2GZ9A

Structure-based drug design and structural biology study of novel nonpeptide inhibitors of sars-cov main protease
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase polyprotein 1ab
publication title Structure-Based Drug Design and Structural Biology Study of Novel Nonpeptide Inhibitors of Severe Acute Respiratory Syndrome Coronavirus Main Protease
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 82
structure length 306
sequence length 306
ec nomenclature ec 3.4.22.-:
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2gz9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2gz9A02
1CSOE 2BDIA 1S82A 4B2AA 1TLDA 2GCTC 1UCYE 8ESTE 1V2QT 3BEFB 4VGCC 4CH2B 1UK3A 1BBRE 2GDDA 1MZDA 5GCHG 4LXBH 4CRFA 1JRSA 3MNBA 2ZU5A 1S6FA 3L6PA 5C1XA 1HAIH 1RFNA 2PUQH 4X1QU 2QXGA 1HAHH 1HLTH 1UVSH 3DA9B 1SLWB 3PWBA 1DE7H 1O2OA 3GY7A 1N8OB 2ZGJA 4X2XA 3NCLA 2BZ6H 1BJVA 1O38A 4BTTB 3BG4B 1HUTH 1O3OA 1O5DH 2OC8A 1K1OA 4WMEA 2FOBA 1GDNA 1QTFA 1MTNC 1C2DA 2BDHA 2VU8E 3U9AH 3VPKA 1DITH 1EP6A 1O2LA 1UK4A 2JETB 2BD4A 1DPOA 1DT2A 3H7OA 2C4FH 1ID5H 3AAUA 1SOTA 1CBWC 1Z8RA 1FXYA 1MCTA 4TPYA 3QGNB 1ABIH 1C1TA 3V13A 2PR3A 4YT6H 3FVFB 3FFGA 3RU4D 3LOXA 3E8LA 3RXCA 5DKMA 1PFXC 1GBDA 4Q7ZA 3NZIA 2G8TA 2A31A 2QXHA 1JIMA 1C2IA 2BY8X 1C5OH 1WAYB 5AFZH 1C1RA 1G3CA 4WXIA 5EXNA 3CS7A 1E0FD 4KELA 3SO3A 1O35A 4YLQH 1T8OA 3A8DA 3ITIA 2ZF0H 2JH5D 3SUFA 1ZPCA 2AYWA 1WTHD 4H6SB 2GCHG 2IJOB 4GVUA 5JDUB 3RDZA 3GCNA 1LVYA 1ELAA 3Q3XA 1UTOA 4Y0YE 5LPRA 3DT0H 1SQOA 4CBOA 4XSKU 3KEEA 4IBLH 3T2NA 3ZZ7A 1QCPA 3AVZA 1GBCA 2O8MA 1CE5A 3A8AA 5AFYH 4ZKNU 4A92A 1AB9B 1GI3A 1P2IA 1J17T 1L0ZA 1F5KU 1HAVB 1TALA 2QXIA 3RC6A 1C1QA 1WOFA 1ZHRA 1DM4B 4CRGA 4JK6A 2QV1A 2BOHB 5ESTE 1MU6B 3MO6A 3B9FH 1O31A 4M7GA 3RXPA 3TU7H 4IN1A 2GTBA 1DWEH 3S0NA 2ZU2A 4WH6A 1O2SA 1GDQA 3M37A 4OS1A 6GCHF 5T3HA 5JYIA 4TYDA 4X1NU 1JMOH 4JMYA 1O2XA 4A1TA 1LPKB 1C5YB 1C1PA 3E3TA 2LPRA 1EX3A 1QGFA 1C2FA 1TNJA 3ZZ5A 9ESTA 3BTHE 1HXEH 4YOGA 1N1LA 6LPRA 4ABJA 3MYWA 5BPEA 4F49A 3RXOA 4WY3A 3DD2H 1ZJDA 2Z9GA 3BTGE 1O36A 2ZKSA 3SV7A 1E37B 1QQ4A 1TYNA 1O3AA 2ALVA 1YF4A 3HK6B 5C1UA 3RXHA 2CN0H 1MMJN 2C8ZB 2FYRA 2Q1JA 3OX7U 4TY7A 3F9EA 3RLYH 1QFKH 5F8XA 4BTUB 2J4IA 2FESH 2HALA 1ZRKA 3TNSA 1ZYOA 3OY6U 1GWAA 1AVWA 5E2OA 4CRDA 1O39A 4XBBA 3T26A 3BF6H 3V12A 1Y3UA 2TRMA 3SNBA 1GBLA 3M36A 4Y8YA 2ZCLP 1AFQC 2WPMS 4FU7A 1CHOF 2BXTH 1ESTA 2OINA 2VGCB 3HGNA 3SI3H 2ZCHP 2P94A 1XMNB 3SU6A 1O37A 3GCTF 1LTOA 1L1JA 5H4IB 3RP2A 4MDSA 3N7OA 4WWYA 3FP6E 1ZLRA 3KCGH 1LHEH 4GLYA 1W2KH 1P12E 2ZGXH 1GHAF 4A1XA 4KTUA 1NS3A 1HPGA 1VITF 1UMAH 1P3CA 1QB6A 1EJMA 2VINA 5C67A 5TCAA 4OS7A 1SGFG 2A45B 1DXPA 3BTFE 4TY6A 1P06A 1OYQA 2P3TB 3QTOH 2B5TB 1O0DH 1VCQA 4DCDA 2VNTA 1XX9A 1C5TA 1KXBA 3U8OH 5E0HA 2R3UA 1TNGA 1H9IE 3GISB 2F9UA 2Y7XA 1W10U 4ZHAA 3FZDA 1ZMLA 1BRUP 3LC5A 4E06H 1TNKA 3BTDE 1TABE 3LGVA 1QY6A 1BMAA 1TBQH 3A81A 1BTXA 1MUEB 1KLJH 1J8AA 5GWZA 3F68H 4WXVA 4JZIA 2TPIZ 4CHAB 5BRRE 4UE7H 1YPGH 2ZIQH 3MU4A 1HJ8A 1AFEH 3ATIA 3SJ9A 2AFQB 1KIGH 2THFB 2CGAA 3I78A 1FY1A 1MQ6A 1QL7A 1H8IH 3RMMH 4U01A 4ESTE 1AMHA 5FPYA 3SQHE 4FUBA 1F5RA 2V3HH 4UFFH 3TGJE 1ETRH 1RIWC 1Z71A 1GG6B 1GI0A 3P92A 3URDA 1V2UT 1QRXA 2ZDNA 4ZROA 1XUFA 2BY9X 4ZXYH 4AB9A 2XYAA 2WUBA 3D49H 4HGCA 1TA2A 4MTBA 3VEQB 2ZZUH 2PTCE 5EW2H 1W13U 4I33A 1AVGH 3SJ8A 4NIVA 3VXEH 2BDCA 1K1JA 4D7FA 2ODPA 3RXAA 4LK4A 5EGMA 1CGIE 2H1UA 4ABFA 2GMTB 4UFGH 2XTTB 2BX4A 1W7XH 1N6XA 2V0BA 1TNIA 1PYTD 1O32A 2Z6BD 1P2QA 3UFAA 3M3SA 1GHWH 3SU5A 3EA8A 2SGPE 3MH5A 2ZGHA 1V2JT 2XWBI 1SSXA 4J1YA 1J14A 1GBEA 1OKXA 1OXGA 1C2GA 4BAKB 1OWEA 2BDBA 1EPTB 2WYJA 1P2OA 1CHGA 1KLIH 4YTAA 3T62A 3TITA 3ZZCA 2V6NA 2CF8H 4ISHH 4I8GA 4ISLA 4YOJA 1A3EH 1P2KA 1V2OT 3S9AA 3IITA 1UTNA 4CREA 3T28A 4K69A 1AKSB 1QA7A 4BAHB 2DUCA 5HXFA 2FI3E 2ZFFH 2FYQA 5DJ7A 5A8YA 1SMFE 2BQWB 1O2MA 1HB0B 4X2WA 2OUAA 3LGTA 1OP8A 1KSNA 1ESBA 1BUIA 4AGJA 1K21H 2D8WA 1T32A 1RTKA 3LT3A 4NZQA 4BXWA 1MH0A 2AERH 3H5CB 1D3TB 4CRBA 1ESAA 3GDUA 4AZ2B 1YPHE 3GYMA 5L30H 1GHZA 1BTPA 2HNTF 5A0BA 1GJ8B 3RC4A 1OYTH 1VZQH 2XW9A 1O3BA 2D1JA 2GT8A 2VIOA 3BIVH 4WVPE 3LGIA 4JZEH 2B8OH 2BM2A 4BAOB 3URCA 1BRAA 1SGYE 3E6PH 1UTJA 3D62A 4Y6DA 1C5QA 2OC0A 1TMBH 4X8VH 1DSTA 1O5GH 1F0UA 1V2WT 1A5GH 1C5NH 1KXCA 1O2VA 1JXPA 4IMQA 1SGCA 1UVOA 4AG2A 3K6ZA 1BTWA 4Y8XA 1WU1A 4NZLA 5A09A 2R0LA 3VB7A 4D9RA 1WV7H 2ZFQH 2Y81A 3VB5A 2ZHWH 3M7UA 4JZFH 2YOLA 1S83A 3S7HB 2QYIA 3QGJA 3RXQA 1ELEE 1UTMA 2P93A 4B74A 1DWCH 5FCKA 4YO9A 5EG4A 1FPHH 2ZU3A 3W94A 2WPHS 4UEHH 2B9LA 2HNTE 3GOVB 2QF0A 3RXBA 5JBCS 4K1EA 1O2IA 1ELVA 4YZUA 1MKWK 1O2TA 1TX6A 1UTQA 3QTVH 2ZDAH 5EW1H 3HATH 4KGAA 1HIAB 1Z8GA 3GCOA 2K1QA 1A46H 2Z3DA 1GBAA 1O5CB 1EAUA 1C5WB 3TJOA 5DP5A 2Z7FE 4X1SU 1NFWA 2ZEBA 2J95A 1UCYH 3GY5A 1DVAH 1N8OC 1J16A 1DSUA 2FOMB 2HGTH 2C90B 1QURH 4UDWH 1JIRA 3BG4C 2QY0B 3ZVCA 2FTMA 1DDJA 4GHTA 1TBZH 3A84A 4JYUH 1OP0A 2ZDLA 3SV9A 3F9HA 1Y5BT 1W14U 4A7IB 5PTPA 1TBRH 2JETC 1IQGA 1O3JA 6GCHG 3LJJA 2OLGA 4IC6A 1C1NA 5AHGH 1SOZA 5FBIA 5LPFA 1ZGVA 5DGJA 1OP2A 1BMLA 4DJZB 1SVPA 4MLFB 3M5LA 3A7WA 1IQEA 3AAVA 1U6QA 