2A4GA

Hepatitis c protease ns3-4a serine protease with ketoamide inhibitor sch225724 bound
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
181
structure length
181
Chain Sequence
b'APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 protease/helicase
publication title Hepatitis C virus NS3-4a serine protease inhibitors. SAR of P2' moiety with improved potency.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Viral protein
total genus 43
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2a4gA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2a4gA01
2A2QH 1BMLA 2A7HA 2BD4A 2P93A 3SUFA 4DG4A 1MD7A 1SB1H 3GY5A 1NRQH 5GNDA 1TE0A 1SQTA 1VGCB 1CT4E 1MZAA 3A84A 1BCUH 3M3SA 4RSPA 3UOPA 4B1TA 2QY0B 3RU4E 3NZIA 1SGEE 1O33A 2Z9KA 1BTZA 3PLPA 1BBRK 1EZSC 4ZH8A 1C2DA 4ZXXH 2BXTH 1SPJA 1NC6A 1KTTB 1VCWA 1EASA 4Z0KA 4JMYA 3SUDA 2A4OA 1C2KA 1C1UH 3LH1A 4VGCB 2GD4B 4OS1A 3S0NA 1T8NA 2FS9A 1BHXB 5GPIB 3RXRA 3ZZ5A 2FLRH 4GPGA 1GBKA 1SGTA 2GCHF 2WYJA 1OP0A 2RDLA 1C5LH 1E0FD 2GGVB 1SGQE 3T27A 1F2SE 1TQ0B 3OY5U 4NWKA 4CREA 3E3TA 1S0RA 3SJ9A 1AB9B 1EJMA 1YLDA 1TX6A 4KP0A 1MTWA 4B6EA 5C5OA 2XCFA 1AIXH 1SQOA 2VIVA 4Y10E 3M7QA 3ELAH 5GIBA 3I78A 4CRCA 1TMUH 4ABAA 3A87A 4XDEA 1OPHB 2QXGA 4NA9H 1C5SA 2BY9X 1C5MD 2JH0D 4FUEA 4SGAE 4XBCA 1TNJA 1C5NH 2WV5A 4ZXYH 5E2OA 1GBTA 3A80A 3A89A 3ATLA 4IN2A 1AFQC 4KTSA 4YT7H 2R2WU 1HAXB 2XWAA 5LGOA 5FPYA 2OUAA 3OY6U 2I6QA 2F9BH 3BEIB 1YF4A 2ZO3H 4ZUHA 2A2XH 3F68H 3GCTG 5CMXH 2HVXA 5T6GA 3SU5A 2BQ6B 3VB4A 1ANEA 2NWNA 1NZQH 1AVXA 4CHAC 1GBIA 4INHA 1A3BH 1Y5AT 2W7UA 3GY6A 4WH8A 4JK5A 3AASA 5A0BA 1JXPA 2FI5E 3FFGA 2XBXA 2OC1A 2TGTA 2W3KA 1GHBG 1SHHB 1ZYOA 2SGFE 1C1MA 3NK8A 3BG4B 2FODA 3DT0H 1NROH 3KGPA 5JBAS 2XYAA 2TIOA 2PTCE 4BOHA 1K21H 1A0LA 1C1WH 3C1KA 1PQ7A 4DT7B 2HWLB 2UUKB 7LPRA 5HYOA 3SV9A 1GJ4H 1ELEE 1O5BB 1A46H 4BAQB 5C1YA 1LVOA 4INLA 2BDIA 2C93B 4YOIA 2ZHWH 3RUOA 3TGIE 3P6ZB 1O5CB 2Z9JA 1PPFE 4AFZA 3FP6E 2V0BA 3LOXA 3F9GA 1HYLA 2QF3A 3ZYEA 1JMOH 3SNCA 1BMNH 1Y8TA 4K60A 1AO5A 1U6QA 1AMHA 1ZTLA 3ZVCA 2O9QA 1DWBH 5BRRE 3HKIB 3KQEA 3ZV8A 4M7GA 1BTWA 4ABGA 3QN7A 3OTPA 4FUIA 1TWXB 2H9HA 4DURA 1BTUA 1CGHA 3M35A 4TYDA 1MTNC 1MQ5A 2Y82A 1P2KA 3RM0H 2CHAB 1HPGA 3TK5A 3M5LA 2OQ5A 1D3TB 1BQYA 2GT8A 1HV7A 3E0NB 1O2QA 4NIWA 3ZZCA 1GI8B 3RXTA 1GJBB 3UPEA 1GHAF 4YESB 3V7TA 4FUFA 2CV3A 4Y0ZE 1Z6JH 1Z8GA 1UTLM 4E05H 1DX5M 3ZV9A 4DW2U 3PLKA 3B23B 3KNXA 4MNYA 4YTAA 1IQLA 1HB0B 3LH3A 2FI3E 1LHFH 3LKWA 2G4UA 4IC6A 2FOGA 4F49A 1C1VH 2BY6X 3ZZ9A 4K5ZA 3ZZ6A 1F0UA 1TNHA 2A4RA 1GI7B 3A8BA 4JZDH 1Q3XA 1SFQB 2NU0E 2D2DA 5E0JA 1V2QT 5C1XA 5F6MA 1O0DH 1XUGA 2AMDA 3GOVB 3SQHE 3K6YA 2H5CA 3LPRA 1W14U 1HAGE 2EI8A 2SGAA 2ZKSA 5EG4A 2Z6BD 2SNVA 5LPEA 1GJ5H 1AUTC 2PW8H 4H4FA 1EXFA 4DCDA 4Y7BA 1ESBA 1AVGH 1EATA 1S82A 1IAUA 4K3JA 2SGPE 1FY4A 5EGMA 3BTTE 1FONA 1QHRB 3UQOA 1BIOA 3GYMA 1F92A 3UNSA 1CHOG 1TPOA 1OWIA 5JB8S 2SNWA 4CBNA 2AGEX 1FLEE 1HJAB 1UVPA 3UWIA 2BVXH 4X6OA 2CJIA 1W3CA 1DICA 5EXNA 3RXGA 2EA3A 4CH8B 1OP2A 2I6SA 1QR3E 1HCGA 2FYRA 1O2GH 2C8WB 3LJJA 1HFDA 2M5TA 2WV9A 4ABEA 1JIMA 1BB0B 1O5AB 1QL8A 4DY7B 3A8CA 3HGPA 1EPTC 5LPFA 1YLCA 2PFEA 1SI5H 2JH6D 1C1SA 1QL9A 2BD8A 1SFIA 1OWDA 3P92A 4RI0A 3SU6A 3OYPA 1GHZA 2VU8E 1UK3A 3M5NA 3V3MA 2C4FH 5J4QA 1GBAA 2OBQA 3QLPH 1C9PA 3BF6H 4XE4A 2AGGX 1PYTC 2PKSC 1EB2A 2P3TB 5I25A 4X0WU 3E91A 2AS9A 3A7VA 2Z3EA 1O2JA 5EXLA 4H42U 4NFFA 4BANB 1TRYA 4Q7YA 1ZSKA 3Q77A 3LONA 2IOTA 2WPKS 4NSVA 4GLYA 4XOJA 2OC7A 2F91A 1IHTH 1TFXA 1W7GH 3E0PB 1MQ6A 1RTFB 4UE7H 3FAOA 3SUGA 1JOUB 1GG6C 1LHDH 1P04A 5IYTA 3LGYA 3FZDA 1SGFA 1YCPK 1B0EA 5HM2A 5I46H 2FXRA 1BTPA 1ZJKA 3RXSA 3L6PA 3D62A 1GMCF 2C8XB 1GCDA 4INKA 4NIVA 1A5HA 3E1XB 1GPZA 1Y3UA 3V13A 1GCTB 1F0RA 2Y7XA 4AFSA 3R3GB 2XW9A 1WCZA 3O8RA 3RLWH 1FY5A 4D76A 1GBCA 1GBFA 1WU1A 5EODA 3ZVBA 2BZAA 4AB9A 2BD3A 2QGRA 1OOKB 2FESH 2P3UB 4DJZB 1P11E 2CN0H 3Q76A 4OS6A 2GZ9A 5EXMA 2BQWB 4MLFB 4IMZA 2XC5A 3TJVA 1JIRA 4NCYA 1FI8A 1Z71A 5GDSH 3SU2A 3AAUA 2WPLS 4J1YA 3ZVAA 4K8BA 2J95A 2GTBA 1Z1IA 1XX9A 5C1UA 1OS8A 3Q3KA 2FOCA 2BB4A 1ESTA 1YCPH 1C5VA 4IGDA 3QX5H 1UTPA 1O3LA 3VEQB 1K1NA 1O5EH 5DP8A 1QBOA 1O3MA 1WSSH 1E35B 1NY22 1C2HA 7GCHF 2Z94A 1O3DA 1BTYA 1TPPA 4KELA 3ZVDA 5LPRA 1QQUA 4J2YB 2ZWLH 3RC4A 2BDAA 2AERH 1HGTH 1MAYA 1SGCA 4QT8C 1UTNA 2Q6FA 2B5TB 1C5OH 1V2UT 2DUCA 5T6FA 1QJ7B 3ATWA 2R3UA 2VIDA 1IQIA 4HI3A 1DUAA 2UWLA 1H9IE 2OD3B 3VB7A 3W94A 4GCHG 1YPJH 1O36A 1NT1A 3ZZ3A 1TGNA 3BTGE 3UFAA 3MH5A 1BTHH 2BD2A 1CQQA 1RIWC 1XMNB 7ESTE 8LPRA 3VXFH 1C1QA 3A85A 1OWJA 1WTGH 4IMQA 1C1PA 2ZTZA 4I32A 2HPQH 1ZPBA 2FIRH 4ZMAH 1INCA 1BOQA 1CA0B 3ODFA 3K6ZA 2A31A 5L2ZH 1TIOA 2BLQA 3UQVA 1AE8H 1O2KA 1ZHMA 1EAWA 1XXFA 2CGAA 3CS7A 2BLWA 2D1JA 2F9VA 2OXSA 1GMHG 4MPUA 2A7JA 3UREA 1AUJA 1V2MT 1IQEA 1A0HB 2ZDVH 1TOCB 1WUNH 3Q3XA 3GY2A 1YM0A 1RTLA 1KTSB 4ISLA 3ZZAA 3T29A 5TJXA 3GCTF 2PLXA 3G01A 4GVUA 5HXFA 2FDAA 1WQSA 4ABBA 3U8OH 1TAWA 1KIGH 1KSNA 1F5RA 4TPIZ 2W5EA 1C2LA 4DIIH 1KLTA 1YP9A 4X8UH 1PJPA 4MNVA 3FP8E 4NA7A 1ARCA 1SG8B 3M36A 3ZZ4A 1J17T 3DHKH 4YOJA 3KQCA 4JYUH 4NIYA 1L4DA 1GHBF 