2GZ9A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Replicase polyprotein 1ab
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
total genus 82
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz9A02
3S69A 4INLA 4CRFA 3LJOA 3CENA 4ISIH 2BD2A 3UFAA 1S83A 1FY1A 1O2ZA 3P8GA 1WQSA 4CRBA 3UWIA 1OP0A 2BDHA 1QIXB 3MTYA 3FVFB 5J4SA 1XM1A 2H9EH 5LH8A 3M5OA 4NIVA 2Y5HA 2CHAC 3S7HB 2PTNA 1QA0A 2H1UA 4ABEA 1N6XA 1SLUB 1C1OA 1GVKB 1IQLA 3D49H 3QGJA 1HPGA 1GMCG 4THNH 3SUEA 2ANWA 1EATA 2ZDAH 4YM9A 3HGNA 1C2HA 3OTJE 2W3KA 1YPHC 2F9VA 3PTBA 1F92A 3FAOA 2W7UA 1Z1IA 5C67A 1V2OT 1EJMA 4WXIA 3PMJA 4HFPB 1IAUA 1NRQH 1PYTC 1CHOG 1OSSA 3P8NA 1O5BB 1W7XH 3MH4A 4JYVH 3LGTA 1N6YA 1CT2E 2A0QB 1P0SH 3RLYH 2ZHWH 3S0NA 1TA2A 1TNKA 2V0BA 3BTEE 1BMNH 1DPOA 1IQNA 2VU8E 3STJA 3ZVCA 4ZH8A 3V12A 4INHA 4WH6A 1NZQH 3BTHE 3PMAB 2H9TH 3GY2A 3W95A 1VGCC 3M7UA 1WOFA 2A2XH 4KGAA 4B1TA 1NFYA 3ZYDA 5FBIA 1BOQA 4LXBH 1NTPA 2Z9IA 1A3EH 5C1UA 3G01A 4E06H 3URDA 1UHBA 5JBAS 1QA7A 4ISHH 2H2ZA 1L4DA 3MHWU 1TBZH 3BTME 1AN1E 2CHAB 4AFZA 1NPMA 3DFJA 1TQ0B 1P01A 5H4IB 5K7RA 2QGRA 2SFAA 2XWAA 2HRVA 1NU9A 2FXRA 1O3GA 1KLTA 1GI2A 3P92A 1SLXB 3QZRA 2FLBH 1DDJA 3LC5A 1O2WA 4JK5A 1LQEA 4WVPE 1ZOMA 2D2DA 4CR5A 1TBQH 3GYMA 3RLWH 1O30A 1GL0E 1CGIE 5IYTA 1MAXA 4Q7YA 3BSQA 1BMMH 1SHHB 1WCZA 1BITA 2GZ7A 2BQWB 2XC5A 1GI1A 2ZDVH 3A8DA 3P70B 3ZZAA 4A1VA 4AYYB 2ZQ1A 2G00A 4CH2B 1IQIA 4MPWA 5ETXA 1WYKA 2ODYB 4X1QU 4IN1A 4K60A 3ZV8A 1TGBA 3PTNA 3RC5A 3DUXH 1C1WH 2GCHF 2KAIA 1SL3A 4UFFH 2GP9B 4JK6A 1GHAG 1T8MA 3RXEA 3RXVA 1DM4B 4ABGA 2BXUH 1RTLA 4O03A 1AGJA 1FPHH 2ZKSA 2FIRH 5C1YA 3SJ8A 2XBXA 1G9IE 1W14U 5T3HA 1QFKH 1C5UA 1FONA 5LPEA 2OC8A 3TLOA 4KELA 2GDDA 2F9PA 1A0LA 2XYAA 1UJ1A 1VZQH 1AUTC 4U30A 2D26C 2RDLA 1AKSA 3B9FH 1ZJKA 3JZ1B 3LJJA 2ANYA 1OX1A 1T7CA 4DIIH 1FPCH 3ATKA 2ZU4A 2ZZUH 3A7XA 4CRAA 1E38B 3UOPA 1IHTH 4OGYA 1SGIB 1P05A 2CN0H 3A82A 3A83A 3RXJA 1QGFA 1Z1JA 1XUHA 4DY7B 3F9FA 2FEQH 5EW1H 1DWCH 4MPVA 3RXBA 3KEEA 1BT7A 1S0QA 1UTKA 3MI4A 1V2LT 4YLQH 3VPKA 2ZECA 3DA9B 3HK3B 2ZCLP 4XBCA 5F8TA 6GCHF 1ANBA 1HAZB 1OWIA 1TMBH 2FDAA 4NWKA 3RXOA 2VINA 4B76A 1JRTA 1C1UH 4H6TA 1BTUA 1GMCF 2FX6A 2HOBA 3BTFE 1NFWA 9ESTA 3UNQA 1YPHE 5HYOA 1O5CB 3N7OA 1NC6A 1TMUH 1FY5A 4AB9A 4U2WA 2XC4A 2JETC 2EI6A 1TALA 5JDUB 1CHOF 1BB0B 3SU5A 3MNBA 3T29A 1YLCA 2FZZA 1DXPA 1SGYE 1O2SA 2ZHEH 1EB2A 1ARCA 5E0HA 1UTJA 2BY9X 2R2WU 2H5DA 3RXUA 1XXDA 3RMOH 2AIQA 2EC9H 4XFQA 4GCHG 3RU4D 4HTCH 2R9PA 1LVYA 3OY5U 3FP6E 3MO6A 5CHAB 2ZEBA 3TNSA 3TK9A 1DUEA 1QJ6B 3I29A 4MQAA 1XMNB 4DIHH 2GZ9A 2A5IA 1ETRH 3VB6A 2BQ7B 1PPZA 1EQ9A 1BZXE 3A88A 4YOIA 5EODA 2I6SA 1EJNA 1W2KH 2Z3CA 4ISOA 2PTCE 3F68H 2H9HA 6CHAB 1FV9A 3SU4A 4YO9A 1EAWA 4CHAC 2CJIA 2BLVA 2VB0A 2OQUA 1O2QA 1C1RA 3TPIZ 4J1YA 1ZMJA 1GBMA 5F8XA 3QTOH 2AFQB 4NIXA 2FOFA 1AE8H 1A3BH 1C1MA 1C5YB 2C90B 3A7VA 1BTYA 1VITH 3MU0A 1H4WA 5FHTA 2RA3A 3LU9B 3ZZDA 3S9CA 1FN6A 1G32B 1E36B 1QL8A 1P2IA 2BDAA 1H9IE 1ZSJA 2P95A 3BG8A 1MTNC 1ZTKA 2W26A 4SGAE 1AVWA 2FYRA 5GJ4B 1GGDC 4UONA 5SGAE 1ELGA 1ANCA 1BTZA 1P8VC 3A86A 2BHGA 4NFEA 4E05H 3SHAH 3L6PA 4BXWA 3GCHB 1Y5UT 2ZG0H 5I46H 1IQJA 1FY8E 1QQ4A 4NA9H 4ABHA 1EP5A 1UTLM 2FI4E 3SNEA 3TITA 1D6RA 3SGAE 3URCA 3TJVA 1YGCH 1GHAF 1C5NH 1C5TA 2BD3A 1P09A 2J34A 3E16B 4UFGH 1HGTH 1A5GH 5GXPA 1V2PT 4TPYA 1TA6A 2VIOA 4FVBA 1LQDB 2V3OH 5G4BA 5DPAA 1O2UA 3A7TA 1O2RA 3E90B 1N1LA 1RGQA 1JWTA 2Z3DA 4I32A 2UWOA 1HAYB 2RCEA 4NA8A 3M7QA 2A5KA 3TU7H 1HRTH 3EBNA 1OP2A 3VB7A 1S82A 3QN7A 3GCOA 6LPRA 4AFUA 4ABBA 3IITA 1SOZA 1ZYOA 3VEQB 3K6YA 3PWCA 1GBHA 2HLCA 1P2NA 4ISLA 4FUHA 4AOQA 3RMLH 4MTBA 1LHCH 3RUOA 3V7TA 4ZHLU 1MTNB 1TPSA 3P17H 1MZDA 1CBWB 2OCVB 1MQ6A 5EW2H 1SMFE 1L4ZA 1Y3WA 3ZZ4A 2DE8A 3F1SB 1PYTD 2FI5E 3VXEH 1C5LH 3EYDA 3SUGA 1J8AA 1GHBF 1L1NA 2O8UA 1SOTA 1AU8A 4CRDA 1SBWA 3RMNH 4LK4A 4O3TA 4NSVA 1GJ8B 1C2JA 5CE1A 1TABE 2UUKB 4K3JA 3SO3A 3ZV9A 5C2ZA 3HATH 1RFNA 3VGCC 4Y8ZA 3U8TH 1FY3A 2ZIQH 2PHBA 4U01A 2OBOA 1P03A 3A7YA 1FAXA 3UREA 1GJAB 4J2YB 1RJXB 1MUEB 1SGFA 6ESTA 4CBOA 2P94A 1TPAE 1MTWA 1D4PB 4MLFB 2SNVA 1MKWK 4XOJA 1YCPK 1VCPA 1K22H 5AFYH 3TH4H 5T6DA 4GCHF 4JYUH 5DKMA 1DOJA 1LPGB 1LHDH 2OD3B 5JB9S 1V2RT 1QRWA 1AQ7A 1F7ZA 1C5OH 2Y82A 4FUGA 1DY9A 2JH5D 4TPIZ 3UR9A 1PPCE 1K1OA 4NCYA 1GL1A 4BTTB 2I6QA 3FZDA 4A6LA 1VJAU 4WH8A 2BD5A 1AIXH 1TGSZ 1CA8B 2JH6D 3BTKE 4ZXYH 5F6MA 4TYDA 4AG1A 1K1MA 2QXHA 3V0XA 4R8TB 3LKWA 2R3UA 1NY22 2SGFE 3LGUA 2CXVA 3TJNA 1YCPM 3QWCH 1GI7B 1TX6A 1T4UH 1O2JA 1O5DH 1O3PB 2SGEE 3LIWA 2G4UA 2J38A 4CRCA 2VIQA 1LHFH 1GVLA 3P8FA 2A7HA 2BZAA 4JZEH 3VGCB 5EQQA 3M3TA 1ZPCA 5FCRA 1W11U 2G81E 2BDIA 2FOHA 1EOJA 1YP9A 4YESB 4AB8A 3LPRA 1GJ6A 2C8YB 1P02A 5A0AE 1GI5A 1OWJA 2A4OA 1VITG 1P2KA 1GBDA 4BANB 4OS2A 1LO6A 2FOBA 2TGPZ 1J9CH 2LNCA 4I8HA 5A09A 1QRXA 2OUAA 2ZC9H 2YNBA 2A4GA 1GBFA 3BTTE 2QXGA 2R3YA 2ESTE 5A2MH 2GV6A 5FPSA 2A1DB 3BV9B 1FI8A 1GI3A 5DK1A 1BRBE 1XUIA 5FPYA 5LPFA 3O8RA 1AY6H 1C5PA 4VGCB 4H42U 2NU3E 3NK8A 1OWKA 2WPJS 2WPHS 1QB1A 4ISNA 1WV7H 5JPMH 2VIWA 1HCGA 4RSPA 1S6HA 1GJ9B 4ABIA 1A7SA 