2GZ9A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords Replicase polyprotein 1ab
total genus 82
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz9A02
1NESE 1GHAG 2ZGHA 1NFXA 1V2VT 2AS9A 3UTUH 1YPGH 2LPRA 3SV6A 1HDTH 4RSPA 1C5XB 2Z7FE 1HYLA 2BD3A 2GP9B 1WYKA 1XUKA 3EE0B 4U01A 2PKSC 1UVOA 1FMGA 1HB0B 3LJJA 4AG2A 1FIWA 3U9AH 3AAUA 3FP8E 1UK3A 4ABJA 2QF3A 1W10U 1INCA 2HGTH 1NRNH 1ZR0A 4X6PA 3OTJE 1A0HB 3D23A 1GHWH 2VWNA 1YLDA 5FXLA 2XBXA 2CJIA 2HRVA 4AFZA 4A7IB 1SGNE 4H4FA 5E2OA 1WTGH 2YNBA 3RXFA 1GVLA 2B8OH 3TNSA 1AWFH 3TGKE 2NWNA 2AGGX 3ZZ3A 1V2KT 1UCYH 1ZHRA 1H1BA 3AW1A 4KELA 1WBGB 2EA3A 1L2EA 3PYHA 2QF0A 1D9IA 3BTQE 1IQJA 1ABIH 1W0YH 1LDTT 2NU2E 1YC0A 5DP3A 1O3IA 2AMQA 1K2I1 3K2UA 1AFQC 1O3AA 1O5CB 4ZXXH 2LNCA 5DKMA 1KLJH 1O5AB 2XNIA 3DD2H 3FP6E 3ZVFA 1GHAF 1GI0A 5CHAC 4X8SH 1IQFA 4B2CA 4JZIA 2C8XB 1E0FD 2O8TA 4OS1A 3UR9A 4NSVA 4MG3A 1V2LT 1GBIA 3OY5U 2W26A 1GMDF 3MHWU 1CA8B 1L1GA 1KSNA 2GMTB 1C5LH 2ZPQA 1WTHD 1OYQA 4ABDA 2FI4E 1TNHA 3SW2B 1GJDB 2BY8X 2XW9A 2ALVA 1YGCH 1TGSZ 4NFEA 1ZJKA 4NIYA 2JETC 4FUIA 3U8OH 1TRNA 1WQVH 2ZHWH 1GHBF 3SZNA 2ZGJA 3SV9A 1BMNH 1GMDG 5FCKA 3A7ZA 1LQDB 3SNDA 3FZZA 3GCHB 9ESTA 1L4ZA 1BDAA 4NWKA 4DT7B 2ZECA 3PMHB 1YCPH 3P92A 4ZHMU 1ZLRA 2ZU2A 3IITA 3P95A 3PROA 2VU8E 3RMLH 3RXHA 1EATA 4CRGA 1Z1JA 1GJ9B 3VEQB 1AU8A 4NSYA 1A61H 1VJAU 1BOQA 2FOAA 3RXDA 5JPMH 4TPIZ 1YCPM 3Q00A 1AE5A 1FY5A 1ELBA 1GI7B 5A09A 5A8XA 1VITH 5FPTA 5FHTA 3MFJA 1K9OE 4IC6A 3SJIA 3PLKA 1O3FA 1V2MT 4AORA 3CP7A 3BTHE 1ESAA 2P16A 3T5FH 2FOFA 3DUXH 1CHGA 3M36A 1CBWC 2CHAB 2ZTYA 2J2UA 3BTEE 5I46H 1A7SA 1O3MA 1O2XA 1A3EH 1KXEA 1BTHH 1MCVA 5A2MH 1J17T 1QBNA 1ZRBA 1SGQE 1WCZA 2WPKS 4ISHH 4F4OC 4XOJA 2ZU4A 5GWZA 1CVWH 1CE5A 1PQ8A 2FDAA 3SU6A 2ZHDA 4J2YB 1AUJA 1QB1A 1N6YA 1ZPCA 5DO4H 4Q2KA 1K1OA 1FPHH 1DSUA 3HKIB 3SO3A 3ATMA 8ESTE 2TGPZ 1MH0A 1AHTH 2R0KA 3M37A 3RM0H 1SGPE 4CBNA 2OQ5A 4DY7B 1XUFA 1Y8TA 1NRSH 3OU0A 4Y8ZA 1MTVA 1P2IA 1ZJDA 1BTPA 3A83A 1EP5A 1C5OH 1EJNA 4AX9H 3A86A 3BTME 4UE7H 2STAE 3LPRA 1QL9A 1D4PB 4WY3A 2H5DA 2PUXB 4TY7A 3MI4A 3RM2H 3VGCC 1RGQA 1G36A 2OUAA 2D26C 3SORA 5SGAE 1OWKA 3SGAE 1F0SA 3NK8A 2AGEX 2ZFSA 1NRRH 1DXWA 2H9HA 2VH0A 2GTBA 1YF4A 4XBBA 3UNQA 5DP7A 3GY6A 4GHQA 5K0HA 5C5NA 1MTSA 4RKOB 3GY5A 4GAWA 2ILNA 1GMHF 2FLRH 2ZU5A 3WY8A 3V12A 4X6OA 2SNWA 2BXTH 1UTMA 1C5RA 1PPCE 1AFEH 1BUIA 1DICA 3BIUH 4UFDH 5AVDA 3P17H 1RXPA 1S83A 1K1PA 1T7CA 5DG6A 1HGTH 1E36B 3MNSA 2R2MB 3C27B 2BLOA 4ZAEA 1C2JA 1LCYA 2A1DB 2VNTA 1AVWA 2ANMH 1RTLA 1MKXH 2IJOB 3VB6A 1ZRKA 3MU0A 3Q3XA 1AVXA 2STBE 2OBOA 1MTNC 1V6DA 1F92A 3VB5A 1BMMH 1O2PA 1PPFE 4ISNA 4UD9H 3GY8A 1A46H 2ZHFH 2ZQ2A 1GVZA 1GBTA 1DUAA 4NA9H 4FUCA 1MD8A 1HAVB 2PGQB 1KDQA 1THPB 4Z0KA 1SLVB 2GCTC 3O8BA 4OGXA 3RXMA 3PTBA 3LU9B 1FQ3A 1TX6A 1AD8H 4Y79A 2KAIB 3ESTA 1SVPA 2P8OB 2A32A 4X6MA 4DW2U 3M3SA 1GI9B 1OS8A 2TRMA 3PTNA 4MNXA 1AMHA 1D3TB 3STJA 1C1MA 4O3UA 3E0PB 4X2XA 3L33A 4ESTE 1ETSH 3HGNA 3HK3B 5JBAS 1ZMJA 1HAHH 3W95A 3M7UA 1MAYA 1NU9A 1O3LA 3QTVH 1JBUH 3RLWH 1P10A 4KP0A 1QJ1B 1TOMH 2EI8A 2G4UA 3RDZA 3UFAA 2BD8A 1FI8A 1UCYE 1P2JA 2Y5GA 1Z8JB 2ZZUH 4D8NA 3EGKH 1O2MA 1UTPA 1G3CA 4FUEA 5DPAA 4BAOB 2ZPSA 1S6HA 2BYAX 1GBBA 1DUEA 3GCHC 2O8MA 3I78A 4LZ4B 1DE7H 2C90B 3A7XA 5EQQA 2HWLB 1TGNA 3IWMA 2GX4A 3RC6A 2QGRA 1C2IA 4B71A 2GDDA 1QCPA 3M5LA 3ZZ8A 2ASUB 4YO9A 3DHKH 1AZZA 4O97A 4ZMAH 4K1SA 3TJOA 1O2JA 1FV9A 5JDUB 3S7KB 3DFJA 1LTOA 4WXIA 3V7TA 4B74A 3SQHE 4DIHH 3SU0A 3F9HA 1ANDA 2A2XH 1DANH 2Y5FA 1O32A 4MLFB 2IPHA 5GDSH 1ETRH 3ZZ4A 2BDCA 3RXBA 1BTZA 2ZI2H 2V3HH 4WMFA 5E0JA 2TGTA 1EJMA 1C5TA 1GI6A 2FPZA 2XRCA 5GIBA 1ELEE 1PYTD 2XCNA 1N8OC 2W3IA 1GBEA 5AF9H 2FO9A 1FAXA 1NM6A 2PTCE 4I8KA 3TGJE 1BZXE 1TQ7B 1OX1A 1H8IH 1KYNA 1C5PA 4YLQH 2ESTE 3SNEA 2QXHA 1W11U 2TIOA 1DWCH 1GG6B 4Y10E 3UREA 1P2MA 1LVYA 1FIZA 2FYQA 1L4DA 1SOZA 3LC3A 2A5IA 2TGAA 2ZIQH 3ZYDA 3HGPA 1TPSA 2TGDA 3PWBA 1NU7B 1Y3XA 3MMGA 5F6MA 4NA7A 3P6ZB 2VH6A 3TJVA 1GBMA 3TITA 1GJ4H 1SMFE 4AB9A 5F8XA 1PQAA 1KXBA 2W5EA 4JMYA 3SU3A 1GI3A 1H9IE 3RXUA 1BQYA 1OWJA 1GDUA 1YCPK 1KIGH 3RXRA 1PPHE 3V3MA 4CR5A 2CHAC 3R3GB 1HNEE 2RA3A 2RDLA 1SGCA 5K7RA 6GCHF 2ZU1A 3RUOA 1Y3UA 7GCHG 1Z71A 5L30H 1ID5H 4IN1A 4FUDA 2ZU3A 3PWCA 1KDQB 1P02A 4Y6DA 3QUMP 2BLQA 1ELVA 1QJ6B 5IDKA 3B9FH 1ESBA 2HNTC 1TMUH 3ZVEA 1YP9A 1EPTC 1FLEE 1P9SA 4X8VH 3F9FA 1TPOA 3SBKA 4ISIH 3V0XA 2XTTB 1UO6A 1SHYA 2A31A 2F9UA 4B75A 1DLKB 1ELTA 2F9BH 2JETB 4TWWA 4BAHB 5C20A 1VJ9U 1TNLA 3PMAB 2NU1E 4Y0ZE 1XMNB 3VGCB 3NKKA 5IYTA 1G3EA 4ABHA 1OYTH 5GPIB 5EU8A 2PV9B 1TWXB 4NA8A 1EOLA 1YPHE 1GJ7B 3STIA 2B7DH 1BIOA 1ELGA 3SHAH 3S9BA 4U30A 2GMTC 4CRAA 4JK5A 3ZZDA 3P8FA 4DJZB 1K21H 1GMCF 1QBVH 2GCHF 5FPYA 2H5CA 2BVXH 3T28A 2J38A 4NFFA 1JIRA 2G4TA 1MD7A 1SLXB 3AASA 3ZZBA 2WPJS 4R0IA 4I8GA 1Z8RA 5EXMA 3MOCA 1ZSKA 1NN6A 2C4FH 2THFB 4K3JA 1Q2WA 4BAKB 1G30B 5EOKA 3SU2A 3ZVDA 1DWDH 4MNYA 2A2QH 2ZA5A 1WUNH 2EI6A 2PSYA 3E6PH 4D9QA 1FXYA 1DM4B 1NFUA 1FPCH 2ZPRA 2AEIH 1V2QT 1ZYOA 4WWYA 3LOXA 3DA9B 1C5NH 2ZFFH 1AFQB 4INKA 3E3TA 1Y5UT 2ZDAH 3ELAH 2WYGA 