1O2LA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2lA02
1DE7H 1DLKB 2BDAA 4X6NA 3A82A 1AB9C 2CJIA 4Y8YA 1AUJA 1HAHH 2FYQA 3PLPA 3SZNA 1YPEH 1GJ9B 2ZGCA 2TPIZ 2ZDNA 1B0EA 2WPMS 1A0LA 2FS8A 4NSYA 4FVBA 2BLQA 3RXPA 2OBOA 2EI6A 3VB3A 1O2ZA 2HPPH 2SNWA 3A8AA 2GP9B 1RRKA 1JRTA 3R3GB 1C1OA 4I8HA 4UE7H 5EW2H 2G81E 3BTEE 2ZU3A 4AZ2B 1F7ZA 1FQ3A 2UWLA 5GCHF 1PPFE 3K2UA 1K2I1 1UMAH 3MHWU 1ZPZA 1L4ZA 3P92A 3CENA 1ELGA 1LDTT 1GJ6A 2BZAA 2FWWA 5F8ZA 1BIOA 1VCPA 3E0PB 4INLA 4FUCA 1GDNA 1KDQA 3SNAA 1EKBB 5A0AE 2FP7B 1BZXE 1IQGA 3JZ1B 3ZZ9A 1DT2A 4B1TA 1AFQC 3MU1A 1O5EH 4F4OC 1NESE 1MMJN 4ABEA 3BTTE 2G00A 1YPKH 1EP6A 2GZ8A 2CF8H 2V6NA 1FIWA 3TPIZ 1NTPA 2ZPSA 1AVXA 5JBAS 3RC4A 1VGCC 2TGAA 1GCTC 3A86A 3QK1A 4NA7A 4OGXA 4X8UH 3VB5A 4ZKOU 2BLOA 4DOQA 1KLIH 1ZTJA 2STAE 1C5QA 3Q3YA 2K1QA 2W5EA 1RJXB 5HGGA 3GYMA 2QXJA 4O3UA 2GV7A 3ODDA 2DE9A 4Y8XA 1ANBA 1P9SA 1WAYB 1NN6A 3DHKH 1MUEB 4NWKA 1BRBE 4GCHF 1HBTH 4X0WU 1BMMH 1PYTD 3ZZ4A 1HXEH 3T2NA 1DSTA 1NO9H 4AFUA 2AGGX 3M7TA 2FOBA 1O3PB 3F9GA 1CHOG 2PW8H 1F0SA 1GMHG 2XC5A 1XUJA 3MNSA 5I25A 1GBBA 5GWZA 5AFYH 1C5SA 2OLGA 1OPHB 1AVGH 1N8OB 3UUZA 1CA0C 1WYKA 3UWJH 1Z6EA 1C5UA 1TMUH 3M7UA 1YP9A 1UCYH 3GICB 1DANH 4KTSA 2GCTC 1P06A 2TBSA 2FYRA 3LC3A 3S9BA 1MCTA 5TCAA 4TPYA 3BIVH 2ZQ1A 3GY7A 2VWMA 1MZDA 1C1NA 3SHCH 1SGQE 1OWJA 3LGIA 1D3QB 4AGJA 1FN6A 3BTQE 1SI5H 2A7CA 1TAWA 2VIDA 1O0DH 3UPEA 3RXAA 3K6ZA 1GWAA 5PTPA 1HAIH 1SGFA 1KXCA 3KIDU 2A32A 7KMEH 1Z1JA 5L30H 4Y76A 1AWFH 3KN2A 4CRFA 1O3GA 2C4FH 5EW1H 1ZJDA 5I46H 1GDUA 1UO6A 5EQRA 2ZIQH 1C5LH 1O2JA 1AE5A 1GMDF 1O30A 3LOXA 1B7XB 1GBHA 3H7OA 3GISB 4FU8A 2H9EH 1ARCA 1WSSH 3GCTG 4HI3A 4KP0A 1LQEA 2GMTB 3SUEA 1PPBH 3LT3A 4GUXA 3NKKA 3GYLB 5B6OA 4AB8A 1SGIB 4CRGA 3GCNA 3LH1A 1RD3B 1SGEE 4WH8A 3V12A 1A0JA 2W26A 5FAHA 3SORA 9ESTA 1ZTKA 3PWBA 1LPKB 2WUBA 1LHFH 4FUIA 2R3UA 3MNXA 3S7KB 3PTBA 1Y59T 2A0QB 2GDDA 1NRSH 3QUMP 3RU4D 1BBRH 1V6DA 1XXDA 2P93A 4ABHA 4KTCA 1UK4A 3ZYDA 4TY7A 1Y3WA 1GG6B 1CT2E 4GHTA 3BTHE 5E0HA 3TK5A 1V2WT 1GHXH 1T7CA 1AQ7A 1QGFA 4X6MA 4BAQB 4I32A 2Z9JA 1TRNA 4X2VA 4X6PA 2BHGA 1K1OA 3RU4T 4CREA 1KXAA 4GSOA 2P8OB 1QB6A 2XCFA 1Y3VA 2PKSB 3GY4A 1UTQA 3SJOA 5GDSH 1E36B 3SNBA 1ZGVA 5FX5A 3E8LA 5A8ZA 1HAVB 2WPKS 2ZNKH 1TBZH 3W95A 1LPZB 3A85A 2H6MA 1SGCA 1GHYH 1CGJE 1K21H 2BX4A 5J4QA 1ABIH 2XNIA 5EOKA 1BT7A 5JYIA 1QB1A 3ATKA 5E8EH 3BV9B 3RDZA 3WY8A 1EP5A 2H2ZA 1BHXF 3DT0H 2A5IA 2THFB 1SQTA 1N6XA 1QB9A 1O3OA 3M3SA 1P11E 2AIQA 1UJ1A 1GJ4H 1ZHPA 3PV4A 3RXMA 2QA9E 1HAXB 1C1RA 1O3AA 1TX7A 3H7TA 1SLWB 2HNTC 3MYWA 3IG6B 3TNSA 3SI4H 3A7XA 2FOGA 1RIWC 4E7RG 2QV1A 1DITH 4ISLA 2A5AA 3SUGA 1C5ZB 1GHBG 2PGQB 2BVXH 2PGBB 2SGEE 1CHOF 1QRXA 3VB7A 3AW0A 2FESH 3ZZ5A 3STJA 2XYAA 1MQ6A 2SGQE 1EZXC 1FPCH 3A8DA 3QX5H 1BITA 2ZPQA 3A7WA 3EQ0H 3SV2H 1UHBA 2PKAB 2P59A 3OY5U 4ZROA 2Y7ZA 3ZVFA 1G9IE 1LHDH 1HRTH 1FY4A 5EODA 4U01A 4UFFH 2SNVA 2XCNA 1IHTH 1LKAA 1O34A 3QZRA 3HGNA 3SU1A 1UK3A 1NS3A 2PTNA 2BLWA 3VGCC 1EPTC 2XBWA 1KY9A 4XFQA 4UFGH 1O31A 1QA0A 1J8AA 2Z6BD 1UTNA 2KAIA 4ISIH 1Q31A 4E05H 2GT8A 2R0KA 2VWOA 4CRCA 2QYIA 1AKSB 3UIRA 1BTYA 3BG8A 3UQVA 1D4PB 1O5GH 1JOUB 1XUFA 3BN9A 1IHSH 3GCTF 8KME2 1Y5UT 5CHAC 5L2ZH 1TONA 5DO4H 1AMHA 1TX8A 1TNIA 1FAXA 2Y6TA 1AFQB 4NFEA 3QDZB 2V0BA 1NU9A 5F8TA 2A2XH 3S69A 2WPLS 1FXYA 4BXSA 4K1SA 1VGCB 3B8JA 2TIOA 2P3UB 4ABDA 4M7GA 3BTME 2VH0A 2C8XB 1CT0E 1DS2E 4I8KA 2QF0A 1MQ5A 3E91A 1G3DA 4NZLA 5TJXA 1H8IH 1L2EA 3ZZAA 3TJVA 1L1JA 1SLXB 2Y80A 3M35A 4IC5A 3TH4H 1BRCE 1SGNE 1A5GH 4E7NA 8GCHG 1LVOA 3D65E 4UONA 1GBMA 2O9QA 4B2CA 1UHBB 5A0BA 3B23B 1QQUA 1TWXB 1O3KA 2ANWA 2VVCA 1TNKA 1YGCH 1P2JA 4FUFA 1WQSA 1O2WA 2CMYA 3DA9B 1P2MA 1E38B 4X1RU 5HYOA 4MPUA 2RA0A 3KHVA 2BDHA 2G55A 2FIRH 1W14U 1GL0E 3EA7A 4WXIA 1O5CB 3DD2H 1THRH 1C5WB 1ELBA 3M36A 1TABE 1ZMNA 4YT6H 3AAVA 4DJZB 5C1XA 1IAUA 2QXIA 3E6PH 5HM2A 1DXWA 1VITH 4K1TA 4K5ZA 3ITIA 2H5DA 5AF9H 1E35B 1LQDB 3TGJE 3PTNA 5F8XA 2GCHG 3AVZA 1UVTH 1B5GH 3UNSA 1ZPCA 3M5LA 2ZI2H 3ZVBA 1G2LA 4ASHA 4YLUA 1LKBA 3B9FH 1FLEE 2J95A 2PSYA 1GJ7B 4BAMB 2J92A 3D49H 2FX4A 3TH3H 1GHBF 4B76A 3ZVEA 3QLPH 2Q1JA 2FOCA 1YCPH 1QTFA 5C67A 6LPRA 1E34B 1QJ6B 3QTVH 2RA3A 1W7GH 2XWBI 1V2RT 1MAYA 4LOYH 1DWBH 1MKWK 5AVDA 1FY8E 7ESTE 1DDJA 4FUHA 1SB1H 3STIA 2AYWA 3A7YA 1Y5AT 4OS2A 1ABJH 5A0CA 1A5HA 1DXPA 5EGMA 1Z1IA 3H5CB 3U8RH 3SGAE 1D6RA 4YM9A 1QL7A 1TMTH 5FX6A 3MI4A 3GY8A 2P3TB 1BJVA 1KXFA 1HJAC 2J2UA 2Y5HA 2EA3A 3SQEE 2BVRH 4ZMAH 3LDXH 3FZZA 4TWYA 3TK9A 1QQ4A 1ZOMA 1ZMJA 2AFQB 3U1IB 1T8LA 1LCYA 2ZU1A 1AZZA 1OWKA 3UOPA 1CA8B 4UD9H 1GI4A 1NFUA 5A2MH 2ZDVH 4UFEH 4IBLH 1A7SA 3SV8A 1FONA 1THSH 1TB6H 2BM2A 5DK1A 3RXHA 2QC2A 1V2VT 1C5VA 2BMGB 1NFYA 1D3PB 1O2KA 3I78A 1TMBH 4CR9A 3LKWA 1HAOH 2TRMA 1XUGA 1M9UA 1YBWA 1ZSLA 2A31A 2PWXA 4IW4E 4LK4A 1LO6A 3LJOA 3P8GA 1IQJA 1RGQA 2VNTA 3ZV9A 1CO7E 1ESTA 3EAJA 2C8WB 4MPVA 1SG8B 2BD2A 2QGRA 1O2PA 1BTZA 1SGRE 2Y5FA 3AAUA 1RIWB 8GCHF 1SSXA 1ETRH 1MU6B 4MQAA 2XXLA 2A5KA 1C4Y2 1O3HA 4JK6A 3IITA 4BAHB 3SU6A 1KLTA 2ZGJA 2OQ5A 3SW2B 1CQQA 4K1EA 5FPSA 