZB 5EW1H 1O35A 3RXEA 2VBCA 3U9AH 4BOHA 3A7YA 1PYTC 1SOZA 1ANDA 1PPEE 2XRCA 2RA0A 3Q76A 1MTNC 3M5LA 3SJOA 2UUJB 4XSKU 1SPJA 3RC6A 1PFXC 1V2RT 1QA7A 1OP8A 2GCHG 1O3FA 2SGQE 1FUJA 4H6TA 4ISLA 2FS8A 3A88A 1K21H 3KQEA 1HFDA 2M5TA 2XYAA 2QF4A 1DITH 1GMDG 1NBMD 2FOAA 2QYIA 5ETXA 5DP6A 4Y11E 1BMLA 1N1LA 2FPZA 5HIZA 1C5PA 1F0TA 2ZNKH 3W95A 4B73A 2NU0E 4ISNA 1SL3A 1NFUA 1O5EH 1D4PB 1KMHB 4WMDA 4WVPE 2EI8A 1D3DB 2C93B 1C2JA 1BBRE 2RG3A 1EPTA 5HM2A 4AG2A 3OEHD 2HALA 3QZQA 5J4SA 4D76A 1VJAU 1C1SA 1DY8A 1MCVA 1DPOA 3LGYA 4K2YA 1O3CA 2ILNA 2XC0A 3EDXB 3FO8D 3UB0A 3URDA 1GHZA 3ZZBA 3ZVGA 1LDTT 5FBIA 3LGTA 3RXAA 1HJ9A 1V3XA 3CS7A 3VG8A 2P8OC 3WW7A 1LQDB 3CS0A 3PB1E 5GXPA 1PPBH 1CGIE 1O3HA 2Z6BD 1YYY1 4IC6A 3EE0B 5FPTA 5DK1A 1BTPA 1KLIH 2ZFQH 2FOFA 3LKWA 4WJG2 1Z7KA 3F68H 1ETRH 1TPOA 4HZHA 1RIWB 3KGPA 1RGQA 2Z9LA 1O36A 2BLOA 1NY22 3SGAE 2PTNA 1VCQA 1AY6H 1QTFA 1AFQB 2JETC 1EJAA 2BLWA 1C2FA 2ZHDA 3DA9B 3PLKA 1YP9A 1TMTH 1ZPCA 3FKSD 2LELA 1G2MA 1KLJH 2GZ9A 4FOUC 1IQGA 2PGQB 2V3HH 5GCHG 3QGNB 3SU5A 3STJA 3VB4A 2Y7XA 1AMHA 2GZ8A 1SQAA 2FOHA 4D7FA 1KXAA 5LPFA 3M5OA 1TX8A 1MCTA 3RXBA 3OY5U 4KP0A 3SV8A 4OGXA 4ZKOU 4X0WU 2VVUA 2BLQA 4ZKNU 4YLUA 3T26A 5KEDA 1EFRD 1A3EH 4YO9A 1N6XA 4ABGA 1GI5A 1MTSA 1O5GH 3F9EA 2O8WA 3GCNA 5FPYA 3F0OA 1GG6B 3GCHC 3BTFE 3BTKE 1SQOA 1W11U 3RLWH 2FOMB 4B74A 1ORFA 5K0HA 2BD4A 3LONA 1IQFA 2WV4A 4INLA 2J4IA 1LHFH 4K1SA 3U8OH 1GMDF 4IBLH 1ABIH 2VINA 4VGCC 4Y0YE 3RXIA 3T27A 1GJCB 5TCCA 6CHAC 1AB9C 1JXPA 3SU1A 3UWIA 1HJAC 1SG8B 3U8TH 2GV6A 4U30A 1BZXE 3LOXA 4X6MA 1UK3A 3PTNA 4HTCH 2ZGBH 1FY5A 2BMGB 4BTTB 3P8GA 1SVPA 3BTDE 2FIRH 4AB8A 1BITA 5JBTA 4X8VH 1V2MT 1QB1A 2Z7FE 1O3OA 1EPTB 3EA8A 1GBEA 5F8TA 4A1XA 3ZZ8A 2FLBH 3WWFA 1BTHH 4U01A 3DFJA 1XKAC 1TMBH 2HOBA 3LGVA 4RT0A 2ZDLA 1H8ED 1UTOA 3CNRA 1QCPA 1YPKH 1H9LB 4OS4A 1D3PB 1JWTA 3K6ZA 3TNSA 2FI3E 1TPPA 3TJVA 2GX4A 2PLXA 3GCTG 5C5OA 1UW7A 1F0UA 3GS9A 4U2WA 4UDWH 1GI4A 2W3IA 3ENSB 1ZMJA 3UR9A 1FDPA 1MABB 1ZRKA 2PSXA 2VVCA 5C1UA 1UJ1A 1QA0A 1NPMA 3GYMA 2VH6A 4XBCA 2BQWB 1PYTD 3IG6B 2J95A 3KQ5A 4AFZA 2BDAA 1KTTB 2ZQ1A 5A8ZA 4X1RU 4YTAA 2L74A 1XKBC 1YBWA 1ZGIA 1QB9A 1SGFA 3UAIC 1C2LA 1W10U 1O2TA 3SUEA 3SUFA 1GVKB 2AGGX 1T4UH 3A89A 1O2LA 5EQSA 2OC8A 2V0BA 1QL7A 1E0FD 2ZDKA 1C1QA 3A8DA 4GAWA 2A5AA 2AEIH 1H1BA 3L3TA 4IN2A 1ID5H 1L1NA 1G2LA 3DUXH 2CF8H 