1O2LA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2lA02
2HALA 3SU4A 1YCPM 1S6HA 1NFWA 5AFYH 3S7KB 3ZZCA 2ZDAH 1G3DA 3FP8E 2H9HA 1SOZA 1ELCA 1GMDG 1GBFA 1GI9B 2VINA 3SU1A 1N6YA 1NZQH 1VITF 4YT6H 1C2LA 1Q31A 1P09A 4A5TS 1CA0B 1TX6A 2AMQA 4I7YH 2XWAA 1D3PB 1BTPA 1V2JT 5T6DA 2ODYB 3E16B 2FTMA 2QXJA 2FX6A 1Z7KA 4WXVA 1NROH 5BRRE 1BDAA 5LGOA 1IHSH 1UTMA 3PMAB 4NA8A 1CHGA 4O9VA 1H9HE 3VGCB 2G4TA 1GCDA 3NCLA 3ZYEA 1QL9A 4JYUH 1QTFA 1FNIA 1O5GH 3ZVCA 1NM6A 3TNTA 2SGAA 1TNHA 1TONA 1MD7A 3H7OA 2G52A 2ODQA 1C5VA 1V2UT 4IS5A 1AUJA 2XYAA 4JZDH 2ZO3H 1ELVA 3GCNA 3UREA 4TYDA 2P3TB 2A0QB 1F0SA 3AAVA 5DPAA 4F49A 6GCHF 4PROA 2NU4E 1EZUC 3LU9B 4FUJA 3RMOH 5EGMA 1ZTLA 2ZCLP 5FBIA 5C20A 1B5GH 1OWDA 1OX1A 4FUDA 4RKJB 5DP9A 1P2NA 3V7TA 4DURA 3SU3A 1FV9A 1KXBA 3V0XA 4OS6A 1O2OA 1C2FA 1LKAA 1Q3XA 4CHAB 4DG4A 2XBXA 1TMBH 2NWNA 3WY8A 1BBRE 1CE5A 1P8VC 1SI5H 4FUEA 1ETTH 1AZ8A 1P9UA 1LO6A 2VNTA 2VU8E 4JMYA 4ZAEA 3OSYA 2P94A 1O32A 5DP3A 4I32A 5F8TA 1O5DH 5L30H 3MO6A 1HB0B 2PFEA 2ZTZA 2ZFRH 1O39A 2ZECA 1T4VH 1EQ9A 3Q00A 3ZVAA 4OGYA 4OS2A 1EUFA 1CA0C 1ELFA 1TPSA 4X8VH 2H9EH 2ZU5A 2NU1E 1MZAA 4YOJA 5A0CA 1HJ8A 4YESB 4NA9H 1O3NA 1KYNA 4E7RG 3PTBA 3O8DA 5JB9S 2ZQ1A 1ZSKA 1QIXB 4E05H 1AFQC 2BY8X 3UWIA 1V6DA 2BZAA 1MAYA 2Z9JA 1UTPA 4NA7A 2R0LA 2VIOA 5TCAA 1FY4A 1AUTC 3CP7A 3DHKH 1ESAA 3VGCC 1GJ5H 1A3EH 1EOLA 4D8NA 1OXGA 5H4IB 4Y8ZA 1SBWA 1ZOMA 5JBAS 2GZ8A 1GDQA 1GI3A 1UMAH 1KTSB 4A6LA 4ZH8A 2ALVA 3UFAA 2ZNKH 4UFFH 1BTZA 3RMMH 2G81E 1Y5AT 1TYNA 1C4V2 3AW0A 1RGQA 5DKMA 4XDEA 1DS2E 2FOAA 1T8NA 4KTUA 1GDUA 2G5VA 1HAVA 1O3DA 4TY7A 5I46H 5DP6A 5EW2H 5HMAA 3BEIB 1FUJA 3A87A 2F9UA 1GHBG 3FP6E 4Z0KA 4U01A 1Y59T 1MQ5A 1W0ZU 3F68H 2R0KA 3TITA 1K1MA 1YGCH 4B75A 2R3UA 3BIVH 3VXFH 3E8LA 3EA7A 2A7CA 1QA7A 4NWKA 3RXFA 5LPRA 1VR1H 1KIGH 3SNBA 1DITH 1LVYA 4D7FA 3BEFB 4R8TB 1RS0A 4AN7A 1LHFH 2AGGX 1DANH 4CHAC 5A2MH 5A09A 1ZSLA 2O8TA 1LMWB 5JBTA 3ZZ8A 4BXWA 3MFJA 1HDTH 1BHXB 1K22H 3V3MA 1O36A 3V12A 3LKWA 2AMPA 1BB0B 1EZSC 1FY1A 2H9TH 2C3SA 5E0HA 3RXKA 3EA8A 4FU8A 3KL6A 1WV7H 1HAXB 4NFEA 4H42U 1J15A 3S9CA 3QWCH 1GMHG 1C5SA 3E90B 4ABDA 1AFEH 2ASUB 4MVNA 2ANYA 2F83A 2VH0A 1O30A 1ZYOA 2UUKB 1GI7B 1INCA 1Z8JB 4ISLA 1MKWH 4UFDH 3UIRA 1YPEH 3L33A 1MU8B 3S9BA 4NIVA 2J92A 1O35A 1TGCA 4TPYA 2A7HA 1GL0E 1O2JA 4RN6A 2EEKA 4YOGA 1SLWB 5C1UA 1XXFA 1ELGA 2TGPZ 3PMBB 3FAOA 1G9IE 3LGTA 3BTFE 4Y0YE 4BXSA 1EKBB 1D3TB 1C5XB 4TY6A 4B2AA 3D49H 1O3LA 3RLWH 3TIUA 1NN6A 1HJAB 1TE0A 3SV2H 3UQOA 3UR9A 3QZQA 4IN1A 5C67A 1QA0A 1DWDH 5K7RA 3KQEA 4RSPA 1KTTB 2M5TA 2OBQA 5T6FA 3BTHE 2ZPQA 1EXFA 1VITH 3TVJB 3RU4D 4AGJA 2GDDA 2BXUH 1O2PA 2SFAA 3BEUA 3BTWE 1VJAU 2JH6D 1PPHE 2VIVA 5F8ZA 2A1DB 3SORA 1BMAA 1P01A 2BD4A 1O2YA 1TB6H 3VB5A 1ZMJA 2P8OB 1QQUA 3IITA 1P2QA 4K8YA 3M7TA 1VGCB 2WPHS 1QRZA 3PYHA 1CT2E 9ESTA 4FUGA 4NCYA 1G3BA 1EX3A 3GY2A 3P70B 1G2LA 1K1NA 3RC4A 3TJNA 1YBWA 4AOQA 5C5OA 3NK8A 2FODA 1S82A 1ZHRA 2KAIA 1QJ1B 1D4PB 3GCTG 1GG6B 3K65B 4OS5A 1EAUA 4O97A 5HM2A 3SU2A 2F9PA 1YPHC 3U69H 3NXPA 1TA2A 1HYLA 1QL7A 5T3HA 1N6XA 2TGDA 3RXVA 1AQ7A 4Q2KA 3AAUA 1OYQA 1U6QA 4IBLH 3GCHB 1A61H 1OWHA 1C1OA 1IQMA 1GHAF 4BAOB 1SVPA 1HLTH 2FS8A 4ISOA 1DFPA 3BTDE 2ZFFH 4UEHH 2XBVA 2GX4A 4HZHA 2P16A 4RKOB 1ACBE 1EAIA 4ZKRU 1KXFA 2W7SA 1V2MT 2NU3E 1A2CH 1TNJA 1GBHA 1Y3XA 1OWIA 1TMUH 3ZZ4A 1LQDB 1GI0A 1UVOA 2BMGB 2XBWA 1KLJH 1C4U2 1PPCE 4IC6A 4DOQA 1M9UA 2LNCA 1TGBA 3UPEA 2IN2A 1DVAH 1HAHH 1O3GA 3RXHA 3TJUA 3M5MA 3MU1A 2SGDE 1V2PT 1GMDF 4X2WA 3U1IB 8GCHG 2G8TA 4AYVB 3SHCH 3TH4H 1AN1E 1N8OB 3RXJA 4JZIA 4A1TA 1HJAC 1L2EA 2SGQE 2ZGBH 1MTUA 3F9FA 1J14A 1GMCG 2R2MB 3LC5A 2WPJS 1CGJE 1IQGA 3KQDA 1HBTH 2IPHA 1AWHB 1C1UH 2KAIB 1C1VH 2ZU2A 1MBMA 1FXYA 1GVKB 3NPSA 3RXOA 3ZVDA 3GDSA 2WPLS 1YPHE 4X0WU 3HK3B 3GYLB 2ZFTA 1GHVH 2UUJB 1AE8H 1DLEA 1YLDA 1K9OE 2UWPA 4CRBA 1NS3A 1IQFA 4AYYB 2ZFQH 4ZHMU 1O3CA 2P8OC 4CH8B 1C2IA 1VGCC 1TABE 2WV4A 2FO9A 4WH6A 3UNRA 1MD8A 1ZRKA 5F8XA 2Y6TA 4THNH 2O8LA 1SLVB 1O2LA 1SGRE 4A1VA 2I6SA 1G3EA 4D9RA 1GGDB 3JZ2B 2BX4A 5ESTE 1GG6C 1GBBA 2V6NA 4FVDA 2W7UA 3RXUA 3M3SA 3A7YA 1LHEH 1A1RA 4IW4E 2BDBA 1NC6A 1UVTH 1HIAA 3GCHC 1Y3UA 3UR6A 1F0RA 5GDSH 1PYTD 2ZC9H 1ZJKA 1ELEE 2Y80A 3EGKH 3PWCA 1DT2A 2VGCB 4WH8A 3ATIA 4BAKB 4AFSA 1MCVA 1O5EH 5L6NH 1H9LB 1TNLA 3MO3A 3M5LA 2CGAA 3U98H 3BTKE 1UCYK 1ZHMA 1DPOA 2PTNA 1FJSA 1T32A 4XBDA 3RXRA 1WCZA 2BXTH 4D7GA 2FTLE 2ZTYA 1PYTC 2A45B 1FY8E 1D6WA 3NWUA 3SJ8A 4B74A 2UWOA 5FPSA 1ZMLA 1O2TA 1C2GA 3PM3A 1TMTH 2TGTA 3STIA 4DVAU 4K2YA 3RXAA 3RXPA 3BF6H 2AFQB 2FLBH 1S0QA 4UDWH 1XXDA 3P95A 2J95A 3RXCA 2PSXA 1N8OC 4NWLA 2GCTB 8ESTE 1C5WB 1RFNA 3SUEA 4AB9A 2GCHF 1HUTH 1O2KA 2ESTE 1WQVH 4MDSA 4K1SA 1OP0A 4ABJA 1BUIA 3GY3A 2CXVA 1OS8A 2VH6A 1MKXH 1SQAA 3MU5A 1W12U 4B76A 4ZMAH 5DO4H 1Z8IB 1O33A 1O3HA 2BDAA 2XW9A 1FZZA 1C2KA 1HIAB 1S0RA 1C5QA 2Y81A 1HAYB 3ZZ9A 1RRKA 1UO6A 2ZHFH 4CR9A 3L3TA 4X2VA 8KME2 2V0BA 1K2I1 1MCTA 1SL3A 5IDKA 4JK5A 5DGJA 3LGIA 3F9HA 2BD7A 3RXGA 3SN8A 4AORA 4FVBA 3IWMA 1QB6A 3ZZAA 1GGDC 2VWOA 2Q6DA 3QLPH 3ZZBA 1C1QA 