1XUGA 3SGAE 1C5PA 4DVAU 1TIOA 1A61H 3DHKH 3A82A 1YLDA 1SQTA 4UFEH 1G3EA 2QC2A 1DS2E 3VGCB 3ODFA 3ATLA 1E38B 1EATA 4JZ1A 3GY6A 4XBDA 1C9TA 1O5BB 4GHQA 2ASUB 3SORA 2ZQ2A 3IWMA 2ZFSA 3M5MA 3PMBB 1MD7A 1Z6EA 1HFDA 1PPGE 2O9QA 3RMOH 2GDEH 3FZZA 1GBTA 2C8XB 3P70B 3MU1A 1KTSB 4K8BA 5J4QA 2QF3A 2ILNA 2AMDA 1SI5H 2VIDA 1O2GH 1EJAA 1TNLA 2CF9H 2CJIA 2R0KA 1A4WH 1HAZB 2V3OH 1S0RA 1O3GA 1A0HB 4Y7AA 1G3DA 4INKA 1TX8A 5GPIB 1CHOG 1BZXE 5FPTA 1GI1A 2VH0A 4BTIB 1OWHA 2FOCA 3RXFA 5EQSA 2BOKA 1DUAA 3GCTG 5HGGA 3RXGA 3LDXH 3BTEE 1O2JA 1WCZA 3VB4A 1A7SA 1F0TA 3ZV8A 1AB9C 3V0XA 2SNVA 5GIBA 2STAE 1S84A 1GHAG 2FS9A 4WMDA 3BG8A 5EU8A 3LGWA 2ODYB 1W11U 2Z9IA 1LHGH 1P09A 1C5XB 5LH8A 3RXDA 2ZHQH 1TMTH 4I8JA 4NWLA 1ZMNA 1O2QA 1UK2A 1TX7A 1EZQA 2FMJA 4Y11E 3ZVDA 1P2NA 2XBXA 3EA7A 4MNYA 4OGYA 3RU4E 2DE8A 2ZGCA 4E7NA 3JZ1B 2RG3A 5F03A 1OOKB 1G2LA 5FX5A 5C2ZA 4K5ZA 2FEQH 5L2ZH 1BA8B 1Y5UT 1FLEE 2OD3B 1A3BH 2HWLB 4JK5A 4ABGA 4DT7B 2STBE 3Q77A 4DGJA 4Z6AH 5HM2A 1CGJE 1XM1A 2PGBB 2QGRA 3ZZ3A 5HM9A 1O3MA 1K1IA 1O3CA 3M3VA 1Y59T 1CU1A 3BEUA 1TPAE 4X8TH 3ELAH 1FJSA 5JBTA 2ZTYA 1O33A 1P3EA 3U8TH 2BD3A 3P95A 1A1RA 1GVKB 1MQ5A 3L33A 5F8ZA 2BY5X 3MI4A 3SV2H 2Z94A 3ZZBA 3LGUA 1TAWA 2NU2E 3U69H 2ANMH 4IGDA 1PPHE 1BRBE 4ABHA 3ZZ6A 1ZTKA 3SU1A 1IQJA 3NWUA 1CO7E 3SBKA 4U32A 1P11E 2C8YB 4O3TA 2J34A 2J94A 3QO6A 1D9IA 4LOYH 1GGDC 1AHTH 2SGFE 2ZTZA 2C3SA 1PQ7A 2A4GA 1GHBG 3SNEA 2ZTXA 5GDSH 3ZVAA 2VGCC 1P02A 2HOBA 1FONA 1K1PA 1K1NA 1SL3A 4AX9H 4INLA 1HBTH 3TIUA 3LIWA 1PYTC 1BJUA 1DWBH 5FPSA 4B71A 4SGAE 2PKSB 1BMMH 1P8VC 3SV6A 2A0QB 2OCVB 2TGDA 3HKJB 3G01A 1MKWH 2W3IA 1V6DA 3PO1C 4QT8C 2F9OA 2ANKH 2A4RA 1NFYA 2ZPSA 4FUGA 1LMWB 1TPPA 2FTLE 4GAWA 4JZDH 1UVUH 1NC6A 1SHYA 4AYYB 2BZAA 1TRNA 2ZA5A 5FX6A 3E90B 4AGKA 3RXUA 4DURA 4HI3A 5DP6A 1BB0B 1RTFB 2XBWA 4IW4E 5FBEA 2ODQA 1C9PA 3SUDA 3TGIE 1KLTA 2HVXA 5FCRA 1SLXB 4A5TS 2PKAA 2GX4A 3RMNH 4CHAC 2RA0A 3SUGA 2BVRH 1LVMA 4NIXA 2AMQA 1ABJH 1F7ZA 3M7QA 1P57B 4E05H 1G30B 2BMGB 1OPHB 3VB6A 1LVBA 2VWLA 1IHTH 4JYTA 1FMGA 3L3TA 3ATKA 4X8UH 3PMHB 1K1MA 4GCHF 3TJNA 1GI7B 1GJ9B 1F92A 3PV4A 1O2KA 2O8LA 1GG6C 3E0NB 1VR1H 1L1NA 3A7TA 1LKAA 5FHTA 1C5LH 1YBWA 3BTME 1FY4A 2SGDE 3PLPA 1GMDF 1BIOA 3MU0A 2D26C 2H2ZA 1VITH 3EGKH 3PMAB 1INCA 4D9QA 2OQ5A 2BD5A 5AVDA 1LDTT 2VJ1A 1C1OA 1L2EA 2GMTC 1F0SA 5DPAA 3TGKE 2F9NA 1AE8H 1YKTA 1DICA 1TE0A 2BVXH 4KP0A 3S9BA 2QXJA 1V3XA 1XXFA 1GI6A 4Y71A 1V2MT 3UR9A 2ZWLH 1SGPE 4OS2A 1C1SA 5K0HA 1SB1H 1MBMA 2FXRA 2FI4E 1GGDB 3O8BA 4FUCA 1AI8H 2XNIA 1Z7KA 1SFIA 1EPTC 1THRH 4R8TB 1E36B 2Z3CA 3S69A 1Q31A 1HAOH 2ZI2H 7GCHF 2BDAA 3QUMP 1QQUA 1V2RT 1M9UA 3GY3A 2BLQA 2FWWA 3RMLH 2OQUA 4NCYA 2M5TA 1UCYK 2O8WA 2VWNA 5E8EH 2B7DH 1BBRK 2ALPA 5LGOA 3PO1B 1BHXF 1W12U 3SOSA 2W3KA 1BCUH 1TA6A 2KAIB 1QRWA 1XUHA 3M5NA 2P3UB 1Z6JH 4UD9H 1BTZA 1NU7B 3LC3A 4Y10E 3PWCA 5K7RA 1BDAA 4ABBA 1C5RA 3MH4A 1D3QB 1FY3A 3ZV9A 5L2YH 2WPJS 1P0SH 1TFXA 2A5AA 1SC8U 3BTTE 3FANA 5T6GA 1QJ1B 1P2MA 1ELGA 2AS9A 3K65B 3AW0A 2OTVA 7ESTE 1EXFA 2SGAA 5DP8A 4ABEA 1T31A 2H9EH 2AGGX 3SNDA 2BB4A 1W0YH 1J9CH 4DIIH 3RXLA 5T6DA 4DY7B 1YYY1 4FUHA 2PW8H 4MNVA 3ZZDA 1IOEA 1O2WA 3SQEE 1HAVA 2BHGA 2GP9B 5HMAA 2TIOA 2XCNA 1FDPA 1NN6A 3ZVBA 4AB8A 1GJCB 2FOAA 2UWOA 1V2KT 3NUMA 2VWOA 2PV9B 3ODDA 1C5UA 1O2YA 3PB1E 1BITA 2NU0E 1C1UH 1S85A 1GHBF 2ZNKH 1NRNH 1XUIA 1SGQE 1YPLH 4J2YB 1JOUB 3M7TA 1LQEA 8KME2 1MD8A 1C4V2 1E34B 2I6QA 1GJAB 1V2TT 1IQNA 5A0AE 1V2ST 2Y6TA 5EODA 2UUKB 1Y3WA 1FY8E 3UPEA 2PWXA 5DO4H 1GVZA 1C5SA 2LNCA 1UTLM 2XCFA 1NM6A 4DOQA 1KXAA 2BDYA 1O5FH 4ZKRU 4AN7A 1TPSA 2YNAA 4K3JA 1BRCE 1A5IA 5E2PA 1C2MA 3V3MA 1W8BH 2F83A 4RKOB 4FUDA 1S5SA 2VIVA 3HK3B 2XC0A 4E7RG 3GY2A 5ESBA 1P04A 1KXFA 5SGAE 2PSYA 2BXUH 3B8JA 2LIZA 4CH8B 2XBYA 1GCTC 1GDUA 1ZZZA 1ELDE 2ZHDA 1C1WH 3OSYA 1Z1IA 4Y0ZE 1GBHA 3EBNA 3VGCC 4BAMB 2GZ8A 1AWHB 1EB1H 3ATMA 1SHHB 2GZ7A 1C2EA 4PROA 4CR5A 2IPHA 3HKIB 3MHWU 2NU1E 1F0RA 3UTUH 2C93B 2SGQE 1C5VA 2R2WU 1KDQB 2FOGA 1JRTA 1DANH 3BTQE 4BNRA 1EAXA 3U1JB 4IMZA 1MKXH 5B6OA 1GBKA 2CV3A 4XE4A 1XKAC 4NFEA 1G9IE 1KY9A 1BTHH 1A0LA 1O34A 4YM9A 1ZPBA 3VXFH 3WY8A 1NRSH 2W7SA 4X1RU 1O3DA 3SJKA 1HGTH 3RXKA 2PGQB 2AEIH 3SGQE 3F9FA 1IQMA 4X6MA 3LGYA 1SGNE 2F9BH 1IHSH 1QJ7B 4ZHMU 1LQDB 4I32A 2PLXA 1KTTB 4CRCA 4THNH 2GKVE 1Z8IB 4ABAA 2ZPRA 1YPKH 4HTCH 5DK1A 3A85A 3Q3YA 3SI4H 4NIYA 1GI8B 4BANB 3E16B 2VH6A 2VWMA 3FP7E 1YGCH 1EJNA 8LPRA 5CMXH 3EAJA 3LKWA 3RM2H 1FAXA 1TGCA 4ZXXH 3E0PB 3NKKA 3UNSA 4TWWA 1ZPZA 1P01A 1P10A 1NRPH 3KHVA 3EYDA 1AZ8A 3VFEA 3F9GA 1EOJA 1EZSC 1GJ4H 2XRCA 2G55A 3S9CA 2SNWA 1SLVB 4K1SA 2AMPA 5E0JA 1BBRH 1RRKA 4Q80A 1NRRH 2A5KA 4GUXA 1D6WA 1WTGH 1G37A 1P9SA 1WSSH 6ESTA 3M3TA 1RJXB 1UTPA 3TJUA 2ZECA 2A4OA 2VIWA 1XXDA 2F9PA 3RXEA 2FDAA 5EOKA 3SNAA 5FXLA 1CT0E 1XUJA 1ELTA 1TRMA 3RUOA 3SW2B 3BV9B 3U98H 2OP9A 1DY9A 5CE1A 3I29A 1GBIA 1PPFE 1Q3XA 3SU3A 4B75A 4MG3A 2FODA 1FUJA 4GCHG 5F6MA 4NA9H 1ELBA 3CENA 1PPEE 1TWXB 1HNEE 2CMYA 4YT7H 2HRVA 1Z8JB 2BLOA 1DLEA 1PQ5A 4X1PU 2W5EA 3GYLB 1IQHA 1EPTA 1GCTB 2PFEA 1CQQA 2G51A 1AE5A 1GMDG 1C2JA 3P8GA 2BD9A 1HJ9A 3SNCA 2CHAB 6CHAB 1BOQA 1AKSA 