1PYTC

Ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
248
structure length
248
Chain Sequence
SRPSSRVVNGEDAVPYSWSWQVSLQYEKDGAFHHTCGGSLIAPDWVVTAGHCISTSRTYQVVLGEYDRSVLQGSEQVIPINAGDLFVHPLWNSNCVACGNDIALVKLSRSAQLGDKVQLANLPPAGDILPNEAPCYISGWGRLYTGGPLPDKLQEALLPVVDYEHCSQYDWWGITVKKTMVCAGGDTRSGCDGDSGGPLNCPAADGSWQVHGVTSFVSAFGCNTIKKPTVFTRVSAFIDWINETIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCARBOXYPEPTIDASE A
publication title The three-dimensional structure of the native ternary complex of bovine pancreatic procarboxypeptidase A with proproteinase E and chymotrypsinogen C.
pubmed rcsb
molecule tags Ternary complex (zymogen)
total genus 53
structure length 248
sequence length 248
ec nomenclature
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytC02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytC01
3AAVA 3HATH 5PTPA 5FPYA 1O2NA 2BDBA 3TH3H 4OS1A 1S6HA 1RTLA 1VR1H 1NY22 4DOQA 3E16B 3M5LA 5LPFA 2XC0A 2XC4A 1FY8E 2FLBH 1K1LA 2ZPQA 4MNXA 4AZ2B 1TB6H 1KXCA 1T4UH 1GBLA 1Z8IB 1ZMJA 4ABBA 1GMHG 1XM1A 1NRSH 3RLYH 1C5TA 2STBE 3F9GA 2A31A 3ZZ8A 1FAXA 3EGKH 4IS5A 1GI1A 2H5CA 1JBUH 2P3FH 1F0SA 2XBYA 2W7SA 5E0HA 4HGCA 2ALVA 3GYMA 2ZGHA 2BOKA 1OS8A 4K8YA 2WPLS 2ZGCA 4FUGA 3LDXH 3SNEA 1O3FA 1TGSZ 1H4WA 4ZMAH 3UNQA 3ZVCA 2FYRA 3SZNA 2PSYA 1QNJA 1F0TA 2TPIZ 1SGQE 2R0LA 2A7CA 5GPIB 2A5KA 2RA0A 3A81A 3H7TA 3HPTB 4HTCH 1HNEE 2F9PA 3LT3A 3TGJE 1BHXF 1AWFH 4KTUA 1AI8H 2GD4B 3RXJA 4X2XA 2P3TB 5HGGA 2A4OA 4FUIA 1AVXA 2GT8A 3T25A 1Z8GA 2OLGA 2BVRH 3ATWA 2FM2A 5HYOA 4IMQA 5JYIA 2ZECA 3QTOH 5GXPA 1A0JA 2ZF0H 4UDWH 2JH0D 2C8WB 2FTLE 2ANKH 3A7YA 5JBTA 1PJPA 3MH5A 9LPRA 1SLXB 1OOKB 3S7KB 1GVLA 2BZ6H 5GJ4B 5J4QA 4FVBA 3N7OA 4UONA 1YPHE 2NWNA 1CE5A 4OS7A 3ELAH 1TPAE 1ZTJA 4YESB 1AFQB 3VEQB 4CBNA 1GBJA 1GBKA 4B71A 3SV7A 1DUAA 4CRBA 1UK2A 1DM4B 1KXEA 3PWCA 3M3SA 4Y76A 1V2OT 1O3BA 2FIRH 2K1QA 2QXJA 1GBDA 2M5TA 5L6NH 1H8DH 1GMCG 5LH8A 2FOEA 2UUKB 3MO6A 1C4Y2 1O3JA 3RU4E 1WYKA 4X8VH 2VNTA 1KYNA 3ATKA 2GCHG 1C1VH 2BY7X 4CHAB 4ABHA 1C1MA 4SGAE 2VWMA 1CBWC 3ESTA 4K3JA 2BXUH 5HM2A 5EXMA 1J17T 1A2CH 3HKIB 1EKBB 1OSSA 1W13U 4FUFA 1FI8A 1DXPA 1UVOA 3RXFA 1KTTB 3M36A 3VB6A 4MPVA 2W5EA 1MZDA 3DHKH 2QXGA 3IG6B 3STIA 2PR3A 2WYGA 4B74A 1CA0C 1UCYE 1ZPZA 1G3DA 1T8LA 4O3TA 2W3KA 2PV9B 9ESTA 2SGFE 1LDTT 3R0FA 1ACBE 1PQ7A 3ITIA 2SGEE 1WOFA 2O8LA 4F4OC 1QJ6B 3A7TA 4NIVA 3R3GB 4AB8A 3PROA 1YBWA 3PLPA 2WYJA 1ZSLA 2BX3A 4WH6A 1C9TA 4BTTB 1F0UA 1C2EA 1OPHB 5IYTA 3MMGA 4GLYA 5FAHA 3SUDA 5L2YH 1V6DA 1F5LA 1Y8TA 3ZZ7A 1A3BH 1FV9A 1E0FD 1BIOA 1EAWA 2F9NA 4ABIA 1PPCE 2VGCC 3LH1A 4TPIZ 5A0CA 1WQVH 1UVPA 4MNWA 3RXSA 1ANCA 1EAIA 1GBHA 1O36A 3OSYA 1Y3YA 2ZO3H 1Y5UT 2ZDVH 3LU9B 3OTJE 1XKBC 1B0FA 4YZUA 4CRDA 1FMGA 1LQDB 4CRAA 1LKBA 2F9OA 1GI3A 3SQHE 3Q77A 1QHRB 5A8ZA 2BDAA 2Z3DA 1YYY1 4O9VA 4B2CA 1CU1A 2ODPA 2RCEA 7ESTE 1LMWB 5C67A 2XBVA 3GY2A 3NCLA 3S9CA 1WSSH 3T5FH 3U98H 4AGKA 1C2DA 2DE8A 1T4VH 3Q00A 4AFSA 2GVFA 3RM0H 3MNXA 3RXIA 1MQ6A 5ETXA 3TJUA 3BTTE 3NUMA 1C5OH 1YC0A 1H1BA 3A87A 3KQBA 1NRPH 4I8JA 4X6PA 5I25A 4X1RU 3S7HB 5DKMA 1O38A 2XBXA 1KSNA 3QDZB 4BTUB 1ZZZA 1SG8B 1YM0A 1GJBB 1LQEA 1EPTC 4MPXA 1DUEA 2OP9A 2Z3CA 1TX6A 3TITA 1GHYH 1G2MA 3LPRA 1ELDE 1GWAA 2WUCA 1GBCA 1K21H 5GDSH 1SLUB 1ZHRA 3BIUH 5F8ZA 1QFKH 1NRQH 1GCDA 5CMXH 4YLQH 1BTUA 2HOBA 1HCGA 1K28D 2TIOA 4FVDA 1NROH 4HI3A 1CHOF 1SQTA 5TJXA 4FUBA 4LK4A 1CBWB 2A1DB 1HXFH 1MAXA 1H9IE 1IAUA 2CMYA 1GGDC 1NRNH 3SUFA 1BTXA 3E91A 3UOUA 1O3NA 2OBQA 1TPPA 1TBQH 1DS2E 3OY5U 1N1LA 4AN7A 1W0YH 4CH8B 3SI4H 1CA0B 1QB9A 1L1JA 5C1UA 2Y7XA 4XOJA 1FPCH 1ARBA 1F2SE 3AAUA 5E0JA 4BXSA 3KGPA 3QK1A 3DFJA 2P94A 5DP9A 4H6TA 1QBOA 1C1WH 1ELAA 1FIZA 3BEIB 3EA8A 2ZHFH 1LPKB 1UTLM 5ESBA 2SGPE 2I6SA 2Y81A 4O97A 1Z8JB 2XRCA 3CS0A 3GDSA 3F9HA 4RN6A 1AUJA 1GHXH 1GJDB 3B9FH 5EGMA 3UR9A 1C5RA 2C90B 3RXGA 1SGEE 3LGVA 2VGCB 4NFEA 3S9BA 3MOCA 4A1TA 1D3TB 1EB2A 2OQ5A 1CVWH 4U32A 2Y6TA 4AG2A 1XVMA 3SJ9A 2CHAC 2QAAA 1DSUA 1MZAA 4X1PU 3S9AA 1TGBA 3A80A 3TLOA 2BD9A 2XTTB 3PB1E 4JYUH 4I7YH 3A7ZA 4BAOB 2G4TA 3HKJB 5B6OA 3TNSA 4ZKOU 1VITH 2Y7ZA 3SNAA 2BX4A 1KXDA 4JK6A 5F6MA 2JETB 1PPBH 2BDHA 1MTUA 4MVNA 4DJZB 2BMGB 3L3TA 2ZCHP 4IC6A 1O2IA 1IQHA 1ZMLA 3EA9A 1QCPA 3PWBA 1QA7A 2AGIX 3RLWH 4CRGA 1EPTA 1QR3E 4XSKU 2O8UA 5JDUB 1V2RT 4JYTA 3RMMH 1EAXA 1L4DA 1QQUA 1D6WA 4WMFA 1EPTB 1K1IA 4XE4A 3LGYA 3PMAB 2F9BH 1SGPE 4ZUHA 4D9RA 5DP8A 3P95A 1DWBH 1UVTH 3A86A 1EATA 2J4IA 3ENSB 3ATIA 1G30B 2AIQA 3JZ1B 4B73A 1FY3A 5GCHF 3ZZ9A 5FXLA 1O37A 1P06A 1O2MA 3KQEA 3TPIZ 2G51A 1O34A 1M9UA 1A5IA 1O35A 4XBDA 4Y79A 2BLQA 1RIWC 2J38A 2Z9JA 1C5SA 1FLEE 2H2ZA 1NM6A 1GGDB 1TYNA 3KQDA 4MPUA 1ZHMA 1YPJH 2BLOA 2BY9X 2P8OB 3QGNB 4ZHAA 5EPYA 4E05H 1O3DA 2Z9GA 1TPOA 2SGAA 5T6GA 3PTBA 2GCHF 2WUBA 2XCNA 3SJOA 1Y5AT 3NK8A 4FXGH 1O2JA 4JMYA 5FX6A 3QX5H 3VB4A 1UTQA 3M3VA 4GPGA 1SGIB 4FUCA 1MD8A 5HMAA 1L4ZA 1ZTLA 2HRVA 5FCKA 2RG3A 1UHBB 3AW1A 1Q31A 1SOTA 5A2MH 3E90B 2F91A 2OXSA 3RXMA 1KLTA 1AQ7A 2UUJB 3TGKE 1O2UA 2A7JA 2BD8A 8ESTE 1RXPA 1GVKB 2QA9E 1V2KT 2GDDA 1O2QA 2BZAA 4Y10E 3ZVFA 3SU2A 2ZQ2A 2UWPA 3RDZA 1SGTA 3RXEA 3PMBB 2A4GA 1ELBA 2ZCKP 