2BOHB 1GHBF 4ABGA 3KEEA 1YP9A 1F5RA 2FWWA 2UUYA 1C5OH 2Y5HA 1GBDA 1CO7E 1QFKH 1YCPK 3P6ZB 1YPGH 2BVRH 5HGGA 5GCHF 3S0NA 1TAWA 3A82A 5HM9A 2HPPH 1YPMH 5FX5A 3RUOA 2VGCC 3DT0H 1ZJDA 3MTYA 1TOMH 2ZPSA 1ARCA 1ANBA 2W26A 4H6TA 1QY6A 1BRBE 7ESTE 2GT8A 2TBSA 5EODA 1O37A 1S85A 1P2KA 1JMOH 3RXEA 1UTKA 3BTTE 2IJOB 2GMTB 1TPOA 3BG4B 1GJBB 4MNYA 4IN2A 5CHAB 4LZ4B 1GVLA 1DWCH 2TIOA 3ZZ6A 2QF0A 2WUBA 3UUZA 5ABWA 2AIPA 4B1TA 2XC0A 4NIWA 1TRMA 1QJ7B 1KXAA 2BLVA 3F6UH 1GMHF 1BTWA 3TGKE 1C1WH 2GCTC 4H4FA 1EASA 1Z1IA 4AZ2B 4I8JA 4WVPE 2Z9KA 1QB1A 4BTUB 4FUCA 1Q2WA 3FANA 1J8AA 3F9EA 1GVZA 2BDIA 1C2HA 4K5ZA 2HNTC 1PQ5A 3QX5H 5EXMA 2ZGHA 1NU7B 3HATH 3LGVA 1DUAA 3E1XB 3MNXA 4CRGA 2GV7A 3T5FH 1C2EA 1P9SA 1CHOG 3MH6A 1ELAA 1FN8A 4Y79A 1Y3WA 2W3KA 4BAMB 1V2KT 1K21H 2OC7A 4X2YA 2FI5E 2A32A 3M7UA 2ZI2H 2PKSB 2ZCKP 1TNKA 1C5NH 1V2WT 1E0FD 4IGDA 1AVWA 1LVMA 1D6RA 3STJA 1UTNA 2IOTA 3CS0A 2ZGJA 3QO6A 1O2GH 1IQJA 4DJZB 1O34A 3A83A 3B9FH 2C90B 4D9QA 5A0BA 5E8EH 3SV9A 1GBMA 2Y82A 2Z7FE 3RXLA 2HVXA 2F9VA 2VWMA 3M37A 2C93B 3QZRA 5LPFA 4FUIA 2A4QA 4K3JA 3SI4H 1OWJA 4X2XA 5C5NA 3P92A 2F9OA 1LQEA 2Z9IA 4ISNA 4WMFA 3RP2A 4INKA 1YKTA 4I33A 1GJAB 2H6MA 5EQRA 3GY8A 4Y76A 1J9CH 4AFZA 1ESBA 3FFGA 1SGNE 3GCTF 1C1SA 2OD3B 4A1XA 1WOFA 3MH5A 2GMTC 1OP2A 2PGQB 3D23A 3S69A 3M7QA 4BOHA 3BG4C 5CHAC 1O38A 4FUBA 3SU0A 2HNTE 1BTYA 1XUIA 5AVDA 1J17T 3EA9A 1ANCA 1K1JA 4IC5A 3MI4A 1ABIH 4LK4A 1MTSA 4ABFA 2HNTF 2ZDMA 1L4DA 2ZFSA 3VFEA 3ZV8A 2BDYA 4XBCA 2H1UA 3LGWA 3P8FA 2C8XB 4O03A 3TPIZ 4I8GA 4ABEA 3HGPA 3ZZ3A 3TGIE 1TQ0B 2YNAA 4H6SB 2FMJA 1F0UA 3MU8A 4XE4A 2A4RA 4AG1A 1NO9H 2FOBA 1O0DH 1K1PA 1EJMA 1LKBA 2A31A 2FDAA 4MPUA 1PPEE 2OC8A 2BY9X 2EC9H 1HRTH 1HXFH 1ZLRA 1MUEB 1OP8A 2BY6X 3RC5A 3AASA 2EI7A 3LOXA 1AZZA 1S81A 2GV6A 2PHBA 5FHTA 2CN0H 3SGBE 1NTPA 2Z9GA 2NU0E 1V2VT 2WV5A 1BQYA 1TPPA 3QGNB 2ZDNA 1SFIA 2BM2A 2OC0A 3ZYDA 1A7SA 3F1SB 5A0AE 1DOJA 8GCHF 1AI8H 2A7JA 2PKSC 5TJXA 1A46H 1BRUP 1KDQA 3M3VA 3MH7A 4WXIA 5JBBS 3ATMA 4A7IB 2A4GA 5AFZH 1UTQA 3O8BA 3Q3YA 3A8CA 4TWWA 2RCEA 3LIWA 1L1JA 4UFEH 1FPCH 1O2HA 3FVFB 1JXPA 2J9NA 5DP7A 2R2WU 3TJOA 1ARBA 2VWLA 4Y7AA 1A5IA 2PSYA 2RA0A 2XBYA 1GL1A 3OY6U 2BLWA 4WMEA 5EQSA 3SI3H 4Y10E 1C2DA 2OCVB 1ZSJA 4YOIA 5GJ4B 3D65E 1WAYB 3E91A 3ATKA 3L6PA 1ANEA 1AU8A 1QCPA 1UTJA 3MNCA 3A89A 2O8WA 2Z3EA 1W8BH 2SNVA 4UONA 1HAZB 1MMJN 1PPZA 1EB1H 3K6YA 3SJOA 1WBGB 2B9LA 2B8OH 4XOJA 3W94A 1QBVH 4Q7ZA 4BANB 2ZF0H 4JZFH 1GHWH 4ZROA 2OP9A 2SGPE 3SO3A 1QGFA 1GI4A 2VVCA 1KLTA 1NRNH 1W13U 3ATWA 4INHA 5EPNA 1L4ZA 3VPKA 1T7CA 3ESTA 2ANKH 2G55A 2FS9A 1PJPA 3P8NA 1LHDH 3SV8A 5J4SA 1ZR0A 2BQWB 2J34A 3UTUH 2HPQH 3KQCA 2J38A 1SQOA 1FY5A 1A0HB 2J4IA 3DD2H 3EDXB 2OTVA 3RXTA 1WUNH 1SGFG 1JIRA 2XCNA 1O3KA 5JPMH 1W3CA 2BD9A 1THRH 3MHWU 2Y5FA 2AEIH 4WMDA 2ZCHP 1KDQB 5FCKA 5E0JA 1W7GH 2H5DA 2P59A 2BDCA 2WYJA 1PPBH 2OXSA 2FYRA 4I31A 1XUJA 2FOHA 3A8DA 2PKAA 4NSVA 1O5AB 1XUGA 1CT0E 1XVOA 2XWBI 5B6OA 1YPJH 1GBKA 4A92A 1MQ6A 3RMLH 4B71A 2WPIS 1RTKA 1C9TA 4NZQA 4X1PU 3GCOA 4D76A 3GY6A 3A8BA 1LVBA 3A85A 1P2JA 2QIQA 1YPKH 2QN5T 2ULLA 1G2MA 1B7XB 3EE0B 1EZXC 2BOKA 1FI8A 1WTGH 2JH0D 1OKXA 1XUHA 1S6FA 1ELTA 1BMNH 1P12E 3SNCA 2PTCE 2AIQA 4Y8YA 2CV3A 1HAPH 3P8OA 1A3BH 2PW8H 5GXPA 1IHTH 1MZDA 1TNGA 1BTXA 1D3DB 2GZ9A 1IQHA 1ANDA 1CU1A 4XSKU 1SR5C 1THSH 2O9QA 1GI5A 4DT7B 2SGEE 1G32B 4KELA 3BTME 3SU5A 2ZDLA 3D62A 1TIOA 2BB4A 2FI4E 3LPRA 1XM1A 3KHVA 3GY7A 5G4BA 1GJ8B 1GDNA 1ZGVA 3T62A 1K1IA 1O2XA 3C27B 1GJDB 4ESTE 1LVOA 4YT7H 2DE8A 1WTHD 1GJCB 2O8MA 2PKAB 3LONA 2Y7ZA 1EOJA 2ZA5A 1TX7A 1O5CB 4K60A 4WWYA 2I6QA 1CBWB 3TGJE 3T27A 3DFJA 1YF4A 4GHTA 4B2BA 8LPRA 1FIWA 2ZGCA 3M5OA 3T29A 1SGQE 1PPFE 1HV7A 3Q77A 4X1QU 3PB1E 3U8OH 1VZQH 1NRRH 3SHAH 3SNEA 2FZZA 4INLA 2ILNA 2VIWA 1BIOA 5C1YA 3NZIA 1GI2A 4GLYA 4U2WA 1SSXA 3MO9A 4IMQA 3DA9B 3I77A 4ABBA 3E0NB 3T2NA 1Z1JA 1Z8GA 2BDGA 2FI3E 3CENA 2OUAA 4X6MA 1ZPBA 3GOVB 1E38B 2FEQH 3T26A 3E0PB 1D3QB 4BAQB 4AX9H 1ORFA 1O2RA 4MTBA 3RU4E 2ZHEH 3KN2A 3TNSA 1VCQA 1SOTA 1CGHA 3PV4A 4AB8A 5C2ZA 3H7TA 1EZQA 1MTVA 2H5CA 5EU8A 3SU6A 2C8WB 1NFUA 2Z6BD 1BRAA 1O2VA 3E3TA 1O5FH 3SJKA 1FAKH 1O3IA 1PQAA 2H2ZA 4R0IA 2AMDA 1H9IE 1AIXH 1CHOF 3TK5A 1C5YB 1P05A 2FOEA 6ESTA 1SGTA 4NIYA 2ZU4A 4AFQA 5EQQA 1C1MA 1AKSA 1KXCA 2ANWA 2Q1JA 1DM4B 4Q7XA 3A88A 1O2QA 3M3TA 3UNSA 3OTJE 2XNIA 3KCGH 4J1YA 3PWBA 1EPTA 4ZUHA 2ODPA 1DLKB 2DE9A 7GCHG 3PLBA 1YLCA 3BTQE 7KMEH 4DY7B 1Y8TA 5GPIB 1L1GA 2UUFB 1O3OA 3SV6A 1P10A 2BQ6B 1Y3YA 4J2YB 3MU4A 3G01A 2STBE 4JYVH 3UWJH 3ITIA 1TBQH 1CBWC 3HPTB 2V3OH 4CBOA 1LPZB 2VVVA 3BSQA 2HOBA 3DUXH 1W2KH 5ESBA 1UTOA 1ZTKA 1SMFE 2TGAA 4Y8XA 1O2UA 3KF2A 5FXLA 4AGKA 1BZXE 5ETXA 1P2MA 4IMZA 1GBJA 4ZHLU 2LPRA 2F91A 4JZ1A 1K1OA 1SGYE 5EXLA 1LPKB 4MNVA 4CRCA 2G5NA 2QXHA 4OGXA 2PLXA 3BTEE 4ZXXH 3SJIA 3ENSB 5LH8A 3RXDA 1RJXB 1HJ9A 5T6GA 3LH1A 2ZHDA 1GHXH 1ZZZA 2XC5A 4JZEH 1UVUH 3TK9A 1EATA 2PV9B 4UFGH 2PR3A 1A5GH 1DWEH 5F03A 5EOKA 1TPAE 2WPMS 2ZPRA 1AKSB 1GBAA 3O8RA 1LHGH 1TOCB 1GHYH 4MLFB 2BVXH 3GYMA 5JBCS 1BRCE 1GBEA 2GDEH 4X6PA 