2D2DA 1ZPBA 2QXJA 5IDKA 2Z3CA 3IITA 4OGYA 1P01A 3RXUA 1QRZA 1D3TB 2DE8A 1KXFA 1KYNA 1N8OC 4NIVA 3TH4H 4THNH 1GI0A 1MBQA 1O38A 1QBNA 2SNWA 2ZHQH 3BEFB 3QX5H 1SSXA 3M3TA 2DUCA 1TFXA 3RMOH 3UIRA 1B5GH 2XNIA 3DHKH 5C67A 1K22H 4ESTE 4KGAA 1GVLA 3D62A 3MNSA 1MKXK 2ZU1A 3QTOH 8ESTE 3JZ2B 2ANMH 2ZU4A 1XUHA 1DE7H 1EJMA 3B9FH 4I8KA 1V6DA 1OP0A 1NU7B 1P03A 1TIOA 5CHAC 1TX7A 1K0HA 1XX9A 3ZVFA 2ANYA 5F53A 1FIZA 1C5XB 4BAMB 1QHRB 2PSYA 3BTME 1W0KD 3ESTA 3P8FA 2QC2A 3UQVA 1AGJA 4AC9A 1P0SH 3MMGA 3O8CA 2YMSD 4X6NA 5EU8A 3RMMH 4Q2KA 3EE7A 4FUIA 3ODDA 1K1LA 1WAYB 4DT4A 2KCAA 2BD5A 1LQEA 2FYQA 3MU8A 2VVVA 5EJLA 4X1NU 2QE7D 5JDUB 5EQQA 3E1XB 3F1SB 1UCYK 1GDQA 1E37B 1WQVH 1SKYE 3ZZ5A 1UHBA 3PMBB 1GDNA 1BRUP 1AI8H 1DXPA 1H4WA 1NT1A 2WYGA 4NWLA 3DSGA 2CV3A 1O2JA 1O2ZA 5E0HA 1WU1A 1T31A 1XUIA 1OYTH 2J9NA 2SGEE 1CE5A 2OBQA 1ANBA 2GCTB 4XD7D 1S5SA 1W12U 3VB6A 1NRPH 4HG6A 3LGIA 4E05H 1THPB 3ZZ9A 1CBWB 3S7HB 2P3FH 3OSYA 1S85A 1KXBA 2ZU5A 3SOSA 5IK2D 1ELTA 3RXDA 2J2UA 1PQAA 2O8UA 2AH4X 3ODFA 5G4BA 4B76A 3MH5A 2B9LA 5EGMA 3KCGH 4HI3A 3QGJA 1IHSH 2XC4A 4JK6A 1OWJA 1O2HA 2GD4B 3BTTE 4ABHA 1RD3B 3RXHA 2QF5A 2UUFB 4BAOB 2YNAA 1VITH 5C0TA 4DIIH 2KAIA 4SGBE 2KCPA 1AHTH 1EAIA 4YM9A 3W94A 3GY4A 4YT7H 4Z0KA 1LTOA 2FTLE 1BT7A 2BHGA 2F9UA 3SUDA 4FUBA 3MU0A 4JZFH 1DSTA 2XTTB 4YLQH 1EP6A 1HAOH 1C5OH 3RXRA 3P6ZB 3QO6A 2BVRH 1A0HB 4O03A 6LPRA 4JZIA 1BMFD 2V7QD 1UTJA 2A4RA 4OS6A 5SGAE 3QWCH 1OXGA 1FAKH 3NWUA 1V2LT 2IPQX 4IC5A 1AB9B 1TQ7B 1EOLA 1VITG 4FXGH 1HJAB 3SU6A 1O3NA 3EA9A 1O5FH 1U6QA 1W14U 4X2WA 1J16A 1A4WH 4MNYA 4WMFA 4ZHAA 1LHCH 3N7DA 1ELCA 1TRYA 4CRDA 3IWMA 3RXKA 1V2WT 1H8DH 2I6SA 1CU1A 1RFNA 3GOVB 2ZCLP 3ZYDA 2GT8A 5EQRA 3A8CA 1V2UT 4CRFA 3RU4T 3TJNA 5ESTE 3A8BA 2O8MA 1BTXA 1BA8B 2AERH 2ZGXH 3TGIE 5T6GA 2Y80A 4E06H 1SQRA 1FY1A 4TT3D 5HIYA 3BTEE 4X8UH 3SNDA 4RSPA 1YWUA 1WQSA 5DKMA 2A4QA 8GCHG 1C1NA 2GP9B 5C94A 1MU8B 2NWNA 4OS1A 3M61U 1N6YA 1Z6EA 1A1RA 4YESB 1YM0A 4NWKA 1E79D 2ZCKP 1O3PB 2F9OA 3ZVCA 2TGTA 1PJPA 1OX1A 2G52A 3RXOA 1UHBB 2OK5A 1SGCA 4H6SB 4PROA 4DVAU 3CP7A 4BANB 4YT6H 2CMYA 3ATLA 2FZZA 1UK2A 2CXVA 4UE7H 2ODPA 1SGFG 1J17T 1QRXA 1TGSZ 1QQ4A 3MU1A 2XBXA 3O8BA 3TIUA 1VR1H 4Y7AA 1V2TT 5BPEA 1C5MD 1Y5UT 1FIWA 1ELBA 4GLYA 4ZHLU 1HB0B 4DIHH 4I33A 3PRBA 3BIVH 1TE0A 1LHGH 2ZGHA 2FXRA 3F2GA 4AFQA 2OC7A 2Y82A 2KAIB 1K2I1 2QIQA 