1KIGH 3KNXA 4I33A 8GCHF 3DT0H 1BBRE 2D26C 1Z71A 1D3PB 2R0KA 3QO6A 2ZHQH 2VU8E 3VFEA 1P05A 2ZGBH 3MNSA 2SNVA 3SJKA 4H6SB 4XBCA 3BTDE 2PHBA 2Z9KA 1Y59T 3SV6A 1P0SH 2NU2E 1O3OA 4ABEA 2H9TH 2UWOA 3P8NA 3KIDU 4WWYA 1TBRH 2C8YB 3M7QA 4B2AA 1O5DH 1C5PA 2BQ7B 3UWIA 1SI5H 1XUKA 1BITA 2FPZA 1OWJA 1QA0A 2BD4A 7KMEH 2Q6DA 2ANMH 4ZROA 2ZGJA 2RA3A 3VXFH 6GCHF 1FPHH 2CJIA 5EQRA 1C2MA 1MQ5A 3RUOA 1RRKA 5DO4H 4PROA 2QF3A 4X1NU 1T8OA 4B76A 1KDQA 1EZXC 1TMBH 1QB1A 1F0RA 1PQAA 1HB0B 4X8SH 1ID5H 3MU5A 2LPRA 3BTKE 1X7AC 1DPOA 2FTMA 2FZZA 1VJ9U 1THSH 4ISOA 5DJ7A 5FHTA 3C1KA 4NCYA 4Z6AH 2BLWA 1SGYE 3LJJA 3SI3H 4U30A 2H1UA 4DGJA 2A7HA 2FS8A 1AGJA 1AFQC 1A0HB 2B7DH 2JH5D 1CHOG 1BMAA 2ZU2A 4JZFH 2FP7B 1FNIA 3UWJH 2NU4E 3LOXA 2WPKS 1D9IA 1J15A 2VINA 2GZ9A 4TPYA 4NWLA 3U8OH 2BQ6B 1CHGA 2KAIB 2LNCA 4WJG2 3SU6A 5T3HA 1GHAF 1WCZA 1NTPA 1MUEB 3F68H 4WXIA 1VITF 4CHAC 2XWAA 3TK9A 1AVGH 1UO6A 2VIDA 2AGGX 4YOIA 2IOTA 1EQ9A 1NFYA 3ZZ3A 3S0NA 1PFXC 1BHXB 2PGQB 2CF9H 4F49A 2HNTE 2D2DA 1W7XH 2THFB 2VWOA 3JZ2B 1W2KH 1S5SA 1C1RA 1TNIA 1O32A 5ESTE 2GZ8A 2PTCE 3ZVBA 2FESH 2WV5A 1C9PA 1O2ZA 2PKAA 3QN7A 2HLCA 1BRCE 3MH4A 3TK5A 1ESAA 1IQKA 4WH8A 3RC6A 1EJAA 5A8XA 1N6YA 4GCHF 2PKAB 1WV7H 3P17H 4BTIB 1MTWA 1C5YB 2HGTH 1HV7A 2XXLA 1AHTH 3M5MA 1ARCA 4CR5A 1DX5M 1TQ0B 3BTQE 2BB4A 5AVDA 1C2JA 3GY7A 4IGDA 1IOEA 5H4IB 3SNBA 1S82A 1UCYK 2R2MB 3ZZ5A 2Y80A 3A8AA 2ULLA 3FP7E 1A7SA 3MI4A 4NZQA 3TNTA 1K1NA 1KXFA 1TA2A 2D8WA 4E06H 2CV3A 4GHQA 3A7WA 1K22H 1TRYA 4AGJA 4KTCA 4NIYA 2FX4A 4BNRA 2FS9A 4K8BA 1BOQA 2BY8X 1PYTC 4MNVA 1LVMA 2XW9A 1HJ8A 1O39A 2BOHB 2AH4X 6CHAB 1EOJA 1Q2WA 2ZFTA 1QJ7B 1GBEA 1V2VT 2YOLA 1MKWK 2XYAA 3CP7A 5GCHG 1BTZA 2OQUA 3RC4A 1FJSA 1D4PB 1LVOA 2I6QA 1F92A 1V2ST 4Z0KA 1ZTKA 5E2PA 1DLEA 2XC5A 2ZGXH 1XUGA 4HFPB 5DP3A 1EJMA 1GJ7B 2FO9A 1BBRH 1YCPM 1DFPA 2WPHS 1C2LA 1HJAB 1CT0E 2J34A 3T62A 2TGAA 4ZXYH 1RTFB 4XBBA 4IC5A 1THPB 2PW8H 3U8RH 2ANYA 2Y5GA 1HRTH 4ISIH 1SQOA 4NSYA 4UFDH 1ANEA 1E35B 1SGFG 4X2VA 2GMTB 1QQ4A 1ZRBA 1ETRH 1G32B 5LPRA 1K1OA 1DXWA 2BD2A 4AX9H 3NXPA 1Q3XA 1DANH 1UTNA 2A2QH 4MTBA 3GCHC 2EI8A 2BTCE 3ZV9A 2ZU1A 4I32A 3PM3A 2C3SA 4FUHA 3VGCC 5C5OA 4ZHMU 1NT1A 3UQVA 3VXEH 2H5DA 1ZYOA 1GCTB 3BEUA 1MBMA 2QC2A 1V3XA 1FY1A 4HZHA 4KGAA 2CN0H 3SW2B 2SNWA 1AZZA 2O9QA 1K9OE 1XUJA 3NPSA 4ZKSU 1W10U 1DITH 1HAHH 3SGBE 4YT7H 4JCNA 1P10A 2ZKSA 8GCHG 1NESE 3EAJA 4J1YA 3BTHE 1EZUC 1SB1H 1C5LH 1W7GH 2ZU4A 3ZZDA 1OWDA 2A4QA 4ABGA 3AW0A 2YNBA 1HAOH 3P6ZB 5A0AE 1J14A 2VWLA 1TE0A 4INKA 1GHVH 3D49H 2Z3EA 2ZFSA 3O8DA 1Z6JH 1AB9C 5C1YA 3A84A 3URDA 7LPRA 1J8AA 4ZHLU 3KHVA 2ZU3A 3UIRA 2QV1A 2FDAA 1ZPBA 1BZXE 2Q1JA 2JKHA 3GICB 1EB1H 3MWIU 6GCHG 1O2TA 1GI5A 3UPEA 2ALPA 1ABIH 1BDAA 4ABAA 1OP2A 2P16A 2AS9A 1ELEE 4WMDA 4BANB 2H9HA 1OWEA 2AMQA 3TIUA 2JETC 1HUTH 1Z1IA 2QXHA 1C1OA 1OP0A 1DOJA 3P8OA 3SV9A 1CGIE 2FOAA 1JOUB 4TY7A 4YO9A 2OC8A 3SO3A 1GBMA 1MAYA 2AMDA 2ZFRH 1SMFE 3PV4A 4FU7A 4UEHH 1AMHA 2CGAA 4KKDA 3RXPA 3TJOA 1T8MA 2TBSA 4DVAU 1HAPH 4ABJA 1GVZA 1P09A 1QIXB 3BTGE 3TH2H 4BAHB 1A46H 4YTAA 3KEEA 2DUCA 5C1XA 1ZSKA 1E37B 1LHGH 2HNTC 4NFFA 1SVPA 2BY5X 4B75A 1Y3VA 2BDIA 4YLUA 3V12A 1BRUP 3FZZA 4E7RG 1FIWA 3K9XB 1GL1A 2SGDE 4OS5A 2G8TA 2FOCA 5TCAA 1BRAA 2QIQA 1GHAG 1O5FH 8LPRA 5EODA 2P3UB 4NG9H 5TCCA 2PKSC 4OGYA 3MFJA 4Q7YA 8KME2 3GCHB 1VITG 1GJAB 1O3CA 3SU0A 1LKAA 3VGCB 1YPMH 3G01A 2P8OC 1DVAH 1GDUA 4GSOA 1SGRE 2R2WU 2VVVA 3K6ZA 4B1TA 1NS3A 1BT7A 3MTYA 1UVUH 5DG6A 4I8KA 4D76A 1EZQA 2ODQA 1QGFA 1HFDA 2BVSH 4K69A 1GI6A 4KP0A 3EDXB 4RSPA 5EQSA 3UTUH 2W3IA 1GBFA 2QXIA 4OS2A 1B5GH 3M7UA 3O8BA 4R0IA 3ZV8A 3HGPA 1ZMNA 2ZHDA 3LGUA 2JH6D 3ZZ4A 3O8RA 4LZ1H 2O8TA 1AFEH 1UTOA 2FX6A 1BCUH 4BAQB 3RMNH 1DY8A 2P93A 4GCHG 5DPAA 1NRRH 1O2YA 1AB9B 1F5RA 1V2UT 1G3CA 1PYTD 1OX1A 3M37A 4ZAEA 4K1TA 1P9SA 2DE9A 5L2ZH 3FP8E 2J94A 3T29A 2O8MA 1TAWA 1TRNA 1H8IH 2AYWA 1FY5A 1O2XA 1S83A 4IW4E 2GTBA 4XFQA 3RU4T 2Z9LA 5SGAE 3H7OA 1NU9A 1YF4A 1JRSA 1VGCB 1VZQH 3A7XA 3MH7A 4DIIH 1T7CA 1AUTC 3LKWA 1BTWA 1TNLA 1SHYA 2ZDMA 1KTSB 1MCVA 2H9EH 4AORA 1YPKH 4O3UA 2H6MA 1N8OB 1V2NT 3D62A 3BG8A 3IWMA 1P01A 2BY6X 1AU8A 1HAXB 3UY9A 3GDUA 4UD9H 5L30H 1P57B 3E8LA 1HAVB 1BBRK 1C1SA 1BTHH 2C8XB 1P3CA 1AO5A 1IHSH 3FAOA 3EYDA 3ZVAA 1UCYH 2BD3A 1Y5BT 2EC9H 1TNKA 2A45B 2ESTE 4KELA 2XBWA 4A5TS 1C2KA 3BTEE 3L6PA 3FZDA 3GYLB 3RMOH 1C5XB 3T26A 1FXYA 3A82A 5DGJA 3OX7U 3PLKA 1ZJKA 2FOHA 1XVOA 3LIWA 3TH4H 1ZR0A 1ZSJA 2TRMA 1ELGA 1K1PA 2AERH 3QTVH 1IQGA 3K6YA 2WINI 2PKSB 4MQAA 1P3EA 1UTPA 1GI4A 1BTYA 1GJ8B 1HIAA 1MTSA 3D65E 4LXBH 1O2OA 5A0BA 1LTOA 1TPSA 2G5VA 2V35A 2V3HH 4NIWA 1MKWH 3DFLA 1DE7H 3LJOA 1W12U 3GCOA 3QZRA 3I29A 2EA3A 1FY4A 3SV8A 1TMUH 1HIAB 1EJNA 1UHBA 5DP4A 1Y3WA 4OGXA 1E34B 1OP8A 3CENA 1V2TT 3SQEE 1YCPK 2XCFA 2OC7A 2B8OH 3MNCA 1JXPA 4JK5A 5CHAC 4AFQA 1B0EA 5AFYH 1P9UA 1PPZA 1G3BA 4GHTA 5C20A 3BG4C 5ABWA 1O2LA 1LVBA 5DK1A 2HPPH 4Y8YA 1XX9A 4UE7H 1KXBA 1BTPA 1HDTH 1DWDH 1BA8B 5T6DA 4DW2U 1ANDA 1W11U 2ZPSA 1C4V2 3SV2H 2AIPA 1NN6A 1C5VA 1TOCB 4JYVH 4CRCA 3BN9A 3LH3A 3LGTA 2TGPZ 2R3UA 1O3GA 2FMJA 3EA7A 5HXFA 1SR5C 1INCA 1NFWA 4J2YB 4AB9A 1KXAA 5LPEA 1LHFH 1U6QA 1EP5A 2ZDLA 1C2FA 1LHEH 