3TH2H 1EPTB 1D9IA 1W7XH 2JH5D 4YLQH 6LPRA 4Q7YA 3IG6B 1BMLA 2Q6FA 1C5PA 1NPMA 1RD3B 1ELDE 1GI6A 3URCA 1EJAA 1IAUA 5BPEA 1QB9A 1AGJA 4ISIH 1JOUB 3KGPA 4GHQA 1A0JA 1OPHB 4K8BA 2THFB 3Q3XA 3S9AA 4NFFA 4ZKOU 4YM9A 2AERH 3EAJA 3SQEE 4CR5A 1QR3E 1V2RT 1DDJA 1EP6A 2QF3A 2F9BH 1GJ4H 1NT1A 1FMGA 4E7NA 3EQ0H 2BD8A 1RIWB 2Y7XA 2ZQ2A 4CREA 1BCUH 2ZP0H 2NU2E 4HFPB 2QAAA 4ASHA 3SGQE 2GKVE 2OQ5A 1ZHPA 4GCHG 4O3UA 2VIDA 3VXEH 1EB2A 1MKWK 2FM2A 4B2CA 3T25A 5FCRA 2HWLB 2ZHQH 5C1XA 5L2ZH 1SHHB 4Y7BA 1T8OA 3ATLA 1S84A 1UK2A 3UNQA 2FOGA 2O8UA 4CBNA 4BTIB 3A81A 2A5IA 4XBBA 3RXBA 1KY9A 1S83A 1RXPA 1GI1A 1GBCA 5HXFA 1Y5UT 3PTNA 4MPVA 5CE1A 5CMXH 3SW2B 5JB8S 1ZPZA 2ZFPH 1QRWA 2FIRH 2GP9B 2AYWA 1SPJA 1AFQB 3QGJA 1P57B 2F3CE 1P0SH 4NIXA 2XCFA 1WYKA 1AHTH 1TNIA 4KP0A 1N1LA 1A4WH 1LPGB 2FOCA 3A80A 3TK6A 1O3EA 1MU6B 1H8DH 2BX3A 3I29A 1P2IA 1DWBH 3QDZB 1ABJH 4U32A 1W10U 1EPTC 3LDXH 1P03A 2BY5X 2FX4A 3QN7A 4B73A 1K1LA 5EW1H 2HRVA 1T31A 1YYY1 2D26C 1DY8A 3GISB 2FOFA 4X8SH 2HGTH 2G00A 1A5HA 3QUMP 1TRNA 1GBLA 5EPYA 2ZWLH 4JK6A 1WU1A 5DP8A 2ANMH 1AO5A 4TPIZ 3A7VA 2PUQH 3HKJB 3HKIB 1UK3A 1C1RA 3SQHE 5F6MA 1J16A 1T4UH 1GBTA 1G36A 3UQVA 3C1KA 2ZIQH 1KXDA 2FP7B 1RTFB 3QK1A 3PROA 1JIMA 2OC1A 1VCWA 1MAXA 1JRTA 3SNDA 1O2IA 1DUEA 2WPKS 1BT7A 4OS4A 4HTCH 3RM0H 2XTTB 2P93A 1RIWC 1KXEA 1MH0A 2BD2A 2FYQA 3NUMA 2BZ6H 4AG2A 1FONA 1BTUA 1TBRH 4ABHA 1F7ZA 1W11U 2V3HH 4GAWA 4YLUA 1C5UA 4X6OA 2ZU3A 4HI3A 1Y3VA 2D8WA 1DICA 4NZLA 1L1NA 1FQ3A 1F0TA 4DW2U 2STAE 4X8TH 2WYGA 2W3IA 3P17H 3A84A 5FPTA 1EAXA 5PTPA 1SGDE 1PQ7A 1SGIB 1UCYH 2CHAB 2A2XH 1G3CA 2FPZA 4O3TA 1XVMA 1AWFH 2AH4X 1XUKA 3AVZA 3Q76A 2GCHG 4DGJA 2BTCE 3GDUA 2Y5GA 4DCDA 4GVUA 3VEQB 5LPEA 2HLCA 4Q80A 3B23B 1V2ST 1H4WA 1BBRK 3SOSA 4Y6DA 3PMHB 1HFDA 1IQLA 1EP5A 3DFLA 4FU7A 1GCTB 2RDLA 4K1TA 4MPWA 5AHGH 1E34B 1FY3A 2C8ZB 1O2ZA 1AD8H 1O2SA 4ABAA 3SGAE 3VB3A 2ZEBA 6CHAB 1K28D 3KNXA 1NFXA 1C5RA 3RM2H 4X1NU 1DXPA 4UE7H 4ZHAA 3ZVBA 3A8AA 2W5EA 2P3FH 1THPB 3SZNA 1WQSA 1TALA 1HPGA 3K6ZA 1TA6A 2VVUA 3VB4A 1QJ6B 4CRAA 1CSOE 3MU0A 1QBNA 2A5AA 3BV9B 9LPRA 1AE5A 1P04A 1GMCF 3MWIU 4ZKSU 2XXLA 4MNWA 2Z9LA 2BLOA 1LDTT 3K2UA 2GVFA 3ZZ5A 4I8KA 4Y71A 1SFQB 2TRMA 5JDUB 4NG9H 3LH3A 1O5BB 3I78A 3B8JA 1YPLH 1NU9A 5I25A 1DXWA 3A7XA 1QL8A 4OS1A 2ZDKA 5GCHG 4NSYA 4WJG2 3UOPA 3RXSA 3OU0A 3TLOA 4SGBE 1UJ1A 5DP4A 3M5NA 1F92A 1OWKA 1FLEE 3OX7U 5FPYA 2CMYA 1TBZH 1KSNA 2VJ1A 1YCPH 4ISHH 1C5MD 3RDZA 1VITG 4E06H 3NKKA 1TFXA 3V13A 1DX5M 1XUFA 3H5CB 3RXIA 1Z6JH 2ZHWH 1HGTH 1FAXA 1XKAC 1C2MA 2ZKSA 4KKDA 3CS7A 1XMNB 4F4OC 3R0FA 5IYTA 3GY5A 3AW1A 1IQIA 1A0LA 3OYPA 2Z3CA 2ZGXH 2QGRA 1IQNA 3MOCA 1UVSH 1S5SA 1UK4A 2CHAC 1O3MA 1ZTJA 3EYDA 7GCHF 4TWYA 2BY7X 1VJ9U 2QC2A 1Y5BT 4JCNA 1GHZA 1C9PA 5EXNA 4LXBH 1O3PB 4Y0ZE 2RG3A 3A7WA 5EG4A 1AVXA 1P02A 2J94A 1SGEE 3LGUA 3T28A 1GCTC 3VB6A 3BN9A 2SNWA 4WY3A 1HAVB 3BTGE 1AY6H 3A86A 2ALPA 4X1RU 5K0HA 2V35A 3U8RH 6CHAC 1SB1H 1SLXB 3LC3A 1IOEA 2YNBA 3R3GB 2BD3A 2TPIZ 4Z6AH 3QTVH 6GCHG 2A4OA 3ZZDA 1MKXK 3MMGA 3FZZA 1BMMH 4K1EA 1GBIA 1FN6A 4FXGH 1AMHA 1NRPH 2C4FH 3ELAH 2BD5A 2GZ7A 1TX8A 1UTLM 1GI8B 1P11E 2JETB 3SBKA 3LJJA 5SGAE 2B5TB 1NRSH 4UD9H 2OINA 2ZTXA 1QHRB 1B0FA 2XRCA 1BITA 1ETSH 3SJ9A 1SGCA 4GPGA 1SC8U 2D2DA 1GWAA 2QXGA 2ZG0H 5J4QA 1P2OA 3PLKA 4MG3A 2K1QA 2OQUA 3MNBA 1C4Y2 1TGSZ 1NRQH 1E36B 2FXRA 1ID5H 2AGEX 5DJ7A 1X7AC 4I8LA 1G37A 1Z71A 3ZZ7A 2CJIA 2VIPA 1V3XA 2PGBB 3RXQA 1BJVA 1C5TA 3Q3KA 1IQKA 5A8ZA 1C2JA 1HXEH 1V2LT 3MYWA 1B0EA 4DIIH 1TWXB 1SGFA 4M7GA 1OOKB 2D1JA 2VIQA 1SLUB 3LGYA 2WINI 4VGCB 1V2NT 3P8GA 1O2NA 3TU7H 2BDHA 3ZVEA 1ETRH 4LOYH 3ODDA 1MTWA 2PWXA 2JKHA 4K69A 2EA3A 1FDPA 5JYIA 4YO9A 3ZV9A 1CGIE 1HAGE 1LHCH 2QXIA 3K9XB 3HGNA 1P3EA 3OY5U 1PPGE 1QNJA 3F9GA 4YZUA 1ESTA 4GCHF 2ZZUH 3GDVA 5FAHA 1AVGH 4FU9A 1LCYA 1O3BA 4FUFA 3RMNH 4X8UH 4MQAA 2BQ7B 2GD4B 1NESE 1ZMNA 3PO1B 3U9AH 1OWEA 1O3JA 2QV1A 2OLGA 1GJ9B 2UWLA 1C5LH 3PMJA 4HGCA 1BBRH 4X6NA 3M36A 2P95A 1NY22 1V2OT 3UY9A 1XKBC 1JBUH 4CH2B 2JETC 4CRFA 1YC0A 4KGAA 2VWNA 1C5ZB 1UHBA 4BAHB 2ZDVH 5GIBA 1G30B 2AS9A 4X1SU 1E37B 4U30A 1CA8B 1TLDA 1TGTA 1UCYE 4CRDA 2FESH 1KLIH 5GWZA 1BHXF 2GGVB 2QA9E 5E2PA 3RU4T 1SQTA 1LTOA 1SHYA 1JWTA 3A7ZA 3U1JB 1AB9B 2FLRH 1HCGA 4WF8A 4OS7A 1O3FA 2GT7A 1V2QT 3URDA 2WUCA 3W95A 1IQEA 3O8CA 1MTNB 1C1NA 4NGAH 4AFUA 2DUCA 1P3CA 3GICB 4GSOA 3M35A 1NFYA 5FBEA 1GPZA 1HAOH 1FPHH 3JZ1B 3KQBA 5E2OA 5A8XA 4VGCC 3TH3H 2B7DH 2YOLA 2BLQA 3ODFA 1DSUA 4BNRA 3SUGA 1XX9A 4DIHH 3S7HB 3RXMA 1SG8B 1HAIH 2RA3A 2R3YA 4KTCA 1E35B 3SNAA 1TQ7B 2P3UB 3ZVGA 2ZU1A 1W0YH 4MNXA 3BIUH 1O31A 5HYOA 2QCYA 5E0GA 5A8YA 1BTHH 1MBQA 2EI8A 2J2UA 1TRYA 4JYTA 1Z8RA 7LPRA 1ZRBA 2SGFE 3U8TH 1EJNA 1DE7H 2QYIA 4Y11E 1UHBB 3LJOA 3KIDU 3PLPA 1EAWA 2EI6A 3SUDA 3PO1C 1H8IH 4KTSA 1QBOA 1ELBA 1CQQA 3RLYH 2Z3DA 5DP5A 1V2TT 4ABIA 1H1BA 1L0ZA 2VB0A 3VB7A 4XFQA 1O2MA 5L2YH 3TJVA 2BYAX 3A7TA 1QQ4A 1PFXC 5DG6A 1JRSA 3UOUA 1SGPE 4MPXA 3RC6A 1ZGIA 4ZKNU 1DSTA 3M61U 1VCPA 2FOMB 3E6PH 2QY0B 4LZ1H 4BTTB 1W14U 3QTOH 2A5KA 3N7OA 2CF8H 1OSSA 1Z6EA 4QT8C 1QRXA 3FZDA 2G51A 2CF9H 2G4UA 2R9PA 2XC4A 3MNSA 3BG8A 1AB9C 4ZXYH 1O3AA 1HNEE 1QURH 1CVWH 2C8YB 4GUXA 4SGAE 1T8LA 3MH4A 4FUHA 1CT4E 1YM0A 1FIZA 4YTAA 3FP7E 1OYTH 1MTNC 1GHAG 1WSSH 2OBOA 1F2SE 5AF9H 1TGNA 2B0FA 1P06A 3ZVFA 2PUXB 1BJUA 2BVSH 1BA8B 1UVPA 1GJ7B 1T8MA 2GTBA 1ZPCA 2Z94A 1O2WA 5C3NA 3LT3A 1RTLA 3SV7A 4I8HA 1C1TA 2AGIX 1DY9A 1C1PA 1PQ8A 3SUFA 2BHGA 3GY4A 5TCCA 2A2QH 1GJ6A 1F5LA 1F5KU 5DK1A 5FX6A 2Q6GA 1BOQA 3HK6B 2F9NA