2QY0B 3VFEA 4SGBE 1LVMA 2BY7X 1TOCB 2FM2A 5TCAA 3LJOA 1GBLA 3KNXA 1VITG 5L2ZH 5GJ4B 5DP9A 1ZTLA 1KTTB 1ZHMA 4XBCA 2BLVA 2DE9A 1EAUA 4FUHA 2ZHQH 1T8OA 1ZPBA 3LGIA 2FS9A 3KN2A 1KLTA 1HXEH 1HXFH 3PLPA 4IN2A 4VGCB 2BQWB 4X2VA 4BNRA 2Y7XA 1P01A 1O3BA 2VIQA 4OS7A 2OTVA 1DWEH 4H42U 2FI3E 3UNRA 2OXSA 3GYLB 1K1IA 3ZZ6A 1G3BA 4UDWH 2BX3A 3UIRA 2EEKA 2GCTB 1TNKA 1GI8B 3D62A 1EX3A 2XBVA 2PKAB 2O8WA 4IC5A 3MH5A 1GL0E 1K22H 8KME2 5EODA 3VB7A 2Y5HA 5GXPA 2PGBB 2BD4A 2ZO3H 2WPHS 4YZUA 3RLYH 1MCTA 1ZMLA 4A92A 3GY3A 4Y7AA 4I7YH 4MPXA 1Y3VA 1GMCG 1S82A 2GCHG 4U2WA 1O2NA 4Y8YA 2AH4X 3ZZAA 4JZFH 3BTTE 3VXFH 1BHXB 1HPGA 4OS4A 1T31A 2ODYB 2ZG0H 1DY8A 2GZ9A 1QGFA 1C4Y2 1JIMA 1SGTA 1SQTA 4WH6A 1UTKA 1O2RA 2TBSA 4WXVA 1AWHB 2FOEA 3OY6U 2TPIZ 2OC0A 4GUXA 1O3JA 2JH6D 1MUEB 1CT0E 4JZEH 1FNIA 1LPKB 1F0RA 3ZVCA 1GCTB 1JMOH 2QCYA 3UR6A 4YM9A 5JBBS 1RFNA 3ZVBA 3A87A 1GBHA 3BG4C 3GDUA 4CR9A 2FOBA 2QAAA 1EB2A 5EXLA 1THSH 5T3HA 1P03A 2BZ6H 4CBOA 1HJAC 1KXCA 7GCHF 2Q1JA 4JYUH 3Q77A 4DOQA 3F6UH 3SN8A 2BDHA 1OXGA 2PR3A 4AN7A 2A5KA 1YPHC 3RU4D 2VINA 1P57B 3PO1C 4LK4A 1SQOA 3F9GA 2C8YB 3U8TH 1TBRH 1CU1A 1WSSH 2SGEE 2IOTA 1H9LB 1QRWA 1BRUP 2B9LA 3A8BA 4BAMB 1YM0A 2F9OA 3M5NA 3MU8A 1MTWA 1UVTH 2BXUH 2G5VA 3SNAA 1Y5BT 3A7WA 2ZFTA 1FUJA 1FAKH 1KY9A 1HAZB 4B76A 5LPFA 1NRQH 1K1JA 2FX4A 1RTKA 3ENSB 3B23B 3FVFB 2FESH 1IQLA 3HKJB 1C2DA 1C4V2 1TNIA 2WV4A 3NXPA 1MKWK 1EP6A 3Q76A 3UWIA 3EA9A 1EB1H 2Z3CA 4BXWA 1NFYA 2NU3E 1P3CA 1P2KA 3NPSA 3ZVGA 1GG6C 1N8OB 1S5SA 1ACBE 3TK5A 1JXPA 1Z6JH 5J4SA 5AHGH 3MO9A 3SUEA 2UWPA 2ZDLA 4CREA 1C4U2 2VIOA 1UHBB 1G2MA 7ESTE 1NTPA 1DPOA 3TLOA 2OLGA 1Y3WA 4KTUA 2OCVB 2ZCLP 1D3QB 1PFXC 4D7FA 1D6RA 1RS0A 2Y7ZA 1QTFA 2VWLA 2BQ7B 1AE8H 4D7GA 2FI5E 1ZPZA 3AAVA 1V2OT 3LH3A 3SU5A 3BTWE 1MKXK 3HATH 1DS2E 5T6DA 2BDBA 4A1XA 1ELCA 3G01A 1PJPA 3SNCA 3M7QA 6LPRA 1O5EH 1V2ST 5DP4A 5EW1H 1K1LA 1V2JT 1TYNA 1GJCB 1TPAE 1NROH 3UQVA 1CSOE 1C5QA 2F83A 4ZKSU 3ATKA 2C93B 3TIUA 1VGCC 3Q3YA 4TYDA 5CMXH 2M5TA 2V6NA 1ETTH 1O5BB 1DXPA 5A0AE 2RCEA 1IQIA 3GCOA 1IAUA 3NCLA 4AG1A 3ZVAA 1VZQH 1HAYB 4OS6A 3SUFA 3T2NA 1O2UA 3MU4A 1IQHA 1C2KA 5EXNA 1QA7A 3GCNA 1SC8U 1AVGH 4ZROA 5A8YA 2HNTE 3LGUA 4YT7H 1MMJN 3QGNB 4Y11E 3BSQA 2Z9GA 2Y81A 3QTOH 4I33A 2PUQH 1DT2A 1J14A 3MYWA 1GI2A 5T6GA 1TQ0B 2Z3DA 1ARBA 1O2TA 3KEEA 1C1SA 1Z8IB 3MWIU 1P2OA 4ZUHA 1ANBA 1MU6B 3PV4A 3M7TA 3SU4A 1FN8A 4Y76A 1T32A 1XUJA 4ZH8A 1C1WH 3GY4A 3GDVA 4YLUA 2WPIS 4E7NA 3ZZ9A 2G55A 4DURA 2BY6X 4GPGA 1A1RA 1HJ8A 3S9AA 1D3PB 4R8TB 2ANWA 3A80A 1NT1A 1DWBH 3T29A 5EW2H 2AIQA 4CH8B 2A4QA 2ZFPH 3IG6B 2R3YA 8GCHG 1CT4E 1BTXA 4IGDA 1C2GA 2FXRA 4B73A 2ZCHP 1ZZZA 5FPSA 1FY4A 2J95A 2PTNA 1KXFA 1T4VH 3BV9B 1QRZA 5HM2A 3UUZA 3U1IB 1UMAH 1F7ZA 4LZ1H 1FN6A 2CF8H 3RXJA 2OP9A 1MU8B 1VGCB 3NUMA 1MTUA 2ODQA 5DK1A 1EUFA 1IHTH 2GV7A 4U32A 1SOTA 2BD5A 4X1QU 1GL1A 1NC6A 3KQEA 1C2FA 2YNAA 1GJBB 2A7CA 1TA2A 4FU9A 1ANCA 1OWDA 1WOFA 3F9EA 3KF2A 4XE4A 3W94A 1TGCA 1G37A 1SGRE 1XXDA 3V13A 5I25A 3A89A 5EGMA 3GISB 5DP8A 1LHGH 1B0FA 4E7RG 3R0FA 1O2QA 3UOPA 3A84A 2GZ7A 3RC4A 1MBMA 1GDNA 1E37B 1VCQA 3PMBB 3TJUA 1Y3YA 1BA8B 2FOCA 2Z94A 4ZKNU 2XC5A 3UOUA 3BEUA 5JBCS 1O3PB 4X1NU 5T6FA 2OC1A 2BHGA 2J94A 1O2HA 1K28D 1F0TA 3A88A 3T26A 2VIPA 4B1TA 4WJG2 4X1PU 2CN0H 3RXSA 3GYMA 2BDGA 2I6QA 6CHAC 2Q6GA 3RXEA 2BOHB 3GICB 5FAHA 2VVCA 3LDXH 3SU1A 4MPUA 1QL7A 1OWEA 1GBCA 1HCGA 1O31A 3SV8A 2R0LA 4ABGA 4ABEA 3BEFB 4I32A 1GJ5H 1IQGA 2SGFE 3NWUA 2ALPA 1XUIA 1KTSB 1A0JA 1YPJH 4DVAU 1A3BH 3GDSA 2HOBA 4FUBA 3MNXA 1NPMA 3LKWA 3QO6A 1O5DH 1DLEA 1TMTH 3PLBA 1EJAA 1T4UH 1P9UA 1HAIH 3TVJB 3P8NA 4K1TA 3LGTA 4CHAB 2CV3A 2ZEBA 1GBFA 1EZQA 1V2TT 2G51A 2GVFA 3RXQA 1MAXA 1A5GH 2XCFA 3A7TA 1VR1H 4CRFA 1MTNB 1SB1H 1FDPA 4B2BA 1GHYH 2ZCKP 4X2YA 2UUKB 3CENA 1G32B 1QQUA 4YT6H 4YOJA 1BMAA 1NS3A 1BRBE 1LKBA 1O2SA 1Q31A 3ZYEA 1AQ7A 2SGPE 1TX8A 1O2ZA 4MTBA 3LH1A 1EAIA 2ANKH 2F9NA 1S0QA 5PTPA 3UQOA 1SQAA 1P06A 4ABFA 3U1JB 1C9PA 1P12E 1BTWA 1ZTKA 4DG4A 1DITH 1A5HA 1C1QA 1P0SH 1FY3A 1HAVA 1DVAH 2B5TB 7LPRA 2ANYA 1UVSH 1SLWB 1LHDH 1W14U 2P59A 1Y59T 1O3HA 5E0GA 1H4WA 1HJ9A 4AYVB 3LIWA 1AUTC 2VIVA 3MTYA 1C2MA 1QL8A 1XKBC 3O8DA 1UK4A 1O5GH 4BANB 1BMLA 1OP8A 1GPZA 2FTLE 3VB4A 1BITA 1TALA 2FOGA 1C1PA 1O34A 1UCYK 2GKVE 1ESTA 2YOLA 1KXAA 1BTUA 2FEQH 1E34B 1F5RA 4MNVA 4NWLA 2ZQ1A 1XVOA 1HAXB 3OYPA 3QZQA 3N7OA 3RXKA 1AY6H 1DOJA 1NRPH 4IMQA 2VIDA 6ESTA 2Z9LA 3RU4E 1J16A 5BRRE 1HFDA 4WMEA 1JOUB 3PB1E 1ZMNA 2FZZA 1QQ4A 5C1YA 3KQDA 9LPRA 2ZFQH 4WVPE 1GGDB 2ZHEH 1SPJA 1QY6A 5TJXA 4VGCC 2D1JA 4FXGH 1EKBB 1KXDA 1C2EA 3RXVA 5C67A 5FX6A 1EPTB 3RXTA 4PROA 1GBAA 4HFPB 1GI1A 1AB9C 1MBQA 4D9RA 2KAIA 1TMBH 4KTCA 3FZDA 1UTQA 2BTCE 3MU1A 3RXPA 1BJVA 1GBKA 4JCNA 3T27A 1BTYA 1CBWB 1G2LA 3TK6A 2F9PA 4FU7A 1H8DH 2BY9X 5JBTA 1ELAA 1OOKB 3MNCA 4H6SB 3A82A 3URCA 2BVRH 2FP7B 3ZZ7A 3U98H 8LPRA 3SUGA 2PW8H 1TBZH 3SJKA 4MPWA 2OINA 2G8TA 4YTAA 4INLA 5F8ZA 1C5YB 2WUCA 2DUCA 1WAYB 1TA6A 5A0CA 1P04A 1SI5H 2B0FA 2QYIA 1JWTA 1TNGA 5JYIA 1O39A 5DGJA 1GGDC 2PHBA 5E8EH 3A8DA 2A4OA 1ZSJA 1THRH 