1NFUA 4JMYA 4KTCA 1D3DB 2WV4A 3ODFA 1BTHH 1TX7A 1SG8B 1YLDA 2ODPA 2QXJA 1F5KU 1W0YH 1SGNE 2VIDA 4WF8A 1TAWA 1A46H 1YYY1 5E0JA 3IG6B 2BQ6B 2PUXB 1SGPE 4BXSA 1JBUH 4Y7BA 2Q6GA 1GJ5H 1WAYB 1C2KA 1NRRH 4GHTA 3UOUA 1QR3E 2GGVB 1K28D 4MDSA 4ABAA 2WV5A 2ZTZA 3PM3A 1ESBA 3T5FH 1DITH 4FUCA 3AVZA 4B74A 1GBIA 4AFQA 1BCUH 1KXEA 1FXYA 3BN9A 4FVDA 1KIGH 1DLEA 1S0RA 1BIOA 1W12U 1W0ZU 2PSXA 1TIOA 5HM9A 2A7JA 1ORFA 2G5VA 2ZTXA 1GI8B 4NWLA 3RXSA 1FJSA 1TGTA 2R0KA 4X6NA 4TY6A 2AYWA 3A8AA 3EGKH 1DICA 3HPTB 4XE4A 3SNAA 3SJIA 3VXFH 3I77A 4KTUA 1W7GH 2AMPA 2IOTA 3M61U 5JBCS 4X6OA 1P9SA 2ZNKH 2BMGB 1C1NA 3T25A 2XW9A 1HAHH 1GHVH 2PKSC 1ETSH 5EGMA 5L2ZH 2SGQE 2VWMA 1KDQB 1O3OA 3M5NA 1ZMLA 4BNRA 2THFB 2WPIS 1Z6JH 4BAHB 1HNEE 2BXTH 2FTLE 3AAVA 3OY6U 2CF8H 1AE5A 2OP9A 4ZMAH 2IJOB 2ZDNA 4DGJA 4X2VA 3GCTG 1S85A 4JZIA 1O3DA 1YC0A 2A31A 1SGEE 2P59A 3A8BA 3RM2H 1O5FH 4Y0ZE 2FOEA 4MNWA 3T27A 2VH0A 1C1PA 1MD7A 1O2VA 2NU4E 3OYPA 3RXTA 4AORA 3SU1A 1UK4A 1ABIH 2NU1E 5DP8A 4MNXA 1T8OA 3SBKA 8LPRA 4Q7XA 1FN8A 3RU4E 5J4QA 2PSYA 1MCTA 4JCNA 1SSXA 2PLXA 1ZTJA 4OS4A 5ABWA 1V2TT 1IQHA 1FDPA 2EEKA 1G3DA 3PV4A 2FOCA 3S7KB 2BOKA 3U69H 1O2XA 2OC7A 1AFEH 1WTGH 2B8OH 4FUEA 1HUTH 1T31A 3SN8A 2BX3A 1HXFH 1LPKB 1GJ4H 3P6ZB 1CT0E 3BTWE 1DANH 2FX4A 3HGPA 1C5RA 1C1SA 2BM2A 3OU0A 3S9AA 2YNAA 1BHXB 2WPLS 1C2FA 2BB4A 3A7WA 3MU5A 1VITF 1Z6EA 4H4FA 5DP3A 2EA3A 2PKSB 3STIA 3PWBA 3GY3A 2Y6TA 4TWYA 2ZFFH 1WSSH 2HNTC 4DJZB 5HXFA 2STBE 2VVVA 4Y79A 3SUDA 1C5MD 1O35A 1BA8B 2ZFRH 4UFDH 2FYQA 2ZPRA 3MNCA 4WXVA 4B2CA 3C1KA 5HMAA 5FCKA 1S84A 2HGTH 4X8UH 3RXDA 1TLDA 4I7YH 1O2HA 2WUCA 4YT6H 4KTSA 4NIWA 1GBBA 2ZDLA 1XKBC 1CQQA 3V13A 5EPYA 7KMEH 1K1LA 1O37A 2BDCA 1V2UT 2VWLA 2TIOA 2OINA 4HZHA 1HB0B 2BDBA 1CA0C 2F9BH 1LVOA 4BOHA 1TOMH 5CHAC 1KXCA 3D62A 1HLTH 3T2NA 4A5TS 3RM0H 4BAMB 4X2YA 2Q6DA 1C5QA 4YOJA 3H7TA 3MO9A 3PLPA 4FUIA 3ESTA 1C2IA 1T8NA 5DP7A 5T6FA 5B6OA 5GDSH 3MU8A 1GBKA 2Z9JA 3ATIA 1PPHE 1SC8U 3PYHA 4K1EA 3QLPH 2HALA 4YZUA 2WINI 2Q1JA 4Y71A 6CHAC 1AVGH 2XBYA 3KNXA 1L1JA 1S6FA 4NA7A 3MNSA 2XBVA 2AGIX 1DY8A 3ELAH 4DG4A 1U6QA 1LMWB 3M5MA 1Y3YA 5C5NA 3O8DA 1C5ZB 3ZZCA 1NROH 3ATWA 5TCAA 1O2LA 3RU4T 1P04A 1EPTB 3MU1A 3E6PH 3K6ZA 3OX7U 2H6MA 3SHCH 1ELAA 3I78A 4B73A 2GTBA 3M35A 2QYIA 4X1SU 1P2QA 3NCLA 1AB9B 2P93A 4D9QA 2GV7A 3MMGA 4NZLA 3VB4A 3NPSA 1OXGA 4IN2A 1C1VH 3RXGA 1D6WA 2BLWA 1TBRH 1YPLH 1SPJA 1ZHRA 3E8LA 4R0IA 4X2WA 1W13U 2HVXA 1F0RA 1GJ7B 1CA0B 5GWZA 2O9QA 4I8JA 3GCHC 1BBRH 2BD4A 1QL7A 1UK3A 4KP0A 2VIPA 4M7GA 4I8GA 3H5CB 3GCTF 3M37A 2OC0A 4GPGA 3UR6A 4X6MA 1SGDE 4GHQA 3S9BA 4K2YA 3SJ9A 3Q76A 3LH1A 1QCPA 1B7XB 1WU1A 1UCYH 1P10A 3T62A 1L0ZA 1C4U2 3FP7E 3RP2A 1BMLA 2FESH 1HV7A 3A81A 1F0UA 4ZUHA 1O34A 1KDQA 1UMAH 2OLGA 3GDVA 1O3BA 2P3FH 2NU2E 2QXIA 2QY0B 1ETTH 1PPGE 1DT2A 4ZHMU 1P57B 1FNIA 4QT8C 1Y5AT 1OYTH 1ZPZA 4JYTA 3PO1B 1MTUA 2A2QH 2Y7XA 1IQGA 3PLKA 1MU8B 1RXPA 1T4VH 1ZHMA 2AIPA 2FS8A 1NO9H 4OS7A 2Z9KA 2K1QA 1YM0A 3MNXA 4NZQA 3SV8A 1TQ7B 2ANMH 1YPKH 1B0FA 1ZGIA 1CBWC 1BTPA 1B0EA 5E2PA 1O3MA 1O5GH 3CS7A 2D8WA 1PPBH 1VJ9U 2HNTE 1GBJA 1XUGA 2ZGJA 1UTMA 3M3VA 1SVPA 1HJ8A 3PLBA 1GWAA 1TRMA 3SV9A 1BBRE 1UTOA 1V2NT 1F0SA 4ZROA 2PW8H 1JOUB 2ZHQH 2G52A 3TGJE 1Q2WA 4A1TA 2G8TA 4UD9H 2VVCA 1O2KA 1CO7E 2P16A 1FAKH 1V6DA 2OTVA 1G3CA 1UCYE 1RIWC 3RXKA 1EX3A 1PQ5A 1IQMA 2FOMB 4GSOA 3LOXA 4K69A 1AZZA 2ZO3H 2YOLA 4ASHA 4GUXA 1O5AB 1QL9A 1JIRA 1WBGB 2FPZA 1HYLA 3BEUA 3A8CA 1G3BA 2ILNA 4D7FA 1DS2E 1FMGA 1YKTA 1XUKA 1BUIA 1DFPA 1V3XA 5C1XA 2PV9B 3L33A 1Z8GA 3SOSA 3B23B 4ZAEA 1MTVA 1DX5M 2J9NA 4B2BA 3QX5H 1D3TB 5EXMA 3ZVDA 2ZCHP 5JB8S 1GBEA 3M3SA 1OPHB 2QA9E 2AS9A 1KXAA 5DO4H 1ABJH 4I8KA 5LPRA 3QTVH 2C8XB 1GMHG 3LH3A 3TH3H 1YPGH 3A80A 2PFEA 2AMDA 1O39A 2SGAA 4ZKNU 4UE7H 4UFEH 3F9HA 1EZUC 1MAYA 1LHEH 3BTQE 3UIRA 4JZ1A 1JXPA 4INKA 3BF6H 1ELFA 5HGGA 5FPTA 1GPZA 3UY9A 1P11E 2ULLA 4UDWH 4CH8B 4DVAU 4X8VH 5A8YA 3GDUA 3Q3KA 1EAIA 2V3HH 3GYLB 3OSYA 4JZFH 4XDEA 2R2MB 4FUFA 2ODQA 3BIUH 1AUJA 5BRRE 1P2MA 1T8LA 1RIWB 4BAKB 1IQKA 1DXWA 2AMQA 3EDXB 1HDTH 1KTSB 5AVDA 1TNLA 1SLWB 4Z6AH 4MPXA 3BTGE 1JIMA 4HGCA 1EPTA 1F2SE 1O3EA 1F5LA 4WMEA 1SHYA 1C4V2 2TGAA 9LPRA 4CRGA 1GHXH 2WUBA 1UVTH 3PROA 2TBSA 1GDQA 3GOVB 1BDAA 1GBLA 2BDGA 1K2I1 2P8OB 3DFLA 1QNJA 3RXFA 3GY4A 2J95A 1SGFG 2B7DH 4B71A 2GZ8A 5EXLA 4VGCC 1TGNA 3LGYA 1CHGA 1TOCB 5DP9A 8ESTE 1S5SA 1G3EA 2FTMA 3DD2H 4E7NA 1OS8A 1PFXC 2RA0A 5BPEA 3V3MA 8KME2 3UNRA 1LDTT 1MQ5A 4AGJA 1RTFB 1MBQA 1HFDA 1Y5BT 4Y0YE 1O33A 3TNTA 1F5RA 4Z0KA 4K8YA 3AW0A 3ZZ7A 4E7RG 5LGOA 1KXFA 3A87A 1EASA 4GAWA 1C4Y2 2Z9GA 1ZSLA 1GHWH 2BVXH 2ALVA 1MU6B 4BTIB 2Z9LA 1Z71A 4AFSA 1THRH 1ARBA 5JBBS 2G55A 3T26A 1RS0A 1XUJA 2VGCC 1XVOA 4Y11E 3JZ2B 1KXBA 1A2CH 2CF9H 4U32A 3Q3YA 1QRZA 3ZVAA 1MTSA 2EI8A 1AD8H 1GCDA 1PPFE 2CGAA 4K5ZA 3GY5A 1NN6A 5EOKA 4Q7ZA 1GJDB 4RN6A 2KAIB 2FLRH 3LC3A 1FUJA 1GDUA 1TFXA 2CMYA 5ESTE 4NSYA 2FI3E 3BEIB 1Z8JB 5C5OA 1A4WH 1DLKB 2F91A 1TX8A 2ZGCA 5EQSA 3SW2B 1NRPH 1EZXC 1P06A 8GCHG 1O3NA 5A0BA 4KKDA 1QBVH 1BRAA 1EOLA 1YF4A 3QDZB 5DP5A 2B0FA 5ESBA 1IQFA 