1O2LA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate Manifold of Short Hydrogen Bond Arrays Mediating Binding of Active Site-Directed Serine Protease Inhibitors
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2lA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2lA02
3U8OH 4O3TA 2PSXA 3LGTA 1ELAA 1QA0A 1IQNA 1L4ZA 1PQ7A 1DANH 3LPRA 5DP3A 3ZZBA 4RKOB 2GDEH 1O5FH 4NCYA 1C5RA 3K9XB 4B75A 3HATH 4CR9A 4GPGA 4FU7A 4FUGA 1DXPA 4I8JA 2FDAA 1YKTA 2P3FH 3BTWE 1VCPA 1J15A 1ZTJA 3M3SA 1TBQH 1GMDF 4Y6DA 4UFEH 4BAKB 1EB2A 1TX7A 2GT8A 3F9EA 1C2HA 1P2IA 1ZPBA 1FI8A 2BY5X 4A1XA 1MZAA 1UTMA 3SUGA 2FO9A 5JDUB 4INKA 8LPRA 1TIOA 2BM2A 1O3IA 2M5TA 2YOLA 1C2MA 3UOUA 2A1DB 1QFKH 5F6MA 1E35B 1EOJA 1JRTA 1O3KA 1NESE 3UY9A 1GBIA 5AVDA 1Z6EA 1S83A 1S6HA 4ABHA 2AMDA 4K5ZA 4U2WA 1XX9A 2WUCA 2ANKH 5B6OA 4UE7H 1HAXB 2TGTA 3TJNA 4AX9H 1MQ6A 4IN1A 5FCRA 5JPMH 1EOLA 1OP0A 2R0LA 1ANCA 1BZXE 1UVSH 3ZVGA 1HFDA 1UCYK 5EU8A 1T32A 1Y3UA 3U8TH 4ABFA 4JZDH 3LH1A 1GI4A 3SJ8A 3RXUA 3SV7A 4D7FA 1P2JA 1O5EH 4XDEA 5A8XA 1T8LA 4X8TH 4Q7YA 1C5NH 1C5SA 4JZEH 1C5TA 3ZVAA 1FAXA 1F92A 1PPZA 3S69A 1ETSH 3TK9A 1P05A 1QURH 3V0XA 3KQDA 1AWHB 1YC0A 3TK6A 2VWNA 1O3OA 1UHBA 5TCAA 2ZDMA 1BA8B 2GCTB 4NA8A 4J1YA 3UQOA 4FUFA 1Z1IA 1DDJA 2XCNA 1D3DB 1UVUH 1TMUH 1BOQA 1T31A 3H5CB 1PFXC 4FUCA 1GL0E 4NIVA 3MMGA 5DP8A 1O2QA 4CBNA 3M7QA 1FLEE 1JWTA 1EAXA 1MD8A 1VJ9U 1P2MA 1SGNE 2QY0B 1DVAH 2RCEA 2WPLS 4NIWA 1C5ZB 1C5WB 2H5CA 1TNGA 1BMMH 1K1OA 3HK6B 1TX8A 2J94A 1VJAU 1SGQE 3FFGA 1YPHC 3ODDA 5CMXH 1CA8B 2P8OB 2XBVA 5EXLA 2SNWA 4KTSA 1GL1A 4XE4A 1MTNB 1QB9A 2Y82A 3KF2A 1D3TB 1MTVA 4Y7AA 2VWMA 3QZQA 1FXYA 1CT0E 4JCNA 1DSTA 3E6PH 1IQKA 4KP0A 1X7AC 1ANDA 2NU3E 1FN8A 1V2JT 3HPTB 1O3FA 2BX4A 3PLKA 5ETXA 3FAOA 3VB5A 4JMYA 1O37A 4JZFH 