1SGDE 4R0IA 3A89A 1KYNA 5I25A 1QHRB 2G52A 1FPCH 1MTVA 1O2PA 1GMCF 1LCYA 4RSPA 1UVPA 3LONA 1FQ3A 2Q6FA 1CVWH 2P8OB 3GDSA 2PKSC 4NFFA 1HYLA 3MTYA 1NTPA 4X6OA 4TWYA 1EUFA 4IN2A 4Z0KA 4MNWA 3ZZAA 2A2XH 5C1YA 1SGTA 1V2VT 1HJAC 3PTBA 1EASA 3BEIB 1YPEH 2HPQH 1FN8A 5FAHA 3M61U 1TOMH 1NU9A 2DE9A 1MBQA 3GY8A 4NSVA 2ZO3H 1C1MA 3CS0A 1YLCA 7GCHG 1MTSA 4ZKSU 1AD8H 1QL9A 1BTYA 1KDQA 2UUFB 4H6TA 2AH4X 1NRQH 3MO9A 2QA9E 4Q2KA 4B2CA 1AN1E 1FN6A 4NGAH 1OWDA 4D76A 1B0EA 1O3NA 2H6MA 1G2MA 2ZCKP 3LU9B 1T4UH 2Q6GA 3BSQA 1DY8A 1HAXB 1YPMH 3TK6A 4B2BA 2XXLA 1GJBB 3P6ZB 1HAGE 5ETXA 1OWKA 2OXSA 2A7JA 3D65E 3MMGA 1OWIA 3BN9A 5DP7A 5G4BA 1GL1A 1GL0E 1O30A 4FUFA 2Y5HA 2ZDKA 5A2MH 4FUJA 5JBBS 1XVMA 2P3FH 3A86A 3HGPA 1O2HA 1XUKA 1YCPM 3KQCA 2EEKA 5GJ4B 4BAQB 4FVDA 3TH3H 4JYVH 3CP7A 2J9NA 3TK5A 3E91A 1LO6A 1P03A 2Z9JA 1CA8B 1L1GA 3FAOA 4K8YA 1FV9A 3MU8A 3TVJB 3R3GB 5A8ZA 1AU8A 1HIAA 2OC1A 3PLBA 1FNIA 5JB9S 1BMNH 1NROH 1S81A 4WH8A 1AIXH 4LZ1H 5EXMA 2WPLS 5C5OA 5IDKA 1ZSKA 2G5NA 2ZG0H 4B1TA 2TGPZ 1C2KA 4JCNA 1QIXB 1EOLA 1NO9H 3P8OA 2VIPA 2FS8A 1EKBB 1UJ1A 1WYKA 1OSSA 1Y8TA 4ABIA 2H9HA 3P8FA 1K1LA 3SV8A 2QN5T 1MZAA 3SUEA 2BTCE 1CGHA 2BDGA 3MU5A 4O9VA 3A87A 2XC4A 4F4OC 1ZR0A 3BTWE 4I7YH 1TQ7B 1QB1A 4D7GA 1ETTH 1TGNA 2GV6A 1ZOMA 1F2SE 2G4UA 1PPCE 3KQEA 5CHAB 4MQAA 7LPRA 1ZMJA 3EA9A 3PTNA 1HCGA 1DWDH 4CBNA 5DG6A 1V2NT 3TK9A 1SGFA 1Y3VA 3PM3A 2J2UA 1THPB 1C2HA 2FOFA 1NZQH 1QB9A 2ANWA 2ZDMA 3OYPA 4X0WU 2JH6D 9LPRA 2PUXB 4XBCA 1IQFA 1HJAB 2WV4A 1MU8B 1ZTJA 3EE0B 1D6RA 3MFJA 4NA7A 2RA3A 3KN2A 5GXPA 1GJ7B 2G4TA 1GJ5H 5AF9H 1H1BA 1CA0C 3RU4T 3UY9A 2FM2A 1GHVH 2Y5FA 1T8MA 3MH6A 4RN6A 2FZZA 1V2LT 2FX6A 4HFPB 3NXPA 1ARBA 2I6SA 1C5MD 2FLRH 2ZHFH 1V2PT 1EQ9A 4X8SH 1SGEE 1EZUC 2F9VA 2NU3E 1ACBE 2WPKS 3AASA 1H9LB 3T25A 2ZC9H 1GBFA 4H4FA 3QX5H 1WBGB 1O3LA 3SJOA 4IC5A 3T29A 1GHXH 1CT2E 3UWIA 1GJ6A 1AVXA 3ZVFA 4ZHLU 4MPWA 2A32A 3ZVGA 2GD4B 3AW1A 1MCVA 1XKBC 3QLPH 1C4U2 2ZFTA 2R3YA 2ANYA 1PQAA 1P9UA 3KGPA 2ULLA 3MNXA 3K9XB 1EP5A 1WQVH 1Y5AT 1O3EA 1FY5A 1OS8A 1GMHF 1AWFH 2GCTB 2TBSA 3P8NA 4GPGA 4U2WA 3Q00A 4VGCB 4DW2U 2WV5A 1PPBH 2FIRH 1MKXK 3GCHC 2BD7A 1B7XB 4AFUA 4AG1A 2PHBA 3RXIA 1K2I1 2FO9A 2ZQ1A 2TGAA 1VGCC 1LPGB 1SLUB 5DP9A 2Y5GA 5EQRA 1O5AB 1O3KA 2OBQA 1YC0A 3ZYDA 1WQSA 2Y7ZA 1Z1JA 2ZP0H 3U1IB 3TH4H 4MPUA 1TMUH 3UREA 1JBUH 5L6NH 1L4ZA 1TONA 1VCPA 1MTNB 4O3UA 1NY22 1ZJKA 2BLWA 3KL6A 3RM0H 1C2LA 1K22H 3P17H 1O3HA 1MAXA 1B5GH 1VCWA 4AFSA 1AUJA 5C5NA 2P95A 2FPZA 1YPHC 4WJG2 8GCHF 3R0FA 4FUIA 3TLOA 1CBWB 3LH3A 4K1TA 1IQKA 1T7CA 4XOJA 3KQBA 3ZYEA 1A2CH 4ISIH 3O8RA 1C4Y2 3MOCA 1GVLA 4D8NA 2QAAA 1UVTH 5EPNA 1LHCH 1DOJA 1GI5A 1TQ0B 3TJVA 3W95A 1QR3E 3K6YA 3UUZA 2WUCA 1DFPA 1KXEA 3PMJA 3QWCH 2IN2A 2BD8A 2SGEE 4XFQA 4ZUHA 1N6YA 1YCPH 1W0ZU 3A88A 2FX4A 3A83A 1RS0A 1ZRBA 4NWKA 1QBOA 1CA0B 1W7GH 3A7VA 5JBAS 4AYVB 1NFUA 2WPIS 1O2NA 4UONA 2G00A 3QDZB 3HPTB 3ZZ8A 4FU9A 3LJOA 4MPVA 1GBBA 1TGTA 4ISOA 2ZFRH 2VVCA 4KTCA 2WYGA 1BHXB 2ZDVH 2O8TA 4OS4A 1O3IA 5A8XA 2R9PA 3UR6A 4SGBE 5GCHF 2HNTC 1MTWA 2NWNA 1IQLA 1Y3YA 1J15A 2BLVA 1QBNA 3ATWA 2EI7A 1NPMA 3PYHA 5LPEA 2VVUA 5F8TA 1RXPA 2BY7X 1ANEA 5C20A 1G3BA 4K60A 1MAYA 1GMCG 1C5ZB 1ARCA 4DG4A 4B76A 5TCCA 2FOHA 4K2YA 3M35A 1HV7A 1SPJA 3UOPA 1AY6H 3SU4A 2D2DA 2OBOA 2H5CA 4ZMAH 3A7ZA 4O03A 3RXTA 2P16A 1S0QA 2PTNA 3QK1A 2VIQA 3GCHB 1UTKA 2GVFA 4Y7BA 3ZZ9A 3IG6B 1VGCB 1SR5C 4I31A 4OS6A 3ENSB 3I77A 3MO3A 3KNXA 4GSOA 1Y3XA 2FI5E 4WF8A 5T6FA 1OX1A 1ANDA 2RCEA 3SHAH 1QL8A 5A0CA 3K2UA 2UWLA 3KIDU 4ZAEA 2HLCA 2AIQA 1SQAA 4ABDA 1QBVH 1T8NA 2GV7A 3TNTA 1RGQA 1O2UA 3VB3A 4ZH8A 1LHDH 1ZGIA 2EI6A 2Y80A 4TPIZ 2H9TH 1H4WA 1AUTC 1THSH 4YLUA 1HXFH 2A2QH 3LH1A 3SN8A 1F5LA 1YM0A 3E1XB 2FOEA 4BOHA 1ANBA 3FP8E 3SU2A 1FZZA 2EI8A 2F91A 1DX5M 1EAWA 1B0FA 1BTUA 3SHCH 2GZ9A 1O3PB 2CXVA 2JH0D 4NSYA 2Z9LA 2GCHF 4I8KA 1HDTH 1PQ8A 1UHBB 1LHFH 1MTUA 1LKBA 3A7YA 1GJDB 3MWIU 1AGJA 1AFQB 3OU0A 3U8RH 1O3FA 3MH7A 3H7TA 4ASHA 2PSXA 4Y79A 2GGVB 3C27B 3RLWH 2ZHEH 2W26A 1S6HA 2JKHA 1DUEA 1T4VH 1KXDA 2F3CE 2CHAC 1BQYA 1ZTLA 4FUEA 3UQOA 6CHAC 2ESTE 1QA0A 2J38A 1E35B 1NESE 1ANCA 1GPZA 2QIQA 2A7CA 1ZHMA 2XC5A 2P8OC 1YP9A 5TJXA 3DUXH 4ISNA 2ZFPH 5EPYA 1O2ZA 3V7TA 2Z9KA 2KAIA 1ZSJA 2W7UA 1A5HA 3SJIA 1OWJA 3QN7A 1C1VH 4MVNA 4Y8ZA 4MPXA 1QRZA 3NK8A 1ELFA 4I8LA 3KF2A 2FP7B 2C8WB 2A5IA 3A8BA 3UQVA 1GI4A 2UUJB 3T27A 1W3CA 3DFJA 2A4QA 1RD3B 2EC9H 2XBVA 5IYTA 4LZ4B 4YESB 2G5VA 1TRYA 1Q2WA 1VJ9U 1P2JA 2GT7A 4FXGH 2IOTA 3JZ2B 4H42U 2VB0A 2RDLA 2B0FA 4KKDA 3RXMA 4A1VA 3UWJH 3TH2H 1P05A 3M5OA 2BQ7B 3QZQA 5HYOA 2K7XA 1GI9B 1RIWB 3GDVA 3MNCA 1IQIA 1QNJA 1G32B 2XWAA 4X2VA 1FIZA 1SFQB 2BYAX 2P59A 4X2YA 4AOQA 1WUNH 7KMEH 3A80A 2VVVA 3C1KA 1O2RA 1QJ6B 3SZNA 1ZSLA 1AO5A 2O8UA 1EZXC 3PLKA 2R2MB 2H5DA 3A7XA 3RXRA 1FIWA 2ZU4A 1ORFA 1D3PB 1JWTA 1SBWA 1AQ7A 4NG9H 1O5EH 1ELCA 3A8CA 2TGTA 1A0JA 1EAIA 1XVOA 2G81E 2AGEX 1H8DH 4UFDH 4X6PA 3T5FH 2WINI 4ZKOU 4HZHA 3OY5U 4XDEA 1EB2A 3RC5A 2Z3EA 1HAYB 1NT1A 2J92A 1ZHPA 1GMHG 4X6NA 1TOCB 5DP3A 5EXLA 3PROA 3RXVA 3O8CA 3O8DA 1PPZA 2ZGBH 1D4PB 3UNQA 5JPMH 2V35A 3TPIZ 2SFAA 2A1DB 2OC7A 3SGBE 3STIA 