3K9XB 3QGNB 1CGJE 1FY4A 3ITIA 2O8TA 1IQEA 2Z7FE 1UTNA 3SZNA 2GCHG 2TGDA 3R3GB 4NIYA 1TB6H 2AERH 1XVMA 5E8EH 3TJUA 4DOQA 1O2NA 3FFGA 1MZAA 2BZ6H 2QCYA 4IC5A 1G2MA 1K21H 2NWNA 2VWNA 1TE0A 5E0GA 1EUFA 4D76A 2J94A 2Y80A 2Z6BD 1C5VA 1AO5A 2SNWA 2ZTYA 3QO6A 3T28A 2BDYA 1Z8IB 1O2OA 2UUJB 3RXIA 1AWHB 2VGCB 3DT0H 4WMDA 1EXFA 2GT8A 1RD3B 3UWJH 4D7GA 4X1NU 1A5IA 2QN5T 4Q2KA 2W5EA 3C27B 3GY8A 2R0LA 1AVXA 4F4OC 1QBOA 2F3CE 1O3FA 1Q3XA 1QJ7B 2IN2A 5E2OA 3F9EA 1JRSA 1V2JT 1INCA 3TK6A 1HAIH 2QF3A 1O5EH 3KQDA 1XKAC 4XBDA 1ZSKA 2BD7A 1EJAA 1E34B 4O3UA 4OGXA 1UO6A 2GMTB 3PMBB 3O8CA 4K1SA 3A84A 1O36A 1QB6A 3BTDE 4AZ2B 4X1PU 3UQVA 2TPIZ 1EAXA 3MU4A 2WPKS 6GCHG 3CS0A 4MVNA 2ZU3A 1V2KT 3RXRA 3SI3H 3K2UA 2F9UA 2ZCKP 3ZVBA 4GLYA 2UWPA 2A4QA 1GVZA 1O2GH 1ELVA 1K9OE 1TNHA 4Y7AA 2F9NA 1DSUA 5GIBA 3EE0B 3U8OH 3KQBA 1MD8A 1NRSH 1OYQA 2HNTF 2XCFA 2Y7ZA 3ODDA 3CP7A 4MNVA 3Q3XA 1A5HA 4FU7A 1BTWA 1ZZZA 3A89A 4D8NA 1O2TA 4MG3A 3RMMH 3MH6A 1O0DH 2K7XA 1OP8A 1V2ST 1Y3XA 1C9TA 1O2PA 2Y5GA 3KQCA 4TY7A 3NUMA 3ZVGA 1O3IA 1HAOH 1VR1H 2GVFA 1LTOA 1HIAB 1KLJH 3UPEA 3GY7A 2XC0A 4K8BA 4HI3A 1CE5A 3SI4H 4AYVB 3ATMA 2FOAA 1Z8RA 3QZQA 1DUAA 3SV6A 1GG6C 2ZHFH 1NRNH 4CBNA 3TJOA 4O9VA 2A45B 1TNGA 3M36A 1RRKA 3U9AH 3LGIA 5DGJA 4Q80A 7LPRA 3UUZA 1HBTH 2ZGXH 1SGTA 1THPB 4ABDA 2RG3A 1GMDG 1QHRB 2GKVE 1ZPBA 3A7ZA 1O3HA 2J92A 3KIDU 1O3JA 1MKXH 2M5TA 4ZXXH 1WUNH 3TVJB 2BYAX 1GBTA 2PUQH 2O8WA 2ZDMA 3HKIB 3SU2A 3D65E 1M9UA 2ZFTA 2A4RA 1C2GA 1SLVB 3SQEE 3W94A 1X7AC 1BBRK 1NT1A 2BVSH 1V2VT 3HKJB 4AX9H 4LZ1H 1EPTC 2VWOA 2VH6A 3RC4A 3RXLA 1SI5H 1UVPA 2ZDKA 1K1PA 3SUFA 4X6PA 3WY8A 1ESAA 3VB5A 1F0TA 1NFXA 1DWBH 2ZP0H 3E0PB 5DP4A 1LKBA 3VB3A 1A0JA 1E37B 1AB9C 1IHSH 1UCYK 2AGGX 8GCHF 3FANA 4FUJA 2QIQA 4BAQB 2BX4A 5FXLA 4FUBA 3EA8A 5FAHA 2Q6FA 3U98H 3MYWA 4A1XA 4TWWA 2QC2A 4YTAA 1TRNA 3FZZA 2J2UA 4IGDA 1UVOA 3P8OA 1CT4E 4XSKU 1C9PA 1O3CA 1VGCB 1GG6B 3MH7A 3GISB 1GHYH 1EB1H 3U1JB 3A85A 2PGBB 5JBTA 4X1RU 2FM2A 1QQUA 3SU6A 1C1TA 1NESE 1TRYA 1L1GA 4Y6DA 2QF0A 4YOGA 3TH2H 2TGTA 4O97A 1YBWA 3MOCA 2GDEH 3PB1E 3R0FA 1O2YA 4F49A 5JYIA 5CMXH 3TK5A 2C8ZB 1QURH 1Y8TA 1PQ7A 1FQ3A 1O32A 2A7CA 4NG9H 1LCYA 1P12E 3QUMP 3SV2H 2BY8X 2FWWA 3O8BA 1D9IA 2GD4B 3MWIU 2SGPE 3BIVH 4SGBE 5A8ZA 1GI6A 1BRCE 3KCGH 3PO1C 1DWDH 1WQVH 2XRCA 4MPUA 1CVWH 5F03A 1TPOA 5K0HA 5AF9H 1C1QA 1DSTA 1NM6A 2FP7B 1QY6A 1AHTH 4NGAH 1OWDA 2OQ5A 1ELCA 2ANKH 1TONA 4Y10E 3MFJA 1A0HB 3SNBA 1FIZA 3F6UH 4AGKA 5A8XA 5IDKA 1KYNA 4Y8YA 3ZZ8A 3SNDA 5F8ZA 1GHBG 1OOKB 3KL6A 1TWXB 1HJAC 3ZZ3A 4DURA 1UVUH 2OBQA 1C5WB 2ZWLH 2STAE 4IC6A 1LVMA 2FO9A 3BG4C 4DW2U 2BOHB 2G51A 1SGQE 1ZGVA 2W7SA 4BTUB 3GCNA 2XXLA 4ESTE 4IMZA 2VNTA 4OS6A 7GCHG 2FODA 1ZR0A 2BY6X 1BQYA 2OC1A 1V2WT 4OS5A 1OWEA 3M7TA 1JMOH 2OXSA 2PGQB 5AFZH 1ELTA 1ACBE 1Z7KA 3U8RH 1AFQC 3MO3A 4I8LA 2LIZA 5TCCA 2HWLB 2BLOA 2G5NA 1AWFH 2HPPH 3ZZ9A 2F83A 5AHGH 3EQ0H 1KXDA 2C93B 3K65B 1AI8H 1J14A 5DG6A 2HPQH 1KSNA 5I25A 2XWBI 1T32A 1VCQA 4LOYH 1AZ8A 2VJ1A 1MH0A 2ASUB 4GVUA 1ID5H 1KLIH 1EAUA 1YPJH 1ANEA 2WYGA 2PKAB 1GMDF 4X0WU 2ALPA 1SGCA 1NS3A 1KY9A 4JZDH 2ZPQA 3LONA 1HIAA 1GBAA 1ZLRA 1C2DA 1HJAB 1HAVB 3P95A 4I33A 2CV3A 1ELEE 2AEIH 3ZZ5A 2BVRH 1GI4A 1QTFA 3BG4B 1TMTH 4A92A 1P2JA 4AN7A 1D3QB 1EZSC 3AAUA 4DT7B 5FBEA 2JETB 2UUFB 2AH4X 4BAOB 4UEHH 1CU1A 1DVAH 2BY7X 2P3UB 1HAGE 3SGQE 3SGBE 2ZA5A 4IBLH 4FXGH 3EA9A 2B5TB 3KHVA 4YLUA 2SGDE 4IMQA 2O8LA 2P3TB 1TYNA 2FMJA 3SJOA 3F9GA 1AFQB 1QJ1B 1G36A 3LDXH 4FU9A 2O8MA 4OS1A 1P3EA 1XX9A 2ZFQH 5TJXA 3LGWA 2JH0D 3KF2A 1K1JA 1L2EA 1O2IA 1W8BH 2F9OA 4AG2A 2Z94A 5A0CA 5DJ7A 1G30B 4MNYA 3FP8E 2GX4A 1OKXA 2TRMA 1O3LA 1WTHD 4X8SH 4H6SB 3UTUH 1ELBA 1A1RA 1EZQA 1P9UA 3NWUA 5T6GA 1GBCA 3ZYEA 2DE9A 2WPMS 5GCHG 2P8OC 3E0NB 1HAPH 3ENSB 1LVBA 1GCTC 2UUYA 3L3TA 4CHAB 1OWHA 2AGEX 5DP6A 5EU8A 5PTPA 5L6NH 1J17T 1B5GH 2UWLA 1UTQA 1MCVA 1MBMA 4RKOB 2W3IA 3M5LA 1W10U 2LPRA 5C20A 3RXCA 4LZ4B 2ZF0H 2XNIA 5GPIB 1UVSH 1K1NA 1ANDA 1H8IH 2A32A 3ZVFA 5EQRA 2J4IA 7ESTE 1SFIA 3EAJA 1BJUA 1XUFA 1CSOE 1GJBB 3LT3A 2Y81A 2A5AA 1PJPA 2C3SA 2GT7A 2V6NA 1THSH 2XTTB 2D1JA 1IOEA 1GGDB 2ZPSA 2B9LA 1DE7H 1E0FD 2ZGHA 5L30H 1XXFA 4WMFA 4X2XA 3VFEA 2FS9A 3E1XB 1BRUP 1SQTA 1LKAA 1RTKA 1SQAA 1QBNA 2FOGA 4FUDA 5EXNA 3UQOA 4ZKSU 3SORA 1VCWA 3KGPA 2Y5FA 1FIWA 4CREA 1GI9B 4NFFA 2G4TA 1Y59T 1Y3UA 2GCTC 5C3NA 1ESTA 4CR9A 4IW4E 4X8TH 7GCHF 1BTXA 4IS5A 1PQAA 1GCTB 1SQOA 5FX6A 3EA7A 3Q77A 3D23A 1UTPA 1O31A 3SJKA 1N8OC 1G2LA 3TGKE 1GJCB 4XBBA 2NU0E 1K1IA 4WY3A 3BEFB 4WWYA 4ABFA 1J15A 1YPMH 2BTCE 1GDNA 2XBWA 3RXQA 2XCNA 2ZHDA 1SGRE 1UHBB 3LGVA 3SQHE 3RXPA 5HM2A 3TIUA 3RXAA 3NKKA 1ZJDA 2VIVA 3UNSA 3TGIE 5EG4A 3NZIA 2ZU2A 3AW1A 4PROA 2PR3A 1DWEH 1TPPA 4ABJA 5L2YH 1O3AA 3RXMA 3SU0A 4A7IB 3ZZBA 4Y8XA 3U1IB 3GICB 3HK6B 2ZU1A 3KQEA 1ZTLA 3SV7A 3AASA 2ZGBH 4Y76A 1Q31A 1AMHA 4I31A 4DCDA 1P3CA 1BJVA 1H8DH 2ZI2H 1C5XB 2QV1A 1EP6A 1ZRKA 3DHKH 1HJ9A 1QB9A 2GCTB 1H1BA 2QAAA 1TNJA 2C4FH 1KTTB 3NXPA 4ZKOU 3E91A 1EKBB 4D9RA 2PKAA 2BY5X 1C2MA 3SNCA 2ZQ2A 1W3CA 1SFQB 4WJG2 1PPEE 3RC6A 1ELDE 2C8WB 1N8OB 1D3PB 4RKJB 4K1TA 1C2LA 2V35A 1HAVA 2GMTC 1PQ8A 1P2OA 4B75A 2IPHA 2WYJA 3B8JA 1TGCA 1TNIA 2JKHA 1HAXB 2ZFSA 5FX5A 3KN2A 3H7OA 1C2EA 1LPZB 1O38A 1FLEE 3RDZA 1SR5C 1BHXF 1Y3VA 1NU7B 1O3KA 1O2MA 3Q00A 2BD8A 1A61H 2Z3EA 1BMAA 5GCHF 5EPNA 1AKSB 4ZKRU 1C5SA 1ZHPA 1FZZA 1G37A 1H9HE 1H9LB 3GDSA 1CGHA 1ZMNA 2EI7A 1V2MT 1UK2A 1V2QT 1MKWH 1YCPH 2H5CA 1SB1H 4B2AA 1GHZA 3MH5A 2PWXA 4ZHAA 2BLQA 2DUCA 1ZRBA 3RXHA 3PMHB 3ATLA 4FU8A 1LHGH 1GMHF 1MKXK 3E3TA 1E35B 1MMJN 1S81A 3GY6A 2ZU5A 2BD9A 2VVUA 3ZVEA 1J16A 3ZZ6A 2ZFPH 1HXEH 3IWMA 1YPEH 4YT7H 1GI0A 3SU3A 3QK1A