4HGCA 1CGHA 1RIWB 1NPMA 1THSH 1EQ9A 4A7IB 5EW1H 3DA9B 9ESTA 4A92A 3BN9A 3CENA 1W12U 4NWLA 4RKJB 1GMCF 1MAXA 1O2SA 3ATMA 1DX5M 2J38A 1N6XA 1FPHH 4CHAB 2B0FA 1SSXA 3GY7A 2GV6A 1D6WA 3A88A 5F8XA 1OWKA 3L6PA 5ESTE 3VGCB 6GCHG 4IW4E 4R8TB 4GAWA 2BOKA 3UNQA 3AW0A 3TLOA 2YNBA 4VGCB 1P57B 1TLDA 2BDAA 1K2I1 2H2ZA 1AB9C 1GJ5H 3MI4A 3D23A 1CBWC 1HXEH 1RTLA 4Y8XA 3GCTF 3KQCA 1TNHA 4JZIA 2EC9H 1BHXB 1EJMA 1W8BH 3RXHA 3SV9A 2FESH 2ZO3H 1DE7H 3MU4A 4DIHH 1EAIA 2ASUB 3AAVA 4O3UA 4GHTA 1JIRA 4TYDA 1SBWA 1TOMH 3GY6A 7ESTE 2QXJA 4BTTB 3P8OA 1SGTA 1O2RA 1QB1A 2ZFFH 6CHAC 7LPRA 1TALA 2GX4A 3WY8A 1QL7A 2V35A 3M5OA 1SOTA 4TWWA 2ESTE 1GHZA 1G9IE 2A7HA 4IGDA 4BNRA 1QL9A 4ZUHA 1Z1JA 5E0HA 5GCHG 2FOHA 2OP9A 2AIQA 1CA0B 4NSVA 1ANBA 3TU7H 2WPIS 2GT7A 4AORA 1AUJA 3QTVH 2VIVA 3GCHB 3I77A 1GCTC 2WV5A 2PW8H 3L3TA 1RTFB 1OP8A 3LU9B 1J14A 5C20A 3KEEA 3OY6U 1P01A 2BVSH 3SU0A 4DOQA 3AW1A 3ZV8A 1UTJA 1XMNB 4DY7B 1W0YH 6LPRA 2LNCA 1BDAA 2BXUH 5HMAA 5LPRA 1MTWA 1O2VA 1BHXF 4CRGA 1FY4A 5E0GA 8ESTE 1C1VH 2EI7A 2BHGA 2FTLE 5ABWA 5GJ4B 1ELVA 4HFPB 4E06H 1KXAA 8GCHG 3SNAA 3GCNA 2ZG0H 1EZUC 4X1PU 2ZHWH 2F9OA 2GMTC 1Y5UT 3MNBA 2G55A 4OS1A 3KGPA 3BEIB 4NZQA 2XWAA 2ZFTA 1BMNH 1FONA 3SNCA 1TAWA 4X1QU 1W10U 1C2GA 3E8LA 3ZZ7A 3P17H 4X6PA 2WV4A 1JIMA 1LKBA 1RXPA 3PMHB 2HPQH 4BAHB 1IQLA 4AFSA 1OXGA 2P3TB 3TNSA 3PWCA 1JOUB 1BRBE 1GBCA 2BB4A 4MDSA 2A4QA 4U32A 3LOXA 1SGYE 1AVGH 1EPTB 1HJAB 2OC0A 2HWLB 4Y71A 4MG3A 1F0TA 2FI5E 3MOCA 1GGDB 4XBDA 2OQ5A 4MPUA 1P0SH 2ZQ2A 1OS8A 4KELA 2A2XH 3A8CA 2OC1A 1YYY1 5BPEA 2ALVA 4BANB 1DICA 3A89A 1GJDB 4FXGH 2DUCA 5A0CA 3RXTA 1TNJA 1O32A 2Z9IA 2FM2A 3ZZ6A 2R0KA 5FPSA 2ZDLA 4BXWA 1ZGVA 1O2HA 2VIOA 5DP6A 3EA7A 1O35A 2NWNA 1SQTA 3A84A 1SQOA 2SGEE 2W3KA 2AIPA 3SGAE 4AB9A 2W5EA 1GJ7B 3E1XB 1A3EH 2FODA 