4AB9A 1GMHF 5PTPA 2G4UA 4NCYA 4FUDA 2ZGJA 4NFFA 3K2UA 1E35B 3TNTA 2FS9A 2R3YA 1KDQA 1YCPM 2VIWA 1MTUA 1AVGH 3BG4C 1B0FA 4MPUA 1NS3A 4J1YA 2ANKH 4AFSA 1DX5M 3SORA 3A7TA 2F9BH 1FV9A 4ZMAH 2HVXA 1CHOG 1P06A 4F49A 3HKIB 1S81A 1BTWA 1VZQH 1W0JD 4P00A 5DP5A 2ZO3H 3S9CA 3N7OA 4IMZA 3RXFA 1LPKB 1G30B 3MWIU 4Y79A 1IQJA 2BY7X 1ELGA 4JCNA 2BQ6B 5DP9A 3H5CB 3EQ0H 5LGOA 1W2KH 5HKKD 2Z3DA 2WPJS 2PTCE 4RN6A 1ZTKA 1GCTC 3RXTA 1CA8B 2ZKSA 4NSVA 4NZLA 2ZIQH 1DWEH 1AUTC 2PKSB 3NRLA 4TWYA 2OQ5A 2PUQH 1WTHD 1HAPH 1KY9A 4YOJA 3RU4D 1Y5BT 3RMLH 5JB8S 1GBIA 2P59A 3A82A 3ZZCA 2B5TB 2LP6A 4O9VA 1EATA 3GDUA 1MAXA 4Y0ZE 5DP8A 3SJ9A 1C2EA 2P94A 3A85A 3TK9A 2BM2A 3SI4H 1JMOH 3RXCA 3LGUA 3UQOA 1YY3A 1YPLH 2GKVE 4MQAA 3S9AA 4CHAB 2OINA 3T5FH 1ETTH 1O3GA 1OWIA 2XC5A 5E2PA 5GIBA 3WY8A 2AGIX 1VGCC 2ZHEH 1YPMH 1O0DH 2BZ6H 4F4OC 1EJNA 1BRAA 1FJSA 1Q31A 2O9QA 2RDLA 2C8XB 5AHGH 2A5IA 1TNGA 3I78A 2WPLS 3OU0A 2ZDAH 2ZWLH 5DSFA 3UOPA 4GHTA 2A2QH 2AMDA 3F0PA 1FPCH 1ZMNA 1EZUC 2QAAA 4JYTA 1ABJH 3F6UH 4DT7B 4K69A 3BG8A 3P17H 3RXLA 1A0LA 2AMQA 2FWWA 2HGTH 2C8ZB 3A80A 1O34A 1C2MA 1C5WB 1JRSA 1PPCE 2EEKA 5C17A 2SGPE 1C4U2 5DGJA 3W1EA 1GHWH 1XXDA 1DWCH 3RXGA 3G01A 2F9NA 3SHCH 1WUNH 3ELAH 3FP6E 8KME2 2BXUH 1HAIH 4FUFA 3SZEA 3M3VA 4ABFA 5KECA 1WOFA 2PHBA 3SQHE 5C0UA 1T8NA 1EUFA 1NO9H 5T3HA 4Y8XA 5I46H 4BXWA 1O3KA 1Z8JB 1QL8A 3DCLA 5I25A 1KIGH 4E7RG 1O3JA 1BQYA 3VEQB 1AZ8A 3RC4A 1EKBB 1O37A 2BDBA 1IOEA 2SFAA 3A8AA 1SHHB 2HPQH 5AFYH 3A7XA 1Z8IB 1LHDH 1KDQB 2NU3E 3ATMA 3ITIA 1A0JA 1ZSLA 1FY4A 2H9HA 1TYNA 4ISOA 2BX4A 4ABDA 4RI0A 4MG3A 1EB1H 1FXYA 1CA0B 4BXSA 1GHBG 4WXIA 1GHAF 2YMSC 4F48B 2OC1A 3GY3A 4Y71A 1ZR0A 4JK5A 3OTJE 2FESH 4IS5A 3P92A 2J92A 1HXEH 4BTUB 3RXJA 7ESTE 1O2YA 2VGCC 3MNBA 3E16B 1P2MA 1HIAA 2BD8A 1E34B 1C1UH 1COWD 1ZRBA 3E90B 2OQUA 2A2XH 5HM9A 3D65E 2PR3A 1MMJN 1NESE 4MPWA 1FN6A 1TRNA 2AS9A 1BHXB 1L0ZA 4FUCA 1FONA 5DN6D 1GGDC 1AVXA 2CF9H 1HAXB 3S69A 1LMWB 4H4FA 1GBHA 1GMCF 3M7TA 5AFZH 2JH5D 5C1XA 2BDCA 4ISIH 1DM4B 1TBZH 1CO7E 4XE4A 2NU1E 3H7OA 2VIPA 4I32A 1UCYE 1A46H 2OD3B 3B23B 2XWAA 1ZJKA 2PKAA 2XXLA 1J15A 1PPFE 2ZI2H 3EYDA 2D8WA 5L2ZH 1HLTH 4UFDH 2GCHF 3A7ZA 2F91A 2OBOA 5FX5A 3S0NA 4CRAA 2GVFA 2A4OA 3D23A 2QY0B 3VB3A 1V2ST 1E38B 1GI3A 1HUTH 2BD9A 2ZFSA 1DFPA 1S83A 4M9FA 3AW0A 2W6ID 1B0EA 1YCPK 2TGAA 2AIQA 1P9UA 3C27B 2WPDD 2J5UA 