1DLEA 2PUQH 5IDKA 1C9PA 4H42U 2I6SA 1Y8TA 2GT7A 1BTPA 5FPYA 1DUEA 2AEIH 3F6UH 4MTBA 1VITF 4ZHLU 3NWUA 4RN6A 4NSVA 1A46H 1NU7B 3SOSA 3ZZBA 2XBXA 9LPRA 2O8TA 3PMAB 1YPJH 3EDXB 1N6YA 1TX6A 4XE4A 1BUIA 3TITA 4ISOA 1ZSKA 4AGKA 4MNXA 1GBEA 1S85A 4X8VH 3VGCB 1EPTB 2HVXA 1QRWA 4B2BA 2HWLB 1XKBC 2B9LA 2XTTB 1GI0A 1HCGA 1SQAA 3P8OA 2GCHF 4AX9H 5K7RA 1MTVA 3NXPA 5EQSA 1WBGB 1BTXA 4IS5A 4AYYB 4BTUB 4WH6A 3MMGA 5A8YA 2PSXA 4CRDA 3MNCA 3OTJE 4TPIZ 3R0FA 1JIRA 2FXRA 3ZV8A 4I7YH 1F5KU 2H9HA 1L0ZA 4XBCA 4XDEA 2C8YB 2ZFQH 3MH4A 4IGDA 1RTKA 5CHAB 1WTGH 3NUMA 4K69A 2AGEX 3HK3B 1GBTA 1TQ7B 4AOQA 3TJUA 2ZFTA 3K9XB 4MNVA 2D1JA 2FOMB 1WV7H 2Z3CA 3OX7U 1SC8U 2CGAA 4LZ4B 1ZR0A 1FPHH 1MTNC 1LVBA 3GY6A 1VCWA 4ABBA 2STBE 2XC4A 1XUIA 5JBTA 3EE0B 2VIVA 2CXVA 1H8DH 4AORA 1VJAU 2ZFPH 3PLBA 1C1MA 3BEUA 3ZVCA 1TNGA 1ZJKA 4Q7ZA 1QY6A 3A84A 1TNLA 4Y6DA 5TCCA 5SGAE 1K1JA 2A45B 1C2IA 3MH7A 2C93B 1F0RA 3RMOH 3FP6E 2A4QA 3RXEA 3U8TH 2ZHQH 3VEQB 1FY5A 1UTLM 1Z8JB 2G52A 2TGPZ 3F68H 1G37A 5JB9S 3S9AA 1GI8B 2WUCA 4GLYA 5C3NA 1O36A 1TPPA 1O33A 1GJBB 3M61U 1YPLH 1O3MA 4UDWH 4HGCA 1O3CA 2EEKA 3SJKA 2W7SA 1KTSB 2TGDA 1EOLA 1EAWA 1O3JA 3RMNH 3PO1C 4MPWA 3ZVGA 4OS1A 4Z6AH 4MNWA 1FN8A 3RXIA 1W0YH 1Y3UA 1YM0A 2BDCA 1GHWH 4K60A 1HAPH 1TRYA 2GKVE 1QR3E 2GTBA 1HAVA 1AO5A 2EI7A 2VJ1A 1Z71A 3A83A 1DY8A 2H1UA 3GY2A 5ESTE 2AMDA 3BEIB 3EA8A 2J4IA 1ZMLA 2BXUH 2AMQA 1C1QA 3MTYA 2LPRA 4ZKNU 2GZ9A 1OP0A 5CMXH 4Y0ZE 1KLJH 2JH0D 5EXLA 3EYDA 5GXPA 1KYNA 5C1UA 4LXBH 2ZTXA 3ZZ7A 1EB1H 4NGAH 2AERH 1GCDA 3BIUH 4ZAEA 3GDUA 1KXEA 3VPKA 4OS5A 3RXTA 3A89A 3NCLA 4ISNA 1V2NT 1C2HA 3SJ9A 2ZCLP 3BSQA 1TGCA 1VR1H 2ANKH 3P70B 1P05A 2Y82A 2OD3B 3P6ZB 1A2CH 1Y3XA 3L33A 5C2ZA 1NY22 2ZDMA 3KNXA 1DPOA 3MO6A 1SR5C 2BDIA 2D8WA 2V35A 3MO9A 1BTHH 2VGCC 4Y11E 1NFXA 2PKAA 1NT1A 1P2IA 1C1VH 2OTVA 2ZHFH 1AU8A 1HV7A 2A4OA 4B75A 2ALVA 1CVWH 5C20A 3PYHA 5EXNA 5FXLA 3VXFH 1DWDH 1HNEE 2B8OH 1J16A 1HJAB 3M5MA 2BD3A 4X6OA 6ESTA 1F0UA 1GI9B 1MBMA 1O3FA 1G3BA 1GJCB 3RXFA 3P17H 1WU1A 1QBOA 3BEFB 2VIPA 1ARBA 3SN8A 3SV7A 4NIVA 5GPIB 4SGAE 3SBKA 3T25A 1C5NH 3KL6A 1HIAB 1W11U 1GBKA 1ZRBA 3UR9A 4B71A 1ELEE 1AKSA 2D26C 1MKXH 4X8SH 5FCKA 4UFDH 1GBCA 2Z3DA 4CH2B 2ANYA 1MZAA 2FOHA 2V3HH 4KTUA 1TGNA 1GJ8B 3O8DA 2NU3E 1P04A 2BD4A 5T6DA 1T31A 4YT7H 4BAKB 2Y81A 2NU1E 2ZDLA 1NRRH 4Y10E 2F83A 4FU7A 3A81A 2QXHA 1P2KA 2J38A 4ABIA 1EZUC 1YCPM 2PTCE 2J9NA 2V3OH 2BQ7B 2O8MA 1ELVA 1GJDB 4OS7A 5JBBS 3BTDE 4U2WA 1XVOA 4I8GA 2HNTF 1GI1A 1T4VH 1TOMH 1O2TA 2SGAA 1GMHF 2ASUB 3FZDA 1GL1A 1SGPE 1T8OA 1O2MA 3QWCH 1SGTA 1P3EA 1WUNH 3C27B 4FUGA 2AMPA 1YPGH 1JRSA 1CBWB 2G51A 5DP9A 1BQYA 1TQ0B 2ANMH 4MPXA 1TNHA 4CHAC 1AB9B 1GI6A 2BZ6H 1FUJA 2RDLA 4YOGA 1G3EA 3QZQA 1PPZA 2BDGA 1V2PT 3A7ZA 1EAIA 1ELFA 1BMNH 3UY9A 3RXCA 5EG4A 4PROA 1GHVH 4OGYA 1ELCA 1RXPA 3MH5A 2P95A 1C2KA 5DG6A 2SFAA 1C4U2 4I31A 3KCGH 1HPGA 1V2TT 1O2HA 2XBVA 1BDAA 2NU0E 3S9CA 3TJOA 2WPJS 6CHAC 4OS6A 4X2XA 2BY8X 2WYGA 1GBFA 3GOVB 1Q2WA 1AE8H 1OOKB 3QO6A 2F9UA 1D6WA 1AVWA 2Z9GA 1C2EA 3PWCA 2VVUA 2WPIS 1SGYE 4VGCC 2ZGBH 3OSYA 1W8BH 3KEEA 4O3TA 1LTOA 1A61H 1THPB 1ZYOA 1QJ7B 2ZHEH 2M5TA 1K28D 3ZZ8A 3P95A 1O3NA 4CBNA 1O3LA 2BVSH 4X1SU 1O5AB 4YTAA 1GCTB 2BX3A 1D3TB 1P10A 1AI8H 2BD8A 2O8UA 1Z8RA 5FHTA 3A88A 1CSOE 3T29A 2EI8A 2BD5A 2G8TA 1NC6A 2Z9KA 4JK5A 1HLTH 1MTNB 3CS0A 4YOIA 3OY6U 3PM3A 3C1KA 1GHZA 5DP3A 3RXKA 5JPMH 1EJMA 1OWEA 3VFEA 2ZTYA 5J4SA 2Z7FE 1FIZA 5T6FA 1RS0A 3GY5A 1TE0A 2Q6DA 5F6MA 1FY3A 2H5CA 2Y5GA 1SFQB 4SGBE 2ULLA 4JZDH 4X1PU 3K65B 3SJ8A 1ESBA 1W13U 1P57B 2AGIX 1CA0B 4D7FA 1KTTB 4I8LA 3ZZ3A 2ODYB 1PYTC 3UREA 1C1PA 2GCTB 4DGJA 3S0NA 2BDYA 2F3CE 4Z0KA 3SHAH 4R8TB 1AD8H 1C1UH 1DFPA 3DFJA 3PO1B 1XM1A 2ZO3H 2F9OA 3ZYEA 4Q7XA 5HXFA 1DWEH 3RP2A 4NCYA 3M5NA 2AIPA 3U8OH 2R2MB 1F2SE 2GX4A 3S7HB 3SQHE 4RKJB 1S81A 5GIBA 1UCYK 3RXLA 2QXGA 4ZHAA 1CGIE 1SLVB 2FOFA 3RXSA 3VB6A 1HUTH 1C4V2 4E06H 2UUFB 1HB0B 2ZG0H 1P2OA 4CRBA 3M3VA 4HZHA 3SU2A 1S6HA 1RFNA 3ZZCA 3NZIA 2J34A 1HDTH 3O8CA 1C5TA 2FI5E 2ZECA 2F9NA 2F9BH 4BTTB 2ZWLH 3I29A 3UQOA 1BCUH 1C5MD 1S82A 2FS9A 3T26A 3KF2A 2EC9H 2VH6A 1SHHB 2YOLA 2VINA 5ESBA 5ETXA 1O2IA 2HALA 2UUJB 3ATLA 2IN2A 2ZC9H 4ZKRU 3UTUH 2VWLA 4B74A 3K6YA 1GDQA 4WJG2 1GHAG 3BF6H 3KQDA 3U1JB 2XWAA 3HK6B 3ELAH 2YNBA 1EASA 3RLYH 2JH5D 3CP7A 2BOHB 3RXDA 4B2AA 3DUXH 2G4TA 2UWOA 1GJAB 1P3CA 1EJNA 1SMFE 4A1VA 1V3XA 2VGCB 1A3BH 3A8BA 1YLCA 2GVFA 4NIXA 1O5DH 1DM4B 1PPCE 2RCEA 4BNRA 1C2MA 1YLDA 3SNEA 3ZZDA 1N1LA 3GCHC 3OYPA 1HAGE 1Z8IB 4X2YA 2BY9X 4K8YA 1BBRK 1Y3YA 1NROH 1QCPA 2SGDE 4NIYA 3RXRA 2JETC 2FMJA 3E90B 1DICA 1EPTA 1HFDA 1NZQH 2P8OC 3MO3A 3A8CA 4I8JA 1QFKH 3E16B 3MU0A 3MFJA 1C2DA 5DP7A 2FX6A 1X7AC 5AHGH 1UCYE 3AW1A 2R2WU 1GBJA 2OBQA 3U98H 1MAXA 1PQ5A 2VIQA 1PJPA 1TFXA 1GI3A 2FODA 3KGPA 1IQMA 4RKOB 5G4BA 4YO9A 3HKIB 1O2QA 1ANDA 1MCVA 3GCOA 1SHYA 3P8FA 1QURH 1F5LA 1Y5BT 3ENSB 5DPAA 2FDAA 3BG4C 1SVPA 5CE1A 4WMEA 1YYY1 3QTOH 1GBAA 4I33A 1TRMA 3F9HA 1BOQA 2HGTH 1XXFA 1UTJA 2WYJA 1ELDE 4A1TA 5L2YH 4Y7AA 2CF9H 2QN5T 2BY6X 2ZU4A 3ODFA 1V2LT 