chains in the Genus database with same CATH superfamily
3S69A 4INLA 4CRFA 3LJOA 2L6OA 3CENA 4ISIH 2BD2A 3UFAA 1S83A 3PV5A 1FY1A 2KCAA 1O2ZA 3P8GA 1WQSA 4CRBA 3UWIA 4DT4A 1OP0A 2BDHA 1QIXB 3MTYA 3FVFB 5J4SA 1XM1A 2H9EH 5LH8A 3M5OA 4NIVA 2Y5HA 2CHAC 3S7HB 2PTNA 1QA0A 2H1UA 4ABEA 1N6XA 1SLUB 4FOUC 1C1OA 1GVKB 1IQLA 3D49H 3QGJA 1HPGA 1GMCG 4THNH 3SUEA 2ANWA 1EATA 2ZDAH 1YLNA 4YM9A 3HGNA 1C2HA 3OTJE 2W3KA 1YPHC 2F9VA 3PTBA 1F92A 3FAOA 2W7UA 3KQ5A 1Z1IA 5C67A 1V2OT 1EJMA 4WXIA 3PMJA 4HFPB 1IAUA 1NRQH 1PYTC 3N7DA 1CHOG 2JIZD 1OSSA 3P8NA 1O5BB 1W7XH 3MH4A 4JYVH 3LGTA 1N6YA 1CT2E 2A0QB 1P0SH 3RLYH 2ZHWH 3S0NA 1TA2A 1TNKA 2V0BA 3BTEE 1BMNH 1DPOA 1IQNA 2VU8E 3STJA 3ZVCA 4ZH8A 3V12A 4INHA 4WH6A 1NZQH 3BTHE 3PMAB 2H9TH 3GY2A 3OEHD 3W95A 1VGCC 3M7UA 1WOFA 2A2XH 4KGAA 4B1TA 1NFYA 3ZYDA 5FBIA 1BOQA 4LXBH 1NTPA 2Z9IA 1A3EH 5C1UA 3G01A 4E06H 3URDA 1UHBA 5JBAS 1QA7A 4ISHH 2H2ZA 1L4DA 3MHWU 1TBZH 3BTME 1AN1E 2CHAB 4AFZA 1NPMA 3DFJA 1TQ0B 1P01A 5H4IB 5K7RA 2QGRA 2SFAA 2XWAA 2HRVA 1NU9A 2JJ1D 2J98A 2FXRA 1O3GA 1KLTA 1GI2A 3P92A 1SLXB 3QZRA 2FLBH 1DDJA 3LC5A 1O2WA 4JK5A 1LQEA 4TT3D 1ZOMA 4WVPE 2D2DA 4CR5A 2L74A 1TBQH 3GYMA 3RLWH 1O30A 1GL0E 1CGIE 5IYTA 1MAXA 2KM0A 4Q7YA 3BSQA 1BMMH 3FKSD 1SHHB 1WCZA 1BITA 2GZ7A 2BQWB 2XC5A 1GI1A 2ZDVH 3A8DA 3P70B 3ZZAA 4A1VA 4AYYB 2ZQ1A 2G00A 4CH2B 1BMFD 1IQIA 4MPWA 5ETXA 1WYKA 2ODYB 4X1QU 4IN1A 1NBME 4K60A 3ZV8A 1TGBA 3PTNA 3RC5A 3DUXH 1C1WH 2GCHF 2KAIA 1SL3A 4UFFH 2GP9B 4JK6A 1GHAG 1T8MA 3RXEA 1EFRD 3RXVA 1DM4B 4ABGA 2BXUH 1RTLA 4O03A 1AGJA 1FPHH 2ZKSA 2FIRH 5C1YA 3SJ8A 2XBXA 1G9IE 1W14U 5T3HA 1QFKH 1C5UA 1FONA 5LPEA 2OC8A 3TLOA 4KELA 2GDDA 2F9PA 1A0LA 2XYAA 1UJ1A 1VZQH 1AUTC 4U30A 2D26C 2RDLA 1AKSA 3B9FH 1ZJKA 3JZ1B 3LJJA 2ANYA 1OX1A 1T7CA 4DIIH 1FPCH 1MABB 3ATKA 2EQNA 2ZU4A 2ZZUH 3A7XA 4CRAA 1E38B 3UOPA 1IHTH 4OGYA 1SGIB 1P05A 2CN0H 3A82A 3A83A 3RXJA 1QGFA 1Z1JA 1XUHA 4DY7B 3F9FA 2FEQH 5EW1H 1DWCH 4MPVA 3RXBA 3KEEA 1BT7A 1S0QA 3OE7D 1UTKA 3MI4A 1V2LT 4YLQH 3VPKA 2ZECA 3DA9B 3HK3B 2ZCLP 4XBCA 5F8TA 6GCHF 1ANBA 1HAZB 1OWIA 1TMBH 2FDAA 4NWKA 3RXOA 2VINA 3PRDA 4B76A 1JRTA 1C1UH 4H6TA 1BTUA 1GMCF 2FX6A 2HOBA 3BTFE 1NFWA 2VBCA 9ESTA 2KR7A 1YPHE 5HYOA 3UNQA 1O5CB 3N7OA 1NC6A 1TMUH 1FY5A 4AB9A 4U2WA 2XC4A 2JETC 2EI6A 1TALA 5JDUB 1CHOF 1BB0B 3SU5A 3MNBA 3SZEA 3T29A 1YLCA 2FZZA 1DXPA 1SGYE 3WW7A 1O2SA 2ZHEH 1EB2A 1ARCA 5E0HA 1UTJA 2BY9X 2R2WU 2H5DA 3RXUA 1XXDA 2GJGA 3RMOH 4F48B 2AIQA 2EC9H 4XFQA 4GCHG 3RU4D 4HTCH 2R9PA 1LVYA 3OY5U 3FP6E 3MO6A 5CHAB 2ZEBA 3TNSA 3TK9A 1DUEA 1QJ6B 3I29A 2KCOA 1XMNB 4MQAA 2GZ9A 4DIHH 2A5IA 1ETRH 3VB6A 2BQ7B 1PPZA 2WHXA 1EQ9A 1BZXE 3A88A 4YOIA 5EODA 2I6SA 1EJNA 1W2KH 2Z3CA 4ISOA 2PTCE 3F68H 2H9HA 6CHAB 1FV9A 3SU4A 4YO9A 3UB0A 1EAWA 4CHAC 3KYFA 2CJIA 1VKYA 2BLVA 2VB0A 2OQUA 1O2QA 1C1RA 3TPIZ 4J1YA 1ZMJA 1GBMA 5B6LA 5F8XA 3QTOH 2F4LA 2AFQB 4NIXA 2FOFA 1AE8H 1A3BH 1C1MA 1C5YB 2C90B 3A7VA 1BTYA 1VITH 3MU0A 1H4WA 5FHTA 2RA3A 3LU9B 3ZZDA 3S9CA 1FN6A 1G32B 1E36B 1QL8A 1P2IA 2BDAA 1H9IE 1ZSJA 2P95A 3BG8A 1MTNC 1ZTKA 2W26A 4SGAE 1AVWA 2FYRA 5GJ4B 1GGDC 4UONA 5SGAE 1ELGA 1ANCA 1BTZA 1P8VC 3A86A 2BHGA 4NFEA 4E05H 3SHAH 3L6PA 4BXWA 3GCHB 1Y5UT 2ZG0H 5I46H 4FETA 1IQJA 1FY8E 1QQ4A 3H09A 4NA9H 4ABHA 1EP5A 1UTLM 2FI4E 3SNEA 3TITA 1D6RA 3SGAE 3MQKC 3URCA 3TJVA 2JDID 2AHME 1YGCH 1GHAF 1C5NH 1C5TA 2BD3A 1P09A 2J34A 3E16B 4UFGH 1HGTH 1A5GH 4F55A 5GXPA 1V2PT 4TPYA 1TA6A 2VIOA 4FVBA 1LQDB 2V3OH 5G4BA 5DPAA 1O2UA 3A7TA 1O2RA 3E90B 1N1LA 1RGQA 1JWTA 1W0JD 2Z3DA 4I32A 2UWOA 1HAYB 2RCEA 4NA8A 3M7QA 2A5KA 3TU7H 1HRTH 3EBNA 1OP2A 3VB7A 1S82A 3QN7A 3GCOA 6LPRA 4AFUA 4ABBA 3IITA 1SOZA 1ZYOA 3VEQB 3K6YA 3PWCA 1GBHA 2HLCA 1P2NA 4ISLA 4FUHA 4AOQA 3RMLH 4MTBA 1LHCH 3RUOA 3V7TA 4ZHLU 1MTNB 1TPSA 3P17H 1MZDA 1CBWB 2OCVB 1MQ6A 5EW2H 1SMFE 1L4ZA 1Y3WA 3ZZ4A 2DE8A 3F1SB 1PYTD 2FI5E 3VXEH 1C5LH 3EYDA 3SUGA 1J8AA 1GHBF 1L1NA 2O8UA 1SOTA 1AU8A 4CRDA 1SBWA 3RMNH 4LK4A 4O3TA 4NSVA 1GJ8B 1C2JA 5CE1A 1TABE 4Q63A 2UUKB 4K3JA 3SO3A 3ZV9A 5C2ZA 3HATH 1RFNA 3VGCC 4Y8ZA 3U8TH 1FY3A 2ZIQH 2PHBA 4U01A 2OBOA 1P03A 3A7YA 1FAXA 3UREA 1GJAB 4J2YB 1RJXB 1MUEB 1SGFA 6ESTA 4CBOA 2P94A 1TPAE 1MTWA 1D4PB 4MLFB 2SNVA 1MKWK 4XOJA 1YCPK 1VCPA 1K22H 5AFYH 3TH4H 5T6DA 4GCHF 4JYUH 5DKMA 1DOJA 1LPGB 1LHDH 2OD3B 5JB9S 1V2RT 1QRWA 1AQ7A 1F7ZA 1C5OH 2Y82A 4FUGA 1DY9A 2JH5D 4TPIZ 3UR9A 1PPCE 1K1OA 4NCYA 1GL1A 4BTTB 2I6QA 3FZDA 4A6LA 1VJAU 4WH8A 2BD5A 1AIXH 1TGSZ 1CA8B 2JH6D 3BTKE 4ZXYH 5F6MA 