1P02A 3T29A 2GMTC 1MQ5A 1ZTLA 1Y3XA 2FX4A 1GHYH 2BDHA 3ATKA 4INKA 3OE7D 5AF9H 1GJ4H 1C4V2 2UWLA 1O3BA 1A2CH 4KKDA 1QBOA 1PQ8A 5DP3A 1K9OE 5JBAS 1MH0A 3FANA 2F3CE 1SR5C 7GCHG 2RA3A 2WINI 2ZEBA 1EP5A 4MNXA 1CVWH 4Y8ZA 1F0RA 2JH6D 1M9UA 3BG4B 3T2NA 4CR5A 3OAAD 5C20A 5LH8A 3N99A 5FHTA 1BMAA 3SV6A 5CHBA 3VGCB 5DO4H 2RCEA 3UNQA 3TITA 1OPHB 1TPSA 1C1RA 1W0ZU 1QGFA 2EY4C 3ATWA 1G37A 4TY7A 2IJOB 1S6FA 3GISB 1O2RA 4NG9H 4LZ1H 1NRSH 3F9GA 1SLVB 1C1VH 4QT8C 1AVWA 2ZC9H 1P11E 3KQBA 4NZQA 4B2BA 3RLYH 2SGAA 3R3GB 2AGEX 4K1TA 2RDEA 2FOEA 2VIVA 3FP7E 1O5BB 2BDGA 1SGTA 3ZZ6A 1KXDA 1W0YH 1TGBA 1SQTA 3KQDA 2EA3A 1WV7H 1C2GA 3MI4A 1P57B 1ZHMA 4ZAEA 4D9RA 3KF2A 1TLDA 3NZIA 3AK5A 3PO1C 2Z94A 4XRNA 3O8DA 2EQNA 2ZFFH 3PWBA 5EOKA 4X1SU 4ZH8A 1BJUA 2EI7A 4Q4LA 2TIOA 1HIAB 2CHAC 5DPAA 4IMQA 1C5SA 4CH2B 5GCHF 5FXLA 4X6PA 1EAXA 1BUIA 1NTPA 3BTHE 1K28D 3U69H 4AGKA 1SLWB 2KCOA 1A5IA 1Y8TA 1MTNB 2KX4A 4Q7YA 2STBE 1P12E 3ZVAA 1TMUH 4GPGA 4HFPB 4X8TH 2FOCA 1Y3VA 1EB2A 1MZDA 3E6PH 1SHYA 2D26C 4JYVH 2A31A 3UPEA 1C5RA 1FAXA 1ZZZA 4OM9A 1LKAA 5GWZA 1Y3WA 2PKAB 4UD9H 1XMNB 1IAUA 1TOMH 2WV5A 2WV9A 3HGPA 4ZXYH 2G5VA 1MTWA 5EPNA 2JDID 1EAWA 1O3IA 1GL0E 1BB0B 1GBMA 1O2SA 3TK6A 5JB9S 4X1QU 4XDEA 1O5DH 3MTYA 3SU3A 1L2EA 1YPJH 4F55A 4LK4A 1ANEA 1FLEE 3A87A 1SB1H 2J97A 1ELVA 3M35A 1J9CH 3SNAA 3H09A 1P09A 1PPGE 2PGBB 3VXFH 1AKSA 2P8OB 2ZU3A 3T25A 2V3MA 2ZTXA 1LO6A 4X8SH 3ZV8A 1H8HD 2BLVA 2C90B 1TA2A 1TWXB 2OTVA 4A1VA 1BMNH 2WHXA 1AWHB 1O32A 2AYWA 1SFQB 4IGDA 4BTIB 5LPRA 1CSOE 2G81E 1HAYB 2ALVA 1GHXH 3FOAA 1QRWA 3GCTF 1VCWA 3MNCA 1XM1A 4NFEA 4SGAE 3TVJB 1GBTA 2PP6A 3BIUH 3ZV9A 1GI8B 2BZAA 2JETB 2ZECA 2XBVA 2PUXB 5E8EH 3TPIZ 4K8BA 3RU4E 3ZZ4A 3L33A 3M5NA 2VIQA 4WXVA 4IW4E 4WH6A 1J8AA 2GJGA 1CQQA 4GUXA 1GPZA 1XUJA 2ZDMA 1SGDE 3C1KA 1GHVH 1O3MA 4RKJB 5A0BA 4X2YA 1BBRH 2GGVB 4JZDH 1GI6A 2PW8H 1QBVH 1VCPA 1YPGH 2FX6A 2HVYB 3ZZ3A 2WYJA 2A32A 4BAHB 1HDTH 3U98H 2LNCA 1YLCA 1HCGA 1D9IA 1C2DA 1SGIB 5FAHA 3R0FA 1DSUA 2BD3A 2KM0A 1JOUB 2BD7A 1ZSJA 1T8LA 1LVBA 3GCHB 5L6NH 1TNJA 3PLPA 1DXWA 1GJ8B 2O8LA 1FZZA 3U1JB 1SGQE 3PLBA 2ODYB 3Q3YA 1V2NT 3T28A 3TLOA 4LOYH 1UVOA 2C8YB 2ZZUH 1DT2A 3VB5A 4VGCB 5F8ZA 5FX6A 6CHAB 2R0KA 4MPXA 1RRKA 2SNVA 4B71A 4YOIA 4U32A 2H2ZA 5GPIB 5CDFE 2STAE 1YPEH 2Q1JA 1GJAB 1Y5AT 1QR3E 4WMEA 3FVFB 4CBOA 4GCHG 4I31A 3K65B 3GY2A 1UTQA 