2CN0H 2VIWA 2QIQA 1TA2A 1FDPA 4WF8A 3BTGE 3T28A 3RXUA 2ZHWH 4GVUA 1J15A 3SI3H 1Z6JH 1V2KT 1QL8A 1Z8GA 1FZZA 4BXWA 3HPTB 1H4WA 4CHAB 1J17T 4D76A 1OWIA 2W3KA 1ZHRA 3URDA 1HYLA 1ZTLA 4O9VA 1O38A 2P3FH 4CH8B 3LGYA 4JZFH 2HRVA 2FLRH 2TGTA 5C5OA 3RUOA 1TOCB 1F92A 1KXBA 3HGPA 4DURA 1YC0A 2ILNA 3KQCA 1A5IA 1C5PA 1BBRE 1DUAA 1TLDA 3VXEH 1PPHE 1XMNB 4XBDA 2Z3EA 5A8XA 4JCNA 5DJ7A 1C5OH 3SU3A 1ORFA 1UTOA 4JZEH 1FJSA 2FZZA 3SNDA 6CHAB 3GY3A 1MBQA 1P12E 1AFEH 2OXSA 1ESAA 1K1PA 3M37A 4ABGA 2OP9A 1MH0A 1QRZA 4IMQA 4GHQA 2ZA5A 2BB4A 4FUBA 4J1YA 4JMYA 1PFXC 1IQFA 2G5VA 2ZQ2A 5DP5A 4VGCB 3UNQA 3RM2H 3SUDA 3ATIA 1CGHA 1GPZA 4A6LA 1EAXA 4IN1A 4AFQA 2WINI 3UWIA 4INHA 5C1YA 1S6FA 2ODPA 1K1MA 2Q6GA 3FP7E 4O97A 1UVUH 1LHGH 2ZFRH 1JWTA 2WPHS 1O32A 2R3YA 4KELA 5A09A 3D23A 3MH6A 1A0HB 1CT4E 1GHAF 1CU1A 1WQVH 1AUTC 2PFEA 3MNBA 3TK6A 1LPGB 3URCA 3SV6A 1SOZA 3LGWA 5FCRA 4DCDA 2B0FA 3LU9B 3RXOA 5LPFA 1INCA 1UVPA 1JBUH 4J2YB 1ANEA 1G36A 4FUEA 1EX3A 5DGJA 5EPNA 3TH2H 2DE8A 1IQHA 3MU5A 2CV3A 1GJ5H 1DSUA 1NM6A 4H4FA 2GD4B 1P8VC 6GCHG 3LJJA 3E3TA 4KKDA 2R9PA 2ZPRA 3P8NA 1HJ8A 1GI7B 2PUXB 3PMHB 1NRNH 2XC0A 4Y7BA 2B7DH 1ZHMA 2NU4E 1OWDA 2OQUA 3ZZ6A 2UWPA 1SFIA 1C2FA 1GBDA 2BQ6B 1ANCA 2OC7A 1B0FA 2UUYA 4B73A 2ODQA 2QAAA 3RXJA 3LGUA 4DIHH 1O2VA 2ZFSA 4JYVH 1W2KH 1SLUB 4FUDA 1AIXH 1LVMA 3LPRA 5EU8A 4AYVB 1HIAA 2FOAA 3RXGA 1CHGA 1H9HE 1K1LA 3LGVA 1QL9A 1XUHA 3PLKA 1EXFA 3KQBA 2ALPA 4MLFB 2BY7X 4AB9A 8LPRA 4WVPE 2PLXA 4ZXYH 5EPYA 2ZZUH 2ESTE 4CR5A 1A1RA 2J94A 1KDQB 1TIOA 1OP2A 1JXPA 4JZ1A 1GVKB 4BAOB 2W7UA 1MKWH 1LVYA 1TBRH 1S84A 4F49A 1XX9A 1FAKH 2ZDKA 1MTWA 3UR6A 1EUFA 2A1DB 4ZHMU 4A7IB 3RXQA 4HTCH 3TLOA 4Y0YE 4DW2U 4ZXXH 1OYQA 1K22H 1O3EA 1DOJA 4Y79A 1T4UH 1GVLA 4YZUA 2ZGXH 5H4IB 2SGFE 4HFPB 3LIWA 4Y71A 4ABAA 2A2QH 3RM0H 4X2WA 1GGDC 4YLQH 1YPHE 2R0LA 1TGBA 5E2OA 1SPJA 1AN1E 4XBBA 1H1BA 1UTKA 1H9IE 2OC0A 5EXMA 1YCPK 2OC1A 2XW9A 1O5BB 2A7HA 3SU0A 2W3IA 1XUKA 4NWLA 2PR3A 4ISHH 4RSPA 3LH3A 3EA9A 1E37B 2BQWB 2SGPE 3L6PA 4AG2A 3LGTA 1G3CA 4MDSA 1O2GH 1C2GA 1IQKA 1K1NA 3A80A 1P2QA 3GCHB 5BRRE 4X8TH 1O2YA 5EQQA 3Q76A 1RTFB 1S5SA 1L1NA 4AFSA 1LHEH 3MOCA 4D8NA 1TPSA 1PQ8A 4DT7B 1QA7A 2QY0B 1KXDA 3E0NB 3FFGA 3PROA 2JETB 1V2OT 3UFAA 3BTFE 1BJUA 3TVJB 4WMFA 1MD7A 2BD7A 5E2PA 2GZ7A 2DUCA 1C2LA 3U9AH 3MWIU 1RTLA 4O03A 1S0RA 1WTHD 1UVSH 4NG9H 4ZUHA 2NU2E 2ZU2A 4Q80A 4XOJA 3RC6A 3SJIA 3RMMH 1GMCG 3QGNB 4AFZA 7GCHG 1EATA 4JYUH 4Q2KA 2ZCKP 1P0SH 1D9IA 1WOFA 2C8ZB 5FBIA 1TPAE 1T32A 5LPRA 1DX5M 1BTWA 1UTPA 2VIOA 5E0GA 2HLCA 3AASA 3KQEA 1UVOA 5HM9A 2BY5X 4MNYA 3RLWH 1FI8A 3BG4B 1K9OE 1VCQA 4CRAA 2Z94A 3T62A 2ZGHA 4JZIA 5FBEA 4D9QA 3TNTA 1BMLA 1PQ7A 4BTIB 2FLBH 2H9TH 2Z9LA 4IC6A 1TGSZ 6GCHF 1IQEA 1G30B 1TBQH 3T27A 1J9CH 2CHAC 1OXGA 2F9VA 2IJOB 2I6QA 2C3SA 1IQLA 3I77A 5AFZH 3RMLH 3EGKH 1ZPBA 2BOKA 1S0QA 4FVDA 1PQAA 1QNJA 1YPMH 1UTMA 2GV6A 1A4WH 1V2QT 4YOJA 1O39A 1BMAA 3SO3A 2FTMA 2OINA 2VWNA 1IQIA 4Y8ZA 1HJ9A 1EAUA 2ZTZA 1C9TA 4DY7B 4WY3A 1SL3A 4FU9A 4K8BA 1QJ1B 1J14A 2XRCA 3V0XA 2BD9A 2FTLE 5L6NH 1QIXB 5JB8S 3F9FA 1XKAC 1AY6H 2IPHA 1TYNA 1O37A 2FI3E 1S83A 1G2MA 4U32A 3ZVAA 2VU8E 4X1NU 4A92A 1KSNA 4WXVA 1C1TA 1FNIA 1V2MT 2FEQH 1Q3XA 2XBYA 1W0ZU 1AHTH 1DVAH 1T8NA 1ELTA 1O2SA 3V3MA 1V2ST 1ZRKA 2P94A 5F03A 1NRQH 1TGTA 2IOTA 1O5FH 1FMGA 3Q00A 1EQ9A 2O8WA 1CE5A 1VZQH 3RXBA 3UNRA 4YESB 3TGKE 1OS8A 1TPOA 2P16A 1L1GA 1WCZA 1OP8A 4A1XA 1P09A 3FVFB 5DP6A 2BYAX 3NPSA 1GBLA 1O35A 5DP8A 2QF3A 7LPRA 3RU4E 3SU4A 3ZVDA 3CS7A 2JH6D 4IMZA 4NA8A 2AH4X 1O2RA 4H6SB 2BTCE 4ABJA 2FI4E 2QCYA 2F9PA 2YNAA 1TALA 2PHBA 1C1WH 1SGFG 1QHRB 3TGIE 4CBOA 2BDBA 4BANB 1SGDE 2F91A 1HGTH 1SBWA 3T5FH 3FP8E 1EOJA 2ZU5A 2WV4A 2D2DA 1ZGIA 8ESTE 3RC5A 3TIUA 2RG3A 1H9LB 4TWWA 3FANA 1FV9A 1C5YB 2OUAA 1TNJA 5FPTA 1ETTH 1SQOA 1T8MA 4NA9H 3GDVA 4INKA 1UK2A 5T3HA 3ATMA 2ZFFH 3MU8A 2GGVB 5GJ4B 1N8OC 1P2NA 5DKMA 1LHCH 4ZH8A 4A5TS 3G01A 1IOEA 1YF4A 4MG3A 4JYTA 1AWHB 1MTUA 5E0JA 5ABWA 1AGJA 2ZEBA 4OS4A 3PB1E 3F1SB 1O3BA 2ZDAH 1GMCF 4LZ1H 7GCHF 3QN7A 2OC8A 4BOHA 1NPMA 1VITG 1OYTH 3O8RA 2OCVB 1DY9A 1MD8A 2G5NA 3A87A 3LC5A 4WWYA 2Z9IA 2KAIB 1W12U 3F9EA 1C5XB 3D62A 1A3EH 3L3TA 1JIMA 3RXVA 2B5TB 1BRUP 2O8LA 1V2UT 1F5RA 3TU7H 2FOEA 4D9RA 3M7QA 4D7GA 1NFWA 2ZF0H 4KGAA 5GCHG 2ZP0H 1HAZB 4AG1A 1QBNA 1YKTA 1L4DA 4UEHH 1P02A 1EB2A 1D3DB 5JDUB 2GMTC 3O8BA 2PV9B 1P03A 5T6GA 2FPZA 1ZLRA 3PMJA 1EZSC 1C5RA 2ZHDA 5LH8A 3M5OA 3ESTA 1K1IA 1Z7KA 1GGDB 1GVZA 1BRAA 1FY1A 2UUKB 1JMOH 2C90B 1HAYB 2A4GA 3SGBE 4THNH 2VVVA 1O2UA 1F0TA 2A7JA 1EJAA 3IWMA 2A4RA 4XSKU 3FAOA 1OX1A 5JBCS 1GG6C 2FO9A 1ACBE 2GDEH 1DWCH 5DP4A 3U69H 1AZ8A 4GCHG 1C1SA 3SV9A 4NZQA 2Y7XA 1OSSA 3M3TA 1EZQA 1ETSH 4DG4A 1OWHA 4AN7A 3V7TA 2BLVA 4Q7YA 1W7XH 3JZ2B 4H6TA 4QT8C 4GAWA 3MU4A 4DVAU 1LMWB 4FUJA 2ZKSA 2PKSC 3BTKE 3ATWA 1MU8B 3HATH 4MVNA 2HNTE 3GDSA 1YPHC 3A7VA 4K2YA 4ABFA 4R0IA 1E0FD 2HOBA 1QBVH 4IN2A 4NFFA 4U30A 1U6QA 1ID5H 1KIGH 4TY6A 3VB4A 1TA6A 3SUFA 5LGOA 3LONA 4K3JA 1C2JA 3SU5A 1BHXB 1BTUA 4DIIH 5LPEA 2JKHA 3QGJA 1BB0B 1PPGE 1O3IA 3TJNA 1MKXK 4FXGH 1HXFH 1XVMA 3Q77A 2ZCHP 1PPEE 2LNCA 1GI2A 4GPGA 4ESTE 1ZSJA 3HKJB 2NWNA 3DFLA 3N7OA 1W10U 1W3CA 3PMBB 3SGQE 1GBIA 1MTSA 1NRPH 5HMAA 1IQNA 1GMDG 1ELAA 4X1QU 3E1XB 1P01A 3A7TA 1G32B 2VB0A 3OU0A 1O3DA 2FM2A 2G4UA 5BPEA 4ZKSU 1GI5A 2AS9A 3SNCA 2CHAB 5K0HA 5IYTA 1O2NA 2Q6FA 1P9UA 1OKXA 4TYDA 1V2JT 3NK8A 1O2XA 1SOTA 4NIWA 3Q3KA 1O2LA 4WMDA 2HPQH 3BTWE 3V13A 3UOUA 1CBWC 3W94A 1ZZZA 2WV5A 3Q3XA 1O2OA 5C5NA 2BXTH 1VJ9U 1BA8B
