1PYTC

Ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
248
structure length
248
Chain Sequence
SRPSSRVVNGEDAVPYSWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLQGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQEALLPVVDYEHCSQYDWWGITVKKTMVCAGGDTRSGCDGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWINETIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ternary complex (zymogen)
molecule keywords PROCARBOXYPEPTIDASE A
publication title The three-dimensional structure of the native ternary complex of bovine pancreatic procarboxypeptidase A with proproteinase E and chymotrypsinogen C.
pubmed rcsb
total genus 53
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytC02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytC01
3BTEE 3KGPA 1CGHA 5DK1A 3MO6A 1Z6JH 3KIDU 1HXFH 3M7UA 4IMQA 5A8ZA 3LGTA 1SFIA 4UFFH 4F49A 3STIA 1D3PB 1CHOF 1LPGB 1C5MD 1Q31A 2WPLS 3RLYH 2PTNA 4X1QU 4AX9H 1VGCB 1AFQB 2FIRH 1V2WT 1ELGA 3S7HB 3ZVEA 1TALA 3ENSB 4JK6A 1PJPA 3MNBA 1CT2E 3GDVA 1GHAF 1W11U 5GCHG 4IN2A 2I6QA 4DW2U 1IQMA 1KXFA 1DANH 1GBIA 3SU0A 3TGKE 4ZXYH 3T26A 1WBGB 3U8OH 2BVRH 4NG9H 1XM1A 2QA9E 1V2LT 1HB0B 3SNBA 3SN8A 2BMGB 1TGTA 4D7GA 2R2MB 3ZZDA 5FBIA 1CGJE 1O2IA 3ZZ6A 3STJA 5HYOA 1LPZB 1EAUA 5C2ZA 3AAVA 4FVBA 4XOJA 3VGCC 4KELA 1HIAB 1GCTB 1O31A 2W5EA 3PTBA 3A7TA 3D23A 1GMHG 1UO6A 4DIHH 4MVNA 3ODFA 1FY4A 4DURA 1ESBA 1CE5A 3UR6A 1UTOA 3GOVB 3GCHB 5GWZA 2NWNA 1S6FA 3A86A 1XMNB 1FZZA 1W7XH 4ESTE 3D62A 5LH8A 2DE8A 1K1OA 4FU7A 1HYLA 1YLDA 4NCYA 2AIQA 1DY9A 2A4GA 4JZ1A 1GMDG 1EJNA 1UCYH 1C9TA 4X2WA 1SLXB 2ASUB 3MO3A 5DP4A 1UK4A 8GCHF 5GDSH 3K6YA 1DVAH 1TNLA 2NU4E 1O33A 3RXCA 4OS6A 1BIOA 4TYDA 2FODA 3TK6A 2PUQH 3GY4A 1OWEA 4INLA 4UD9H 4X8TH 1YP9A 3UWJH 4J1YA 3KQBA 3EE0B 2ZCHP 1SGRE 1CBWC 4F4OC 2OINA 3UQOA 1HAHH 1EB1H 1HAXB 4CH8B 1CGIE 2PHBA 3F9EA 3T28A 3RXQA 1O2KA 1W10U 1TPSA 4KKDA 2D8WA 4Y76A 1AD8H 2VIQA 1UVSH 4Q80A 3O8CA 4YO9A 3P8GA 4DOQA 1K21H 3H5CB 5JBBS 2ODPA 1FMGA 2AMDA 3SHCH 2BQ7B 1GL0E 2G51A 3GY7A 1NFWA 5LPFA 2GMTB 2QIQA 3LPRA 2HLCA 3V7TA 1AWFH 1ZR0A 1XUJA 1TPAE 1TPPA 2G55A 2ZP0H 3SJIA 2SNWA 1SGTA 2GCTC 4B76A 1BBRH 2PWXA 1EX3A 3M36A 2FTMA 4BOHA 2JH6D 4TY6A 1YPKH 1AGJA 1Y3VA 3SNDA 1GJ4H 3R0FA 1AUTC 2P8OB 3SJ8A 2W26A 4ABIA 5DKMA 1GHBG 3U98H 1KXEA 3SUDA 3OYPA 1OPHB 4VGCC 4GAWA 1DITH 1C5TA 1CHGA 5A8YA 5HGGA 1O30A 1YKTA 2C8ZB 1SBWA 2VVVA 4IGDA 1DE7H 1O2RA 4X1SU 5F03A 1GHYH 1DX5M 1W8BH 2AGIX 3SU4A 1P57B 1GBKA 1T8LA 1O3CA 1KTSB 1YPEH 4WMDA 4ZKOU 2FS9A 2FYQA 1S84A 1ZHMA 4MNWA 4NA9H 3PYHA 3FAOA 2Q6GA 3SGQE 1O5CB 3L33A 1PPFE 4IW4E 2R0KA 1JMOH 1DY8A 2Q1JA 1NROH 3BTHE 1O2OA 1FN8A 3D49H 3ATKA 5LGOA 3RDZA 3RXIA 4YTAA 3RC5A 1IQEA 3SU2A 1Z71A 3LGUA 1KXDA 3C27B 2ZQ2A 2C8YB 3UWIA 5T3HA 7ESTE 3ESTA 1T8NA 3EAJA 2UUKB 2BY9X 5PTPA 1P0SH 1WQVH 1S83A 1C2HA 1QL7A 2ANKH 1BTYA 1TOMH 4M7GA 2BX4A 1IQNA 2BYAX 1C2LA 1MD8A 3KHVA 4X2XA 1SOZA 2ALPA 1GBMA 2GT7A 1AN1E 1DLEA 2UUYA 3H7TA 3S69A 1OXGA 3QN7A 2ANYA 1A3EH 1G3CA 5DP3A 4FUIA 1EPTC 1MH0A 2THFB 3V12A 1FAKH 1O35A 4FUDA 2BXUH 1ELEE 5FX5A 3Q3XA 1UCYE 1XVOA 4RSPA 5JYIA 3LDXH 4IC5A 1P02A 4JYVH 1Z8RA 4Q7ZA 4CRDA 1F7ZA 1HAIH 5AF9H 2VVCA 1BTUA 1BUIA 4IN1A 1O3DA 3OTJE 3ELAH 1A0JA 2VIVA 2G4TA 2P3UB 4CRBA 2WYGA 1O3KA 3RM0H 3F9FA 1W3CA 1MQ6A 3RU4D 2TGDA 1XUGA 1E34B 3VGCB 5E0JA 1S6HA 1ETRH 3RXPA 3MU8A 1AVXA 3SQHE 1PPZA 3E90B 3SQEE 1OWJA 4X6NA 1UTKA 2CGAA 1BITA 3RXRA 3W94A 3PMJA 4NSVA 5IYTA 5K0HA 1GI7B 1EJMA 2FWWA 1H9LB 1QFKH 1GBCA 3H7OA 1TMTH 4NSYA 4ISOA 2QGRA 2C8XB 2AGGX 5FAHA 2PTCE 4Y8XA 2JETC 1MTSA 1FONA 2Y81A 5AFZH 1KLIH 4O3UA 1BTPA 2J94A 5BRRE 1TRYA 2OTVA 3D65E 2ZTYA 1SVPA 1P2NA 2P59A 4ZHMU 3ZVCA 1TMBH 5DGJA 1BBRE 1JOUB 3RXUA 1C5LH 1G2LA 1EQ9A 1NZQH 2BDIA 1CBWB 1GBTA 3IITA 4ZKSU 3G01A 3HATH 4JCNA 1BJUA 2BD7A 1EP6A 1QBVH 4GSOA 1A2CH 5DPAA 5GPIB 1D9IA 4YZUA 3PMBB 3JZ1B 3LKWA 1O3MA 1UHBA 3LOXA 1TRMA 4NA7A 3SNEA 3VB4A 2PGQB 3T25A 4MNVA 4NFFA 3OU0A 3BIUH 5L2YH 2TBSA 5DP7A 3S9BA 2BTCE 4NZQA 3TNTA 3ZZ8A 1JRSA 1QQ4A 4ASHA 4CBOA 2BD8A 2H5CA 2OBQA 3BV9B 1EZUC 2P16A 1IAUA 1DM4B 1TNGA 2GCTB 4ABEA 3NUMA 4GHQA 4QT8C 3M3SA 1MCVA 1SB1H 1EKBB 1V6DA 1ZJKA 2FOCA 1ZMNA 2BLOA 1TWXB 1D6RA 1S5SA 2Z7FE 1FQ3A 5EXLA 4XSKU 4Y7BA 1LVYA 4FUJA 3B23B 1GI3A 1GJCB 1AWHB 4BAKB 1O2ZA 1EXFA 2ZO3H 4VGCB 5EOKA 3S7KB 5GXPA 4B71A 4ISIH 1Z1JA 1C1MA 1MD7A 3RXBA 3UIRA 1FPCH 3VB5A 4D7FA 2J2UA 3LC5A 1UCYK 1QJ6B 1SHHB 1C1PA 1TNIA 1TNHA 2ODQA 4DJZB 3BTKE 1F5RA 1XUHA 3RXMA 3FP7E 3U9AH 5AVDA 1MCTA 1NESE 1GJ5H 1F5LA 1SR5C 1O2XA 2F9BH 1KTTB 1GI4A 1ORFA 2FI4E 1C5VA 1QCPA 2KAIB 1C2IA 3EQ0H 2FOEA 1FY1A 4TY7A 2H1UA 4K5ZA 2BM2A 2R3UA 3P6ZB 2AERH 1AKSA 2O8WA 3VB6A 4AYVB 1UTQA 5EQQA 3SJOA 2ZKSA 1UVTH 3JZ2B 1QA7A 8LPRA 3RUOA 2J4IA 1HNEE 1MTWA 3ZZ5A 1H9IE 2ZFQH 3GY6A 3S9CA 1C4U2 2W3KA 4A7IB 2BZAA 2EI6A 5E0GA 1TBQH 1HJAC 5A0BA 3BG4C 1OP0A 3BTQE 3MH4A 3R3GB 4U2WA 4NIYA 1GVLA 1IQLA 1SGEE 4I8KA 5CE1A 3BG8A 2H9TH 1OWIA 2A0QB 2XBYA 1EPTB 3ZV8A 1E35B 1BBRK 3E8LA 1Z7KA 2F9PA 1GJAB 5FCRA 4SGBE 1KXBA 2ZU2A 3RXAA 3NCLA 2GP9B 2ZPSA 4RKOB 1K1NA 4K2YA 1RD3B 1L1GA 3A8AA 2F83A 3A7VA 2Q6DA 1C5XB 2AH4X 3ZVFA 4OS1A 