1CBWB 1LMWB 2ESTE 1GI9B 2P16A 3UWJH 1G32B 4DOQA 1CGJE 1JRSA 3PO1C 4BAMB 1V2RT 3IITA 3TK9A 1P57B 2P94A 4X8TH 1HDTH 1ZJDA 5FAHA 2A5AA 2Y7ZA 2ZEBA 2ZDAH 1DXPA 3GICB 2TGAA 2VH6A 4XFQA 2QCYA 1DXWA 3EDXB 2JKHA 1K1OA 1OXGA 1PFXC 2HNTC 1GI1A 3LJOA 1G2MA 5E8EH 1ELDE 1PPEE 5SGAE 1L0ZA 1MTUA 2VWLA 5LH8A 3TK6A 1TB6H 4MVNA 4NG9H 2CXVA 1K1PA 1GI3A 1YC0A 2FOFA 4XSKU 1GWAA 2GT7A 1CSOE 5B6OA 1NRRH 1LHGH 1FQ3A 3AVZA 4YLUA 3MOCA 4HZHA 3O8BA 5C20A 1S6FA 1K28D 1PQ8A 4Q2KA 3SN8A 2PTNA 4K1EA 4PROA 1HAOH 4JZIA 3HGNA 2BD7A 3M5MA 2WZQA 3Q3YA 4Y0YE 3KF2A 2FX4A 1P0SH 2ZU4A 4I8GA 4Y8XA 1MMJN 1GI0A 3MMGA 1XUKA 4ABFA 1TGTA 1O35A 1SLUB 3TH4H 1AI8H 2SGDE 2HPPH 2W26A 6CHAB 1TALA 4TY7A 3RU4D 2K1QA 3NPSA 1NN6A 4NSYA 3TNSA 2BDHA 1CA8B 1FY8E 4CBOA 4E7NA 1GHYH 1SBWA 5A0AE 1JRTA 2VVCA 1O38A 3RXMA 1AGJA 3SV7A 2UWPA 2BVSH 2BLVA 3ESTA 1O2PA 2SGQE 3LGIA 1ELFA 3LDXH 3RLYH 2FLBH 2PHBA 3SNAA 3L33A 5G4BA 2FPZA 2OP9A 2R2MB 1P2JA 3U8RH 4A6LA 2ILNA 2ANMH 3NUMA 4B2BA 5GJ4B 1RJXB 3RXHA 4O97A 2G55A 1GI4A 1D3QB 4WXIA 4ZHMU 1GI5A 2ASUB 1QGFA 2GMTC 1TYNA 1E37B 1S0QA 1GBLA 1QY6A 2EEKA 4YLQH 3O8CA 3RMMH 2ALPA 3ATIA 1HRTH 4AYYB 1BA8B 2G52A 1V2PT 4B75A 1BRAA 3SNDA 5DP9A 3O8DA 3ZZDA 3MH7A 3TJOA 1BRBE 1C5ZB 3MO3A 2Y6TA 1IOEA 1S83A 1GGDC 1DDJA 3SI4H 2EI7A 1PPHE 1CHOF 3F9FA 4UEHH 2ZHEH 3RXIA 2XXLA 3RXOA 3GCHB 1G30B 1P9UA 2BDYA 1UK4A 4WJG2 1VJ9U 2R0LA 2QA9E 5ETXA 1K1LA 1C2FA 4R0IA 4UFFH 5F03A 1LVBA 1GVLA 1XKBC 3RXVA 3D65E 5FHTA 1BBRH 1IQHA 1O3IA 4ZHLU 1FMGA 3BTEE 3MI4A 1EJAA 3QGJA 3SW2B 3L3TA 4I8LA 1AN1E 1KDQB 4CRGA 1GMDG 1GBBA 5A8ZA 1ELBA 1XUHA 1YPMH 5F8ZA 2BD5A 3K65B 1A5IA 3BTDE 3MU1A 5DP3A 3RXDA 1UTQA 2STBE 1B7XB 5DP5A 5DO4H 1AU8A 3NWUA 1QJ6B 5TCCA 1C9TA 1CT2E 2P8OB 2FTMA 4YO9A 4UFGH 1DY8A 3C27B 2F4LA 1YPKH 3RDZA 3SU1A 3SZNA 1T31A 3TVJB 3RXBA 3K9XB 2JETB 2GZ7A 1GDNA 2IJD1 3ZVEA 1UMAH 2PV9B 1EP5A 4AX9H 1AKSB 1HJ8A 4JZFH 2VIOA 3E90B 1Q2WA 3U1JB 1AD8H 1EQ9A 3MNXA 1LHEH 1A61H 1YGCH 1FN6A 2FMJA 2ZPRA 4LZ4B 1LPGB 2Q1JA 4TWWA 2GDEH 1YBWA 1GDUA 4O9VA 2PGQB 3A7WA 2NU4E 3EYDA 1MUEB 1TPSA 1Z7KA 3GDSA 5AFZH 2JH5D 2HNTF 3LGTA 4X2YA 2P3FH 2H9EH 1FJSA 2ZQ1A 1DANH 4X8SH 1C1RA 1QB1A 4JK6A 3TU7H 1LTOA 1ZLRA 2BDBA 4TWYA 1IQNA 1FNIA 1IQKA 1L1NA 1UK2A 2QN5T 5T3HA 1O3NA 1A5GH 2OQUA 2BD9A 2BY5X 1ZTJA 4TPYA 1ZPCA 1VGCC 5BPEA 4AZ2B 1AHTH 2GCTB 2GP9B 2YNBA 1G2LA 4ESTE 3QO6A 8ESTE 1ORFA 2TPIZ 1SGYE 1EUFA 3D23A 5C2ZA 4Q7ZA 1O5GH 1GJ8B 1E36B 3ENSB 3RXAA 2AIPA 1YKTA 1V2LT 5J4SA 3LGVA 2CF9H 1MAXA 2B8OH 2BX3A 2TGDA 3V12A 1SGFG 1MTVA 3RXQA 3CS0A 4GCHF 2BX4A 4H6TA 2ZFQH 1G37A 4VGCC 1J15A 1Y3WA 3B8JA 1S81A 3A7TA 3VB3A 2Y80A 1NU7B 3PV2A 1KDQA 1O39A 1KXEA 1DLKB 1THRH 4JYVH 3VB5A 3PTBA 1YCPM 2VGCB 1QL7A 1PPCE 1VCPA 5GCHG 3PM3A 2VIQA 3STIA 4AGKA 5FPSA 1EKBB 1C4Y2 1AB9C 2A45B 2OINA 4YM9A 2AYWA 3GCNA 3FANA 3MNBA 5H4IB 1HAZB 1O2YA 4CRDA 1XUFA 4MNWA 3HATH 2BTCE 2G51A 2O8TA 4CR9A 1THSH 2LPRA 3LGWA 1ELVA 1S6HA 1GMHF 3LT3A 1ELGA 2IJOB 1F5LA 1QQ4A 2ODYB 3RXFA 1GHXH 2DE9A 4ZKNU 5A0CA 3ATKA 2J38A 1OX1A 1TGCA 2VB0A 1OYTH 1AKSA 1D3PB 1H8IH 1XKAC 3RC6A 2BOHB 3RM2H 2GCHG 1BJUA 1ABIH 1HAIH 4D7FA 2BY7X 3GCOA 4BAHB 1SLXB 1UCYE 4WMDA 3BTKE 1ZHPA 1P2MA 5FX5A 1TX7A 3AW0A 1DWCH 2HOBA 5A09A 1TQ7B 1TRNA 2VWOA 2ZDNA 3M61U 4AYVB 2OK5A 4ISOA 4ZROA 3VPKA 4O03A 1VITG 1THPB 5EQQA 1OP8A 1O37A 1TA2A 1QFKH 1ZRKA 3A81A 1GJ9B 3VB6A 1OWKA 2A5IA 1DUEA 4UONA 5FXLA 4OGYA 1X7AC 2A5KA 2HNTE 2Y5FA 3BG4C 1O3BA 4MDSA 2SGEE 5JB9S 1S84A 3S9CA 4Y8ZA 3H7OA 1O30A 4AFUA 3PMJA 3VGCB 4Y7AA 2J34A 4MPXA 1O32A 3P95A 4A7IB 1SMFE 4MG3A 1ETSH 1P2IA 1L1JA 4IW4E 1ANCA 1NRNH 3MH4A 1DWDH 1DPOA 5F8XA 3GY7A 2WPMS 3U9AH 1UTKA 3PMBB 1GHWH 6GCHG 3BTHE 1C4U2 1O2HA 2WPIS 5EQSA 4IS5A 3LIWA 3HKJB 5FCRA 2RCEA 1O2MA 4RKJB 1GJCB 4ZKRU 4ABHA 1V2ST 2OCVB 2R9PA 2Z3CA 3ODDA 2O8LA 1FPCH 3E8LA 1UVOA 1O2ZA 1J9CH 1BUIA 2J4IA 3A7YA 4DGJA 2ANKH 3EAJA 3STJA 1EP6A 1ANDA 1MBQA 4BTTB 2FOMB 1QA7A 3TNTA 4BXWA 1AY6H 5K0HA 5A8YA 1SLVB 1DSUA 3KN2A 2R0KA 2XBVA 3TITA 2CHAC 1OSSA 4XBDA 5HGGA 3SHAH 5CHAB 1DE7H 2WPHS 2ZU3A 2PWXA 5AF9H 2ZTYA 1F7ZA 1O5FH 2FX6A 1KXCA 1TMTH 1UTJA 2C3SA 2ZFRH 2BY8X 1EZQA 2VH0A 4X2XA 3N7OA 3JZ2B 3SHCH 4AG2A 3PLBA 2WYGA 1UHBB 2ZG0H 1UJ1A 1J8AA 1C5UA 1YPGH 4GAWA 4B71A 4MTBA 8GCHG 1DSTA 4FU9A 3RMOH 2WINI 1ZSLA 2FS8A 2H9TH 1L2EA 1O3GA 4X6NA 2A4GA 1T4UH 4M9FA 1FIZA 4K1SA 4WH6A 3V0XA 2G5VA 4MPWA 4FU8A 1N8OB 3DUXH 4ASHA 2BDCA 3SYJA 1C5YB 3TH2H 1F5KU 3VXEH 4NIXA 3QUMP 1BDAA 5B6LA 3F1SB 1TBQH 2J2UA 1LPKB 3PMAB 1B5GH 1VITH 2B0FA 3BTFE 2KAIB 3SJKA 2XRCA 2QXHA 3M3TA 3QDZB 3R0FA 2Y5GA 1CHGA 3H09A 1KLIH 2VWMA 2IN2A 2RA3A 1F0SA 1XUIA 3GISB 3SV8A 3M7TA 1EOLA 1VR1H 2Y5HA 4BTUB 1BHXF 1ANBA 5EW2H 5EU8A 1HJAC 2FM2A 1TONA 1MU8B 1K2I1 1L4ZA 2THFB 2Q6GA 3TIUA 3AAVA 3MO9A 1GI6A 3LU9B 4WXVA 1HJ9A 1FZZA 2ANYA 2BXUH 2QXJA 3PB1E 1ZMLA 2VVVA 3SJOA 4A5TS 5DP6A 3SZEA 1K1MA 1Z1JA 2F9UA 1G3BA 2XWBI 1GMDF 1N6XA 2XTTB 2H1UA 1NFYA 2A1DB 2ZI2H 4FUHA 2FP7B 1O2WA 3TGJE 3U1IB 1O5DH 2QAAA 2PSYA 3MWIU 3SQEE 1V6DA 2FZZA 5C67A 3TH3H 4K1TA 4AORA 2P95A 2ULLA 1BZXE 1BBRE 1SSXA 6ESTA 1WAYB 1LKAA 1ELAA 3KL6A 4RN6A 4BAKB 1C1NA 1P9SA 4KTUA 4MNXA 1CU1A 