2WV9A 4TYDA 4AG1A 1K1MA 2QXHA 3V0XA 4R8TB 3LKWA 2R3UA 1NY22 2SGFE 3LGUA 2CXVA 3TJNA 1YCPM 3QWCH 1GI7B 1TX6A 1T4UH 1O2JA 1O5DH 1O3PB 2SGEE 3LIWA 2G4UA 2J38A 4CRCA 2VIQA 1LHFH 2QF5A 1GVLA 3P8FA 2A7HA 2BZAA 4JZEH 3VGCB 5EQQA 3M3TA 1ZPCA 5FCRA 1W11U 2G81E 2BDIA 2FOHA 1EOJA 1YP9A 4YESB 4AB8A 3LPRA 1GJ6A 1WXRA 2C8YB 1P02A 5A0AE 1GI5A 1OWJA 1K0HA 2A4OA 1VITG 1P2KA 1UW7A 1GBDA 4BANB 4OS2A 1LO6A 2FOBA 2TGPZ 1J9CH 2LNCA 4I8HA 5A09A 1QRXA 2OUAA 2JJ2D 5GNDA 2ZC9H 2YNBA 2W6JD 2A4GA 1GBFA 3BTTE 2QXGA 2R3YA 2ESTE 5A2MH 2GV6A 5FPSA 2A1DB 3BV9B 1FI8A 1GI3A 5DK1A 1BRBE 1XUIA 5FPYA 5LPFA 3O8RA 1AY6H 1C5PA 4VGCB 4H42U 2NU3E 3NK8A 1OWKA 2WPJS 2WPHS 1QB1A 3PV2A 4OM9A 4ISNA 1WV7H 5JPMH 2VIWA 1HCGA 4RSPA 1S6HA 1GJ9B 4ABIA 1A7SA 1NFUA 4JMYA 4KTCA 1D3DB 2WV4A 3ODFA 1BTHH 1TX7A 1SG8B 1YLDA 2ODPA 2QXJA 1F5KU 1W0YH 1SGNE 2VIDA 4WF8A 1TAWA 1A46H 1YYY1 5E0JA 3IG6B 2BQ6B 2PUXB 1SGPE 1QZ8A 4BXSA 1JBUH 4Y7BA 2Q6GA 1E1RD 1GJ5H 1WAYB 1C2KA 1NRRH 4GHTA 3UOUA 1QR3E 2GGVB 1K28D 4MDSA 4ABAA 2WV5A 2ZTZA 3PM3A 1ESBA 3T5FH 1DITH 4FUCA 3AVZA 4B74A 1GBIA 4AFQA 1BCUH 1KXEA 1FXYA 3BN9A 4FVDA 1KIGH 1DLEA 2W6ID 1S0RA 1BIOA 1W12U 1W0ZU 2PSXA 1TIOA 5HM9A 2A7JA 1ORFA 2G5VA 2ZTXA 1GI8B 4NWLA 3OTPA 3RXSA 1FJSA 1TGTA 2R0KA 4X6NA 4TY6A 2AYWA 3A8AA 3EGKH 1DICA 3HPTB 4XE4A 3SNAA 3SJIA 3VXFH 3I77A 4KTUA 1W7GH 2AMPA 2IOTA 3M61U 2J97A 5JBCS 4X6OA 1P9SA 2ZNKH 2BMGB 1C1NA 3T25A 2XW9A 1HAHH 1GHVH 2PKSC 1ETSH 5EGMA 5L2ZH 2SGQE 2VWMA 1KDQB 1O3OA 3M5NA 1ZMLA 4BNRA 2THFB 2WPIS 1Z6JH 4BAHB 1HNEE 2BXTH 1KMHB 2FTLE 3AAVA 3OY6U 2CF8H 1AE5A 2OP9A 4ZMAH 2IJOB 2ZDNA 4DGJA 3F2GA 4X2VA 3GCTG 1S85A 4JZIA 1O3DA 1YC0A 2A31A 1SGEE 2P59A 3A8BA 3RM2H 1O5FH 4Y0ZE 2FOEA 4MNWA 3T27A 2VH0A 1C1PA 1MD7A 1O2VA 2NU4E 3OYPA 3RXTA 4AORA 3SU1A 1UK4A 1ABIH 2NU1E 5DP8A 4MNXA 1T8OA 3SBKA 8LPRA 4Q7XA 1FN8A 3RU4E 5J4QA 2PSYA 1MCTA 4JCNA 1SSXA 2PLXA 1ZTJA 4OS4A 5ABWA 1V2TT 1IQHA 1FDPA 2EEKA 1G3DA 3PV4A 2FOCA 3S7KB 2BOKA 3U69H 1H8HD 1O2XA 2OC7A 1AFEH 1WTGH 2B8OH 4FUEA 1HUTH 1T31A 3SN8A 2BX3A 5CHBA 2QF4A 1HXFH 1LPKB 1GJ4H 3P6ZB 1CT0E 3BTWE 1DANH 2KX4A 2FX4A 3HGPA 1C5RA 2HVYB 1C1SA 2BM2A 3OU0A 3S9AA 2YNAA 1BHXB 2WPLS 1C2FA 2BB4A 3A7WA 3MU5A 1VITF 1Z6EA 4H4FA 5DP3A 2EA3A 2PKSB 2KCYA 3STIA 3PWBA 3GY3A 1E79D 2Y6TA 4TWYA 2ZFFH 1WSSH 2HNTC 4DJZB 5HXFA 2STBE 2VVVA 4Y79A 3SUDA 1C5MD 1O35A 1BA8B 2ZFRH 4UFDH 2FYQA 2ZPRA 3MNCA 4WXVA 4B2CA 3C1KA 5HMAA 5FCKA 1S84A 2HGTH 4X8UH 3RXDA 1TLDA 4I7YH 1O2HA 2WUCA 4YT6H 4KTSA 4NIWA 1GBBA 2ZDLA 1XKBC 1CQQA 3V13A 5EPYA 7KMEH 1K1LA 1O37A 2BDCA 4RT1A 1V2UT 2VWLA 2TIOA 2OINA 4HZHA 1HB0B 2BDBA 1CA0C 2F9BH 1LVOA 4BOHA 1TOMH 3F0OA 5CHAC 1KXCA 3D62A 1HLTH 3T2NA 4A5TS 3RM0H 4BAMB 4M9FA 4X2YA 2Q6DA 4I86A 1C5QA 4YOJA 3H7TA 3MO9A 3PLPA 4FUIA 3ESTA 1C2IA 1T8NA 5DP7A 5T6FA 5B6OA 5GDSH 3MU8A 1GBKA 2Z9JA 3ATIA 1PPHE 1SC8U 3PYHA 4K1EA 3QLPH 2HALA 4YZUA 2WINI 2Q1JA 4Y71A 6CHAC 1AVGH 2XBYA 3KNXA 1L1JA 1S6FA 4NA7A 3MNSA 2XBVA 2AGIX 1DY8A 3ELAH 4DG4A 1U6QA 1LMWB 3M5MA 1Y3YA 5C5NA 3O8DA 1C5ZB 3ZZCA 1NROH 3ATWA 5TCAA 1O2LA 3RU4T 1P04A 1EPTB 3MU1A 3E6PH 3K6ZA 3OX7U 2H6MA 3SHCH 1ELAA 3I78A 4B73A 2GTBA 4RT0A 3M35A 2QYIA 4X1SU 1P2QA 3NCLA 1AB9B 2P93A 4D9QA 5EIYA 2GV7A 3MMGA 4NZLA 3VB4A 3NPSA 1OXGA 4IN2A 1C1VH 3RXGA 1D6WA 2BLWA 1TBRH 1YPLH 1SPJA 1ZHRA 3E8LA 4R0IA 4X2WA 1W13U 2HVXA 1F0RA 3DCLA 1GJ7B 1CA0B 5GWZA 2O9QA 4I8JA 3GCHC 1BBRH 2BD4A 1QL7A 1UK3A 4KP0A 2VIPA 4M7GA 4I8GA 3H5CB 3GCTF 3M37A 2OC0A 4GPGA 4ZCNA 3UR6A 4X6MA 1SGDE 1FX0B 4GHQA 3S9BA 4K2YA 3SJ9A 3Q76A 4P02A 3LH1A 1QCPA 4B6EA 1B7XB 1WU1A 1UCYH 1P10A 3T62A 1L0ZA 1C4U2 2V3MA 3FP7E 3RP2A 1BMLA 2FESH 1HV7A 3A81A 1F0UA 4ZUHA 1O34A 1KDQA 1UMAH 2OLGA 3GDVA 1O3BA 2P3FH 2NU2E 2QXIA 5KECA 2QY0B 1ETTH 1PPGE 1DT2A 1YWUA 4ZHMU 1P57B 1FNIA 3GS9A 4QT8C 1Y5AT 1OYTH 1ZPZA 4JYTA 3PO1B 1MTUA 2A2QH 2Y7XA 1IQGA 3F2HA 3PLKA 1MU8B 1RXPA 1T4VH 1ZHMA 2AIPA 2FS8A 3WWFA 1NO9H 4OS7A 2CK3D 2Z9KA 2K1QA 1YM0A 3MNXA 4NZQA 3SV8A 1TQ7B 2ANMH 1YPKH 1B0FA 1ZGIA 1CBWC 1BTPA 1B0EA 5E2PA 1O3MA 1O5GH 3CS7A 2D8WA 1PPBH 1VJ9U 2HNTE 1GBJA 1XUGA 2ZGJA 1UTMA 2K0QA 3M3VA 1SVPA 1HJ8A 3PLBA 1GWAA 1TRMA 3SV9A 1BBRE 1UTOA 1V2NT 1F0SA 4ZROA 2PW8H 1JOUB 2ZHQH 2G52A 3TGJE 4YXWD 1Q2WA 4A1TA 2G8TA 4UD9H 2VVCA 1O2KA 1CO7E 2P16A 1FAKH 1V6DA 2OTVA 1G3CA 1UCYE 1RIWC 3RXKA 1EX3A 1PQ5A 1IQMA 2FOMB 4GSOA 3LOXA 4K69A 1AZZA 2ZO3H 2YOLA 3N99A 4ASHA 4GUXA 1O5AB 1QL9A 1JIRA 1WBGB 2FPZA 4Q4LA 1HYLA 2J5UA 3BEUA 3A8CA 1G3BA 2ILNA 4D7FA 1DS2E 1FMGA 1YKTA 1XUKA 1BUIA 1DFPA 1V3XA 5C1XA 2PV9B 3L33A 1Z8GA 3SOSA 3B23B 4ZAEA 1MTVA 1DX5M 2J9NA 4B2BA 5DSFA 3QX5H 1D3TB 5EXMA 3ZVDA 2ZCHP 5JB8S 1GBEA 3M3SA 3VG8A 1OPHB 2QA9E 2AS9A 1KXAA 5DO4H 1ABJH 4I8KA 5C0TA 5LPRA 3QTVH 2C8XB 1GMHG 3LH3A 3TH3H 1YPGH 3A80A 2PFEA 2AMDA 1O39A 2SGAA 4ZKNU 4UE7H 4UFEH 3F9HA 1EZUC 1MAYA 1LHEH 3BTQE 3UIRA 4JZ1A 1JXPA 4INKA 3BF6H 1ELFA 3F0PA 2QE7D 5C94A 5HGGA 5FPTA 1GPZA 3UY9A 1P11E 2ULLA 4UDWH 4CH8B 4DVAU 4X8VH 5A8YA 3GDUA 3Q3KA 1EAIA 2HLDD 2V3HH 3GYLB 3OSYA 4JZFH 1H8ED 4XDEA 2R2MB 4FUFA 2ODQA 3BIUH 1AUJA 5BRRE 1P2MA 5EJZA 1T8LA 1RIWB 