1TBRH 1RRKA 5TCAA 2ZHQH 1JRTA 4CBNA 2A32A 1Z8IB 1V2KT 1QRWA 4DCDA 1C1QA 1C4V2 3RXJA 2PKAA 2RA3A 1C1WH 1QRZA 4CR5A 1C5NH 4I33A 4DGJA 1O3OA 1L4ZA 2FDAA 4AOQA 2HOBA 3TJOA 1JIMA 2VGCC 4ABAA 3LGVA 3RM2H 3SBKA 1F0UA 1NRQH 1Y3YA 4UFEH 3ZVBA 3M61U 3DFJA 1GDNA 2XWBI 2YNBA 4K69A 5C1YA 5DJ7A 1BDAA 2JETB 1TIOA 2ZHWH 3LC3A 6GCHF 1H9HE 1K2I1 2FLBH 1SI5H 1QB9A 1XXFA 3MYWA 2CHAC 1LHCH 3U1JB 1E36B 3BEUA 1HXEH 1M9UA 1GBEA 2Y7ZA 4X8SH 2ZFTA 1SGPE 4CRFA 3DD2H 2A5KA 2J34A 2R0LA 1TFXA 2QAAA 1K1JA 1NN6A 4H4FA 2B8OH 5HM2A 5JB9S 1EASA 1DWBH 5LPRA 1A5HA 2Z9JA 2FI5E 1C2GA 1GHZA 3N7OA 3SU5A 3VXEH 5FBEA 4ABJA 2NU1E 1XXDA 4YT6H 5BPEA 3I78A 2C93B 8ESTE 4MPWA 2Y80A 1P01A 2XBXA 5I25A 2EI7A 2DUCA 2OQ5A 3MNXA 1ELCA 3UUZA 2BDYA 1ZGIA 2ZCLP 3Q3YA 1T7CA 4YESB 4CHAC 3SI4H 3CP7A 2OXSA 2TGAA 4MNXA 4BNRA 3TIUA 1VITH 4MLFB 2ZDMA 2AEIH 1SOTA 2FPZA 2GCHG 1UVOA 1GBHA 2PV9B 2H5DA 3HK3B 1OYTH 2PKSC 1AE5A 1FXYA 2FM2A 2AIPA 1BRBE 4B2CA 1AIXH 3P95A 1L1NA 1BCUH 1MU8B 2XXLA 3DT0H 1WYKA 1T8OA 4Y8YA 1E0FD 1W14U 5C1XA 1SLVB 2UWOA 3Q00A 2SGFE 4OS7A 3FP6E 4GUXA 1HRTH 3W95A 1HIAA 1A5IA 3M5NA 1O2MA 3TJUA 4LK4A 1ETTH 1PYTD 1C5PA 2B5TB 2HALA 1H1BA 5A09A 3A8BA 1SL3A 5JDUB 1HAVB 1Y8TA 1YPMH 3ZZ4A 2B9LA 2EI8A 1E37B 2ZPRA 4GCHG 1OWHA 1EATA 2Z9KA 5EPNA 1YCPH 1EAIA 2ZPQA 4Y79A 1A5GH 3SV7A 4D8NA 2ZC9H 1V2RT 2QYIA 2WPMS 3MU1A 1G3BA 5F8ZA 1ZMLA 4WXVA 1UVUH 1HLTH 4ABFA 2VIOA 1TONA 1NFYA 1P10A 2QXIA 3LH3A 1D3DB 3T29A 3PM3A 3M35A 1BZXE 5JBTA 1FJSA 1GHXH 4A1VA 4HGCA 1QBNA 3BG4B 3KL6A 2STBE 2BXTH 2Z9LA 4X6OA 3UNRA 1Y3WA 2D1JA 1INCA 3HPTB 2BY6X 1TGNA 2VWOA 2ZDKA 1O3NA 1UMAH 4K1SA 4E05H 4Y6DA 1THRH 3A7WA 1GPZA 1J16A 3MU5A 4U32A 3DUXH 3F1SB 1C1NA 1IQFA 2FI3E 1QL9A 4R0IA 1AQ7A 4XDEA 1C5OH 1HGTH 2BVSH 1HAPH 4D9QA 1YM0A 2P93A 5HM9A 1O2WA 2ZG0H 3SU1A 3QX5H 3BEIB 5FPTA 1SQTA 1SC8U 2A7CA 2TIOA 1KIGH 1PQ7A 3TITA 4FUFA 1GJ8B 1GI5A 1O2NA 3QTOH 1EB2A 2VGCB 5GCHF 1HCGA 1XUIA 2QF3A 3E16B 3M5OA 2BX3A 2Y82A 2ALVA 2BQ6B 2ZDNA 4DVAU 2BD9A 1SSXA 3MI4A 4NFEA 3SV6A 1J9CH 4AGJA 1LPKB 4GCHF 1FLEE 1GJBB 1WTHD 2GX4A 1P3EA 4H6SB 4LXBH 3PLKA 3GY3A 2FLRH 2CHAB 4KTSA 2FYRA 2XTTB 2ZHDA 1GBLA 1C1SA 1O37A 4IBLH 1G3DA 5AFYH 4ZKRU 2ZU4A 1S82A 2SGDE 1IHSH 1QNJA 3UOPA 3ATWA 5JPMH 3AW0A 4KTUA 4WMFA 1GMHF 3GYLB 1EOLA 4WH8A 2GZ7A 2RA0A 4UDWH 5EXMA 3GY2A 4AZ2B 2WYJA 1SFQB 1TNKA 2OUAA 3BSQA 1QJ1B 4JYUH 3GCOA 1AVWA 1ABJH 1MZDA 1NS3A 4WXIA 1GMDF 3IWMA 1QHRB 1GHWH 2AMPA 3SJKA 3URDA 2VWMA 3T27A 4Y0YE 3AW1A 4RN6A 4UE7H 5C20A 1F5KU 5EXNA 3LU9B 1LKAA 2VNTA 4DIIH 2D2DA 1G32B 3TH4H 1UK3A 4U30A 5SGAE 2CV3A 4Y71A 1F92A 1SG8B 1P2JA 3GCTG 1WU1A 3T62A 1GJ7B 3S0NA 2OC1A 1AFEH 1H4WA 4YM9A 1VZQH 1QQUA 3P70B 1WUNH 4ISLA 1O5GH 2BB4A 3MU0A 4NWKA 4I8GA 1RJXB 2BD2A 3MH7A 1KLJH 1ABIH 2PKSB 2XBWA 2PSXA 2A4QA 3A8CA 1MKXH 4YT7H 2ZCKP 1O2LA 5I46H 5HMAA 2GGVB 1VCWA 5EPYA 4BAHB 1TE0A 1O2JA 1P9SA 3FFGA 1W0YH 1CA0C 2ULLA 1NT1A 3P17H 1VJ9U 1IQGA 1ZSLA 4OS4A 3TJVA 4KTCA 4ABGA 1GG6C 3E3TA 1P2KA 3U8TH 1B0FA 2PW8H 1NC6A 1BHXB 1Q2WA 4A1TA 3LONA 5TCCA 4K8YA 3A83A 2UWLA 2RG3A 3I77A 3F9GA 1NO9H 2GZ8A 3URCA 1PPEE 3TGJE 1BJVA 2Z3EA 3Q3KA 4LOYH 3VFEA 4YOGA 1V2MT 6CHAC 5FCKA 1GJDB 1SGQE 3P8FA 4JZFH 1GHBF 4X1NU 1GDQA 2O8LA 3PV4A 1ZPZA 1ZJDA 1K1IA 1TGBA 3VXFH 5ABWA 4NIVA 1QBOA 1C5SA 1T4VH 4ZMAH 1ETSH 3NPSA 4I31A 1QL8A 1KYNA 1TYNA 1BMMH 3QGNB 1F2SE 1CA8B 1UTJA 7GCHG 2ESTE 2GT8A 3ZZ9A 1JWTA 1NFUA 2BLQA 2F91A 4O9VA 1C1OA 3RXTA 3ZYEA 4A1XA 1TX8A 1C1VH 2HNTF 3TLOA 3FP8E 5ETXA 3PO1C 3LGWA 1HUTH 4ZXXH 3MTYA 2ZGXH 3B8JA 1O32A 1HJ9A 1LVMA 3PMAB 4WF8A 1CQQA 2BOKA 4XBDA 3TH2H 1ZPCA 4CR9A 1AI8H 3SUGA 1RS0A 3OX7U 4YOIA 1XUFA 3BIVH 4ZHAA 1AMHA 2UUJB 1C4Y2 2UUFB 3SU6A 2SGQE 1ANCA 1C5ZB 3P8NA 1FY8E 4JK5A 4AB8A 1O5FH 1CSOE 2ZECA 1TA6A 1ELVA 1P12E 2VIDA 2QN5T 1W2KH 2BDGA 2O8TA 4FUBA 3QTVH 2A2XH 3P92A 1XUKA 2BDBA 2HGTH 2LNCA 3QGJA 4X1RU 3M7TA 3SGAE 3MMGA 5CHAC 2A31A 3FZDA 1B5GH 1D3QB 1YCPK 1S0QA 3CENA 2CF9H 4OGYA 5E8EH 1KY9A 1OP8A 5HXFA 1MUEB 5FXLA 2XRCA 1LQEA 1O5EH 2ZNKH 3HK6B 1O5BB 1IOEA 3GY5A 7GCHF 2OD3B 2J9NA 1GBFA 1XKAC 1PQ5A 2V3HH 4I32A 2HNTC 4FUCA 3GISB 2GV6A 1K28D 1ACBE 1L4DA 2NU3E 2O8MA 1UHBB 5EG4A 2Y5FA 4NWLA 1EJAA 2RCEA 4BANB 3M5LA 3RXVA 1XVMA 3T5FH 4HZHA 2FP7B 2WPHS 2YOLA 1ZHRA 1SGCA 1ZHPA 3NKKA 5DP9A 1J17T 3O8RA 3UREA 8KME2 4I7YH 4XBCA 3RXDA 2QC2A 5IDKA 4Q2KA 1AUJA 2OC0A 2G8TA 4FUHA 2A2QH 1O3PB 3VB3A 4WWYA 1P06A 4AFZA 1A61H 1EAXA 3EA7A 3QZRA 5L2ZH 1UTPA 3K2UA 1EZQA 1S0RA 2C90B 4GPGA 1C2EA 1CA0B 4MG3A 3A82A 4WH6A 2O9QA 4KGAA 1GI1A 1BMLA 3OY5U 4MDSA 1GG6B 3U69H 2F9OA 2P3TB 5EW1H 1SGYE 2ANMH 2TPIZ 4GLYA 2GVFA 1C5WB 1MAYA 1MZAA 1SQAA 1ZSJA 2VH6A 4O03A 4OS5A 1LQDB 1EP5A 3MNSA 3RXKA 4BXSA 1ZOMA 5E2OA 1GI8B 3E1XB 4UFGH 2BDCA 6CHAB 1LHGH 2ZIQH 5F6MA 3M3TA 2VVUA 2XNIA 5T6DA 2VIPA 3ATLA 1GGDC 1Y5BT 1C5QA 1ZPBA 1OSSA 1N6YA 1AKSB 3A7ZA 1RTFB 3TJNA 3VEQB 2LPRA 1H8IH 4FXGH 1CVWH 1GI9B 1HFDA 3KN2A 3HGPA 3V13A 1ELTA 1RTLA 1LDTT 2PLXA 1O3AA 5L30H 2V6NA 1D6WA 2VIWA 5A8XA 1LO6A 1T32A 1TBZH 3QO6A 1P05A 1HAOH 2XC0A 3RXHA 5A0AE 3UFAA 4B2AA 3QUMP 2ZDVH 1YBWA 3PO1B 3LJJA 1VCQA 2V35A 4ZHLU 4B73A 1DDJA 1CHOG 3NXPA 1Z1IA 3RLWH 4AFSA 4Y7AA 4UONA 1FV9A 1ANBA 