1QA0A 1CO7E 1KXFA 1LDTT 2ZF0H 3S7KB 4ABIA 4O3UA 4X6MA 1NTPA 3ATMA 3BEUA 4U2WA 2NU1E 1AFQB 3W95A 1ACBE 2FOAA 1C2GA 5FBEA 1DT2A 1V2WT 1ZHRA 3A8AA 3ZZ7A 9LPRA 1P05A 4E7RG 2ZC9H 4LOYH 1AZ8A 1CVWH 1HLTH 1UHBA 3SU0A 5PTPA 1GCTC 1IQGA 3S9AA 1MKWK 4CHAB 1MBMA 1K22H 1W13U 1BMAA 5DPAA 4D9QA 1JBUH 1W0YH 1QNJA 3SNEA 1SOZA 4Y79A 3MTYA 2G5NA 5C5NA 1TNLA 2WPJS 1W8BH 2Y81A 4NWLA 2Z3DA 4ZKOU 4GHTA 1WOFA 1VZQH 3OU0A 1EB1H 2DE8A 5L2YH 2EC9H 5EPNA 2KAIA 3BTWE 3QK1A 3F9EA 1GL1A 1UO6A 1UVSH 2XNIA 4FVDA 1KYNA 5FBIA 4F4OC 2ZFSA 3BV9B 2XC4A 1C5PA 2AFQB 2BQ7B 3M37A 5GWZA 3TLOA 1F0TA 4X6PA 4Y71A 2VJ1A 2WV4A 2TBSA 2F83A 1O3OA 2A7CA 1T32A 3TJUA 2QYIA 4FUJA 5L30H 4A1XA 2A32A 1GVKB 2ZZUH 1MKWH 1O2SA 2WHXA 3UR9A 2PGBB 1V2JT 3MFJA 2GX4A 2FOEA 4K8YA 1QRZA 1OYQA 1TBRH 3PROA 1B0FA 1BMMH 5EPYA 4A92A 3A88A 4UD9H 1OWEA 1NPMA 3QZRA 1MTNB 4JZEH 1SL3A 5T1VA 4KTCA 1O3KA 5DP7A 2J9NA 1D4PB 5GCHF 1O2LA 3PTNA 4K2YA 1MCVA 1GJ7B 2VIPA 5JBTA 3PWCA 1IQJA 3JZ1B 1ESAA 2HALA 1ZTKA 3UTUH 3GY4A 3KQDA 1NM6A 1ZR0A 2PKAB 1P8VC 7GCHG 1MTSA 1Y3YA 3PV4A 1CA0C 5DGJA 1FY3A 1YYY1 1A2CH 1W11U 3EA7A 3SORA 1O31A 1ZOMA 1KLJH 5DG6A 1C2EA 1HXFH 2CF8H 3RMLH 4YOGA 1JWTA 4X1QU 5F8TA 4NA8A 1PYTD 2V3HH 2ZDMA 4KGAA 1QTFA 4AN7A 1K9OE 1O34A 1UTMA 1FV9A 1TABE 1MD8A 1YPHC 1NESE 1SLWB 1D6RA 1O3JA 1C2MA 1D9IA 1O3PB 2AMPA 3RMNH 3PYHA 2ODPA 1QCPA 2BVRH 2HLCA 1NU9A 1A1RA 3E16B 3GDVA 4B76A 4D9RA 1H9HE 4U32A 1GJDB 1P03A 2RG3A 1VITF 3SNBA 5JBCS 4BXSA 5AHGH 1SHYA 1CBWC 1ZGIA 1WXRA 1C1OA 3AW1A 4MQAA 3S69A 1MZDA 2D26C 1MCTA 2ZHDA 2GZ8A 3ZVFA 2ZPQA 1RFNA 1V2NT 4FXGH 1O2OA 4B2CA 1DLEA 1BRCE 2ZU1A 3DFJA 2PUQH 2ZPSA 1Z8RA 3URDA 4KKDA 2OLGA 2OC8A 1EPTB 1DOJA 3GDUA 3U8TH 1LQDB 1XXDA 1SGDE 3ZZ8A 4HTCH 2AEIH 3P8FA 6GCHF 1EZXC 4ISNA 4Y76A 5ESBA 1ZSJA 1GDQA 4WMFA 1TX8A 1WYKA 3OSYA 1WV7H 3MNSA 4WMEA 2QV1A 3WY8A 3S7HB 2BZ6H 1TPAE 1UVTH 2G8TA 2TRMA 3SBKA 1Y5BT 2ZGBH 1Z6EA 1QRWA 2ZHFH 3MO6A 4ABJA 4WY3A 1Y3XA 1EAIA 2QF0A 3QTVH 2VNTA 2PKSB 2ANWA 2ZCHP 1GL0E 3RC5A 4AB8A 3URCA 2PSXA 1NRPH 1L1GA 2WUCA 1E38B 1KXDA 3TPIZ 2AH4X 2EI6A 4IBLH 3BEFB 4I7YH 1RTKA 3T28A 2GKVE 1TNKA 2ZU5A 1C5XB 1ID5H 6CHAC 3E6PH 2XBWA 1HXEH 4UFDH 1GG6B 1SC8U 4ABDA 1G36A 3A86A 4HGCA 1QRXA 4LXBH 2PUXB 1J16A 1FDPA 2O8MA 1QBVH 1O3EA 2PKAA 1VJAU 4FUGA 4Y8YA 3KEEA 2PR3A 3CENA 4AGJA 3NCLA 2B7DH 4Y6DA 4BTIB 1BJVA 3UNRA 3GY8A 1O2VA 1ZRBA 1O3HA 3T26A 1EJNA 8GCHF 3SV6A 2ZCLP 2XC0A 2VWNA 3LGUA 5AFYH 1NFWA 1J14A 1RRKA 3FP7E 1SGNE 1DS2E 3P8NA 2HGTH 3MU5A 2RA0A 4XBBA 3T5FH 4CR5A 1DY9A 3MU8A 4ISIH 4OS2A 1CE5A 1TMBH 4FUBA 2ALVA 5FCKA 1K1IA 2UWOA 1C1TA 1T8LA 2F9NA 3ZYDA 1QBNA 1P06A 4X1SU 3M3VA 1PQAA 1KXAA 2ZNKH 1KXBA 1QURH 1O2TA 1ARBA 2ZFPH 3DFLA 2FTLE 2Z9IA 5JPMH 2OBOA 2C8ZB 4X1NU 1OKXA 1AE5A 4Y11E 2ZCKP 4Q7XA 5DJ7A 5TCAA 3UY9A 1O3AA 3GCHC 3OX7U 4ZHAA 1LVYA 3HK6B 3OTJE 1A3EH 3QTOH 1FPHH 1CGIE 3ITIA 2XBYA 4LZ1H 2ZGJA 2OC0A 3FVFB 4B2AA 4GUXA 1EAUA 2UUJB 1O2XA 1H9LB 5A2MH 2BMGB 1EPTA 2HRVA 1EOJA 1W7XH 1QIXB 1C4V2 2Z9GA 1EX3A 2W3IA 5EW1H 1P12E 2AMQA 3MU0A 1O2IA 1RIWB 1ZPZA 2VBCA 3PWBA 4GHQA 1TRMA 2G81E 1FUJA 2FWWA 1DITH 4AG1A 1MU6B 3UIRA 3BN9A 1BTXA 2W7SA 1Y59T 2VINA 8KME2 2ZU2A 1SVPA 3RXUA 2P8OC 3U69H 5E0GA 2BYAX 1AQ7A 3A7XA 1XUJA 3ZZBA 3SUEA 3EA8A 1GBDA 3A7ZA 1RGQA 1V2OT 1P2OA 1W10U 3RXKA 2ZGCA 1HAHH 3P8OA 2WUBA 1WTHD 1GBHA 2YOLA 2QC2A 1SGRE 5CE1A 3LC5A 4D8NA 2JETC 1XVOA 2ODQA 1V2TT 1C5RA 2A4QA 1Z8IB 1P2NA 1IHSH 2LNCA 1GBEA 1K1JA 1IQFA 1Q31A 1YPLH 3SJ8A 2AGIX 1NFUA 3BTME 1P09A 2J94A 2ZA5A 2VIWA 3SGQE 3H7TA 5AVDA 1GVZA 1QB6A 1AWHB 3T25A 4BAOB 2GV6A 5T6DA 1UTOA 5FPTA 3BTQE 3TGKE 3KCGH 3QZQA 1Y5UT 4X1PU 1DWEH 5DP4A 2ZQ2A 1ABJH 2Z7FE 2Q6DA 3RXCA 3PO1B 3HK3B 2OTVA 1XVMA 4WWYA 1GHVH 4X1RU 2F9PA 4I8KA 1TLDA 4X2WA 5HMAA 1C5TA 4JYTA 1LPZB 2BM2A 2BOKA 4Q80A 2F9OA 3BG8A 4THNH 2F3CE 2ZECA 1LVMA 2A0QB 1LO6A 2GVFA 1GJ6A 4NZQA 4O3TA 3SOSA 1AZZA 2O8UA 1BITA 5E2PA 1EZUC 1LKBA 1ZZZA 1P3CA 1V3XA 4I31A 3U98H 2GCTC 4A1TA 3KQBA 1FXYA 3KIDU 1NFXA 2ZTXA 4FUCA 1C2IA 1C5WB 2NU2E 3I29A 1E34B 3IWMA 1HIAB 1V2KT 3A83A 4UDWH 4JZ1A 3HPTB 1O2RA 3KHVA 4OS5A 4A1VA 3SO3A 1C2JA 1OWHA 3PMHB 2V35A 1PPZA 6LPRA 1M9UA 4WVPE 4ISHH 4E06H 2YNAA 5A8XA 4H6SB 3PV5A 2GV7A 1EAXA 1MH0A 2ZGHA 4HFPB 1TBZH 3GY3A 1CT0E 4CRFA 2G00A 3T2NA 1A4WH 1TA6A 1W2KH 3QGNB 1H8DH 1SOTA 1AVWA 2VVUA 2VGCC 4B74A 1NS3A 5L6NH 1PQ5A 1D3DB 4RKOB 1W0ZU 1AWFH 1BRUP 1N1LA 3ZVGA 2BHGA 1FY1A 1P02A 4CH2B 1ELTA 3EGKH 1RS0A 1UCYK 4CRAA 3GYLB 1AFEH 2R3YA 3UUZA 1T8OA 1A0JA 1GHAG 2FI4E 2V3OH 2ZIQH 1BT7A 2ZHQH 4ZAEA 1DFPA 3BIUH 1DM4B 1HAVB 3FZZA 1FAKH 3K2UA 1ETRH 3CP7A 7KMEH 3IG6B 1YPHE 1P01A 3RU4T 1HUTH 2P59A 3RP2A 1O3FA 5JDUB 2D8WA 1LQEA 1O2NA 1O2UA 3H5CB 4FU7A 1MKXK 5E0HA 1LHCH 3RXEA 3S9BA 2SFAA 1KY9A 2GMTB 1NRSH 1VCQA 1TGBA 1GJAB 5JBBS 3DA9B 4X2VA 3SJIA 1N6YA 4OS4A 4YZUA 4OM9A 5DKMA 4BNRA 4OGXA 2H6MA 1HAPH 1ZMJA 2TGPZ 1P3EA 1SR5C 3MYWA 3NXPA 1PPBH 3AK5A 2QIQA 4U01A 3EQ0H 3RXJA 4DVAU 1GGDB 5EQRA 4Z6AH 1PPGE 1W12U 2O8WA 2UUYA 1QJ1B 3D49H 2FOBA 3NKKA 1UCYH 2IPHA 2CMYA 3SV2H 3SU4A 3LC3A 1WQVH 2FYQA 2G4TA 4FVBA 1HBTH 4NZLA 1SGPE 1Y3VA 3VGCC 1NO9H 2ZFFH 3SI3H 4B73A 4IC5A 1ETTH 