4A6LA 2XNIA 3PO1B 1MTNB 3QGJA 4H42U 1UK4A 1LO6A 1SHHB 1HAYB 2C8ZB 4Y7AA 3KN2A 1SL3A 5FX5A 2QY0B 4ZKNU 1NFXA 2OTVA 1THRH 2Y5HA 2ZI2H 1AY6H 1S0RA 2OCVB 1GJCB 1GBBA 2ZEBA 1JIRA 1O2GH 1PPEE 1C1NA 2FOGA 4E7NA 1MKXK 1SGDE 3OY6U 3GCTF 1O30A 2Q6GA 3TJNA 4YOJA 5JBCS 4INLA 2QCYA 2XWBI 2V0BA 5C3NA 1ZOMA 2FXRA 3LC5A 2QYIA 3SOSA 2VB0A 4CRFA 3F6UH 2GV7A 2VVUA 3KF2A 3CS7A 2FI5E 1VCPA 2V3OH 2W26A 1TNHA 1CT4E 1AIXH 3K2UA 5E8EH 2SGQE 1GHZA 1OYTH 1TGTA 1LVYA 3A88A 1HAIH 1HJ9A 4D9QA 3NWUA 3BEFB 2J2UA 1O3EA 6CHAC 4IN1A 1PPGE 3SHAH 3GY3A 3U8TH 3GY8A 3FFGA 1ZLRA 1EOLA 3GDVA 1T8NA 4AYYB 4BXWA 1GHBG 4Y8XA 2GP9B 4IBLH 1O3HA 2PLXA 3E1XB 3WY8A 2ZIQH 2KAIA 5EPNA 1P11E 1O5CB 3BTWE 2G4UA 3RP2A 4X2WA 1FAKH 1LHDH 3F9EA 4WF8A 5EU8A 2UWLA 1C1UH 4U01A 1W8BH 3UNSA 1TNGA 2ZZUH 3RXKA 3VB5A 1HJAC 2ZG0H 3A8CA 4AFZA 5LGOA 3SBKA 3RXBA 1V2WT 1NO9H 2ZHWH 5CHAB 4JZEH 4DCDA 1YLDA 5GWZA 1SBWA 4FU9A 2GMTC 2VH0A 3BG4B 4GVUA 3L33A 2PWXA 1AWHB 2ZPRA 1J9CH 3BTFE 3P8FA 2HWLB 1AZ8A 2B0FA 1O5GH 3HK6B 1IQLA 1RD3B 1QBNA 4QT8C 4YT6H 2SFAA 1OYQA 3GISB 3IITA 2STAE 3BSQA 3M5NA 1GCTC 3Q3YA 1GDNA 1P2IA 5DP5A 3RXQA 5A8YA 5A09A 5BPEA 2IPHA 2PUQH 4MNYA 2ZHEH 1KLJH 2Z94A 3HGNA 3MU8A 3ATLA 1YGCH 7GCHG 1EX3A 3RU4D 4CREA 3URCA 2FI3E 2D1JA 1BQYA 2QGRA 1C2IA 1E36B 1O2PA 4MDSA 1V2PT 2CF8H 2IN2A 5JBAS 1MD7A 1BB0B 3ZZ6A 4Y0ZE 3A8BA 4K60A 1H9HE 1Z8RA 2FOFA 2ZFFH 3FVFB 4XDEA 4Q7XA 3TVJB 1WAYB 4JZDH 1D3QB 1QL9A 1L1GA 2G00A 1GDQA 4ISNA 5I46H 1TQ7B 3E6PH 1C5UA 2P95A 5JBBS 1ETTH 1E38B 1B7XB 1S85A 1AVWA 1BMNH 4DT7B 2W7UA 2PGBB 1O3KA 2GCTC 4DURA 1XUFA 1ZRKA 3P70B 1QURH 1GL0E 1GBAA 1Z7KA 3SUGA 1PPFE 1IQJA 5F8TA 1CO7E 1L1NA 4AOQA 3TGIE 1W0ZU 1ABJH 1QB6A 1UTJA 3P8GA 3UREA 1NC6A 1O2KA 2R9PA 2UUYA 3ZZBA 1RFNA 1WTGH 2QF0A 1V2MT 2BDCA 4NIXA 4RKJB 1ELFA 3MHWU 3RMLH 4Y8ZA 3PMJA 3ZZCA 4BAMB 4O03A 1HYLA 2C4FH 1ELTA 1TX8A 4KTSA 4X0WU 5F03A 1CGHA 2NU3E 3MYWA 2OBOA 3SU5A 4ABDA 3LGWA 3UQOA 3UOPA 2FODA 1FUJA 3RXDA 4M7GA 1AN1E 1FDPA 2FOBA 4K1SA 3SN8A 3SNDA 3PLBA 1K1JA 2A4RA 1AE8H 3PYHA 4JZIA 1VCQA 3MU4A 2TGTA 1WUNH 4ISHH 5DP7A 1C2GA 3V3MA 4CBOA 3U1IB 3A85A 2R3YA 1QJ1B 1UMAH 3F1SB 5FBEA 1YLCA 2TGDA 4MG3A 3UNRA 1T32A 1LHCH 2Z7FE 2BD5A 5EW2H 2GDEH 1ZGVA 1FQ3A 2ZNKH 1DY9A 1CQQA 1XMNB 4SGBE 1QRXA 5FPTA 1GG6C 1S0QA 1P8VC 4THNH 1IQIA 4GUXA 1ESBA 2AFQB 4LOYH 1OXGA 4GAWA 4OS4A 4TWWA 3QZQA 3BTME 3GY6A 1A1RA 1K2I1 3M5OA 1MU6B 1EZSC 1QL7A 3SUEA 1GJ6A 2OINA 1FZZA 4VGCC 2BDYA 3V13A 1C5ZB 1MCTA 1BRBE 1HXEH 1ETSH 1QBVH 3UR6A 1LCYA 1L0ZA 3U1JB 1P02A 3RXLA 4D7GA 1ZHPA 2BLVA 1C1TA 1YCPH 1GMDF 4IN2A 4K5ZA 2P59A 1C1PA 1TWXB 2A2XH 3U9AH 1A5HA 2Y5FA 1TMTH 3QLPH 2HALA 4ISLA 2VWNA 1P2MA 1IHTH 2GX4A 2ZDNA 2G55A 1V2LT 3I78A 4A1XA 1G2LA 1ZGIA 5K0HA 1BMLA 2GCTB 2OUAA 2BYAX 1O5AB 1HBTH 3GCTG 1BJUA 1G3EA 2VVCA 3I77A 1G36A 4DG4A 4NA9H 2HPQH 6LPRA 1GPZA 4X6MA 4I31A 3RXHA 1P2QA 1VGCC 1O3LA 1QY6A 2G52A 3Q3KA 1Y3UA 1DLKB 4CH2B 1TIOA 3SGQE 1GJ9B 1SQAA 1C5QA 1GI8B 3PMHB 1OWKA 3NZIA 1N8OC 3HK3B 1DT2A 2FLRH 5FCRA 3QUMP 3T2NA 2WPJS 1TFXA 3PTNA 1AKSA 4ZKRU 2B9LA 4TWYA 1MKXH 3K65B 1DSTA 1V2JT 1IQNA 1KLIH 2BHGA 5EXNA 1AKSB 2Y82A 3LC3A 3RXUA 3SJ8A 1CGJE 1N6XA 1O2RA 4ZH8A 4I8HA 2AEIH 1TLDA 1TBZH 1HAZB 3ODFA 4Q2KA 2O8WA 1P03A 3SGAE 4TYDA 3ZVEA 1GHBF 1MU8B 1ELCA 1O0DH 1P2OA 1MBQA 2PTNA 1XKAC 5C2ZA 3TU7H 1CSOE 3RXVA 1XXDA 1JWTA 3C27B 1YPLH 1GG6B 4DY7B 3RXRA 4LZ4B 4WMEA 3B8JA 1LPZB 3RM2H 1NFUA 1VCWA 2VIPA 2ZDKA 1BMMH 3OYPA 3FP6E 2ZQ1A 1GI2A 4MPWA 1S84A 3W95A 3W94A 2OD3B 1SSXA 4VGCB 3VPKA 3MU0A 3Q3XA 1TX7A 3ATMA 1CA8B 3UFAA 5G4BA 1IQFA 4UFGH 1UK3A 1EAUA 1SC8U 4FU8A 2A5AA 2FI4E 1IQMA 1SFQB 1YKTA 2EI7A 4X1SU 1W3CA 1RGQA 2VIWA 4I8GA 2ZWLH 3SU1A 4NWKA 3M61U 1ELVA 1VJAU 1YPGH 1GJ5H 3VB7A 3AVZA 1HAGE 1O5BB 2FYQA 2ZU5A 3A7VA 4R8TB 5EQQA 3LONA 1D6RA 7GCHF 2PFEA 3LGIA 4Y6DA 1C2HA 2ZC9H 3A8DA 5F8XA 1L2EA 4FUEA 1Z1JA 4D7FA 2EEKA 1TOMH 1NU7B 2ZCLP 3H5CB 1CT2E 1A0LA 6ESTA 1FN8A 3KL6A 1P2KA 2FOMB 1GMHF 3PO1C 1MTNC 1A3EH 2A0QB 4X2YA 3D23A 3DA9B 3BV9B 1SGCA 1SGFA 3Q76A 1UJ1A 1GBTA 1YPHC 4X8UH 5DP6A 2ASUB 3TJVA 2WPIS 1WBGB 4X1QU 1HAVA 5E2OA 4DIHH 3M7TA 3UUZA 3GCNA 2WPMS 1SOZA 3MNBA 4ESTE 3OU0A 4OS6A 2FEQH 1K1MA 1O5EH 2BDGA 2ZTZA 3QWCH 1P04A 4WY3A 1C5NH 2VH6A 2OC1A 1FONA 1TNJA 1Z6EA 1QTFA 1DWCH 3DUXH 2WV4A 4TY6A 1HPGA 1UTKA 1TALA 3A83A 1TA6A 5EW1H 4ABFA 4A92A 3EE0B 1PQ5A 4ZXXH 1O2WA 2GZ7A 3VB3A 1EP6A 1EUFA 4MLFB 1GI7B 3SU4A 1YP9A 2NU1E 4YOGA 2VIVA 4B2BA 4U2WA 5EOKA 4H4FA 3S69A 1W14U 1C5MD 3SJIA 4X6NA 3ZYDA 4BOHA 3M3TA 1PPHE 2IJOB 1SGNE 1EASA 1D3DB 1O33A 2AGEX 2VJ1A 3MO9A 1TONA 3ODDA 5FPSA 1JRTA 5AFZH 1GHWH 1NZQH 2G81E 4FUJA 1TGNA 1C5WB 1ANBA 1KY9A 1O3IA 3GOVB 4A1VA 1T31A 5AHGH 5E0GA 2ZTYA 5FBIA 2F83A 2F3CE 3TK6A 3RXOA 1SPJA 4D8NA 5BRRE 1Y3XA 1GMCF 2BM2A 1O2VA 1S81A 2HVXA 3U69H 4AFUA 4WXVA 3T28A 2GGVB 3SNCA 1WTHD 3GY4A 5EG4A 1QL8A 1HLTH 3E0NB 1HGTH 4NA8A 1ORFA 2Z6BD 2F9VA 3DD2H 2VIOA 1TRMA 1J16A 3O8CA 1ESTA 1G9IE 1GMDG 1GBIA 1O2SA 5J4SA 1LPGB 4WVPE 3RC5A 4Y7BA 4AYVB 3M35A 3STJA 3E0PB 5CE1A 1XXFA 3V7TA 1WQSA 1H9LB 2OC0A 2HNTF 2PSXA 1S6FA 1MMJN 1TABE 1FN6A 2FWWA 5HM9A 5JPMH 4UFEH 2GT7A 2J95A 1QRWA 2BVXH 1BUIA 4NZLA 1UVSH 1XUHA 2CHAB 3V0XA 