2J92A 1CO7E 3KQDA 2BD4A 2VWNA 1W13U 1L2EA 3QK1A 3K9XB 3RXFA 1O0DH 4ZKNU 4TPYA 1DXWA 1C5RA 3A80A 1EAWA 3FANA 1MKXK 1VITG 3ZYDA 1DXPA 1GHAG 3SI3H 2OQUA 2K1QA 2ZDAH 3PWBA 4Y11E 3DHKH 1PQAA 1V2QT 1O36A 1AHTH 2PKAB 4YLUA 3SU3A 1MBMA 2V3OH 1PPGE 2Y7XA 1DLKB 2FEQH 1MTUA 1O3IA 1ZTKA 3BTTE 2ZGHA 3TH3H 1ARCA 1HAYB 2R3YA 3BTDE 5C3NA 5J4QA 1VCPA 2C3SA 2GZ9A 3E0NB 1OYQA 3MU4A 5G4BA 4TPIZ 1KXCA 1TQ0B 3TPIZ 1PPBH 3MHWU 1P9UA 1P03A 5CHAB 1YC0A 1OX1A 2SGAA 3ATIA 4E7NA 5C1UA 2CJIA 1GI0A 1FDPA 1BTWA 5ESTE 2NU0E 5F8XA 1FY3A 4A5TS 2GTBA 1NRSH 4TWYA 1O2VA 1NRRH 3SNCA 1Q3XA 1HJ8A 3RP2A 4NZLA 4BTUB 1HAVA 2F9UA 1DWCH 1QJ7B 1BTZA 4MPXA 1UJ1A 2WV4A 4I8LA 3OSYA 1KDQB 3KF2A 1ZTLA 1QRXA 1O5DH 2PFEA 4PROA 3VB7A 1F0TA 1G2MA 1FIWA 1QGFA 2OC8A 1XX9A 1C2FA 2J95A 2Y5HA 3E0PB 1GWAA 1KXAA 3PLBA 9LPRA 4ABDA 1NTPA 1P2IA 3FZZA 3BTWE 4X1PU 4DT7B 1AU8A 1K1PA 5JB8S 3CS7A 2AFQB 3V0XA 5E2PA 1C2KA 1CU1A 1DSTA 2XYAA 4AB9A 1RGQA 1GMCG 2G5NA 4NIWA 1NU7B 1QIXB 1VITF 1GBBA 3K65B 3F68H 3I29A 2BD3A 4U01A 1LMWB 1N1LA 1TX6A 3B9FH 2Z3CA 2EEKA 3O8DA 3SJ9A 2XC4A 1FN6A 1GI2A 4BAMB 2BD5A 3TNSA 2XBVA 5EQRA 4D76A 1GVZA 3EDXB 2A4RA 1BMNH 1K22H 1N6XA 1JBUH 3BTGE 1EUFA 1ZLRA 1HJAB 1C1TA 2Z9GA 5A0CA 4B2BA 2ZWLH 1PFXC 2ZU3A 2SFAA 2ZTZA 1C2MA 1V2JT 4AG2A 1MAXA 2ZGJA 4JZEH 2C8WB 1CT0E 2GCHF 1ID5H 1C2JA 4JYTA 1O3BA 4INHA 1ZTJA 2PUXB 2JH5D 2P3FH 1QR3E 3EYDA 1YLCA 2G4UA 2ZQ1A 5FPSA 1NFXA 3QWCH 2WPJS 1GGDB 4WY3A 3DFLA 2Q6FA 1D4PB 1C9PA 4ABHA 3SHAH 1GVKB 4MTBA 1V2TT 1EOJA 2HVXA 2EA3A 1ZGVA 5JBCS 5LPEA 5DO4H 1J15A 1GHVH 3KQEA 2IPHA 5FPYA 1F0SA 1SHYA 1D3TB 4AORA 3RXOA 2YNAA 1TGSZ 3K6ZA 1TOCB 1Y5UT 1V2UT 1P2OA 1ANEA 3TK5A 1RXPA 2JKHA 4X8VH 1K9OE 2ILNA 1DICA 1A7SA 1RFNA 1RIWC 2WINI 4Q7XA 5EODA 1UVPA 2CN0H 5K7RA 4R8TB 3RXSA 1GMCF 5JBAS 3F6UH 2ZA5A 2FXRA 1TGCA 1WQSA 2H9HA 4BAOB 1G37A 4IMZA 2H6MA 2ZHEH 1OP2A 3LJOA 1ELAA 3GY8A 1MTNC 1E38B 1NM6A 3HKJB 5TJXA 2IJOB 4WMEA 3BN9A 3ZVGA 3SV2H 2IOTA 4Z6AH 3MFJA 2JH0D 2F3CE 1CT4E 1MBQA 1MKWH 1YPLH 3UY9A 1P11E 1QY6A 3UTUH 4X2VA 3HGNA 1H8DH 2VJ1A 1MTVA 1OS8A 1F0RA 3SNAA 5T6FA 2OP9A 1SLUB 1O2PA 3LIWA 2FOAA 4THNH 1P04A 4MPVA 3A7YA 2B0FA 1P2QA 2VINA 1LVOA 3RMMH 3ZZBA 4K3JA 1LVBA 3SV8A 7LPRA 1Z6EA 4CHAB 3KNXA 3LGYA 1WSSH 2CF8H 5DP8A 1MU6B 1NU9A 1KSNA 2ZFSA 1BTXA 2HRVA 5CMXH 3RU4E 1GJ6A 2ZHFH 4J2YB 4A6LA 2BHGA 1AZ8A 4AFQA 3DA9B 2ZEBA 4ISHH 4X0WU 1NRPH 2BLVA 4BAQB 1QURH 2HPPH 4KP0A 2HWLB 4FU8A 2GDEH 3SORA 1L0ZA 1DSUA 2G00A 4H42U 1W12U 1B7XB 1BRAA 3A88A 1IQKA 1O39A 1DS2E 3O8BA 1O2QA 1K1LA 2WUCA 3KEEA 6LPRA 1EZSC 1QA0A 4FU9A 1SPJA 1FNIA 2A5IA 1C1UH 1UK2A 1SGFG 3A89A 2Z6BD 3TVJB 3RU4T 3RMOH 3UQVA 1P09A 2UWPA 3ITIA 1GBDA 1O2TA 1AB9C 1ARBA 4XE4A 1GBJA 1Y3XA 2F9VA 3UR9A 1IQHA 1SGNE 4BTTB 1O3EA 1O3LA 2VH0A 1N8OC 2ANWA 3TGIE 2GD4B 1EZXC 2ZF0H 2FOMB 1GCDA 1YPGH 1PQ8A 3ODDA 5GIBA 1V2PT 2A45B 4NIXA 1BRUP 1FAXA 1QB6A 1LCYA 3MH6A 1J8AA 2FOHA 5FHTA 5C5OA 3E6PH 1BB0B 1YGCH 1DFPA 4MNYA 1O3JA 1V3XA 1OWKA 1UTMA 3A84A 3MOCA 3RMNH 4MQAA 2Y6TA 3ATMA 3QZQA 4DY7B 1GDUA 2BDAA 3BTFE 4B75A 1Y5AT 2PGBB 2TGTA 3FVFB 1O3FA 2A1DB 1NPMA 1OWDA 1SGIB 2I6SA 2TRMA 1YPHC 4HI3A 1G30B 2NU2E 3SZNA 1K1MA 3ZV9A 1ZRBA 2FESH 3GCTF 3ZZAA 3SUFA 4E06H 2QY0B 9ESTA 1C1RA 2BVXH 4UEHH 3BF6H 1VJAU 3U1IB 4TWWA 3Q77A 4OS2A 3PTNA 1GBAA 3GICB 3ZZ7A 4AYYB 3RMLH 2XC5A 3A81A 2ZFFH 1MQ5A 1TABE 5F8TA 1LTOA 4ZROA 1A0HB 1S85A 4ISNA 4FUGA 2WPKS 1BQYA 4IS5A 2OBOA 3ZZ3A 4X2YA 4Q7YA 3U8RH 2H9EH 1PPHE 3BEFB 1PPCE 3MH5A 1DWEH 1WTGH 4K1TA 1SGDE 1Y3UA 1TQ7B 3OY6U 2AGEX 2A7JA 2BY7X 3L6PA 1YPHE 1A1RA 6ESTA 1O3HA 4CREA 3EA8A 1DUAA 3UNSA 4AGKA 2A5AA 2ODYB 2GDDA 2J38A 1FUJA 2BY5X 1ZRKA 1V2VT 1MMJN 3A87A 1RIWB 1O2GH 5E0HA 1WV7H 3M3VA 4CH2B 1Z8GA 2VB0A 4ABBA 1A46H 2TGPZ 2VWLA 1DOJA 1O34A 1YF4A 1XKBC 2Z9IA 2BY8X 4X8UH 4LZ4B 5T6GA 1FIZA 1A4WH 4O3TA 1IQIA 1MTNB 2B7DH 3UPEA 4CRAA 1DWDH 4B74A 2STAE 3PWCA 2CMYA 1AVGH 3Q76A 1AZZA 1FPHH 2WPIS 2P94A 2QV1A 2ZTXA 1P3CA 3SW2B 2KAIA 2G5VA 2IN2A 1VR1H 1ZMJA 4Y0ZE 2HPQH 1DT2A 1GI6A 5DP5A 3CS0A 4Y10E 4ZUHA 4I8JA 3NZIA 3SO3A 5L6NH 1LHEH 4OGXA 2WV5A 4NGAH 2H2ZA 5B6OA 4K1EA 3V3MA 5EW2H 4GVUA 4AFUA 4BTIB 1DPOA 1O2YA 1YCPM 2FOGA 2ZU5A 3F9HA 4LZ1H 2BOHB 3NK8A 5FX6A 2DE9A 1W7GH 1P8VC 1VGCC 1L1JA 1T8MA 1AFQC 4B1TA 2FO9A 4HFPB 3RXEA 1ESTA 2C4FH 4WJG2 3UNQA 3LT3A 2HNTE 1ELDE 1EPTA 1HPGA 3ZVAA 2PR3A 4ZH8A 2FMJA 1C2DA 3AAUA 3SGBE 3L3TA 1IQJA 3GDUA 2WUBA 4XFQA 2OC7A 3PROA 3T2NA 1ZZZA 1LHDH 5EU8A 4H6TA 1RTKA 6GCHG 4JMYA 2EC9H 4JZDH 2BLWA 3PB1E 2F9NA 1JXPA 1UTNA 1O3GA 4A92A 4UFDH 2ZDLA 1OOKB 1TMUH 1G9IE 3AASA 2AS9A 4SGAE 2W7SA 1O2HA 3MO9A 3HKIB 3UOUA 3PLPA 2BDHA 1GCTC 3MWIU 2M5TA 4Z0KA 1QB1A 3ZVDA 1LHFH 1HBTH 3GCHC 3M7QA 3ZZCA 1HAGE 2GV7A 2XCNA 4X6MA 1WCZA 3C1KA 3VPKA 4AN7A 1A3BH 3A7XA 1AY6H 4NA8A 1ESAA 1YPJH 1AB9B 2ZFRH 2GKVE 2VU8E 5EGMA 1OKXA 3NWUA 4JZIA 5DP6A 4WVPE 2ZGBH 1DUEA 2XCFA 1TAWA 1SLWB 2ZI2H 1N8OB 4ZAEA 1MKWK 2QXHA 3A8DA 3EGKH 1HAZB 1FY5A 5ESBA 2OCVB 3TK9A 2SGEE 3SOSA 1G3EA 2A7HA 1O2UA 1QTFA 2G81E 2ZZUH 2SGPE 2A4OA 3M5MA 1AE8H 3RXGA 4BXWA 1Z8JB 1T4UH 1KLTA 2R2WU 1C5YB 1O5AB 2QCYA 5AHGH 3PMHB 4XBBA 2ZGCA 4FVDA 4YOJA 1HV7A 1G36A 3LH1A 1BMAA 1Y59T 3BTME 2BQWB 