2NU3E 1MKXH 4SGBE 4I8HA 3B9FH 1O3CA 2J92A 3SGBE 1HNEE 1H1BA 4R8TB 3RXPA 1UVUH 1ELCA 4DIHH 3T62A 4K69A 2C8YB 2FO9A 3DD2H 2BLOA 1P2QA 3RXLA 4GSOA 4U30A 1T8MA 3EA9A 1TNIA 9ESTA 1HIAA 1YPEH 3I77A 1G9IE 3P70B 3TJNA 1D6WA 1FIWA 3VFEA 5IDKA 1DVAH 1G3CA 2Z9LA 2ZP0H 3UR6A 5ESTE 1P10A 3BIVH 1SQAA 4UFEH 4TY6A 1G3DA 2V6NA 2UUFB 1T4VH 2C90B 5DK1A 3P8GA 3F6UH 3QWCH 3MHWU 4OS7A 3A8DA 3P17H 2GDDA 1RD3B 5CHAC 3EE0B 1S85A 2FEQH 2ZGXH 5JYIA 4X8VH 3F9HA 3SGAE 1FN8A 1RXPA 1C5QA 4CRBA 1TGSZ 2ZDKA 4ZKSU 4AOQA 4D7GA 1GBMA 2H5DA 4JCNA 5C3NA 3MH6A 1SGIB 1S5SA 4MPVA 5K7RA 3A82A 4WF8A 1GMCG 1WBGB 4I8JA 1GBJA 1H4WA 4LK4A 1HAVA 1ZGVA 1Z8JB 4NFEA 3SU3A 2BDGA 5FX6A 2XCNA 5ABWA 3MU4A 5HM9A 1G3EA 2QXIA 1IQMA 2B9LA 1TNGA 2STAE 1A7SA 4I33A 1GI2A 5GXPA 4YT6H 1FAXA 3UOUA 3M5OA 1N8OC 1V2VT 1XM1A 3BSQA 2AIQA 4FUDA 3Q00A 1QB9A 2FOHA 2ZFTA 2H2ZA 4AFQA 3UNQA 4IN1A 1ZMNA 3M7UA 4NGAH 1LCYA 5EOKA 3MNCA 1TOMH 4B6FA 1HAYB 1T7CA 2ZDLA
chains in the Genus database with same CATH superfamily
2A2QH 1BMLA 2A7HA 2BD4A 2P93A 3SUFA 4DG4A 1MD7A 1SB1H 3GY5A 1NRQH 5GNDA 1TE0A 1SQTA 1VGCB 2RFKC 1CT4E 1MZAA 3A84A 1BCUH 3M3SA 4RSPA 3UOPA 4B1TA 2QY0B 3RU4E 3NZIA 2QF5A 1SGEE 1O33A 2Z9KA 1BTZA 3PLPA 1BBRK 1EZSC 5KGOA 4ZH8A 1C2DA 4ZXXH 2BXTH 1SPJA 1NC6A 1KTTB 1VCWA 1EASA 4Z0KA 4JMYA 3SUDA 2A4OA 1C2KA 1C1UH 3LH1A 4VGCB 2GD4B 4OS1A 3S0NA 1T8NA 2FS9A 1BHXB 5GPIB 3RXRA 3ZZ5A 2FLRH 2L74A 4GPGA 1GBKA 1SGTA 2GCHF 2WYJA 4F55A 1OP0A 2RDLA 1C5LH 1E0FD 2GGVB 1SGQE 3T27A 1F2SE 1TQ0B 3OY5U 4NWKA 4CREA 3E3TA 1S0RA 5C94A 3SJ9A 1AB9B 1EJMA 1YLDA 1TX6A 4KP0A 1MTWA 4B6EA 5C5OA 2XCFA 1AIXH 1SQOA 2VIVA 4Y10E 3M7QA 3ELAH 5GIBA 3I78A 4CRCA 1TMUH 4ABAA 3A87A 4XDEA 1OPHB 2QXGA 4NA9H 1C5SA 2BY9X 1C5MD 2JH0D 4FUEA 4SGAE 4XBCA 1TNJA 1C5NH 2WV5A 4ZXYH 2HLDD 5E2OA 1GBTA 3A80A 3A89A 3ATLA 4IN2A 3GS9A 1AFQC 4KTSA 4YT7H 2R2WU 1HAXB 2XWAA 5LGOA 5FPYA 2OUAA 3OY6U 2I6QA 2F9BH 3BEIB 1YF4A 2ZO3H 4ZUHA 2A2XH 3F68H 3GCTG 5CMXH 2HVXA 5T6GA 3SU5A 2BQ6B 3VB4A 1ANEA 2NWNA 1NZQH 1AVXA 4CHAC 1GBIA 4INHA 1A3BH 1Y5AT 2W7UA 3GY6A 4WH8A 4JK5A 3AASA 5A0BA 1JXPA 2FI5E 4XD7D 3FFGA 2XBXA 2OC1A 2TGTA 2W3KA 1GHBG 1SHHB 1ZYOA 2SGFE 1C1MA 3NK8A 3BG4B 2FODA 3DT0H 1NROH 3KGPA 5JBAS 2XYAA 2TIOA 2PTCE 4BOHA 1K21H 1A0LA 1C1WH 3C1KA 1PQ7A 4DT7B 2HWLB 2UUKB 7LPRA 5HYOA 3SV9A 1GJ4H 1ELEE 1O5BB 1A46H 4BAQB 5C1YA 1LVOA 4INLA 2BDIA 2C93B 4YOIA 2ZHWH 3RUOA 3TGIE 3P6ZB 1O5CB 2Z9JA 1PPFE 4AFZA 3EE7A 3FP6E 2V0BA 3LOXA 3F9GA 1HYLA 2QF3A 3ZYEA 1JMOH 3SNCA 1BMNH 1Y8TA 4K60A 1AO5A 1U6QA 1AMHA 1ZTLA 3ZVCA 2O9QA 1DWBH 5BRRE 3HKIB 3KQEA 3ZV8A 4M7GA 1BTWA 4ABGA 3QN7A 3OTPA 4FUIA 1TWXB 2H9HA 4DURA 1BTUA 1CGHA 4I86A 3M35A 4TYDA 1MTNC 1MQ5A 5FL7D 2Y82A 1P2KA 3RM0H 2CHAB 1HPGA 3TK5A 3M5LA 2OQ5A 1D3TB 1BQYA 2GT8A 1HV7A 3E0NB 1O2QA 4NIWA 3ZZCA 1GI8B 3RXTA 1GJBB 3UPEA 1GHAF 4YESB 3V7TA 4FUFA 2CV3A 4Y0ZE 1Z6JH 1Z8GA 1UTLM 4E05H 1DX5M 3ZV9A 4DW2U 3PLKA 3B23B 2KR7A 3KNXA 4MNYA 4YTAA 1IQLA 1HB0B 3LH3A 2FI3E 1LHFH 3LKWA 2G4UA 4IC6A 2HVYB 3ZIAD 2FOGA 4F49A 1C1VH 1H8ED 2BY6X 3ZZ9A 4K5ZA 3ZZ6A 1F0UA 1TNHA 2A4RA 5C0UA 1GI7B 3A8BA 4JZDH 1Q3XA 1SFQB 2NU0E 2D2DA 5E0JA 1V2QT 5C1XA 5F6MA 1O0DH 1XUGA 2AMDA 3GOVB 3SQHE 4AC9A 3K6YA 2H5CA 3LPRA 1W14U 1HAGE 2EI8A 2SGAA 2ZKSA 5EG4A 2Z6BD 2SNVA 5LPEA 1GJ5H 1AUTC 2PW8H 4H4FA 1EXFA 4DCDA 4Y7BA 1ESBA 1AVGH 1EATA 1S82A 1IAUA 4K3JA 2SGPE 1FY4A 5EGMA 3BTTE 1FONA 1QHRB 3UQOA 1BIOA 2KM0A 1F92A 3GYMA 3UNSA 1CHOG 1TPOA 1OWIA 5JB8S 2SNWA 4CBNA 2AGEX 1FLEE 1HJAB 1UVPA 3UWIA 2BVXH 2YMSD 4X6OA 2CJIA 1W3CA 1DICA 5EXNA 3RXGA 2EA3A 4CH8B 1OP2A 2I6SA 1W0KD 1QR3E 1HCGA 2FYRA 1O2GH 2C8WB 3DSPA 3LJJA 1HFDA 2M5TA 2WV9A 4ABEA 1JIMA 1BB0B 1O5AB 1QL8A 4DY7B 1S6LA 3A8CA 3HGPA 1EPTC 5LPFA 1YLCA 2PFEA 3N7EA 1SI5H 2JH6D 4ZCNA 1C1SA 1QL9A 2BD8A 1SFIA 1OWDA 3P92A 4RI0A 3SU6A 3OYPA 1GHZA 2VU8E 1UK3A 4ACAA 3M5NA 3V3MA 2C4FH 5J4QA 1GBAA 2OBQA 3QLPH 1C9PA 3BF6H 4XE4A 2AGGX 1PYTC 2PKSC 1EB2A 2P3TB 5I25A 4X0WU 3E91A 2AS9A 3A7VA 2Z3EA 1O2JA 5EXLA 4H42U 4NFFA 4BANB 1TRYA 4Q7YA 1ZSKA 3Q77A 3LONA 2IOTA 2WPKS 4NSVA 4GLYA 4XOJA 2OC7A 2F91A 1IHTH 1TFXA 1W7GH 3E0PB 1MQ6A 4Q63A 1RTFB 4UE7H 3FAOA 3SUGA 1JOUB 1GG6C 1LHDH 1P04A 5IYTA 3LGYA 3FZDA 1SGFA 1YCPK 1B0EA 5HM2A 5I46H 2FXRA 1BTPA 1ZJKA 3RXSA 3L6PA 3D62A 1GMCF 2C8XB 1GCDA 4INKA 4NIVA 2YMSB 1A5HA 3E1XB 1GPZA 1Y3UA 3V13A 1GCTB 1F0RA 2Y7XA 4AFSA 2CK3D 3R3GB 2XW9A 1WCZA 3O8RA 3RLWH 1FY5A 4D76A 1GBCA 1GBFA 1WU1A 5EODA 3ZVBA 2BZAA 4AB9A 2BD3A 2QGRA 1OOKB 2FESH 2P3UB 4DJZB 1P11E 2CN0H 3Q76A 4OS6A 2GZ9A 5EXMA 2BQWB 4MLFB 4IMZA 2XC5A 3TJVA 1JIRA 4NCYA 1FI8A 1Z71A 5GDSH 3SU2A 3AAUA 2WPLS 4J1YA 3ZVAA 4K8BA 2J95A 2GTBA 1Z1IA 1XX9A 5C1UA 1OS8A 3Q3KA 2FOCA 2BB4A 1ESTA 1YCPH 1C5VA 4IGDA 3QX5H 1UTPA 1O3LA 3VEQB 1K1NA 1O5EH 5DP8A 1QBOA 1O3MA 1WSSH 1E35B 1NY22 1C2HA 7GCHF 2Z94A 1O3DA 1BTYA 1TPPA 4KELA 3ZVDA 5LPRA 1QQUA 4J2YB 2ZWLH 3RC4A 2BDAA 3KQ5A 2AERH 1HGTH 1MAYA 3FO8D 1SGCA 4QT8C 1UTNA 2Q6FA 2B5TB 1C5OH 1V2UT 2DUCA 3NRLA 5T6FA 5CDFE 1QJ7B 3ATWA 2EQNA 2R3UA 5CHBA 2VIDA 1IQIA 4HI3A 1DUAA 2UWLA 1H9IE 2OD3B 2JJ2D 3VB7A 3W94A 4GCHG 1YPJH 1O36A 1NT1A 3ZZ3A 1TGNA 