3P92A 1MTVA 5C5NA 1SLWB 3EQ0H 2RDLA 2A5IA 3E3TA 1RS0A 1P2JA 1BJVA 1RJXB 1A5GH 4NA7A 1O31A 4JZ1A 1P12E 1G37A 1GI9B 3FANA 1SFIA 2BQWB 4BAKB 4CR9A 1PQ8A 1OWHA 2EI6A 5K7RA 5EXLA 4UFFH 3MO3A 1A61H 1RTKA 2ANWA 2ZP0H 1EXFA 4YM9A 4Q80A 2ZFPH 4FUDA 4Y0YE 2ZFQH 2NU0E 2PUXB 4X6OA 2YNAA 4K1EA 1DICA 3ZVGA 4Y71A 3ZVDA 1SLVB 1YPEH 3BF6H 3RXAA 4AG1A 5GIBA 1C4U2 2AMPA 3SHCH 1IQEA 3KQCA 2ZDAH 3MU1A 4INHA 3RXTA 2ILNA 2A32A 2J9NA 2Q6FA 5JB8S 1OKXA 1OWIA 2GKVE 3ZYEA 4X8TH 4Y11E 2ZA5A 3SU3A 1GJ4H 2F9UA 3F9FA 1AD8H 1KDQB 3A89A 1AE5A 1P2NA 4NGAH 4NSVA 5IDKA 2BD7A 1QRZA 1JIMA 4I8LA 2J92A 4RKOB 3GY5A 1NPMA 1O2HA 3KCGH 2ODYB 1JMOH 1RIWB 3ZZAA 2Z9IA 1V2QT 3MH6A 1A4WH 1O3PB 2QN5T 2B5TB 5JB9S 1UTMA 1F5KU 1O3MA 2GV6A 1WU1A 1F7ZA 3BIVH 5T6FA 1GI0A 2VIQA 2ZTXA 1ZJDA 1TGCA 2G5NA 2CXVA 1ZPCA 4IMZA 4ASHA 1DDJA 1MH0A 2C93B 3AASA 5AF9H 2V6NA 4K2YA 4Q7ZA 3SORA 3NKKA 3RXCA 1XUIA 3T27A 1DWEH 1C1QA 4A7IB 1O3AA 3B23B 2BXTH 2UUFB
chains in the Genus database with same CATH superfamily
3AAVA 3HATH 5PTPA 5FPYA 1O2NA 2BDBA 3TH3H 4OS1A 1S6HA 1RTLA 1VR1H 1NY22 4DOQA 3E16B 3M5LA 5LPFA 2XC0A 3F2FA 2XC4A 1FY8E 2FLBH 1K1LA 2ZPQA 4MNXA 4AZ2B 1TB6H 1KXCA 1T4UH 1GBLA 1Z8IB 1ZMJA 4ABBA 1GMHG 1XM1A 1NRSH 3RLYH 1C5TA 2KR7A 2STBE 3F9GA 2A31A 2WZQA 5IK2D 3ZZ8A 1FAXA 3EGKH 4IS5A 1GI1A 2H5CA 1JBUH 2P3FH 1F0SA 2XBYA 2W7SA 5E0HA 4HGCA 2ALVA 3GYMA 2ZGHA 2BOKA 1OS8A 4K8YA 2WPLS 2ZGCA 4FUGA 3LDXH 3SNEA 1O3FA 1TGSZ 1H4WA 4ZMAH 3UNQA 2WPDD 3ZVCA 5C0UA 2FYRA 3SZNA 2PSYA 2LP6A 1QNJA 1F0TA 2TPIZ 1SGQE 2R0LA 2A7CA 5GPIB 2A5KA 2RA0A 3A81A 3H7TA 3HPTB 4HTCH 1FX0B 1HNEE 2F9PA 3LT3A 3TGJE 1BHXF 1AWFH 4KTUA 1AI8H 2GD4B 3RXJA 4X2XA 2P3TB 5HGGA 2A4OA 4FUIA 1AVXA 2GT8A 3T25A 1Z8GA 2OLGA 2BVRH 3ATWA 4TT3D 2FM2A 5GNDA 5HYOA 4IMQA 1SQRA 4OM9A 5JYIA 2ZECA 3QTOH 5GXPA 3FN8A 1A0JA 1S6LA 2ZF0H 3DSGA 4UDWH 2XNDD 2JH0D 2C8WB 2FTLE 2ANKH 3A7YA 5JBTA 1PJPA 3MH5A 9LPRA 1SLXB 1OOKB 3S7KB 1GVLA 2BZ6H 5GJ4B 5J4QA 4FVBA 3N7OA 4UONA 1YPHE 2NWNA 1CE5A 4OS7A 3ELAH 1TPAE 1ZTJA 4YESB 1AFQB 3VEQB 4CBNA 1GBJA 1GBKA 4B71A 3SV7A 1DUAA 4CRBA 1UK2A 1DM4B 1KXEA 3PWCA 3M3SA 4Y76A 1V2OT 1O3BA 2FIRH 2K1QA 2QXJA 1SKYE 1GBDA 2M5TA 5L6NH 1H8DH 1GMCG 5LH8A 2FOEA 2UUKB 3MO6A 1C4Y2 1O3JA 3RU4E 1WYKA 4X8VH 2VNTA 1KYNA 3ATKA 2GCHG 1C1VH 2BY7X 4CHAB 3PRBA 4ABHA 1C1MA 4SGAE 2VWMA 1CBWC 5DN6D 3ESTA 4K3JA 2BXUH 5HM2A 5EXMA 1J17T 1A2CH 3HKIB 1EKBB 1OSSA 1W13U 3KYGA 4FUFA 4HG6A 1FI8A 1DXPA 1UVOA 3RXFA 1KTTB 3M36A 3VB6A 4MPVA 2W5EA 1MZDA 3DHKH 2QXGA 3IG6B 3STIA 2PR3A 2WYGA 4B74A 5KECA 1CA0C 1UCYE 1ZPZA 1G3DA 1T8LA 4O3TA 2W3KA 2PV9B 9ESTA 2SGFE 1LDTT 3R0FA 1ACBE 1PQ7A 3ITIA 2F43B 2SGEE 1WOFA 2O8LA 4F4OC 1QJ6B 3A7TA 4NIVA 3R3GB 4AB8A 3PROA 1YBWA 3PLPA 2HVYB 2WYJA 1ZSLA 2BX3A 4WH6A 1C9TA 4BTTB 1F0UA 1C2EA 1OPHB 5IYTA 3MMGA 4GLYA 5FAHA 3SUDA 5L2YH 1V6DA 3ZIAD 1F5LA 1Y8TA 3ZZ7A 1A3BH 1FV9A 1E0FD 1BIOA 1EAWA 2F9NA 4ABIA 1PPCE 2VGCC 3LH1A 4TPIZ 5A0CA 1WQVH 1UVPA 4MNWA 3RXSA 3WWBA 1ANCA 1EAIA 1GBHA 1O36A 3OSYA 1Y3YA 2ZO3H 1Y5UT 2ZDVH 3LU9B 3OTJE 1XKBC 1B0FA 4YZUA 4CRDA 1FMGA 1LQDB 4CRAA 1LKBA 2F9OA 1H8HD 1GI3A 3SQHE 3Q77A 1QHRB 5A8ZA 2BDAA 2Z3DA 1YYY1 4O9VA 4B2CA 1CU1A 2ODPA 3KYFA 4ACBA 2RCEA 7ESTE 1LMWB 5C67A 2XBVA 3GY2A 3NCLA 3S9CA 1WSSH 3T5FH 3U98H 4AGKA 1C2DA 2DE8A 1T4VH 3Q00A 4AFSA 2GVFA 4TSFD 3RM0H 3MNXA 3RXIA 1MQ6A 5ETXA 3TJUA 3WWFA 3BTTE 3NUMA 3PRDA 1C5OH 1YC0A 1H1BA 3A87A 3KQBA 1NRPH 4I8JA 1YWUA 4X6PA 2YMSB 4X1RU 5I25A 3S7HB 2V7QD 5DKMA 1O38A 2XBXA 1KSNA 3QDZB 4BTUB 1ZZZA 1SG8B 1YM0A 1GJBB 1LQEA 1EPTC 4MPXA 1DUEA 2OP9A 2Z3CA 1TX6A 3TITA 1GHYH 1G2MA 3LPRA 1ELDE 1GWAA 2WUCA 1GBCA 1K21H 5GDSH 3OEHD 1SLUB 1ZHRA 3BIUH 5F8ZA 1QFKH 3N7DA 1NRQH 1GCDA 5CMXH 4YLQH 1BTUA 2HOBA 1HCGA 1K28D 2TIOA 4FVDA 1NROH 4HI3A 1CHOF 1SQTA 5TJXA 4FUBA 4LK4A 1CBWB 2A1DB 2IJD1 1HXFH 1MAXA 1H9IE 1IAUA 2CMYA 1GGDC 1NRNH 3SUFA 1BTXA 3E91A 3UOUA 1O3NA 4FOUC 2OBQA 1TPPA 1TBQH 1DS2E 3OY5U 1N1LA 4AN7A 1W0YH 4CH8B 3SI4H 1CA0B 1QB9A 1L1JA 5C1UA 2Y7XA 4XOJA 1FPCH 1ARBA 1F2SE 3AAUA 5E0JA 4BXSA 3KGPA 3QK1A 3DFJA 2P94A 5DP9A 4H6TA 1QBOA 1C1WH 1ELAA 1FIZA 3BEIB 3EA8A 2ZHFH 1LPKB 1UTLM 3KQ5A 2SGPE 5ESBA 2I6SA 5CHBA 2Y81A 4O97A 1Z8JB 2XRCA 3CS0A 5C17A 3GDSA 3F9HA 4RN6A 1AUJA 1GHXH 1GJDB 3B9FH 5EGMA 3UR9A 1C5RA 2C90B 3RXGA 1SGEE 3LGVA 2VGCB 3U28C 4NFEA 3S9BA 3MOCA 4A1TA 1D3TB 1EB2A 2OQ5A 1CVWH 4U32A 2Y6TA 4AG2A 1XVMA 3SJ9A 2CHAC 2QAAA 2YMSD 1DSUA 1MZAA 4X1PU 3S9AA 1TGBA 3A80A 3H09A 3TLOA 2BD9A 2XTTB 3PB1E 4JYUH 4I7YH 3A7ZA 4BAOB 2G4TA 3HKJB 5B6OA 3TNSA 4ZKOU 1VITH 2Y7ZA 3SNAA 2BX4A 1KXDA 4JK6A 5F6MA 2JETB 1PPBH 2BDHA 1MTUA 4MVNA 3FOAA 4DJZB 2BMGB 3L3TA 2ZCHP 4IC6A 1O2IA 1IQHA 1ZMLA 3EA9A 1QCPA 3PWBA 4B6FA 1QA7A 2AGIX 3RLWH 4CRGA 1EPTA 1QR3E 4XSKU 2O8UA 5JDUB 1V2RT 4JYTA 3RMMH 1MABB 2LELA 1EAXA 1L4DA 3UB0A 1QQUA 1D6WA 4WMFA 1EPTB 1K1IA 4XE4A 3LGYA 3PMAB 2F9BH 1SGPE 4ZUHA 4D9RA 5DP8A 3P95A 1DWBH 1UVTH 3A86A 1EATA 2J4IA 3ENSB 3ATIA 1G30B 2AIQA 3JZ1B 4B73A 2V3MA 1FY3A 5GCHF 3ZZ9A 5FXLA 5HIZA 1O37A 1P06A 1O2MA 3KQEA 3TPIZ 2G51A 1O34A 1M9UA 1A5IA 1O35A 4XBDA 4Y79A 2BLQA 1RIWC 2J38A 2Z9JA 1C5SA 1FLEE 2H2ZA 1NM6A 1GGDB 1TYNA 3KQDA 4MPUA 1ZHMA 1YPJH 