3IG6B 1PYTC 1GJ9B 4AG1A 7KMEH 2R9PA 1SMFE 1V2ST 4IC6A 1P2MA 4GHTA 1BOQA 1SQOA 4YLQH 1U6QA 2CXVA 4Y8ZA 3QDZB 3A85A 4K60A 1X7AC 3RXLA 5DG6A 2W7UA 5GJ4B 2SNVA 1TNJA 2FOBA 1FI8A 4MPUA 2GMTC 4I8HA 1ANDA 5C67A 1ZSKA 2Z94A 4O97A 1T31A 2AMQA 1ELBA 1J14A 1BHXF 1TA2A 3GCNA 4CRCA 3P8OA 1S81A 2PSYA 4FUEA 2FX4A 3GDSA 2V0BA 2Z3DA 2QXJA 2D26C 1LKBA 2FOFA 1O2SA 3SUEA 3WY8A 1C5UA 1B0EA 3KQCA 5A2MH 5H4IB 1BA8B 1UTLM 1WOFA 3E91A 1TX7A 2AYWA 2P8OC 1BTHH 1THSH 1KDQA 4INKA 1W0ZU 1WAYB 1V2NT 1A0LA 4X6PA 1TRNA 2QXGA 2FZZA 2OLGA 2Y5GA 3EA9A 3M37A 2ZFPH 3SV9A 1TLDA 3TU7H 2FX6A 1IHTH 4K8BA 1HDTH 1GL1A 1NRNH 3LGIA 4CRGA 2XWAA 3RC6A 2O8UA 2XW9A 1NY22 4E7RG 3S9AA 3GYMA 2BZ6H 1YYY1 1V2OT 1BRCE 2RDLA 1O38A 2FTLE 3QLPH 1BT7A 4D9RA 1TB6H 2FS8A 5EQSA 1JIRA 4HTCH 2G52A 1ZYOA 1AO5A 3MNCA 2P95A 2ZU1A 1ELFA 1SGFA 5C5NA 4RKJB 1THPB 3AVZA 5J4SA 1TPOA 4DG4A 3KCGH 2QF0A 3RC4A 2W3IA 8GCHG
chains in the Genus database with same CATH superfamily
3BTEE 3KGPA 1CGHA 5DK1A 3MO6A 1Z6JH 3KIDU 1HXFH 3M7UA 4IMQA 5A8ZA 3LGTA 1SFIA 2CK3D 4UFFH 4F49A 3STIA 1D3PB 1CHOF 1LPGB 1C5MD 1Q31A 2WPLS 3RLYH 2PTNA 4X1QU 4AX9H 1VGCB 1AFQB 2FIRH 1V2WT 1ELGA 3S7HB 3ZVEA 1TALA 3ENSB 4JK6A 1PJPA 3MNBA 2HVYB 1CT2E 3GDVA 1GHAF 1W11U 5GCHG 4IN2A 2I6QA 4DW2U 1IQMA 1KXFA 4TT3D 1DANH 1GBIA 3SU0A 3TGKE 4ZXYH 3T26A 1WBGB 3U8OH 2BVRH 4NG9H 1XM1A 2QA9E 1V2LT 1HB0B 3SNBA 3SN8A 2BMGB 1TGTA 4D7GA 2R2MB 3ZZDA 5FBIA 1CGJE 1O2IA 3ZZ6A 3STJA 5HYOA 1LPZB 1EAUA 5C2ZA 3AAVA 4FVBA 4XOJA 3VGCC 4KELA 1HIAB 1GCTB 1O31A 2W5EA 3PTBA 3A7TA 3D23A 1GMHG 3F0OA 1UO6A 4DIHH 4MVNA 3ODFA 1FY4A 4DURA 1ESBA 1CE5A 3UR6A 1UTOA 3GOVB 5FL7D 3GCHB 5GWZA 2NWNA 1S6FA 3A86A 1XMNB 1FZZA 1W7XH 4ESTE 3D62A 5LH8A 2DE8A 1K1OA 4FU7A 1HYLA 1YLDA 4NCYA 2AIQA 1DY9A 2AHME 2A4GA 4JZ1A 1GMDG 1EJNA 4M9FA 1UCYH 1C9TA 4X2WA 1SLXB 2ASUB 3MO3A 5DP4A 1UK4A 8GCHF 5GDSH 3K6YA 1DVAH 1TNLA 2NU4E 1O33A 3RXCA 4OS6A 1BIOA 4TYDA 2FODA 3TK6A 2PUQH 3GY4A 1OWEA 3H09A 4INLA 4UD9H 4X8TH 5EJLA 1YP9A 3UWJH 4J1YA 3KQBA 3EE0B 2ZCHP 1SGRE 1CBWC 4F4OC 2OINA 2L74A 5F53A 1HAHH 3UQOA 1EB1H 1HAXB 4CH8B 1CGIE 1H8ED 2RDEA 2PHBA 3F9EA 3T28A 3RXQA 1O2KA 1W10U 1SQRA 1TPSA 4KKDA 2D8WA 4Y76A 1AD8H 2VIQA 1UVSH 4Q80A 3O8CA 4YO9A 3P8GA 4DOQA 1K21H 3H5CB 5JBBS 2ODPA 1FMGA 2AMDA 3SHCH 2BQ7B 1GL0E 2G51A 3GY7A 3OEED 1NFWA 5LPFA 2GMTB 2QIQA 3LPRA 2HLCA 3V7TA 1AWFH 1ZR0A 1XUJA 1SKYE 1TPAE 1TPPA 2G55A 5T1VA 2ZP0H 3SJIA 2SNWA 1SGTA 2GCTC 4B76A 1BBRH 2PWXA 1EX3A 3M36A 2FTMA 4BOHA 2JH6D 4TY6A 1YPKH 1AGJA 4XD7D 1Y3VA 3SNDA 1GJ4H 3R0FA 1AUTC 2P8OB 3SJ8A 2W26A 4ABIA 5DKMA 1GHBG 3U98H 1KXEA 3SUDA 3OYPA 1OPHB 4VGCC 4GAWA 1DITH 1C5TA 1CHGA 5A8YA 5HGGA 1O30A 1YKTA 2C8ZB 1SBWA 2VVVA 4IGDA 1DE7H 1O2RA 4X1SU 5F03A 1GHYH 1DX5M 1W8BH 2AGIX 1KMHB 1P57B 3SU4A 5HKKD 1GBKA 1T8LA 1O3CA 1KTSB 1YPEH 4WMDA 4ZKOU 2FS9A 2FYQA 1S84A 1ZHMA 4MNWA 4NA9H 2RFKC 3PYHA 3FAOA 2Q6GA 3SGQE 1O5CB 3L33A 1PPFE 4IW4E 2R0KA 5KECA 1JMOH 1DY8A 2Q1JA 2GJGA 1NROH 3BTHE 1O2OA 1FN8A 3D49H 3ATKA 5LGOA 3RDZA 3RXIA 4YTAA 3RC5A 1IQEA 3SU2A 1Z71A 3LGUA 1KXDA 3C27B 2ZQ2A 2C8YB 3UWIA 5T3HA 7ESTE 3ESTA 1T8NA 1S6LA 3EAJA 2UUKB 2BY9X 5PTPA 1P0SH 2V7QD 1WQVH 1S83A 1C2HA 1QL7A 2ANKH 1BTYA 1TOMH 4M7GA 2BX4A 1IQNA 2BYAX 1C2LA 1MD8A 3KHVA 4X2XA 1SOZA 2ALPA 1GBMA 2GT7A 1AN1E 1DLEA 2UUYA 3H7TA 3S69A 3F0PA 1OXGA 3QN7A 2ANYA 1A3EH 1G3CA 5DP3A 4FUIA 1EPTC 1MH0A 2THFB 3V12A 1FAKH 1O35A 4FUDA 2BXUH 1ELEE 5FX5A 3Q3XA 1UCYE 1XVOA 4RSPA 5JYIA 3LDXH 4IC5A 1P02A 4JYVH 1Z8RA 4Q7ZA 2J97A 4CRDA 1F7ZA 1HAIH 5AF9H 2VVCA 1BTUA 1BUIA 4IN1A 1O3DA 3OTJE 3ELAH 1A0JA 2VIVA 2G4TA 2P3UB 4CRBA 2WYGA 1O3KA 3RM0H 3F9FA 1W3CA 1MQ6A 3RU4D 2TGDA 5CHBA 1XUGA 1E34B 3VGCB 5E0JA 1S6HA 1ETRH 3RXPA 3MU8A 1AVXA 3SQHE 2YMSC 1PPZA 3E90B 3SQEE 1OWJA 4X6NA 1UTKA 2CGAA 1BITA 3RXRA 3W94A 3PMJA 4NSVA 5IYTA 5K0HA 1GI7B 1EJMA 2FWWA 1H9LB 1QFKH 1GBCA 3H7OA 1TMTH 4NSYA 4ISOA 2QGRA 2C8XB 2AGGX 5FAHA 2PTCE 4Y8XA 2JETC 1MTSA 1FONA 2Y81A 5AFZH 1KLIH 4O3UA 1BTPA 2J94A 5BRRE 1TRYA 2OTVA 3D65E 2ZTYA 1SVPA 1P2NA 2P59A 4ZHMU 3ZVCA 1TMBH 5DGJA 1BBRE 1JOUB 3RXUA 1C5LH 1G2LA 2K8IA 1EQ9A 1NZQH 2BDIA 1CBWB 1GBTA 3IITA 5GNDA 4ZKSU 3G01A 3HATH 4JCNA 1BJUA 2BD7A 1EP6A 1QBVH 4GSOA 1A2CH 5DPAA 5GPIB 1D9IA 4YZUA 3PMBB 3JZ1B 3LKWA 1O3MA 1UHBA 3LOXA 1TRMA 4NA7A 3SNEA 3VB4A 3DCLA 2PGQB 3T25A 4MNVA 4NFFA 3OU0A 5C17A 1NBMD 3BIUH 5L2YH 2TBSA 5DP7A 3S9BA 2BTCE 4NZQA 3TNTA 3ZZ8A 1JRSA 1QQ4A 4ASHA 4CBOA 2BD8A 2H5CA 2OBQA 3BV9B 1EZUC 2P16A 1IAUA 1DM4B 1TNGA 2GCTB 4ABEA 3NUMA 4GHQA 4QT8C 3M3SA 2IPQX 1MCVA 1SB1H 1EKBB 1V6DA 1ZJKA 2FOCA 1ZMNA 2BLOA 1TWXB 1D6RA 1S5SA 2Z7FE 1FQ3A 5KGOA 5EXLA 4XSKU 4Y7BA 1LVYA 4FUJA 3B23B 1GI3A 2EY4C 1GJCB 1AWHB 4BAKB 1O2ZA 1EXFA 2ZO3H 4VGCB 5EOKA 3S7KB 5GXPA 4B71A 4ISIH 1Z1JA 1C1MA 1MD7A 3RXBA 3UIRA 1FPCH 3VB5A 4D7FA 2J2UA 3LC5A 1UCYK 1QJ6B 1SHHB 1C1PA 1TNIA 1TNHA 2ODQA 4DJZB 2WZQA 3BTKE 1F5RA 1XUHA 3RXMA 3FP7E 3U9AH 5AVDA 1MCTA 1NESE 1GJ5H 1F5LA 1SR5C 1O2XA 2F9BH 1KTTB 1GI4A 2KR7A 1ORFA 2FI4E 1C5VA 1QCPA 2KAIB 1C2IA 3EQ0H 2FOEA 1FY1A 4TY7A 2H1UA 4K5ZA 2BM2A 2R3UA 3P6ZB 2AERH 1AKSA 2O8WA 3VB6A 4AYVB 1UTQA 5EQQA 3SJOA 2ZKSA 1UVTH 3JZ2B 1QA7A 