3BTGE 3UFAA 3MH5A 1BTHH 2BD2A 1CQQA 1RIWC 1XMNB 7ESTE 8LPRA 3VXFH 1C1QA 3A85A 2WSSD 1OWJA 1WTGH 4IMQA 1C1PA 2ZTZA 4I32A 2HPQH 1ZPBA 2FIRH 4ZMAH 1INCA 1BOQA 1CA0B 3ODFA 3K6ZA 2A31A 5L2ZH 1TIOA 2BLQA 3UQVA 1AE8H 1O2KA 1ZHMA 1EAWA 1XXFA 2CGAA 3CS7A 2BLWA 3PRBA 2D1JA 2F9VA 2OXSA 1GMHG 4FETA 2K0QA 4MPUA 1NBME 2A7JA 3UREA 1AUJA 1V2MT 1IQEA 1A0HB 2ZDVH 5EIYA 1TOCB 1WUNH 3Q3XA 2JJ1D 3GY2A 1YM0A 1RTLA 1KTSB 4ISLA 3ZZAA 3T29A 5TJXA 3GCTF 2PLXA 3G01A 4GVUA 5HXFA 2FDAA 1WQSA 4ABBA 3U8OH 2J98B 1TAWA 1KIGH 1KSNA 1F5RA 4TPIZ 2W5EA 1C2LA 4DIIH 1KLTA 1YP9A 4X8UH 4XRNA 1PJPA 4MNVA 3FP8E 4NA7A 1ARCA 1SG8B 2K8IA 3M36A 2XOKD 3ZZ4A 1J17T 3DHKH 4YOJA 3KQCA 4JYUH 4NIYA 1L4DA 1GHBF 1CBWB 1LMWB 2ESTE 1GI9B 2P16A 3UWJH 1G32B 4DOQA 1CGJE 1JRSA 3PO1C 4BAMB 1V2RT 3IITA 3TK9A 1P57B 2P94A 4X8TH 1HDTH 1ZJDA 5FAHA 2A5AA 2Y7ZA 2ZEBA 2ZDAH 1DXPA 3GICB 2TGAA 2VH6A 3WW7A 4XFQA 2QCYA 1DXWA 3EDXB 2JKHA 1K1OA 1OXGA 1PFXC 2HNTC 1GI1A 1E1RD 3LJOA 1G2MA 5E8EH 1ELDE 1PPEE 5SGAE 1L0ZA 1MTUA 2VWLA 5LH8A 3TK6A 1TB6H 4MVNA 4NG9H 2CXVA 1K1PA 1GI3A 1YC0A 2FOFA 4XSKU 1GWAA 2GT7A 1CSOE 5B6OA 1NRRH 1LHGH 1FQ3A 3AVZA 4YLUA 3MOCA 4HZHA 3O8BA 5C20A 1S6FA 3F0OA 1K28D 1PQ8A 4Q2KA 3SN8A 2PTNA 4K1EA 2F43B 4PROA 1HAOH 4JZIA 3HGNA 2QF4A 2BD7A 3M5MA 2WZQA 4DT4A 3Q3YA 5HKKD 4Y0YE 3KF2A 2FX4A 1P0SH 2ZU4A 4I8GA 4Y8XA 1MMJN 1GI0A 3MMGA 1XUKA 4ABFA 1TGTA 1O35A 1SLUB 3TH4H 1AI8H 2SGDE 2HPPH 2W26A 6CHAB 1TALA 4TY7A 3RU4D 2K1QA 3NPSA 1NN6A 4NSYA 3TNSA 2BDHA 1CA8B 1FY8E 4CBOA 4E7NA 1GHYH 1SBWA 5A0AE 1JRTA 2VVCA 1O38A 4TSFD 3RXMA 1AGJA 3SV7A 2UWPA 2BVSH 2BLVA 3ESTA 1O2PA 2SGQE 3LGIA 1ELFA 3LDXH 3RLYH 2FLBH 2PHBA 3SNAA 3L33A 5G4BA 2FPZA 2OP9A 2R2MB 1P2JA 3U8RH 4A6LA 2ILNA 2ANMH 3NUMA 4B2BA 5GJ4B 1RJXB 3RXHA 4O97A 2G55A 1GI4A 1D3QB 4WXIA 4ZHMU 1GI5A 2ASUB 1QGFA 2GMTC 1FX0B 1TYNA 1E37B 1S0QA 1GBLA 1QY6A 2EEKA 4YLQH 3O8CA 3RMMH 2ALPA 3ATIA 1HRTH 2J98A 4AYYB 1BA8B 2G52A 1V2PT 4B75A 1BRAA 3SNDA 5DP9A 3O8DA 3ZZDA 3MH7A 3TJOA 1BRBE 1C5ZB 2KCOA 3MO3A 2Y6TA 1IOEA 1S83A 3FOAA 1GGDC 1DDJA 3SI4H 2EI7A 1PPHE 1CHOF 2WPDD 3F9FA 1BMFD 1UW7A 4UEHH 2ZHEH 3RXIA 2XXLA 3RXOA 3GCHB 1G30B 1P9UA 1E1QD 2BDYA 1UK4A 4WJG2 1VJ9U 2R0LA 4RT0A 2QA9E 5ETXA 1K1LA 3KYGA 1C2FA 4R0IA 4UFFH 5F03A 1LVBA 1GVLA 1XKBC 3RXVA 3D65E 5FHTA 1BBRH 1IQHA 1O3IA 2LELA 4ZHLU 1FMGA 3BTEE 3MI4A 1EJAA 3QGJA 3SW2B 3L3TA 4I8LA 1AN1E 1KDQB 4CRGA 1GMDG 1GBBA 5A8ZA 1ELBA 1XUHA 1YPMH 5F8ZA 2BD5A 3K65B 1A5IA 3BTDE 3MU1A 5DP3A 3RXDA 1UTQA 2STBE 1B7XB 5DP5A 5DO4H 1AU8A 3NWUA 1QJ6B 5TCCA 1C9TA 1CT2E 2P8OB 2FTMA 4YO9A 4UFGH 1DY8A 3C27B 2F4LA 1YPKH 3RDZA 3SU1A 3SZNA 1T31A 3TVJB 3RXBA 3K9XB 2JETB 2GZ7A 3F0PA 1GDNA 2IJD1 3ZVEA 1UMAH 2PV9B 1EP5A 2KCPA 4AX9H 1AKSB 1HJ8A 4JZFH 2VIOA 3E90B 1Q2WA 3U1JB 1AD8H 1EQ9A 2KCYA 3MNXA 1LHEH 1A61H 1YGCH 1FN6A 2FMJA 2ZPRA 4LZ4B 1LPGB 1COWD 2Q1JA 4TWWA 2GDEH 1YBWA 1GDUA 4O9VA 2J5UA 2PGQB 3A7WA 2NU4E 3EYDA 1MUEB 1TPSA 1Z7KA 3GDSA 5AFZH 2JH5D 2HNTF 3LGTA 4X2YA 2P3FH 2H9EH 1FJSA 2ZQ1A 1DANH 4X8SH 1C1RA 1QB1A 4JK6A 3TU7H 1LTOA 1ZLRA 4HG6A 2BDBA 4TWYA 1K0HA 1IQNA 1FNIA 1IQKA 1L1NA 1UK2A 2QN5T 5T3HA 4F48B 1O3NA 1A5GH 2OQUA 2BD9A 2BY5X 1ZTJA 4ASUD 4TPYA 1ZPCA 1VGCC 5BPEA 4AZ2B 1AHTH 2GCTB 2GP9B 2YNBA 1G2LA 4ESTE 3QO6A 8ESTE 1ORFA 2TPIZ 1SGYE 1EUFA 3D23A 5C2ZA 4Q7ZA 1O5GH 1GJ8B 1E36B 1W0JD 3ENSB 2AIPA 3RXAA 1YKTA 2LP6A 1V2LT 5J4SA 3LGVA 2CF9H 2KCAA 1MAXA 2B8OH 2BX3A 2TGDA 3V12A 1SGFG 1MTVA 3RXQA 3CS0A 4GCHF 2AHME 2BX4A 2ZFQH 1G37A 4H6TA 4VGCC 1J15A 1Y3WA 3B8JA 1S81A 3A7TA 3VB3A 2Y80A 1NU7B 3PV2A 1KDQA 1O39A 1KXEA 1DLKB 1THRH 3WWBA 4JYVH 3VB5A 3PTBA 1YCPM 2VGCB 1QL7A 1PPCE 1VCPA 5GCHG 3PM3A 2VIQA 3STIA 4AGKA 5FPSA 1EKBB 1C4Y2 1AB9C 2A45B 2OINA 2PP6A 4YM9A 5IK2D 2AYWA 3GCNA 3FANA 3MNBA 5H4IB 1HAZB 1O2YA 4CRDA 1XUFA 4MNWA 3HATH 2BTCE 2G51A 2O8TA 4CR9A 1THSH 2LPRA 3LGWA 1ELVA 1S6HA 2V7QD 1GMHF 3LT3A 1ELGA 2IJOB 1F5LA 1QQ4A 2ODYB 3RXFA 1GHXH 2DE9A 3OAAD 4ZKNU 5A0CA 3ATKA 2J38A 1OX1A 1TGCA 2VB0A 1OYTH 1AKSA 1D3PB 1H8IH 1XKAC 3RC6A 2BOHB 3RM2H 2GCHG 1BJUA 1ABIH 1HAIH 4D7FA 2BY7X 3GCOA 4BAHB 1SLXB 1UCYE 4WMDA 3BTKE 1ZHPA 1P2MA 5FX5A 1TX7A 3AW0A 1DWCH 2HOBA 5A09A 1TQ7B 1TRNA 2VWOA 2ZDNA 3M61U 2OK5A 4AYVB 4ISOA 4ZROA 3VPKA 4O03A 1VITG 1THPB 5EQQA 1OP8A 1O37A 1TA2A 1QFKH 1ZRKA 3A81A 1GJ9B 3CNRA 3VB6A 1OWKA 2A5IA 1DUEA 4UONA 5FXLA 4OGYA 1X7AC 2A5KA 2HNTE 2Y5FA 3BG4C 1O3BA 4MDSA 2SGEE 5JB9S 1WDIA 1S84A 3S9CA 4Y8ZA 3H7OA 1O30A 4AFUA 3PMJA 3VGCB 4Y7AA 2J34A 4MPXA 1O32A 3P95A 3W1EA 1SMFE 4A7IB 4MG3A 1ETSH 1P2IA 1L1JA 4IW4E 1ANCA 1NRNH 3MH4A 1DWDH 1DPOA 5F8XA 2V3MA 3GY7A 2WPMS 3U9AH 1UTKA 3PMBB 1GHWH 6GCHG 3BTHE 1C4U2 1O2HA 2WPIS 5EQSA 4IS5A 3LIWA 3MQKC 3HKJB 5FCRA 2RCEA 1O2MA 4RKJB 1GJCB 4ZKRU 4ABHA 1V2ST 2OCVB 2R9PA 2Z3CA 3ODDA 2O8LA 1FPCH 3E8LA 1UVOA 1O2ZA 1J9CH 1BUIA 2J4IA 3A7YA 4DGJA 2ANKH 3EAJA 3STJA 1EP6A 1ANDA 1MBQA 4BTTB 2FOMB 3DCLA 1QA7A 3TNTA 4BXWA 1AY6H 1OHHD 5K0HA 5A8YA 1SLVB 1DSUA 3KN2A 2R0KA 2XBVA 3TITA 2CHAC 1OSSA 4XBDA 5HGGA 3SHAH 5CHAB 1DE7H 2WPHS 2ZU3A 2PWXA 5AF9H 2ZTYA 1F7ZA 1O5FH 2FX6A 1KXCA 1TMTH 1UTJA 2C3SA 2ZFRH 2BY8X 1EZQA 2VH0A 4X2XA 3N7OA 