2BLOA 2BY9X 2P8OB 3QGNB 4ZHAA 5EPYA 4E05H 1O3DA 2CK3D 2Z9GA 1TPOA 2SGAA 5T6GA 3PTBA 2GCHF 2WUBA 2XCNA 3SJOA 1Y5AT 3NK8A 4FXGH 1O2JA 4JMYA 5FX6A 3QX5H 3VB4A 1UTQA 3M3VA 4GPGA 1SGIB 4FUCA 1MD8A 5HMAA 1L4ZA 1ZTLA 2HRVA 2WHXA 2RG3A 1UHBB 1QZ8A 3AW1A 5FCKA 1Q31A 1SOTA 5A2MH 3E90B 2F91A 2OXSA 3RXMA 1KLTA 1AQ7A 2UUJB 3TGKE 1O2UA 2A7JA 2BD8A 8ESTE 1RXPA 1GVKB 2QA9E 5EIYA 1V2KT 2GDDA 1O2QA 2BZAA 4Y10E 3ZVFA 3SU2A 2ZQ2A 2UWPA 3RDZA 1SGTA 3RXEA 3PMBB 2A4GA 1ELBA 2ZCKP 1KIGH 3KNXA 4I33A 8GCHF 3DT0H 1BBRE 2D26C 1Z71A 1D3PB 2R0KA 3QO6A 2ZHQH 2VU8E 3VFEA 1P05A 2ZGBH 3MNSA 2SNVA 3SJKA 4H6SB 4XBCA 3BTDE 2PHBA 2Z9KA 1Y59T 3SV6A 1P0SH 2NU2E 3AK5A 1O3OA 4ABEA 2H9TH 2UWOA 3P8NA 3KIDU 4WWYA 1TBRH 2C8YB 3M7QA 4B2AA 1O5DH 1C5PA 2BQ7B 3UWIA 1SI5H 1XUKA 1BITA 1KMHB 2FPZA 1OWJA 1QA0A 2BD4A 4RT0A 7KMEH 2Q6DA 2ANMH 4ZROA 2WSSD 2ZGJA 2RA3A 3VXFH 1WDIA 6GCHF 1FPHH 2CJIA 5EQRA 1C2MA 1MQ5A 3RUOA 1RRKA 5DO4H 4PROA 1YY3A 2QF3A 4X1NU 1T8OA 4B76A 1KDQA 1EZXC 1TMBH 1QB1A 1F0RA 1PQAA 1HB0B 4X8SH 1ID5H 3MU5A 3F0PA 2LPRA 3BTKE 1X7AC 1DPOA 2FTMA 2FZZA 1VJ9U 2M2AA 1THSH 4ISOA 5DJ7A 5FHTA 3C1KA 4NCYA 4Z6AH 2BLWA 1SGYE 3LJJA 3SI3H 4U30A 2H1UA 4DGJA 2A7HA 2FS8A 1AGJA 1AFQC 1A0HB 2B7DH 2JH5D 1CHOG 1BMAA 2ZU2A 4JZFH 1W0JD 2FP7B 1FNIA 3UWJH 2NU4E 3LOXA 3F2HA 2WPKS 1D9IA 2J5UA 1J15A 2VINA 2KX4A 2GZ9A 4TPYA 4NWLA 3U8OH 2BQ6B 1CHGA 2KAIB 2LNCA 4WJG2 3SU6A 5T3HA 1GHAF 3N7EA 1WCZA 1NTPA 1MUEB 3F68H 4WXIA 1VITF 4CHAC 2XWAA 3TK9A 1AVGH 1UO6A 2VIDA 2AGGX 4YOIA 2IOTA 1EQ9A 1NFYA 3ZZ3A 3S0NA 1PFXC 1BHXB 2PGQB 2CF9H 4F49A 2HNTE 2D2DA 1W7XH 2THFB 2VWOA 3JZ2B 1EFRD 1W2KH 1S5SA 1C1RA 1TNIA 1O32A 5ESTE 2K0QA 2GZ8A 2PTCE 3ZVBA 2FESH 2WV5A 1C9PA 1O2ZA 2PKAA 3QN7A 2HLCA 1BRCE 3MH4A 3TK5A 1ESAA 1IQKA 4WH8A 3RC6A 1EJAA 5A8XA 1N6YA 4GCHF 2PKAB 1WV7H 3P17H 4BTIB 1MTWA 1C5YB 2HGTH 1HV7A 2XXLA 5EJZA 1AHTH 3M5MA 1ARCA 4CR5A 1DX5M 1TQ0B 3BTQE 2BB4A 5AVDA 1C2JA 3GY7A 4IGDA 1IOEA 5H4IB 3SNBA 1S82A 1UCYK 2R2MB 3ZZ5A 2Y80A 3A8AA 2ULLA 3FP7E 1A7SA 3MI4A 4NZQA 3TNTA 4Q63A 1K1NA 1KXFA 5F53A 1TA2A 2D8WA 4E06H 2CV3A 4GHQA 3A7WA 1K22H 1TRYA 4AGJA 4KTCA 4NIYA 2FX4A 4BNRA 2FS9A 4K8BA 1BOQA 2BY8X 1PYTC 4MNVA 1LVMA 2XW9A 1HJ8A 1O39A 2BOHB 2AH4X 6CHAB 1EOJA 1Q2WA 2ZFTA 1QJ7B 1GBEA 1V2VT 2YMSC 2YOLA 1MKWK 2XYAA 3CP7A 5GCHG 1BTZA 2OQUA 3RC4A 1FJSA 1D4PB 1LVOA 2I6QA 2IPQX 1F92A 1V2ST 4Z0KA 1ZTKA 5E2PA 1DLEA 2XC5A 2ZGXH 1XUGA 4HFPB 5DP3A 1EJMA 1GJ7B 2FO9A 1BBRH 1YCPM 1DFPA 2WPHS 1C2LA 1HJAB 1CT0E 2J34A 3T62A 2TGAA 4ZXYH 1RTFB 4XBBA 4IC5A 1THPB 2PW8H 3U8RH 2ANYA 2Y5GA 1HRTH 4ISIH 1SQOA 4NSYA 4UFDH 1ANEA 1E35B 3SZEA 1SGFG 4X2VA 2GMTB 1QQ4A 1ZRBA 1ETRH 1G32B 5LPRA 3OAAD 1K1OA 1DXWA 2BD2A 4AX9H 3NXPA 1Q3XA 1DANH 1UTNA 2A2QH 4MTBA 3GCHC 2EI8A 2BTCE 3ZV9A 2ZU1A 4I32A 3PM3A 2C3SA 4FUHA 3VGCC 5C5OA 4ZHMU 1NT1A 3UQVA 3VXEH 2H5DA 1ZYOA 1GCTB 3BEUA 1MBMA 2QC2A 1V3XA 4M9FA 1FY1A 4HZHA 4KGAA 2CN0H 3SW2B 2SNWA 1AZZA 2O9QA 1K9OE 1XUJA 3NPSA 4ZKSU 1W10U 1DITH 1HAHH 3SGBE 4YT7H 4JCNA 1P10A 2ZKSA 8GCHG 1NESE 3EAJA 4J1YA 3BTHE 1EZUC 1SB1H 1C5LH 1W7GH 2ZU4A 3ZZDA 1OWDA 2A4QA 4ABGA 3AW0A 2YNBA 1HAOH 3P6ZB 3WW7A 5A0AE 1J14A 2VWLA 1TE0A 4INKA 1GHVH 3D49H 2Z3EA 2ZFSA 3O8DA 1Z6JH 1AB9C 5C1YA 3A84A 3URDA 7LPRA 1J8AA 4ZHLU 3KHVA 2ZU3A 3UIRA 5B6LA 2QV1A 2KZ4A 4Q4LA 2FDAA 4RT1A 1ZPBA 1BZXE 2Q1JA 2RFKC 2JKHA 3GICB 1EB1H 3MWIU 6GCHG 1O2TA 1GI5A 2QF4A 3UPEA 2ALPA 1ABIH 1BDAA 4ABAA 1OP2A 2P16A 2AS9A 1ELEE 4WMDA 4BANB 2H9HA 1OWEA 5KEDA 2AMQA 3TIUA 2JETC 1HUTH 1Z1IA 2QXHA 1C1OA 1OP0A 1DOJA 3P8OA 3SV9A 1CGIE 2FOAA 1JOUB 4TY7A 4YO9A 2OC8A 3SO3A 1GBMA 1MAYA 2AMDA 2ZFRH 1SMFE 3PV4A 4FU7A 4UEHH 1AMHA 2CGAA 4KKDA 3RXPA 3TJOA 1T8MA 2TBSA 4DVAU 1HAPH 4ABJA 1GVZA 1P09A 1QIXB 3BTGE 3TH2H 4BAHB 1A46H 4YTAA 3KEEA 2DUCA 5C1XA 1ZSKA 4ZCNA 1E37B 1LHGH 2HNTC 2J97A 4NFFA 1SVPA 2BY5X 4B75A 1Y3VA 2BDIA 4YLUA 3V12A 1BRUP 3FZZA 4E7RG 3PV2A 1FIWA 3K9XB 1GL1A 4I86A 2SGDE 4OS5A 2G8TA 3F0OA 2FOCA 5TCAA 1BRAA 2QIQA 1GHAG 1O5FH 5EJ1A 8LPRA 5EODA 2P3UB 4NG9H 5TCCA 2PKSC 4OGYA 3MFJA 4Q7YA 8KME2 3GCHB 1VITG 2JDID 1GJAB 1O3CA 3SU0A 1LKAA 3VGCB 1YPMH 3G01A 2P8OC 1DVAH 1GDUA 4GSOA 1SGRE 2R2WU 2VVVA 3K6ZA 4B1TA 1NS3A 1BT7A 3MTYA 1UVUH 5DG6A 4I8KA 4D76A 1EZQA 2ODQA 1QGFA 1HFDA 2BVSH 4K69A 1GI6A 4KP0A 3EDXB 4RSPA 5EQSA 3UTUH 2W3IA 1GBFA 2QXIA 4OS2A 1B5GH 3M7UA 3O8BA 4R0IA 3ZV8A 2KCYA 1ZMNA 3HGPA 2ZHDA 3LGUA 2JH6D 3ZZ4A 3O8RA 4LZ1H 2O8TA 1AFEH 1UTOA 2FX6A 1BCUH 4BAQB 3RMNH 1DY8A 2P93A 4GCHG 5DPAA 3VG8A 3OTPA 1NRRH 1O2YA 1AB9B 1F5RA 1V2UT 1G3CA 1PYTD 1OX1A 3M37A 4ZAEA 4K1TA 1E1RD 1P9SA 2DE9A 5L2ZH 3FP8E 2KCPA 2J94A 1E1QD 3T29A 2O8MA 1TAWA 1TRNA 1H8IH 3MQKC 2AYWA 1FY5A 1O2XA 1S83A 4IW4E 2GTBA 4XFQA 3RU4T 2Z9LA 5SGAE 3H7OA 1NU9A 1YF4A 1JRSA 1VGCB 1VZQH 3A7XA 3MH7A 2W6JD 2OK5A 4DIIH 1T7CA 1AUTC 3LKWA 1BTWA 1TNLA 1SHYA 2ZDMA 1KTSB 1MCVA 2H9EH 4AORA 1YPKH 4O3UA 2H6MA 1N8OB 1V2NT 3D62A 3BG8A 3IWMA 1P01A 2BY6X 1AU8A 1HAXB 3UY9A 3GDUA 4UD9H 5L30H 1P57B 3E8LA 1HAVB 1BBRK 1C1SA 1BTHH 2C8XB 1P3CA 1AO5A 1IHSH 3FAOA 3EYDA 3ZVAA 1UCYH 2BD3A 1OHHD 1Y5BT 1TNKA 2EC9H 2A45B 2ESTE 4KELA 2XBWA 4A5TS 1C2KA 3BTEE 3L6PA 3FZDA 3GYLB 3RMOH 1C5XB 3T26A 2RDEA 