chains in the Genus database with same CATH superfamily
2HALA 3SU4A 1YCPM 1S6HA 1NFWA 5AFYH 3S7KB 3ZZCA 2ZDAH 1G3DA 3FP8E 2H9HA 1SOZA 1ELCA 1GMDG 1GBFA 1GI9B 2VINA 3SU1A 1N6YA 1NZQH 1VITF 4YT6H 1C2LA 1Q31A 3WWFA 1P09A 4A5TS 1CA0B 1TX6A 2AMQA 4I7YH 2XWAA 1D3PB 1BTPA 1V2JT 5T6DA 2ODYB 3E16B 2FTMA 2QXJA 2FX6A 1Z7KA 4WXVA 1NROH 5BRRE 5GNDA 1BDAA 5LGOA 3CNRA 4XD7D 1IHSH 1UTMA 3PMAB 4NA8A 1CHGA 4O9VA 1H9HE 2KCOA 3VGCB 2G4TA 1GCDA 3NCLA 3ZYEA 1QL9A 4JYUH 1QTFA 1FNIA 1O5GH 3ZVCA 1NM6A 2YMSD 3TNTA 2SGAA 1TNHA 1TONA 1MD7A 3H7OA 2G52A 2ODQA 1C5VA 1V2UT 4IS5A 1AUJA 2K0QA 2XYAA 4JZDH 2ZO3H 1ELVA 4ZCNA 3GCNA 3UREA 4TYDA 2P3TB 2A0QB 1F0SA 3AAVA 5DPAA 3FN8A 4F49A 6GCHF 2WHXA 4PROA 4P00A 2NU4E 1EZUC 3LU9B 4FUJA 3RMOH 1E79D 5EGMA 1ZTLA 2ZCLP 5FBIA 5C20A 1B5GH 1OWDA 1OX1A 4FUDA 4RKJB 5DP9A 1P2NA 3V7TA 4DURA 3SU3A 1FV9A 1KXBA 3V0XA 4OS6A 1O2OA 3DSGA 2AHME 1C2FA 1LKAA 1Q3XA 4CHAB 4DG4A 2XBXA 1TMBH 2NWNA 3WY8A 1BBRE 1CE5A 1P8VC 1SI5H 4FUEA 1ETTH 1AZ8A 1P9UA 1LO6A 2VNTA 2VU8E 4JMYA 4ZAEA 3OSYA 2P94A 4YXWD 2QF5A 1O32A 5DP3A 4I32A 5F8TA 1O5DH 5L30H 3MO6A 1HB0B 2PFEA 2ZTZA 2ZFRH 1O39A 2ZECA 1T4VH 1EQ9A 3Q00A 3ZVAA 3FOAA 4OGYA 4OS2A 1EUFA 1CA0C 1ELFA 1TPSA 4X8VH 2H9EH 2ZU5A 2NU1E 1MZAA 4YOJA 5A0CA 1HJ8A 4YESB 4NA9H 1O3NA 1KYNA 4E7RG 3PTBA 3O8DA 2KR7A 5JB9S 2ZQ1A 1ZSKA 1QIXB 4E05H 1AFQC 2BY8X 3UWIA 1V6DA 2BZAA 1MAYA 2Z9JA 1UTPA 4NA7A 2R0LA 2VIOA 5TCAA 1FY4A 1AUTC 3CP7A 3DHKH 1ESAA 3VGCC 1GJ5H 1A3EH 1EOLA 4D8NA 1OXGA 5H4IB 4Y8ZA 1SBWA 1ZOMA 5JBAS 2GZ8A 1GDQA 1GI3A 1UMAH 1KTSB 4A6LA 4ZH8A 2ALVA 3UFAA 2ZNKH 4UFFH 1BTZA 3RMMH 2G81E 1Y5AT 1TYNA 1C4V2 3AW0A 1RGQA 5DKMA 4XDEA 1DS2E 2FOAA 1T8NA 4KTUA 1GDUA 2G5VA 1HAVA 1O3DA 4TY7A 5I46H 5DP6A 5EW2H 5HMAA 3BEIB 1FUJA 3A87A 3DCLA 2F9UA 1GHBG 3FP6E 4Z0KA 4U01A 1Y59T 1MQ5A 1W0ZU 3F68H 2R0KA 3TITA 1K1MA 1YGCH 4B75A 2R3UA 3BIVH 3VXFH 3E8LA 3EA7A 2A7CA 3VG8A 1QA7A 4NWKA 3RXFA 5LPRA 1VR1H 1KIGH 3SNBA 1DITH 1LVYA 2V3MA 3BEFB 4R8TB 4D7FA 1RS0A 4AN7A 1LHFH 2AGGX 1DANH 4CHAC 5A2MH 5A09A 1ZSLA 2O8TA 1LMWB 5JBTA 3ZZ8A 4BXWA 3MFJA 1HDTH 1BHXB 1K22H 3V3MA 1O36A 3V12A 3LKWA 2AMPA 1BB0B 1EZSC 1FY1A 2H9TH 2C3SA 5E0HA 3RXKA 3EA8A 4FU8A 3KL6A 1WV7H 1HAXB 4NFEA 4H42U 1J15A 4Q4LA 3S9CA 3QWCH 1GMHG 1C5SA 3E90B 4ABDA 2LELA 1AFEH 2ASUB 4MVNA 2ANYA 2F83A 2VH0A 1O30A 1ZYOA 2UUKB 1GI7B 1INCA 1Z8JB 4ISLA 1MKWH 4UFDH 3UIRA 1YPEH 3L33A 1MU8B 3S9BA 4NIVA 2J92A 1O35A 1TGCA 4TPYA 2A7HA 1GL0E 1O2JA 4RN6A 2EEKA 4YOGA 1SLWB 5C1UA 1XXFA 1ELGA 2TGPZ 3PMBB 3FAOA 1G9IE 3LGTA 2JJ2D 3W1EA 3BTFE 4Y0YE 5C17A 4BXSA 1EKBB 1D3TB 1C5XB 4TY6A 4B2AA 3D49H 1O3LA 3RLWH 3TIUA 1NN6A 1HJAB 1TE0A 3SV2H 3UQOA 3UR9A 3QZQA 4IN1A 5C67A 1QA0A 1DWDH 5K7RA 3KQEA 4RSPA 1KTTB 2M5TA 2OBQA 5T6FA 3BTHE 2ZPQA 1EXFA 1VITH 3TVJB 3RU4D 4AGJA 2GDDA 2BXUH 1O2PA 2SFAA 3BEUA 2J98A 3BTWE 1VJAU 2JH6D 1PPHE 2VIVA 5F8ZA 2A1DB 3SORA 1BMAA 1P01A 2BD4A 1O2YA 1TB6H 3VB5A 1ZMJA 2P8OB 1QQUA 3IITA 1P2QA 4K8YA 3M7TA 1VGCB 2WPHS 1QRZA 3PYHA 1CT2E 9ESTA 4FUGA 4NCYA 1G3BA 1EX3A 5FL7D 3GY2A 3P70B 1G2LA 1K1NA 3RC4A 3TJNA 1YBWA 4AOQA 5C5OA 3NK8A 2FODA 1S82A 1ZHRA 2KAIA 1QJ1B 1D4PB 3GCTG 1GG6B 3K65B 4OS5A 1EAUA 4O97A 5HM2A 3SU2A 2F9PA 1YPHC 3U69H 3NXPA 1TA2A 1HYLA 1QL7A 5T3HA 1N6XA 2TGDA 3RXVA 1AQ7A 4Q2KA 3AAUA 1OYQA 1U6QA 4IBLH 2EQNA 3GCHB 1A61H 1OWHA 1C1OA 1IQMA 2KCYA 1GHAF 4BAOB 1SVPA 1HLTH 2FS8A 4ISOA 1DFPA 3BTDE 2ZFFH 4UEHH 2XBVA 2GX4A 4HZHA 5C0UA 2P16A 4RKOB 1ACBE 1EAIA 4ZKRU 1KXFA 2W7SA 1V2MT 2NU3E 1A2CH 1TNJA 1GBHA 1Y3XA 1OWIA 1TMUH 3ZZ4A 1LQDB 1GI0A 1UVOA 2BMGB 2XBWA 1KLJH 1C4U2 1PPCE 4IC6A 4DOQA 1M9UA 2LNCA 1TGBA 3UPEA 2IN2A 1DVAH 1HAHH 1O3GA 3RXHA 3TJUA 3M5MA 3MU1A 2SGDE 2J98B 1V2PT 1BMFD 1GMDF 4X2WA 3U1IB 8GCHG 2G8TA 4AYVB 3SHCH 3TH4H 1AN1E 1N8OB 3RXJA 4JZIA 4A1TA 2WSSD 1HJAC 1L2EA 2SGQE 2ZGBH 1MTUA 3F9FA 1J14A 1GMCG 2R2MB 3LC5A 2WPJS 1CGJE 1IQGA 3KQDA 1HBTH 2IPHA 1AWHB 1C1UH 2KAIB 1C1VH 2ZU2A 1MBMA 1FXYA 1GVKB 2IJD1 3NPSA 3RXOA 3ZVDA 3GDSA 2WPLS 1YPHE 4X0WU 3HK3B 3GYLB 2ZFTA 1GHVH 2UUJB 1AE8H 1DLEA 1YLDA 1K9OE 2UWPA 4CRBA 1NS3A 1IQFA 4AYYB 2ZFQH 4ZHMU 1O3CA 2P8OC 4CH8B 1C2IA 1VGCC 1TABE 2WV4A 2FO9A 4WH6A 3UNRA 1MD8A 1ZRKA 5F8XA 2Y6TA 4THNH 2O8LA 1SLVB 1O2LA 1SGRE 4A1VA 2I6SA 1WXRA 1G3EA 4D9RA 1GGDB 3JZ2B 2BX4A 5ESTE 1GG6C 1GBBA 4FOUC 2V6NA 4FVDA 2W7UA 3RXUA 3M3SA 3A7YA 1LHEH 1A1RA 4IW4E 2BDBA 4RT1A 1NC6A 1UVTH 1HIAA 3GCHC 1Y3UA 3UR6A 1F0RA 5GDSH 1PYTD 2ZC9H 1ZJKA 1ELEE 2Y80A 3EGKH 3PWCA 1DT2A 2VGCB 4WH8A 2KFWA 3ATIA 4BAKB 4AFSA 1MCVA 1O5EH 5L6NH 1H9LB 1TNLA 3MO3A 3M5LA 2CGAA 5EJZA 3U98H 3BTKE 1UCYK 1ZHMA 1DPOA 2PTNA 1FJSA 