3JZ2B 3SHCH 4AG2A 3PLBA 2WYGA 1UHBB 2ZG0H 1UJ1A 1J8AA 1C5UA 1YPGH 2KZ4A 4GAWA 4B71A 4MTBA 8GCHG 1DSTA 2M2AA 4FU9A 3RMOH 2WINI 1ZSLA 2FS8A 2H9TH 1L2EA 1O3GA 4X6NA 2A4GA 1T4UH 4M9FA 1FIZA 4K1SA 4WH6A 3V0XA 2G5VA 4MPWA 4FU8A 1N8OB 3DUXH 4ASHA 2BDCA 3SYJA 3N99A 1C5YB 3TH2H 1F5KU 1YY3A 3VXEH 4NIXA 3QUMP 1BDAA 5B6LA 3F1SB 1TBQH 2J2UA 1LPKB 3PMAB 1B5GH 1VITH 2B0FA 3BTFE 2KAIB 3SJKA 2XRCA 2QXHA 3M3TA 3QDZB 3R0FA 2EY4C 2Y5GA 1CHGA 3H09A 1KLIH 2VWMA 2IN2A 2RA3A 1F0SA 1XUIA 3GISB 3SV8A 3M7TA 1EOLA 1VR1H 2Y5HA 1NBMD 4BTUB 1BHXF 1ANBA 5EW2H 5EU8A 1HJAC 2FM2A 1TONA 1MU8B 1K2I1 1L4ZA 2THFB 2Q6GA 3TIUA 3AAVA 3MO9A 1GI6A 3LU9B 4WXVA 1HJ9A 1FZZA 2ANYA 2BXUH 2QXJA 3PB1E 1ZMLA 2VVVA 3SJOA 4A5TS 5DP6A 3SZEA 1K1MA 1Z1JA 2F9UA 1G3BA 2XWBI 1GMDF 1N6XA 2XTTB 2H1UA 1NFYA 2A1DB 2ZI2H 4FUHA 2FP7B 1O2WA 3TGJE 2XNDD 3U1IB 1O5DH 2QAAA 2PSYA 3MWIU 3SQEE 1V6DA 2FZZA 5C67A 3TH3H 4K1TA 4AORA 2QE7D 2P95A 2ULLA 1BZXE 5EJ1A 1BBRE 1SSXA 6ESTA 1WAYB 2W6ID 1LKAA 1ELAA 3KL6A 4RN6A 4BAKB 1C1NA 1P9SA 4KTUA 4MNXA 1CU1A 1QA0A 1CO7E 1KXFA 1LDTT 2ZF0H 3S7KB 4ABIA 4O3UA 4X6MA 1NTPA 3ATMA 3BEUA 4U2WA 2NU1E 1AFQB 3W95A 1ACBE 2FOAA 1C2GA 5FBEA 1DT2A 1V2WT 1ZHRA 3A8AA 3ZZ7A 9LPRA 1P05A 4E7RG 2ZC9H 4LOYH 1AZ8A 2YMSC 1CVWH 1HLTH 1UHBA 3SU0A 5PTPA 1GCTC 1IQGA 3S9AA 1MKWK 4CHAB 1MBMA 1K22H 1W13U 1BMAA 5DPAA 4D9QA 1JBUH 1W0YH 1VKYA 1QNJA 3SNEA 1SOZA 4Y79A 3MTYA 2G5NA 5C5NA 1TNLA 2WPJS 1W8BH 2Y81A 4NWLA 2Z3DA 4ZKOU 4GHTA 1WOFA 1VZQH 3U28C 3OU0A 1EB1H 2DE8A 5L2YH 2EC9H 5EPNA 2KAIA 3BTWE 3QK1A 3F9EA 1GL1A 1UO6A 1UVSH 2XNIA 4FVDA 1KYNA 5FBIA 4F4OC 2ZFSA 3BV9B 2XC4A 1C5PA 2AFQB 2BQ7B 3M37A 5GWZA 3TLOA 1F0TA 4X6PA 4Y71A 3OE7D 2VJ1A 2WV4A 2TBSA 2F83A 1O3OA 2A7CA 1T32A 4RT1A 3TJUA 2QYIA 4FUJA 5L30H 4A1XA 2A32A 1GVKB 2ZZUH 1MKWH 1O2SA 2KFWA 2WHXA 3UR9A 2PGBB 1V2JT 3MFJA 2GX4A 2FOEA 4K8YA 1QRZA 1OYQA 1TBRH 3PROA 1B0FA 5EJZA 1BMMH 5EPYA 4A92A 3A88A 4UD9H 1OWEA 1NPMA 3QZRA 1MTNB 4JZEH 1SL3A 5T1VA 4KTCA 1O3KA 5DP7A 5KEDA 2J9NA 1D4PB 5GCHF 1O2LA 3PTNA 4K2YA 1MCVA 1GJ7B 2VIPA 5JBTA 3PWCA 1IQJA 3JZ1B 1ESAA 2HALA 1ZTKA 3UTUH 3GY4A 1EFRD 3KQDA 1NM6A 1ZR0A 2PKAB 1P8VC 7GCHG 1MTSA 3DSOA 1Y3YA 3PV4A 1CA0C 5DGJA 1FY3A 1YYY1 1A2CH 1W11U 3EA7A 3SORA 1O31A 1ZOMA 1KLJH 5DG6A 1C2EA 1HXFH 2CF8H 3RMLH 4YOGA 1JWTA 4X1QU 5F8TA 5C0TA 4NA8A 1PYTD 2V3HH 2ZDMA 4KGAA 1QTFA 4AN7A 1K9OE 1O34A 1UTMA 1FV9A 1TABE 1MD8A 3OFND 1YPHC 1NESE 1SLWB 4YXWD 1D6RA 1O3JA 1C2MA 1D9IA 1O3PB 2AMPA 3RMNH 3PYHA 2ODPA 1QCPA 2BVRH 2HLCA 1NU9A 1A1RA 3E16B 3GDVA 4B76A 3KYFA 4D9RA 1H9HE 4U32A 1GJDB 1P03A 2RG3A 1VITF 3SNBA 5JBCS 4BXSA 5AHGH 1SKYE 1SHYA 1CBWC 1ZGIA 4ACBA 1WXRA 1C1OA 3AW1A 4MQAA 3S69A 1MZDA 1YLNA 4TT3D 2D26C 1MCTA 2ZHDA 2GZ8A 3ZVFA 2ZPQA 1RFNA 1V2NT 4FXGH 1O2OA 4B2CA 1DLEA 1BRCE 2ZU1A 3DFJA 2PUQH 2ZPSA 1Z8RA 3URDA 4KKDA 2OLGA 2OC8A 1EPTB 1DOJA 3GDUA 3U8TH 1LQDB 5DSFA 1XXDA 1SGDE 3ZZ8A 4HTCH 2AEIH 3P8FA 6GCHF 1EZXC 4ISNA 4Y76A 5ESBA 2JIZD 1ZSJA 1GDQA 4WMFA 1TX8A 1WYKA 3F3BA 3OSYA 1WV7H 3MNSA 4WMEA 2QV1A 3WY8A 3S7HB 2BZ6H 1TPAE 1UVTH 2G8TA 2TRMA 3F2FA 1Y5BT 3SBKA 2ZGBH 1Z6EA 1QRWA 2ZHFH 3MO6A 4ABJA 5HIYA 4WY3A 1Y3XA 1EAIA 2QF0A 3QTVH 2J97A 2VNTA 2PKSB 2ANWA 2ZCHP 1GL0E 2KX4A 3RC5A 4AB8A 3FKSD 2PSXA 1NRPH 3URCA 1L1GA 2WUCA 1E38B 1KXDA 3F2HA 3TPIZ 2AH4X 2EI6A 4IBLH 4P00A 3BEFB 5DN6D 4I7YH 1RTKA 3T28A 2GKVE 1TNKA 2ZU5A 1C5XB 1ID5H 6CHAC 3E6PH 2XBWA 1HXEH 5KECA 4UFDH 1GG6B 1SC8U 4ABDA 1G36A 3A86A 4HGCA 1H8HD 1QRXA 4LXBH 2PUXB 1J16A 1FDPA 2O8MA 1QBVH 2L6OA 1O3EA 2PKAA 1VJAU 4FUGA 4Y8YA 3KEEA 2PR3A 3CENA 4AGJA 3NCLA 2B7DH 4Y6DA 4BTIB 1BJVA 3UNRA 1MABB 3GY8A 1O2VA 1ZRBA 1O3HA 3T26A 1EJNA 8GCHF 3SV6A 2ZCLP 2XC0A 2VWNA 3LGUA 5AFYH 1NFWA 1J14A 1RRKA 3FP7E 1SGNE 1DS2E 3P8NA 2HGTH 3MU5A 2RA0A 4XBBA 3T5FH 4CR5A 1DY9A 3MU8A 5F53A 4ISIH 4OS2A 1CE5A 1TMBH 3OEED 4FUBA 2ALVA 5FCKA 1K1IA 2UWOA 1C1TA 1T8LA 2F9NA 3ZYDA 1QBNA 1P06A 4X1SU 3M3VA 2IPQX 3N7DA 1PQAA 1KXAA 2ZNKH 1KXBA 1QURH 1O2TA 1ARBA 2ZFPH 3DFLA 2FTLE 2Z9IA 5JPMH 2OBOA 2C8ZB 4X1NU 1OKXA 1AE5A 4Y11E 2ZCKP 4Q7XA 5DJ7A 5TCAA 3UY9A 1O3AA 3GCHC 3OX7U 4ZHAA 1LVYA 3HK6B 3OTJE 1A3EH 3QTOH 1FPHH 1CGIE 3ITIA 2XBYA 4Z1MD 4LZ1H 3DSGA 2ZGJA 2OC0A 3FVFB 4B2AA 4GUXA 1EAUA 2UUJB 1O2XA 1H9LB 5A2MH 2BMGB 1EPTA 2HRVA 2W6JD 1EOJA 1W7XH 1QIXB 1C4V2 2Z9GA 1EX3A 2W3IA 4FOUC 5EW1H 1P12E 2AMQA 3MU0A 1O2IA 1RIWB 1ZPZA 2VBCA 3PWBA 4GHQA 1TRMA 2G81E 1FUJA 2FWWA 1DITH 4AG1A 1MU6B 3UIRA 3BN9A 1BTXA 2W7SA 1Y59T 2VINA 8KME2 2ZU2A 1SVPA 3RXUA 2P8OC 3U69H 5E0GA 2BYAX 1AQ7A 3A7XA 1XUJA 3ZZBA 3SUEA 3VG8A 3EA8A 1GBDA 3A7ZA 1RGQA 1V2OT 1P2OA 1W10U 3RXKA 2ZGCA 1HAHH 3P8OA 2WUBA 1WTHD 1GBHA 2YOLA 2QC2A 1SGRE 5CE1A 3LC5A 4D8NA 2JETC 1XVOA 2ODQA 1V2TT 1C5RA 2A4QA 1Z8IB 1P2NA 1IHSH 4P02A 2LNCA 1GBEA 1K1JA 1IQFA 1Q31A 1YPLH 3SJ8A 2AGIX 1NFUA 3BTME 1P09A 2J94A 2ZA5A 2VIWA 3SGQE 3H7TA 5AVDA 1GVZA 1QB6A 1AWHB 3T25A 4BAOB 2GV6A 5T6DA 1UTOA 5FPTA 3BTQE 3TGKE 3KCGH 3QZQA 1Y5UT 4X1PU 1DWEH 5DP4A 2ZQ2A 1ABJH 2Z7FE 2Q6DA 3RXCA 3PO1B 3HK3B 2OTVA 1XVMA 4WWYA 1GHVH 4X1RU 2F9PA 4I8KA 1TLDA 4X2WA 5HMAA 1C5TA 4JYTA 1LPZB 2BM2A 2BOKA 4Q80A 2F9OA 3BG8A 4THNH 