1NRNH 1P2KA 1ACBE 3OFND 1SBWA 3M3SA 2GZ7A 1GBJA 5E0GA 3SYJA 4NIXA 3M37A 2J34A 4OS2A 1V2QT 1TGCA 2BYAX 5DJ7A 2TPIZ 5TJXA 4DURA 2IPHA 1ZGVA 3HK3B 3MU4A 1ETSH 1XUFA 2HPPH 1O2VA 3SU4A 1QFKH 2GV7A 1F5KU 1HYLA 3E0PB 5F03A 3A7WA 1IQKA 3S7KB 1T8OA 1NM6A 1TNKA 3GDVA 4B75A 3NPSA 4P02A 1IQNA 3HATH 1AFQC 4TY6A 5DG6A 2BD2A 4ABJA 2XW9A 1DWDH 1CGHA 4YOGA 1H8IH 1IQEA 5EJ1A 1GI7B 1IQHA 1QJ6B 2ZG0H 3MO9A 4DGJA 1W8BH 1G3EA 4O3UA 5EJZA 1NN6A 2G5NA 3M7QA 1DUAA 3SUGA 2R3UA 2WUBA 2IN2A 2WPHS 3UWJH 1C5UA 1OKXA 1ZTJA 1AE8H 1TPAE 2HNTE 1P2IA 2CHAB 4XFQA 1C5QA 1O33A 3MYWA 5JBCS 2B0FA 1LVYA 4FETA 2R2MB 4I7YH 3UOUA 3V7TA 3H7TA 3RMNH 2ZFPH 3BTGE 3BTWE 1GBCA 1UTNA 2VB0A 3RXSA 2Y5GA 2F9VA 2F43B 1N8OB 2BB4A 3A81A 1V2KT 1LPZB 5HYOA 1GG6C 1K1IA 1MKWH 5EG4A 3ZVBA 2VJ1A 1HAVA 4KTCA 4I8HA 2Z3EA 1DOJA 2W26A 4LXBH 2ESTE 5TCAA 4NGAH 3RXQA 1JIRA 1O2XA 3SV9A 4CREA 1FY8E 1C5VA 3P95A 3PMJA 3GICB 1HXFH 1GBFA 4FVDA 1KLTA 1AQ7A 1TBRH 3EAJA 1ESAA 5CHAB 4ZKSU 2M2AA 1ZJDA 2XCNA 1VITF 1O5AB 2KFWA 1E1RD 4J2YB 3QN7A 1ELAA 2Z9GA 5A8YA 2SGDE 2QF3A 3RM2H 3UNSA 1EPTC 1FMGA 3TH3H 3JZ1B 3BEIB 2ZTZA 1WXRA 1OOKB 1PQ5A 4X1PU 3B8JA 4FU8A 4B1TA 1QQUA 8LPRA 2W7SA 1VJ9U 2FM2A 2BY8X 3SQEE 3SV7A 1BDAA 2KZ4A 3NXPA 2FTMA 4IN1A 1JIMA 1Y3YA 2JJ1D 3GY5A 4K1EA 1RTLA 1ARBA 1H9IE 3M5MA 2W7UA 2JH0D 4TPIZ 5FCKA 1ZOMA 2WPMS 4Q7XA 2H9TH 2ZHWH 1O2OA 2C4FH 4O3TA 1C1OA 2P16A 1QZ8A 5CE1A 8GCHF 1OS8A 3FAOA 1TNHA 2J98A 1O2NA 3TGKE 2UWOA 3MOCA
chains in the Genus database with same CATH topology
4ZXXH 1BIOA 1TB6H 7LPRA 7KMEH 1YC0A 1GJ5H 1C1PA 3BTQE 2QXHA 1Q3XA 2C3SA 1L1JA 2LPRA 4R8TB 1ANCA 1GJBB 5FPSA 2ZA5A 5A2MH 3NKKA 3V13A 3LU9B 5J4QA 5FCRA 1O3DA 2B7DH 2P3UB 3TJOA 1GBKA 5LPEA 4FU9A 1ELEE 3RDZA 2NU4E 3GDSA 1W7XH 1EOJA 2ZGCA 1T8MA 4CRBA 1O3LA 1SGEE 1G32B 2Q6FA 1YGCH 2C8WB 1NZQH 1C5LH 2QV1A 1KTSB 1KSNA 2V3OH 4ABBA 1C4Y2 1MZAA 4LZ4B 1FI8A 1WBGB 3KNXA 2J38A 2ZCHP 1C5NH 1G3BA 1O3AA 2GDDA 4I8LA 1YKTA 4NSYA 1O2KA 9ESTA 1ZHRA 1PPHE 4A5TS 4X2XA 1W13U 4Q7ZA 2FI4E 5C3NA 1HGTH 3E0NB 1HAVB 1G9IE 3LC5A 3Q00A 2O8TA 3UUZA 1UMAH 1BRCE 4K8YA 4JZ1A 3BN9A 2ZDNA 4MDSA 2TGPZ 4DY7B 2BDYA 1HAZB 2QGRA 1TQ0B 2Y7ZA 1GDUA 1A61H 2VWOA 1GBLA 4A92A 3QDZB 1P2OA 1WSSH 1CHOF 2FDAA 3SGQE 1Y3UA 5ABWA 3PROA 4UFGH 1S82A 1NU9A 1SI5H 1Y59T 2A4GA 2A0QB 1OWDA 3QUMP 4AN7A 3QTVH 1C2HA 2FOGA 1NFWA 1T4VH 4DOQA 3HGNA 1EAUA 