chains in the Genus database with same CATH superfamily
1DE7H 1DLKB 2BDAA 4X6NA 3A82A 1AB9C 2CJIA 4Y8YA 1AUJA 1HAHH 2FYQA 3PLPA 3SZNA 1YPEH 2KCOA 1GJ9B 2ZGCA 2TPIZ 2ZDNA 1B0EA 2WPMS 1A0LA 2FS8A 4NSYA 5C17A 4FVBA 2BLQA 3RXPA 2OBOA 2EI6A 3VB3A 1O2ZA 2HPPH 2SNWA 3A8AA 2GP9B 1RRKA 1JRTA 1W0JD 1C1OA 3R3GB 4I8HA 4UE7H 2G81E 3BTEE 2ZU3A 5EJLA 4AZ2B 1F7ZA 1FQ3A 5EW2H 2UWLA 5GCHF 1PPFE 3K2UA 1K2I1 1UMAH 3MHWU 1ZPZA 1L4ZA 3P92A 3CENA 1ELGA 4Q4LA 1LDTT 1GJ6A 2BZAA 2FWWA 5F8ZA 1BIOA 1VCPA 3E0PB 4INLA 4FUCA 1GDNA 1KDQA 3SNAA 1EKBB 5A0AE 2FP7B 1BZXE 1IQGA 3JZ1B 3ZZ9A 1DT2A 4B1TA 1AFQC 3MU1A 1O5EH 4F4OC 1NESE 1MMJN 4ABEA 3BTTE 2G00A 1YPKH 1EP6A 2GZ8A 2CF8H 2V6NA 1FIWA 3TPIZ 1NTPA 2ZPSA 1AVXA 5JBAS 3RC4A 1VGCC 2TGAA 1GCTC 3A86A 3QK1A 4NA7A 4OGXA 4X8UH 3VB5A 4ZKOU 2BLOA 4DOQA 1KLIH 1ZTJA 2STAE 1C5QA 3Q3YA 2K1QA 2W5EA 1RJXB 5HGGA 3GYMA 2QXJA 4O3UA 2GV7A 3ODDA 2DE9A 4Y8XA 1ANBA 1P9SA 1WAYB 1NN6A 3DHKH 1MUEB 3H09A 4NWKA 1BRBE 4GCHF 1HBTH 4X0WU 1BMMH 1PYTD 3ZZ4A 1HXEH 3T2NA 1DSTA 1NO9H 4AFUA 2AGGX 3M7TA 2FOBA 1O3PB 3F9GA 5HIZA 1CHOG 2PW8H 1F0SA 1GMHG 2XC5A 1XUJA 3MNSA 5I25A 2JJ2D 1GBBA 5GWZA 5AFYH 1C5SA 2OLGA 1OPHB 1AVGH 1N8OB 3F0PA 3UUZA 1CA0C 1WYKA 3UWJH 1Z6EA 1C5UA 1TMUH 3KQ5A 3M7UA 1YP9A 1UCYH 1OHHD 3GICB 1DANH 4KTSA 4DT4A 2GCTC 1P06A 2TBSA 2FYRA 3LC3A 3S9BA 1MCTA 5TCAA 4TPYA 3SZEA 3BIVH 2ZQ1A 3GY7A 3DSPA 2VWMA 1MZDA 1C1NA 3SHCH 1SGQE 1OWJA 3LGIA 1D3QB 4AGJA 1FN6A 3BTQE 1SI5H 2A7CA 1TAWA 2VIDA 1O0DH 3UPEA 3RXAA 3K6ZA 2JJ1D 1GWAA 5PTPA 1HAIH 1SGFA 1KXCA 3KIDU 2A32A 7KMEH 1Z1JA 5L30H 4Y76A 1AWFH 3KN2A 4CRFA 1O3GA 2C4FH 5EW1H 1ZJDA 5I46H 1GDUA 1UO6A 5EQRA 4ACAA 2ZIQH 1C5LH 1O2JA 1AE5A 1GMDF 5HIYA 1O30A 3LOXA 1B7XB 1GBHA 5KGOA 3H7OA 3GISB 4FU8A 2H9EH 1ARCA 1WSSH 3GCTG 4HI3A 4KP0A 1LQEA 2GMTB 3DCLA 3SUEA 1PPBH 3LT3A 4GUXA 3NKKA 3GYLB 5B6OA 4AB8A 2EY4C 1SGIB 3OE7D 4CRGA 3GCNA 3LH1A 1RD3B 1SGEE 4WH8A 3V12A 1A0JA 2W26A 5FAHA 3SORA 9ESTA 1ZTKA 3PWBA 1LPKB 2WUBA 1LHFH 4FUIA 2R3UA 3MNXA 3S7KB 3PTBA 1Y59T 2A0QB 2GDDA 1NRSH 3QUMP 3RU4D 1BBRH 1V6DA 1XXDA 2P93A 4ABHA 4KTCA 1UK4A 3ZYDA 4TY7A 1Y3WA 1GG6B 1CT2E 4GHTA 3BTHE 5E0HA 3TK5A 1V2WT 1GHXH 1T7CA 1AQ7A 1QGFA 4X6MA 4BAQB 4I32A 2Z9JA 1TRNA 4X2VA 4X6PA 2BHGA 1K1OA 3RU4T 4CREA 1KXAA 4GSOA 2P8OB 1QB6A 2XCFA 1Y3VA 2PKSB 3GY4A 1UTQA 3SJOA 5GDSH 1E36B 3SNBA 1ZGVA 5FX5A 3E8LA 5A8ZA 1HAVB 2WPKS 2ZNKH 1TBZH 3W95A 1LPZB 3A85A 2H6MA 1SGCA 1GHYH 1CGJE 1K21H 3F0OA 4P02A 2BX4A 4AC9A 5J4QA 1ABIH 2XNIA 5EOKA 1BT7A 5JYIA 1QB1A 3ATKA 5E8EH 3BV9B 3RDZA 5FL7D 3WY8A 1EP5A 2H2ZA 1BHXF 3DT0H 2A5IA 2M2AA 2THFB 1SQTA 1N6XA 1QB9A 1O3OA 3M3SA 1P11E 2AIQA 1UJ1A 1GJ4H 1ZHPA 3PV4A 3RXMA 2QA9E 1HAXB 1C1RA 1O3AA 1TX7A 3H7TA 1SLWB 2HNTC 3MYWA 2WSSD 3IG6B 3TNSA 3SI4H 3A7XA 2FOGA 1RIWC 4E7RG 2QV1A 3EE7A 3N99A 1DITH 4ISLA 2A5AA 3SUGA 1C5ZB 1GHBG 2PGQB 2BVXH 2PGBB 2SGEE 1CHOF 1QRXA 3VB7A 3AW0A 3N7EA 2FESH 3ZZ5A 3STJA 2XYAA 1MQ6A 2SGQE 1EZXC 1FPCH 3A8DA 1EFRD 3QX5H 1BITA 2ZPQA 3A7WA 2K0QA 3EQ0H 3SV2H 1UHBA 2PKAB 2P59A 3OY5U 4ZROA 2Y7ZA 5CHBA 3ZVFA 1G9IE 1LHDH 1HRTH 1FY4A 5EODA 4U01A 4UFFH 2SNVA 2XCNA 1IHTH 1LKAA 1O34A 3QZRA 3HGNA 3SU1A 1UK3A 1NS3A 2PTNA 2BLWA 3VGCC 1EPTC 2XBWA 1KY9A 4XFQA 4UFGH 1O31A 1QA0A 1J8AA 2Z6BD 1UTNA 2KAIA 4ISIH 1Q31A 4E05H 2GT8A 2R0KA 2VWOA 2XOKD 4CRCA 2QYIA 1AKSB 3UIRA 1BTYA 3BG8A 2V7QD 3UQVA 2J98B 1D4PB 1O5GH 1JOUB 1XUFA 3BN9A 3OTPA 1IHSH 3GCTF 8KME2 2HVYB 1Y5UT 5CHAC 5L2ZH 1TONA 5DO4H 1AMHA 1TX8A 2JDID 1TNIA 1FAXA 2Y6TA 1AFQB 4NFEA 3QDZB 2V0BA 1NU9A 5F8TA 2A2XH 3S69A 2WPLS 1FXYA 4BXSA 4K1SA 1VGCB 3B8JA 2TIOA 2P3UB 4ABDA 4M7GA 3BTME 2VH0A 2C8XB 3WWFA 1CT0E 1DS2E 4I8KA 2QF0A 1MQ5A 3E91A 1G3DA 1UW7A 4NZLA 5TJXA 1H8IH 1L2EA 3ZZAA 2V3MA 3TJVA 1L1JA 1SLXB 2Y80A 3M35A 3PRDA 4IC5A 2F43B 3TH4H 1BRCE 1SGNE 1A5GH 4E7NA 8GCHG 1LVOA 3D65E 4UONA 1GBMA 2O9QA 4B2CA 1UHBB 5A0BA 3B23B 1QQUA 1TWXB 2L6OA 1O3KA 2ANWA 2VVCA 3FO8D 1TNKA 1YGCH 1P2JA 4FUFA 1WQSA 1O2WA 2CMYA 3DA9B 1P2MA 1E38B 4X1RU 5HYOA 4MPUA 4RI0A 2RA0A 3KHVA 2BDHA 2G55A 2FIRH 1W14U 1GL0E 3EA7A 4WXIA 1O5CB 3DD2H 3UAIC 1THRH 1C5WB 1ELBA 3M36A 1TABE 1ZMNA 4YT6H 3AAVA 4DJZB 5C1XA 1IAUA 2QXIA 1QZ8A 3E6PH 5HM2A 1DXWA 1VITH 4K1TA 4K5ZA 3ITIA 4HG6A 2H5DA 5AF9H 4B6EA 1E35B 1LQDB 3TGJE 3PTNA 5F8XA 2GCHG 3AVZA 1UVTH 1B5GH 3UNSA 1ZPCA 3M5LA 2ZI2H 3ZVBA 1G2LA 4ASHA 4YLUA 1LKBA 3B9FH 1FLEE 2J95A 2PSYA 1GJ7B 4BAMB 2J92A 3D49H 2FX4A 3TH3H 1GHBF 4B76A 1K0HA 3ZVEA 3QLPH 2Q1JA 2FOCA 5GNDA 1YCPH 1QTFA 2J5UA 5C67A 6LPRA 1E34B 1QJ6B 3QTVH 2RA3A 1W7GH 2XWBI 1V2RT 1MAYA 4LOYH 1DWBH 1MKWK 5AVDA 1FY8E 7ESTE 1DDJA 4FUHA 1SB1H 