1LQEA 4AGKA 1HAGE 3TNTA 5AFZH 1O38A 2CXVA 2BY5X 2PKSB 3EBNA 2OD3B 1ORFA 2ZDKA 2OC7A 3SGBE 2RG3A 1GWAA 1RD3B 4XFQA 2A7JA 2A5AA 3FP7E 1LO6A 5EQSA 2P94A 3M3TA 3A7YA 1XKAC 2A0QB 3S9CA 2O8LA 2P93A 1G3DA 1SGDE 2CMYA 3TH3H 3MH7A 1O2YA 3UPEA 2BDIA 3QWCH 1O3OA 1HJAB 2F9VA 2BDAA 2Y80A 4UFEH 2QXJA 1TRYA 1MZAA 1C1VH 1V2PT 1YLCA 3SOSA 1P8VC 1A4WH 5HM9A 5J4QA 3KGPA 1O2VA 1C1RA 2H9EH 3BTFE 4H6TA 2BLWA 2WYJA 2SGQE 1ARCA 1SGIB 4X1SU 2VVUA 5FBIA 3L6PA 1LMWB 1F5LA 3KL6A 4X8TH 5DP5A 1ZGIA 4NGAH 1UVPA 3M35A 4FUJA 4SGAE 4WF8A 1O2LA 2BDYA 1QA0A 2R2WU 3GCTF 1N6XA 2Q6DA 1HIAA 3BEIB 3K6YA 3BTGE 3KHVA 2J4IA 1LHFH 1QHRB 4UFGH 2XC0A 2G5NA 4JZ1A 4KGAA 3RXIA 5L6NH 4DGJA 1UHBA 1QJ7B 1QB9A 2C8ZB 2P95A 1AO5A 1O0DH 1VCWA 3BIVH 2K7XA 1SGFA 4JYTA 4NCYA 1BBRE 1MQ5A 4YOIA 1FY1A 1MKWH 1QR3E 4M7GA 1C2LA 1ELFA 2ZGXH 3B8JA 3AW0A 3TU7H 1W12U 1V2RT 3H5CB 1GCDA 1Q3XA 3EDXB 4OGYA 3SV7A 4XDEA 4X1RU 2BVSH 5LH8A 3UY9A 3PO1B 3SGQE 5C5OA 3SJ8A 1S84A 5A0BA 1QURH 5ESBA 3EYDA 5EG4A 2RA0A 4YESB 2UWLA 3EQ0H 5B6OA 4GLYA 4MPVA 3RXOA 1K1NA 2GZ8A 1SBWA 1BJUA 1YBWA 1HLTH 1RRKA 1RIWC 3I29A 1XM1A 3GOVB 3QZRA 1CA0C 4UEHH 1W2KH 1XUGA 2H6MA 3F68H 2HPPH 3FFGA 2BD2A 2AGIX 1DX5M 1O30A 3CS7A 2FOHA 1LPGB 3A8AA 1O2KA 1NY22 1JRSA 2K1QA 3SUDA 1MZDA 1NFWA 1SSXA 2I6SA 3TJNA 5LGOA 1BT7A 2NU4E 4RN6A 2VVVA 3ODFA 4AGJA 4HI3A 1Z6EA 1AI8H 1CHOF 1QFKH 2GV6A 2PFEA 2A7HA 2UWOA 3MU5A 3ITIA 3K6ZA 1EOJA 4ZXYH 1P2NA 1FY8E 1O3CA 1PYTC 1NO9H 1GJAB 2ZDNA 4O9VA 1G9IE 1WQSA 1QRXA 1EXFA 1DDJA 1OPHB 3A81A 4D76A 1KLIH 1SG8B 1SLUB 1W3CA 1HAPH 2OQUA 1TGTA 1EAWA 3KQCA 3DFLA 4BOHA 1P05A 1XX9A 1PPBH 3D65E 2R3UA 4CRBA 2BOKA 1A0LA 4JZDH 5FCRA 3AVZA 3MO3A 1HIAB 1OWIA 3ATWA 2P3TB 3A7VA 5HYOA 2FLBH 1AN1E 2H1UA 3PM3A 3RC5A 1WV7H 4GCHF 4NIXA 3S7HB 3QK1A 1A2CH 1CQQA 3D49H 2R9PA 2AIPA 2ODPA 1HRTH 2ZF0H 1ZHPA 2D8WA 2EC9H 1L1JA 4THNH 2BMGB 4AFSA 1V2WT 5LPEA 1Z8GA 2XBWA 1EZSC 1C1OA 2BZAA 3OSYA 2D2DA 1YYY1 5ESTE 3RMOH 2Z9IA 2AYWA 2FX6A 1BBRK 1C5WB 3JZ1B 1TB6H 2WV5A 5E0HA 3T62A 1IOEA 4ASHA 3RP2A 4K69A 1YPKH 4A1VA 1EASA 4I8HA 3RMNH 1HAOH 5FBEA 2V3OH 2FWWA 2ZNKH 3LGYA 1OKXA 4O3TA 1F0UA 1LHCH 1O3KA 1UTLM 3EA8A 4K1EA 5HXFA 4BTIB 1C2HA 4K8BA 1U6QA 4FU8A 3P70B 2VGCB 5C3NA 1C5MD 3VXEH 3E1XB 2G00A 3OX7U 4NIVA 1GHXH 1ANEA 2JKHA 2VJ1A 1A5IA 1P09A 1UTOA 1UVUH 2J34A 2Z6BD 2ZGBH 5FX5A 5EQRA 2AMDA 4ABBA 2O8UA 2P3FH 4HZHA 1VCPA 2AFQB 2VWMA 3H7TA 2P8OC 4ABIA 3SNBA 5HMAA 3MH4A 4FVBA 4BAQB 4BTTB 2AMPA 3E8LA 5DP6A 3TGIE 4IBLH 3RMMH 4O03A 1LKAA 1W0ZU 2GD4B 3E90B 1ZGVA 2Z3EA 3GCTG 3P8GA 1O36A 3E0NB 2HPQH 2AERH 2ZKSA 3GY2A 1TPPA 1BRCE 1HBTH 2OBQA 2HALA 4ABAA 1S0RA 1FONA 1UK2A 2BB4A 1AGJA 1O3EA 2VGCC 2W7UA 2O9QA 2UUJB 1YPLH 1XXFA 3KIDU 2PSXA 5C1XA 1UTNA 2W3KA 4AOQA 1J15A 1C1NA 1OSSA 3NZIA 6CHAB 3P8OA 1QIXB 2FYRA 3RXAA 5A8ZA 3S0NA 2XXLA 2ULLA 3L3TA 1D3DB 2OC8A 3TK9A 5BPEA 4ZKOU 2A4RA 3ZZCA 2LIZA 3CS0A 1IQNA 3K65B 5CE1A 3EAJA 3ATLA 2ZP0H 3LT3A 1O2OA 3E91A 3QLPH 4A6LA 4I8JA 2FMJA 1TBQH 2ZTZA 1GJ8B 3F1SB 3LGWA 1WU1A 5H4IB 2XBYA 1EZUC 1B0EA 3QN7A 3LONA 3RXCA 1GVKB 1XUHA 4QT8C 2Z9KA 1H9HE 3E16B 3M3VA 4K2YA 2QXIA 2GGVB 4FVDA 2FTMA 3KCGH 1TE0A 1ZSLA 2NU0E 4ZHLU 3LC5A 2XWBI 4J1YA 3QGJA 1V2NT 3HK6B 3QDZB 4LOYH 4BXSA 1J9CH 1ABJH 3BG8A 4YOGA 4F49A 3ZV9A 4E06H 1O3GA 2WINI 6GCHG 2C3SA 3SI4H 4E05H 1C5SA 2CF9H 2HLCA 1IQMA 1Z1IA 2FODA 4NZLA 3M5OA 3FANA 1E38B 5TCCA 3SHCH 2VIWA 4ISOA 3A8CA 4JK6A 3SJ9A 4CHAC 3O8CA 1UTJA 1SFIA 3O8RA 4X0WU 1TNJA 1PPGE 4JYVH 2G52A 5E2PA 5GCHF 2J92A 1F5KU 3LGVA 2ZDMA 2ZWLH 4ZKRU 2A4GA 2F91A 4MQAA 3URDA 4CRCA 2PWXA 5EPNA 1AKSA 1K1MA 4INHA 2DE8A 1JRTA 1GBJA 1AIXH 1OP2A 1W8BH 1C9TA 1O37A 2HVXA 4A5TS 5F8TA 1S85A 4GVUA 1W7XH 1GDQA 4B2AA 1P11E 3U69H 2BD9A 1GBDA 1O5FH 4XBDA 1CA0B 1SR5C 2QN5T 1GHVH 2H9TH 2SGDE 4KKDA 3EA7A 2IN2A 1BCUH 3RXLA 1AZ8A 3MNBA 3T25A 4AZ2B 4ZHAA 4TPYA 3ODDA 4XSKU 1TONA 4UONA 1TLDA 4K5ZA 4I8LA 4Q7YA 1OWHA 1FZZA 2QIQA 2V35A 1GMHG 1SFQB 4Q7ZA 1L0ZA 4AFUA 3FAOA 1PQ5A 4Y0YE 3C1KA 2J9NA 1AB9B 2SFAA 1S6FA 2CGAA 1YPMH 2HNTF 4FUGA 4NG9H 1EPTA 2ZFRH 3H7OA 4K60A 2Z9JA 1QB6A 1SL3A 5AFYH 4K8YA 1O33A 1ELDE 1GI4A 1BHXF 4OS2A 5EPYA 4BTUB 2ZTXA 2XYAA 1YKTA 1ZTJA 4LXBH 2ZDVH 1EAXA 1TABE 3BF6H 1PPZA 4Z6AH 3VPKA 1TRMA 1C5VA 5DJ7A 3QX5H 1S81A 2UUYA 1O3NA 2FIRH 1GHBG 2Y82A 1DY9A 4GSOA 2QXGA 1CHOG 1LVBA 2SNVA 2PLXA 3SQEE 2FS8A 3TH4H 1LHEH 3M61U 4IS5A 4WH8A 1P2QA 4TY6A 1CGIE 4RKJB 4DIIH 5ETXA 3S69A 1IQEA 1GJ6A 1RJXB 1SGEE 1SHHB 1OP0A 2W7SA 4MNWA 3TH2H 4MDSA 1NZQH 1D6WA 1O2WA 1T8MA 3DT0H 2WPMS 2BQ6B 3UWJH 1O35A 2GDEH 3SI3H 2GT8A 3BTKE 4DCDA 2BD7A 3RXGA 1C5ZB 4ISLA 3SJOA 4Y7BA 1QBOA 1PPEE 1V3XA 1VITF 2JH5D 1LVOA 1GI5A 1YPEH 4UFFH 5CHAB 1FJSA 1AKSB 2SGAA 3HPTB 3VB3A 3ATIA 4AYYB 1CT2E 3UNSA 8GCHF 4IMZA 1EZXC 5ABWA 5HGGA 2F3CE 1C1UH 4CH2B 1O3DA 1O2GH 4IW4E 2ZC9H 1QNJA 1HV7A 1V2UT 1RIWB 4X8UH 1TFXA 2Q6FA 1SGFG 3MH6A 5G4BA 7KMEH 3M5MA 1IHSH 4I31A 2WUBA 1J8AA 1BRAA 1CO7E 1X7AC 2VWOA 1DFPA 2QC2A 1L1NA 4NZQA 5C2ZA 4OS5A 1M9UA 1E35B 3GY7A 2WPLS 1F2SE 2P3UB 2XWAA 1O2IA 5GCHG 1EQ9A 2C8WB 3JZ2B 4HTCH 5LPRA 1UJ1A 2JH0D 1DSTA 2Y6TA 1BBRH 2V0BA 3BG4B 1BB0B 1CGJE 3I77A 2QA9E 1SGYE 1TAWA 1GHZA 4HGCA 4FUFA 4GCHG 2BM2A 4Y71A 1CGHA 2BX4A 3BTDE 4Q7XA 4Q80A 5C1UA 1B5GH 3SV2H 4KTSA 3ZV8A 3BN9A 3U8RH 1HUTH 1LPZB 2ZGCA 1TX7A 4CRDA 2G81E 2H2ZA 4GHTA 4A1TA 1GCTC 2VB0A 2QV1A 1B7XB 1Y5AT 1N1LA 5F03A 5JB8S 3MO6A 3ZZ5A 3PMJA 5JB9S 1TGBA 2UUFB 1XVMA 4MVNA 1TIOA 4X2WA 3Q3KA 2GT7A 4X6NA 5L2YH 3K9XB 4NIWA 4WMDA 1ZOMA 2FOMB 2A45B 3TPIZ 4TWYA 1IQKA 3A85A 1W13U 1T8NA 3RU4T 4AFQA 1RTFB 4Y8XA 4AB8A 1C1TA 1W7GH 1PQ7A 3KQBA 1C5UA 2XC4A 2EI7A 1T8LA 2PKAA 1P3EA 1MQ6A 1Z7KA