4BAKB 1IQKA 1DXWA 2AMQA 3EDXB 3OEED 1OHHD 5KGOA 1HDTH 1KTSB 5AVDA 1TNLA 1SLWB 2WSSD 4Z6AH 4MPXA 3BTGE 1JIMA 4HGCA 1EPTA 1F2SE 1O3EA 1F5LA 4WMEA 1SHYA 1C4V2 2TGAA 9LPRA 4CRGA 1GHXH 2WUBA 1UVTH 3PROA 2TBSA 1GDQA 3GOVB 1BDAA 1GBLA 2BDGA 1K2I1 2P8OB 3DFLA 1QNJA 3RXFA 3GY4A 2J95A 1SGFG 2B7DH 4B71A 2GZ8A 4RI0A 5EXLA 4VGCC 1TGNA 3LGYA 5C0UA 1CHGA 1TOCB 5DP9A 8ESTE 1S5SA 4HG6A 2K8IA 1G3EA 2FTMA 3DD2H 4E7NA 1OS8A 4ACAA 1PFXC 3F2FA 2RA0A 5C17A 3DSPA 5BPEA 3V3MA 8KME2 3UNRA 1LDTT 1MQ5A 4AGJA 5FL7D 1RTFB 1MBQA 1HFDA 1Y5BT 4Y0YE 1O33A 3TNTA 2WPDD 2OK5A 1F5RA 4Z0KA 4K8YA 3AW0A 3ZZ7A 4E7RG 5LGOA 1KXFA 2YMSC 3A87A 1EASA 4GAWA 1C4Y2 2Z9GA 1ZSLA 1GHWH 1WDIA 2BVXH 2ALVA 1MU6B 4XRNA 4BTIB 2Z9LA 1Z71A 4AFSA 1THRH 1ARBA 5JBBS 2G55A 3T26A 1RS0A 1XUJA 2VGCC 1XVOA 4Y11E 3JZ2B 1KXBA 4Z1MD 1A2CH 2IPQX 2CF9H 4U32A 3Q3YA 1QRZA 3ZVAA 1MTSA 5EJ1A 2EI8A 1AD8H 1GCDA 1PPFE 2CGAA 4K5ZA 3GY5A 1NN6A 5EOKA 4Q7ZA 1GJDB 4RN6A 2KAIB 2FLRH 3LC3A 1FUJA 1GDUA 1TFXA 2CMYA 5ESTE 4NSYA 2FI3E 3BEIB 1Z8JB 5C5OA 1A4WH 1DLKB 2F91A 1TX8A 2ZGCA 5EQSA 3SW2B 1NRPH 1EZXC 1P06A 8GCHG 1E1QD 1O3NA 5A0BA 4KKDA 1QBVH 1BRAA 1EOLA 1YF4A 3QDZB 5DP5A 2B0FA 5ESBA 1IQFA 3K9XB 3QGNB 1SKYE 1CGJE 1FY4A 3ITIA 2O8TA 1IQEA 2Z7FE 1UTNA 3SZNA 2GCHG 2TGDA 3R3GB 4NIYA 1TB6H 2AERH 1XVMA 5E8EH 3TJUA 4DOQA 1O2NA 3FFGA 1MZAA 2BZ6H 2YMSB 2QCYA 4IC5A 1G2MA 1K21H 2NWNA 2VWNA 1TE0A 5E0GA 1EUFA 4D76A 2J94A 2PP6A 2Y80A 2Z6BD 1C5VA 1AO5A 2SNWA 2ZTYA 3QO6A 5HIYA 3T28A 2BDYA 1Z8IB 1O2OA 2UUJB 3RXIA 1AWHB 2VGCB 3DT0H 4WMDA 1EXFA 2GT8A 1RD3B 3UWJH 3DSGA 4D7GA 4X1NU 1A5IA 2QN5T 4Q2KA 2W5EA 2KFWA 3C27B 3GY8A 2R0LA 1AVXA 4F4OC 1QBOA 2F3CE 1O3FA 1Q3XA 1QJ7B 2IN2A 5E2OA 3F9EA 1JRSA 1V2JT 1INCA 3TK6A 1HAIH 2QF3A 1O5EH 3KQDA 1XKAC 4XBDA 1ZSKA 2BD7A 1EJAA 1E34B 4O3UA 4OGXA 1UO6A 2GMTB 3PMBB 3O8CA 4K1SA 3A84A 1O36A 1QB6A 3BTDE 3ZIAD 4AZ2B 4X1PU 3UQVA 2TPIZ 1EAXA 3MU4A 2WPKS 6GCHG 3CS0A 4MVNA 2ZU3A 1V2KT 3RXRA 3SI3H 3K2UA 2F9UA 2ZCKP 3ZVBA 4GLYA 2UWPA 2A4QA 1GVZA 5HIZA 1O2GH 1ELVA 1K9OE 1TNHA 4Y7AA 2F9NA 5IK2D 1DSUA 5GIBA 3EE0B 3U8OH 3KQBA 1MD8A 1NRSH 1OYQA 2HNTF 2XCFA 2Y7ZA 3ODDA 3CP7A 4MNVA 3Q3XA 1A5HA 4FU7A 1BTWA 1ZZZA 2M2AA 3A89A 4D8NA 1O2TA 4MG3A 3RMMH 3MH6A 1O0DH 2K7XA 1OP8A 1V2ST 1Y3XA 1C9TA 1O2PA 2Y5GA 3KQCA 4TY7A 3NUMA 3ZVGA 1O3IA 1HAOH 1VR1H 2GVFA 1LTOA 1HIAB 1KLJH 3UPEA 3GY7A 2XC0A 4K8BA 4HI3A 1CE5A 3SI4H 4AYVB 3ATMA 2FOAA 1Z8RA 3QZQA 1DUAA 3SV6A 2RDEA 1GG6C 2ZHFH 1NRNH 4CBNA 3TJOA 4O9VA 2A45B 1TNGA 3M36A 1RRKA 3U9AH 3LGIA 5DGJA 4Q80A 7LPRA 3UUZA 1HBTH 2ZGXH 1SGTA 1THPB 4ABDA 2RG3A 1GMDG 1QHRB 2GKVE 1ZPBA 3A7ZA 1O3HA 2J92A 3KIDU 1O3JA 1MKXH 2M5TA 4ZXXH 1WUNH 3TVJB 3EE7A 4B6FA 2BYAX 1GBTA 2PUQH 2O8WA 2ZDMA 3HKIB 3SU2A 3D65E 1M9UA 2ZFTA 2A4RA 1C2GA 1SLVB 3SQEE 3W94A 1X7AC 1BBRK 1NT1A 2BVSH 1V2VT 3HKJB 4AX9H 4LZ1H 1EPTC 2VWOA 2VH6A 3RC4A 3RXLA 1SI5H 1UVPA 2ZDKA 1K1PA 3SUFA 4X6PA 3WY8A 1ESAA 3VB5A 1F0TA 1NFXA 1DWBH 2ZP0H 3E0PB 5DP4A 1LKBA 3VB3A 1A0JA 1E37B 1AB9C 1IHSH 1UCYK 2AGGX 4TSFD 3FANA 8GCHF 4FUJA 2QIQA 4BAQB 2BX4A 5FXLA 4FUBA 3EA8A 5FAHA 2Q6FA 3U98H 3MYWA 4A1XA 4TWWA 2QC2A 4YTAA 1TRNA 3FZZA 2J2UA 4IGDA 1UVOA 3P8OA 1CT4E 4XSKU 1C9PA 1O3CA 5HKKD 1VGCB 1GG6B 3MH7A 3GISB 1GHYH 1EB1H 3N7EA 3U1JB 3A85A 2PGBB 5JBTA 4X1RU 2V7QD 5T1VA 2FM2A 1QQUA 3SU6A 1C1TA 1NESE 1TRYA 1L1GA 4Y6DA 2QF0A 4YOGA 3TH2H 2TGTA 4O97A 1YBWA 3MOCA 2GDEH 3PB1E 3R0FA 1O2YA 4F49A 5JYIA 5CMXH 3TK5A 2C8ZB 1QURH 1Y8TA 1PQ7A 1FQ3A 1O32A 2A7CA 4NG9H 2XNDD 1LCYA 1P12E 3QUMP 3SV2H 2BY8X 2FWWA 3O8BA 1D9IA 2GD4B 3MWIU 2SGPE 3W1EA 3BIVH 4SGBE 5A8ZA 1GI6A 1BRCE 3KCGH 3PO1C 1DWDH 1WQVH 2XRCA 5EJLA 4MPUA 1CVWH 5F03A 1TPOA 5K0HA 5AF9H 1C1QA 3FO8D 1DSTA 1NM6A 2FP7B 1QY6A 1AHTH 4NGAH 1OWDA 2OQ5A 1ELCA 2ANKH 1TONA 4Y10E 3MFJA 1A0HB 3SNBA 1FIZA 3F6UH 4AGKA 5A8XA 5IDKA 1KYNA 4Y8YA 3ZZ8A 3SNDA 5F8ZA 1SQRA 1GHBG 1OOKB 3KL6A 1TWXB 1HJAC 3ZZ3A 4DURA 1UVUH 2OBQA 1C5WB 2ZWLH 2STAE 4IC6A 1LVMA 2FO9A 3BG4C 4DW2U 2BOHB 2G51A 1SGQE 1ZGVA 2W7SA 4BTUB 3GCNA 2XXLA 4ESTE 4IMZA 2VNTA 2KZ4A 4OS6A 7GCHG 2FODA 1ZR0A 2BY6X 2YMSD 1BQYA 2OC1A 1V2WT 4OS5A 1OWEA 3M7TA 1JMOH 2OXSA 2PGQB 3FOAA 5AFZH 1ELTA 1ACBE 1Z7KA 3U8RH 1AFQC 3MO3A 4I8LA 2LIZA 5TCCA 2HWLB 2BLOA 2G5NA 1AWFH 2HPPH 3ZZ9A 2F83A 5AHGH 3EQ0H 1KXDA 2C93B 3K65B 1AI8H 1J14A 5DG6A 1W0KD 2HPQH 1KSNA 5I25A 2XWBI 1T32A 1VCQA 4LOYH 1AZ8A 2VJ1A 1MH0A 2ASUB 4GVUA 1ID5H 1KLIH 1EAUA 1YPJH 3FN8A 1ANEA 2WYGA 2PKAB 1GMDF 4X0WU 5F53A 2LP6A 2ALPA 1SGCA 1NS3A 1KY9A 4JZDH 5CDFE 2ZPQA 3LONA 1HIAA 1GBAA 1ZLRA 1C2DA 1HJAB 1HAVB 3P95A 4I33A 2CV3A 1ELEE 2AEIH 3ZZ5A 2BVRH 1GI4A 1QTFA 3BG4B 1TMTH 4A92A 1P2JA 4AN7A 1D3QB 1EZSC 1NBMD 3AAUA 4DT7B 5FBEA 2JETB 2UUFB 2XOKD 2AH4X 4BAOB 4UEHH 1CU1A 1DVAH 3SYJA 2BY7X 2P3UB 1COWD 1HAGE 4P00A 3SGBE 2ZA5A 3SGQE 4IBLH 4FXGH 3EA9A 2B5TB 3KHVA 4YLUA 2SGDE 4IMQA 2O8LA 2P3TB 1TYNA 2FMJA 3SJOA 3F9GA 1AFQB 1QJ1B 1G36A 3LDXH 4FU9A 2O8MA 4OS1A 1P3EA 1XX9A 2ZFQH 2KCPA 5TJXA 3LGWA 2JH0D 3KF2A 1K1JA 2F9OA 1L2EA 1O2IA 1W8BH 4AG2A 2Z94A 5A0CA 5DJ7A 1G30B 4MNYA 3FP8E 2GX4A 1OKXA 2TRMA 1O3LA 