5CHAC 2Q6DA 3RXJA 3ZZ4A 2Y82A 5I46H 3BTKE 3S7KB 1NFXA 3STJA 2FLBH 1YPJH 3LPRA 1GCDA 1UHBA 1RTLA 1TGSZ 1HAPH 1ETSH 4FVBA 1T8LA 3SU0A 1LVOA 1G36A 4I8HA 3RXSA 2ZPQA 1H9HE 3KQDA 4Q7YA 5ABWA 4MNXA 3GICB 4NIWA 3MNSA 5DP4A 1GI2A 1SG8B 5JB8S 1D3DB 3EQ0H 1LPZB 5E0GA 4DIHH 2NU4E 2BVSH 3Q3KA 3QZRA 3ZVEA 3DFLA 1AZZA 2QCYA 3F1SB 3UOUA 3D23A 4IS5A 8GCHG 3F6UH 4Q7XA 1TPOA 3UNRA 1UO6A 1GBMA 1SGIB 2BY6X 1FI8A 1CT4E 4INHA 4BXSA 2AIPA 1FAKH 3ESTA 2BQ6B 4CR9A 3GY4A 1TGBA 1DLKB 3B23B 2A7HA 2HPPH 4RKJB 4FU8A 3BIUH 2AGIX 1DXWA 2UWPA 4KTSA 2PKAB 4AORA 4AFQA 2BD2A 3UIRA 1YCPK 4B73A 1GHYH 4A6LA 1BT7A 4WMFA 1TB6H 5J4SA 1X7AC 1L4DA 2BX3A 5EQQA 2EA3A 3OTJE 4AFZA 2ZU1A 4Y76A 3EDXB 4CRAA 3Q76A 1IAUA 1SGRE 2UUYA 2YNBA 1VJAU 1PJPA 1K9OE 4NA8A 1TNHA 4YOIA 5C3NA 3NPSA 4OS5A 4O97A 4OGXA 4U30A 1HRTH 1GBJA 1VITG 1K28D
chains in the Genus database with same CATH superfamily
1CSOE 2BDIA 1S82A 4B2AA 2V7QD 1TLDA 2GCTC 1UCYE 8ESTE 1V2QT 3OFND 3BEFB 4VGCC 4CH2B 1UK3A 1BBRE 2GDDA 1MZDA 5GCHG 4LXBH 4CRFA 1JRSA 2IPQX 3MNBA 2ZU5A 1S6FA 3L6PA 5C1XA 1HAIH 1RFNA 2PUQH 4X1QU 2QXGA 1HAHH 1HLTH 1UVSH 2KCOA 3DA9B 1SLWB 3PWBA 1DE7H 1O2OA 3GY7A 1N8OB 2ZGJA 4X2XA 3NCLA 2BZ6H 1BJVA 1O38A 4BTTB 3BG4B 1HUTH 1O3OA 1O5DH 2OC8A 1K1OA 4WMEA 2FOBA 1GDNA 1QTFA 1MTNC 1C2DA 2BDHA 2VU8E 3U9AH 3VPKA 1DITH 1EP6A 1O2LA 2YMSC 5KGOA 4ZCNA 1UK4A 3WW7A 2JETB 2BD4A 1DPOA 1DT2A 3H7OA 2K0QA 2C4FH 1ID5H 3AAUA 1SOTA 1CBWC 1Z8RA 3DCLA 1FXYA 1MCTA 4TPYA 3QGNB 1ABIH 1C1TA 3V13A 2PR3A 4YT6H 3FVFB 3FFGA 3RU4D 3LOXA 3E8LA 3RXCA 5DKMA 1PFXC 1GBDA 4Q7ZA 3NZIA 2G8TA 2A31A 2QXHA 3GS9A 1JIMA 1C2IA 2BY8X 1MABB 1C5OH 1WAYB 5AFZH 1C1RA 1G3CA 4WXIA 5EXNA 3CS7A 1E0FD 4KELA 3SO3A 1O35A 4YLQH 1T8OA 3A8DA 3ITIA 2ZF0H 2JH5D 3F0OA 5C0UA 3SUFA 1ZPCA 2AYWA 1WTHD 4H6SB 2GCHG 2IJOB 4GVUA 5JDUB 3RDZA 3GCNA 1LVYA 1ELAA 3Q3XA 1UTOA 4Y0YE 2VBCA 5LPRA 3DT0H 1SQOA 4CBOA 4XSKU 3KEEA 4IBLH 3T2NA 1E1RD 3ZZ7A 1QCPA 3AVZA 1GBCA 2O8MA 3FN8A 1CE5A 3A8AA 4Z1MD 5AFYH 4ZKNU 4A92A 1AB9B 1GI3A 1P2IA 1J17T 1L0ZA 2JDID 1F5KU 1HAVB 1TALA 2QXIA 4Q4LA 3RC6A 1C1QA 1WOFA 1ZHRA 1DM4B 4CRGA 4JK6A 2QV1A 2BOHB 5ESTE 1MU6B 3MO6A 3B9FH 1O31A 4M7GA 3RXPA 3TU7H 4IN1A 2GTBA 1DWEH 3S0NA 2ZU2A 4WH6A 1O2SA 1GDQA 3SZEA 2WSSD 3M37A 4OS1A 6GCHF 2KCPA 5T3HA 5JYIA 4TYDA 4X1NU 1JMOH 4JMYA 1O2XA 4A1TA 1LPKB 1C5YB 3SYJA 1C1PA 3E3TA 2LPRA 1EX3A 1QGFA 1C2FA 1TNJA 3ZZ5A 9ESTA 3BTHE 1UW7A 1HXEH 4YOGA 1N1LA 4Q63A 6LPRA 3N99A 4ABJA 3MYWA 5BPEA 4F49A 3RXOA 4WY3A 3DD2H 1ZJDA 2Z9GA 3BTGE 2V3MA 1O36A 2ZKSA 3SV7A 1E37B 1QQ4A 1TYNA 1O3AA 2ALVA 1YF4A 3HK6B 5C1UA 3RXHA 2CN0H 1MMJN 2C8ZB 2FYRA 2Q1JA 3OX7U 4TY7A 3F9EA 3RLYH 1QFKH 5F8XA 4BTUB 2J4IA 2FESH 2HALA 4XRNA 1ZRKA 3TNSA 1ZYOA 3OY6U 1GWAA 1AVWA 5E2OA 4CRDA 1O39A 4XBBA 3T26A 3BF6H 3V12A 1Y3UA 2TRMA 3SNBA 1GBLA 3M36A 4Y8YA 2ZCLP 1AFQC 2RDEA 3U28C 2WPMS 4FU7A 1CHOF 2BXTH 1ESTA 2OINA 3KYFA 2VGCB 3HGNA 3SI3H 2ZCHP 4HG6A 2P94A 1XMNB 3SU6A 1O37A 3GCTF 1LTOA 1L1JA 5H4IB 3RP2A 4MDSA 3N7OA 4WWYA 3FP6E 3F3BA 2KCYA 1ZLRA 3KCGH 1LHEH 2KM0A 1W2KH 4GLYA 1P12E 2ZGXH 1GHAF 4A1XA 4KTUA 1NS3A 1HPGA 1VITF 1UMAH 5C94A 1P3CA 1QB6A 1EJMA 2VINA 5C67A 5TCAA 4OS7A 1SGFG 2A45B 1DXPA 3FKSD 3BTFE 4TY6A 1P06A 1OYQA 2P3TB 3QTOH 2B5TB 1O0DH 1VCQA 4DCDA 2VNTA 1XX9A 1C5TA 1KXBA 3U8OH 5E0HA 2R3UA 1TNGA 1H9IE 3GISB 2F9UA 2Y7XA 5DSFA 1W10U 4ZHAA 3FZDA 1ZMLA 1BRUP 3LC5A 4E06H 1TNKA 2JIZD 3BTDE 1S6LA 1TABE 3LGVA 1QY6A 1BMAA 1TBQH 3A81A 1BTXA 1MUEB 1KLJH 1J8AA 5GWZA 3F68H 4WXVA 4JZIA 2TPIZ 4CHAB 5BRRE 4UE7H 2AHME 1YPGH 2ZIQH 3MU4A 1HJ8A 1AFEH 3ATIA 3F2FA 3SJ9A 2AFQB 1KIGH 2THFB 2CGAA 3I78A 1FY1A 1MQ6A 1QL7A 1H8IH 3RMMH 4U01A 4ESTE 1AMHA 2YMSD 5FPYA 3SQHE 3DSGA 4FUBA 1F5RA 1OHHD 2V3HH 4UFFH 3TGJE 2M2AA 1ETRH 1RIWC 1Z71A 1GG6B 1GI0A 3P92A 3URDA 1V2UT 1QRXA 2ZDNA 4ZROA 1XUFA 2BY9X 4ZXYH 4AB9A 2XYAA 2WUBA 3D49H 4HGCA 1TA2A 4MTBA 3VEQB 2ZZUH 2PTCE 5EW2H 1W13U 4I33A 1AVGH 3SJ8A 4NIVA 3FOAA 3VXEH 2BDCA 1K1JA 4D7FA 2ODPA 3RXAA 4LK4A 1NBME 1CGIE 2H1UA 5EGMA 4ABFA 2GMTB 3OE7D 4UFGH 1YLNA 2XTTB 2BX4A 4TT3D 1W7XH 1N6XA 2V0BA 1TNIA 1PYTD 1O32A 2Z6BD 1P2QA 3UFAA 3M3SA 1GHWH 3SU5A 2QE7D 3EA8A 4RI0A 2L74A 2SGPE 3MH5A 2ZGHA 1V2JT 2XWBI 1SSXA 4J1YA 1J14A 1GBEA 1OKXA 1OXGA 1C2GA 4BAKB 1OWEA 2BDBA 1EPTB 2WYJA 1P2OA 1CHGA 2W6ID 1KLIH 4YTAA 3T62A 3TITA 3ZZCA 2V6NA 2CF8H 4ISHH 4I8GA 4ISLA 4YOJA 1A3EH 1P2KA 1V2OT 3S9AA 3IITA 1UTNA 4CREA 3T28A 4K69A 1AKSB 1QA7A 4BAHB 2DUCA 5HXFA 2FI3E 2JJ2D 2ZFFH 2FYQA 5DJ7A 5A8YA 1SMFE 2BQWB 1O2MA 1HB0B 4X2WA 2OUAA 3LGTA 1OP8A 1KSNA 1ESBA 1BUIA 4AGJA 1K21H 2D8WA 1T32A 1RTKA 3LT3A 4NZQA 4BXWA 1MH0A 2AERH 3H5CB 1D3TB 4CRBA 1ESAA 3GDUA 4AZ2B 1YPHE 3GYMA 5L30H 1GHZA 5EJZA 1BTPA 2HNTF 5A0BA 1GJ8B 3RC4A 1OYTH 1VZQH 2XW9A 1O3BA 2D1JA 2GT8A 2J5UA 2VIOA 3BIVH 4WVPE 3LGIA 4JZEH 2B8OH 2BM2A 4BAOB 3URCA 1BRAA 1SGYE 3E6PH 1UTJA 3D62A 4Y6DA 1C5QA 2OC0A 1TMBH 4X8VH 1DSTA 1O5GH 1F0UA 1V2WT 1A5GH 1C5NH 1KXCA 1O2VA 1JXPA 4IMQA 1SGCA 1UVOA 4AG2A 3K6ZA 1BTWA 4Y8XA 1WU1A 4NZLA 5A09A 2R0LA 3VB7A 4D9RA 1WV7H 2ZFQH 2Y81A 3VB5A 2ZHWH 3M7UA 4JZFH 2YOLA 1S83A 3S7HB 2QYIA 3QGJA 3RXQA 1ELEE 1UTMA 1H8ED 