2GT7A 1HAGE 3FFGA 4WY3A 1C2KA 1AO5A 1KXEA 3STIA 1AZZA 3O8RA 3T62A 3K6YA 3KQCA 1E36B 1TGTA 3FZDA 1LVOA 1O31A 5EXLA 1OWHA 4E7NA 3FP8E 2AFQB 2FOBA 1FY3A 4A6LA 2GTBA 1O2WA 2BX3A 4WWYA 1OSSA 2ZP0H 2GCTC 3M7UA 2BY6X 1TRMA 1CBWC 1ESBA 3KN2A 3V0XA 3SNEA 1C1WH 3A84A 5JPMH 4XBBA 4B2CA 2OLGA 3DD2H 3LH1A 1GL1A 3EA7A 1PQ7A 2QCYA 2XBWA 3NCLA 1S6HA 1ZSKA 2TRMA 1F5LA 1S0RA 2THFB 4OS7A 1KXCA 1ZMLA 1JBUH 4D7GA 1XVMA 3ZZ7A 4I8GA 3LDXH 4ZKRU 3TGJE 2ZQ2A 1C9PA 3I77A 4K3JA 4Q80A 4CR9A 2AMPA 1L4ZA 2Y5HA 2ZTYA 3Q3KA 2VWMA 4H42U 1J14A 1BTUA 1DICA 1P05A 1EQ9A 1V2VT 1HRTH 4DCDA 1C9TA 3HKJB 4ASHA 2BVSH 2CN0H 4O97A 1O30A 1ELDE 2H5DA 5BRRE 3PMHB 2TGDA 2VIOA 1O5CB 1P2NA 1UTLM 1GVZA 1UK4A 1F0SA 1O2UA 4AYVB 3LC3A 3NUMA 2ZPQA 1TBQH 1P3CA 5E0JA 2V35A 4AYYB 1G36A 4R0IA 2HRVA 3E8LA 4RKOB 1Z1IA 2QXGA 4CBNA 3NK8A 1MUEB 1F5RA 4AORA 4Y8YA 1LPGB 1SLUB 1SLXB 1BTYA 3LJJA 4MLFB 3PTBA 3UFAA 3UNRA 1OYQA 3TK5A 5E2OA 1MU6B 1S0QA 2K1QA 1NRQH 1TAWA 1GJ9B 3P8NA 5C5NA 1P9SA 1FQ3A 1O2MA 2W3KA 3SGBE 1INCA 1LHEH 3MH7A 1O2PA 3K9XB 1WYKA 1GCTB 1A5GH 1V2OT 1XVOA 3BV9B 3AVZA 2F9PA 1B7XB 2OXSA 1GHBF 1V2JT 4UFFH 1MD8A 1OP2A 1EZXC 3Q3XA 1AE5A 1HV7A 3SHAH 1P10A 1HPGA 2H6MA 2VNTA 3ATIA 4WF8A 3QZRA 1GBBA 2FEQH 1TABE 1Z71A 1H9HE 5FBEA 2FO9A 1UVPA 2Z9KA 3ZZDA 2VIDA 4BAQB 1UO6A 3BF6H 4M7GA 3LH3A 3F9FA 3QK1A 1NFYA 1TOCB 1GJ7B 3UTUH 1DANH 1ZHPA 1C5YB 1D3QB 3V3MA 1GCDA 1C1MA 1GJ6A 1DUEA 2A7CA 2A1DB 4DJZB 1VGCB 2A5KA 3VFEA 2G51A 3GY7A 1SGYE 2XCFA 3CENA 2G00A 5DP7A 1BBRK 4FUHA 2QXIA 5GDSH 2IOTA 1LKBA 1OWEA 5EPYA 2YOLA 1THSH 5A8XA 2J94A 3RXPA 5A0AE 3TH2H 2XWBI 3F9HA 1TA6A 5AVDA 1BRBE 2JKHA 3SJ8A 4Y76A 3UR6A 3SZNA 4TWWA 1GI1A 1JRTA 3DFLA 2YNBA 2ASUB 2BDIA 1NROH 1UVUH 2D1JA 2H9EH 1YCPH 4K5ZA 2Y5FA 1FNIA 5EXNA 1IQIA 1HAHH 1EZSC 1T32A 4AOQA 1DDJA 3AW1A 1AN1E 3UREA 3SJKA 1FN8A 1CHGA 1CT0E 4WH8A 2FP7B 3RUOA 4AGJA 3A86A 1Z6JH 1P04A 4K60A 3QLPH 6ESTA 3LT3A 1Z8GA 2HWLB 1NRRH 2WPKS 2OUAA 1IQMA 1TX6A 7GCHF 3MU5A 4KTSA 2CGAA 3BEUA 2OC0A 2A7JA 2WPIS 1NC6A 1DWBH 3A83A 2ZDVH 3SW2B 1SGPE 3E91A 2XBYA 5JYIA 2BOKA 4MTBA 2H5CA 3TJUA 3AAUA 1X7AC 1F92A 1HNEE 2PKSC 5L30H 2PFEA 3SU2A 2VGCB 5DP4A 4GVUA 3ZVDA 1GBAA 2QN5T 4X6OA 1RS0A 1ESTA 4AZ2B 4AFUA 3AAVA 2EI6A 3PV4A 4AG1A 1BHXF 1MBMA 1SMFE 2QA9E 4TPYA 1FPHH 1CT4E 4NA7A 4ABIA 4CHAC 2I6QA 1GGDB 2G55A 2HNTF 3KIDU 3M36A 1F2SE 3MH4A 3KHVA 3UY9A 