1WTHD 4X8SH 3NRLA 4H6SB 3UTUH 1ELBA 1A1RA 1EZQA 1P9UA 3NWUA 5T6GA 1GBCA 3ZYEA 2DE9A 2WPMS 5GCHG 2P8OC 3E0NB 1HAPH 3ENSB 1LVBA 1GCTC 2UUYA 3L3TA 4CHAB 1OWHA 2AGEX 5DP6A 5EU8A 5PTPA 5L6NH 1J17T 1B5GH 2UWLA 1UTQA 1MCVA 1MBMA 4RKOB 2W3IA 3M5LA 1W10U 2WZQA 4AC9A 2LPRA 5C20A 3RXCA 3UAIC 4LZ4B 2ZF0H 2XNIA 5GPIB 1UVSH 1K1NA 1ANDA 1H8IH 2A32A 3ZVFA 5EQRA 2J4IA 7ESTE 1SFIA 3EAJA 1BJUA 1XUFA 1CSOE 1GJBB 3LT3A 2RFKC 2Y81A 2A5AA 1PJPA 2C3SA 2GT7A 2V6NA 1THSH 2XTTB 2D1JA 1IOEA 1GGDB 2ZPSA 3KYGA 2B9LA 1DE7H 1E0FD 2ZGHA 5L30H 1XXFA 4WMFA 4X2XA 3VFEA 2FS9A 3E1XB 1BRUP 1SQTA 1LKAA 1RTKA 1SQAA 1QBNA 2FOGA 4FUDA 5EXNA 3UQOA 4ZKSU 3SORA 1VCWA 3KGPA 2Y5FA 1FIWA 4CREA 1GI9B 4NFFA 2G4TA 1Y59T 1Y3UA 2GCTC 5C3NA 1ESTA 4CR9A 2LELA 4IW4E 4X8TH 3PRBA 7GCHF 1BTXA 3OAAD 4IS5A 1PQAA 3CNRA 1GCTB 1SQOA 5FX6A 3EA7A 3Q77A 3D23A 1UTPA 1O31A 3SJKA 1N8OC 1G2LA 3TGKE 1GJCB 4XBBA 2NU0E 1K1IA 4WY3A 3BEFB 4WWYA 3WWBA 1J15A 1YPMH 2BTCE 4ABFA 1GDNA 2XBWA 3RXQA 2XCNA 3OFND 2ZHDA 1SGRE 1UHBB 3LGVA 3SQHE 3RXPA 5HM2A 3TIUA 3RXAA 3NKKA 1ZJDA 2VIVA 3UNSA 3TGIE 5EG4A 3NZIA 2ZU2A 3AW1A 4PROA 2PR3A 3U28C 1DWEH 1TPPA 4ABJA 5L2YH 3AK5A 2IJD1 1O3AA 3RXMA 2J98B 3SU0A 4A7IB 1YY3A 3ZZBA 4Y8XA 3U1IB 3GICB 3HK6B 2ZU1A 4ASUD 3DSOA 3KQEA 1ZTLA 3SV7A 3AASA 2ZGBH 4Y76A 5KEDA 1Q31A 1AMHA 4I31A 4DCDA 1P3CA 1BJVA 1H8DH 2ZI2H 1C5XB 2QV1A 1EP6A 1ZRKA 3DHKH 1HJ9A 1QB9A 2GCTB 1H1BA 2QAAA 1TNJA 2C4FH 1KTTB 3NXPA 4ZKOU 3E91A 1EKBB 4D9RA 2PKAA 3F3BA 2BY5X 1C2MA 3SNCA 2ZQ2A 1W3CA 1SFQB 4WJG2 2EY4C 1PPEE 3RC6A 1ELDE 2C8WB 1N8OB 1D3PB 4RKJB 4K1TA 1C2LA 2V35A 1HAVA 2GMTC 1PQ8A 1P2OA 4XD7D 4B75A 2IPHA 2WYJA 3B8JA 1TGCA 1TNIA 2JKHA 1HAXB 2ZFSA 5FX5A 3KN2A 3H7OA 1C2EA 1LPZB 1O38A 1FLEE 3RDZA 1SR5C 1BHXF 1Y3VA 1NU7B 1O3KA 1O2MA 3Q00A 2BD8A 1A61H 2Z3EA 1BMAA 5GCHF 2F43B 5EPNA 1AKSB 4ZKRU 1C5SA 4ACBA 1ZHPA 1FZZA 1G37A 1H9HE 1H9LB 3GDSA 5DN6D 1CGHA 1ZMNA 2EI7A 1V2MT 1UK2A 1V2QT 1MKWH 1YCPH 2H5CA 1SB1H 4B2AA 1GHZA 3MH5A 2PWXA 4ZHAA 2BLQA 2DUCA 1ZRBA 3RXHA 3PMHB 3ATLA 4FU8A 1LHGH 1GMHF 1MKXK 3E3TA 1E35B 1MMJN 1S81A 3GY6A 2ZU5A 2BD9A 2VVUA 3ZVEA 1J16A 3ZZ6A 2ZFPH 1HXEH 3IWMA 1YPEH 4YT7H 1GI0A 3SU3A 3QK1A 1S6LA
chains in the Genus database with same CATH topology
3S69A 4INLA 4CRFA 3LJOA 3CENA 4ISIH 2BD2A 3UFAA 1S83A 1FY1A 1O2ZA 3P8GA 1WQSA 4CRBA 3UWIA 1OP0A 2BDHA 1QIXB 3MTYA 3FVFB 5J4SA 1XM1A 2H9EH 5LH8A 3M5OA 4NIVA 2Y5HA 2CHAC 3S7HB 2PTNA 1QA0A 2H1UA 4ABEA 1N6XA 1SLUB 1C1OA 1GVKB 1IQLA 3D49H 3QGJA 1HPGA 1GMCG 4THNH 3SUEA 2ANWA 1EATA 2ZDAH 4YM9A 3HGNA 1C2HA 3OTJE 2W3KA 1YPHC 2F9VA 3PTBA 1F92A 3FAOA 2W7UA 1Z1IA 5C67A 1V2OT 1EJMA 4WXIA 3PMJA 4HFPB 1IAUA 1NRQH 1PYTC 1CHOG 1OSSA 3P8NA 1O5BB 1W7XH 3MH4A 4JYVH 3LGTA 1N6YA 1CT2E 2A0QB 1P0SH 3RLYH 2ZHWH 3S0NA 1TA2A 1TNKA 2V0BA 3BTEE 1BMNH 1DPOA 1IQNA 2VU8E 3STJA 3ZVCA 4ZH8A 3V12A 4INHA 4WH6A 1NZQH 3BTHE 3PMAB 2H9TH 3GY2A 3W95A 1VGCC 3M7UA 1WOFA 2A2XH 4KGAA 4B1TA 1NFYA 3ZYDA 5FBIA 1BOQA 4LXBH 1NTPA 2Z9IA 1A3EH 5C1UA 3G01A 4E06H 3URDA 1UHBA 5JBAS 1QA7A 4ISHH 2H2ZA 1L4DA 3MHWU 1TBZH 3BTME 1AN1E 2CHAB 4AFZA 1NPMA 3DFJA 1TQ0B 1P01A 5H4IB 5K7RA 2QGRA 2SFAA 2XWAA 2HRVA 1NU9A 2FXRA 1O3GA 1KLTA 1GI2A 3P92A 1SLXB 3QZRA 2FLBH 1DDJA 3LC5A 1O2WA 4JK5A 1LQEA 4WVPE 1ZOMA 2D2DA 4CR5A 1TBQH 3GYMA 3RLWH 1O30A 1GL0E 1CGIE 5IYTA 1MAXA 4Q7YA 3BSQA 1BMMH 1SHHB 1WCZA 1BITA 2GZ7A 2BQWB 2XC5A 1GI1A 2ZDVH 3A8DA 3P70B 3ZZAA 4A1VA 4AYYB 2ZQ1A 2G00A 4CH2B 1IQIA 4MPWA 5ETXA 1WYKA 2ODYB 4X1QU 4IN1A 4K60A 3ZV8A 1TGBA 3PTNA 3RC5A 3DUXH 1C1WH 2GCHF 2KAIA 1SL3A 4UFFH 2GP9B 4JK6A 1GHAG 1T8MA 3RXEA 3RXVA 1DM4B 4ABGA 2BXUH 1RTLA 4O03A 1AGJA 1FPHH 2ZKSA 2FIRH 5C1YA 3SJ8A 2XBXA 1G9IE 1W14U 5T3HA 1QFKH 1C5UA 1FONA 5LPEA 2OC8A 3TLOA 4KELA 2GDDA 2F9PA 1A0LA 2XYAA 1UJ1A 1VZQH 1AUTC 4U30A 2D26C 2RDLA 1AKSA 3B9FH 1ZJKA 3JZ1B 3LJJA 2ANYA 1OX1A 1T7CA 4DIIH 1FPCH 3ATKA 2ZU4A 2ZZUH 3A7XA 4CRAA 1E38B 3UOPA 1IHTH 4OGYA 1SGIB 1P05A 2CN0H 3A82A 3A83A 3RXJA 1QGFA 1Z1JA 1XUHA 4DY7B 3F9FA 2FEQH 5EW1H 1DWCH 4MPVA 3RXBA 3KEEA 1BT7A 1S0QA 1UTKA 3MI4A 1V2LT 4YLQH 3VPKA 2ZECA 3DA9B 3HK3B 2ZCLP 4XBCA 5F8TA 6GCHF 1ANBA 1HAZB 1OWIA 1TMBH 2FDAA 4NWKA 3RXOA 2VINA 4B76A 1JRTA 1C1UH 4H6TA 1BTUA 1GMCF 2FX6A 2HOBA 3BTFE 1NFWA 9ESTA 3UNQA 1YPHE 5HYOA 1O5CB 3N7OA 1NC6A 1TMUH 1FY5A 4AB9A 4U2WA 2XC4A 2JETC 2EI6A 1TALA 5JDUB 1CHOF 1BB0B 3SU5A 3MNBA 3T29A 1YLCA 2FZZA 1DXPA 1SGYE 1O2SA 2ZHEH 1EB2A 1ARCA 5E0HA 1UTJA 2BY9X 2R2WU 2H5DA 3RXUA 1XXDA 3RMOH 2AIQA 2EC9H 4XFQA 4GCHG 3RU4D 4HTCH 2R9PA 1LVYA 3OY5U 3FP6E 3MO6A 5CHAB 2ZEBA 3TNSA 3TK9A 1DUEA 1QJ6B 3I29A 4MQAA 1XMNB 4DIHH 2GZ9A 2A5IA 1ETRH 3VB6A 2BQ7B 1PPZA 1EQ9A 1BZXE 3A88A 4YOIA 5EODA 2I6SA 1EJNA 1W2KH 2Z3CA 4ISOA 2PTCE 3F68H 2H9HA 6CHAB 1FV9A 3SU4A 4YO9A 1EAWA 4CHAC 2CJIA 2BLVA 2VB0A 2OQUA 1O2QA 1C1RA 3TPIZ 4J1YA 1ZMJA 1GBMA 5F8XA 3QTOH 2AFQB 4NIXA 2FOFA 1AE8H 1A3BH 1C1MA 1C5YB 2C90B 3A7VA 1BTYA 1VITH 3MU0A 1H4WA 5FHTA 2RA3A 3LU9B 3ZZDA 3S9CA 1FN6A 1G32B 1E36B 1QL8A 1P2IA 2BDAA 1H9IE 1ZSJA 2P95A 3BG8A 1MTNC 1ZTKA 2W26A 4SGAE 1AVWA 2FYRA 5GJ4B 1GGDC 4UONA 5SGAE 