1FXYA 3A82A 5DGJA 3OX7U 3PLKA 1ZJKA 2FOHA 1XVOA 3LIWA 3TH4H 1ZR0A 1ZSJA 2TRMA 1ELGA 1K1PA 2AERH 3QTVH 1IQGA 3K6YA 2WINI 2PKSB 4MQAA 1P3EA 1UTPA 1GI4A 1BTYA 1GJ8B 1HIAA 1MTSA 2W6ID 3D65E 4LXBH 1O2OA 5A0BA 3F3BA 1LTOA 1TPSA 2G5VA 2V35A 2V3HH 4NIWA 1MKWH 3DFLA 1DE7H 3LJOA 1W12U 3GCOA 3QZRA 3I29A 2EA3A 1FY4A 3SV8A 1TMUH 1HIAB 1EJNA 1UHBA 5DP4A 1Y3WA 4OGXA 1E34B 1OP8A 3CENA 1V2TT 3SQEE 1YCPK 2XCFA 2OC7A 2B8OH 3MNCA 1JXPA 4JK5A 5CHAC 4AFQA 1B0EA 5AFYH 1P9UA 1PPZA 1G3BA 4GHTA 2F4LA 5C20A 1E79D 3DCLA 3BG4C 5ABWA 1O2LA 1LVBA 1COWD 5DK1A 2HPPH 4Y8YA 1XX9A 4UE7H 1KXBA 1BTPA 1HDTH 1DWDH 1BA8B 5T6DA 4DW2U 1ANDA 1W11U 2ZPSA 1C4V2 4FETA 3SV2H 2AIPA 1NN6A 1C5VA 1TOCB 4JYVH 4CRCA 3BN9A 3LH3A 3LGTA 2TGPZ 2R3UA 1O3GA 2FMJA 2KCAA 3EA7A 5HXFA 1SR5C 1INCA 1NFWA 4J2YB 3W1EA 4AB9A 1KXAA 5LPEA 1LHFH 1U6QA 1EP5A 2ZDLA 1C2FA 1LHEH 4A6LA 2XNIA 3PO1B 1MTNB 3QGJA 4H42U 1UK4A 1LO6A 1SHHB 1HAYB 4F48B 2C8ZB 4Y7AA 3KN2A 1SL3A 5FX5A 2QY0B 4ZKNU 1NFXA 2OTVA 1THRH 2Y5HA 2ZI2H 1AY6H 1S0RA 2OCVB 1GJCB 1GBBA 2ZEBA 1JIRA 1O2GH 1PPEE 1C1NA 2FOGA 4E7NA 1MKXK 1SGDE 3OY6U 3GCTF 1O30A 3NRLA 2Q6GA 3TJNA 4YOJA 5JBCS 4INLA 2QCYA 2XWBI 2V0BA 5C3NA 1ZOMA 2FXRA 3LC5A 2QYIA 3SOSA 2VB0A 4CRFA 3F6UH 2GV7A 2VVUA 3KF2A 3CS7A 2FI5E 1VCPA 2V3OH 2W26A 3GS9A 1TNHA 1CT4E 1AIXH 3K2UA 5E8EH 2SGQE 1GHZA 1H8ED 1OYTH 1TGTA 1LVYA 3A88A 1HAIH 3EE7A 1HJ9A 4D9QA 3NWUA 3N99A 3BEFB 2J2UA 1O3EA 6CHAC 4IN1A 1PPGE 3SHAH 3GY3A 3U8TH 3GY8A 3FFGA 1ZLRA 1EOLA 2XOKD 3GDVA 1T8NA 4AYYB 4BXWA 1GHBG 4Y8XA 2GP9B 4IBLH 1O3HA 2PLXA 2QE7D 3E1XB 3WY8A 2ZIQH 2KAIA 5EPNA 1P11E 2GJGA 1O5CB 3BTWE 2G4UA 3RP2A 4X2WA 1FAKH 1LHDH 3F9EA 4WF8A 5EU8A 2UWLA 1C1UH 4U01A 1W8BH 3UNSA 1TNGA 2ZZUH 3RXKA 3VB5A 1HJAC 2ZG0H 3A8CA 4AFZA 2J98B 5LGOA 3SBKA 3RXBA 1V2WT 1NBMD 1NO9H 2ZHWH 5CHAB 4JZEH 4DCDA 1YLDA 5GWZA 1SBWA 4FU9A 2GMTC 2JIZD 2VH0A 3BG4B 4GVUA 3L33A 2PWXA 1AWHB 2KCOA 1J9CH 2ZPRA 3BTFE 3P8FA 2HWLB 1AZ8A 2B0FA 1O5GH 3HK6B 1IQLA 1RD3B 1QBNA 4QT8C 4YT6H 2SFAA 1OYQA 3GISB 3IITA 2STAE 3BSQA 3M5NA 1GCTC 3Q3YA 1GDNA 1P2IA 5DP5A 3RXQA 5A8YA 5A09A 5BPEA 2IPHA 2PUQH 1BMFD 4MNYA 2ZHEH 1KLJH 2Z94A 3HGNA 3MU8A 3ATLA 1YGCH 7GCHG 1EX3A 3RU4D 4CREA 3URCA 2FI3E 2D1JA 1BQYA 2QGRA 1C2IA 1E36B 1O2PA 4MDSA 1V2PT 2CF8H 2IN2A 5JBAS 1MD7A 1BB0B 3ZZ6A 4Y0ZE 3A8BA 4K60A 1H9HE 1Z8RA 2FOFA 2ZFFH 3FVFB 4XDEA 4Q7XA 3TVJB 1WAYB 2KFWA 4JZDH 1D3QB 1QL9A 1L1GA 2G00A 1GDQA 4ISNA 5I46H 1TQ7B 3E6PH 1C5UA 2P95A 5JBBS 1ETTH 1E38B 1B7XB 1S85A 1AVWA 1BMNH 4DT7B 2W7UA 2PGBB 1O3KA 2GCTC 4DURA 1XUFA 1ZRKA 3P70B 1QURH 1GL0E 1GBAA 1Z7KA 3SUGA 2HLDD 1PPFE 1IQJA 5F8TA 1CO7E 1L1NA 4AOQA 3TGIE 1W0ZU 1ABJH 1QB6A 3UAIC 1UTJA 3P8GA 3UREA 1NC6A 1O2KA 2R9PA 2UUYA 3ZZBA 1RFNA 1WTGH 2QF0A 1V2MT 2BDCA 4NIXA 4RKJB 1ELFA 3MHWU 3RMLH 4Y8ZA 3PMJA 3ZZCA 4BAMB 4O03A 1HYLA 2C4FH 1ELTA 1TX8A 4KTSA 4X0WU 5F03A 1CGHA 2NU3E 3MYWA 4ASUD 3CNRA 2OBOA 3SU5A 4ABDA 3LGWA 3UQOA 3UOPA 3DSPA 2FODA 1NBME 1FUJA 3RXDA 4M7GA 1AN1E 1FDPA 2FOBA 4K1SA 3SN8A 3SNDA 3PLBA 1K1JA 2A4RA 2AHME 1AE8H 3PYHA 4JZIA 1VCQA 3MU4A 2TGTA 1WUNH 4ISHH 5DP7A 1C2GA 3V3MA 4CBOA 3U1IB 3A85A 2R3YA 1QJ1B 1UMAH 3F1SB 5FBEA 1YLCA 2TGDA 4MG3A 3UNRA 1T32A 1LHCH 2Z7FE 2BD5A 5EW2H 2GDEH 5FL7D 1ZGVA 1FQ3A 2ZNKH 1DY9A 1CQQA 1XMNB 4SGBE 1QRXA 5FPTA 1GG6C 1S0QA 1P8VC 4THNH 1IQIA 4GUXA 1ESBA 2AFQB 4LOYH 1OXGA 4GAWA 4OS4A 4TWWA 2L6OA 3QZQA 3BTME 3GY6A 1A1RA 1K2I1 2VBCA 3M5OA 1MU6B 1EZSC 1QL7A 3SUEA 1GJ6A 2OINA 3OFND 1FZZA 4VGCC 2BDYA 3DSOA 3V13A 1C5ZB 1MCTA 1BRBE 1HXEH 1ETSH 1QBVH 3UR6A 1LCYA 4AC9A 1L0ZA 3U1JB 1P02A 3RXLA 4D7GA 1ZHPA 2BLVA 1C1TA 1YCPH 1GMDF 4IN2A 4K5ZA 2P59A 1C1PA 1TWXB 2A2XH 3PV5A 3U9AH 1A5HA 2Y5FA 1TMTH 3QLPH 2HALA 4ISLA 2VWNA 1P2MA 1IHTH 2GX4A 2ZDNA 2G55A 1V2LT 2JJ1D 3I78A 4A1XA 2KM0A 1G2LA 1ZGIA 5K0HA 1BMLA 2GCTB 2OUAA 2BYAX 1O5AB 1HBTH 3GCTG 1BJUA 1G3EA 2VVCA 3I77A 1G36A 4DG4A 4NA9H 2HPQH 6LPRA 1GPZA 4X6MA 4I31A 3RXHA 1P2QA 1VGCC 1O3LA 1QY6A 2G52A 3Q3KA 1Y3UA 4YXWD 1DLKB 4CH2B 1TIOA 3FKSD 3SGQE 1GJ9B 1SQAA 1C5QA 1GI8B 3PMHB 1OWKA 3NZIA 1N8OC 2EQNA 5C0TA 4DT4A 3HK3B 1DT2A 2FLRH 5DSFA 5FCRA 3QUMP 3T2NA 2WPJS 1TFXA 3PTNA 1AKSA 4ZKRU 2B9LA 4TWYA 1MKXH 3K65B 1DSTA 1V2JT 1IQNA 1KLIH 2BHGA 5EXNA 1AKSB 2Y82A 3LC3A 4RI0A 3RXUA 3SJ8A 4XRNA 4F55A 1CGJE 1N6XA 1O2RA 4ZH8A 4I8HA 2AEIH 4B6EA 1TLDA 1TBZH 1HAZB 3ODFA 4Q2KA 2O8WA 1P03A 3SGAE 4TYDA 1VKYA 3ZVEA 1GHBF 1MU8B 1ELCA 1O0DH 3F2GA 1P2OA 1MBQA 2PTNA 1XKAC 5C2ZA 2WV9A 3TU7H 1CSOE 3RXVA 1XXDA 1JWTA 3C27B 1YPLH 1GG6B 4DY7B 3RXRA 4LZ4B 4WMEA 3B8JA 1LPZB 3RM2H 1NFUA 1VCWA 2VIPA 2ZDKA 1BMMH 3OYPA 3FP6E 2ZQ1A 1GI2A 4MPWA 1S84A 3W95A 3W94A 2OD3B 1SSXA 4VGCB 3VPKA 3MU0A 3Q3XA 1TX7A 3ATMA 1CA8B 3UFAA 5G4BA 1IQFA 4UFGH 1UK3A 1EAUA 1SC8U 4FU8A 2A5AA 2FI4E 1IQMA 1SFQB 1YKTA 2EI7A 4X1SU 1W3CA 1RGQA 2VIWA 4I8GA 2ZWLH 3SU1A 4NWKA 3M61U 1ELVA 1VJAU 1YPGH 1GJ5H 3OE7D 4XD7D 3VB7A 3AVZA 1HAGE 1O5BB 2FYQA 2ZU5A 3A7VA 4R8TB 5EQQA 3LONA 1D6RA 7GCHF 4P02A 2PFEA 2JJ2D 3FO8D 4Z1MD 3LGIA 2K8IA 4Y6DA 1C2HA 2ZC9H 3A8DA 5F8XA 1L2EA 1WXRA 4FUEA 1Z1JA 4D7FA 2EEKA 1TOMH 1NU7B 2ZCLP 3H5CB 1CT2E 1A0LA 6ESTA 1FN8A 3KL6A 1W0KD 1P2KA 2FOMB 1GMHF 3PO1C 1MTNC 1A3EH 