2A7HA 1TONA 1BMMH 1WCZA 2ZHFH 4GHQA 1XUKA 2BQ7B 2G8TA 3S9BA 4D8NA 1G3CA 1AUJA 3GY8A 3RXMA 4DG4A 4TYDA 3OX7U 4KTUA 2OCVB 4MNVA 1K1MA 1RJXB 3P8OA 1O2QA 3P70B 4NA9H 1GBDA 2HLCA 2UWPA 4JMYA 3L6PA 1GI9B 1ZYOA 5L2YH 1QJ1B 1MQ6A 2BY9X 2ZU2A 2TBSA 4UONA 1QURH 5C1YA 1P2JA 1P8VC 1LVMA 1MKWK 1YLDA 4DW2U 1SGRE 2Y81A 6GCHG 1GMHG 1QJ7B 2UUYA 1XXFA 4BNRA 2GMTB 3KEEA 1MKXH 2PWXA 1T7CA 1QNJA 2ALPA 1LCYA 4JYUH 1W3CA 1AIXH 5H4IB 1SOTA 2OP9A 3FZZA 1K1NA 1AU8A 4CRGA 1QY6A 4NIWA 3URCA 1EX3A 1EASA 1BTZA 1PPZA 2ZFRH 1AD8H 2BTCE 4BAKB 4FU7A 4OS5A 5A0CA 4ZUHA 4MPVA 2UUKB 1NFXA 2P93A 3BSQA 3SO3A 3EGKH 1QIXB 1YF4A 3U1IB 4XOJA 3MO6A 4NIYA 4ZHMU 4JZEH 1W7GH 1QL9A 1O3EA 2ZPRA 1DY9A 2VH0A 4Z6AH 3PM3A 3ZVEA 2QF0A 5T6FA 1AKSB 1RIWC 1C1TA 1EXFA 1ZLRA 1BOQA 1CA0C 1ELFA 4XBDA 1ARCA 1UCYH 9LPRA 1IHTH 3RXVA 5T6DA 1V2PT 2Q6GA 1L4DA 1A3BH 5C2ZA 1BCUH 3GYLB 2Z9JA 1Z1JA 2F83A 5HMAA 1UTPA 2ANWA 3SN8A 1DVAH 1MTVA 3LGWA 1TGNA 1P3EA 4FUGA 3LJOA 1UTMA 4INHA 3MFJA 1ZPZA 3PO1B 5HXFA 4X2VA 2P3TB 3Q77A 2HNTC 1SFIA 1P2QA 3HK6B 3RM0H 1WTGH 3KL6A 4I8JA 2FODA 1O2GH 2W5EA 1O2IA 1K1OA 5K7RA 5F6MA 3MH6A 1SC8U 1A5HA 2FLRH 4D9QA 4YZUA 2R2WU 1TALA 1C5TA 4B2AA 2BVXH 2R0LA 1THRH 2V6NA 1L1GA 1Z8RA 2VWNA 3SNCA 4AX9H 2Z9IA 1G3DA 4Y10E 1F7ZA 4ABAA 1DLEA 4CH8B 3SBKA 1CGJE 4FVBA 4UFEH 3RC5A 1OWKA 2FYRA 3LPRA 2EC9H 2CJIA 1A7SA 2DE9A 4ISHH 3HPTB 1UVTH 3PMAB 3PYHA 1GJDB 3VXEH 3SJIA 6GCHF 1CT2E 1AFEH 2ULLA 3E3TA 2WUCA 2Q6DA 3SV2H 5EODA 2GDEH 3AASA 2A45B 3I29A 5ESBA 4GSOA 1MD7A 1D6RA 2VWLA 3A7VA 1K1PA 5IYTA 2BOHB 4Y7BA 1Q2WA 4HGCA 3GY6A 5JBBS 4GCHF 1RTKA 1XUGA 3D49H 1MAYA 2AIPA 2FI5E 4A7IB 2B8OH 1UVSH 3GCOA 1C2IA 3DT0H 3VGCC 3ZYEA 2P95A 2VU8E 2SGFE 1HJ8A 4CRCA 4UEHH 5GJ4B 1S84A 4MNWA 2G4TA 4FUEA 4ZROA 1GHAG 3SU0A 3OYPA 3RP2A 3OY6U 1D6WA 4ABEA 2ZFTA 3TU7H 1UTKA 1YPHE 4A1TA 1TNLA 1YPHC 3MHWU 2ZPSA 5EXMA 3MNXA 4Y6DA 4MVNA 3PWCA 2ODQA 3LIWA 3SI3H 1DLKB 1GWAA 1SGNE 2NU2E 5HGGA 1AWFH 3VB7A 1IQLA 1EZQA 2FMJA 1TNIA 4NA8A 3MO3A 1RTFB 1QB6A 5B6OA 2BXTH 1GI2A 5A09A 3SNBA 1DS2E 1O39A 1RXPA 2R9PA 3V12A 1HBTH 4FUJA 2H1UA 3ZZAA 1GMCG 5CMXH 2PV9B 2BY5X 2Y6TA 4KELA 3U8RH 5F8XA 1BJVA 3VPKA 5EW2H 2ZF0H 1K1JA 1C5ZB 5EW1H 1O35A 3RXEA 3U9AH 4BOHA 3A7YA 1PYTC 1SOZA 1ANDA 1PPEE 2XRCA 2RA0A 3Q76A 1MTNC 3M5LA 3SJOA 2UUJB 4XSKU 1SPJA 3RC6A 1PFXC 1V2RT 1QA7A 1OP8A 2GCHG 1O3FA 2SGQE 1FUJA 4H6TA 