2P93A 1DWCH 4B74A 5FCKA 4YO9A 5EG4A 1FPHH 2ZU3A 3W94A 1QZ8A 2WPHS 4UEHH 2B9LA 2HNTE 3GOVB 2QF0A 3RXBA 5JBCS 4K1EA 1O2IA 1ELVA 4YZUA 3OEHD 1MKWK 1O2TA 1TX6A 1UTQA 3QTVH 2ZDAH 5EW1H 3HATH 4KGAA 1HIAB 1Z8GA 3GCOA 2K1QA 1A46H 2J97A 2Z3DA 1GBAA 1O5CB 4ASUD 1EAUA 4P00A 1C5WB 3TJOA 5DP5A 2F4LA 2Z7FE 4X1SU 1NFWA 2XNDD 2ZEBA 2J95A 1UCYH 3GY5A 1DVAH 1N8OC 1J16A 1DSUA 2FOMB 2HGTH 2C90B 1QURH 4UDWH 1JIRA 3BG4C 4XD7D 2QY0B 3ZVCA 2FTMA 1DDJA 4GHTA 1TBZH 3A84A 4JYUH 1OP0A 2ZDLA 3SV9A 3F9HA 1Y5BT 1W14U 4A7IB 5PTPA 1TBRH 2JETC 1IQGA 1O3JA 3DSOA 6GCHG 3LJJA 2OLGA 4IC6A 1C1NA 5AHGH 1SOZA 5FBIA 5LPFA 1ZGVA 5DGJA 1OP2A 1BMLA 4DJZB 1SVPA 4MLFB 3M5LA 3A7WA 1IQEA 3AAVA 1U6QA 1XUGA 3SGAE 1C5PA 4DVAU 1TIOA 1A61H 3DHKH 3A82A 1YLDA 1SQTA 4UFEH 3PRBA 1G3EA 2L6OA 2J98B 2QC2A 1DS2E 3VGCB 3ODFA 3ATLA 1E38B 1EATA 4JZ1A 3GY6A 4XBDA 1C9TA 1O5BB 4GHQA 2ASUB 3SORA 2ZQ2A 3IWMA 2ZFSA 3M5MA 3PMBB 1MD7A 1Z6EA 1HFDA 1PPGE 2O9QA 3RMOH 2GDEH 3FZZA 1GBTA 2C8XB 3P70B 3MU1A 1KTSB 4K8BA 5J4QA 4OM9A 2W6JD 5T1VA 2QF3A 2ILNA 2AMDA 1SI5H 2VIDA 1O2GH 1EJAA 1TNLA 2CF9H 2CJIA 2R0KA 1A4WH 1HAZB 2V3OH 1S0RA 1O3GA 1A0HB 4Y7AA 1G3DA 4INKA 1TX8A 5GPIB 1CHOG 1BZXE 5FPTA 1GI1A 2VH0A 4BTIB 1OWHA 2FOCA 3RXFA 5EQSA 2BOKA 1DUAA 3GCTG 5HGGA 3RXGA 3LDXH 3BTEE 1O2JA 1WCZA 3VB4A 1A7SA 1F0TA 3ZV8A 1AB9C 3V0XA 2SNVA 5GIBA 2STAE 5EJLA 1S84A 1GHAG 2FS9A 4WMDA 5HKKD 3BG8A 5EU8A 3LGWA 2ODYB 1W11U 2Z9IA 1LHGH 1P09A 4B6FA 2LELA 1C5XB 5LH8A 3RXDA 2ZHQH 1TMTH 4I8JA 4NWLA 1ZMNA 1O2QA 1UK2A 1TX7A 1EZQA 2FMJA 4Y11E 3ZVDA 1P2NA 2XBXA 3EA7A 4MNYA 4OGYA 3RU4E 2DE8A 2ZGCA 4E7NA 3JZ1B 2RG3A 5F03A 1OOKB 1G2LA 5FX5A 5C2ZA 4K5ZA 2FEQH 5L2ZH 1BA8B 3F2GA 1Y5UT 1FLEE 2OD3B 1A3BH 2HWLB 4JK5A 4ABGA 4DT7B 2RFKC 2STBE 3Q77A 4DGJA 4Z6AH 5HM2A 1CGJE 1XM1A 2PGBB 2QGRA 3ZZ3A 5HM9A 1O3MA 1K1IA 1O3CA 3M3VA 1Y59T 1CU1A 3BEUA 1TPAE 4X8TH 3ELAH 1FJSA 5JBTA 2ZTYA 1O33A 1P3EA 3U8TH 2BD3A 3P95A 1A1RA 1GVKB 1MQ5A 3L33A 5F8ZA 2BY5X 3MI4A 3SV2H 2Z94A 3ZZBA 3LGUA 1TAWA 2NU2E 3U69H 2ANMH 4IGDA 1PPHE 1BRBE 4ABHA 3ZZ6A 1ZTKA 3SU1A 1IQJA 3NWUA 1CO7E 3SBKA 4U32A 1P11E 2C8YB 4O3TA 2J34A 2J94A 3QO6A 1D9IA 4LOYH 1GGDC 1AHTH 2SGFE 2ZTZA 2C3SA 1PQ7A 2A4GA 1GHBG 3SNEA 1WDIA 2ZTXA 5GDSH 3ZVAA 2VGCC 1P02A 2HOBA 1FONA 1K1PA 1K1NA 1SL3A 4AX9H 4INLA 1HBTH 3TIUA 3LIWA 1PYTC 1BJUA 1DWBH 5FPSA 4B71A 4SGAE 2PKSB 1BMMH 1P8VC 3SV6A 2QF5A 2A0QB 3KYGA 2KZ4A 2J98A 2OCVB 2TGDA 3HKJB 3G01A 1MKWH 2W3IA 1V6DA 3PO1C 4QT8C 2F9OA 2ANKH 4YXWD 2A4RA 1NFYA 2ZPSA 4FUGA 1LMWB 1TPPA 2FTLE 4P02A 4GAWA 4JZDH 1UVUH 1NC6A 1SHYA 4AYYB 2BZAA 2HLDD 1TRNA 2ZA5A 2EY4C 5FX6A 3E90B 4AGKA 5EIYA 3RXUA 4DURA 4HI3A 5DP6A 1BB0B 1RTFB 2XBWA 4IW4E 5FBEA 2ODQA 1C9PA 3SUDA 3TGIE 1KLTA 2HVXA 5FCRA 1SLXB 4A5TS 2PKAA 2GX4A 3RMNH 4CHAC 2RA0A 3SUGA 2BVRH 1LVMA 4NIXA 2AMQA 1ABJH 1F7ZA 3M7QA 1P57B 4E05H 1G30B 2BMGB 1OPHB 3VB6A 1LVBA 2VWLA 1IHTH 4JYTA 1FMGA 3L3TA 3ATKA 4X8UH 3PMHB 1K1MA 4GCHF 3TJNA 1GI7B 1GJ9B 1F92A 3PV4A 1O2KA 2O8LA 1YWUA 1GG6C 2KCAA 3E0NB 1VR1H 1L1NA 3A7TA 1LKAA 5FHTA 1COWD 1C5LH 1YBWA 2OK5A 3BTME 1FY4A 2SGDE 3PLPA 1GMDF 2WPDD 1BIOA 1W0JD 3MU0A 2D26C 2H2ZA 1VITH 3EGKH 3PMAB 1INCA 4D9QA 5EJ1A 2OQ5A 2BD5A 5AVDA 1LDTT 2VJ1A 1C1OA 1L2EA 2GMTC 1F0SA 5DPAA 3TGKE 2F9NA 1AE8H 1YKTA 1DICA 1TE0A 2BVXH 4KP0A 3S9BA 2QXJA 1V3XA 1XXFA 1GI6A 4Y71A 1V2MT 3UR9A 2ZWLH 1SGPE 4OS2A 1C1SA 5K0HA 1SB1H 1MBMA 2FXRA 2FI4E 1GGDB 3O8BA 4FUCA 1AI8H 2XNIA 1Z7KA 1SFIA 1EPTC 1THRH 4R8TB 1E36B 2Z3CA 3S69A 1Q31A 1HAOH 2ZI2H 5CDFE 7GCHF 2BDAA 3QUMP 1QQUA 1V2RT 3W1EA 1M9UA 3GY3A 2BLQA 2FWWA 3RMLH 2OQUA 4NCYA 2M5TA 1UCYK 2O8WA 2VWNA 5E8EH 5KECA 2B7DH 1BBRK 2ALPA 5LGOA 3MQKC 3PO1B 1BHXF 5B6LA 5C0TA 1W12U 3SOSA 2W3KA 1BCUH 1TA6A 2KAIB 1QRWA 1XUHA 3M5NA 2P3UB 1Z6JH 4UD9H 1BTZA 3N7EA 1NU7B 3LC3A 4Y10E 3PWCA 5K7RA 1BDAA 4ABBA 1C5RA 3MH4A 1D3QB 1FY3A 3ZV9A 5L2YH 2WPJS 1P0SH 1TFXA 2A5AA 1SC8U 3BTTE 2IJD1 5KEDA 3FANA 5T6GA 1QJ1B 1P2MA 2F43B 1ELGA 2AS9A 3K65B 3AW0A 2OTVA 7ESTE 1EXFA 2SGAA 5DP8A 4ABEA 1T31A 2H9EH 2AGGX 3SNDA 2BB4A 3VG8A 1W0YH 1J9CH 4DIIH 3RXLA 5T6DA 4DY7B 1YYY1 4FUHA 2PW8H 4MNVA 3ZZDA 1IOEA 1O2WA 3SQEE 1HAVA 2BHGA 3PV2A 2GP9B 5HMAA 2TIOA 2XCNA 1FDPA 1NN6A 3ZVBA 5GNDA 4AB8A 1GJCB 2FOAA 2UWOA 1V2KT 3NUMA 2VWOA 2PV9B 3ODDA 1C5UA 1O2YA 3PB1E 1BITA 2NU0E 1C1UH 1S85A 1GHBF 2ZNKH 2QF4A 1NRNH 2K8IA 1XUIA 3DSPA 1SGQE 1YPLH 4J2YB 1JOUB 3M7TA 1LQEA 8KME2 1MD8A 1C4V2 1E34B 2I6QA 1GJAB 1V2TT 1IQNA 5A0AE 1V2ST 2Y6TA 5EODA 2UUKB 1Y3WA 1FY8E 3UPEA 2PWXA 5DO4H 1GVZA 1C5SA 2LNCA 1UTLM 2XCFA 1NM6A 4DOQA 1KXAA 2KR7A 2BDYA 1O5FH 4ZKRU 4AN7A 1TPSA 2YNAA 4K3JA 1BRCE 1A5IA 5E2PA 1C2MA 3V3MA 1W8BH 2F83A 3H09A 4RKOB 4FUDA 1S5SA 2VIVA 3HK3B 2XC0A 4E7RG 3GY2A 5ESBA 4B6EA 1P04A 1KXFA 5SGAE 2PSYA 2BXUH 3B8JA 2LIZA 4CH8B 2XBYA 1GCTC 1GDUA 1ZZZA 1ELDE 2ZHDA 1C1WH 3OSYA 1Z1IA 4Y0ZE 5HIZA 1GBHA 3EBNA 3VGCC 4BAMB 2GZ8A 1AWHB 1EB1H 3ATMA 1SHHB 2GZ7A 1C2EA 4PROA 4CR5A 2IPHA 3HKIB 3MHWU 2NU1E 1F0RA 3UTUH 2C93B 2SGQE 1C5VA 2R2WU 1KDQB 2FOGA 1JRTA 1DANH 3BTQE 4BNRA 1EAXA 3U1JB 1E79D 2CK3D 4IMZA 1MKXH 5B6OA 1GBKA 2CV3A 4XE4A 1XKAC 4NFEA 1G9IE 1KY9A 1BTHH 1A0LA 1O34A 