1T32A 4XBDA 3RXRA 4AC9A 1WCZA 2BXTH 4D7GA 2FTLE 2ZTYA 1PYTC 2A45B 1FY8E 1D6WA 3NWUA 3SJ8A 4B74A 2UWOA 3FKSD 5FPSA 1ZMLA 1O2TA 1C2GA 3PM3A 1TMTH 2TGTA 3STIA 4DVAU 4K2YA 3RXAA 3RXPA 3BF6H 2AFQB 2FLBH 1S0QA 4UDWH 1XXDA 3P95A 2J95A 4I86A 3RXCA 2PSXA 1N8OC 4NWLA 2GCTB 8ESTE 1C5WB 1RFNA 3SUEA 4AB9A 2GCHF 1HUTH 1O2KA 2ESTE 2K8IA 1WQVH 4MDSA 4K1SA 1OP0A 4ABJA 1BUIA 3GY3A 2CXVA 1OS8A 2VH6A 1MKXH 1SQAA 3MU5A 1W12U 4B76A 4ZMAH 5DO4H 1Z8IB 1O33A 1O3HA 2BDAA 2XW9A 1FZZA 1C2KA 1HIAB 1S0RA 1C5QA 2Y81A 1HAYB 3ZZ9A 1RRKA 1UO6A 2ZHFH 5KGOA 3L3TA 4CR9A 4X2VA 8KME2 2V0BA 1K2I1 1MCTA 1SL3A 2XNDD 2YMSB 5IDKA 4JK5A 5DGJA 3LGIA 3F9HA 2BD7A 3RXGA 3SN8A 4AORA 4FVBA 4B6FA 3IWMA 1QB6A 3ZZAA 1GGDC 2VWOA 2Q6DA 3QLPH 3ZZBA 1C1QA 2JIZD 2BOHB 1GHBF 4ABGA 3KEEA 1YP9A 1F5RA 2FWWA 2UUYA 1C5OH 2Y5HA 1GBDA 1CO7E 1QFKH 1YCPK 4ASUD 3P6ZB 1YPGH 2BVRH 5HGGA 5GCHF 3S0NA 1TAWA 3A82A 5HM9A 2HPPH 1YPMH 5FX5A 3RUOA 2VGCC 3DT0H 1ZJDA 3OEED 3MTYA 1TOMH 2WZQA 2ZPSA 1ARCA 1ANBA 2W26A 4H6TA 1QY6A 1BRBE 7ESTE 2GT8A 2TBSA 5EODA 1O37A 5CDFE 1S85A 1P2KA 1JMOH 3RXEA 1UTKA 3BTTE 2IJOB 1W0JD 2GMTB 1TPOA 3BG4B 1GJBB 4MNYA 4IN2A 5CHAB 3UB0A 4LZ4B 1GVLA 1DWCH 2TIOA 3FO8D 3ZZ6A 4TSFD 2QF0A 2WUBA 3UUZA 5ABWA 2AIPA 4B1TA 2XC0A 4NIWA 1TRMA 1QJ7B 1KXAA 2BLVA 3F6UH 1GMHF 1BTWA 3TGKE 1C1WH 2GCTC 4H4FA 1EASA 1Z1IA 4AZ2B 4I8JA 4WVPE 2Z9KA 1QB1A 4BTUB 4FUCA 1Q2WA 3FANA 1J8AA 3F9EA 1GVZA 2BDIA 1C2HA 4K5ZA 2HNTC 1PQ5A 3QX5H 5EXMA 2ZGHA 1NU7B 3HATH 3LGVA 1DUAA 3E1XB 3MNXA 4CRGA 2GV7A 3T5FH 1C2EA 1P9SA 2V7QD 1CHOG 3MH6A 1ELAA 1FN8A 4Y79A 1Y3WA 2W3KA 4BAMB 1V2KT 1K21H 2OC7A 4X2YA 2FI5E 2A32A 3M7UA 2YMSC 2ZI2H 2PKSB 2ZCKP 1TNKA 1C5NH 1V2WT 1E0FD 4IGDA 1AVWA 1LVMA 4Z1MD 1D6RA 4B6EA 3STJA 3OFND 1UTNA 2IOTA 3CS0A 2ZGJA 3QO6A 1O2GH 3OEHD 1IQJA 4DJZB 1O34A 3A83A 3B9FH 2C90B 4D9QA 5A0BA 5E8EH 3SV9A 1GBMA 2Y82A 2Z7FE 3RXLA 2HVXA 2F9VA 2VWMA 3M37A 2C93B 3QZRA 5LPFA 4FUIA 2A4QA 2WPDD 4K3JA 3SI4H 1OWJA 4X2XA 5C5NA 3P92A 2F9OA 1LQEA 2Z9IA 2KM0A 4ISNA 4WMFA 3RP2A 4INKA 3F0OA 1YKTA 4I33A 1GJAB 2H6MA 5EQRA 3GY8A 4Y76A 1J9CH 4AFZA 1ESBA 3FFGA 1SGNE 3GCTF 1C1SA 2OD3B 4A1XA 1WOFA 3MH5A 2GMTC 1OP2A 2PGQB 3D23A 3S69A 3M7QA 4BOHA 3BG4C 5CHAC 1O38A 4FUBA 3SU0A 2HNTE 1BTYA 1XUIA 5AVDA 1J17T 3EA9A 1ANCA 1K1JA 4IC5A 3MI4A 1ABIH 4LK4A 1MTSA 4ABFA 2HNTF 2ZDMA 1L4DA 3OE7D 2ZFSA 3VFEA 3ZV8A 2BDYA 4XBCA 2H1UA 3LGWA 3P8FA 2C8XB 4O03A 3TPIZ 4I8GA 4ABEA 3HGPA 3ZZ3A 3TGIE 1TQ0B 3AK5A 2YNAA 4H6SB 2FMJA 1F0UA 3MU8A 4XE4A 2A4RA 4AG1A 1NO9H 2FOBA 1O0DH 5CHBA 1K1PA 1EJMA 1LKBA 2A31A 2FDAA 4MPUA 1PPEE 2BY9X 2OC8A 2EC9H 1HRTH 1HXFH 1ZLRA 1MUEB 1OP8A 2BY6X 3RC5A 3AASA 2EI7A 3LOXA 1AZZA 1S81A 2GV6A 2PHBA 5FHTA 2CN0H 3SGBE 1NTPA 2Z9GA 2NU0E 1V2VT 2WV5A 1BQYA 1TPPA 3QGNB 2ZDNA 1SFIA 2BM2A 2OC0A 3ZYDA 1A7SA 3F1SB 1YWUA 5A0AE 1DOJA 8GCHF 1AI8H 2A7JA 2PKSC 5TJXA 1A46H 1BRUP 1KDQA 3MQKC 3M3VA 3MH7A 4WXIA 5JBBS 3ATMA 4A7IB 2A4GA 5AFZH 1UTQA 3O8BA 3Q3YA 3A8CA 4TWWA 2RCEA 1COWD 3LIWA 1L1JA 4UFEH 1FPCH 1O2HA 3FVFB 1JXPA 2J9NA 5DP7A 2R2WU 3TJOA 5C0TA 1ARBA 2VWLA 4Y7AA 1A5IA 3H09A 2PSYA 2RA0A 2XBYA 1GL1A 3OY6U 2BLWA 4WMEA 5EQSA 3SI3H 4Y10E 1C2DA 2OCVB 1ZSJA 4YOIA 5GJ4B 3D65E 1WAYB 3E91A 3ATKA 3L6PA 1ANEA 1AU8A 1QCPA 1UTJA 3MNCA 3A89A 1FX0B 2O8WA 2Z3EA 1W8BH 2SNVA 4UONA 1HAZB 4XRNA 2HVYB 1MMJN 1PPZA 1EB1H 3K6YA 3SJOA 1WBGB 2B9LA 2B8OH 4XOJA 3W94A 1QBVH 4Q7ZA 2W6JD 4BANB 2ZF0H 4JZFH 1GHWH 4ZROA 2OP9A 2SGPE 3SO3A 1QGFA 1GI4A 2VVCA 1KLTA 1NRNH 1W13U 3ATWA 4INHA 5EPNA 1L4ZA 3VPKA 2HLDD 1T7CA 3ESTA 2ANKH 2G55A 2FS9A 1PJPA 3P8NA 1LHDH 3SV8A 5J4SA 1ZR0A 2BQWB 2J34A 3UTUH 2HPQH 3KQCA 2J38A 1SQOA 1FY5A 1A0HB 2J4IA 3DD2H 3EDXB 2OTVA 3RXTA 1WUNH 1SGFG 1JIRA 2XCNA 1O3KA 5JPMH 1W3CA 2BD9A 1THRH 3MHWU 2Y5FA 2AEIH 4WMDA 5HIYA 2ZCHP 1KDQB 5FCKA 5E0JA 1W7GH 2H5DA 2P59A 2BDCA 2WYJA 1PPBH 2OXSA 2FYRA 4I31A 1XUJA 2FOHA 3A8DA 2PKAA 4NSVA 2RFKC 1O5AB 1XUGA 1CT0E 1XVOA 2XWBI 5B6OA 1YPJH 1GBKA 2VBCA 4A92A 1MQ6A 3RMLH 4B71A 2WPIS 1RTKA 1C9TA 4NZQA 4X1PU 3GCOA 4D76A 3GY6A 3A8BA 1LVBA 3A85A 1P2JA 2QIQA 1YPKH 2QN5T 2ULLA 1G2MA 1B7XB 3EE0B 1EZXC 2BOKA 1FI8A 1WTGH 2JH0D 1OKXA 1XUHA 1S6FA 1ELTA 1BMNH 1P12E 3SNCA 2PTCE 2AIQA 4Y8YA 2CV3A 1HAPH 3P8OA 1A3BH 3KQ5A 2PW8H 5GXPA 1IHTH 1MZDA 1TNGA 1BTXA 1D3DB 2GZ9A 1IQHA 2W6ID 1ANDA 1CU1A 4XSKU 1SR5C 1THSH 2O9QA 1GI5A 4DT7B 2SGEE 1G32B 4KELA 3BTME 3SU5A 2ZDLA 3D62A 1TIOA 2BB4A 2FI4E 3LPRA 1XM1A 3KHVA 3GY7A 5G4BA 1GJ8B 1GDNA 1ZGVA 3T62A 1K1IA 1O2XA 3C27B 1GJDB 4ESTE 1LVOA 4YT7H 2DE8A 1WTHD 1GJCB 1WDIA 2O8MA 1SKYE 2PKAB 3LONA 2Y7ZA 1EOJA 1YY3A 2ZA5A 1TX7A 1O5CB 4K60A 4WWYA 2I6QA 1CBWB 3TGJE 5B6LA 3T27A 3DFJA 1YF4A 4GHTA 4B2BA 8LPRA 1FIWA 2ZGCA 3M5OA 3T29A 1SGQE 1PPFE 1HV7A 3Q77A 4X1QU 3PB1E 3U8OH 1VZQH 1NRRH 3SHAH 5IK2D 3SNEA 2FZZA 4INLA 2ILNA 2VIWA 1BIOA 5C1YA 3NZIA 1GI2A 4GLYA 4U2WA 1SSXA 3MO9A 4IMQA 3DA9B 3I77A 4ABBA 3E0NB 3T2NA 1Z1JA 1Z8GA 2BDGA 2FI3E 3CENA 2OUAA 4X6MA 1ZPBA 3GOVB 1E38B 2FEQH 3T26A 3E0PB 1D3QB 4BAQB 4AX9H 1ORFA 1O2RA 4MTBA 3RU4E 5HIZA 2ZHEH 3KN2A 3TNSA 2PP6A 1VCQA 1SOTA 1CGHA 