2F3CE 2ZECA 1LVMA 2RDEA 2A0QB 1LO6A 2GVFA 1GJ6A 4NZQA 4O3TA 3SOSA 1AZZA 2O8UA 1BITA 5E2PA 1EZUC 1LKBA 1ZZZA 1P3CA 1V3XA 3FN8A 2GJGA 4I31A 3U98H 2GCTC 4A1TA 3KQBA 1FXYA 3KIDU 1NFXA 2ZTXA 4FUCA 1C2IA 1C5WB 2NU2E 5C17A 3I29A 1E34B 3IWMA 1HIAB 1V2KT 3A83A 4UDWH 4JZ1A 3HPTB 1O2RA 3KHVA 4OS5A 3UAIC 4A1VA 3SO3A 1C2JA 1OWHA 3PMHB 2V35A 1PPZA 6LPRA 1M9UA 4WVPE 4ISHH 4E06H 2YNAA 5A8XA 4H6SB 3PV5A 2GV7A 1EAXA 1MH0A 2ZGHA 4HFPB 1TBZH 3GY3A 1E79D 1CT0E 4CRFA 2G00A 3T2NA 1A4WH 1TA6A 1W2KH 3QGNB 1H8DH 1SOTA 1AVWA 2VVUA 2VGCC 4B74A 1NS3A 5L6NH 1PQ5A 1D3DB 4RKOB 1W0ZU 1AWFH 1BRUP 1N1LA 3ZVGA 2BHGA 1FY1A 1P02A 4CH2B 1ELTA 1YWUA 3EGKH 1RS0A 1UCYK 4CRAA 3GYLB 1AFEH 2R3YA 3UUZA 1T8OA 1A0JA 1GHAG 2FI4E 2V3OH 2ZIQH 1BT7A 2ZHQH 4ZAEA 1DFPA 3BIUH 1DM4B 1HAVB 3FZZA 3PRDA 1FAKH 3K2UA 1ETRH 3CP7A 7KMEH 3IG6B 1YPHE 1P01A 3RU4T 1HUTH 2P59A 3RP2A 1O3FA 5JDUB 2D8WA 1LQEA 1O2NA 1O2UA 3H5CB 4FU7A 1MKXK 5E0HA 4Q4LA 1LHCH 3RXEA 3S9BA 2SFAA 1KY9A 2GMTB 1NRSH 1VCQA 1TGBA 1GJAB 5JBBS 3DA9B 4X2VA 3SJIA 1N6YA 4OS4A 4YZUA 4OM9A 5DKMA 4BNRA 4OGXA 2H6MA 1HAPH 1ZMJA 2TGPZ 1P3EA 1SR5C 3MYWA 5HIZA 3NXPA 1PPBH 3AK5A 2QIQA 4U01A 3EQ0H 3RXJA 4DVAU 1GGDB 5EQRA 4Z6AH 1PPGE 1W12U 2O8WA 2UUYA 1QJ1B 3D49H 2FOBA 3NKKA 1UCYH 2IPHA 2CMYA 3SV2H 3SU4A 3LC3A 1WQVH 2FYQA 2G4TA 4FVBA 1HBTH 4NZLA 1SGPE 1Y3VA 3VGCC 1NO9H 2ZFFH 3SI3H 4B73A 4IC5A 1ETTH 2NU3E 1MKXH 4SGBE 4I8HA 3B9FH 1O3CA 3OEHD 2J92A 3SGBE 1HNEE 1H1BA 4R8TB 3RXPA 1UVUH 1ELCA 4DIHH 3T62A 4K69A 2C8YB 2FO9A 3DD2H 2BLOA 1P2QA 3RXLA 1SQRA 4GSOA 4U30A 1T8MA 3EA9A 1TNIA 9ESTA 1HIAA 1YPEH 3I77A 1G9IE 3P70B 3TJNA 1D6WA 1FIWA 3VFEA 5IDKA 1DVAH 1G3CA 2Z9LA 2ZP0H 3UR6A 5ESTE 1P10A 3BIVH 1SQAA 4UFEH 4TY6A 1G3DA 2V6NA 2UUFB 1T4VH 2C90B 5DK1A 3P8GA 3F6UH 1KMHB 3QWCH 3MHWU 4OS7A 3A8DA 3P17H 2GDDA 1RD3B 5CHAC 3EE0B 1S85A 2FEQH 2ZGXH 5JYIA 4X8VH 3F9HA 3SGAE 1FN8A 1RXPA 1C5QA 4CRBA 1TGSZ 2ZDKA 4ZKSU 4AOQA 4D7GA 1GBMA 2H5DA 4JCNA 5C3NA 3MH6A 1SGIB 3UB0A 1S5SA 4MPVA 5K7RA 3A82A 3WWFA 4WF8A 3F2GA 1GMCG 1WBGB 4I8JA 1GBJA 1H4WA 4LK4A 1HAVA 1ZGVA 1Z8JB 4NFEA 3SU3A 2BDGA 5FX6A 2XCNA 5ABWA 3MU4A 5HM9A 1G3EA 2QXIA 1IQMA 2B9LA 1TNGA 2STAE 1A7SA 4I33A 1GI2A 5GXPA 4YT6H 1FAXA 3UOUA 3M5OA 1N8OC 1V2VT 1XM1A 3BSQA 2AIQA 4FUDA 3Q00A 1QB9A 2FOHA 2ZFTA 2H2ZA 4AFQA 3UNQA 4IN1A 1ZMNA 1QZ8A 3M7UA 4NGAH 1LCYA 5EOKA 3MNCA 1TOMH 4B6FA 1HAYB 2JDID 5EJLA 1T7CA 2ZDLA
chains in the Genus database with same CATH topology
2A2QH 1BMLA 2A7HA 2BD4A 2P93A 3SUFA 4DG4A 1MD7A 1SB1H 3GY5A 1NRQH 5GNDA 1TE0A 1SQTA 1VGCB 1CT4E 1MZAA 3A84A 1BCUH 3M3SA 4RSPA 3UOPA 4B1TA 2QY0B 3RU4E 3NZIA 2QF5A 1SGEE 1O33A 2Z9KA 1BTZA 3PLPA 1BBRK 1EZSC 4ZH8A 1C2DA 4ZXXH 2BXTH 1SPJA 1NC6A 1KTTB 1VCWA 1EASA 4Z0KA 4JMYA 3SUDA 2A4OA 1C2KA 1C1UH 3LH1A 4VGCB 2GD4B 4OS1A 3S0NA 1T8NA 2FS9A 1BHXB 5GPIB 3RXRA 3ZZ5A 2FLRH 4GPGA 1GBKA 1SGTA 2GCHF 2WYJA 4F55A 1OP0A 2RDLA 1C5LH 1E0FD 2GGVB 1SGQE 3T27A 1F2SE 1TQ0B 3OY5U 4NWKA 4CREA 3E3TA 1S0RA 3SJ9A 1AB9B 1EJMA 1YLDA 1TX6A 4KP0A 1MTWA 4B6EA 5C5OA 2XCFA 1AIXH 1SQOA 2VIVA 4Y10E 3M7QA 3ELAH 5GIBA 3I78A 4CRCA 1TMUH 4ABAA 3A87A 4XDEA 1OPHB 2QXGA 4NA9H 1C5SA 2BY9X 1C5MD 2JH0D 4FUEA 4SGAE 4XBCA 1TNJA 1C5NH 2WV5A 4ZXYH 2HLDD 5E2OA 1GBTA 3A80A 3A89A 3ATLA 4IN2A 3GS9A 1AFQC 4KTSA 4YT7H 2R2WU 1HAXB 2XWAA 5LGOA 5FPYA 2OUAA 3OY6U 2I6QA 2F9BH 3BEIB 1YF4A 2ZO3H 4ZUHA 2A2XH 3F68H 3GCTG 5CMXH 2HVXA 5T6GA 3SU5A 2BQ6B 3VB4A 1ANEA 2NWNA 1NZQH 1AVXA 4CHAC 1GBIA 4INHA 1A3BH 1Y5AT 2W7UA 3GY6A 4WH8A 4JK5A 3AASA 5A0BA 1JXPA 2FI5E 4XD7D 3FFGA 2XBXA 2OC1A 2TGTA 2W3KA 1GHBG 1SHHB 1ZYOA 2SGFE 1C1MA 3NK8A 3BG4B 2FODA 3DT0H 1NROH 3KGPA 5JBAS 2XYAA 2TIOA 2PTCE 4BOHA 1K21H 1A0LA 1C1WH 3C1KA 1PQ7A 4DT7B 2HWLB 2UUKB 7LPRA 5HYOA 3SV9A 1GJ4H 1ELEE 1O5BB 1A46H 4BAQB 5C1YA 1LVOA 4INLA 2BDIA 2C93B 4YOIA 2ZHWH 3RUOA 3TGIE 3P6ZB 1O5CB 2Z9JA 1PPFE 4AFZA 3FP6E 2V0BA 3LOXA 3F9GA 1HYLA 2QF3A 3ZYEA 1JMOH 3SNCA 1BMNH 1Y8TA 4K60A 1AO5A 1U6QA 1AMHA 1ZTLA 3ZVCA 2O9QA 1DWBH 5BRRE 3HKIB 3KQEA 3ZV8A 4M7GA 1BTWA 4ABGA 3QN7A 3OTPA 4FUIA 1TWXB 2H9HA 4DURA 1BTUA 1CGHA 3M35A 4TYDA 1MTNC 1MQ5A 5FL7D 2Y82A 1P2KA 3RM0H 2CHAB 1HPGA 3TK5A 3M5LA 2OQ5A 1D3TB 1BQYA 2GT8A 1HV7A 3E0NB 1O2QA 4NIWA 3ZZCA 1GI8B 3RXTA 1GJBB 3UPEA 1GHAF 4YESB 3V7TA 4FUFA 2CV3A 4Y0ZE 1Z6JH 1Z8GA 1UTLM 4E05H 1DX5M 3ZV9A 4DW2U 3PLKA 3B23B 2KR7A 3KNXA 4MNYA 4YTAA 1IQLA 1HB0B 3LH3A 2FI3E 1LHFH 3LKWA 2G4UA 4IC6A 3ZIAD 2FOGA 4F49A 1C1VH 1H8ED 2BY6X 3ZZ9A 4K5ZA 3ZZ6A 1F0UA 1TNHA 2A4RA 5C0UA 1GI7B 3A8BA 4JZDH 1Q3XA 1SFQB 2NU0E 2D2DA 5E0JA 1V2QT 5C1XA 5F6MA 1O0DH 1XUGA 2AMDA 3GOVB 3SQHE 3K6YA 2H5CA 3LPRA 1W14U 1HAGE 2EI8A 2SGAA 2ZKSA 5EG4A 2Z6BD 2SNVA 5LPEA 1GJ5H 1AUTC 2PW8H 4H4FA 1EXFA 4DCDA 4Y7BA 1ESBA 1AVGH 1EATA 1S82A 1IAUA 4K3JA 2SGPE 1FY4A 5EGMA 3BTTE 1FONA 1QHRB 3UQOA 1BIOA 3GYMA 1F92A 2KM0A 3UNSA 1CHOG 1TPOA 1OWIA 5JB8S 2SNWA 4CBNA 2AGEX 1FLEE 1HJAB 1UVPA 3UWIA 2BVXH 2YMSD 4X6OA 2CJIA 1W3CA 1DICA 5EXNA 3RXGA 2EA3A 4CH8B 1OP2A 2I6SA 1W0KD 1QR3E 1HCGA 2FYRA 1O2GH 2C8WB 3LJJA 3DSPA 1HFDA 2M5TA 2WV9A 4ABEA 1JIMA 1BB0B 1O5AB 1QL8A 4DY7B 1S6LA 3A8CA 3HGPA 1EPTC 5LPFA 1YLCA 