4YM9A 1ZPBA 3VXFH 3WY8A 1NRSH 2W7SA 4X1RU 1O3DA 3SJKA 1HGTH 3RXKA 5HIYA 2PGQB 2AEIH 3SGQE 3F9FA 1IQMA 4X6MA 3LGYA 1SGNE 2F9BH 1IHSH 1QJ7B 4ZHMU 1LQDB 4I32A 2PLXA 1KTTB 4RT1A 4CRCA 4THNH 2GKVE 1Z8IB 4ABAA 2ZPRA 1YPKH 4HTCH 5DK1A 3A85A 3Q3YA 3SI4H 4NIYA 1GI8B 4BANB 3E16B 2VH6A 2VWMA 3FP7E 1YGCH 1EJNA 2LP6A 8LPRA 5CMXH 1EFRD 3EAJA 3LKWA 3RM2H 1FAXA 1TGCA 4ZXXH 3E0PB 3NKKA 3UNSA 1SKYE 4TWWA 1P01A 1P10A 1NRPH 1ZPZA 3EYDA 1AZ8A 3KHVA 3VFEA 3F9GA 1EOJA 1EZSC 1GJ4H 2XRCA 2G55A 3S9CA 2SNWA 1SLVB 4K1SA 2AMPA 5E0JA 1BBRH 1RRKA 4Q80A 1NRRH 2A5KA 4GUXA 1D6WA 1WTGH 1G37A 1P9SA 1WSSH 6ESTA 3M3TA 1RJXB 1UTPA 3TJUA 2ZECA 2A4OA 2VIWA 1XXDA 2F9PA 3RXEA 2FDAA 5EOKA 3SNAA 5FXLA 1CT0E 1XUJA 1ELTA 1TRMA 3RUOA 3SW2B 3BV9B 3U98H 2OP9A 1DY9A 5CE1A 3I29A 1GBIA 1PPFE 1Q3XA 3SU3A 4B75A 4MG3A 2FODA 1FUJA 4GCHG 5F6MA 4NA9H 1ELBA 3CENA 1PPEE 1TWXB 1HNEE 2CMYA 4YT7H 2HRVA 1Z8JB 2BLOA 1DLEA 1PQ5A 4X1PU 2W5EA 3GYLB 1IQHA 1EPTA 1GCTB 2PFEA 1CQQA 2G51A 1AE5A 1GMDG 1C2JA 3P8GA 2BD9A 1HJ9A 3SNCA 2CHAB 6CHAB 1BOQA 1AKSA 1SGDE 4R0IA 3A89A 1KYNA 5I25A 1QHRB 2G52A 1FPCH 1MTVA 1O2PA 1GMCF 1LCYA 4RSPA 1UVPA 3LONA 1FQ3A 2Q6FA 1CVWH 2P8OB 3GDSA 2PKSC 4NFFA 1HYLA 4M9FA 3MTYA 1NTPA 4X6OA 4TWYA 1EUFA 4IN2A 4Z0KA 4MNWA 3ZZAA 2HVYB 1VKYA 2A2XH 5C1YA 1SGTA 1V2VT 1HJAC 3PTBA 1EASA 3BEIB 3WWBA 4RT0A 1YPEH 2HPQH 1FN8A 5FAHA 3M61U 1TOMH 1NU9A 2DE9A 1MBQA 3GY8A 4NSVA 2ZO3H 1C1MA 3CS0A 1YLCA 3PV5A 2PP6A 7GCHG 1MTSA 4ZKSU 1AD8H 1QL9A 1BTYA 1KDQA 2UUFB 4H6TA 2AH4X 1NRQH 3MO9A 2QA9E 4Q2KA 4B2CA 1AN1E 1FN6A 4NGAH 1OWDA 4D76A 1B0EA 1O3NA 2H6MA 1G2MA 2ZCKP 3LU9B 1T4UH 2Q6GA 3BSQA 1WXRA 1DY8A 1HAXB 1YPMH 3TK6A 4B2BA 2XXLA 1GJBB 3P6ZB 1HAGE 1KMHB 1OWKA 5ETXA 2OXSA 2A7JA 3D65E 3MMGA 1OWIA 3BN9A 5DP7A 5G4BA 1GL1A 1GL0E 1O30A 4FUFA 2Y5HA 2ZDKA 5A2MH 4FUJA 5JBBS 1XVMA 2P3FH 3A86A 3HGPA 1O2HA 3UAIC 1XUKA 1YCPM 3KQCA 2EEKA 5GJ4B 4BAQB 4FVDA 3TH3H 4JYVH 3CP7A 2J9NA 3TK5A 3E91A 1LO6A 1P03A 2Z9JA 1CA8B 1L1GA 3FAOA 4K8YA 1FV9A 3MU8A 1BMFD 3TVJB 3R3GB 5A8ZA 1AU8A 1HIAA 2OC1A 3PLBA 1FNIA 5JB9S 1BMNH 1NROH 1S81A 4WH8A 1AIXH 4LZ1H 5EXMA 2WPLS 5C5OA 5IDKA 1ZSKA 2G5NA 2ZG0H 4B1TA 2TGPZ 1C2KA 4JCNA 1QIXB 1EOLA 1NO9H 3P8OA 2VIPA 2FS8A 1EKBB 1UJ1A 1WYKA 1OSSA 1Y8TA 4ABIA 2H9HA 3P8FA 1K1LA 3SV8A 2QN5T 1MZAA 3WWFA 3SUEA 2BTCE 1CGHA 2BDGA 3MU5A 4O9VA 3A87A 2XC4A 4F4OC 1ZR0A 3BTWE 2XOKD 4I7YH 1TQ7B 2KX4A 1QB1A 5DN6D 4D7GA 1ETTH 1TGNA 2GV6A 1ZOMA 1F2SE 2G4UA 1PPCE 3KQEA 5CHAB 4MQAA 7LPRA 1ZMJA 3EA9A 3PTNA 1HCGA 1DWDH 4CBNA 5DG6A 1V2NT 3TK9A 1SGFA 1Y3VA 3PM3A 2J2UA 1THPB 1C2HA 2FOFA 1NZQH 1QB9A 2ANWA 2ZDMA 3OYPA 4X0WU 2JH6D 9LPRA 2PUXB 2EQNA 4XBCA 1IQFA 1HJAB 2WV4A 1MU8B 1ZTJA 3EE0B 1D6RA 3MFJA 4NA7A 2RA3A 3KN2A 5GXPA 1GJ7B 2WZQA 2G4TA 1GJ5H 5AF9H 1H1BA 1CA0C 3RU4T 3UY9A 2FM2A 1GHVH 2Y5FA 1T8MA 3MH6A 4RN6A 2FZZA 1V2LT 2FX6A 4HFPB 3NXPA 1ARBA 2I6SA 1C5MD 2FLRH 2ZHFH 1V2PT 1EQ9A 3F2HA 4X8SH 1SGEE 1EZUC 2F9VA 2NU3E 1ACBE 2WPKS 1W0KD 3AASA 1H9LB 5C17A 3T25A 2ZC9H 1GBFA 1SQRA 4H4FA 3QX5H 1WBGB 1O3LA 3SJOA 4IC5A 3T29A 1GHXH 1CT2E 3UWIA 1GJ6A 1AVXA 3ZVFA 4ZHLU 4MPWA 2A32A 3ZVGA 2GD4B 3AW1A 1MCVA 1XKBC 3QLPH 1C4U2 2ZFTA 2R3YA 1E1QD 2ANYA 1PQAA 1P9UA 3KGPA 2ULLA 3MNXA 3K9XB 1EP5A 1WQVH 1Y5AT 1O3EA 1FY5A 1OS8A 1GMHF 1AWFH 2GCTB 2TBSA 3P8NA 4GPGA 4U2WA 3Q00A 4VGCB 4DW2U 2WV5A 3KQ5A 1PPBH 2FIRH 2GJGA 1MKXK 3GCHC 2BD7A 1B7XB 4AFUA 4AG1A 2PHBA 3RXIA 1K2I1 2FO9A 2ZQ1A 2TGAA 1VGCC 1LPGB 1SLUB 5DP9A 2Y5GA 5EQRA 1O5AB 1O3KA 2OBQA 1YC0A 3ZYDA 1WQSA 2Y7ZA 1Z1JA 2ZP0H 3U1IB 3TH4H 4MPUA 4DT4A 1TMUH 3OAAD 3UREA 1JBUH 5L6NH 1L4ZA 1TONA 1VCPA 1MTNB 4O3UA 1NY22 1ZJKA 2BLWA 3KL6A 3RM0H 1C2LA 1K22H 3P17H 1O3HA 1MAXA 2YMSB 1B5GH 1VCWA 4AFSA 1AUJA 5C5NA 2P95A 4TSFD 2FPZA 1YPHC 4WJG2 8GCHF 3R0FA 4FUIA 3TLOA 1CBWB 3LH3A 4K1TA 1IQKA 1T7CA 4XOJA 3KQBA 3ZYEA 1A2CH 3F0PA 4ISIH 3O8RA 1C4Y2 3MOCA 1GVLA 4D8NA 2QAAA 1UVTH 5EPNA 1LHCH 1DOJA 1GI5A 1TQ0B 3TJVA 3W95A 1QR3E 3K6YA 3UUZA 2WUCA 1DFPA 1KXEA 3PMJA 3QWCH 2IN2A 2BD8A 2SGEE 4XFQA 4ZUHA 1N6YA 1YCPH 1W0ZU 3A88A 2FX4A 3A83A 1RS0A 1ZRBA 4NWKA 3PRDA 1QBOA 1CA0B 1W7GH 3A7VA 5JBAS 4AYVB 1NFUA 2WPIS 3OEED 1O2NA 4UONA 2G00A 3QDZB 3HPTB 3ZZ8A 4FU9A 3LJOA 4MPVA 1GBBA 1TGTA 4ISOA 2ZFRH 2VVCA 4KTCA 2WYGA 1BHXB 2ZDVH 2O8TA 4OS4A 1O3IA 3FO8D 5A8XA 2R9PA 3UR6A 4SGBE 4AC9A 5GCHF 2HNTC 1MTWA 2NWNA 1IQLA 1Y3YA 1J15A 3N7DA 2BLVA 5FL7D 1QBNA 3ATWA 2EI7A 1NPMA 3PYHA 5LPEA 2VVUA 5F8TA 1RXPA 2BY7X 1ANEA 5C20A 1G3BA 4K60A 1MAYA 1GMCG 1C5ZB 1ARCA 4DG4A 4B76A 5TCCA 2FOHA 4K2YA 3M35A 1HV7A 1SPJA 2KFWA 3UOPA 1AY6H 3SU4A 2D2DA 2OBOA 2H5CA 4ZMAH 3A7ZA 4O03A 3RXTA 2P16A 1S0QA 2PTNA 3QK1A 2VIQA 3GCHB 1UTKA 2GVFA 4Y7BA 3ZZ9A 3IG6B 1VGCB 1SR5C 4I31A 4OS6A 3AK5A 3ENSB 3I77A 3MO3A 3KNXA 4GSOA 1Y3XA 2FI5E 4WF8A 5T6FA 1OX1A 1ANDA 2RCEA 3SHAH 1QL8A 5A0CA 3K2UA 2UWLA 3KIDU 4ZAEA 2HLCA 4FETA 2AIQA 1SQAA 4ABDA 1QBVH 1T8NA 2GV7A 3TNTA 1RGQA 1O2UA 3VB3A 4ZH8A 1LHDH 1ZGIA 2EI6A 2Y80A 4TPIZ 2H9TH 1H4WA 1AUTC 1THSH 4YLUA 1HXFH 2A2QH 3LH1A 3SN8A 1F5LA 1YM0A 3E1XB 2FOEA 4BOHA 1ANBA 3FP8E 3SU2A 1FZZA 2EI8A 2F91A 1DX5M 1EAWA 1B0FA 1BTUA 3SHCH 2GZ9A 1O3PB 2CXVA 2JH0D 