3PV4A 4AB8A 5C2ZA 3H7TA 1EZQA 3F2FA 1MTVA 2H5CA 5EU8A 3SU6A 2C8WB 1NFUA 2Z6BD 1BRAA 1O2VA 3E3TA 1O5FH 3SJKA 1FAKH 1O3IA 1PQAA 2H2ZA 4R0IA 2AMDA 1H9IE 1AIXH 1CHOF 3TK5A 1C5YB 1P05A 2FOEA 6ESTA 1SGTA 4NIYA 2ZU4A 4AFQA 3PV5A 4F55A 5EQQA 1C1MA 1AKSA 1KXCA 2ANWA 2Q1JA 1DM4B 4Q7XA 3A88A 1O2QA 3M3TA 3UNSA 3OTJE 2XNIA 3KCGH 4J1YA 3PWBA 5DSFA 1EPTA 4ZUHA 2ODPA 1DLKB 2DE9A 7GCHG 1VKYA 3PLBA 1YLCA 3BTQE 7KMEH 4DY7B 1Y8TA 5GPIB 1L1GA 2UUFB 1O3OA 3SV6A 1P10A 2BQ6B 1Y3YA 4J2YB 5C94A 3MU4A 3G01A 2STBE 4JYVH 3UWJH 3ITIA 1TBQH 1NBMD 1CBWC 3HPTB 2V3OH 4CBOA 1LPZB 2VVVA 3BSQA 2HOBA 3DUXH 1W2KH 5ESBA 1UTOA 1ZTKA 1SMFE 2TGAA 4Y8XA 1O2UA 3KF2A 5FXLA 4AGKA 1K0HA 1BZXE 1S6LA 5ETXA 1P2MA 4IMZA 1GBJA 4ZHLU 2LPRA 2F91A 3DSPA 1K1OA 1SGYE 4JZ1A 5EXLA 1LPKB 4MNVA 4CRCA 2G5NA 2QXHA 4OGXA 2PLXA 3BTEE 4ZXXH 3SJIA 3ENSB 5LH8A 3RXDA 1MABB 1RJXB 1HJ9A 5T6GA 3LH1A 5DN6D 2KCPA 2ZHDA 1GHXH 1ZZZA 2XC5A 4JZEH 1UVUH 3TK9A 1EATA 2PV9B 4UFGH 2PR3A 1A5GH 1DWEH 5F03A 5EOKA 1TPAE 2WPMS 2ZPRA 1AKSB 1GBAA 3O8RA 1LHGH 1TOCB 1GHYH 4MLFB 2BVXH 3GYMA 5JBCS 1BRCE 1GBEA 2GDEH 4X6PA 3TH2H 1EPTB 1D9IA 3F3BA 1W7XH 2JH5D 4YLQH 6LPRA 4Q7YA 3IG6B 1BMLA 2Q6FA 1C5PA 1NPMA 1RD3B 1ELDE 3ZIAD 1GI6A 3URCA 1EJAA 2KZ4A 1IAUA 5BPEA 1QB9A 1AGJA 4ISIH 1JOUB 3KGPA 4GHQA 1A0JA 3GS9A 1OPHB 4K8BA 2IPQX 2THFB 3Q3XA 3S9AA 4NFFA 4ZKOU 4YM9A 2AERH 3EAJA 3SQEE 4CR5A 1QR3E 1V2RT 1DDJA 1EP6A 2QF3A 2F9BH 1GJ4H 1NT1A 1FMGA 4E7NA 3EQ0H 2BD8A 1RIWB 2Y7XA 2ZQ2A 4CREA 1BCUH 2ZP0H 2NU2E 4HFPB 2QAAA 4ASHA 3SGQE 2GKVE 2OQ5A 1ZHPA 4GCHG 2LP6A 4O3UA 2VIDA 3VXEH 1EB2A 1MKWK 2FM2A 4B2CA 3T25A 5FCRA 2HWLB 2ZHQH 3F2HA 5C1XA 3DSOA 5L2ZH 1SHHB 4Y7BA 1T8OA 3ATLA 1S84A 3SZEA 1UK2A 3UNQA 2FOGA 2O8UA 1UW7A 4BTIB 4CBNA 5KECA 3A81A 2A5IA 1SQRA 4XBBA 3RXBA 1KY9A 1S83A 1RXPA 1GI1A 1GBCA 2QF4A 5HXFA 1Y5UT 3PTNA 4MPVA 5CE1A 2L74A 5CMXH 3SW2B 5JB8S 1ZPZA 2ZFPH 1QRWA 2FIRH 2GP9B 2AYWA 1SPJA 1AFQB 3QGJA 1P57B 2F3CE 1P0SH 4NIXA 2XCFA 1WYKA 1AHTH 1TNIA 4KP0A 1N1LA 1E1RD 1A4WH 1LPGB 2FOCA 3A80A 3TK6A 1O3EA 1MU6B 1H8DH 1YLNA 2BX3A 3I29A 1P2IA 1DWBH 3QDZB 1ABJH 4U32A 2GJGA 1W10U 1EPTC 3LDXH 1P03A 2BY5X 2FX4A 3QN7A 4B73A 3NRLA 1K1LA 5EW1H 2HRVA 1T31A 1YYY1 2D26C 1DY8A 3GISB 2FOFA 4X8SH 2HGTH 3N99A 2G00A 1A5HA 3QUMP 1TRNA 1GBLA 5EPYA 2ZWLH 4JK6A 1WU1A 5DP8A 2ANMH 1AO5A 4TPIZ 3A7VA 2PUQH 3HKJB 3HKIB 1UK3A 1C1RA 3SQHE 2WV9A 5F6MA 1J16A 1T4UH 1GBTA 3F0PA 1G36A 3KYGA 3UQVA 3C1KA 2ZIQH 1KXDA 2FP7B 1RTFB 3QK1A 3PROA 1JIMA 2OC1A 1VCWA 1MAXA 1JRTA 3SNDA 1O2IA 1DUEA 2WPKS 1BT7A 4OS4A 4HTCH 3RM0H 2XTTB 2P93A 1RIWC 1KXEA 1MH0A 2BD2A 2FYQA 3NUMA 2BZ6H 4AG2A 2F4LA 4P02A 1FONA 4ACBA 1BTUA 1TBRH 2J97A 4ABHA 1F7ZA 1W11U 2V3HH 4GAWA 4YLUA 1C5UA 4X6OA 2ZU3A 4HI3A 1Y3VA 2D8WA 1DICA 4NZLA 1L1NA 3OAAD 2J5UA 1FQ3A 1F0TA 4DW2U 1H8ED 1QZ8A 2STAE 4X8TH 2WYGA 2W3IA 3P17H 1E1QD 3A84A 5FPTA 1EAXA 5PTPA 1SGDE 1PQ7A 1SGIB 2L6OA 1UCYH 2CHAB 2A2XH 2CK3D 1G3CA 2FPZA 4O3TA 1XVMA 1AWFH 2AH4X 1XUKA 2QE7D 3AVZA 3Q76A 1OHHD 2GCHG 4DGJA 2BTCE 2RDEA 3GDUA 2Y5GA 4DCDA 4GVUA 3VEQB 5LPEA 2HLCA 4Q80A 3B23B 1V2ST 1H4WA 1BBRK 3SOSA 4Y6DA 3PMHB 1HFDA 1IQLA 1EP5A 3DFLA 4FU7A 1GCTB 2RDLA 4K1TA 4MPWA 5AHGH 1E34B 1FY3A 2C8ZB 1O2ZA 4M9FA 1AD8H 4F48B 1O2SA 4ABAA 3SGAE 3VB3A 2ZEBA 6CHAB 1K28D 3KNXA 1NFXA 1C5RA 3RM2H 2F43B 4X1NU 1DXPA 4UE7H 4ZHAA 3ZVBA 3A8AA 2W5EA 2P3FH 1THPB 3SZNA 1WQSA 1TALA 1HPGA 3K6ZA 1TA6A 2VVUA 3VB4A 1QJ6B 4CRAA 1CSOE 3MU0A 1QBNA 2A5AA 3BV9B 9LPRA 1AE5A 1P04A 1GMCF 3MWIU 4ZKSU 2XXLA 4MNWA 2Z9LA 2BLOA 1LDTT 3K2UA 4RI0A 2GVFA 3ZZ5A 4I8KA 4Y71A 1SFQB 2TRMA 5JDUB 4NG9H 3LH3A 1O5BB 3I78A 3B8JA 1YPLH 3U28C 1NU9A 5I25A 1DXWA 3A7XA 1QL8A 4OS1A 2ZDKA 5GCHG 4NSYA 4WJG2 3UOPA 3RXSA 3OU0A 3TLOA 4SGBE 1UJ1A 5DP4A 3M5NA 1F92A 1OWKA 1FLEE 3OX7U 5FPYA 2CMYA 1TBZH 1KSNA 2VJ1A 1YCPH 4ISHH 1C5MD 3RDZA 1VITG 4E06H 3NKKA 1TFXA 3V13A 1DX5M 1XUFA 3H5CB 3RXIA 1Z6JH 2ZHWH 4OM9A 1HGTH 1FAXA 1XKAC 1C2MA 2ZKSA 4KKDA 3CS7A 1XMNB 4F4OC 3R0FA 5IYTA 3GY5A 3AW1A 1IQIA 1A0LA 3OYPA 2Z3CA 2ZGXH 2QGRA 1IQNA 3MOCA 1UVSH 1S5SA 1UK4A 2CHAC 1O3MA 1ZTJA 3EYDA 7GCHF 4TWYA 2BY7X 1VJ9U 2QC2A 1Y5BT 3F2GA 3PRDA 4HG6A 4JCNA 1GHZA 1C9PA 5EXNA 4LXBH 1O3PB 4Y0ZE 2RG3A 3A7WA 5EG4A 2JJ1D 1AVXA 4FETA 1P02A 2J94A 1SGEE 3LGUA 3T28A 1GCTC 3VB6A 3BN9A 2SNWA 4WY3A 1HAVB 3BTGE 1AY6H 3A86A 2ALPA 4X1RU 5K0HA 2V35A 3U8RH 6CHAC 1SB1H 1SLXB 3LC3A 1IOEA 2YNBA 3R3GB 2BD3A 2TPIZ 4Z6AH 3QTVH 6GCHG 2A4OA 3ZZDA 1MKXK 1W0KD 3MMGA 3FZZA 1BMMH 4K1EA 1GBIA 1FN6A 4FXGH 1AMHA 1NRPH 2C4FH 3ELAH 2BD5A 2GZ7A 1TX8A 1UTLM 1GI8B 1P11E 2JETB 3SBKA 3LJJA 5SGAE 2B5TB 1NRSH 4UD9H 2OINA 2ZTXA 1QHRB 1B0FA 2XRCA 1BITA 1ETSH 3SJ9A 1SGCA 4GPGA 1SC8U 2D2DA 1GWAA 2QXGA 2ZG0H 5J4QA 1P2OA 3PLKA 4MG3A 2K1QA 2OQUA 3MNBA 1C4Y2 1TGSZ 1NRQH 1E36B 2FXRA 1ID5H 2AGEX 5DJ7A 1X7AC 4I8LA 1G37A 1Z71A 3ZZ7A 2CJIA 2VIPA 1V3XA 2PGBB 3RXQA 1BJVA 1C5TA 3Q3KA 1IQKA 5A8ZA 1C2JA 1HXEH 1V2LT 3MYWA 1B0EA 4DIIH 1TWXB 4TT3D 1SGFA 4M7GA 1OOKB 2D1JA 2VIQA 1SLUB 3LGYA 2WINI 4VGCB 1V2NT 3P8GA 1O2NA 5HKKD 3TU7H 2BDHA 3ZVEA 2M2AA 1ETRH 4LOYH 3ODDA 