4ISLA 2FS8A 3A88A 1K21H 3KQEA 1HFDA 2M5TA 2XYAA 1DITH 1GMDG 2FOAA 2QYIA 5ETXA 5DP6A 4Y11E 1BMLA 1N1LA 2FPZA 3W95A 1C5PA 1F0TA 2ZNKH 4B73A 2NU0E 4ISNA 1SL3A 1NFUA 1O5EH 1D4PB 4WMDA 4WVPE 2EI8A 1D3DB 2C93B 1C2JA 1BBRE 2RG3A 1EPTA 5HM2A 4AG2A 2HALA 3QZQA 5J4SA 4D76A 1VJAU 1C1SA 1DY8A 1MCVA 1DPOA 3LGYA 4K2YA 1O3CA 2ILNA 2XC0A 3EDXB 3URDA 1GHZA 3ZZBA 3ZVGA 1LDTT 5FBIA 3LGTA 3RXAA 1HJ9A 1V3XA 3CS7A 2P8OC 1LQDB 3CS0A 3PB1E 5GXPA 1PPBH 1CGIE 1O3HA 2Z6BD 1YYY1 4IC6A 3EE0B 5FPTA 5DK1A 1BTPA 1KLIH 2ZFQH 2FOFA 3LKWA 4WJG2 1Z7KA 3F68H 1ETRH 1TPOA 4HZHA 1RIWB 3KGPA 1RGQA 2Z9LA 1O36A 2BLOA 1NY22 3SGAE 2PTNA 1VCQA 1AY6H 1QTFA 1AFQB 2JETC 1EJAA 2BLWA 1C2FA 2ZHDA 3DA9B 3PLKA 1YP9A 1TMTH 1ZPCA 1G2MA 1KLJH 2GZ9A 1IQGA 2PGQB 2V3HH 5GCHG 3QGNB 3SU5A 3STJA 3VB4A 2Y7XA 1AMHA 2GZ8A 1SQAA 2FOHA 4D7FA 1KXAA 5LPFA 3M5OA 1TX8A 1MCTA 3RXBA 3OY5U 4KP0A 3SV8A 4OGXA 4ZKOU 4X0WU 2VVUA 2BLQA 4ZKNU 4YLUA 3T26A 1A3EH 4YO9A 1N6XA 4ABGA 1GI5A 1MTSA 1O5GH 3F9EA 2O8WA 3GCNA 5FPYA 1GG6B 3GCHC 3BTFE 3BTKE 1SQOA 1W11U 3RLWH 2FOMB 4B74A 1ORFA 5K0HA 2BD4A 3LONA 1IQFA 2WV4A 4INLA 2J4IA 1LHFH 4K1SA 3U8OH 1GMDF 4IBLH 1ABIH 2VINA 4VGCC 4Y0YE 3RXIA 3T27A 1GJCB 5TCCA 6CHAC 1AB9C 1JXPA 3SU1A 3UWIA 1HJAC 1SG8B 3U8TH 2GV6A 4U30A 1BZXE 3LOXA 4X6MA 1UK3A 3PTNA 4HTCH 2ZGBH 1FY5A 2BMGB 4BTTB 3P8GA 1SVPA 3BTDE 2FIRH 4AB8A 1BITA 5JBTA 4X8VH 1V2MT 1QB1A 2Z7FE 1O3OA 1EPTB 3EA8A 1GBEA 5F8TA 4A1XA 3ZZ8A 2FLBH 1BTHH 4U01A 3DFJA 1XKAC 1TMBH 2HOBA 3LGVA 2ZDLA 1UTOA 1QCPA 1YPKH 1H9LB 4OS4A 1D3PB 1JWTA 3K6ZA 3TNSA 2FI3E 1TPPA 3TJVA 2GX4A 2PLXA 3GCTG 5C5OA 1F0UA 4U2WA 4UDWH 1GI4A 2W3IA 3ENSB 1ZMJA 3UR9A 1FDPA 1ZRKA 2PSXA 2VVCA 5C1UA 1UJ1A 1QA0A 1NPMA 3GYMA 2VH6A 4XBCA 2BQWB 1PYTD 3IG6B 2J95A 4AFZA 2BDAA 1KTTB 2ZQ1A 5A8ZA 4X1RU 4YTAA 1XKBC 1YBWA 1ZGIA 1QB9A 1SGFA 1C2LA 1W10U 1O2TA 3SUEA 3SUFA 1GVKB 2AGGX 1T4UH 3A89A 1O2LA 5EQSA 2OC8A 2V0BA 1QL7A 1E0FD 2ZDKA 1C1QA 3A8DA 4GAWA 2A5AA 2AEIH 1H1BA 3L3TA 4IN2A 1ID5H 1L1NA 1G2LA 3DUXH 2CF8H 2D2DA 1ZPBA 2QXJA 5IDKA 2Z3CA 3IITA 4OGYA 1P01A 3RXUA 1QRZA 1D3TB 2DE8A 1KXFA 1KYNA 1N8OC 4NIVA 3TH4H 4THNH 1GI0A 1MBQA 1O38A 1QBNA 2SNWA 2ZHQH 3BEFB 3QX5H 1SSXA 3M3TA 2DUCA 1TFXA 3RMOH 3UIRA 1B5GH 2XNIA 3DHKH 5C67A 1K22H 4ESTE 4KGAA 1GVLA 3D62A 3MNSA 1MKXK 2ZU1A 3QTOH 8ESTE 3JZ2B 2ANMH 2ZU4A 1XUHA 1DE7H 1EJMA 3B9FH 4I8KA 1V6DA 1OP0A