8LPRA 3RUOA 2J4IA 1HNEE 3PV5A 1MTWA 3ZZ5A 1H9IE 2ZFQH 3GY6A 3S9CA 1C4U2 2QF5A 2W3KA 4A7IB 2BZAA 1W0JD 2LP6A 2EI6A 5E0GA 1TBQH 1HJAC 5A0BA 3BG4C 1OP0A 3BTQE 3MH4A 3R3GB 4U2WA 4NIYA 1GVLA 1IQLA 1SGEE 4I8KA 5CE1A 3BG8A 2H9TH 1OWIA 1YWUA 2A0QB 4B6FA 2XBYA 1EPTB 3ZV8A 1E35B 1BBRK 3E8LA 1Z7KA 2F9PA 1GJAB 5FCRA 4SGBE 1KXBA 2ZU2A 3RXAA 3NCLA 2GP9B 2ZPSA 4RKOB 1K1NA 4K2YA 1RD3B 1L1GA 3A8AA 2F83A 3A7VA 2Q6DA 1C5XB 2AH4X 3ZVFA 4OS1A 1TBRH 1RRKA 5TCAA 2ZHQH 1JRTA 5EJZA 4CBNA 2A32A 1Z8IB 1V2KT 1QRWA 4DCDA 1C1QA 1C4V2 3RXJA 2PKAA 2RA3A 1C1WH 1QRZA 4CR5A 2YMSB 1C5NH 4I33A 4DGJA 1O3OA 1L4ZA 2FDAA 4AOQA 2HOBA 3TJOA 1JIMA 2VGCC 4ABAA 3LGVA 3RM2H 3SBKA 1F0UA 1NRQH 1Y3YA 4UFEH 3ZVBA 3M61U 3DFJA 1GDNA 2XWBI 3SYJA 2YNBA 4K69A 5C1YA 5DJ7A 1BDAA 2JETB 1TIOA 2F43B 2ZHWH 3LC3A 6GCHF 1H9HE 1K2I1 2FLBH 1SI5H 1QB9A 1XXFA 3MYWA 2CHAC 1LHCH 3U1JB 1E36B 3FN8A 3BEUA 4RT1A 1HXEH 1M9UA 1GBEA 2Y7ZA 4X8SH 2XOKD 2ZFTA 1SGPE 4CRFA 3DD2H 2A5KA 2J34A 2R0LA 1TFXA 2QAAA 1K1JA 1NN6A 4H4FA 2B8OH 5HM2A 5JB9S 1EASA 1DWBH 1YLNA 5LPRA 1A5HA 2Z9JA 2FI5E 1C2GA 1GHZA 3N7OA 3SU5A 3VXEH 5FBEA 4ABJA 2NU1E 1XXDA 4YT6H 5BPEA 3I78A 2C93B 8ESTE 4MPWA 1COWD 2Y80A 1P01A 2XBXA 5I25A 2EI7A 2DUCA 2OQ5A 3MNXA 1ELCA 3UUZA 2BDYA 1ZGIA 2ZCLP 3Q3YA 1T7CA 4YESB 4CHAC 3SI4H 3CP7A 3W1EA 2OXSA 2TGAA 4MNXA 4BNRA 3TIUA 1VITH 4MLFB 2ZDMA 2AEIH 1SOTA 2FPZA 2GCHG 1UVOA 1GBHA 2PV9B 4Q4LA 3MQKC 2H5DA 3PRDA 3HK3B 1OYTH 2PKSC 1AE5A 1FXYA 2FM2A 2AIPA 1BRBE 4B2CA 1AIXH 3P95A 1L1NA 1BCUH 1MU8B 2XXLA 3DT0H 1WYKA 1T8OA 4Y8YA 1E0FD 1W14U 5C1XA 1SLVB 2UWOA 3Q00A 2SGFE 4OS7A 3FP6E 4GUXA 1HRTH 3W95A 1HIAA 1A5IA 3M5NA 1O2MA 3TJUA 4LK4A 1ETTH 1PYTD 1C5PA 1E1QD 2B5TB 2HALA 1H1BA 5A09A 3A8BA 1SL3A 2KM0A 5JDUB 1HAVB 1Y8TA 1YPMH 3ZZ4A 2B9LA 2EI8A 1E37B 2ZPRA 4GCHG 1OWHA 1EATA 2Z9KA 5EPNA 1YCPH 1EAIA 2ZPQA 4Y79A 1A5GH 3SV7A 4D8NA 2ZC9H 3OE7D 1V2RT 2QYIA 2WPMS 3MU1A 1G3BA 2W6ID 1ZMLA 4WXVA 5F8ZA 1UVUH 1HLTH 4ABFA 2VIOA 1TONA 1NFYA 1P10A 2QXIA 3LH3A 3VG8A 1D3DB 3T29A 3PM3A 3M35A 1BZXE 5JBTA 1FJSA 1GHXH 4A1VA 4HGCA 3DSGA 1QBNA 3BG4B 3KL6A 2STBE 2BXTH 2Z9LA 4X6OA 3UNRA 1Y3WA 2D1JA 1INCA 3HPTB 2BY6X 1TGNA 2VWOA 2ZDKA 1O3NA 1UMAH 4K1SA 4E05H 4Y6DA 1THRH 3A7WA 1GPZA 1OHHD 3KYFA 1J16A 3MU5A 4U32A 3DUXH 3F1SB 1C1NA 1IQFA 2FI3E 1QL9A 4R0IA 1AQ7A 4XDEA 1C5OH 1HGTH 2BVSH 1HAPH 4D9QA 1YM0A 2P93A 5HM9A 1O2WA 2JJ2D 2ZG0H 3SU1A 3QX5H 3BEIB 5FPTA 1SQTA 3F2GA 3UAIC 1SC8U 2A7CA 2TIOA 1KIGH 1PQ7A 4FETA 3TITA 4FUFA 1GJ8B 1GI5A 1O2NA 3QTOH 2PP6A 1EB2A 2VGCB 5GCHF 1HCGA 1XUIA 2QF3A 3E16B 3M5OA 2BX3A 2Y82A 2ALVA 2BQ6B 2ZDNA 4DVAU 2BD9A 1SSXA 5EJ1A 3MI4A 4NFEA 1WDIA 3GS9A 3SV6A 1J9CH 4AGJA 1LPKB 4GCHF 1FLEE 1GJBB 1WTHD 2GX4A 1P3EA 4H6SB 4LXBH 3PLKA 3GY3A 2FLRH 2CHAB 4KTSA 2FYRA 2XTTB 2ZHDA 1GBLA 1C1SA 1O37A 4IBLH 1G3DA 2OK5A 5AFYH 4ZKRU 2ZU4A 1S82A 2SGDE 1IHSH 1QNJA 3UOPA 3ATWA 5JPMH 3AW0A 4KTUA 4WMFA 1GMHF 3GYLB 1EOLA 4WH8A 2GZ7A 2RA0A 4UDWH 5EXMA 3GY2A 4AZ2B 2WYJA 1SFQB 1TNKA 2OUAA 3BSQA 1QJ1B 4JYUH 3GCOA 1AVWA 1ABJH 1MZDA 1NS3A 4WXIA 1GMDF 3IWMA 1QHRB 1GHWH 2AMPA 3SJKA 3URDA 2VWMA 3T27A 4Y0YE 3AW1A 4RN6A 4UE7H 5C20A 4ASUD 1F5KU 5EXNA 3LU9B 1LKAA 2VNTA 4DIIH 2D2DA 1G32B 3TH4H 1UK3A 4U30A 5SGAE 2CV3A 4Y71A 1F92A 1SG8B 1P2JA 3GCTG 1WU1A 3T62A 1GJ7B 3S0NA 1AFEH 2OC1A 1H4WA 4YM9A 1VZQH 1QQUA 3P70B 1WUNH 4ISLA 1O5GH 2BB4A 3MU0A 4NWKA 4I8GA 1RJXB 2BD2A 2J5UA 3MH7A 1KLJH 1ABIH 2PKSB 2XBWA 2PSXA 2A4QA 3A8CA 1MKXH 4YT7H 2ZCKP 2LELA 1O2LA 5I46H 5HMAA 2GGVB 1VCWA 5EPYA 4BAHB 1TE0A 1O2JA 1P9SA 3FFGA 1W0YH 1CA0C 4P00A 2ULLA 1NT1A 3P17H 1VJ9U 1IQGA 1ZSLA 4OS4A 3TJVA 4KTCA 4ABGA 1GG6C 3E3TA 1P2KA 3U8TH 1B0FA 2PW8H 1NC6A 1BHXB 1Q2WA 3U28C 4A1TA 3LONA 2WPDD 5TCCA 4K8YA 3A83A 2UWLA 2RG3A 3I77A 3F9GA 1NO9H 2GZ8A 3URCA 1PPEE 3TGJE 2HLDD 1BJVA 2L6OA 2Z3EA 3Q3KA 4LOYH 3VFEA 4YOGA 1V2MT 6CHAC 2IJD1 5FCKA 1GJDB 1SGQE 3P8FA 4JZFH 1GHBF 4X1NU 1GDQA 2O8LA 3PV4A 1ZPZA 1ZJDA 1K1IA 1TGBA 3VXFH 5ABWA 4NIVA 1QBOA 1C5SA 1T4VH 4ZMAH 4RI0A 1ETSH 3NPSA 4I31A 1QL8A 1KYNA 1TYNA 1BMMH 3QGNB 1H8HD 1F2SE 1CA8B 1UTJA 7GCHG 2ESTE 2GT8A 3ZZ9A 1JWTA 1NFUA 2BLQA 2F91A 4O9VA 1C1OA 3RXTA 1UW7A 3ZYEA 1TX8A 4A1XA 1C1VH 2HNTF 3TLOA 3FP8E 5ETXA 3PO1C 3LGWA 1WXRA 1HUTH 4ZXXH 3MTYA 2ZGXH 3B8JA 1O32A 3OFND 1HJ9A 4F48B 1LVMA 3PMAB 4WF8A 1CQQA 2BOKA 4XBDA 3TH2H 1QZ8A 1ZPCA 4CR9A 1AI8H 3SUGA 1RS0A 3OX7U 4YOIA 1XUFA 3BIVH 4ZHAA 2VBCA 1AMHA 2UUJB 1C4Y2 2UUFB 3SU6A 2J98A 2XNDD 2SGQE 1ANCA 1C5ZB 3P8NA 1FY8E 4JK5A 4AB8A 1O5FH 1CSOE 2ZECA 1TA6A 1ELVA 1P12E 2VIDA 2QN5T 1W2KH 2BDGA 4FOUC 2O8TA 4FUBA 3QTVH 2V3MA 2A2XH 3P92A 1XUKA 4Q63A 2BDBA 2HGTH 2LNCA 3QGJA 4X1RU 3M7TA 3SGAE 3MMGA 5CHAC 2A31A 2KCYA 3ZIAD 3FZDA 1B5GH 1D3QB 1YCPK 1S0QA 3CENA 2CF9H 3F3BA 4OGYA 5E8EH 1KY9A 1OP8A 5HXFA 3FO8D 1MUEB 5FXLA 2XRCA 1LQEA 1O5EH 2ZNKH 3HK6B 1O5BB 1IOEA 3GY5A 7GCHF 2OD3B 4DT4A 2J9NA 1GBFA 1XKAC 3OAAD 1PQ5A 2V3HH 4I32A 2HNTC 4FUCA 3GISB 2GV6A 1K28D 1ACBE 1L4DA 2NU3E 2O8MA 1UHBB 5EG4A 2Y5FA 4P02A 4NWLA 3DSPA 1EJAA 2YMSD 5B6LA 5DN6D 2RCEA 4BANB 3M5LA 3RXVA 1XVMA 3T5FH 4HZHA 1YY3A 2FP7B 2WPHS 4OM9A 2YOLA 1ZHRA 3CNRA 1SGCA 1ZHPA 3NKKA 5DP9A 1J17T 3O8RA 3UREA 8KME2 