5T1VA 1MTWA 2PWXA 2JKHA 4K69A 2EA3A 1FDPA 5JYIA 4YO9A 3ZV9A 1CGIE 1HAGE 1LHCH 3EE7A 2QXIA 3K9XB 3HGNA 1P3EA 3N7EA 3OY5U 1PPGE 1QNJA 3F9GA 4YZUA 1ESTA 4GCHF 2ZZUH 3GDVA 5FAHA 5KEDA 1AVGH 4FU9A 5EJLA 1LCYA 1O3BA 4FUFA 3RMNH 4X8UH 4MQAA 2BQ7B 2GD4B 1NESE 1ZMNA 3PO1B 3U9AH 1OWEA 1O3JA 2QV1A 2OLGA 1GJ9B 2UWLA 1C5LH 3PMJA 4HGCA 5F53A 3PV2A 1BBRH 4X6NA 3UAIC 3M36A 2P95A 1NY22 1V2OT 3UY9A 1XKBC 1JBUH 4CH2B 2JETC 4CRFA 4ACAA 1YC0A 4KGAA 2VWNA 1C5ZB 1KMHB 1UHBA 4BAHB 2ZDVH 5GIBA 1G30B 3WWBA 2AS9A 4X1SU 1E37B 4U30A 2KCAA 1CA8B 1TLDA 1TGTA 1UCYE 4CRDA 2FESH 1KLIH 5GWZA 1BHXF 2GGVB 2QA9E 1H8HD 5E2PA 3RU4T 1SQTA 1LTOA 1SHYA 1JWTA 3A7ZA 3U1JB 1AB9B 2FLRH 1HCGA 4WF8A 4OS7A 1O3FA 2GT7A 1V2QT 3URDA 2WUCA 3W95A 1IQEA 3O8CA 1MTNB 5EJ1A 1C1NA 2EY4C 4NGAH 1EFRD 4AFUA 2DUCA 1P3CA 3GICB 4GSOA 3M35A 1NFYA 5FBEA 1GPZA 4Q63A 1HAOH 1FPHH 3JZ1B 3KQBA 5E2OA 5A8XA 4VGCC 3SYJA 3TH3H 2B7DH 2YOLA 2BLQA 3ODFA 1DSUA 4BNRA 3SUGA 1XX9A 4DIHH 3S7HB 3RXMA 1SG8B 1HAIH 2RA3A 2R3YA 4KTCA 1E35B 3SNAA 1TQ7B 2P3UB 3ZVGA 2ZU1A 1W0YH 4MNXA 3BIUH 1O31A 3N7DA 2OK5A 5HYOA 2QCYA 5E0GA 5A8YA 1BTHH 1MBQA 2EI8A 2J2UA 1TRYA 4JYTA 1Z8RA 7LPRA 1ZRBA 2SGFE 3U8TH 1EJNA 1DE7H 2QYIA 4Y11E 1UHBB 3LJOA 3KIDU 3PLPA 1EAWA 2EI6A 3SUDA 3PO1C 1H8IH 4KTSA 1QBOA 1ELBA 1CQQA 3RLYH 2Z3DA 5DP5A 1V2TT 4ABIA 1H1BA 1L0ZA 2VB0A 3VB7A 4XFQA 1O2MA 5L2YH 3TJVA 2BYAX 3A7TA 1QQ4A 1PFXC 5DG6A 1JRSA 3UOUA 1SGPE 4MPXA 3RC6A 1ZGIA 4ZKNU 1DSTA 3M61U 3WW7A 1VCPA 2FOMB 3E6PH 2QY0B 4LZ1H 4BTTB 1W14U 3QTOH 2A5KA 3N7OA 2CF8H 1OSSA 1Z6EA 4QT8C 1QRXA 3FZDA 2G51A 2CF9H 2G4UA 2R9PA 2XC4A 3KYFA 4DT4A 3MNSA 3PRBA 3BG8A 1AB9C 4ZXYH 1O3AA 1HNEE 1QURH 1CVWH 2C8YB 4GUXA 4SGAE 1T8LA 3MH4A 4FUHA 1CT4E 1YM0A 1FIZA 2XOKD 4YTAA 3FP7E 1OYTH 1MTNC 1GHAG 1WSSH 2OBOA 2KX4A 1F2SE 5AF9H 5EIYA 1TGNA 2B0FA 1P06A 3ZVFA 2PUXB 1BJUA 2BVSH 1BA8B 1UVPA 1GJ7B 1T8MA 2GTBA 1ZPCA 2Z94A 1NBME 1O2WA 5C3NA 3LT3A 1RTLA 3SV7A 4I8HA 1C1TA 2AGIX 1DY9A 1C1PA 1PQ8A 3SUFA 3OTPA 2BHGA 3GY4A 5TCCA 2A2QH 4RT0A 1GJ6A 1F5LA 2JDID 1F5KU 5DK1A 5FX6A 2Q6GA 1BOQA 3HK6B 2F9NA
chains in the Genus database with same CATH topology
2HALA 3SU4A 1YCPM 1S6HA 1NFWA 5AFYH 3S7KB 3ZZCA 2ZDAH 1G3DA 3FP8E 2H9HA 1SOZA 1ELCA 1GMDG 1GBFA 1GI9B 2VINA 3SU1A 1N6YA 1NZQH 1VITF 4YT6H 1C2LA 1Q31A 1P09A 4A5TS 1CA0B 1TX6A 2AMQA 4I7YH 2XWAA 1D3PB 1BTPA 1V2JT 5T6DA 2ODYB 3E16B 2FTMA 2QXJA 2FX6A 1Z7KA 4WXVA 1NROH 5BRRE 1BDAA 5LGOA 1IHSH 1UTMA 3PMAB 4NA8A 1CHGA 4O9VA 1H9HE 3VGCB 2G4TA 1GCDA 3NCLA 3ZYEA 1QL9A 4JYUH 1QTFA 1FNIA 1O5GH 3ZVCA 1NM6A 3TNTA 2SGAA 1TNHA 1TONA 1MD7A 3H7OA 2G52A 2ODQA 1C5VA 1V2UT 4IS5A 1AUJA 2XYAA 4JZDH 2ZO3H 1ELVA 3GCNA 3UREA 4TYDA 2P3TB 2A0QB 1F0SA 3AAVA 5DPAA 4F49A 6GCHF 4PROA 2NU4E 1EZUC 3LU9B 4FUJA 3RMOH 5EGMA 1ZTLA 2ZCLP 5FBIA 5C20A 1B5GH 1OWDA 1OX1A 4FUDA 4RKJB 5DP9A 1P2NA 3V7TA 4DURA 3SU3A 1FV9A 1KXBA 3V0XA 4OS6A 1O2OA 1C2FA 1LKAA 1Q3XA 4CHAB 4DG4A 2XBXA 1TMBH 2NWNA 3WY8A 1BBRE 1CE5A 1P8VC 1SI5H 4FUEA 1ETTH 1AZ8A 1P9UA 1LO6A 2VNTA 2VU8E 4JMYA 4ZAEA 3OSYA 2P94A 1O32A 5DP3A 4I32A 5F8TA 1O5DH 5L30H 3MO6A 1HB0B 2PFEA 2ZTZA 2ZFRH 1O39A 2ZECA 1T4VH 1EQ9A 3Q00A 3ZVAA 4OGYA 4OS2A 1EUFA 1CA0C 1ELFA 1TPSA 4X8VH 2H9EH 2ZU5A 2NU1E 1MZAA 4YOJA 5A0CA 1HJ8A 4YESB 4NA9H 1O3NA 1KYNA 4E7RG 3PTBA 3O8DA 5JB9S 2ZQ1A 1ZSKA 1QIXB 4E05H 1AFQC 2BY8X 3UWIA 1V6DA 2BZAA 1MAYA 2Z9JA 1UTPA 4NA7A 2R0LA 2VIOA 5TCAA 1FY4A 1AUTC 3CP7A 3DHKH 1ESAA 3VGCC 1GJ5H 1A3EH 1EOLA 4D8NA 1OXGA 5H4IB 4Y8ZA 1SBWA 1ZOMA 5JBAS 2GZ8A 1GDQA 1GI3A 1UMAH 1KTSB 4A6LA 4ZH8A 2ALVA 3UFAA 2ZNKH 4UFFH 1BTZA 3RMMH 2G81E 1Y5AT 1TYNA 1C4V2 3AW0A 1RGQA 5DKMA 4XDEA 1DS2E 2FOAA 1T8NA 4KTUA 1GDUA 2G5VA 1HAVA 1O3DA 4TY7A 5I46H 5DP6A 5EW2H 5HMAA 3BEIB 1FUJA 3A87A 2F9UA 1GHBG 3FP6E 4Z0KA 4U01A 1Y59T 1MQ5A 1W0ZU 3F68H 2R0KA 3TITA 1K1MA 1YGCH 4B75A 2R3UA 3BIVH 3VXFH 3E8LA 3EA7A 2A7CA 1QA7A 4NWKA 3RXFA 5LPRA 1VR1H 1KIGH 3SNBA 1DITH 1LVYA 4D7FA 3BEFB 4R8TB 1RS0A 4AN7A 1LHFH 2AGGX 1DANH 4CHAC 5A2MH 5A09A 1ZSLA 2O8TA 1LMWB 5JBTA 3ZZ8A 4BXWA 3MFJA 1HDTH 1BHXB 1K22H 3V3MA 1O36A 3V12A 3LKWA 2AMPA 1BB0B 1EZSC 1FY1A 2H9TH 2C3SA 5E0HA 3RXKA 3EA8A 4FU8A 3KL6A 1WV7H 1HAXB 4NFEA 4H42U 1J15A 3S9CA 3QWCH 1GMHG 1C5SA 3E90B 4ABDA 1AFEH 2ASUB 4MVNA 2ANYA 2F83A 2VH0A 1O30A 1ZYOA 2UUKB 1GI7B 1INCA 1Z8JB 4ISLA 1MKWH 4UFDH 3UIRA 1YPEH 3L33A 1MU8B 3S9BA 4NIVA 2J92A 1O35A 1TGCA 4TPYA 2A7HA 1GL0E 1O2JA 4RN6A 2EEKA 4YOGA 1SLWB 5C1UA 1XXFA 1ELGA 2TGPZ 3PMBB 3FAOA 1G9IE 3LGTA 3BTFE 4Y0YE 4BXSA 1EKBB 1D3TB 1C5XB 4TY6A 4B2AA 3D49H 1O3LA 3RLWH 3TIUA 1NN6A 1HJAB 1TE0A 3SV2H 3UQOA 3UR9A 3QZQA 4IN1A 5C67A 1QA0A 1DWDH 5K7RA 3KQEA 4RSPA 1KTTB 2M5TA 2OBQA 5T6FA 3BTHE 2ZPQA 1EXFA 1VITH 3TVJB 3RU4D 4AGJA 2GDDA 2BXUH 1O2PA 2SFAA 3BEUA 3BTWE 1VJAU 2JH6D 1PPHE 2VIVA 5F8ZA 2A1DB 3SORA 1BMAA 1P01A 2BD4A 1O2YA 1TB6H 3VB5A 1ZMJA 2P8OB 1QQUA 3IITA 1P2QA 4K8YA 3M7TA 1VGCB 2WPHS 1QRZA 3PYHA 1CT2E 9ESTA 4FUGA 4NCYA 1G3BA 1EX3A 3GY2A 3P70B 1G2LA 1K1NA 3RC4A 3TJNA 1YBWA 4AOQA 5C5OA 3NK8A 2FODA 1S82A 1ZHRA 2KAIA 1QJ1B 1D4PB 3GCTG 1GG6B 