4NSYA 2Z9LA 2GCHF 4I8KA 1HDTH 1PQ8A 1UHBB 1LHFH 1MTUA 1LKBA 3A7YA 1GJDB 3MWIU 1AGJA 1AFQB 3OU0A 3U8RH 1O3FA 3MH7A 3H7TA 4ASHA 2PSXA 4Y79A 2GGVB 3C27B 3RLWH 2ZHEH 2W26A 1S6HA 2JKHA 1DUEA 1T4VH 1KXDA 2F3CE 2CHAC 1BQYA 1ZTLA 4FUEA 3UQOA 6CHAC 2ESTE 1QA0A 2J38A 1E35B 1NESE 3CNRA 4I86A 1ANCA 1GPZA 2QIQA 2A7CA 1NBMD 1ZHMA 2XC5A 1K0HA 2P8OC 1YP9A 5TJXA 3DUXH 5F53A 4ISNA 2ZFPH 5EPYA 1O2ZA 3V7TA 2Z9KA 2KAIA 1ZSJA 2W7UA 1A5HA 3SJIA 1OWJA 3QN7A 1C1VH 4MVNA 4Y8ZA 4MPXA 1H8HD 1QRZA 3NK8A 1ELFA 4I8LA 3KF2A 2FP7B 2C8WB 2A5IA 3A8BA 3UQVA 4FOUC 1GI4A 2UUJB 3T27A 1W3CA 3DFJA 2A4QA 1RD3B 1FX0B 2EC9H 2XBVA 5IYTA 4LZ4B 4YESB 2G5VA 1TRYA 1Q2WA 1VJ9U 1P2JA 2GT7A 4FXGH 2IOTA 3JZ2B 4H42U 2VB0A 2RDLA 2B0FA 4KKDA 3RXMA 4A1VA 3UWJH 3TH2H 1P05A 3M5OA 2BQ7B 3QZQA 5HYOA 2K7XA 1GI9B 1RIWB 3GDVA 3MNCA 1IQIA 1QNJA 1G32B 2XWAA 4X2VA 1FIZA 4F55A 1SFQB 2BYAX 2P59A 4X2YA 4AOQA 1WUNH 7KMEH 3A80A 2VVVA 2WHXA 3C1KA 1O2RA 1QJ6B 3ZIAD 3SZNA 1ZSLA 1AO5A 2O8UA 1EZXC 3PLKA 2R2MB 2H5DA 3A7XA 3RXRA 1FIWA 2ZU4A 1ORFA 1D3PB 1JWTA 1SBWA 1AQ7A 4NG9H 1O5EH 1ELCA 2JJ1D 3A8CA 2TGTA 1A0JA 1EAIA 1XVOA 2G81E 2AGEX 1H8DH 3OTPA 4UFDH 4X6PA 3T5FH 2WINI 4ZKOU 5CHBA 4HZHA 3OY5U 3UB0A 4XDEA 1EB2A 4ACBA 3RC5A 2Z3EA 1HAYB 1NT1A 2J92A 1ZHPA 5IK2D 1GMHG 4X6NA 1TOCB 5DP3A 5EXLA 3PROA 3RXVA 3O8CA 3O8DA 1PPZA 2ZGBH 1D4PB 3UNQA 5JPMH 2V35A 3TPIZ 2SFAA 2A1DB 2OC7A 3SGBE 3STIA 5CHAC 2Q6DA 3RXJA 3EE7A 3ZZ4A 2Y82A 5I46H 4ACAA 3BTKE 3S7KB 1NFXA 3STJA 2FLBH 1YPJH 3LPRA 1GCDA 1UHBA 1RTLA 1TGSZ 1HAPH 1ETSH 4FVBA 1T8LA 3SU0A 1LVOA 1G36A 4I8HA 3RXSA 2ZPQA 1H9HE 3KQDA 4Q7YA 5ABWA 4MNXA 3GICB 4NIWA 3MNSA 5DP4A 1GI2A 1SG8B 5JB8S 1D3DB 3EQ0H 1LPZB 5E0GA 4DIHH 2NU4E 2BVSH 3Q3KA 3QZRA 3ZVEA 3NRLA 3DFLA 1AZZA 2QCYA 3F1SB 3UOUA 3D23A 4IS5A 8GCHG 3F6UH 4Q7XA 1TPOA 3UNRA 1UO6A 1GBMA 4F48B 1SGIB 2BY6X 1FI8A 1CT4E 4INHA 1YY3A 4BXSA 2AIPA 1FAKH 3ESTA 2BQ6B 4CR9A 3GY4A 1TGBA 1DLKB 3B23B 2A7HA 2HPPH 4RKJB 4FU8A 3BIUH 2AGIX 1DXWA 2UWPA 4KTSA 2PKAB 4AORA 4AFQA 2BD2A 3UIRA 1YCPK 4B73A 1GHYH 4A6LA 1BT7A 4WMFA 1TB6H 5J4SA 1X7AC 1L4DA 2BX3A 5EQQA 2EA3A 3OTJE 4AFZA 2ZU1A 4Y76A 2WV9A 3EDXB 4CRAA 3Q76A 1IAUA 1SGRE 2UUYA 2YNBA 1VJAU 1PJPA 1K9OE 4NA8A 1TNHA 4YOIA 5C3NA 3NPSA 4OS5A 4O97A 4OGXA 4U30A 1HRTH 1GBJA 1VITG 1K28D
chains in the Genus database with same CATH topology
1CSOE 2BDIA 1S82A 4B2AA 1TLDA 2GCTC 1UCYE 8ESTE 1V2QT 3BEFB 4VGCC 4CH2B 1UK3A 1BBRE 2GDDA 1MZDA 5GCHG 4LXBH 4CRFA 1JRSA 3MNBA 2ZU5A 1S6FA 3L6PA 5C1XA 1HAIH 1RFNA 2PUQH 4X1QU 2QXGA 1HAHH 1HLTH 1UVSH 3DA9B 1SLWB 3PWBA 1DE7H 1O2OA 3GY7A 1N8OB 2ZGJA 4X2XA 3NCLA 2BZ6H 1BJVA 1O38A 4BTTB 3BG4B 1HUTH 1O3OA 1O5DH 2OC8A 1K1OA 4WMEA 2FOBA 1GDNA 1QTFA 1MTNC 1C2DA 2BDHA 2VU8E 3U9AH 3VPKA 1DITH 1EP6A 1O2LA 1UK4A 2JETB 2BD4A 1DPOA 1DT2A 3H7OA 2C4FH 1ID5H 3AAUA 1SOTA 1CBWC 1Z8RA 1FXYA 1MCTA 4TPYA 3QGNB 1ABIH 1C1TA 3V13A 2PR3A 4YT6H 3FVFB 3FFGA 3RU4D 3LOXA 3E8LA 3RXCA 5DKMA 1PFXC 1GBDA 4Q7ZA 3NZIA 2G8TA 2A31A 2QXHA 1JIMA 1C2IA 2BY8X 1C5OH 1WAYB 5AFZH 1C1RA 1G3CA 4WXIA 5EXNA 3CS7A 1E0FD 4KELA 3SO3A 1O35A 4YLQH 1T8OA 3A8DA 3ITIA 2ZF0H 2JH5D 3SUFA 1ZPCA 2AYWA 1WTHD 4H6SB 2GCHG 2IJOB 4GVUA 5JDUB 3RDZA 3GCNA 1LVYA 1ELAA 3Q3XA 1UTOA 4Y0YE 5LPRA 3DT0H 1SQOA 4CBOA 4XSKU 3KEEA 4IBLH 3T2NA 3ZZ7A 1QCPA 3AVZA 1GBCA 2O8MA 1CE5A 3A8AA 5AFYH 4ZKNU 4A92A 1AB9B 1GI3A 1P2IA 1J17T 1L0ZA 1F5KU 1HAVB 1TALA 2QXIA 3RC6A 1C1QA 1WOFA 1ZHRA 1DM4B 4CRGA 4JK6A 2QV1A 2BOHB 5ESTE 1MU6B 3MO6A 3B9FH 1O31A 4M7GA 3RXPA 3TU7H 4IN1A 2GTBA 1DWEH 3S0NA 2ZU2A 4WH6A 1O2SA 1GDQA 3M37A 4OS1A 6GCHF 5T3HA 5JYIA 4TYDA 4X1NU 1JMOH 4JMYA 1O2XA 4A1TA 1LPKB 1C5YB 1C1PA 3E3TA 2LPRA 1EX3A 1QGFA 1C2FA 1TNJA 3ZZ5A 9ESTA 3BTHE 1HXEH 4YOGA 1N1LA 6LPRA 4ABJA 3MYWA 5BPEA 4F49A 3RXOA 4WY3A 3DD2H 1ZJDA 2Z9GA 3BTGE 1O36A 2ZKSA 3SV7A 1E37B 1QQ4A 1TYNA 1O3AA 2ALVA 1YF4A 3HK6B 5C1UA 3RXHA 2CN0H 1MMJN 2C8ZB 2FYRA 2Q1JA 3OX7U 4TY7A 3F9EA 3RLYH 1QFKH 5F8XA 4BTUB 2J4IA 2FESH 2HALA 1ZRKA 3TNSA 1ZYOA 3OY6U 1GWAA 1AVWA 5E2OA 4CRDA 1O39A 4XBBA 3T26A 3BF6H 3V12A 1Y3UA 2TRMA 3SNBA 1GBLA 3M36A 4Y8YA 2ZCLP 1AFQC 2WPMS 4FU7A 1CHOF 2BXTH 1ESTA 2OINA 2VGCB 3HGNA 3SI3H 2ZCHP 2P94A 1XMNB 3SU6A 1O37A 3GCTF 1LTOA 1L1JA 5H4IB 3RP2A 4MDSA 3N7OA 4WWYA 3FP6E 1ZLRA 3KCGH 1LHEH 4GLYA 1W2KH 1P12E 2ZGXH 1GHAF 4A1XA 4KTUA 1NS3A 1HPGA 1VITF 1UMAH 1P3CA 1QB6A 1EJMA 2VINA 5C67A 5TCAA 4OS7A 1SGFG 2A45B 1DXPA 3BTFE 4TY6A 1P06A 1OYQA 2P3TB 3QTOH 2B5TB 1O0DH 1VCQA 4DCDA 2VNTA 1XX9A 1C5TA 1KXBA 3U8OH 5E0HA 2R3UA 1TNGA 1H9IE 3GISB 2F9UA 2Y7XA 1W10U 4ZHAA 3FZDA 1ZMLA 1BRUP 3LC5A 4E06H 1TNKA 3BTDE 1TABE 3LGVA 1QY6A 1BMAA 1TBQH 3A81A 1BTXA 1MUEB 1KLJH 1J8AA 5GWZA 3F68H 4WXVA 4JZIA 2TPIZ 4CHAB 5BRRE 4UE7H 1YPGH 2ZIQH 3MU4A 1HJ8A 1AFEH 3ATIA 3SJ9A 2AFQB 1KIGH 2THFB 2CGAA 3I78A 1FY1A 1MQ6A 1QL7A 1H8IH 3RMMH 4U01A 4ESTE 1AMHA 5FPYA 3SQHE 4FUBA 1F5RA 2V3HH 4UFFH 3TGJE 1ETRH 1RIWC 1Z71A 1GG6B 1GI0A 3P92A 3URDA 1V2UT 1QRXA 2ZDNA 4ZROA 1XUFA 2BY9X 4ZXYH 4AB9A 2XYAA 2WUBA 3D49H 4HGCA 1TA2A 4MTBA 3VEQB 2ZZUH 2PTCE 5EW2H 1W13U 4I33A 1AVGH 3SJ8A 4NIVA 3VXEH 2BDCA 1K1JA 4D7FA 2ODPA 3RXAA 4LK4A 5EGMA 1CGIE 2H1UA 