4I7YH 4XBCA 3RXDA 2QC2A 5IDKA 4Q2KA 1AUJA 2OC0A 2G8TA 4FUHA 2A2QH 1O3PB 3VB3A 4WWYA 1P06A 4AFZA 1A61H 1EAXA 3EA7A 3QZRA 5L2ZH 1UTPA 3K2UA 1EZQA 1S0RA 2C90B 4GPGA 1C2EA 1CA0B 4MG3A 3A82A 4WH6A 2O9QA 4F55A 4KGAA 1GI1A 1BMLA 3OY5U 4MDSA 1GG6B 3U69H 4XRNA 2F9OA 2P3TB 5EW1H 1SGYE 2ANMH 2TPIZ 4GLYA 2GVFA 1C5WB 1MAYA 1MZAA 1SQAA 1ZSJA 2VH6A 4O03A 4OS5A 1LQDB 1EP5A 3MNSA 3RXKA 4BXSA 1ZOMA 5HIYA 5E2OA 1GI8B 3E1XB 4UFGH 2BDCA 1K0HA 6CHAB 1LHGH 2ZIQH 5F6MA 3M3TA 2VVUA 2XNIA 5T6DA 2VIPA 3ATLA 1GGDC 1Y5BT 1C5QA 1ZPBA 1OSSA 1N6YA 1AKSB 3A7ZA 1RTFB 3TJNA 3VEQB 2LPRA 1H8IH 4FXGH 1CVWH 1GI9B 1HFDA 3KN2A 3HGPA 3V13A 1ELTA 1RTLA 4Z1MD 1LDTT 2PLXA 1O3AA 5L30H 2V6NA 1D6WA 2VIWA 5A8XA 1LO6A 1T32A 1TBZH 3QO6A 1P05A 1HAOH 2XC0A 3RXHA 5A0AE 3UFAA 4B2AA 3QUMP 2ZDVH 1YBWA 3PO1B 3LJJA 1VCQA 2V35A 4ZHLU 1E1RD 4B73A 1DDJA 1CHOG 3N99A 2WHXA 3NXPA 1Z1IA 3RLWH 4AFSA 4Y7AA 4UONA 1FV9A 1ANBA 2J92A 1CO7E 3KQDA 2BD4A 2VWNA 1W13U 3EE7A 1L2EA 3QK1A 3K9XB 3RXFA 1O0DH 4ZKNU 2EQNA 4TPYA 1DXWA 1C5RA 3A80A 1EAWA 3FANA 1MKXK 1VITG 3ZYDA 1DXPA 1GHAG 3SI3H 2OQUA 2K1QA 2ZDAH 3PWBA 4Y11E 3DHKH 1PQAA 1V2QT 1O36A 1AHTH 2PKAB 4YLUA 3SU3A 1MBMA 2V3OH 1PPGE 2Y7XA 1DLKB 2FEQH 1MTUA 1O3IA 1ZTKA 3BTTE 2ZGHA 3TH3H 1ARCA 1HAYB 2R3YA 3BTDE 5C3NA 5J4QA 1VCPA 2C3SA 2GZ9A 3E0NB 1OYQA 3MU4A 5G4BA 4TPIZ 1KXCA 1TQ0B 3TPIZ 1PPBH 3MHWU 1P9UA 1P03A 5CHAB 1YC0A 1OX1A 2SGAA 3ATIA 4E7NA 5C1UA 2CJIA 1GI0A 1FDPA 1BTWA 5ESTE 3AK5A 2NU0E 5F8XA 1FY3A 4A5TS 2GTBA 1NRSH 4TWYA 1O2VA 1NRRH 3SNCA 1Q3XA 1HJ8A 3RP2A 4NZLA 4BTUB 1HAVA 2F9UA 1DWCH 1QJ7B 1BTZA 4MPXA 1UJ1A 2WV4A 4I8LA 3OSYA 1KDQB 3KF2A 2KZ4A 1ZTLA 1QRXA 1O5DH 2PFEA 4PROA 3VB7A 1F0TA 1G2MA 1FIWA 1QGFA 2OC8A 1XX9A 1C2FA 2J95A 4AC9A 2Y5HA 3E0PB 1GWAA 1KXAA 3PLBA 9LPRA 4ABDA 3WWFA 1NTPA 1P2IA 3FZZA 3BTWE 4X1PU 4DT7B 1AU8A 1K1PA 5JB8S 3CS7A 2AFQB 3V0XA 3FKSD 5E2PA 1C2KA 1CU1A 1DSTA 2XYAA 4AB9A 1RGQA 1GMCG 2G5NA 4NIWA 1NU7B 1QIXB 1VITF 1GBBA 3K65B 3F68H 3I29A 2BD3A 4U01A 1LMWB 1N1LA 1TX6A 3B9FH 2Z3CA 2EEKA 3O8DA 3SJ9A 2XC4A 1FN6A 1GI2A 4BAMB 2BD5A 3TNSA 2XBVA 2KX4A 5EQRA 4D76A 1GVZA 3EDXB 2A4RA 1BMNH 1K22H 1N6XA 1JBUH 3BTGE 1EUFA 1ZLRA 1HJAB 1C1TA 2Z9GA 5A0CA 4B2BA 2ZWLH 1PFXC 2ZU3A 2SFAA 2ZTZA 1C2MA 1V2JT 4AG2A 1MAXA 2ZGJA 4JZEH 1MABB 2C8WB 1CT0E 2GCHF 1ID5H 1C2JA 4JYTA 1O3BA 4INHA 1ZTJA 2PUXB 2JH5D 2P3FH 1QR3E 3EYDA 1YLCA 2G4UA 2ZQ1A 5FPSA 1NFXA 3QWCH 2WPJS 1GGDB 4WY3A 3DFLA 4HG6A 2Q6FA 1D4PB 1C9PA 4ABHA 3SHAH 1GVKB 4MTBA 1V2TT 1EOJA 2HVXA 2EA3A 1ZGVA 3KYGA 5JBCS 5LPEA 5DO4H 1J15A 1GHVH 3KQEA 2IPHA 5FPYA 1F0SA 1SHYA 1D3TB 4AORA 3RXOA 2YNAA 1TGSZ 3K6ZA 4I86A 1TOCB 1Y5UT 1V2UT 1P2OA 1ANEA 1BMFD 1RXPA 2JKHA 4X8VH 3TK5A 1K9OE 2ILNA 1DICA 1A7SA 1RFNA 1RIWC 2WINI 4Q7XA 5EODA 1UVPA 2CN0H 5K7RA 4R8TB 3RXSA 2F4LA 1GMCF 5JBAS 3F6UH 2ZA5A 2FXRA 1TGCA 1WQSA 2H9HA 4ACBA 4BAOB 1G37A 4IMZA 2H6MA 2ZHEH 1OP2A 3LJOA 1ELAA 3GY8A 1MTNC 1E38B 1NM6A 3HKJB 5TJXA 2IJOB 4WMEA 3BN9A 3ZVGA 3SV2H 3UB0A 2IOTA 4Z6AH 3MFJA 2JH0D 2F3CE 1CT4E 1MBQA 1MKWH 1YPLH 3UY9A 1P11E 1QY6A 3UTUH 4X2VA 3HGNA 1H8DH 2VJ1A 1MTVA 1OS8A 1F0RA 3SNAA 5T6FA 2OP9A 1SLUB 1O2PA 3LIWA 2FOAA 4THNH 1P04A 4MPVA 3A7YA 2B0FA 1P2QA 2VINA 1LVOA 5C94A 3PV2A 3RMMH 3ZZBA 4K3JA 1LVBA 3SV8A 7LPRA 1Z6EA 4CHAB 3KNXA 3LGYA 1WSSH 2CF8H 5DP8A 1MU6B 1NU9A 1KSNA 2ZFSA 1BTXA 2HRVA 5CMXH 3RU4E 1GJ6A 2ZHFH 4J2YB 4A6LA 2BHGA 1AZ8A 4AFQA 3WW7A 3DA9B 2ZEBA 4ISHH 4X0WU 1NRPH 2KCPA 2BLVA 4BAQB 1QURH 4ZCNA 2HPPH 4KP0A 2HWLB 4FU8A 3SZEA 2GDEH 3SORA 1L0ZA 1DSUA 2G00A 4H42U 1W12U 1B7XB 1BRAA 3A88A 1IQKA 1O39A 1DS2E 3O8BA 1O2QA 2KCAA 1K1LA 2WUCA 3KEEA 6LPRA 1EZSC 1QA0A 4FU9A 1SPJA 1FNIA 2A5IA 1C1UH 5C0UA 1UK2A 1SGFG 3A89A 2Z6BD 3TVJB 3RU4T 3RMOH 3UQVA 1P09A 2UWPA 3ITIA 1GBDA 1O2TA 1AB9C 2JDID 1ARBA 4XE4A 1GBJA 1Y3XA 2F9VA 3UR9A 1IQHA 1SGNE 4BTTB 1O3EA 1O3LA 2VH0A 1N8OC 2ANWA 3TGIE 2GD4B 2M2AA 1EZXC 3PRBA 2ZF0H 2FOMB 1GCDA 1YPGH 1PQ8A 3ODDA 5GIBA 1V2PT 2A45B 4NIXA 1BRUP 1FAXA 1QB6A 1LCYA 3MH6A 1J8AA 2FOHA 5FHTA 5C5OA 3FOAA 3E6PH 1BB0B 1YGCH 1DFPA 4MNYA 1O3JA 1V3XA 1OWKA 1UTMA 3A84A 1NBME 3MOCA 3RMNH 4MQAA 2Y6TA 3ATMA 3QZQA 4DY7B 1GDUA 2BDAA 3BTFE 4B75A 1Y5AT 2PGBB 2TGTA 3FVFB 1O3FA 2A1DB 1NPMA 1OWDA 1SGIB 2I6SA 2TRMA 1YPHC 4HI3A 1G30B 2NU2E 3SZNA 1K1MA 3ZV9A 1ZRBA 2FESH 3GCTF 3ZZAA 3SUFA 4E06H 2QY0B 9ESTA 1C1RA 2BVXH 4UEHH 2W6JD 3BF6H 1VJAU 3U1IB 5KEDA 4TWWA 3Q77A 4OS2A 3PTNA 1GBAA 3GICB 3ZZ7A 4AYYB 3RMLH 2XC5A 3A81A 2ZFFH 1MQ5A 1TABE 5F8TA 1LTOA 4ZROA 1A0HB 1S85A 4ISNA 4FUGA 2WPKS 2JJ1D 1BQYA 4IS5A 2OBOA 3ZZ3A 4TSFD 4X2YA 5CDFE 4Q7YA 3U8RH 2H9EH 1PPHE 3BEFB 1PPCE 3MH5A 1DWEH 1WTGH 4K1TA 1SGDE 1Y3UA 1TQ7B 3OY6U 2AGEX 2A7JA 2BY7X 3L6PA 3OTPA 1YPHE 1A1RA 6ESTA 1O3HA 4CREA 3EA8A 1DUAA 3UNSA 4AGKA 2A5AA 2ODYB 2GDDA 2J38A 5IK2D 1FUJA 2BY5X 1ZRKA 1V2VT 1MMJN 3A87A 1RIWB 1O2GH 5E0HA 1WV7H 3M3VA 2JIZD 4CH2B 1Z8GA 2VB0A 4ABBA 1A46H 2TGPZ 2VWLA 1DOJA 1O34A 2K0QA 3OEHD 1YF4A 1XKBC 2Z9IA 2BY8X 5HIZA 4X8UH 4LZ4B 5T6GA 1FIZA 1A4WH 4O3TA 1IQIA 1MTNB 2B7DH 3UPEA 4CRAA 1DWDH 4B74A 2STAE 3PWCA 2CMYA 1AVGH 3Q76A 1AZZA 1FPHH 2WPIS 4ACAA 2P94A 2QV1A 2ZTXA 1P3CA 3SW2B 2KAIA 2G5VA 2J98B 2IN2A 1VR1H 