1ELGA 1ANCA 1BTZA 1P8VC 3A86A 2BHGA 4NFEA 4E05H 3SHAH 3L6PA 4BXWA 3GCHB 1Y5UT 2ZG0H 5I46H 1IQJA 1FY8E 1QQ4A 4NA9H 4ABHA 1EP5A 1UTLM 2FI4E 3SNEA 3TITA 1D6RA 3SGAE 3URCA 3TJVA 1YGCH 1GHAF 1C5NH 1C5TA 2BD3A 1P09A 2J34A 3E16B 4UFGH 1HGTH 1A5GH 5GXPA 1V2PT 4TPYA 1TA6A 2VIOA 4FVBA 1LQDB 2V3OH 5G4BA 5DPAA 1O2UA 3A7TA 1O2RA 3E90B 1N1LA 1RGQA 1JWTA 2Z3DA 4I32A 2UWOA 1HAYB 2RCEA 4NA8A 3M7QA 2A5KA 3TU7H 1HRTH 3EBNA 1OP2A 3VB7A 1S82A 3QN7A 3GCOA 6LPRA 4AFUA 4ABBA 3IITA 1SOZA 1ZYOA 3VEQB 3K6YA 3PWCA 1GBHA 2HLCA 1P2NA 4ISLA 4FUHA 4AOQA 3RMLH 4MTBA 1LHCH 3RUOA 3V7TA 4ZHLU 1MTNB 1TPSA 3P17H 1MZDA 1CBWB 2OCVB 1MQ6A 5EW2H 1SMFE 1L4ZA 1Y3WA 3ZZ4A 2DE8A 3F1SB 1PYTD 2FI5E 3VXEH 1C5LH 3EYDA 3SUGA 1J8AA 1GHBF 1L1NA 2O8UA 1SOTA 1AU8A 4CRDA 1SBWA 3RMNH 4LK4A 4O3TA 4NSVA 1GJ8B 1C2JA 5CE1A 1TABE 2UUKB 4K3JA 3SO3A 3ZV9A 5C2ZA 3HATH 1RFNA 3VGCC 4Y8ZA 3U8TH 1FY3A 2ZIQH 2PHBA 4U01A 2OBOA 1P03A 3A7YA 1FAXA 3UREA 1GJAB 4J2YB 1RJXB 1MUEB 1SGFA 6ESTA 4CBOA 2P94A 1TPAE 1MTWA 1D4PB 4MLFB 2SNVA 1MKWK 4XOJA 1YCPK 1VCPA 1K22H 5AFYH 3TH4H 5T6DA 4GCHF 4JYUH 5DKMA 1DOJA 1LPGB 1LHDH 2OD3B 5JB9S 1V2RT 1QRWA 1AQ7A 1F7ZA 1C5OH 2Y82A 4FUGA 1DY9A 2JH5D 4TPIZ 3UR9A 1PPCE 1K1OA 4NCYA 1GL1A 4BTTB 2I6QA 3FZDA 4A6LA 1VJAU 4WH8A 2BD5A 1AIXH 1TGSZ 1CA8B 2JH6D 3BTKE 4ZXYH 5F6MA 4TYDA 4AG1A 1K1MA 2QXHA 3V0XA 4R8TB 3LKWA 2R3UA 1NY22 2SGFE 3LGUA 2CXVA 3TJNA 1YCPM 3QWCH 1GI7B 1TX6A 1T4UH 1O2JA 1O5DH 1O3PB 2SGEE 3LIWA 2G4UA 2J38A 4CRCA 2VIQA 1LHFH 1GVLA 3P8FA 2A7HA 2BZAA 4JZEH 3VGCB 5EQQA 3M3TA 1ZPCA 5FCRA 1W11U 2G81E 2BDIA 2FOHA 1EOJA 1YP9A 4YESB 4AB8A 3LPRA 1GJ6A 2C8YB 1P02A 5A0AE 1GI5A 1OWJA 2A4OA 1VITG 1P2KA 1GBDA 4BANB 4OS2A 1LO6A 2FOBA 2TGPZ 1J9CH 2LNCA 4I8HA 5A09A 1QRXA 2OUAA 2ZC9H 2YNBA 2A4GA 1GBFA 3BTTE 2QXGA 2R3YA 2ESTE 5A2MH 2GV6A 5FPSA 2A1DB 3BV9B 1FI8A 1GI3A 5DK1A 1BRBE 1XUIA 5FPYA 5LPFA 3O8RA 1AY6H 1C5PA 4VGCB 4H42U 2NU3E 3NK8A 1OWKA 2WPJS 2WPHS 1QB1A 4ISNA 1WV7H 5JPMH 2VIWA 1HCGA 4RSPA 1S6HA 1GJ9B 4ABIA 1A7SA 1NFUA 4JMYA 4KTCA 1D3DB 2WV4A 3ODFA 1BTHH 1TX7A 1SG8B 1YLDA 2ODPA 2QXJA 1F5KU 1W0YH 1SGNE 2VIDA 4WF8A 1TAWA 1A46H 1YYY1 5E0JA 3IG6B 2BQ6B 2PUXB 1SGPE 4BXSA 1JBUH 4Y7BA 2Q6GA 1GJ5H 1WAYB 1C2KA 1NRRH 4GHTA 3UOUA 1QR3E 2GGVB 1K28D 4MDSA 4ABAA 2WV5A 2ZTZA 3PM3A 1ESBA 3T5FH 1DITH 4FUCA 3AVZA 4B74A 1GBIA 4AFQA 1BCUH 1KXEA 1FXYA 3BN9A 4FVDA 1KIGH 1DLEA 1S0RA 1BIOA 1W12U 1W0ZU 2PSXA 1TIOA 5HM9A 2A7JA 1ORFA 2G5VA 2ZTXA 1GI8B 4NWLA 3RXSA 1FJSA 1TGTA 2R0KA 4X6NA 4TY6A 2AYWA 3A8AA 3EGKH 1DICA 3HPTB 4XE4A 3SNAA 3SJIA 3VXFH 3I77A 4KTUA 1W7GH 2AMPA 2IOTA 3M61U 5JBCS 4X6OA 1P9SA 2ZNKH 2BMGB 1C1NA 3T25A 2XW9A 1HAHH 1GHVH 2PKSC 1ETSH 5EGMA 5L2ZH 2SGQE 2VWMA 1KDQB 1O3OA 3M5NA 1ZMLA 4BNRA 2THFB 2WPIS 1Z6JH 4BAHB 1HNEE 2BXTH 2FTLE 3AAVA 3OY6U 2CF8H 1AE5A 2OP9A 4ZMAH 2IJOB 2ZDNA 4DGJA 4X2VA 3GCTG 1S85A 4JZIA 1O3DA 1YC0A 2A31A 1SGEE 2P59A 3A8BA 3RM2H 1O5FH 4Y0ZE 2FOEA 4MNWA 3T27A 2VH0A 1C1PA 1MD7A 1O2VA 2NU4E 3OYPA 3RXTA 4AORA 3SU1A 1UK4A 1ABIH 2NU1E 5DP8A 4MNXA 1T8OA 3SBKA 8LPRA 4Q7XA 1FN8A 3RU4E 5J4QA 2PSYA 1MCTA 4JCNA 1SSXA 2PLXA 1ZTJA 4OS4A 5ABWA 1V2TT 1IQHA 1FDPA 2EEKA 1G3DA 3PV4A 2FOCA 3S7KB 2BOKA 3U69H 1O2XA 2OC7A 1AFEH 1WTGH 2B8OH 4FUEA 1HUTH 1T31A 3SN8A 2BX3A 1HXFH 1LPKB 1GJ4H 3P6ZB 1CT0E 3BTWE 1DANH 2FX4A 3HGPA 1C5RA 1C1SA 2BM2A 3OU0A 3S9AA 2YNAA 1BHXB 2WPLS 1C2FA 2BB4A 3A7WA 3MU5A 1VITF 1Z6EA 4H4FA 5DP3A 2EA3A 2PKSB 3STIA 3PWBA 3GY3A 2Y6TA 4TWYA 2ZFFH 1WSSH 2HNTC 4DJZB 5HXFA 2STBE 2VVVA 4Y79A 3SUDA 1C5MD 1O35A 1BA8B 2ZFRH 4UFDH 2FYQA 2ZPRA 3MNCA 4WXVA 4B2CA 3C1KA 5HMAA 5FCKA 1S84A 2HGTH 4X8UH 3RXDA 1TLDA 4I7YH 1O2HA 2WUCA 4YT6H 4KTSA 4NIWA 1GBBA 2ZDLA 1XKBC 1CQQA 3V13A 5EPYA 7KMEH 1K1LA 1O37A 2BDCA 1V2UT 2VWLA 2TIOA 2OINA 4HZHA 1HB0B 2BDBA 1CA0C 2F9BH 1LVOA 4BOHA 1TOMH 5CHAC 1KXCA 3D62A 1HLTH 3T2NA 4A5TS 3RM0H 4BAMB 4X2YA 2Q6DA 1C5QA 4YOJA 3H7TA 3MO9A 3PLPA 4FUIA 3ESTA 1C2IA 1T8NA 5DP7A 5T6FA 5B6OA 5GDSH 3MU8A 1GBKA 2Z9JA 3ATIA 1PPHE 1SC8U 3PYHA 4K1EA 3QLPH 2HALA 4YZUA 2WINI 2Q1JA 4Y71A 6CHAC 1AVGH 2XBYA 3KNXA 1L1JA 1S6FA 4NA7A 3MNSA 2XBVA 2AGIX 1DY8A 3ELAH 4DG4A 1U6QA 1LMWB 3M5MA 1Y3YA 5C5NA 3O8DA 1C5ZB 3ZZCA 1NROH 3ATWA 5TCAA 1O2LA 3RU4T 1P04A 1EPTB 3MU1A 3E6PH 3K6ZA 3OX7U 2H6MA 3SHCH 1ELAA 3I78A 4B73A 2GTBA 3M35A 2QYIA 4X1SU 1P2QA 3NCLA 1AB9B 2P93A 4D9QA 2GV7A 3MMGA 4NZLA 3VB4A 3NPSA 1OXGA 4IN2A 1C1VH 3RXGA 1D6WA 2BLWA 1TBRH 1YPLH 1SPJA 1ZHRA 3E8LA 4R0IA 4X2WA 1W13U 2HVXA 1F0RA 1GJ7B 1CA0B 5GWZA 2O9QA 4I8JA 3GCHC 1BBRH 2BD4A 1QL7A 1UK3A 4KP0A 2VIPA 4M7GA 4I8GA 3H5CB 3GCTF 3M37A 2OC0A 4GPGA 3UR6A 4X6MA 1SGDE 4GHQA 3S9BA 4K2YA 3SJ9A 3Q76A 3LH1A 1QCPA 1B7XB 1WU1A 1UCYH 1P10A 3T62A 1L0ZA 1C4U2 3FP7E 3RP2A 1BMLA 2FESH 1HV7A 3A81A 1F0UA 4ZUHA 1O34A 1KDQA 1UMAH 2OLGA 3GDVA 1O3BA 2P3FH 2NU2E 2QXIA 2QY0B 1ETTH 1PPGE 1DT2A 4ZHMU 1P57B 1FNIA 4QT8C 1Y5AT 1OYTH 1ZPZA 4JYTA 3PO1B 1MTUA 2A2QH 2Y7XA 1IQGA 3PLKA 1MU8B 1RXPA 1T4VH 1ZHMA 2AIPA 2FS8A 1NO9H 4OS7A 2Z9KA 2K1QA 1YM0A 3MNXA 4NZQA 3SV8A 1TQ7B 2ANMH 1YPKH 1B0FA 1ZGIA 1CBWC 1BTPA 1B0EA 5E2PA 1O3MA 1O5GH