chains in the Genus database with same CATH superfamily
1NESE 1GHAG 2ZGHA 1NFXA 1V2VT 2AS9A 3UTUH 1YPGH 2LPRA 3SV6A 1HDTH 4RSPA 1C5XB 2Z7FE 1HYLA 2BD3A 3U28C 2GP9B 1WYKA 1XUKA 3EE0B 4U01A 5FL7D 2PKSC 1UVOA 1FMGA 1HB0B 3LJJA 4AG2A 1FIWA 3U9AH 3AAUA 3FP8E 1UK3A 4ABJA 2QF3A 1W10U 1INCA 2HGTH 1H8HD 1NRNH 1ZR0A 5EJ1A 4X6PA 3OTJE 1A0HB 3D23A 1GHWH 2VWNA 1YLDA 5FXLA 2XBXA 2CJIA 2HRVA 4AFZA 4A7IB 1SGNE 4H4FA 5E2OA 1WTGH 2YNBA 3RXFA 1GVLA 2B8OH 3TNSA 1AWFH 3TGKE 2NWNA 2AGGX 3ZZ3A 1V2KT 1UCYH 1ZHRA 1H1BA 3AW1A 4KELA 1WBGB 2EA3A 1L2EA 3PYHA 2QF0A 1D9IA 3BTQE 1IQJA 1ABIH 1W0YH 1LDTT 2NU2E 1YC0A 5DP3A 1O3IA 2AMQA 1K2I1 2YMSB 1AFQC 3K2UA 1O3AA 1O5CB 4ZXXH 2LNCA 5DKMA 1KLJH 1O5AB 2XNIA 3DD2H 3FP6E 3ZVFA 1GHAF 1GI0A 5CHAC 4X8SH 1IQFA 4B2CA 4JZIA 2C8XB 1E0FD 2JIZD 2O8TA 4OS1A 3UR9A 4Q63A 4NSVA 4MG3A 1V2LT 1GBIA 3OY5U 2W26A 3WWBA 1GMDF 2VBCA 3MHWU 1CA8B 1L1GA 1KSNA 2GMTB 1C5LH 2CK3D 1WTHD 2ZPQA 1OYQA 4ABDA 4AC9A 2FI4E 1TNHA 2IJD1 3SW2B 1GJDB 2BY8X 2XW9A 2ALVA 1YGCH 1TGSZ 4NFEA 1ZJKA 4NIYA 2JETC 4FUIA 3U8OH 4P00A 1TRNA 1WQVH 2ZHWH 1GHBF 3SZNA 2ZGJA 3SV9A 1BMNH 1GMDG 5FCKA 3A7ZA 1LQDB 3SNDA 3FZZA 3GCHB 9ESTA 1L4ZA 1BDAA 4NWKA 4DT7B 2ZECA 3PMHB 1YCPH 3P92A 4ZHMU 1ZLRA 2ZU2A 3IITA 3P95A 3PROA 2VU8E 3RMLH 3RXHA 1EATA 4CRGA 1Z1JA 1GJ9B 3VEQB 1AU8A 4NSYA 1A61H 1VJAU 1BOQA 2FOAA 3RXDA 5JPMH 4TPIZ 1YCPM 3Q00A 1AE5A 1FY5A 1ELBA 1GI7B 5A09A 5A8XA 1VITH 5FPTA 5FHTA 3MFJA 1K9OE 3PV5A 4IC6A 3SJIA 3PLKA 1O3FA 1V2MT 4AORA 3CP7A 3BTHE 1ESAA 2P16A 3T5FH 2FOFA 3DUXH 1CHGA 3M36A 1CBWC 2CHAB 2ZTYA 2J2UA 3BTEE 5I46H 1A7SA 1O3MA 1O2XA 1A3EH 1KXEA 1BTHH 1MCVA 5A2MH 1J17T 1QBNA 1ZRBA 1SGQE 1WCZA 2WPKS 4ISHH 4F4OC 2W6JD 4XOJA 2ZU4A 5GWZA 1CVWH 1CE5A 1PQ8A 2FDAA 3SU6A 2ZHDA 4J2YB 1AUJA 1QB1A 1N6YA 4RT0A 1ZPCA 5DO4H 4Q2KA 1K1OA 1FPHH 2KCOA 1DSUA 3HKIB 3SO3A 3ATMA 8ESTE 2TGPZ 1MH0A 1AHTH 2R0KA 3M37A 3RM0H 1SGPE 4CBNA 2OQ5A 4DY7B 1XUFA 1Y8TA 1NRSH 3OU0A 4Y8ZA 1MTVA 1P2IA 1ZJDA 1BTPA 3A83A 1EP5A 1C5OH 1EJNA 3W1EA 4AX9H 3A86A 3BTME 4UE7H 2STAE 3LPRA 1QL9A 1D4PB 3F2FA 4WY3A 2H5DA 2PUXB 4TY7A 3MI4A 3RM2H 3VGCC 1RGQA 1G36A 2OUAA 2D26C 3SORA 5SGAE 1OWKA 3SGAE 1F0SA 3NK8A 2AGEX 2ZFSA 1NRRH 1DXWA 2H9HA 2VH0A 2GTBA 1YF4A 4XBBA 3UNQA 5DP7A 3GY6A 4GHQA 5K0HA 5C5NA 1MTSA 4RKOB 3GY5A 4GAWA 2ILNA 1GMHF 2FLRH 2ZU5A 3WY8A 3V12A 4X6OA 5DSFA 2SNWA 2BXTH 1UTMA 1C5RA 1PPCE 1AFEH 1BUIA 1DICA 3BIUH 4UFDH 5AVDA 3P17H 1RXPA 1S83A 2KM0A 2RFKC 2J98B 1K1PA 1T7CA 5DG6A 1HGTH 1E36B 3MNSA 2R2MB 3C27B 2BLOA 4ZAEA 1C2JA 1LCYA 2A1DB 2VNTA 1AVWA 2JDID 2ANMH 1RTLA 1MKXH 2IJOB 3VB6A 1ZRKA 3MU0A 3Q3XA 1AVXA 2STBE 2OBOA 1MTNC 1V6DA 1F92A 1NBMD 3VB5A 1BMMH 1O2PA 1PPFE 4ISNA 4UD9H 3GY8A 1A46H 2ZHFH 1W0JD 2ZQ2A 3DSPA 1GVZA 1GBTA 1DUAA 4NA9H 4FUCA 1MD8A 3F0PA 1HAVB 2PGQB 3FKSD 1KDQA 1THPB 4Z0KA 1SLVB 2GCTC 3O8BA 4OGXA 3RXMA 3PTBA 3LU9B 1FQ3A 1TX6A 1AD8H 4Y79A 2KAIB 3ESTA 1SVPA 2P8OB 4FOUC 2A32A 4X6MA 4DW2U 3M3SA 1GI9B 1OS8A 2TRMA 3PTNA 4MNXA 1AMHA 1D3TB 3STJA 1C1MA 2WV9A 4O3UA 3E0PB 4X2XA 3L33A 4ESTE 1ETSH 3HGNA 3HK3B 5JBAS 1ZMJA 1HAHH 1K0HA 3W95A 3M7UA 1MAYA 1NU9A 1O3LA 1E1RD 3QTVH 1JBUH 1UW7A 3RLWH 1P10A 4KP0A 2EQNA 1COWD 1QJ1B 1TOMH 4F55A 2EI8A 2G4UA 3RDZA 3UFAA 2BD8A 1FI8A 1UCYE 1P2JA 2Y5GA 1Z8JB 2ZZUH 4D8NA 3EGKH 1O2MA 1UTPA 1G3CA 4FUEA 5DPAA 4BAOB 2ZPSA 2L74A 1S6HA 2BYAX 1GBBA 1DUEA 3GCHC 2O8MA 3I78A 4LZ4B 1DE7H 2C90B 3A7XA 3CNRA 5EQQA 2HWLB 2XNDD 1TGNA 3IWMA 2GX4A 3RC6A 2QGRA 1C2IA 4B71A 2GDDA 1QCPA 3M5LA 3ZZ8A 2ASUB 2WPDD 4YO9A 3FO8D 3DHKH 1AZZA 4O97A 4ZMAH 4K1SA 3TJOA 1O2JA 1FV9A 5JDUB 2HLDD 3S7KB 3DFJA 1LTOA 4WXIA 3V7TA 4B74A 3SQHE 4DIHH 3SU0A 3F9HA 1ANDA 2A2XH 1DANH 2IPQX 2Y5FA 1O32A 4MLFB 2IPHA 5GDSH 1ETRH 3ZZ4A 2BDCA 3RXBA 1BTZA 2ZI2H 2V3HH 4WMFA 5E0JA 2TGTA 1EJMA 1C5TA 1GI6A 2FPZA 4Q4LA 2XRCA 5GIBA 1ELEE 1PYTD 4XD7D 2XCNA 3ZIAD 1N8OC 4YXWD 2W3IA 1GBEA 5AF9H 2FO9A 1FAXA 2YMSC 2KCPA 1NM6A 2PTCE 4I8KA 3TGJE 1BZXE 1TQ7B 1OX1A 1H8IH 1KYNA 1C5PA 4YLQH 2ESTE 3SNEA 2QXHA 1W11U 2TIOA 1DWCH 1GG6B 4Y10E 3UREA 1P2MA 1LVYA 1FIZA 2FYQA 1L4DA 1SOZA 2RDEA 2A5IA 2TGAA 3LC3A 2ZIQH 3ZYDA 3HGPA 1TPSA 2TGDA 3PWBA 1NU7B 1Y3XA 3MMGA 5F6MA 4NA7A 3P6ZB 2VH6A 3TJVA 1GBMA 3TITA 1GJ4H 1SMFE 4AB9A 1NBME 5F8XA 1PQAA 1KXBA 2W5EA 3N99A 4JMYA 1GI3A 3SU3A 1H9IE 3RXUA 3SZEA 1BQYA 1OWJA 1GDUA 1YCPK 1KIGH 3DSOA 3RXRA 1PPHE 3V3MA 2F43B 4CR5A 2CHAC 3R3GB 1HNEE 2RA3A 2RDLA 1SGCA 5K7RA 6GCHF 2ZU1A 3RUOA 1Y3UA 7GCHG 2JJ2D 1Z71A 5L30H 1ID5H 4IN1A 4FUDA 2ZU3A 3PWCA 1KDQB 1E1QD 1P02A 4Y6DA 3QUMP 2BLQA 