4ABFA 2GMTB 4UFGH 2XTTB 2BX4A 1W7XH 1N6XA 2V0BA 1TNIA 1PYTD 1O32A 2Z6BD 1P2QA 3UFAA 3M3SA 1GHWH 3SU5A 3EA8A 2SGPE 3MH5A 2ZGHA 1V2JT 2XWBI 1SSXA 4J1YA 1J14A 1GBEA 1OKXA 1OXGA 1C2GA 4BAKB 1OWEA 2BDBA 1EPTB 2WYJA 1P2OA 1CHGA 1KLIH 4YTAA 3T62A 3TITA 3ZZCA 2V6NA 2CF8H 4ISHH 4I8GA 4ISLA 4YOJA 1A3EH 1P2KA 1V2OT 3S9AA 3IITA 1UTNA 4CREA 3T28A 4K69A 1AKSB 1QA7A 4BAHB 2DUCA 5HXFA 2FI3E 2ZFFH 2FYQA 5DJ7A 5A8YA 1SMFE 2BQWB 1O2MA 1HB0B 4X2WA 2OUAA 3LGTA 1OP8A 1KSNA 1ESBA 1BUIA 4AGJA 1K21H 2D8WA 1T32A 1RTKA 3LT3A 4NZQA 4BXWA 1MH0A 2AERH 3H5CB 1D3TB 4CRBA 1ESAA 3GDUA 4AZ2B 1YPHE 3GYMA 5L30H 1GHZA 1BTPA 2HNTF 5A0BA 1GJ8B 3RC4A 1OYTH 1VZQH 2XW9A 1O3BA 2D1JA 2GT8A 2VIOA 3BIVH 4WVPE 3LGIA 4JZEH 2B8OH 2BM2A 4BAOB 3URCA 1BRAA 1SGYE 3E6PH 1UTJA 3D62A 4Y6DA 1C5QA 2OC0A 1TMBH 4X8VH 1DSTA 1O5GH 1F0UA 1V2WT 1A5GH 1C5NH 1KXCA 1O2VA 1JXPA 4IMQA 1SGCA 1UVOA 4AG2A 3K6ZA 1BTWA 4Y8XA 1WU1A 4NZLA 5A09A 2R0LA 3VB7A 4D9RA 1WV7H 2ZFQH 2Y81A 3VB5A 2ZHWH 3M7UA 4JZFH 2YOLA 1S83A 3S7HB 2QYIA 3QGJA 3RXQA 1ELEE 1UTMA 2P93A 4B74A 1DWCH 5FCKA 4YO9A 5EG4A 1FPHH 2ZU3A 3W94A 2WPHS 4UEHH 2B9LA 2HNTE 3GOVB 2QF0A 3RXBA 5JBCS 4K1EA 1O2IA 1ELVA 4YZUA 1MKWK 1O2TA 1TX6A 1UTQA 3QTVH 2ZDAH 5EW1H 3HATH 4KGAA 1HIAB 1Z8GA 3GCOA 2K1QA 1A46H 2Z3DA 1GBAA 1O5CB 1EAUA 1C5WB 3TJOA 5DP5A 2Z7FE 4X1SU 1NFWA 2ZEBA 2J95A 1UCYH 3GY5A 1DVAH 1N8OC 1J16A 1DSUA 2FOMB 2HGTH 2C90B 1QURH 4UDWH 1JIRA 3BG4C 2QY0B 3ZVCA 2FTMA 1DDJA 4GHTA 1TBZH 3A84A 4JYUH 1OP0A 2ZDLA 3SV9A 3F9HA 1Y5BT 1W14U 4A7IB 5PTPA 1TBRH 2JETC 1IQGA 1O3JA 6GCHG 3LJJA 2OLGA 4IC6A 1C1NA 5AHGH 1SOZA 5FBIA 5LPFA 1ZGVA 5DGJA 1OP2A 1BMLA 4DJZB 1SVPA 4MLFB 3M5LA 3A7WA 1IQEA 3AAVA 1U6QA 1XUGA 3SGAE 1C5PA 4DVAU 1TIOA 1A61H 3DHKH 3A82A 1YLDA 1SQTA 4UFEH 1G3EA 2QC2A 1DS2E 3VGCB 3ODFA 3ATLA 1E38B 1EATA 4JZ1A 3GY6A 4XBDA 1C9TA 1O5BB 4GHQA 2ASUB 3SORA 2ZQ2A 3IWMA 2ZFSA 3M5MA 3PMBB 1MD7A 1Z6EA 1HFDA 1PPGE 2O9QA 3RMOH 2GDEH 3FZZA 1GBTA 2C8XB 3P70B 3MU1A 1KTSB 4K8BA 5J4QA 2QF3A 2ILNA 2AMDA 1SI5H 2VIDA 1O2GH 1EJAA 1TNLA 2CF9H 2CJIA 2R0KA 1A4WH 1HAZB 2V3OH 1S0RA 1O3GA 1A0HB 4Y7AA 1G3DA 4INKA 1TX8A 5GPIB 1CHOG 1BZXE 5FPTA 1GI1A 2VH0A 4BTIB 1OWHA 2FOCA 3RXFA 5EQSA 2BOKA 1DUAA 3GCTG 5HGGA 3RXGA 3LDXH 3BTEE 1O2JA 1WCZA 3VB4A 1A7SA 1F0TA 3ZV8A 1AB9C 3V0XA 2SNVA 5GIBA 2STAE 1S84A 1GHAG 2FS9A 4WMDA 3BG8A 5EU8A 3LGWA 2ODYB 1W11U 2Z9IA 1LHGH 1P09A 1C5XB 5LH8A 3RXDA 2ZHQH 1TMTH 4I8JA 4NWLA 1ZMNA 1O2QA 1UK2A 1TX7A 1EZQA 2FMJA 4Y11E 3ZVDA 1P2NA 2XBXA 3EA7A 4MNYA 4OGYA 3RU4E 2DE8A 2ZGCA 4E7NA 3JZ1B 2RG3A 5F03A 1OOKB 1G2LA 5FX5A 5C2ZA 4K5ZA 2FEQH 5L2ZH 1BA8B 1Y5UT 1FLEE 2OD3B 1A3BH 2HWLB 4JK5A 4ABGA 4DT7B 2STBE 3Q77A 4DGJA 4Z6AH 5HM2A 1CGJE 1XM1A 2PGBB 2QGRA 3ZZ3A 5HM9A 1O3MA 1K1IA 1O3CA 3M3VA 1Y59T 1CU1A 3BEUA 1TPAE 4X8TH 3ELAH 1FJSA 5JBTA 2ZTYA 1O33A 1P3EA 3U8TH 2BD3A 3P95A 1A1RA 1GVKB 1MQ5A 3L33A 5F8ZA 2BY5X 3MI4A 3SV2H 2Z94A 3ZZBA 3LGUA 1TAWA 2NU2E 3U69H 2ANMH 4IGDA 1PPHE 1BRBE 4ABHA 3ZZ6A 1ZTKA 3SU1A 1IQJA 3NWUA 1CO7E 3SBKA 4U32A 1P11E 2C8YB 4O3TA 2J34A 2J94A 3QO6A 1D9IA 4LOYH 1GGDC 1AHTH 2SGFE 2ZTZA 2C3SA 1PQ7A 2A4GA 1GHBG 3SNEA 2ZTXA 5GDSH 3ZVAA 2VGCC 1P02A 2HOBA 1FONA 1K1PA 1K1NA 1SL3A 4AX9H 4INLA 1HBTH 3TIUA 3LIWA 1PYTC 1BJUA 1DWBH 5FPSA 4B71A 4SGAE 2PKSB 1BMMH 1P8VC 3SV6A 2A0QB 2OCVB 2TGDA 3HKJB 3G01A 1MKWH 2W3IA 1V6DA 3PO1C 4QT8C 2F9OA 2ANKH 2A4RA 1NFYA 2ZPSA 4FUGA 1LMWB 1TPPA 2FTLE 4GAWA 4JZDH 1UVUH 1NC6A 1SHYA 4AYYB 2BZAA 1TRNA 2ZA5A 5FX6A 3E90B 4AGKA 3RXUA 4DURA 4HI3A 5DP6A 1BB0B 1RTFB 2XBWA 4IW4E 5FBEA 2ODQA 1C9PA 3SUDA 3TGIE 1KLTA 2HVXA 5FCRA 1SLXB 4A5TS 2PKAA 2GX4A 3RMNH 4CHAC 2RA0A 3SUGA 2BVRH 1LVMA 4NIXA 2AMQA 1ABJH 1F7ZA 3M7QA 1P57B 4E05H 1G30B 2BMGB 1OPHB 3VB6A 1LVBA 2VWLA 1IHTH 4JYTA 1FMGA 3L3TA 3ATKA 4X8UH 3PMHB 1K1MA 4GCHF 3TJNA 1GI7B 1GJ9B 1F92A 3PV4A 1O2KA 2O8LA 1GG6C 3E0NB 1VR1H 1L1NA 3A7TA 1LKAA 5FHTA 1C5LH 1YBWA 3BTME 1FY4A 2SGDE 3PLPA 1GMDF 1BIOA 3MU0A 2D26C 2H2ZA 1VITH 3EGKH 3PMAB 1INCA 4D9QA 2OQ5A 2BD5A 5AVDA 1LDTT 2VJ1A 1C1OA 1L2EA 2GMTC 1F0SA 5DPAA 3TGKE 2F9NA 1AE8H 1YKTA 1DICA 1TE0A 2BVXH 4KP0A 3S9BA 2QXJA 1V3XA 1XXFA 1GI6A 4Y71A 1V2MT 3UR9A 2ZWLH 1SGPE 4OS2A 1C1SA 5K0HA 1SB1H 1MBMA 2FXRA 2FI4E 1GGDB 3O8BA 4FUCA 1AI8H 2XNIA 1Z7KA 1SFIA 1EPTC 1THRH 4R8TB 1E36B 2Z3CA 3S69A 1Q31A 1HAOH 2ZI2H 7GCHF 2BDAA 3QUMP 1QQUA 1V2RT 1M9UA 3GY3A 2BLQA 2FWWA 3RMLH 2OQUA 4NCYA 2M5TA 1UCYK 2O8WA 2VWNA 5E8EH 2B7DH 1BBRK 2ALPA 5LGOA 3PO1B 1BHXF 1W12U 3SOSA 2W3KA 1BCUH 1TA6A 2KAIB 1QRWA 1XUHA 3M5NA 2P3UB 1Z6JH 4UD9H 1BTZA 1NU7B 3LC3A 4Y10E 3PWCA 5K7RA 1BDAA 4ABBA 1C5RA 3MH4A 1D3QB 1FY3A 3ZV9A 5L2YH 2WPJS 1P0SH 1TFXA 2A5AA 1SC8U 3BTTE 3FANA 5T6GA 1QJ1B 1P2MA 1ELGA 2AS9A 3K65B 3AW0A 2OTVA 7ESTE 1EXFA 2SGAA 5DP8A 4ABEA 1T31A 2H9EH 2AGGX 3SNDA 2BB4A 1W0YH 1J9CH 4DIIH 3RXLA 5T6DA 4DY7B 1YYY1 4FUHA 2PW8H 4MNVA 3ZZDA 1IOEA 1O2WA 3SQEE 1HAVA 2BHGA 2GP9B 5HMAA 2TIOA 2XCNA 1FDPA 1NN6A 3ZVBA 4AB8A 1GJCB 2FOAA 2UWOA 1V2KT 3NUMA 2VWOA 2PV9B 3ODDA 1C5UA 1O2YA 3PB1E 1BITA 2NU0E 1C1UH 1S85A 1GHBF 2ZNKH 1NRNH 1XUIA 1SGQE 1YPLH 4J2YB 1JOUB 3M7TA 1LQEA 8KME2 1MD8A 1C4V2 1E34B 2I6QA 1GJA