1ZMJA 4Y0ZE 2HPQH 1DT2A 1GI6A 5DP5A 3CS0A 4Y10E 4ZUHA 4I8JA 3NZIA 3SO3A 5L6NH 1LHEH 4OGXA 2WV5A 4NGAH 2H2ZA 5B6OA 4K1EA 3V3MA 5EW2H 1VKYA 4GVUA 4AFUA 4BTIB 1DPOA 1O2YA 1YCPM 2FOGA 1FX0B 2ZU5A 3F9HA 5DSFA 4LZ1H 2BOHB 3NK8A 5FX6A 2WV9A 2DE9A 1W7GH 1P8VC 1VGCC 1L1JA 1T8MA 1AFQC 4B1TA 2FO9A 4HFPB 3RXEA 1ESTA 2C4FH 4WJG2 3UNQA 3LT3A 2HNTE 3N7DA 1ELDE 1EPTA 1HPGA 3WWBA 3ZVAA 2PR3A 4ZH8A 2FMJA 1C2DA 3AAUA 3SGBE 3L3TA 3NRLA 1IQJA 3GDUA 2WUBA 4XFQA 2OC7A 3PROA 3T2NA 1ZZZA 1LHDH 4YXWD 5EU8A 4H6TA 1RTKA 6GCHG 4JMYA 2EC9H 3KQ5A 4JZDH 2BLWA 3PB1E 2F9NA 1JXPA 1UTNA 1E79D 1O3GA 4A92A 4UFDH 2ZDLA 1OOKB 1TMUH 1G9IE 3AASA 2AS9A 4SGAE 2WSSD 2W7SA 1O2HA 3MO9A 3HKIB 2KCOA 3UOUA 3PLPA 2BDHA 1GCTC 3MWIU 2M5TA 4Z0KA 1QB1A 3ZVDA 1LHFH 1HBTH 3GCHC 3M7QA 3ZZCA 1HAGE 2GV7A 2XCNA 4X6MA 1WCZA 3C1KA 4RT0A 3VPKA 4AN7A 1A3BH 3A7XA 1AY6H 4NA8A 1ESAA 1YPJH 1AB9B 2ZFRH 2GKVE 2VU8E 5EGMA 1OKXA 3NWUA 4JZIA 3DSOA 5DP6A 4WVPE 2ZGBH 1DUEA 2XCFA 1TAWA 1SLWB 2ZI2H 2KFWA 1N8OB 4ZAEA 1MKWK 2QXHA 3A8DA 3EGKH 1HAZB 1FY5A 5ESBA 2OCVB 3TK9A 2SGEE 3SOSA 1G3EA 2A7HA 1O2UA 1QTFA 2G81E 2ZZUH 4B6EA 2SGPE 2A4OA 3M5MA 1AE8H 3RXGA 4BXWA 1Z8JB 1W0KD 1T4UH 1KLTA 2R2WU 1C5YB 1O5AB 2QCYA 5C0TA 3N7EA 5AHGH 3PMHB 4XBBA 2ZGCA 4FVDA 4YOJA 1HV7A 1G36A 3LH1A 1BMAA 1Y59T 3BTME 2BQWB 3IG6B 1PYTC 1GJ9B 2QF4A 4AG1A 7KMEH 2R9PA 1SMFE 1V2ST 4IC6A 1P2MA 4GHTA 1BOQA 1SQOA 4YLQH 1U6QA 2CXVA 4Y8ZA 3QDZB 3A85A 4K60A 1X7AC 3RXLA 5DG6A 2W7UA 5GJ4B 2SNVA 5EIYA 1TNJA 2FOBA 1FI8A 4MPUA 2GMTC 4I8HA 1ANDA 5C67A 1ZSKA 2Z94A 4O97A 1T31A 2AMQA 1ELBA 1J14A 1BHXF 1TA2A 3GCNA 4CRCA 3P8OA 1S81A 2PSYA 4FUEA 2FX4A 3GDSA 2V0BA 2Z3DA 2QXJA 2D26C 1LKBA 2FOFA 1O2SA 3SUEA 3WY8A 1C5UA 1B0EA 3KQCA 5A2MH 5H4IB 1BA8B 1UTLM 1WOFA 3E91A 1TX7A 2AYWA 2P8OC 1BTHH 1THSH 1EFRD 1KDQA 4INKA 1W0ZU 1WAYB 1V2NT 1A0LA 4X6PA 1TRNA 2QXGA 2FZZA 2OLGA 2Y5GA 3EA9A 3M37A 2ZFPH 3SV9A 1TLDA 3TU7H 2FX6A 1IHTH 4K8BA 1HDTH 1GL1A 1NRNH 3LGIA 4CRGA 2XWAA 3RC6A 2O8UA 2XW9A 1NY22 3F2HA 4E7RG 3S9AA 3GYMA 2BZ6H 1YYY1 1V2OT 1BRCE 2RDLA 1O38A 2FTLE 3QLPH 1BT7A 4D9RA 1TB6H 2FS8A 5EQSA 3F2FA 1JIRA 4HTCH 2G52A 1ZYOA 1AO5A 3MNCA 2P95A 2ZU1A 1ELFA 1SGFA 5C5NA 4RKJB 1THPB 3AVZA 5J4SA 1TPOA 4DG4A 3KCGH 2QF0A 3RC4A 2W3IA 8GCHG 2QE7D
chains in the Genus database with same CATH topology
3BTEE 3KGPA 1CGHA 5DK1A 3MO6A 1Z6JH 3KIDU 1HXFH 3M7UA 4IMQA 5A8ZA 3LGTA 1SFIA 4UFFH 4F49A 3STIA 1D3PB 1CHOF 1LPGB 1C5MD 1Q31A 2WPLS 3RLYH 2PTNA 4X1QU 4AX9H 1VGCB 1AFQB 2FIRH 1V2WT 1ELGA 3S7HB 3ZVEA 1TALA 3ENSB 4JK6A 1PJPA 3MNBA 1CT2E 3GDVA 1GHAF 1W11U 5GCHG 4IN2A 2I6QA 4DW2U 1IQMA 1KXFA 1DANH 1GBIA 3SU0A 3TGKE 4ZXYH 3T26A 1WBGB 3U8OH 2BVRH 4NG9H 1XM1A 2QA9E 1V2LT 1HB0B 3SNBA 3SN8A 2BMGB 1TGTA 4D7GA 2R2MB 3ZZDA 5FBIA 1CGJE 1O2IA 3ZZ6A 3STJA 5HYOA 1LPZB 1EAUA 5C2ZA 3AAVA 4FVBA 4XOJA 3VGCC 4KELA 1HIAB 1GCTB 1O31A 2W5EA 3PTBA 3A7TA 3D23A 1GMHG 1UO6A 4DIHH 4MVNA 3ODFA 1FY4A 4DURA 1ESBA 1CE5A 3UR6A 1UTOA 3GOVB 3GCHB 5GWZA 2NWNA 1S6FA 3A86A 1XMNB 1FZZA 1W7XH 4ESTE 3D62A 5LH8A 2DE8A 1K1OA 4FU7A 1HYLA 1YLDA 4NCYA 2AIQA 1DY9A 2A4GA 4JZ1A 1GMDG 1EJNA 1UCYH 1C9TA 4X2WA 1SLXB 2ASUB 3MO3A 5DP4A 1UK4A 8GCHF 5GDSH 3K6YA 1DVAH 1TNLA 2NU4E 1O33A 3RXCA 4OS6A 1BIOA 4TYDA 2FODA 3TK6A 2PUQH 3GY4A 1OWEA 4INLA 4UD9H 4X8TH 1YP9A 3UWJH 4J1YA 3KQBA 3EE0B 2ZCHP 1SGRE 1CBWC 4F4OC 2OINA 3UQOA 1HAHH 1EB1H 1HAXB 4CH8B 1CGIE 2PHBA 3F9EA 3T28A 3RXQA 1O2KA 1W10U 1TPSA 4KKDA 2D8WA 4Y76A 1AD8H 2VIQA 1UVSH 4Q80A 3O8CA 4YO9A 3P8GA 4DOQA 1K21H 3H5CB 5JBBS 2ODPA 1FMGA 2AMDA 3SHCH 2BQ7B 1GL0E 2G51A 3GY7A 1NFWA 5LPFA 2GMTB 2QIQA 3LPRA 2HLCA 3V7TA 1AWFH 1ZR0A 1XUJA 1TPAE 1TPPA 2G55A 2ZP0H 3SJIA 2SNWA 1SGTA 2GCTC 4B76A 1BBRH 2PWXA 1EX3A 3M36A 2FTMA 4BOHA 2JH6D 4TY6A 1YPKH 1AGJA 1Y3VA 3SNDA 1GJ4H 3R0FA 1AUTC 2P8OB 3SJ8A 2W26A 4ABIA 5DKMA 1GHBG 3U98H 1KXEA 3SUDA 3OYPA 1OPHB 4VGCC 4GAWA 1DITH 1C5TA 1CHGA 5A8YA 5HGGA 1O30A 1YKTA 2C8ZB 1SBWA 2VVVA 4IGDA 1DE7H 1O2RA 4X1SU 5F03A 1GHYH 1DX5M 1W8BH 2AGIX 3SU4A 1P57B 1GBKA 1T8LA 1O3CA 1KTSB 1YPEH 4WMDA 4ZKOU 2FS9A 2FYQA 1S84A 1ZHMA 4MNWA 4NA9H 3PYHA 3FAOA 2Q6GA 3SGQE 1O5CB 3L33A 1PPFE 4IW4E 2R0KA 1JMOH 1DY8A 2Q1JA 1NROH 3BTHE 1O2OA 1FN8A 3D49H 3ATKA 5LGOA 3RDZA 3RXIA 4YTAA 3RC5A 1IQEA 3SU2A 1Z71A 3LGUA 1KXDA 3C27B 2ZQ2A 2C8YB 3UWIA 5T3HA 7ESTE 3ESTA 1T8NA 3EAJA 2UUKB 2BY9X 5PTPA 1P0SH 1WQVH 1S83A 1C2HA 1QL7A 2ANKH 1BTYA 1TOMH 4M7GA 2BX4A 1IQNA 2BYAX 1C2LA 1MD8A 3KHVA 4X2XA 1SOZA 2ALPA 1GBMA 2GT7A 1AN1E 1DLEA 2UUYA 3H7TA 3S69A 1OXGA 3QN7A 2ANYA 1A3EH 1G3CA 5DP3A 4FUIA 1EPTC 1MH0A 2THFB 3V12A 1FAKH 1O35A 4FUDA 2BXUH 1ELEE 5FX5A 3Q3XA 1UCYE 1XVOA 4RSPA 5JYIA 3LDXH 4IC5A 1P02A 4JYVH 1Z8RA 4Q7ZA 4CRDA 1F7ZA 1HAIH 5AF9H 2VVCA 1BTUA 1BUIA 4IN1A 1O3DA 3OTJE 3ELAH 1A0JA 2VIVA 2G4TA 2P3UB 4CRBA 2WYGA 1O3KA 3RM0H 3F9FA 1W3CA 1MQ6A 3RU4D 2TGDA 1XUGA 1E34B 3VGCB 5E0JA 1S6HA 1ETRH 3RXPA 3MU8A 1AVXA 3SQHE 1PPZA 3E90B 3SQEE 1OWJA 4X6NA 1UTKA 2CGAA 1BITA 3RXRA 3W94A 3PMJA 4NSVA 5IYTA 5K0HA 1GI7B 1EJMA 2FWWA 1H9LB 1QFKH 1GBCA 3H7OA 1TMTH 4NSYA 4ISOA 2QGRA 2C8XB 2AGGX 5FAHA 2PTCE 4Y8XA 2JETC 1MTSA 1FONA 2Y81A 5AFZH 1KLIH 4O3UA 1BTPA 2J94A 5BRRE 