1ELVA 1QJ6B 5IDKA 3B9FH 1ESBA 2HNTC 1TMUH 3ZVEA 1YP9A 1EPTC 1FLEE 1P9SA 4X8VH 3F9FA 1TPOA 3SBKA 4ISIH 3V0XA 2XTTB 1UO6A 1SHYA 3PV2A 2A31A 2F9UA 2WSSD 4B75A 1DLKB 1ELTA 2F9BH 2JETB 4TWWA 4BAHB 5C20A 1VJ9U 1TNLA 1E79D 1H8ED 3PMAB 2NU1E 4Y0ZE 1XMNB 3VGCB 3NKKA 5IYTA 1G3EA 2KR7A 4ABHA 1OYTH 5GPIB 5EU8A 2PV9B 1TWXB 4NA8A 1EOLA 1YPHE 1GJ7B 3STIA 2B7DH 1BIOA 1ELGA 3SHAH 3S9BA 4U30A 2GMTC 4RT1A 3F0OA 4CRAA 4JK5A 4RI0A 3ZZDA 3P8FA 4DJZB 1K21H 1GMCF 1QBVH 2GCHF 5FPYA 2H5CA 2BVXH 3T28A 2J38A 4NFFA 1JIRA 2G4TA 1MD7A 1SLXB 3AASA 3ZZBA 2WPJS 4R0IA 4I8GA 1Z8RA 5EXMA 1FX0B 4B6EA 3MOCA 1ZSKA 1NN6A 2C4FH 2THFB 4K3JA 1Q2WA 4BAKB 1G30B 5EOKA 3SU2A 3ZVDA 1DWDH 4MNYA 2A2QH 2ZA5A 1WUNH 2EI6A 2PSYA 3E6PH 4D9QA 3PRBA 1FXYA 1DM4B 1NFUA 1FPCH 2ZPRA 2AEIH 1V2QT 1ZYOA 4WWYA 3LOXA 3DA9B 1C5NH 2ZFFH 1AFQB 4INKA 3E3TA 1Y5UT 1BMFD 2ZDAH 3ELAH 2WYGA 2QY0B 3VFEA 4SGBE 1LVMA 2BY7X 1TOCB 2FM2A 5TCAA 3LJOA 1GBLA 3KNXA 1VITG 5L2ZH 5GJ4B 5DP9A 1ZTLA 1KTTB 1ZHMA 4XBCA 2BLVA 2DE9A 1EAUA 4FUHA 2J5UA 2ZHQH 3KYFA 1T8OA 1ZPBA 3LGIA 2FS9A 3KN2A 1KLTA 1HXEH 1HXFH 3PLPA 4IN2A 4VGCB 2BQWB 4X2VA 4BNRA 2Y7XA 1P01A 1YY3A 1O3BA 2VIQA 4OS7A 2OTVA 1DWEH 4H42U 2FI3E 3KYGA 2OXSA 3UNRA 3GYLB 1K1IA 3ZZ6A 1G3BA 4UDWH 2BX3A 3UIRA 2EEKA 2GCTB 1TNKA 1GI8B 3D62A 1EX3A 2XBVA 2PKAB 2O8WA 4IC5A 3MH5A 1GL0E 1K22H 8KME2 5EODA 3VB7A 2Y5HA 5GXPA 2PGBB 2BD4A 2ZO3H 2WPHS 4YZUA 3RLYH 1MCTA 1ZMLA 4A92A 3GY3A 4Y7AA 4I7YH 4MPXA 1Y3VA 1GMCG 1S82A 2GCHG 4U2WA 1O2NA 4Y8YA 2AH4X 3ZZAA 3GS9A 4JZFH 3BTTE 3VXFH 1BHXB 1YWUA 1HPGA 4OS4A 1T31A 3F3BA 2ODYB 2ZG0H 1DY8A 2GZ9A 1QGFA 1C4Y2 1JIMA 1SGTA 1SQTA 4WH6A 1UTKA 1O2RA 2TBSA 4WXVA 1AWHB 2FOEA 3OY6U 2TPIZ 2OK5A 2OC0A 4GUXA 1O3JA 5T1VA 2JH6D 1MUEB 1CT0E 4JZEH 1FNIA 1LPKB 1F0RA 3ZVCA 1GCTB 1JMOH 2QCYA 3UR6A 4YM9A 5JBBS 1RFNA 3ZVBA 2JJ1D 3A87A 1GBHA 3BG4C 3GDUA 4CR9A 2FOBA 2QAAA 1EB2A 5EXLA 1THSH 5T3HA 3FOAA 1P03A 2BZ6H 4CBOA 1HJAC 1KXCA 7GCHF 2Q1JA 4JYUH 3Q77A 4DOQA 3F6UH 3SN8A 2BDHA 1OXGA 2PR3A 4AN7A 2A5KA 1YPHC 4HG6A 3RU4D 2VINA 2WHXA 1P57B 3PO1C 4LK4A 1SQOA 3F9GA 2C8YB 3U8TH 1TBRH 1CU1A 1WSSH 2SGEE 2IOTA 4M9FA 1H9LB 1QRWA 1BRUP 2B9LA 3A8BA 4BAMB 1YM0A 2F9OA 3M5NA 3MU8A 1MTWA 1UVTH 2BXUH 2G5VA 3SNAA 1Y5BT 3A7WA 2ZFTA 1FUJA 1FAKH 1KY9A 1HAZB 4B76A 5LPFA 1NRQH 1K1JA 2FX4A 1RTKA 3ENSB 3B23B 3FVFB 2FESH 3UB0A 1IQLA 3HKJB 1C2DA 3WWFA 1C4V2 1TNIA 2WV4A 3NXPA 1MKWK 1EP6A 3Q76A 3UWIA 3EA9A 1EB1H 2Z3CA 4BXWA 1NFYA 2NU3E 1P3CA 1P2KA 3NPSA 3ZVGA 1GG6C 1N8OB 1S5SA 1ACBE 3TK5A 1JXPA 1Z6JH 5J4SA 5AHGH 3MO9A 3SUEA 2UWPA 2ZDLA 4CREA 1C4U2 2VIOA 1UHBB 1G2MA 7ESTE 1NTPA 3OTPA 1DPOA 3TLOA 2OLGA 1Y3WA 4KTUA 2OCVB 2ZCLP 1D3QB 1PFXC 4D7FA 1D6RA 1RS0A 2Y7ZA 5C17A 1QTFA 2VWLA 2BQ7B 1AE8H 4D7GA 2FI5E 1ZPZA 3AAVA 1V2OT 3LH3A 3SU5A 3BTWE 1MKXK 3HATH 4P02A 1DS2E 5T6DA 2BDBA 4A1XA 1ELCA 3G01A 1PJPA 3SNCA 3M7QA 6LPRA 1O5EH 1V2ST 5C0TA 5DP4A 5EW1H 1K1LA 1V2JT 1TYNA 1GJCB 1TPAE 1NROH 4OM9A 3UQVA 1CSOE 1C5QA 2F83A 1YLNA 4ZKSU 3ATKA 2C93B 3TIUA 1VGCC 3Q3YA 4TYDA 5CMXH 2M5TA 2V6NA 1ETTH 1O5BB 1DXPA 5A0AE 2RCEA 1IQIA 3GCOA 1IAUA 3NCLA 4ZCNA 4AG1A 3ZVAA 1VZQH 1HAYB 4OS6A 3SUFA 3T2NA 1O2UA 3MU4A 1IQHA 1C2KA 5EXNA 1QA7A 3GCNA 1SC8U 1AVGH 4ZROA 5A8YA 2HNTE 3LGUA 3OE7D 4YT7H 1MMJN 3QGNB 4Y11E 2WZQA 3BSQA 1OHHD 2Z9GA 2Y81A 3QTOH 4I33A 2PUQH 1DT2A 1J14A 3MYWA 1GI2A 5T6GA 1TQ0B 2Z3DA 1ARBA 4Z1MD 1O2TA 3KEEA 1C1SA 3MQKC 1Z8IB 3MWIU 1P2OA 4ZUHA 1ANBA 1MU6B 3PV4A 3M7TA 3SU4A 1FN8A 4Y76A 1T32A 1XUJA 4ZH8A 1C1WH 3GY4A 3GDVA 4YLUA 2WPIS 4E7NA 3ZZ9A 2G55A 4DURA 2BY6X 4GPGA 1A1RA 1HJ8A 2K8IA 3S9AA 1D3PB 4R8TB 2ANWA 3A80A 1NT1A 1DWBH 3T29A 5EW2H 2AIQA 4CH8B 2A4QA 2ZFPH 3IG6B 2R3YA 8GCHG 1CT4E 1BTXA 4IGDA 1C2GA 2FXRA 4B73A 2ZCHP 1ZZZA 5FPSA 1FY4A 2J95A 2PTNA 1KXFA 1T4VH 3BV9B 1QRZA 5HM2A 3UUZA 3U1IB 1UMAH 1F7ZA 4LZ1H 1FN6A 2CF8H 3RXJA 2OP9A 1MU8B 1VGCB 3NUMA 1MTUA 2ODQA 5EIYA 5DK1A 1EUFA 1IHTH 2GV7A 4U32A 1SOTA 2BD5A 4X1QU 1GL1A 1KMHB 1NC6A 3KQEA 1C2FA 2YNAA 1WDIA 1GJBB 2A7CA 1TA2A 4FU9A 1ANCA 1OWDA 1WOFA 3F9EA 3KF2A 4XE4A 3W94A 1TGCA 1G37A 1SGRE 1XXDA 3V13A 5I25A 3A89A 4TSFD 5EGMA 3GISB 5DP8A 1LHGH 1B0FA 4E7RG 3R0FA 1O2QA 3UOPA 3A84A 2GZ7A 3RC4A 1MBMA 1GDNA 1E37B 1VCQA 3PMBB 3TJUA 1Y3YA 1BA8B 5HIYA 2FOCA 2QE7D 2Z94A 4ZKNU 2XC5A 3UOUA 3BEUA 5C0UA 1O3PB 5JBCS 4X1NU 5T6FA 3DCLA 2OC1A 2BHGA 2J94A 1O2HA 1K28D 1F0TA 3A88A 3T26A 2VIPA 4B1TA 4WJG2 4X1PU 3OFND 2CN0H 3RXSA 3GYMA 2BDGA 2I6QA 6CHAC 2Q6GA 3RXEA 2BOHB 3GICB 5FAHA 2VVCA 3LDXH 3SU1A 4MPUA 1QL7A 1OWEA 1GBCA 1HCGA 1O31A 3SV8A 2R0LA 4ABGA 2KCAA 2HVYB 4ABEA 3BEFB 4I32A 1GJ5H 1IQGA 2SGFE 3NWUA 2KX4A 2ALPA 1XUIA 1KTSB 1A0JA 1YPJH 4DVAU 1A3BH 3GDSA 2HOBA 4FUBA 3MNXA 1NPMA 3LKWA 3QO6A 1O5DH 1DLEA 1TMTH 3PLBA 1EJAA 1T4UH 1P9UA 1HAIH 3TVJB 3P8NA 4K1TA 3LGTA 4CHAB 2CV3A 2ZEBA 1GBFA 1EZQA 1V2TT 2G51A 2GVFA 3RXQA 1MAXA 1A5GH 2XCFA 3A7TA 1VR1H 4CRFA 1MTNB 1SB1H 1FDPA 4B2BA 1GHYH 2ZCKP 4X2YA 4ACAA 2UUKB 3CENA 1G32B 1QQUA 4YT6H 4YOJA 1QZ8A 1BMAA 1NS3A 1BRBE 1LKBA 1O2SA 1Q31A 4TT3D 3ZYEA 1AQ7A 2SGPE 1TX8A 1O2ZA 4MTBA 1VKYA 1EAIA 2ANKH 