2A0QB 4X2YA 3D23A 3DA9B 3BV9B 4ACAA 1SGCA 1SGFA 3Q76A 1UJ1A 1GBTA 1YPHC 4X8UH 5DP6A 2ASUB 3TJVA 2WPIS 1WBGB 4X1QU 1HAVA 5E2OA 4DIHH 3M7TA 3UUZA 3GCNA 2WPMS 1SOZA 3MNBA 4ESTE 3OU0A 4OS6A 2FEQH 1K1MA 1O5EH 2BDGA 2ZTZA 3QWCH 1P04A 4WY3A 1C5NH 2VH6A 5T1VA 2OC1A 2EY4C 1FONA 1TNJA 2PP6A 1Z6EA 1QTFA 1DWCH 3DUXH 2WV4A 4TY6A 1HPGA 1UTKA 1TALA 3A83A 1TA6A 5EW1H 4ABFA 4A92A 2L74A 3EE0B 1PQ5A 4ZXXH 1O2WA 2GZ7A 3VB3A 1EP6A 1EUFA 4MLFB 1GI7B 3SU4A 1YP9A 2NU1E 4YOGA 2VIVA 4B2BA 4U2WA 5EOKA 4H4FA 3S69A 1W14U 1C5MD 3SJIA 4X6NA 3ZYDA 4BOHA 3M3TA 1PPHE 2IJOB 1SGNE 1EASA 1D3DB 1O33A 2AGEX 2VJ1A 3MO9A 1TONA 3ODDA 5FPSA 1JRTA 5AFZH 1GHWH 1NZQH 2G81E 4FUJA 1TGNA 1C5WB 1ANBA 1KY9A 1O3IA 3GOVB 4A1VA 1T31A 5AHGH 5E0GA 2ZTYA 5FBIA 2F83A 2F3CE 3TK6A 3RXOA 1SPJA 1K0HA 4D8NA 5BRRE 1Y3XA 1GMCF 2BM2A 1O2VA 1S81A 2HVXA 3U69H 4AFUA 4WXVA 3T28A 2GGVB 3SNCA 1WTHD 3GY4A 5EG4A 1QL8A 1HLTH 3E0NB 1HGTH 4NA8A 1ORFA 2Z6BD 3OEED 2F9VA 3DD2H 2VIOA 1TRMA 1J16A 3O8CA 1ESTA 1G9IE 1GMDG 1GBIA 1O2SA 5J4SA 1LPGB 4WVPE 3RC5A 4Y7BA 4AYVB 3M35A 3STJA 3SYJA 3E0PB 5CE1A 1XXFA 3V7TA 1WQSA 1H9LB 2OC0A 2HNTF 5CDFE 2PSXA 1S6FA 1MMJN 1TABE 1FN6A 2FWWA 5HM9A 5JPMH 4UFEH 2GT7A 2J95A 1QRWA 2BVXH 1BUIA 4NZLA 1UVSH 1XUHA 2CHAB 3V0XA 3P92A 1YLNA 1MTVA 5C5NA 1SLWB 5HIYA 3EQ0H 2RDLA 2A5IA 3E3TA 1RS0A 1P2JA 2QF5A 1BJVA 1RJXB 1A5GH 4NA7A 1O31A 4JZ1A 1P12E 1G37A 1GI9B 3FANA 1SFIA 2BQWB 4BAKB 4CR9A 1PQ8A 1OWHA 2EI6A 5K7RA 5EXLA 4UFFH 3MO3A 1A61H 1RTKA 2ANWA 2ZP0H 1EXFA 4YM9A 4Q80A 2ZFPH 4FUDA 4Y0YE 2ZFQH 2NU0E 2PUXB 4X6OA 2YNAA 4K1EA 1DICA 3ZVGA 4Y71A 3ZVDA 1SLVB 1YPEH 3BF6H 3RXAA 4AG1A 5GIBA 1C4U2 2AMPA 3SHCH 1IQEA 3KQCA 2ZDAH 3MU1A 4INHA 3RXTA 2ILNA 2A32A 2J9NA 2Q6FA 5JB8S 1OKXA 1OWIA 2GKVE 3ZYEA 4X8TH 4Y11E 2ZA5A 3SU3A 1GJ4H 2F9UA 3F9FA 1AD8H 1KDQB 3A89A 1AE5A 1P2NA 4NGAH 4NSVA 5IDKA 5C94A 2BD7A 5KGOA 1QRZA 1JIMA 4I8LA 2J98A 2J92A 4RKOB 3GY5A 1NPMA 1O2HA 3KCGH 2ODYB 1JMOH 1RIWB 3ZZAA 2Z9IA 1V2QT 3MH6A 1A4WH 1O3PB 2QN5T 2B5TB 5JB9S 1UTMA 1F5KU 1O3MA 2GV6A 1WU1A 1F7ZA 3BIVH 5T6FA 1GI0A 2VIQA 2ZTXA 1ZJDA 5HKKD 1TGCA 2G5NA 2CXVA 1ZPCA 4IMZA 4P00A 4ASHA 1DDJA 1MH0A 2C93B 3AASA 5EJLA 5AF9H 2V6NA 4K2YA 4Q7ZA 3SORA 3NKKA 3RXCA 1UW7A 1XUIA 3T27A 1DWEH 1C1QA 4A7IB 1O3AA 3B23B 2BXTH 2UUFB
chains in the Genus database with same CATH topology
3AAVA 3HATH 5PTPA 5FPYA 1O2NA 2BDBA 3TH3H 4OS1A 1S6HA 1RTLA 1VR1H 1NY22 4DOQA 3E16B 3M5LA 5LPFA 2XC0A 2XC4A 1FY8E 2FLBH 1K1LA 2ZPQA 4MNXA 4AZ2B 1TB6H 1KXCA 1T4UH 1GBLA 1Z8IB 1ZMJA 4ABBA 1GMHG 1XM1A 1NRSH 3RLYH 1C5TA 2STBE 3F9GA 2A31A 3ZZ8A 1FAXA 3EGKH 4IS5A 1GI1A 2H5CA 1JBUH 2P3FH 1F0SA 2XBYA 2W7SA 5E0HA 4HGCA 2ALVA 3GYMA 2ZGHA 2BOKA 1OS8A 4K8YA 2WPLS 2ZGCA 4FUGA 3LDXH 3SNEA 1O3FA 1TGSZ 1H4WA 4ZMAH 3UNQA 3ZVCA 2FYRA 3SZNA 2PSYA 1QNJA 1F0TA 2TPIZ 1SGQE 2R0LA 2A7CA 5GPIB 2A5KA 2RA0A 3A81A 3H7TA 3HPTB 4HTCH 1HNEE 2F9PA 3LT3A 3TGJE 1BHXF 1AWFH 4KTUA 1AI8H 2GD4B 3RXJA 4X2XA 2P3TB 5HGGA 2A4OA 4FUIA 1AVXA 2GT8A 3T25A 1Z8GA 2OLGA 2BVRH 3ATWA 2FM2A 5HYOA 4IMQA 5JYIA 2ZECA 3QTOH 5GXPA 1A0JA 2ZF0H 4UDWH 2JH0D 2C8WB 2FTLE 2ANKH 3A7YA 5JBTA 1PJPA 3MH5A 9LPRA 1SLXB 1OOKB 3S7KB 1GVLA 2BZ6H 5GJ4B 5J4QA 4FVBA 3N7OA 4UONA 1YPHE 2NWNA 1CE5A 4OS7A 3ELAH 1TPAE 1ZTJA 4YESB 1AFQB 3VEQB 4CBNA 1GBJA 1GBKA 4B71A 3SV7A 1DUAA 4CRBA 1UK2A 1DM4B 1KXEA 3PWCA 3M3SA 4Y76A 1V2OT 1O3BA 2FIRH 2K1QA 2QXJA 1GBDA 2M5TA 5L6NH 1H8DH 1GMCG 5LH8A 2FOEA 2UUKB 3MO6A 1C4Y2 1O3JA 3RU4E 1WYKA 4X8VH 2VNTA 1KYNA 3ATKA 2GCHG 1C1VH 2BY7X 4CHAB 4ABHA 1C1MA 4SGAE 2VWMA 1CBWC 3ESTA 4K3JA 2BXUH 5HM2A 5EXMA 1J17T 1A2CH 3HKIB 1EKBB 1OSSA 1W13U 4FUFA 1FI8A 1DXPA 1UVOA 3RXFA 1KTTB 3M36A 3VB6A 4MPVA 2W5EA 1MZDA 3DHKH 2QXGA 3IG6B 3STIA 2PR3A 2WYGA 4B74A 1CA0C 1UCYE 1ZPZA 1G3DA 1T8LA 4O3TA 2W3KA 2PV9B 9ESTA 2SGFE 1LDTT 3R0FA 1ACBE 1PQ7A 3ITIA 2SGEE 1WOFA 2O8LA 4F4OC 1QJ6B 3A7TA 4NIVA 3R3GB 4AB8A 3PROA 1YBWA 3PLPA 2WYJA 1ZSLA 2BX3A 4WH6A 1C9TA 4BTTB 1F0UA 1C2EA 1OPHB 5IYTA 3MMGA 4GLYA 5FAHA 3SUDA 5L2YH 1V6DA 1F5LA 1Y8TA 3ZZ7A 1A3BH 1FV9A 1E0FD 1BIOA 1EAWA 2F9NA 4ABIA 1PPCE 2VGCC 3LH1A 4TPIZ 5A0CA 1WQVH 1UVPA 4MNWA 3RXSA 1ANCA 1EAIA 1GBHA 1O36A 3OSYA 1Y3YA 2ZO3H 1Y5UT 2ZDVH 3LU9B 3OTJE 1XKBC 1B0FA 4YZUA 4CRDA 1FMGA 1LQDB 4CRAA 1LKBA 2F9OA 1GI3A 3SQHE 3Q77A 1QHRB 5A8ZA 2BDAA 2Z3DA 1YYY1 4O9VA 4B2CA 1CU1A 2ODPA 2RCEA 7ESTE 1LMWB 5C67A 2XBVA 3GY2A 3NCLA 3S9CA 1WSSH 3T5FH 3U98H 4AGKA 1C2DA 2DE8A 1T4VH 3Q00A 4AFSA 2GVFA 3RM0H 3MNXA 3RXIA 1MQ6A 5ETXA 3TJUA 3BTTE 3NUMA 1C5OH 1YC0A 1H1BA 3A87A 3KQBA 1NRPH 4I8JA 4X6PA 5I25A 4X1RU 3S7HB 5DKMA 1O38A 2XBXA 1KSNA 3QDZB 4BTUB 1ZZZA 1SG8B 1YM0A 1GJBB 1LQEA 1EPTC 4MPXA 1DUEA 2OP9A 2Z3CA 1TX6A 3TITA 1GHYH 1G2MA 3LPRA 1ELDE 1GWAA 2WUCA 1GBCA 1K21H 5GDSH 1SLUB 1ZHRA 3BIUH 5F8ZA 1QFKH 1NRQH 1GCDA 5CMXH 4YLQH 1BTUA 2HOBA 1HCGA 1K28D 2TIOA 4FVDA 1NROH 4HI3A 1CHOF 1SQTA 5TJXA 4FUBA 4LK4A 1CBWB 2A1DB 1HXFH 1MAXA 1H9IE 1IAUA 2CMYA 1GGDC 1NRNH 3SUFA 1BTXA 3E91A 3UOUA 1O3NA 2OBQA 1TPPA 1TBQH 1DS2E 3OY5U 1N1LA 4AN7A 1W0YH 4CH8B 3SI4H 1CA0B 1QB9A 1L1JA 5C1UA 2Y7XA 4XOJA 1FPCH 1ARBA 1F2SE 3AAUA 5E0JA 4BXSA 3KGPA 3QK1A 3DFJA 2P94A 5DP9A 4H6TA 1QBOA 1C1WH 1ELAA 