2PFEA 3N7EA 1SI5H 2JH6D 4ZCNA 1C1SA 1QL9A 2BD8A 1SFIA 1OWDA 3P92A 4RI0A 3SU6A 3OYPA 1GHZA 2VU8E 1UK3A 3M5NA 3V3MA 2C4FH 5J4QA 1GBAA 2OBQA 3QLPH 1C9PA 3BF6H 4XE4A 2AGGX 1PYTC 2PKSC 1EB2A 2P3TB 5I25A 4X0WU 3E91A 2AS9A 3A7VA 2Z3EA 1O2JA 5EXLA 4H42U 4NFFA 4BANB 1TRYA 4Q7YA 1ZSKA 3Q77A 3LONA 2IOTA 2WPKS 4NSVA 4GLYA 4XOJA 2OC7A 2F91A 1IHTH 1TFXA 1W7GH 3E0PB 1MQ6A 4Q63A 1RTFB 4UE7H 3FAOA 3SUGA 1JOUB 1GG6C 1LHDH 1P04A 5IYTA 3LGYA 3FZDA 1SGFA 1YCPK 1B0EA 5HM2A 5I46H 2FXRA 1BTPA 1ZJKA 3RXSA 3L6PA 3D62A 1GMCF 2C8XB 1GCDA 4INKA 4NIVA 2YMSB 1A5HA 3E1XB 1GPZA 1Y3UA 3V13A 1GCTB 1F0RA 2Y7XA 4AFSA 2CK3D 3R3GB 2XW9A 1WCZA 3O8RA 3RLWH 1FY5A 4D76A 1GBCA 1GBFA 1WU1A 5EODA 3ZVBA 2BZAA 4AB9A 2BD3A 2QGRA 1OOKB 2FESH 2P3UB 4DJZB 1P11E 2CN0H 3Q76A 4OS6A 2GZ9A 5EXMA 2BQWB 4MLFB 4IMZA 2XC5A 3TJVA 1JIRA 4NCYA 1FI8A 1Z71A 5GDSH 3SU2A 3AAUA 2WPLS 4J1YA 3ZVAA 4K8BA 2J95A 2GTBA 1Z1IA 1XX9A 5C1UA 1OS8A 3Q3KA 2FOCA 2BB4A 1ESTA 1YCPH 1C5VA 4IGDA 3QX5H 1UTPA 1O3LA 3VEQB 1K1NA 1O5EH 5DP8A 1QBOA 1O3MA 1WSSH 1E35B 1NY22 1C2HA 7GCHF 2Z94A 1O3DA 1BTYA 1TPPA 4KELA 3ZVDA 5LPRA 1QQUA 4J2YB 2ZWLH 3RC4A 2BDAA 2AERH 1HGTH 1MAYA 3FO8D 1SGCA 4QT8C 1UTNA 2Q6FA 2B5TB 1C5OH 1V2UT 2DUCA 3NRLA 5T6FA 5CDFE 1QJ7B 3ATWA 2R3UA 5CHBA 2VIDA 1IQIA 4HI3A 1DUAA 2UWLA 1H9IE 2OD3B 3VB7A 2JJ2D 3W94A 4GCHG 1YPJH 1O36A 1NT1A 3ZZ3A 1TGNA 3BTGE 3UFAA 3MH5A 1BTHH 2BD2A 1CQQA 1RIWC 1XMNB 7ESTE 8LPRA 3VXFH 1C1QA 3A85A 2WSSD 1OWJA 1WTGH 4IMQA 1C1PA 2ZTZA 4I32A 2HPQH 1ZPBA 2FIRH 4ZMAH 1INCA 1BOQA 1CA0B 3ODFA 3K6ZA 2A31A 5L2ZH 1TIOA 2BLQA 3UQVA 1AE8H 1O2KA 1ZHMA 1EAWA 1XXFA 2CGAA 3CS7A 2BLWA 3PRBA 2D1JA 2F9VA 2OXSA 1GMHG 4FETA 2K0QA 4MPUA 1NBME 2A7JA 3UREA 1AUJA 1V2MT 1IQEA 1A0HB 2ZDVH 1TOCB 1WUNH 3Q3XA 2JJ1D 3GY2A 1YM0A 1RTLA 1KTSB 4ISLA 3ZZAA 3T29A 5TJXA 3GCTF 2PLXA 3G01A 4GVUA 5HXFA 2FDAA 1WQSA 4ABBA 3U8OH 1TAWA 1KIGH 1KSNA 1F5RA 4TPIZ 2W5EA 1C2LA 4DIIH 1KLTA 1YP9A 4X8UH 1PJPA 4MNVA 3FP8E 4NA7A 1ARCA 1SG8B 3M36A 2K8IA 3ZZ4A 2XOKD 1J17T 3DHKH 4YOJA 3KQCA 4JYUH 4NIYA 1L4DA 1GHBF 1CBWB 1LMWB 2ESTE 1GI9B 2P16A 3UWJH 1G32B 4DOQA 1CGJE 1JRSA 3PO1C 4BAMB 1V2RT 3IITA 3TK9A 1P57B 2P94A 4X8TH 1HDTH 1ZJDA 5FAHA 2A5AA 2Y7ZA 2ZEBA 2ZDAH 1DXPA 3GICB 2TGAA 2VH6A 3WW7A 4XFQA 2QCYA 1DXWA 3EDXB 2JKHA 1K1OA 1OXGA 1PFXC 2HNTC 1GI1A 1E1RD 3LJOA 1G2MA 5E8EH 1ELDE 1PPEE 5SGAE 1L0ZA 1MTUA 2VWLA 5LH8A 3TK6A 1TB6H 4MVNA 4NG9H 2CXVA 1K1PA 1GI3A 1YC0A 2FOFA 4XSKU 1GWAA 2GT7A 1CSOE 5B6OA 1NRRH 1LHGH 1FQ3A 3AVZA 4YLUA 3MOCA 4HZHA 3O8BA 5C20A 1S6FA 3F0OA 1K28D 1PQ8A 4Q2KA 3SN8A 2PTNA 4K1EA 2F43B 4PROA 1HAOH 4JZIA 3HGNA 2QF4A 2BD7A 3M5MA 2WZQA 4DT4A 3Q3YA 5HKKD 4Y0YE 3KF2A 2FX4A 1P0SH 2ZU4A 4I8GA 4Y8XA 1MMJN 1GI0A 3MMGA 1XUKA 4ABFA 1TGTA 1O35A 1SLUB 3TH4H 1AI8H 2SGDE 2HPPH 2W26A 6CHAB 1TALA 4TY7A 3RU4D 2K1QA 3NPSA 1NN6A 4NSYA 3TNSA 2BDHA 1CA8B 1FY8E 4CBOA 4E7NA 1GHYH 1SBWA 5A0AE 1JRTA 2VVCA 1O38A 3RXMA 4TSFD 1AGJA 3SV7A 2UWPA 2BVSH 2BLVA 3ESTA 1O2PA 2SGQE 3LGIA 1ELFA 3LDXH 3RLYH 2FLBH 2PHBA 3SNAA 3L33A 5G4BA 2FPZA 2OP9A 2R2MB 1P2JA 3U8RH 4A6LA 2ILNA 2ANMH 3NUMA 4B2BA 5GJ4B 1RJXB 3RXHA 4O97A 2G55A 1GI4A 1D3QB 4WXIA 4ZHMU 1GI5A 2ASUB 1QGFA 2GMTC 1TYNA 1FX0B 1E37B 1S0QA 1GBLA 1QY6A 2EEKA 4YLQH 3O8CA 3RMMH 2ALPA 3ATIA 1HRTH 4AYYB 1BA8B 2G52A 1V2PT 4B75A 1BRAA 3SNDA 5DP9A 3O8DA 3ZZDA 3MH7A 3TJOA 1BRBE 1C5ZB 3MO3A 2KCOA 2Y6TA 1IOEA 1S83A 3FOAA 1GGDC 1DDJA 3SI4H 2EI7A 1PPHE 1CHOF 2WPDD 3F9FA 1BMFD 4UEHH 2ZHEH 3RXIA 2XXLA 3RXOA 3GCHB 1G30B 1P9UA 1E1QD 2BDYA 1UK4A 4WJG2 1VJ9U 2R0LA 2QA9E 5ETXA 1K1LA 1C2FA 4R0IA 4UFFH 5F03A 1LVBA 1GVLA 1XKBC 3RXVA 3D65E 5FHTA 1BBRH 1IQHA 1O3IA 2LELA 4ZHLU 1FMGA 3BTEE 3MI4A 1EJAA 3QGJA 3SW2B 3L3TA 4I8LA 1AN1E 1KDQB 4CRGA 1GMDG 1GBBA 5A8ZA 1ELBA 1XUHA 1YPMH 5F8ZA 2BD5A 3K65B 1A5IA 3BTDE 3MU1A 5DP3A 3RXDA 1UTQA 2STBE 1B7XB 5DP5A 5DO4H 1AU8A 3NWUA 1QJ6B 5TCCA 1C9TA 1CT2E 2P8OB 2FTMA 4YO9A 4UFGH 1DY8A 3C27B 2F4LA 1YPKH 3RDZA 3SU1A 3SZNA 1T31A 3TVJB 3RXBA 3K9XB 2JETB 2GZ7A 3F0PA 1GDNA 2IJD1 3ZVEA 1UMAH 2PV9B 1EP5A 4AX9H 2KCPA 1AKSB 1HJ8A 4JZFH 2VIOA 3E90B 1Q2WA 3U1JB 1AD8H 1EQ9A 3MNXA 2KCYA 1LHEH 1A61H 1YGCH 1FN6A 2FMJA 2ZPRA 4LZ4B 1LPGB 1COWD 2Q1JA 4TWWA 2GDEH 1YBWA 1GDUA 4O9VA 2PGQB 3A7WA 2J5UA 2NU4E 3EYDA 1MUEB 1TPSA 1Z7KA 3GDSA 5AFZH 2JH5D 2HNTF 3LGTA 4X2YA 2P3FH 2H9EH 1FJSA 2ZQ1A 1DANH 4X8SH 1C1RA 1QB1A 4JK6A 3TU7H 1LTOA 1ZLRA 2BDBA 4TWYA 1IQNA 1FNIA 1IQKA 1L1NA 1UK2A 2QN5T 5T3HA 1O3NA 1A5GH 2OQUA 2BD9A 2BY5X 1ZTJA 4ASUD 4TPYA 1ZPCA 1VGCC 5BPEA 4AZ2B 1AHTH 2GCTB 2GP9B 2YNBA 1G2LA 4ESTE 3QO6A 8ESTE 1ORFA 2TPIZ 1SGYE 1EUFA 3D23A 5C2ZA 4Q7ZA 1O5GH 1GJ8B 1E36B 3ENSB 3RXAA 2AIPA 1W0JD 1YKTA 1V2LT 5J4SA 3LGVA 2CF9H 2KCAA 1MAXA 2B8OH 2BX3A 2TGDA 3V12A 1SGFG 1MTVA 3RXQA 3CS0A 4GCHF 2BX4A 4H6TA 2ZFQH 1G37A 4VGCC 2AHME 1J15A 1Y3WA 3B8JA 1S81A 3A7TA 3VB3A 2Y80A 1NU7B 3PV2A 1KDQA 1O39A 1KXEA 1DLKB 1THRH 3WWBA 4JYVH 3VB5A 3PTBA 1YCPM 2VGCB 1QL7A 1PPCE 1VCPA 5GCHG 3PM3A 2VIQA 3STIA 4AGKA 5FPSA 1EKBB 1C4Y2 1AB9C 2A45B 2OINA 4YM9A 5IK2D 2AYWA 3GCNA 3FANA 3MNBA 5H4IB 1HAZB 1O2YA 4CRDA 1XUFA 4MNWA 3HATH 2BTCE 2G51A 2O8TA 4CR9A 1THSH