3LH1A 2F9NA 1S0QA 5PTPA 3UQOA 1SQAA 1P06A 4ABFA 3U1JB 1C9PA 1P12E 1BTWA 1ZTKA 3SYJA 4DG4A 1DITH 1A5HA 1C1QA 1P0SH 1FY3A 1HAVA 1DVAH 2B5TB 7LPRA 2ANYA 1UVSH 1SLWB 1LHDH 1W14U 2P59A 3FN8A 1Y59T 4XRNA 1O3HA 5E0GA 1H4WA 1HJ9A 4AYVB 3LIWA 1AUTC 2VIVA 3MTYA 1C2MA 1QL8A 1XKBC 3O8DA 1UK4A 1O5GH 4BANB 1BMLA 1OP8A 1GPZA 4ASUD 2FTLE 3VB4A 1BITA 1TALA 2FOGA 1C1PA 1O34A 1UCYK 2GKVE 1ESTA 2YOLA 1KXAA 1BTUA 2W6ID 2FEQH 5CHBA 1E34B 1F5RA 4MNVA 4NWLA 2KCYA 2ZQ1A 1XVOA 1HAXB 3OYPA 3QZQA 3N7OA 3RXKA 1AY6H 1DOJA 1NRPH 4IMQA 2VIDA 6ESTA 2Z9LA 3RU4E 1J16A 1S6LA 5BRRE 1HFDA 4WMEA 1JOUB 3PB1E 1ZMNA 2FZZA 1QQ4A 5C1YA 3KQDA 5B6LA 3OEED 9LPRA 2KFWA 2ZFQH 4WVPE 1GGDB 2ZHEH 1SPJA 1QY6A 5TJXA 4VGCC 2D1JA 4FXGH 1EKBB 1KXDA 1C2EA 3RXVA 5C67A 5FX6A 1EPTB 3RXTA 4PROA 1GBAA 4HFPB 1GI1A 1AB9C 1MBQA 4D9RA 2KAIA 1TMBH 4KTCA 3FZDA 1UTQA 2BTCE 3MU1A 3RXPA 1BJVA 1GBKA 4JCNA 3T27A 1BTYA 1CBWB 1G2LA 3TK6A 2F9PA 4FU7A 1H8DH 2AHME 2BY9X 5JBTA 1ELAA 1OOKB 3MNCA 4H6SB 3A82A 3URCA 2BVRH 2FP7B 3ZZ7A 3U98H 8LPRA 3SUGA 2PW8H 1TBZH 3SJKA 4MPWA 2OINA 2G8TA 4YTAA 4INLA 5F8ZA 1C5YB 2WUCA 2DUCA 1WAYB 1TA6A 5A0CA 1P04A 1SI5H 2B0FA 5EJLA 2QYIA 1JWTA 1TNGA 5JYIA 1O39A 5DGJA 1GGDC 2PHBA 5E8EH 3A8DA 2A4OA 1ZSJA 1THRH 1LQEA 4AGKA 1WXRA 1HAGE 3TNTA 1SKYE 5AFZH 1O38A 2CXVA 2BY5X 2PKSB 3EBNA 2OD3B 1ORFA 2ZDKA 2OC7A 3SGBE 2RG3A 1GWAA 1RD3B 4XFQA 2A7JA 2A5AA 3FP7E 1LO6A 5EQSA 2P94A 3M3TA 3A7YA 1XKAC 2A0QB 2J97A 3S9CA 2O8LA 2P93A 1G3DA 1SGDE 2CMYA 3TH3H 3MH7A 1O2YA 3UPEA 2BDIA 3QWCH 1O3OA 1HJAB 2F9VA 2BDAA 2Y80A 4UFEH 1TRYA 1MZAA 1V2PT 1C1VH 1YLCA 2QXJA 3SOSA 1P8VC 1A4WH 5HM9A 5J4QA 3KGPA 1O2VA 1C1RA 2H9EH 3BTFE 4H6TA 2BLWA 2WYJA 2SGQE 1ARCA 1SGIB 4X1SU 2VVUA 5FBIA 3L6PA 1LMWB 1F5LA 3KL6A 4X8TH 5DP5A 1ZGIA 4NGAH 1UVPA 3M35A 4FUJA 4SGAE 4WF8A 1O2LA 2BDYA 1QA0A 2R2WU 3GCTF 1N6XA 4F48B 2Q6DA 1HIAA 3BEIB 3K6YA 3BTGE 3KHVA 2J4IA 1LHFH 3WW7A 1QHRB 4UFGH 1SQRA 2XC0A 2G5NA 4JZ1A 4KGAA 3RXIA 5L6NH 4DGJA 1UHBA 1QJ7B 1QB9A 2C8ZB 2P95A 1AO5A 1O0DH 1VCWA 3BIVH 2K7XA 1SGFA 4JYTA 4NCYA 1BBRE 1MQ5A 4YOIA 1FY1A 1MKWH 1QR3E 4M7GA 1C2LA 1ELFA 2ZGXH 3B8JA 3AW0A 3TU7H 3F2HA 1W12U 1V2RT 3H5CB 1GCDA 1Q3XA 3EDXB 4OGYA 3SV7A 4XDEA 4X1RU 2BVSH 5LH8A 3UY9A 3PO1B 3SGQE 5C5OA 3SJ8A 1S84A 5A0BA 1QURH 5ESBA 3EYDA 5EG4A 2RA0A 4YESB 3UAIC 2UWLA 3EQ0H 5B6OA 4GLYA 4MPVA 3RXOA 1K1NA 2GZ8A 1SBWA 1BJUA 1YBWA 1HLTH 1RRKA 1RIWC 3I29A 1XM1A 3GOVB 3QZRA 1CA0C 4UEHH 1W2KH 1XUGA 2H6MA 3F68H 2HPPH 3FFGA 2BD2A 2AGIX 1DX5M 1O30A 3CS7A 2FOHA 1LPGB 3A8AA 1O2KA 1NY22 1JRSA 2K1QA 3SUDA 1MZDA 1NFWA 1SSXA 2I6SA 3TJNA 5LGOA 1BT7A 2NU4E 4RN6A 2VVVA 2M2AA 3ODFA 4AGJA 4HI3A 1Z6EA 1AI8H 1CHOF 1QFKH 2GV6A 2PFEA 2A7HA 2UWOA 3MU5A 3ITIA 3K6ZA 1EOJA 4ZXYH 1P2NA 1FY8E 1O3CA 1PYTC 1NO9H 1GJAB 2ZDNA 4O9VA 1G9IE 1WQSA 1QRXA 5CDFE 1EXFA 1DDJA 3F2GA 1OPHB 3A81A 5KEDA 4D76A 1KLIH 1SG8B 1SLUB 3N7EA 1W3CA 1HAPH 2OQUA 1TGTA 1EAWA 3KQCA 3DFLA 4BOHA 1P05A 1XX9A 1PPBH 3D65E 2R3UA 4CRBA 3OEHD 2BOKA 1A0LA 4JZDH 5FCRA 3AVZA 3MO3A 1HIAB 1OWIA 3ATWA 2P3TB 3A7VA 5HYOA 2FLBH 1AN1E 2H1UA 3PM3A 3RC5A 1WV7H 4GCHF 4NIXA 3S7HB 3QK1A 1A2CH 1CQQA 3D49H 2R9PA 2AIPA 2ODPA 1HRTH 2ZF0H 1ZHPA 2D8WA 2EC9H 1L1JA 2XOKD 4THNH 2BMGB 4AFSA 1V2WT 5LPEA 1Z8GA 2XBWA 1EZSC 1C1OA 2BZAA 3OSYA 2D2DA 1YYY1 5ESTE 3RMOH 2Z9IA 2AYWA 2FX6A 1BBRK 1C5WB 3JZ1B 1TB6H 2WV5A 2QF4A 5E0HA 3T62A 5EJZA 1IOEA 4ASHA 4B6FA 3RP2A 3N7DA 4K69A 1YPKH 4A1VA 1EASA 2QF5A 4I8HA 2PP6A 3RMNH 1HAOH 5FBEA 2V3OH 2FWWA 2ZNKH 5HIZA 3LGYA 1OKXA 4O3TA 1F0UA 1LHCH 1O3KA 1UTLM 3EA8A 4K1EA 5HXFA 4BTIB 1C2HA 4K8BA 1U6QA 4FU8A 3P70B 2VGCB 3AK5A 2V3MA 5C3NA 1C5MD 3VXEH 3E1XB 2G00A 1MABB 3OX7U 1GHXH 1ANEA 4NIVA 2JKHA 2VJ1A 1A5IA 1P09A 1UTOA 1UVUH 2J34A 2Z6BD 2ZGBH 5FX5A 5EQRA 2AMDA 4ABBA 2O8UA 2P3FH 4HZHA 1VCPA 2AFQB 2VWMA 3H7TA 2P8OC 4ABIA 3SNBA 5HMAA 3MH4A 4FVBA 4BAQB 4BTTB 2AMPA 3E8LA 5DP6A 3TGIE 4IBLH 3RMMH 4O03A 1LKAA 1W0ZU 2GD4B 3E90B 1ZGVA 2Z3EA 3GCTG 3P8GA 1O36A 3E0NB 2HPQH 2AERH 2ZKSA 3GY2A 1TPPA 1BRCE 1HBTH 2OBQA 2HALA 4ABAA 1S0RA 1FONA 1UK2A 2BB4A 1AGJA 1O3EA 2VGCC 2W7UA 2O9QA 2UUJB 1YPLH 1XXFA 3KIDU 2PSXA 5C1XA 1UTNA 2V7QD 2W3KA 4AOQA 1J15A 1C1NA 1OSSA 3NZIA 6CHAB 3P8OA 1QIXB 2FYRA 3RXAA 5A8ZA 3S0NA 2XXLA 2ULLA 3L3TA 1D3DB 3H09A 2OC8A 3TK9A 5BPEA 4ZKOU 2A4RA 3ZZCA 2LIZA 3CS0A 1IQNA 3K65B 5CE1A 3EAJA 3ATLA 2ZP0H 3LT3A 1O2OA 3E91A 3QLPH 4A6LA 4I8JA 2FMJA 1TBQH 2ZTZA 1GJ8B 3F1SB 3LGWA 1WU1A 5H4IB 2XBYA 5IK2D 1EZUC 1B0EA 2J98A 3LONA 3QN7A 3RXCA 1GVKB 1XUHA 3PRDA 4QT8C 2Z9KA 1H9HE 3E16B 3M3VA 4K2YA 2QXIA 2GGVB 4FVDA 2FTMA 3KCGH 1TE0A 1ZSLA 2NU0E 4ZHLU 3LC5A 2XWBI 4J1YA 3QGJA 1V2NT 3HK6B 3QDZB 4LOYH 4BXSA 1J9CH 1ABJH 3BG8A 4YOGA 4F49A 3ZV9A 4E06H 1O3GA 2WINI 6GCHG 2C3SA 3SI4H 4E05H 2F4LA 1C5SA 2CF9H 2HLCA 1IQMA 1Z1IA 2FODA 4NZLA 5KECA 3M5OA 3FANA 1E38B 5TCCA 3SHCH 2VIWA 4ISOA 3A8CA 4JK6A 3SJ9A 4CHAC 3O8CA 1UTJA 1SFIA 3O8RA 4X0WU 1TNJA 1PPGE 4JYVH 2G52A 5E2PA 3EE7A 5GCHF 2J92A 1F5KU 3LGVA 2ZDMA 2ZWLH 4ZKRU 2A4GA 2F91A 3DSGA 4MQAA 3URDA 4CRCA 2PWXA 5EPNA 1AKSA 1K1MA 4INHA 2DE8A 1JRTA 2KZ4A 1GBJA 