3K65B 4OS5A 1EAUA 4O97A 5HM2A 3SU2A 2F9PA 1YPHC 3U69H 3NXPA 1TA2A 1HYLA 1QL7A 5T3HA 1N6XA 2TGDA 3RXVA 1AQ7A 4Q2KA 3AAUA 1OYQA 1U6QA 4IBLH 3GCHB 1A61H 1OWHA 1C1OA 1IQMA 1GHAF 4BAOB 1SVPA 1HLTH 2FS8A 4ISOA 1DFPA 3BTDE 2ZFFH 4UEHH 2XBVA 2GX4A 4HZHA 2P16A 4RKOB 1ACBE 1EAIA 4ZKRU 1KXFA 2W7SA 1V2MT 2NU3E 1A2CH 1TNJA 1GBHA 1Y3XA 1OWIA 1TMUH 3ZZ4A 1LQDB 1GI0A 1UVOA 2BMGB 2XBWA 1KLJH 1C4U2 1PPCE 4IC6A 4DOQA 1M9UA 2LNCA 1TGBA 3UPEA 2IN2A 1DVAH 1HAHH 1O3GA 3RXHA 3TJUA 3M5MA 3MU1A 2SGDE 1V2PT 1GMDF 4X2WA 3U1IB 8GCHG 2G8TA 4AYVB 3SHCH 3TH4H 1AN1E 1N8OB 3RXJA 4JZIA 4A1TA 1HJAC 1L2EA 2SGQE 2ZGBH 1MTUA 3F9FA 1J14A 1GMCG 2R2MB 3LC5A 2WPJS 1CGJE 1IQGA 3KQDA 1HBTH 2IPHA 1AWHB 1C1UH 2KAIB 1C1VH 2ZU2A 1MBMA 1FXYA 1GVKB 3NPSA 3RXOA 3ZVDA 3GDSA 2WPLS 1YPHE 4X0WU 3HK3B 3GYLB 2ZFTA 1GHVH 2UUJB 1AE8H 1DLEA 1YLDA 1K9OE 2UWPA 4CRBA 1NS3A 1IQFA 4AYYB 2ZFQH 4ZHMU 1O3CA 2P8OC 4CH8B 1C2IA 1VGCC 1TABE 2WV4A 2FO9A 4WH6A 3UNRA 1MD8A 1ZRKA 5F8XA 2Y6TA 4THNH 2O8LA 1SLVB 1O2LA 1SGRE 4A1VA 2I6SA 1G3EA 4D9RA 1GGDB 3JZ2B 2BX4A 5ESTE 1GG6C 1GBBA 2V6NA 4FVDA 2W7UA 3RXUA 3M3SA 3A7YA 1LHEH 1A1RA 4IW4E 2BDBA 1NC6A 1UVTH 1HIAA 3GCHC 1Y3UA 3UR6A 1F0RA 5GDSH 1PYTD 2ZC9H 1ZJKA 1ELEE 2Y80A 3EGKH 3PWCA 1DT2A 2VGCB 4WH8A 3ATIA 4BAKB 4AFSA 1MCVA 1O5EH 5L6NH 1H9LB 1TNLA 3MO3A 3M5LA 2CGAA 3U98H 3BTKE 1UCYK 1ZHMA 1DPOA 2PTNA 1FJSA 1T32A 4XBDA 3RXRA 1WCZA 2BXTH 4D7GA 2FTLE 2ZTYA 1PYTC 2A45B 1FY8E 1D6WA 3NWUA 3SJ8A 4B74A 2UWOA 5FPSA 1ZMLA 1O2TA 1C2GA 3PM3A 1TMTH 2TGTA 3STIA 4DVAU 4K2YA 3RXAA 3RXPA 3BF6H 2AFQB 2FLBH 1S0QA 4UDWH 1XXDA 3P95A 2J95A 3RXCA 2PSXA 1N8OC 4NWLA 2GCTB 8ESTE 1C5WB 1RFNA 3SUEA 4AB9A 2GCHF 1HUTH 1O2KA 2ESTE 1WQVH 4MDSA 4K1SA 1OP0A 4ABJA 1BUIA 3GY3A 2CXVA 1OS8A 2VH6A 1MKXH 1SQAA 3MU5A 1W12U 4B76A 4ZMAH 5DO4H 1Z8IB 1O33A 1O3HA 2BDAA 2XW9A 1FZZA 1C2KA 1HIAB 1S0RA 1C5QA 2Y81A 1HAYB 3ZZ9A 1RRKA 1UO6A 2ZHFH 4CR9A 3L3TA 4X2VA 8KME2 2V0BA 1K2I1 1MCTA 1SL3A 5IDKA 4JK5A 5DGJA 3LGIA 3F9HA 2BD7A 3RXGA 3SN8A 4AORA 4FVBA 3IWMA 1QB6A 3ZZAA 1GGDC 2VWOA 2Q6DA 3QLPH 3ZZBA 1C1QA 2BOHB 1GHBF 4ABGA 3KEEA 1YP9A 1F5RA 2FWWA 2UUYA 1C5OH 2Y5HA 1GBDA 1CO7E 1QFKH 1YCPK 3P6ZB 1YPGH 2BVRH 5HGGA 5GCHF 3S0NA 1TAWA 3A82A 5HM9A 2HPPH 1YPMH 5FX5A 3RUOA 2VGCC 3DT0H 1ZJDA 3MTYA 1TOMH 2ZPSA 1ARCA 1ANBA 2W26A 4H6TA 1QY6A 1BRBE 7ESTE 2GT8A 2TBSA 5EODA 1O37A 1S85A 1P2KA 1JMOH 3RXEA 1UTKA 3BTTE 2IJOB 2GMTB 1TPOA 3BG4B 1GJBB 4MNYA 4IN2A 5CHAB 4LZ4B 1GVLA 1DWCH 2TIOA 3ZZ6A 2QF0A 2WUBA 3UUZA 5ABWA 2AIPA 4B1TA 2XC0A 4NIWA 1TRMA 1QJ7B 1KXAA 2BLVA 3F6UH 1GMHF 1BTWA 3TGKE 1C1WH 2GCTC 4H4FA 1EASA 1Z1IA 4AZ2B 4I8JA 4WVPE 2Z9KA 1QB1A 4BTUB 4FUCA 1Q2WA 3FANA 1J8AA 3F9EA 1GVZA 2BDIA 1C2HA 4K5ZA 2HNTC 1PQ5A 3QX5H 5EXMA 2ZGHA 1NU7B 3HATH 3LGVA 1DUAA 3E1XB 3MNXA 4CRGA 2GV7A 3T5FH 1C2EA 1P9SA 1CHOG 3MH6A 1ELAA 1FN8A 4Y79A 1Y3WA 2W3KA 4BAMB 1V2KT 1K21H 2OC7A 4X2YA 2FI5E 2A32A 3M7UA 2ZI2H 2PKSB 2ZCKP 1TNKA 1C5NH 1V2WT 1E0FD 4IGDA 1AVWA 1LVMA 1D6RA 3STJA 1UTNA 2IOTA 3CS0A 2ZGJA 3QO6A 1O2GH 1IQJA 4DJZB 1O34A 3A83A 3B9FH 2C90B 4D9QA 5A0BA 5E8EH 3SV9A 1GBMA 2Y82A 2Z7FE 3RXLA 2HVXA 2F9VA 2VWMA 3M37A 2C93B 3QZRA 5LPFA 4FUIA 2A4QA 4K3JA 3SI4H 1OWJA 4X2XA 5C5NA 3P92A 2F9OA 1LQEA 2Z9IA 4ISNA 4WMFA 3RP2A 4INKA 1YKTA 4I33A 1GJAB 2H6MA 5EQRA 3GY8A 4Y76A 1J9CH 4AFZA 1ESBA 3FFGA 1SGNE 3GCTF 1C1SA 2OD3B 4A1XA 1WOFA 3MH5A 2GMTC 1OP2A 2PGQB 3D23A 3S69A 3M7QA 4BOHA 3BG4C 5CHAC 1O38A 4FUBA 3SU0A 2HNTE 1BTYA 1XUIA 5AVDA 1J17T 3EA9A 1ANCA 1K1JA 4IC5A 3MI4A 1ABIH 4LK4A 1MTSA 4ABFA 2HNTF 2ZDMA 1L4DA 2ZFSA 3VFEA 3ZV8A 2BDYA 4XBCA 2H1UA 3LGWA 3P8FA 2C8XB 4O03A 3TPIZ 4I8GA 4ABEA 3HGPA 3ZZ3A 3TGIE 1TQ0B 2YNAA 4H6SB 2FMJA 1F0UA 3MU8A 4XE4A 2A4RA 4AG1A 1NO9H 2FOBA 1O0DH 1K1PA 1EJMA 1LKBA 2A31A 2FDAA 4MPUA 1PPEE 2OC8A 2BY9X 2EC9H 1HRTH 1HXFH 1ZLRA 1MUEB 1OP8A 2BY6X 3RC5A 3AASA 2EI7A 3LOXA 1AZZA 1S81A 2GV6A 2PHBA 5FHTA 2CN0H 3SGBE 1NTPA 2Z9GA 2NU0E 1V2VT 2WV5A 1BQYA 1TPPA 3QGNB 2ZDNA 1SFIA 2BM2A 2OC0A 3ZYDA 1A7SA 3F1SB 5A0AE 1DOJA 8GCHF 1AI8H 2A7JA 2PKSC 5TJXA 1A46H 1BRUP 1KDQA 3M3VA 3MH7A 4WXIA 5JBBS 3ATMA 4A7IB 2A4GA 5AFZH 1UTQA 3O8BA 3Q3YA 3A8CA 4TWWA 2RCEA 3LIWA 1L1JA 4UFEH 1FPCH 1O2HA 3FVFB 1JXPA 2J9NA 5DP7A 2R2WU 3TJOA 1ARBA 2VWLA 4Y7AA 1A5IA 2PSYA 2RA0A 2XBYA 1GL1A 3OY6U 2BLWA 4WMEA 5EQSA 3SI3H 4Y10E 1C2DA 2OCVB 1ZSJA 4YOIA 5GJ4B 3D65E 1WAYB 3E91A 3ATKA 3L6PA 1ANEA 1AU8A 1QCPA 1UTJA 3MNCA 3A89A 2O8WA 2Z3EA 1W8BH 2SNVA 4UONA 1HAZB 1MMJN 1PPZA 1EB1H 3K6YA 3SJOA 1WBGB 2B9LA 2B8OH 4XOJA 3W94A 1QBVH 4Q7ZA 4BANB 2ZF0H 4JZFH 1GHWH 4ZROA 2OP9A 2SGPE 3SO3A 1QGFA 1GI4A 2VVCA 1KLTA 1NRNH 1W13U 3ATWA 4INHA 5EPNA 1L4ZA 3VPKA 1T7CA 3ESTA 2ANKH 2G55A 2FS9A 1PJPA 3P8NA 1LHDH 3SV8A 5J4SA 1ZR0A 2BQWB 2J34A 3UTUH 2HPQH 3KQCA 2J38A 1SQOA 1FY5A 1A0HB 2J4IA 3DD2H 3EDXB 2OTVA 3RXTA 1WUNH 1SGFG 1JIRA 2XCNA 1O3KA 5JPMH 1W3CA 2BD9A 1THRH 3MHWU 2Y5FA 2AEIH 4WMDA 2ZCHP 1KDQB 5FCKA 5E0JA 1W7GH 2H5DA 2P59A 2BDCA 2WYJA 1PPBH 2OXSA 2FYRA 4I31A 1XUJA 2FOHA 3A8DA 2PKAA 4NSVA 1O5AB 1XUGA 1CT0E 1XVOA 2XWBI 5B6OA 1YPJH 1GBKA 4A92A