3STIA 2AYWA 3A7YA 2IPQX 1Y5AT 4OS2A 1ABJH 5A0CA 1A5HA 1DXPA 5EGMA 1Z1IA 1E1QD 3H5CB 3U8RH 3SGAE 1D6RA 4YM9A 1QL7A 1TMTH 5FX6A 3MI4A 3GY8A 2P3TB 1BJVA 1KXFA 1HJAC 2J2UA 2Y5HA 2EA3A 3SQEE 2BVRH 4ZMAH 3LDXH 3FZZA 4TWYA 1SKYE 3TK9A 1QQ4A 1ZOMA 1ZMJA 2AFQB 3U1IB 1T8LA 1LCYA 2ZU1A 1AZZA 1OWKA 3UOPA 1CA8B 4UD9H 1GI4A 1NFUA 5A2MH 2ZDVH 4UFEH 4IBLH 1A7SA 3SV8A 1FONA 1THSH 4YXWD 3OAAD 1TB6H 2BM2A 5DK1A 3RXHA 2QC2A 1V2VT 1C5VA 2BMGB 1NFYA 1D3PB 1O2KA 3I78A 1TMBH 2JIZD 3F2HA 3LKWA 4CR9A 1HAOH 2TRMA 1XUGA 1M9UA 1YBWA 1ZSLA 2A31A 2PWXA 4IW4E 4LK4A 1LO6A 3LJOA 3P8GA 1IQJA 1RGQA 2VNTA 3ZV9A 5C0TA 1CO7E 3CNRA 1ESTA 3EAJA 2C8WB 4MPVA 1SG8B 2BD2A 2QGRA 1O2PA 1BTZA 1SGRE 5KEDA 2Y5FA 3AAUA 1RIWB 8GCHF 1SSXA 1ETRH 1MU6B 4MQAA 2XXLA 4RT1A 2A5KA 1C4Y2 1O3HA 4JK6A 3IITA 4BAHB 3SU6A 1KLTA 2ZGJA 2OQ5A 3SW2B 1CQQA 4K1EA 5FPSA 1DLEA 2PUQH 5IDKA 1C9PA 4H42U 2I6SA 1Y8TA 2GT7A 1BTPA 5FPYA 2K8IA 1DUEA 2AEIH 3F6UH 4MTBA 1VITF 4ZHLU 3NWUA 4RN6A 4NSVA 1A46H 1NU7B 3SOSA 3ZZBA 2XBXA 9LPRA 2O8TA 3PMAB 1YPJH 3EDXB 1N6YA 1TX6A 4XE4A 1BUIA 3FN8A 3TITA 4ISOA 1ZSKA 4AGKA 4MNXA 1GBEA 3F3BA 1S85A 4X8VH 3VGCB 1EPTB 2HVXA 1QRWA 4B2BA 2HWLB 1XKBC 5KECA 2B9LA 2XTTB 1GI0A 1HCGA 1SQAA 3P8OA 2GCHF 4AX9H 2KCYA 5K7RA 1MTVA 2QF5A 3NXPA 5EQSA 1WBGB 1BTXA 4IS5A 4AYYB 4BTUB 4WH6A 3MMGA 5A8YA 2PSXA 4CRDA 3MNCA 3OTJE 4TPIZ 3R0FA 1JIRA 2FXRA 3ZV8A 4I7YH 1F5KU 2H9HA 1L0ZA 4XBCA 4XDEA 2C8YB 2ZFQH 3MH4A 4IGDA 1RTKA 5CHAB 1WTGH 3NUMA 4K69A 2AGEX 3HK3B 1GBTA 1TQ7B 4AOQA 3TJUA 2ZFTA 3K9XB 4MNVA 2LP6A 2D1JA 2FOMB 1WV7H 2Z3CA 3OX7U 1SC8U 3VG8A 2CGAA 4LZ4B 1ZR0A 1FPHH 1MTNC 1LVBA 3GY6A 1VCWA 4ABBA 2STBE 2XC4A 1XUIA 5JBTA 3EE0B 2VIVA 2CXVA 1H8DH 2WPDD 4AORA 1VJAU 2ZFPH 3PLBA 1C1MA 3BEUA 3ZVCA 1TNGA 1ZJKA 4Q7ZA 1QY6A 3A84A 1TNLA 4Y6DA 5TCCA 5SGAE 1K1JA 2A45B 1C2IA 3MH7A 2C93B 1F0RA 3RMOH 3FP6E 2A4QA 3RXEA 3U8TH 2ZHQH 3VEQB 1FY5A 1UTLM 1Z8JB 2G52A 2TGPZ 3F68H 1G37A 5JB9S 3S9AA 1GI8B 2WUCA 4GLYA 5C3NA 1O36A 1TPPA 1O33A 1GJBB 2HLDD 3M61U 1YPLH 1O3MA 4UDWH 4HGCA 1O3CA 2EEKA 3SJKA 2W7SA 1KTSB 2TGDA 1EOLA 1EAWA 3PV2A 1O3JA 3RMNH 3PO1C 4MPWA 3ZVGA 4OS1A 4Z6AH 4MNWA 1FN8A 3RXIA 1W0YH 1Y3UA 1YM0A 2BDCA 1GHWH 4K60A 1HAPH 1TRYA 2GKVE 1QR3E 2GTBA 1HAVA 1AO5A 2EI7A 2VJ1A 3PRBA 2J97A 1Z71A 3A83A 1DY8A 2H1UA 3GY2A 5ESTE 2AMDA 3BEIB 3EA8A 2J4IA 1ZMLA 2BXUH 2AMQA 1C1QA 3MTYA 2LPRA 4ZKNU 2GZ9A 1OP0A 1VKYA 4FETA 4Y0ZE 5CMXH 1KLJH 2JH0D 5EXLA 3EYDA 5GXPA 1KYNA 5C1UA 3KYFA 4LXBH 2ZTXA 3ZZ7A 1EB1H 4NGAH 2AERH 1GCDA 3BIUH 4ZAEA 3GDUA 1KXEA 3VPKA 4OS5A 3RXTA 3A89A 3NCLA 4ISNA 3UB0A 1V2NT 1C2HA 3SJ9A 2ZCLP 3BSQA 1TGCA 1VR1H 2ANKH 3P70B 1P05A 2Y82A 2OD3B 3P6ZB 1A2CH 1Y3XA 5EIYA 3L33A 5C2ZA 1NY22 2ZDMA 3KNXA 1DPOA 3MO6A 1SR5C 2BDIA 2D8WA 2V35A 3MO9A 1BTHH 2VGCC 4Y11E 1NFXA 2PKAA 1NT1A 1P2IA 1C1VH 4ZCNA 2OTVA 2ZHFH 1AU8A 1HV7A 2A4OA 4B75A 2ALVA 1CVWH 5C20A 3PYHA 5EXNA 5FXLA 3VXFH 1DWDH 1HNEE 2B8OH 1J16A 1HJAB 3M5MA 2BD3A 4X6OA 6ESTA 1F0UA 1GI9B 1MBMA 1O3FA 3DSOA 1G3BA 1GJCB 3RXFA 3P17H 1WU1A 1QBOA 3BEFB 2VIPA 1ARBA 3SN8A 3SV7A 4NIVA 5GPIB 4SGAE 3SBKA 3T25A 1C5NH 3KL6A 1HIAB 1W11U 1GBKA 1ZRBA 3UR9A 4B71A 1ELEE 1AKSA 2D26C 1MKXH 4X8SH 2J98A 2EQNA 5FCKA 4UFDH 1GBCA 2Z3DA 4CH2B 2ANYA 1MZAA 2FOHA 2V3HH 4KTUA 1TGNA 1GJ8B 3O8DA 2NU3E 1P04A 2BD4A 5T6DA 1T31A 4YT7H 4BAKB 2Y81A 2NU1E 2ZDLA 1NRRH 3AK5A 4Y10E 2F83A 4FU7A 3A81A 2QXHA 2WZQA 4ASUD 1P2KA 2J38A 2PP6A 4ABIA 2QF4A 1EZUC 1YCPM 2PTCE 2J9NA 2V3OH 2BQ7B 1E1RD 2O8MA 1ELVA 1GJDB 4OS7A 5JBBS 3BTDE 4U2WA 1XVOA 4I8GA 2HNTF 1H8ED 1GI1A 1T4VH 1TOMH 1O2TA 2SGAA 1GMHF 2ASUB 3OEED 3FZDA 1GL1A 3GS9A 1SGPE 1T8OA 1O2MA 3QWCH 1SGTA 1P3EA 1WUNH 4TSFD 3C27B 4FUGA 2AMPA 1YPGH 1JRSA 1CBWB 2G51A 5DP9A 1BQYA 1TQ0B 2ANMH 4MPXA 1TNHA 4CHAC 1AB9B 1GI6A 2BZ6H 1FUJA 2RDLA 4YOGA 1G3EA 3QZQA 1PPZA 2BDGA 1V2PT 3A7ZA 1EAIA 1ELFA 1BMNH 3UY9A 3RXCA 5EG4A 4PROA 1GHVH 4OGYA 1ELCA 1RXPA 3MH5A 2P95A 1C2KA 5DG6A 2SFAA 1C4U2 4I31A 3KCGH 3WWBA 1HPGA 1V2TT 1O2HA 2XBVA 1BDAA 2NU0E 3S9CA 3TJOA 2WPJS 6CHAC 4OS6A 4X2XA 2BY8X 2WYGA 2OK5A 1GBFA 3GOVB 1Q2WA 1AE8H 1OOKB 3QO6A 2F9UA 1D6WA 1AVWA 2Z9GA 1C2EA 3PWCA 2VVUA 1E79D 2WPIS 1SGYE 4VGCC 2ZGBH 3OSYA 1W8BH 3KEEA 4O3TA 1LTOA 1A61H 1THPB 1ZYOA 1QJ7B 2ZHEH 2M5TA 1K28D 3ZZ8A 3P95A 1O3NA 4CBNA 1O3LA 2BVSH 4X1SU 1O5AB 4YTAA 1GCTB 2BX3A 1D3TB 1P10A 1AI8H 2BD8A 2O8UA 1Z8RA 5FHTA 3A88A 1CSOE 3T29A 2EI8A 2BD5A 2G8TA 1NC6A 2Z9KA 4JK5A 4F48B 2LELA 1HLTH 1MTNB 3CS0A 4YOIA 3OY6U 3PM3A 3C1KA 1GHZA 5DP3A 3RXKA 5JPMH 1EJMA 1OWEA 3VFEA 2ZTYA 5J4SA 2Z7FE 1FIZA 5T6FA 1RS0A 1W0KD 2W6JD 3GY5A 1TE0A 2Q6DA 5F6MA 1FY3A 2H5CA 2Y5GA 1SFQB 4SGBE 2ULLA 4JZDH 4X1PU 3K65B 3SJ8A 1ESBA 1W13U 1P57B 2AGIX 1CA0B 4D7FA 1KTTB 4I8LA 3ZZ3A 2ODYB 1PYTC 3UREA 5HKKD 1C1PA 2XNDD 2GCTB 4DGJA 3S0NA 2BDYA 2F3CE 4Z0KA 3SHAH 4R8TB 1AD8H 1C1UH 1DFPA 3DFJA 3PO1B 1XM1A 2ZO3H 4OM9A 2F9OA 3ZYEA 4Q7XA 5HXFA 1DWEH 3RP2A 4NCYA 3M5NA 2AIPA 3U8OH 2R2MB 1F2SE 2GX4A 3S7HB 3SQHE 4RKJB 1S81A 5GIBA 1UCYK 3RXLA 5IK2D 2QXGA 4ZHAA 1CGIE 1SLVB 2FOFA 3RXSA 3VB6A 1HUTH 1C4V2 4E06H 2UUFB 1HB0B 