4DT4A 1AIXH 1OP2A 1W8BH 1C9TA 1O37A 2HVXA 4A5TS 5F8TA 1S85A 4GVUA 1W7XH 1GDQA 4B2AA 1P11E 3U69H 5C94A 2BD9A 1GBDA 1O5FH 4XBDA 1CA0B 1SR5C 2QN5T 1GHVH 2H9TH 2SGDE 4KKDA 3EA7A 2IN2A 1BCUH 3RXLA 1AZ8A 3MNBA 3T25A 4AZ2B 4ZHAA 4TPYA 3ODDA 4XSKU 5HKKD 1TONA 4UONA 1TLDA 4K5ZA 4I8LA 4Q7YA 1OWHA 1FZZA 2QIQA 2V35A 1GMHG 1SFQB 2YMSD 4Q7ZA 1L0ZA 4AFUA 3FAOA 1PQ5A 4Y0YE 3C1KA 2J9NA 1AB9B 2LELA 2SFAA 1S6FA 2CGAA 1YPMH 2HNTF 4FUGA 4NG9H 1EPTA 2ZFRH 3H7OA 3OAAD 4K60A 2Z9JA 1QB6A 1SL3A 5AFYH 4K8YA 1O33A 1ELDE 1GI4A 1BHXF 4OS2A 5EPYA 4BTUB 2ZTXA 2XYAA 1YKTA 1ZTJA 4LXBH 2ZDVH 1EAXA 1TABE 3BF6H 1PPZA 4Z6AH 3VPKA 1TRMA 1C5VA 5DJ7A 3QX5H 1S81A 2UUYA 1O3NA 2FIRH 1GHBG 2Y82A 1DY9A 4GSOA 2QXGA 1CHOG 1LVBA 2SNVA 2PLXA 3SQEE 1W0KD 2FS8A 3TH4H 1LHEH 3M61U 4IS5A 4WH8A 1P2QA 4TY6A 3KQ5A 1CGIE 4FETA 4RKJB 1EFRD 4DIIH 4I86A 5ETXA 3S69A 1IQEA 1GJ6A 1RJXB 1SGEE 1SHHB 1OP0A 2W7SA 4MNWA 3TH2H 4MDSA 1NZQH 1D6WA 1O2WA 1T8MA 3DT0H 2WPMS 2BQ6B 3UWJH 1O35A 2GDEH 3SI3H 2GT8A 3BTKE 4DCDA 2BD7A 3RXGA 1C5ZB 4ISLA 3SJOA 4Y7BA 1QBOA 1PPEE 1V3XA 1VITF 2JH5D 1LVOA 1GI5A 1YPEH 4UFFH 5CHAB 1FJSA 3NRLA 1AKSB 2SGAA 3HPTB 2LP6A 3VB3A 3ATIA 4AYYB 1CT2E 3UNSA 8GCHF 4IMZA 1EZXC 5ABWA 5HGGA 2F3CE 1C1UH 4CH2B 1O3DA 1O2GH 4IW4E 2ZC9H 1QNJA 1HV7A 1V2UT 1RIWB 4X8UH 1TFXA 2Q6FA 1SGFG 3MH6A 5G4BA 7KMEH 3M5MA 1IHSH 4ACBA 4I31A 2WUBA 5F53A 1J8AA 1BRAA 1CO7E 1X7AC 2VWOA 2K0QA 1DFPA 2QC2A 1L1NA 4NZQA 5C2ZA 4OS5A 1M9UA 1E35B 3GY7A 2WPLS 1F2SE 2P3UB 2XWAA 1O2IA 5GCHG 1EQ9A 2C8WB 3JZ2B 4HTCH 5LPRA 1UJ1A 2JH0D 1DSTA 2Y6TA 1BBRH 2V0BA 3BG4B 1BB0B 1CGJE 3I77A 2QA9E 1SGYE 1TAWA 1GHZA 4HGCA 4FUFA 5GNDA 4GCHG 5KGOA 2BM2A 4Y71A 5DN6D 1CGHA 2BX4A 3BTDE 4Q7XA 4Q80A 5C1UA 1B5GH 3SV2H 4KTSA 3ZV8A 3BN9A 3U8RH 1HUTH 1LPZB 2ZGCA 2GJGA 1TX7A 4CRDA 2G81E 2L6OA 2H2ZA 4GHTA 4A1TA 1GCTC 2VB0A 1B7XB 1Y5AT 2QV1A 1N1LA 5F03A 5JB8S 3MO6A 3ZZ5A 3PMJA 5JB9S 1TGBA 2UUFB 1XVMA 4MVNA 1TIOA 4X2WA 3Q3KA 2GT7A 4X6NA 5L2YH 3K9XB 4NIWA 4WMDA 1ZOMA 2FOMB 2A45B 2EY4C 3TPIZ 4TWYA 1IQKA 3A85A 1W13U 1T8NA 3RU4T 4AFQA 1RTFB 4Y8XA 4AB8A 1C1TA 1W7GH 1PQ7A 3KQBA 1C5UA 2XC4A 2EI7A 1T8LA 2PKAA 1P3EA 1MQ6A 3VG8A 1Z7KA
chains in the Genus database with same CATH topology
1NESE 1GHAG 2ZGHA 1NFXA 1V2VT 2AS9A 3UTUH 1YPGH 2LPRA 3SV6A 1HDTH 4RSPA 1C5XB 2Z7FE 1HYLA 2BD3A 2GP9B 1WYKA 1XUKA 3EE0B 4U01A 2PKSC 1UVOA 1FMGA 1HB0B 3LJJA 4AG2A 1FIWA 3U9AH 3AAUA 3FP8E 1UK3A 4ABJA 2QF3A 1W10U 1INCA 2HGTH 1NRNH 1ZR0A 4X6PA 3OTJE 1A0HB 3D23A 1GHWH 2VWNA 1YLDA 5FXLA 2XBXA 2CJIA 2HRVA 4AFZA 4A7IB 1SGNE 4H4FA 5E2OA 1WTGH 2YNBA 3RXFA 1GVLA 2B8OH 3TNSA 1AWFH 3TGKE 2NWNA 2AGGX 3ZZ3A 1V2KT 1UCYH 1ZHRA 1H1BA 3AW1A 4KELA 1WBGB 2EA3A 1L2EA 3PYHA 2QF0A 1D9IA 3BTQE 1IQJA 1ABIH 1W0YH 1LDTT 2NU2E 1YC0A 5DP3A 1O3IA 2AMQA 1K2I1 3K2UA 1AFQC 1O3AA 1O5CB 4ZXXH 2LNCA 5DKMA 1KLJH 1O5AB 2XNIA 3DD2H 3FP6E 3ZVFA 1GHAF 1GI0A 5CHAC 4X8SH 1IQFA 4B2CA 4JZIA 2C8XB 1E0FD 2O8TA 4OS1A 3UR9A 4NSVA 4MG3A 1V2LT 1GBIA 3OY5U 2W26A 1GMDF 3MHWU 1CA8B 1L1GA 1KSNA 2GMTB 1C5LH 2ZPQA 1WTHD 1OYQA 4ABDA 2FI4E 1TNHA 3SW2B 1GJDB 2BY8X 2XW9A 2ALVA 1YGCH 1TGSZ 4NFEA 1ZJKA 4NIYA 2JETC 4FUIA 3U8OH 1TRNA 1WQVH 2ZHWH 1GHBF 3SZNA 2ZGJA 3SV9A 1BMNH 1GMDG 5FCKA 3A7ZA 1LQDB 3SNDA 3FZZA 3GCHB 9ESTA 1L4ZA 1BDAA 4NWKA 4DT7B 2ZECA 3PMHB 1YCPH 3P92A 4ZHMU 1ZLRA 2ZU2A 3IITA 3P95A 3PROA 2VU8E 3RMLH 3RXHA 1EATA 4CRGA 1Z1JA 1GJ9B 3VEQB 1AU8A 4NSYA 1A61H 1VJAU 1BOQA 2FOAA 3RXDA 5JPMH 4TPIZ 1YCPM 3Q00A 1AE5A 1FY5A 1ELBA 1GI7B 5A09A 5A8XA 1VITH 5FPTA 5FHTA 3MFJA 1K9OE 4IC6A 3SJIA 3PLKA 1O3FA 1V2MT 4AORA 3CP7A 3BTHE 1ESAA 2P16A 3T5FH 2FOFA 3DUXH 1CHGA 3M36A 1CBWC 2CHAB 2ZTYA 2J2UA 3BTEE 5I46H 1A7SA 1O3MA 1O2XA 1A3EH 1KXEA 1BTHH 1MCVA 5A2MH 1J17T 1QBNA 1ZRBA 1SGQE 1WCZA 2WPKS 4ISHH 4F4OC 4XOJA 2ZU4A 5GWZA 1CVWH 1CE5A 1PQ8A 2FDAA 3SU6A 2ZHDA 4J2YB 1AUJA 1QB1A 1N6YA 1ZPCA 5DO4H 4Q2KA 1K1OA 1FPHH 1DSUA 3HKIB 3SO3A 3ATMA 8ESTE 2TGPZ 1MH0A 1AHTH 2R0KA 3M37A 3RM0H 1SGPE 4CBNA 2OQ5A 4DY7B 1XUFA 1Y8TA 1NRSH 3OU0A 4Y8ZA 1MTVA 1P2IA 1ZJDA 1BTPA 3A83A 1EP5A 1C5OH 1EJNA 4AX9H 3A86A 3BTME 4UE7H 2STAE 3LPRA 1QL9A 1D4PB 4WY3A 2H5DA 2PUXB 4TY7A 3MI4A 3RM2H 3VGCC 1RGQA 1G36A 2OUAA 2D26C 3SORA 5SGAE 1OWKA 3SGAE 1F0SA 3NK8A 2AGEX 2ZFSA 1NRRH 1DXWA 2H9HA 2VH0A 2GTBA 1YF4A 4XBBA 3UNQA 5DP7A 3GY6A 4GHQA 5K0HA 5C5NA 1MTSA 4RKOB 3GY5A 4GAWA 2ILNA 1GMHF 2FLRH 2ZU5A 3WY8A 3V12A 4X6OA 2SNWA 2BXTH 1UTMA 1C5RA 1PPCE 1AFEH 1BUIA 1DICA 3BIUH 4UFDH 5AVDA 3P17H 1RXPA 1S83A 1K1PA 1T7CA 5DG6A 1HGTH 1E36B 3MNSA 2R2MB 3C27B 2BLOA 4ZAEA 1C2JA 1LCYA 2A1DB 2VNTA 1AVWA 2ANMH 1RTLA 1MKXH 2IJOB 3VB6A 1ZRKA 3MU0A 3Q3XA 1AVXA 2STBE 2OBOA 1MTNC 1V6DA 1F92A 3VB5A 1BMMH 1O2PA 1PPFE 4ISNA 4UD9H 3GY8A 1A46H 2ZHFH 2ZQ2A 1GVZA 1GBTA 1DUAA 4NA9H 4FUCA 1MD8A 1HAVB 2PGQB 1KDQA 1THPB 4Z0KA 1SLVB 2GCTC 3O8BA 4OGXA 3RXMA 3PTBA 3LU9B 1FQ3A 1TX6A 1AD8H 4Y79A 2KAIB 3ESTA 1SVPA 2P8OB 2A32A 4X6MA 4DW2U 3M3SA 1GI9B 1OS8A 2TRMA 3PTNA 4MNXA 1AMHA 1D3TB 3STJA 1C1MA 4O3UA 3E0PB 4X2XA 3L33A 4ESTE 1ETSH 3HGNA 3HK3B 5JBAS 1ZMJA 1HAHH 3W95A 3M7UA 1MAYA 1NU9A 