1FIZA 3BEIB 3EA8A 2ZHFH 1LPKB 1UTLM 5ESBA 2SGPE 2I6SA 2Y81A 4O97A 1Z8JB 2XRCA 3CS0A 3GDSA 3F9HA 4RN6A 1AUJA 1GHXH 1GJDB 3B9FH 5EGMA 3UR9A 1C5RA 2C90B 3RXGA 1SGEE 3LGVA 2VGCB 4NFEA 3S9BA 3MOCA 4A1TA 1D3TB 1EB2A 2OQ5A 1CVWH 4U32A 2Y6TA 4AG2A 1XVMA 3SJ9A 2CHAC 2QAAA 1DSUA 1MZAA 4X1PU 3S9AA 1TGBA 3A80A 3TLOA 2BD9A 2XTTB 3PB1E 4JYUH 4I7YH 3A7ZA 4BAOB 2G4TA 3HKJB 5B6OA 3TNSA 4ZKOU 1VITH 2Y7ZA 3SNAA 2BX4A 1KXDA 4JK6A 5F6MA 2JETB 1PPBH 2BDHA 1MTUA 4MVNA 4DJZB 2BMGB 3L3TA 2ZCHP 4IC6A 1O2IA 1IQHA 1ZMLA 3EA9A 1QCPA 3PWBA 1QA7A 2AGIX 3RLWH 4CRGA 1EPTA 1QR3E 4XSKU 2O8UA 5JDUB 1V2RT 4JYTA 3RMMH 1EAXA 1L4DA 1QQUA 1D6WA 4WMFA 1EPTB 1K1IA 4XE4A 3LGYA 3PMAB 2F9BH 1SGPE 4ZUHA 4D9RA 5DP8A 3P95A 1DWBH 1UVTH 3A86A 1EATA 2J4IA 3ENSB 3ATIA 1G30B 2AIQA 3JZ1B 4B73A 1FY3A 5GCHF 3ZZ9A 5FXLA 1O37A 1P06A 1O2MA 3KQEA 3TPIZ 2G51A 1O34A 1M9UA 1A5IA 1O35A 4XBDA 4Y79A 2BLQA 1RIWC 2J38A 2Z9JA 1C5SA 1FLEE 2H2ZA 1NM6A 1GGDB 1TYNA 3KQDA 4MPUA 1ZHMA 1YPJH 2BLOA 2BY9X 2P8OB 3QGNB 4ZHAA 5EPYA 4E05H 1O3DA 2Z9GA 1TPOA 2SGAA 5T6GA 3PTBA 2GCHF 2WUBA 2XCNA 3SJOA 1Y5AT 3NK8A 4FXGH 1O2JA 4JMYA 5FX6A 3QX5H 3VB4A 1UTQA 3M3VA 4GPGA 1SGIB 4FUCA 1MD8A 5HMAA 1L4ZA 1ZTLA 2HRVA 5FCKA 2RG3A 1UHBB 3AW1A 1Q31A 1SOTA 5A2MH 3E90B 2F91A 2OXSA 3RXMA 1KLTA 1AQ7A 2UUJB 3TGKE 1O2UA 2A7JA 2BD8A 8ESTE 1RXPA 1GVKB 2QA9E 1V2KT 2GDDA 1O2QA 2BZAA 4Y10E 3ZVFA 3SU2A 2ZQ2A 2UWPA 3RDZA 1SGTA 3RXEA 3PMBB 2A4GA 1ELBA 2ZCKP 1KIGH 3KNXA 4I33A 8GCHF 3DT0H 1BBRE 2D26C 1Z71A 1D3PB 2R0KA 3QO6A 2ZHQH 2VU8E 3VFEA 1P05A 2ZGBH 3MNSA 2SNVA 3SJKA 4H6SB 4XBCA 3BTDE 2PHBA 2Z9KA 1Y59T 3SV6A 1P0SH 2NU2E 1O3OA 4ABEA 2H9TH 2UWOA 3P8NA 3KIDU 4WWYA 1TBRH 2C8YB 3M7QA 4B2AA 1O5DH 1C5PA 2BQ7B 3UWIA 1SI5H 1XUKA 1BITA 2FPZA 1OWJA 1QA0A 2BD4A 7KMEH 2Q6DA 2ANMH 4ZROA 2ZGJA 2RA3A 3VXFH 6GCHF 1FPHH 2CJIA 5EQRA 1C2MA 1MQ5A 3RUOA 1RRKA 5DO4H 4PROA 2QF3A 4X1NU 1T8OA 4B76A 1KDQA 1EZXC 1TMBH 1QB1A 1F0RA 1PQAA 1HB0B 4X8SH 1ID5H 3MU5A 2LPRA 3BTKE 1X7AC 1DPOA 2FTMA 2FZZA 1VJ9U 1THSH 4ISOA 5DJ7A 5FHTA 3C1KA 4NCYA 4Z6AH 2BLWA 1SGYE 3LJJA 3SI3H 4U30A 2H1UA 4DGJA 2A7HA 2FS8A 1AGJA 1AFQC 1A0HB 2B7DH 2JH5D 1CHOG 1BMAA 2ZU2A 4JZFH 2FP7B 1FNIA 3UWJH 2NU4E 3LOXA 2WPKS 1D9IA 1J15A 2VINA 2GZ9A 4TPYA 4NWLA 3U8OH 2BQ6B 1CHGA 2KAIB 2LNCA 4WJG2 3SU6A 5T3HA 1GHAF 1WCZA 1NTPA 1MUEB 3F68H 4WXIA 1VITF 4CHAC 2XWAA 3TK9A 1AVGH 1UO6A 2VIDA 2AGGX 4YOIA 2IOTA 1EQ9A 1NFYA 3ZZ3A 3S0NA 1PFXC 1BHXB 2PGQB 2CF9H 4F49A 2HNTE 2D2DA 1W7XH 2THFB 2VWOA 3JZ2B 1W2KH 1S5SA 1C1RA 1TNIA 1O32A 5ESTE 2GZ8A 2PTCE 3ZVBA 2FESH 2WV5A 1C9PA 1O2ZA 2PKAA 3QN7A 2HLCA 1BRCE 3MH4A 3TK5A 1ESAA 1IQKA 4WH8A 3RC6A 1EJAA 5A8XA 1N6YA 4GCHF 2PKAB 1WV7H 3P17H 4BTIB 1MTWA 1C5YB 2HGTH 1HV7A 2XXLA 1AHTH 3M5MA 1ARCA 4CR5A 1DX5M 1TQ0B 3BTQE 2BB4A 5AVDA 1C2JA 3GY7A 4IGDA 1IOEA 5H4IB 3SNBA 1S82A 1UCYK 2R2MB 3ZZ5A 2Y80A 3A8AA 2ULLA 3FP7E 1A7SA 3MI4A 4NZQA 3TNTA 1K1NA 1KXFA 1TA2A 2D8WA 4E06H 2CV3A 4GHQA 3A7WA 1K22H 1TRYA 4AGJA 4KTCA 4NIYA 2FX4A 4BNRA 2FS9A 4K8BA 1BOQA 2BY8X 1PYTC 4MNVA 1LVMA 2XW9A 1HJ8A 1O39A 2BOHB 2AH4X 6CHAB 1EOJA 1Q2WA 2ZFTA 1QJ7B 1GBEA 1V2VT 2YOLA 1MKWK 2XYAA 3CP7A 5GCHG 1BTZA 2OQUA 3RC4A 1FJSA 1D4PB 1LVOA 2I6QA 1F92A 1V2ST 4Z0KA 1ZTKA 5E2PA 1DLEA 2XC5A 2ZGXH 1XUGA 4HFPB 5DP3A 1EJMA 1GJ7B 2FO9A 1BBRH 1YCPM 1DFPA 2WPHS 1C2LA 1HJAB 1CT0E 2J34A 3T62A 2TGAA 4ZXYH 1RTFB 4XBBA 4IC5A 1THPB 2PW8H 3U8RH 2ANYA 2Y5GA 1HRTH 4ISIH 1SQOA 4NSYA 4UFDH 1ANEA 1E35B 1SGFG 4X2VA 2GMTB 1QQ4A 1ZRBA 1ETRH 1G32B 5LPRA 1K1OA 1DXWA 2BD2A 4AX9H 3NXPA 1Q3XA 1DANH 1UTNA 2A2QH 4MTBA 3GCHC 2EI8A 2BTCE 3ZV9A 2ZU1A 4I32A 3PM3A 2C3SA 4FUHA 3VGCC 5C5OA 4ZHMU 1NT1A 3UQVA 3VXEH 2H5DA 1ZYOA 1GCTB 3BEUA 1MBMA 2QC2A 1V3XA 1FY1A 4HZHA 4KGAA 2CN0H 3SW2B 2SNWA 1AZZA 2O9QA 1K9OE 1XUJA 3NPSA 4ZKSU 1W10U 1DITH 1HAHH 3SGBE 4YT7H 4JCNA 1P10A 2ZKSA 8GCHG 1NESE 3EAJA 4J1YA 3BTHE 1EZUC 1SB1H 1C5LH 1W7GH 2ZU4A 3ZZDA 1OWDA 2A4QA 4ABGA 3AW0A 2YNBA 1HAOH 3P6ZB 5A0AE 1J14A 2VWLA 1TE0A 4INKA 1GHVH 3D49H 2Z3EA 2ZFSA 3O8DA 1Z6JH 1AB9C 5C1YA 3A84A 3URDA 7LPRA 1J8AA 4ZHLU 3KHVA 2ZU3A 3UIRA 2QV1A 2FDAA 1ZPBA 1BZXE 2Q1JA 2JKHA 3GICB 1EB1H 3MWIU 6GCHG 1O2TA 1GI5A 3UPEA 2ALPA 1ABIH 1BDAA 4ABAA 1OP2A 2P16A 2AS9A 1ELEE 4WMDA 4BANB 2H9HA 1OWEA 2AMQA 3TIUA 2JETC 1HUTH 1Z1IA 2QXHA 1C1OA 1OP0A 1DOJA 3P8OA 3SV9A 1CGIE 2FOAA 1JOUB 4TY7A 4YO9A 2OC8A 3SO3A 1GBMA 1MAYA 2AMDA 2ZFRH 1SMFE 3PV4A 4FU7A 4UEHH 1AMHA 2CGAA 4KKDA 3RXPA 3TJOA 1T8MA 2TBSA 4DVAU 1HAPH 4ABJA 1GVZA 1P09A 1QIXB 3BTGE 3TH2H 4BAHB 1A46H 4YTAA 3KEEA 2DUCA 5C1XA 1ZSKA 1E37B 1LHGH 2HNTC 4NFFA 1SVPA 2BY5X 4B75A 1Y3VA 2BDIA 4YLUA 3V12A 1BRUP 3FZZA 4E7RG 1FIWA 3K9XB 1GL1A 2SGDE 4OS5A 2G8TA 2FOCA 5TCAA 1BRAA 2QIQA 1GHAG 1O5FH 8LPRA 5EODA 2P3UB 4NG9H 5TCCA 2PKSC 4OGYA 3MFJA 4Q7YA 8KME2 3GCHB 1VITG 1GJAB 1O3CA 3SU0A 1LKAA 3VGCB 1YPMH 3G01A 2P8OC 1DVAH 1GDUA 4GSOA 1SGRE 2R2WU 2VVVA 3K6ZA 4B1TA 1NS3A 1BT7A 3MTYA 1UVUH 5DG6A 4I8KA 4D76A 1EZQA 2ODQA 1QGFA 1HFDA 2BVSH 4K69A 1GI6A 4KP0A 3EDXB 4RSPA 5EQSA 3UTUH 2W3IA 1GBFA 2QXIA 4OS2A 1B5GH 3M7UA 3O8BA 4R0IA 3ZV8A 3HGPA 1ZMNA 2ZHDA 3LGUA 2JH6D 3ZZ4A 3O8RA 4LZ1H 2O8TA 1AFEH 1UTOA 2FX6A 1BCUH 4BAQB 3RMNH