2ZG0H 1P2OA 4CRBA 3M3VA 4HZHA 3SU2A 1S6HA 1RFNA 4P00A 3ZZCA 3NZIA 2J34A 1HDTH 3O8CA 1C5TA 2FI5E 2ZECA 2F9NA 2F9BH 4BTTB 3F2GA 2ZWLH 3I29A 3UQOA 1BCUH 1C5MD 1S82A 2FS9A 3T26A 3KF2A 2EC9H 2VH6A 1SHHB 2YOLA 2VINA 5ESBA 5ETXA 1O2IA 2HALA 2UUJB 3ATLA 2IN2A 2ZC9H 4ZKRU 3UTUH 2VWLA 2F4LA 4B74A 3K6YA 1GDQA 4WJG2 1GHAG 3BF6H 3KQDA 3U1JB 2XWAA 3HK6B 3ELAH 2YNBA 1EASA 3RLYH 2JH5D 3CP7A 2BOHB 3RXDA 4B2AA 3DUXH 2G4TA 2UWOA 1GJAB 1P3CA 1EJNA 1SMFE 4A1VA 1V3XA 2VGCB 1A3BH 3A8BA 1YLCA 2GVFA 3OFND 1O5DH 1DM4B 1PPCE 2RCEA 4NIXA 4TT3D 4BNRA 1C2MA 1YLDA 3SNEA 3ZZDA 1N1LA 3GCHC 3OYPA 1HAGE 1Z8IB 4X2YA 2BY9X 4K8YA 1BBRK 1Y3YA 1NROH 1QCPA 2SGDE 4NIYA 3RXRA 2JETC 4XRNA 2FMJA 3E90B 1DICA 1EPTA 1HFDA 1NZQH 2P8OC 3MO3A 3A8CA 4I8JA 1QFKH 3E16B 3MU0A 3MFJA 1C2DA 5DP7A 2FX6A 1X7AC 5AHGH 1UCYE 3AW1A 2R2WU 1GBJA 2OBQA 3U98H 1MAXA 1PQ5A 2VIQA 1PJPA 1TFXA 1GI3A 2FODA 3KGPA 1IQMA 4RKOB 5G4BA 4YO9A 3HKIB 1O2QA 1ANDA 1MCVA 3GCOA 1SHYA 1FX0B 3P8FA 4M9FA 1QURH 1F5LA 1Y5BT 3ENSB 5DPAA 2FDAA 3BG4C 1SVPA 5CE1A 4WMEA 1YYY1 3QTOH 1GBAA 4I33A 1TRMA 3F9HA 1BOQA 2RDEA 2HGTH 1XXFA 1UTJA 2WYJA 1ELDE 4A1TA 5L2YH 4Y7AA 1MABB 2CF9H 1BMFD 2QN5T 2BY6X 2ZU4A 3ODFA 1V2LT 2CN0H 2VIWA 2QIQA 1TA2A 1FDPA 3ZIAD 4WF8A 3BTGE 3T28A 3RXUA 2ZHWH 4GVUA 1J15A 2YMSC 3SI3H 1Z6JH 1V2KT 1QL8A 1Z8GA 1FZZA 4BXWA 3HPTB 1H4WA 4CHAB 1J17T 5DSFA 1OWIA 2W3KA 4D76A 1ZHRA 3URDA 3OEHD 1HYLA 1ZTLA 4O9VA 1O38A 2P3FH 4CH8B 3LGYA 4JZFH 2HRVA 2FLRH 2TGTA 5C5OA 3RUOA 1TOCB 1F92A 1KXBA 3HGPA 4DURA 1YC0A 2ILNA 1H8HD 3KQCA 1A5IA 1C5PA 1BBRE 1DUAA 1TLDA 3VXEH 1PPHE 1XMNB 3F2FA 3NRLA 3U28C 4XBDA 2Z3EA 5A8XA 4JCNA 5DJ7A 1C5OH 3SU3A 1ORFA 1UTOA 4JZEH 1FJSA 2FZZA 3SNDA 6CHAB 3GY3A 1MBQA 3PV5A 1P12E 1AFEH 2OXSA 1ESAA 1K1PA 3M37A 4ABGA 2OP9A 1MH0A 1QRZA 4IMQA 4GHQA 2ZA5A 2BB4A 4FUBA 4J1YA 4JMYA 1PFXC 1IQFA 2G5VA 2ZQ2A 5DP5A 4VGCB 3UNQA 3RM2H 3SUDA 3ATIA 1CGHA 1GPZA 4A6LA 1EAXA 4IN1A 4AFQA 2WINI 3UWIA 4INHA 5C1YA 1S6FA 2KM0A 2ODPA 1K1MA 2Q6GA 3FP7E 4O97A 1UVUH 1LHGH 2ZFRH 1JWTA 2WPHS 1O32A 2R3YA 5C94A 4KELA 5A09A 3D23A 3MH6A 1A0HB 1CT4E 1GHAF 1CU1A 1WQVH 1AUTC 2PFEA 3MNBA 3TK6A 1LPGB 3URCA 3SV6A 1SOZA 3LGWA 5FCRA 4DCDA 2B0FA 3LU9B 3RXOA 5LPFA 1INCA 1UVPA 1JBUH 4J2YB 1ANEA 1G36A 4FUEA 1EX3A 5DGJA 5EPNA 3TH2H 1NBME 2DE8A 2YMSD 1IQHA 3MU5A 2CV3A 1GJ5H 1DSUA 1NM6A 4H4FA 2GD4B 1P8VC 6GCHG 1S6LA 3LJJA 3E3TA 4KKDA 2R9PA 2ZPRA 3P8NA 1HJ8A 1GI7B 2PUXB 3PMHB 1NRNH 2XC0A 4Y7BA 2B7DH 3FKSD 1ZHMA 2NU4E 1OWDA 2OQUA 3ZZ6A 2UWPA 1SFIA 1C2FA 1GBDA 2BQ6B 1ANCA 2OC7A 1B0FA 2KZ4A 2UUYA 4B73A 2ODQA 2QAAA 3RXJA 3LGUA 4DIHH 1O2VA 2ZFSA 2QE7D 4JYVH 1W2KH 1SLUB 4FUDA 1AIXH 1LVMA 3LPRA 5EU8A 4AYVB 1HIAA 2FOAA 3RXGA 1CHGA 1H9HE 1K1LA 3LGVA 1QL9A 1XUHA 3PLKA 1EXFA 3KQBA 2ALPA 4MLFB 2BY7X 4AB9A 8LPRA 4WVPE 2PLXA 3DSGA 4ZXYH 1WXRA 5EPYA 2ZZUH 2ESTE 4CR5A 1A1RA 2J94A 1KDQB 1TIOA 1OP2A 1JXPA 4JZ1A 1GVKB 4BAOB 2W7UA 1MKWH 1LVYA 1TBRH 1S84A 4F49A 1XX9A 1FAKH 2ZDKA 1MTWA 3UR6A 1EUFA 2A1DB 4ZHMU 4A7IB 3RXQA 4HTCH 3TLOA 4Y0YE 4DW2U 4ZXXH 1OYQA 1K22H 1O3EA 1DOJA 4Y79A 1T4UH 1GVLA 4YZUA 2ZGXH 3WW7A 5H4IB 2SGFE 4B6FA 4HFPB 3LIWA 4Y71A 4ABAA 2A2QH 3RM0H 4X2WA 1GGDC 4YLQH 1YPHE 2R0LA 1TGBA 5E2OA 1YWUA 3W1EA 1SPJA 1AN1E 4XBBA 1H1BA 2RFKC 1UTKA 1H9IE 2OC0A 5EXMA 1YCPK 2OC1A 2XW9A 1O5BB 2A7HA 3SU0A 2W3IA 1XUKA 4NWLA 2PR3A 4ISHH 4RSPA 3LH3A 1YY3A 3EA9A 1E37B 2BQWB 2SGPE 1SQRA 3L6PA 4AG2A 3LGTA 1G3CA 4Z1MD 4MDSA 1O2GH 1C2GA 1IQKA 5DN6D 1K1NA 3A80A 1P2QA 3GCHB 5BRRE 4X8TH 1O2YA 5EQQA 3Q76A 1RTFB 1S5SA 1L1NA 4AFSA 1LHEH 3MOCA 4D8NA 1TPSA 1PQ8A 4DT7B 1QA7A 2QY0B 1KXDA 3E0NB 3FFGA 3PROA 2JETB 2KR7A 1V2OT 3UFAA 3BTFE 1BJUA 3TVJB 4WMFA 1MD7A 2BD7A 5E2PA 2GZ7A 5B6LA 2DUCA 1C2LA 3U9AH 3MWIU 1RTLA 4O03A 1S0RA 1WTHD 1UVSH 4NG9H 4ZUHA 2KFWA 2NU2E 2ZU2A 4Q80A 4XOJA 3RC6A 3SJIA 3RMMH 1GMCG 3QGNB 4AFZA 7GCHG 1EATA 4JYUH 4Q2KA 2ZCKP 1P0SH 1D9IA 1WOFA 2C8ZB 5FBIA 1TPAE 1T32A 5LPRA 2WV9A 1DX5M 1BTWA 1UTPA 2VIOA 5E0GA 2HLCA 3AASA 3KQEA 1UVOA 5HM9A 2BY5X 4MNYA 3RLWH 1FI8A 3BG4B 1K9OE 2KCPA 1VCQA 4CRAA 2Z94A 3T62A 5EJZA 2ZGHA 4JZIA 5FBEA 5T1VA 4D9QA 3TNTA 1BMLA 1PQ7A 4BTIB 2FLBH 2H9TH 2Z9LA 4IC6A 1TGSZ 6GCHF 1IQEA 1G30B 1TBQH 3T27A 1J9CH 2CHAC 1OXGA 2F9VA 2IJOB 2I6QA 2C3SA 1IQLA 3I77A 5AFZH 3RMLH 3EGKH 1ZPBA 2BOKA 1S0QA 4FVDA 1PQAA 1QNJA 1YPMH 1UTMA 2GV6A 1A4WH 1V2QT 4YOJA 1O39A 2YMSB 1BMAA 3SO3A 2FTMA 2OINA 2VWNA 1IQIA 4Y8ZA 1HJ9A 1EAUA 2ZTZA 1C9TA 4DY7B 4WY3A 1SL3A 4FU9A 4K8BA 1QJ1B 1J14A 2XRCA 3V0XA 2BD9A 2FTLE 5L6NH 1QIXB 5JB8S 3F9FA 1XKAC 1AY6H 5CDFE 2IPHA 1TYNA 1O37A 2FI3E 1S83A 1G2MA 4U32A 3ZVAA 2VU8E 4X1NU 4A92A 1KSNA 4WXVA 1C1TA 1FNIA 1V2MT 2FEQH 1Q3XA 2XBYA 1W0ZU 1AHTH 1DVAH 1T8NA 1ELTA 1O2SA 3V3MA 1COWD 1V2ST 1ZRKA 2P94A 5F03A 1NRQH 1TGTA 2IOTA 1O5FH 1FMGA 3Q00A 1EQ9A 4FOUC 2O8WA 1CE5A 1VZQH 3RXBA 3UNRA 2W6ID 4YESB 3TGKE 1OS8A 1TPOA 2P16A 1L1GA 1WCZA 1OP8A 4A1XA 1P09A 3FVFB 5DP6A 2BYAX 1YLNA 1GBLA 1O35A 3NPSA 5DP8A 2QF3A 7LPRA 3RU4E 3SU4A 3ZVDA 3CS7A 1KMHB 2JH6D 4IMZA 4NA8A 2AH4X 1O2RA 4H6SB 2BTCE 4ABJA 2FI4E 2QCYA 2F9PA 2YNAA 