1TRYA 2OTVA 3D65E 2ZTYA 1SVPA 1P2NA 2P59A 4ZHMU 3ZVCA 1TMBH 5DGJA 1BBRE 1JOUB 3RXUA 1C5LH 1G2LA 1EQ9A 1NZQH 2BDIA 1CBWB 1GBTA 3IITA 4ZKSU 3G01A 3HATH 4JCNA 1BJUA 2BD7A 1EP6A 1QBVH 4GSOA 1A2CH 5DPAA 5GPIB 1D9IA 4YZUA 3PMBB 3JZ1B 3LKWA 1O3MA 1UHBA 3LOXA 1TRMA 4NA7A 3SNEA 3VB4A 2PGQB 3T25A 4MNVA 4NFFA 3OU0A 3BIUH 5L2YH 2TBSA 5DP7A 3S9BA 2BTCE 4NZQA 3TNTA 3ZZ8A 1JRSA 1QQ4A 4ASHA 4CBOA 2BD8A 2H5CA 2OBQA 3BV9B 1EZUC 2P16A 1IAUA 1DM4B 1TNGA 2GCTB 4ABEA 3NUMA 4GHQA 4QT8C 3M3SA 1MCVA 1SB1H 1EKBB 1V6DA 1ZJKA 2FOCA 1ZMNA 2BLOA 1TWXB 1D6RA 1S5SA 2Z7FE 1FQ3A 5EXLA 4XSKU 4Y7BA 1LVYA 4FUJA 3B23B 1GI3A 1GJCB 1AWHB 4BAKB 1O2ZA 1EXFA 2ZO3H 4VGCB 5EOKA 3S7KB 5GXPA 4B71A 4ISIH 1Z1JA 1C1MA 1MD7A 3RXBA 3UIRA 1FPCH 3VB5A 4D7FA 2J2UA 3LC5A 1UCYK 1QJ6B 1SHHB 1C1PA 1TNIA 1TNHA 2ODQA 4DJZB 3BTKE 1F5RA 1XUHA 3RXMA 3FP7E 3U9AH 5AVDA 1MCTA 1NESE 1GJ5H 1F5LA 1SR5C 1O2XA 2F9BH 1KTTB 1GI4A 1ORFA 2FI4E 1C5VA 1QCPA 2KAIB 1C2IA 3EQ0H 2FOEA 1FY1A 4TY7A 2H1UA 4K5ZA 2BM2A 2R3UA 3P6ZB 2AERH 1AKSA 2O8WA 3VB6A 4AYVB 1UTQA 5EQQA 3SJOA 2ZKSA 1UVTH 3JZ2B 1QA7A 8LPRA 3RUOA 2J4IA 1HNEE 1MTWA 3ZZ5A 1H9IE 2ZFQH 3GY6A 3S9CA 1C4U2 2W3KA 4A7IB 2BZAA 2EI6A 5E0GA 1TBQH 1HJAC 5A0BA 3BG4C 1OP0A 3BTQE 3MH4A 3R3GB 4U2WA 4NIYA 1GVLA 1IQLA 1SGEE 4I8KA 5CE1A 3BG8A 2H9TH 1OWIA 2A0QB 2XBYA 1EPTB 3ZV8A 1E35B 1BBRK 3E8LA 1Z7KA 2F9PA 1GJAB 5FCRA 4SGBE 1KXBA 2ZU2A 3RXAA 3NCLA 2GP9B 2ZPSA 4RKOB 1K1NA 4K2YA 1RD3B 1L1GA 3A8AA 2F83A 3A7VA 2Q6DA 1C5XB 2AH4X 3ZVFA 4OS1A 1TBRH 1RRKA 5TCAA 2ZHQH 1JRTA 4CBNA 2A32A 1Z8IB 1V2KT 1QRWA 4DCDA 1C1QA 1C4V2 3RXJA 2PKAA 2RA3A 1C1WH 1QRZA 4CR5A 1C5NH 4I33A 4DGJA 1O3OA 1L4ZA 2FDAA 4AOQA 2HOBA 3TJOA 1JIMA 2VGCC 4ABAA 3LGVA 3RM2H 3SBKA 1F0UA 1NRQH 1Y3YA 4UFEH 3ZVBA 3M61U 3DFJA 1GDNA 2XWBI 2YNBA 4K69A 5C1YA 5DJ7A 1BDAA 2JETB 1TIOA 2ZHWH 3LC3A 6GCHF 1H9HE 1K2I1 2FLBH 1SI5H 1QB9A 1XXFA 3MYWA 2CHAC 1LHCH 3U1JB 1E36B 3BEUA 1HXEH 1M9UA 1GBEA 2Y7ZA 4X8SH 2ZFTA 1SGPE 4CRFA 3DD2H 2A5KA 2J34A 2R0LA 1TFXA 2QAAA 1K1JA 1NN6A 4H4FA 2B8OH 5HM2A 5JB9S 1EASA 1DWBH 5LPRA 1A5HA 2Z9JA 2FI5E 1C2GA 1GHZA 3N7OA 3SU5A 3VXEH 5FBEA 4ABJA 2NU1E 1XXDA 4YT6H 5BPEA 3I78A 2C93B 8ESTE 4MPWA 2Y80A 1P01A 2XBXA 5I25A 2EI7A 2DUCA 2OQ5A 3MNXA 1ELCA 3UUZA 2BDYA 1ZGIA 2ZCLP 3Q3YA 1T7CA 4YESB 4CHAC 3SI4H 3CP7A 2OXSA 2TGAA 4MNXA 4BNRA 3TIUA 1VITH 4MLFB 2ZDMA 2AEIH 1SOTA 2FPZA 2GCHG 1UVOA 1GBHA 2PV9B 2H5DA 3HK3B 1OYTH 2PKSC 1AE5A 1FXYA 2FM2A 2AIPA 1BRBE 4B2CA 1AIXH 3P95A 1L1NA 1BCUH 1MU8B 2XXLA 3DT0H 1WYKA 1T8OA 4Y8YA 1E0FD 1W14U 5C1XA 1SLVB 2UWOA 3Q00A 2SGFE 4OS7A 3FP6E 4GUXA 1HRTH 3W95A 1HIAA 1A5IA 3M5NA 1O2MA 3TJUA 4LK4A 1ETTH 1PYTD 1C5PA 2B5TB 2HALA 1H1BA 5A09A 3A8BA 1SL3A 5JDUB 1HAVB 1Y8TA 1YPMH 3ZZ4A 2B9LA 2EI8A 1E37B 2ZPRA 4GCHG 1OWHA 1EATA 2Z9KA 5EPNA 1YCPH 1EAIA 2ZPQA 4Y79A 1A5GH 3SV7A 4D8NA 2ZC9H 1V2RT 2QYIA 2WPMS 3MU1A 1G3BA 5F8ZA 1ZMLA 4WXVA 1UVUH 1HLTH 4ABFA 2VIOA 1TONA 1NFYA 1P10A 2QXIA 3LH3A 1D3DB 3T29A 3PM3A 3M35A 1BZXE 5JBTA 1FJSA 1GHXH 4A1VA 4HGCA 1QBNA 3BG4B 3KL6A 2STBE 2BXTH 2Z9LA 4X6OA 3UNRA 1Y3WA 2D1JA 1INCA 3HPTB 2BY6X 1TGNA 2VWOA 2ZDKA 1O3NA 1UMAH 4K1SA 4E05H 4Y6DA 1THRH 3A7WA 1GPZA 1J16A 3MU5A 4U32A 3DUXH 3F1SB 1C1NA 1IQFA 2FI3E 1QL9A 4R0IA 1AQ7A 4XDEA 1C5OH 1HGTH 2BVSH 1HAPH 4D9QA 1YM0A 2P93A 5HM9A 1O2WA 2ZG0H 3SU1A 3QX5H 3BEIB 5FPTA 1SQTA 1SC8U 2A7CA 2TIOA 1KIGH 1PQ7A 3TITA 4FUFA 1GJ8B 1GI5A 1O2NA 3QTOH 1EB2A 2VGCB 5GCHF 1HCGA 1XUIA 2QF3A 3E16B 3M5OA 2BX3A 2Y82A 2ALVA 2BQ6B 2ZDNA 4DVAU 2BD9A 1SSXA 3MI4A 4NFEA 3SV6A 1J9CH 4AGJA 1LPKB 4GCHF 1FLEE 1GJBB 1WTHD 2GX4A 1P3EA 4H6SB 4LXBH 3PLKA 3GY3A 2FLRH 2CHAB 4KTSA 2FYRA 2XTTB 2ZHDA 1GBLA 1C1SA 1O37A 4IBLH 1G3DA 5AFYH 4ZKRU 2ZU4A 1S82A 2SGDE 1IHSH 1QNJA 3UOPA 3ATWA 5JPMH 3AW0A 4KTUA 4WMFA 1GMHF 3GYLB 1EOLA 4WH8A 2GZ7A 2RA0A 4UDWH 5EXMA 3GY2A 4AZ2B 2WYJA 1SFQB 1TNKA 2OUAA 3BSQA 1QJ1B 4JYUH 3GCOA 1AVWA 1ABJH 1MZDA 1NS3A 4WXIA 1GMDF 3IWMA 1QHRB 1GHWH 2AMPA 3SJKA 3URDA 2VWMA 3T27A 4Y0YE 3AW1A 4RN6A 4UE7H 5C20A 1F5KU 5EXNA 3LU9B 1LKAA 2VNTA 4DIIH 2D2DA 1G32B 3TH4H 1UK3A 4U30A 5SGAE 2CV3A 4Y71A 1F92A 1SG8B 1P2JA 3GCTG 1WU1A 3T62A 1GJ7B 3S0NA 2OC1A 1AFEH 1H4WA 4YM9A 1VZQH 1QQUA 3P70B 1WUNH 4ISLA 1O5GH 2BB4A 3MU0A 4NWKA 4I8GA 1RJXB 2BD2A 3MH7A 1KLJH 1ABIH 2PKSB 2XBWA 2PSXA 2A4QA 3A8CA 1MKXH 4YT7H 2ZCKP 1O2LA 5I46H 5HMAA 2GGVB 1VCWA 5EPYA 4BAHB 1TE0A 1O2JA 1P9SA 3FFGA 1W0YH 1CA0C 2ULLA 1NT1A 3P17H 1VJ9U 1IQGA 1ZSLA 4OS4A 3TJVA 4KTCA 4ABGA 1GG6C 3E3TA 1P2KA 3U8TH 1B0FA 2PW8H 1NC6A 1BHXB 1Q2WA 4A1TA 3LONA 5TCCA 4K8YA 3A83A 2UWLA 2RG3A 3I77A 3F9GA 1NO9H 2GZ8A 3URCA 1PPEE 3TGJE 1BJVA 2Z3EA 3Q3KA 4LOYH 3VFEA 4YOGA 1V2MT 6CHAC 5FCKA 1GJDB 1SGQE 3P8FA 4JZFH 1GHBF 4X1NU 1GDQA 2O8LA 3PV4A 1ZPZA 1ZJDA 1K1IA 1TGBA 3VXFH 5ABWA 4NIVA 1QBOA 1C5SA 1T4VH 4ZMAH 1ETSH 3NPSA 4I31A 1QL8A 1KYNA 1TYNA 1BMMH 3QGNB 1F2SE 1CA8B 1UTJA 7GCHG 2ESTE 2GT8A 3ZZ9A 1JWTA 1NFUA 2BLQA 2F91A 4O9VA 1C1OA 3RXTA 3ZYEA 4A1XA 1TX8A 1C1VH 2HNTF 3TLOA 3FP8E 5ETXA 3PO1C 3LGWA 1HUTH 4ZXXH 3MTYA 2ZGXH 3B8JA 1O32A 1HJ9A 1LVMA 3PMAB 4WF8A 1CQQA 2BOKA 4XBDA 3TH2H 1ZPCA 4CR9A 1AI8H 3SUGA 1RS0A 3OX7U 4YOIA 1XUFA 3BIVH 4ZHAA 1AMHA