1O3LA 3QTVH 1JBUH 3RLWH 1P10A 4KP0A 1QJ1B 1TOMH 2EI8A 2G4UA 3RDZA 3UFAA 2BD8A 1FI8A 1UCYE 1P2JA 2Y5GA 1Z8JB 2ZZUH 4D8NA 3EGKH 1O2MA 1UTPA 1G3CA 4FUEA 5DPAA 4BAOB 2ZPSA 1S6HA 2BYAX 1GBBA 1DUEA 3GCHC 2O8MA 3I78A 4LZ4B 1DE7H 2C90B 3A7XA 5EQQA 2HWLB 1TGNA 3IWMA 2GX4A 3RC6A 2QGRA 1C2IA 4B71A 2GDDA 1QCPA 3M5LA 3ZZ8A 2ASUB 4YO9A 3DHKH 1AZZA 4O97A 4ZMAH 4K1SA 3TJOA 1O2JA 1FV9A 5JDUB 3S7KB 3DFJA 1LTOA 4WXIA 3V7TA 4B74A 3SQHE 4DIHH 3SU0A 3F9HA 1ANDA 2A2XH 1DANH 2Y5FA 1O32A 4MLFB 2IPHA 5GDSH 1ETRH 3ZZ4A 2BDCA 3RXBA 1BTZA 2ZI2H 2V3HH 4WMFA 5E0JA 2TGTA 1EJMA 1C5TA 1GI6A 2FPZA 2XRCA 5GIBA 1ELEE 1PYTD 2XCNA 1N8OC 2W3IA 1GBEA 5AF9H 2FO9A 1FAXA 1NM6A 2PTCE 4I8KA 3TGJE 1BZXE 1TQ7B 1OX1A 1H8IH 1KYNA 1C5PA 4YLQH 2ESTE 3SNEA 2QXHA 1W11U 2TIOA 1DWCH 1GG6B 4Y10E 3UREA 1P2MA 1LVYA 1FIZA 2FYQA 1L4DA 1SOZA 3LC3A 2A5IA 2TGAA 2ZIQH 3ZYDA 3HGPA 1TPSA 2TGDA 3PWBA 1NU7B 1Y3XA 3MMGA 5F6MA 4NA7A 3P6ZB 2VH6A 3TJVA 1GBMA 3TITA 1GJ4H 1SMFE 4AB9A 5F8XA 1PQAA 1KXBA 2W5EA 4JMYA 3SU3A 1GI3A 1H9IE 3RXUA 1BQYA 1OWJA 1GDUA 1YCPK 1KIGH 3RXRA 1PPHE 3V3MA 4CR5A 2CHAC 3R3GB 1HNEE 2RA3A 2RDLA 1SGCA 5K7RA 6GCHF 2ZU1A 3RUOA 1Y3UA 7GCHG 1Z71A 5L30H 1ID5H 4IN1A 4FUDA 2ZU3A 3PWCA 1KDQB 1P02A 4Y6DA 3QUMP 2BLQA 1ELVA 1QJ6B 5IDKA 3B9FH 1ESBA 2HNTC 1TMUH 3ZVEA 1YP9A 1EPTC 1FLEE 1P9SA 4X8VH 3F9FA 1TPOA 3SBKA 4ISIH 3V0XA 2XTTB 1UO6A 1SHYA 2A31A 2F9UA 4B75A 1DLKB 1ELTA 2F9BH 2JETB 4TWWA 4BAHB 5C20A 1VJ9U 1TNLA 3PMAB 2NU1E 4Y0ZE 1XMNB 3VGCB 3NKKA 5IYTA 1G3EA 4ABHA 1OYTH 5GPIB 5EU8A 2PV9B 1TWXB 4NA8A 1EOLA 1YPHE 1GJ7B 3STIA 2B7DH 1BIOA 1ELGA 3SHAH 3S9BA 4U30A 2GMTC 4CRAA 4JK5A 3ZZDA 3P8FA 4DJZB 1K21H 1GMCF 1QBVH 2GCHF 5FPYA 2H5CA 2BVXH 3T28A 2J38A 4NFFA 1JIRA 2G4TA 1MD7A 1SLXB 3AASA 3ZZBA 2WPJS 4R0IA 4I8GA 1Z8RA 5EXMA 3MOCA 1ZSKA 1NN6A 2C4FH 2THFB 4K3JA 1Q2WA 4BAKB 1G30B 5EOKA 3SU2A 3ZVDA 1DWDH 4MNYA 2A2QH 2ZA5A 1WUNH 2EI6A 2PSYA 3E6PH 4D9QA 1FXYA 1DM4B 1NFUA 1FPCH 2ZPRA 2AEIH 1V2QT 1ZYOA 4WWYA 3LOXA 3DA9B 1C5NH 2ZFFH 1AFQB 4INKA 3E3TA 1Y5UT 2ZDAH 3ELAH 2WYGA 2QY0B 3VFEA 4SGBE 1LVMA 2BY7X 1TOCB 2FM2A 5TCAA 3LJOA 1GBLA 3KNXA 1VITG 5L2ZH 5GJ4B 5DP9A 1ZTLA 1KTTB 1ZHMA 4XBCA 2BLVA 2DE9A 1EAUA 4FUHA 2ZHQH 1T8OA 1ZPBA 3LGIA 2FS9A 3KN2A 1KLTA 1HXEH 1HXFH 3PLPA 4IN2A 4VGCB 2BQWB 4X2VA 4BNRA 2Y7XA 1P01A 1O3BA 2VIQA 4OS7A 2OTVA 1DWEH 4H42U 2FI3E 3UNRA 2OXSA 3GYLB 1K1IA 3ZZ6A 1G3BA 4UDWH 2BX3A 3UIRA 2EEKA 2GCTB 1TNKA 1GI8B 3D62A 1EX3A 2XBVA 2PKAB 2O8WA 4IC5A 3MH5A 1GL0E 1K22H 8KME2 5EODA 3VB7A 2Y5HA 5GXPA 2PGBB 2BD4A 2ZO3H 2WPHS 4YZUA 3RLYH 1MCTA 1ZMLA 4A92A 3GY3A 4Y7AA 4I7YH 4MPXA 1Y3VA 1GMCG 1S82A 2GCHG 4U2WA 1O2NA 4Y8YA 2AH4X 3ZZAA 4JZFH 3BTTE 3VXFH 1BHXB 1HPGA 4OS4A 1T31A 2ODYB 2ZG0H 1DY8A 2GZ9A 1QGFA 1C4Y2 1JIMA 1SGTA 1SQTA 4WH6A 1UTKA 1O2RA 2TBSA 4WXVA 1AWHB 2FOEA 3OY6U 2TPIZ 2OC0A 4GUXA 1O3JA 2JH6D 1MUEB 1CT0E 4JZEH 1FNIA 1LPKB 1F0RA 3ZVCA 1GCTB 1JMOH 2QCYA 3UR6A 4YM9A 5JBBS 1RFNA 3ZVBA 3A87A 1GBHA 3BG4C 3GDUA 4CR9A 2FOBA 2QAAA 1EB2A 5EXLA 1THSH 5T3HA 1P03A 2BZ6H 4CBOA 1HJAC 1KXCA 7GCHF 2Q1JA 4JYUH 3Q77A 4DOQA 3F6UH 3SN8A 2BDHA 1OXGA 2PR3A 4AN7A 2A5KA 1YPHC 3RU4D 2VINA 1P57B 3PO1C 4LK4A 1SQOA 3F9GA 2C8YB 3U8TH 1TBRH 1CU1A 1WSSH 2SGEE 2IOTA 1H9LB 1QRWA 1BRUP 2B9LA 3A8BA 4BAMB 1YM0A 2F9OA 3M5NA 3MU8A 1MTWA 1UVTH 2BXUH 2G5VA 3SNAA 1Y5BT 3A7WA 2ZFTA 1FUJA 1FAKH 1KY9A 1HAZB 4B76A 5LPFA 1NRQH 1K1JA 2FX4A 1RTKA 3ENSB 3B23B 3FVFB 2FESH 1IQLA 3HKJB 1C2DA 1C4V2 1TNIA 2WV4A 3NXPA 1MKWK 1EP6A 3Q76A 3UWIA 3EA9A 1EB1H 2Z3CA 4BXWA 1NFYA 2NU3E 1P3CA 1P2KA 3NPSA 3ZVGA 1GG6C 1N8OB 1S5SA 1ACBE 3TK5A 1JXPA 1Z6JH 5J4SA 5AHGH 3MO9A 3SUEA 2UWPA 2ZDLA 4CREA 1C4U2 2VIOA 1UHBB 1G2MA 7ESTE 1NTPA 1DPOA 3TLOA 2OLGA 1Y3WA 4KTUA 2OCVB 2ZCLP 1D3QB 1PFXC 4D7FA 1D6RA 1RS0A 2Y7ZA 1QTFA 2VWLA 2BQ7B 1AE8H 4D7GA 2FI5E 1ZPZA 3AAVA 1V2OT 3LH3A 3SU5A 3BTWE 1MKXK 3HATH 1DS2E 5T6DA 2BDBA 4A1XA 1ELCA 3G01A 1PJPA 3SNCA 3M7QA 6LPRA 1O5EH 1V2ST 5DP4A 5EW1H 1K1LA 1V2JT 1TYNA 1GJCB 1TPAE 1NROH 3UQVA 1CSOE 1C5QA 2F83A 4ZKSU 3ATKA 2C93B 3TIUA 1VGCC 3Q3YA 4TYDA 5CMXH 2M5TA 2V6NA 1ETTH 1O5BB 1DXPA 5A0AE 2RCEA 1IQIA 3GCOA 1IAUA 3NCLA 4AG1A 3ZVAA 1VZQH 1HAYB 4OS6A 3SUFA 3T2NA 1O2UA 3MU4A 1IQHA 1C2KA 5EXNA 1QA7A 3GCNA 1SC8U 1AVGH 4ZROA 5A8YA 2HNTE 3LGUA 4YT7H 1MMJN 3QGNB 4Y11E 3BSQA 2Z9GA 2Y81A 3QTOH 4I33A 2PUQH 1DT2A 1J14A 3MYWA 1GI2A 5T6GA 1TQ0B 2Z3DA 1ARBA 1O2TA 3KEEA 1C1SA 1Z8IB 3MWIU 1P2OA 4ZUHA 1ANBA 1MU6B 3PV4A 3M7TA 3SU4A 1FN8A 4Y76A 1T32A 1XUJA 4ZH8A 1C1WH 3GY4A 3GDVA 4YLUA 2WPIS 4E7NA 3ZZ9A 2G55A 4DURA 2BY6X 4GPGA 1A1RA 1HJ8A 3S9AA 1D3PB 4R8TB 2ANWA 3A80A 1NT1A 1DWBH 3T29A 5EW2H 2AIQA 4CH8B 2A4QA 2ZFPH 3IG6B 2R3YA 8GCHG 1CT4E 1BTXA 4IGDA 1C2GA 2FXRA 4B73A 2ZCHP 1ZZZA 5FPSA 1FY4A 2J95A 2PTNA 1KXFA 1T4VH 3BV9B 1QRZA 5HM2A 3UUZA 3U1IB 1UMAH 1F7ZA 4LZ1H 1FN6A 2CF8H 3RXJA 2OP9A 1MU8B 1VGCB 3NUMA 1MTUA 2ODQA 5DK1A 1EUFA 1IHTH 2GV7A 4U32A 1SOTA 2BD5A 4X1QU 1GL1A 1NC6A 3KQEA 1C2FA 2YNAA 1GJBB 2A7CA 1TA2A 4FU9A 1ANCA 1OWDA 1WOFA 3F9EA 3KF2A 4XE4A 3W94A 1TGCA 1G37A 1SGRE 1XXDA 3V13A 5I25A 3A89A 5EGMA 3GISB