1TALA 2PHBA 1C1WH 1SGFG 1QHRB 3TGIE 4CBOA 2BDBA 4BANB 1SGDE 2F91A 1HGTH 1SBWA 3T5FH 3FP8E 1EOJA 2ZU5A 2WV4A 2D2DA 1ZGIA 2L74A 8ESTE 3RC5A 3TIUA 2RG3A 1H9LB 4TWWA 2IJD1 3FANA 1FV9A 1C5YB 2OUAA 1TNJA 5FPTA 1ETTH 1SQOA 1T8MA 4NA9H 3GDVA 4INKA 1UK2A 5T3HA 3ATMA 2ZFFH 3MU8A 3MQKC 2GGVB 5GJ4B 1N8OC 1P2NA 5DKMA 1LHCH 4ZH8A 4A5TS 3G01A 1IOEA 1YF4A 4MG3A 4JYTA 1AWHB 1MTUA 5E0JA 5ABWA 1AGJA 2ZEBA 4OS4A 3PB1E 3F1SB 1O3BA 2ZDAH 1GMCF 4LZ1H 7GCHF 3QN7A 2OC8A 4BOHA 1NPMA 1VITG 1OYTH 3O8RA 2OCVB 1DY9A 2AHME 3KYGA 1MD8A 2G5NA 3A87A 3LC5A 4WWYA 2Z9IA 2KAIB 1W12U 3F9EA 1C5XB 3D62A 1WDIA 1A3EH 3L3TA 1JIMA 3RXVA 2B5TB 1BRUP 2VBCA 2O8LA 1V2UT 1F5RA 3TU7H 2FOEA 4D9RA 3M7QA 4D7GA 1NFWA 2ZF0H 4KGAA 2KX4A 5GCHG 2ZP0H 1HAZB 4AG1A 1QBNA 1YKTA 1L4DA 4UEHH 1P02A 2GJGA 1EB2A 1D3DB 5JDUB 2GMTC 3O8BA 2PV9B 1P03A 5T6GA 2FPZA 1ZLRA 3PMJA 1EZSC 1C5RA 2ZHDA 5LH8A 3M5OA 3ESTA 1K1IA 1Z7KA 5EJ1A 1GGDB 1GVZA 1BRAA 1FY1A 2UUKB 1JMOH 2C90B 1HAYB 2A4GA 3SGBE 4THNH 2VVVA 1O2UA 1F0TA 2A7JA 1EJAA 3IWMA 2A4RA 4XSKU 3FAOA 1OX1A 5JBCS 4F55A 1GG6C 4Q63A 2FO9A 1ACBE 2GDEH 1DWCH 5DP4A 3U69H 1AZ8A 4GCHG 1C1SA 3SV9A 4NZQA 2Y7XA 1OSSA 3M3TA 1EZQA 1ETSH 4DG4A 1OWHA 4AN7A 3V7TA 2BLVA 4Q7YA 1W7XH 3JZ2B 4H6TA 4I86A 1NBMD 4QT8C 4GAWA 5C0UA 3MU4A 4DVAU 1LMWB 4FUJA 2ZKSA 2PKSC 3BTKE 3ATWA 1MU8B 3HATH 4MVNA 2HNTE 3GDSA 1YPHC 3A7VA 4K2YA 4ABFA 4ACBA 4R0IA 1E0FD 2HOBA 1QBVH 4IN2A 4RT0A 4NFFA 3SYJA 4U30A 1U6QA 1ID5H 1KIGH 3N7DA 4TY6A 3VB4A 1TA6A 3SUFA 5LGOA 3LONA 4K3JA 1C2JA 3SU5A 1BHXB 1BTUA 4DIIH 5LPEA 2JKHA 3QGJA 1BB0B 1PPGE 1O3IA 3TJNA 1MKXK 2KCAA 4FXGH 1HXFH 1XVMA 3Q77A 2ZCHP 1PPEE 2LNCA 1GI2A 2WHXA 4GPGA 4ESTE 1ZSJA 3HKJB 2NWNA 3DFLA 3N7OA 1W10U 1W3CA 3PMBB 3SGQE 1GBIA 2CK3D 1MTSA 1NRPH 5HMAA 1IQNA 1GMDG 1ELAA 4X1QU 3E1XB 1P01A 3A7TA 3FOAA 5F53A 1G32B 2VB0A 3OU0A 1O3DA 2FM2A 2G4UA 5BPEA 4ZKSU 1GI5A 2AS9A 3SNCA 2CHAB 5K0HA 5IYTA 1O2NA 2Q6FA 1P9UA 1OKXA 4TYDA 1V2JT 3NK8A 1O2XA 1SOTA 4NIWA 3Q3KA 1O2LA 4WMDA 2HPQH 3BTWE 3V13A 3UOUA 1CBWC 3W94A 1ZZZA 4XD7D 2WV5A 3Q3XA 1O2OA 5C5NA 2BXTH 1VJ9U 1BA8B
chains in the Genus database with same CATH topology
1DE7H 1DLKB 2BDAA 4X6NA 3A82A 1AB9C 2CJIA 4Y8YA 1AUJA 1HAHH 2FYQA 3PLPA 3SZNA 1YPEH 1GJ9B 2ZGCA 2TPIZ 2ZDNA 1B0EA 2WPMS 1A0LA 2FS8A 4NSYA 4FVBA 2BLQA 3RXPA 2OBOA 2EI6A 3VB3A 1O2ZA 2HPPH 2SNWA 3A8AA 2GP9B 1RRKA 1JRTA 3R3GB 1C1OA 4I8HA 4UE7H 5EW2H 2G81E 3BTEE 2ZU3A 4AZ2B 1F7ZA 1FQ3A 2UWLA 5GCHF 1PPFE 3K2UA 1K2I1 1UMAH 3MHWU 1ZPZA 1L4ZA 3P92A 3CENA 1ELGA 1LDTT 1GJ6A 2BZAA 2FWWA 5F8ZA 1BIOA 1VCPA 3E0PB 4INLA 4FUCA 1GDNA 1KDQA 3SNAA 1EKBB 5A0AE 2FP7B 1BZXE 1IQGA 3JZ1B 3ZZ9A 1DT2A 4B1TA 1AFQC 3MU1A 1O5EH 4F4OC 1NESE 1MMJN 4ABEA 3BTTE 2G00A 1YPKH 1EP6A 2GZ8A 2CF8H 2V6NA 1FIWA 3TPIZ 1NTPA 2ZPSA 1AVXA 5JBAS 3RC4A 1VGCC 2TGAA 1GCTC 3A86A 3QK1A 4NA7A 4OGXA 4X8UH 3VB5A 4ZKOU 2BLOA 4DOQA 1KLIH 1ZTJA 2STAE 1C5QA 3Q3YA 2K1QA 2W5EA 1RJXB 5HGGA 3GYMA 2QXJA 4O3UA 2GV7A 3ODDA 2DE9A 4Y8XA 1ANBA 1P9SA 1WAYB 1NN6A 3DHKH 1MUEB 4NWKA 1BRBE 4GCHF 1HBTH 4X0WU 1BMMH 1PYTD 3ZZ4A 1HXEH 3T2NA 1DSTA 1NO9H 4AFUA 2AGGX 3M7TA 2FOBA 1O3PB 3F9GA 1CHOG 2PW8H 1F0SA 1GMHG 2XC5A 1XUJA 3MNSA 5I25A 1GBBA 5GWZA 5AFYH 1C5SA 2OLGA 1OPHB 1AVGH 1N8OB 3UUZA 1CA0C 1WYKA 3UWJH 1Z6EA 1C5UA 1TMUH 3M7UA 1YP9A 1UCYH 3GICB 1DANH 4KTSA 2GCTC 1P06A 2TBSA 2FYRA 3LC3A 3S9BA 1MCTA 5TCAA 4TPYA 3BIVH 2ZQ1A 3GY7A 2VWMA 1MZDA 1C1NA 3SHCH 1SGQE 1OWJA 3LGIA 1D3QB 4AGJA 1FN6A 3BTQE 1SI5H 2A7CA 1TAWA 2VIDA 1O0DH 3UPEA 3RXAA 3K6ZA 1GWAA 5PTPA 1HAIH 1SGFA 1KXCA 3KIDU 2A32A 7KMEH 1Z1JA 5L30H 4Y76A 1AWFH 3KN2A 4CRFA 1O3GA 2C4FH 5EW1H 1ZJDA 5I46H 1GDUA 1UO6A 5EQRA 2ZIQH 1C5LH 1O2JA 1AE5A 1GMDF 1O30A 3LOXA 1B7XB 1GBHA 3H7OA 3GISB 4FU8A 2H9EH 1ARCA 1WSSH 3GCTG 4HI3A 4KP0A 1LQEA 2GMTB 3SUEA 1PPBH 3LT3A 4GUXA 3NKKA 3GYLB 5B6OA 4AB8A 1SGIB 4CRGA 3GCNA 3LH1A 1RD3B 1SGEE 4WH8A 3V12A 1A0JA 2W26A 5FAHA 3SORA 9ESTA 1ZTKA 3PWBA 1LPKB 2WUBA 1LHFH 4FUIA 2R3UA 3MNXA 3S7KB 3PTBA 1Y59T 2A0QB 2GDDA 1NRSH 3QUMP 3RU4D 1BBRH 1V6DA 1XXDA 2P93A 4ABHA 4KTCA 1UK4A 3ZYDA 4TY7A 1Y3WA 1GG6B 1CT2E 4GHTA 3BTHE 5E0HA 3TK5A 1V2WT 1GHXH 1T7CA 1AQ7A 1QGFA 4X6MA 4BAQB 4I32A 2Z9JA 1TRNA 4X2VA 4X6PA 2BHGA 1K1OA 3RU4T 4CREA 1KXAA 4GSOA 2P8OB 1QB6A 2XCFA 1Y3VA 2PKSB 3GY4A 1UTQA 3SJOA 5GDSH 1E36B 3SNBA 1ZGVA 5FX5A 3E8LA 5A8ZA 1HAVB 2WPKS 2ZNKH 1TBZH 3W95A 1LPZB 3A85A 2H6MA 1SGCA 1GHYH 1CGJE 1K21H 2BX4A 5J4QA 1ABIH 2XNIA 5EOKA 1BT7A 5JYIA 1QB1A 3ATKA 5E8EH 3BV9B 3RDZA 3WY8A 1EP5A 2H2ZA 1BHXF 3DT0H 2A5IA 2THFB 1SQTA 1N6XA 1QB9A 1O3OA 3M3SA 1P11E 2AIQA 1UJ1A 1GJ4H 1ZHPA 3PV4A 3RXMA 2QA9E 1HAXB 1C1RA 1O3AA 1TX7A 3H7TA 1SLWB 2HNTC 3MYWA 3IG6B 3TNSA 3SI4H 3A7XA 2FOGA 1RIWC 4E7RG 2QV1A 1DITH 4ISLA 2A5AA 3SUGA 1C5ZB 1GHBG 2PGQB 2BVXH 2PGBB 2SGEE 1CHOF 1QRXA 3VB7A 3AW0A 2FESH 3ZZ5A 3STJA 2XYAA 1MQ6A 2SGQE 1EZXC 1FPCH 3A8DA 3QX5H 1BITA 2ZPQA 3A7WA 3EQ0H 3SV2H 1UHBA 2PKAB 2P59A 3OY5U 4ZROA 2Y7ZA 3ZVFA 1G9IE 1LHDH 1HRTH 1FY4A 5EODA 4U01A 4UFFH 2SNVA 2XCNA 1IHTH 1LKAA 1O34A 3QZRA 3HGNA 3SU1A 1UK3A 1NS3A 2PTNA 2BLWA 3VGCC 1EPTC 2XBWA 1KY9A 4XFQA 4UFGH 1O31A 1QA0A 1J8AA 2Z6BD 1UTNA 2KAIA 4ISIH 1Q31A 4E05H 2GT8A 2R0KA 2VWOA 4CRCA 2QYIA 1AKSB 3UIRA 1BTYA 3BG8A 3UQVA 1D4PB 1O5GH 1JOUB 1XUFA 3BN9A 1IHSH 3GCTF 8KME2 1Y5UT 5CHAC 5L2ZH 1TONA 5DO4H 1AMHA 1TX8A 1TNIA 1FAXA 2Y6TA 1AFQB 4NFEA 3QDZB 2V0BA 1NU9A 5F8TA 2A2XH 3S69A 2WPLS 1FXYA 4BXSA 4K1SA 1VGCB 3B8JA 2TIOA 2P3UB 4ABDA 4M7GA 3BTME 2VH0A 2C8XB 1CT0E 1DS2E 4I8KA 2QF0A 1MQ5A 3E91A 1G3DA 4NZLA 5TJXA 1H8IH 1L2EA 3ZZAA 3TJVA 1L1JA 1SLXB 2Y80A 3M35A 4IC5A 3TH4H 1BRCE 1SGNE 1A5GH 4E7NA 8GCHG 1LVOA 3D65E 4UONA 1GBMA 2O9QA 4B2CA 1UHBB 5A0BA 3B23B 1QQUA 1TWXB 1O3KA 2ANWA 2VVCA 1TNKA 1YGCH 1P2JA 4FUFA 1WQSA 1O2WA 2CMYA 3DA9B 1P2MA 1E38B 4X1RU 5HYOA 4MPUA 2RA0A 3KHVA 2BDHA 2G55A 2FIRH 1W14U 1GL0E 3EA7A 4WXIA 1O5CB 3DD2H 1THRH 1C5WB 1ELBA 3M36A 1TABE 1ZMNA 4YT6H 3AAVA 4DJZB 5C1XA 1IAUA 2QXIA 3E6PH 5HM2A 1DXWA 1VITH 4K1TA 4K5ZA 3ITIA 2H5DA 5AF9H 1E35B 1LQDB 3TGJE 3PTNA 5F8XA 2GCHG 3AVZA 1UVTH 1B5GH 3UNSA 1ZPCA 3M5LA 2ZI2H 3ZVBA 1G2LA 4ASHA 4YLUA 1LKBA 3B9FH 1FLEE 2J95A 2PSYA 1GJ7B 4BAMB 2J92A 3D49H 2FX4A 3TH3H 1GHBF 4B76A 3ZVEA 3QLPH 2Q1JA 2FOCA 1YCPH 1QTFA 5C67A 6LPRA 1E34B 1QJ6B 3QTVH 2RA3A 1W7GH 2XWBI 1V2RT 1MAYA 4LOYH 1DWBH 1MKWK 5AVDA 1FY8E 7ESTE 1DDJA 4FUHA 1SB1H 3STIA 2AYWA 3A7YA 1Y5AT 4OS2A 1ABJH 5A0CA 1A5HA 1DXPA 5EGMA 1Z1IA 3H5CB 3U8RH 3SGAE 1D6RA 4YM9A 1QL7A 1TMTH 5FX6A 3MI4A 3GY8A 2P3TB 1BJVA 1KXFA 1HJAC 2J2UA 2Y5HA 2EA3A 3SQEE 2BVRH 4ZMAH 3LDXH 3FZZA 4TWYA 3TK9A 1QQ4A 1ZOMA 1ZMJA 2AFQB 3U1IB 1T8LA 1LCYA 2ZU1A 1AZZA 1OWKA 3UOPA 1CA8B 4UD9H 1GI4A 1NFUA 5A2MH 2ZDVH 4UFEH 4IBLH 1A7SA 3SV8A 1FONA 1THSH 1TB6H 2BM2A 5DK1A 3RXHA 2QC2A 1V2VT 1C5VA 2BMGB 1NFYA 1D3PB 1O2KA 3I78A 1TMBH 4CR9A 3LKWA 1HAOH 2TRMA 1XUGA 1M9UA 1YBWA 1ZSLA 2A31A 2PWXA 4IW4E 4LK4A 1LO6A 3LJOA 3P8GA 1IQJA 1RGQA 2VNTA 3ZV9A 1CO7E 1ESTA 3EAJA 2C8WB 4MPVA 1SG8B 2BD2A 2QGRA 1O2PA 1BTZA 1SGRE 2Y5FA 3AAUA 1RIWB 8GCHF 1SSXA 1ETRH 1MU6B 4MQAA 2XXLA 2A5KA 1C4Y2 1O3HA 4JK6A 3IITA 4BAHB 3SU6A 1KLTA 2ZGJA 2OQ5A 3SW2B 1CQQA 4K1EA 5FPSA 1DLEA 2PUQH 5IDKA 1C9PA 4H42U 2I6SA 1Y8TA 2GT7A 1BTPA 5FPYA 1DUEA 2AEIH 3F6UH 4MTBA 1VITF 4ZHLU 3NWUA 4RN6A 4NSVA 1A46H 1NU7B 3SOSA 3ZZBA 2XBXA 9LPRA 2O8TA 3PMAB 1YPJH 3EDXB 1N6YA 1TX6A 4XE4A 1BUIA 3TITA 4ISOA 1ZSKA 4AGKA 4MNXA 1GBEA 1S85A 4X8VH 3VGCB 1EPTB 2HVXA 1QRWA 4B2BA 2HWLB 1XKBC 2B9LA 2XTTB 1GI0A 1HCGA 1SQAA 3P8OA 2GCHF 4AX9H 5K7RA 1MTVA 3NXPA 5EQSA 1WBGB 1BTXA 4IS5A 4AYYB 4BTUB 4WH6A 3MMGA 5A8YA 2PSXA 4CRDA 3MNCA 3OTJE 4TPIZ 3R0FA 1JIRA 2FXRA 3ZV8A 4I7YH 1F5KU 2H9HA 1L0ZA 4XBCA 4XDEA 2C8YB 2ZFQH 3MH4A 4IGDA 1RTKA 5CHAB 1WTGH 3NUMA 4K69A 2AGEX 3HK3B 1GBTA 1TQ7B 4AOQA 3TJUA 2ZFTA 3K9XB 4MNVA 2D1JA 2FOMB 1WV7H 2Z3CA 3OX7U 1SC8U 2CGAA 4LZ4B 1ZR0A 1FPHH 1MTNC 1LVBA 3GY6A 1VCWA 4ABBA 2STBE 2XC4A 1XUIA 5JBTA 3EE0B 2VIVA 2CXVA 1H8DH 4AORA 1VJAU 2ZFPH 3PLBA 1C1MA 3BEUA 3ZVCA 1TNGA 1ZJKA 4Q7ZA 1QY6A 3A84A 1TNLA 4Y6DA 5TCCA 5SGAE 1K1JA 2A45B 1C2IA 3MH7A 2C93B 1F0RA 3RMOH 3FP6E 2A4QA 3RXEA 3U8TH 2ZHQH 3VEQB 1FY5A 1UTLM 1Z8JB 2G52A 2TGPZ 3F68H 1G37A 5JB9S 3S9AA 1GI8B 2WUCA 4GLYA 5C3NA 1O36A 1TPPA 1O33A 1GJBB 3M61U 1YPLH 1O3MA 4UDWH 4HGCA 1O3CA 2EEKA 3SJKA 2W7SA 1KTSB 2TGDA 1EOLA 1EAWA 1O3JA 3RMNH 3PO1C 4MPWA 3ZVGA 4OS1A 4Z6AH 4MNWA 1FN8A 3RXIA 1W0YH 1Y3UA 1YM0A 2BDCA 1GHWH 4K60A 1HAPH 1TRYA 2GKVE 1QR3E 2GTBA 1HAVA 1AO5A 2EI7A 2VJ1A 1Z71A 3A83A 1DY8A 2H1UA 3GY2A 5ESTE 2AMDA 3BEIB 3EA8A 2J4IA 1ZMLA 2BXUH 2AMQA 1C1QA 3MTYA 2LPRA 4ZKNU 2GZ9A 1OP0A 5CMXH 4Y0ZE 1KLJH 2JH0D 5EXLA 3EYDA 5GXPA 1KYNA 5C1UA 4LXBH 2ZTXA 3ZZ7A 1EB1H 4NGAH 2AERH 1GCDA 3BIUH 4ZAEA 3GDUA 1KXEA 3VPKA 4OS5A 3RXTA 3A89A 3NCLA 4ISNA 1V2NT 1C2HA 3SJ9A 2ZCLP 3BSQA 1TGCA 1VR1H 2ANKH 3P70B 1P05A 2Y82A 2OD3B 3P6ZB 1A2CH 1Y3XA 3L33A 5C2ZA 1NY22 2ZDMA 3KNXA 1DPOA 3MO6A 1SR5C 2BDIA 2D8WA 2V35A 3MO9A 1BTHH 2VGCC 4Y11E 1NFXA 2PKAA 1NT1A 1P2IA 1C1VH 2OTVA 2ZHFH 1AU8A 1HV7A 2A4OA 4B75A 2ALVA 1CVWH 5C20A 3PYHA 5EXNA 5FXLA 3VXFH 1DWDH 1HNEE 2B8OH 1J16A 1HJAB 3M5MA 2BD3A 4X6OA 6ESTA 1F0UA 1GI9B 1MBMA 1O3FA 1G3BA 1GJCB 3RXFA 3P17H 1WU1A 1QBOA 3BEFB 2VIPA 1ARBA 3SN8A 3SV7A 4NIVA 5GPIB 4SGAE 3SBKA 3T25A 1C5NH 3KL6A 1HIAB 1W11U 1GBKA 1ZRBA 3UR9A 4B71A 1ELEE 1AKSA 2D26C 1MKXH 4X8SH 5FCKA 4UFDH 1GBCA 2Z3DA 4CH2B 2ANYA 1MZAA 2FOHA 2V3HH 4KTUA 1TGNA 1GJ8B 3O8DA 2NU3E 1P04A 2BD4A 5T6DA 1T31A 4YT7H 4BAKB 2Y81A 2NU1E 2ZDLA 1NRRH 4Y10E 2F83A 4FU7A 3A81A 2QXHA 1P2KA 2J38A 4ABIA 1EZUC 1YCPM 2PTCE 2J9NA 2V3OH 2BQ7B 2O8MA 1ELVA 1GJDB 4OS7A 5JBBS 3BTDE 4U2WA 1XVOA 4I8GA 2HNTF 1GI1A 1T4VH 1TOMH 1O2TA 2SGAA 1GMHF 2ASUB 3FZDA 1GL1A 1SGPE 1T8OA 1O2MA 3QWCH 1SGTA 1P3EA 1WUNH 3C27B 4FUGA 2AMPA 1YPGH 1JRSA 1CBWB 2G51A 5DP9A 1BQYA 1TQ0B 2ANMH 4MPXA 1TNHA 4CHAC 1AB9B 1GI6A 2BZ6H 1FUJA 2RDLA 4YOGA 1G3EA 3QZQA 1PPZA 2BDGA 1V2PT 3A7ZA 1EAIA 1ELFA 1BMNH 3UY9A 3RXCA 5EG4A 4PROA 1GHVH 4OGYA 1ELCA 1RXPA 3MH5A 2P95A 1C2KA 5DG6A 2SFAA 1C4U2 4I31A 3KCGH 1HPGA 1V2TT 1O2HA 2XBVA 1BDAA 2NU0E 3S9CA 3TJOA 2WPJS 6CHAC 4OS6A 4X2XA 2BY8X 2WYGA 1GBFA 3GOVB