3GY8A 4PROA 3U8RH 3LONA 4NWKA 1O31A 1TPPA 2Z3EA 3B9FH 4IS5A 5GXPA 4NFFA 3CP7A 1GDQA 3F6UH 4E7NA 1GI1A 1MBMA 4I31A 5H4IB 2GTBA 2PWXA 3RXKA 3CS7A 1LQEA 4YLUA 2FOCA 1BQYA 1YPEH 3RXJA 1V2RT 1JBUH 3FZZA 1THPB 1F0UA 1F0SA 1V2OT 2ZU4A 2WYJA 4O03A 3SOSA 4INHA 3W95A 5JB9S 1SR5C 5C3NA 5FAHA 2BDIA 2ZFPH 1B0EA 3TH4H 2LPRA 3RMLH 3BTDE 1YBWA 2PKSB 5HXFA 4TPYA 1KIGH 4FUIA 3RXAA 2I6SA 2HLCA 2IN2A 1Z7KA 3ATLA 3VPKA 1B5GH 1O5AB 1NU7B 3IWMA 4IBLH 3GISB 1TMTH 1BMLA 4XFQA 1QJ7B 4WMEA 5FXLA 2TPIZ 5C1XA 1MBQA 5PTPA 4AFZA 3ZVDA 3D62A 3M7TA 2PV9B 4ABAA 1F7ZA 1DLEA 5T6FA 4ZHLU 3F9FA 1TPAE 4FUDA 4K1SA 3BTTE 1C2FA 1AKSB 3GOVB 1GHVH 5LGOA 1GHAF 2C8XB 3ZZ4A 5A2MH 2D2DA 3QTOH 4X1NU 1BRAA 3Q3KA 4I7YH 1AGJA 3ZVBA 3NZIA 3RDZA 3SV8A 7KMEH 1C5VA 3RUOA 3ZZ5A 3O8RA 3PO1C 1L4DA 1RRKA 2BDYA 1DUEA 2O8TA 2Q6GA 1GHBF 1BBRH 1HJ8A 4ZKOU 3V13A 4AGKA 1GDUA 1TWXB 4JZ1A 3V3MA 4A1TA 2JH0D 5EXMA 5HGGA 2Y5GA 2BD4A 1XXFA 4DCDA 1GVZA 1PQAA 2G5VA 4FU8A 2XBXA 3BG4C 2Z9JA 3GYLB 1GBTA 3AAUA 4XOJA 1G3CA 2BDCA 1CT2E 1ZHPA 4X8UH 2NU0E 3CS0A 3OX7U 3ZVEA 4Q80A 1QJ1B 3E3TA 4GLYA 5EQSA 3RP2A 1DFPA 1OX1A 4K8YA 1Y3WA 1YPGH 3E0NB 1V2PT 3RU4E 3Q76A 2ZGCA 1TPOA 5DP7A 1RTKA 3UNSA 2XCFA 1AVXA 2QIQA 2FLRH 4B76A 1O2IA 1YPMH 4ZKNU 4NFEA 1PQ5A 2G51A 4K69A 4DG4A 3E0PB 2CGAA 3E91A 2DE8A 2ZIQH 2A5IA 4GCHG 2VGCB 2AERH 5C2ZA 3Q00A 1AY6H 2ODQA 1O36A 3RXIA 1S5SA 4NIXA 2BDHA 4AOQA 2A32A 1NFXA 1QRWA 3Q77A 2O8WA 2Y5FA 2B7DH 1ACBE 5C1YA 4WMDA 1CGJE 2XC4A 3AVZA 3ENSB 3RMNH 2WUBA 1SOZA 4I8LA 2PUQH 4Z0KA 4AYVB 3RLWH 3A8BA 5C5OA 1LVOA 1AU8A 1LVMA 3ZZ3A 1SVPA 4NG9H 1MZDA 1EP5A 2ZCKP 1TABE 3GY3A 4WXIA 4GUXA 3A85A 1MCVA 5GIBA 2C8ZB 1TYNA 3MFJA 1C1WH 2I6QA 1DY9A 1NRSH 3I29A 1TBRH 1MKXK 1LO6A 2BVXH 5A0AE 1V2UT 3SGBE 1QHRB 1D4PB 1WBGB 1YPKH 1T4UH 1DT2A 1GVKB 2SGQE 1P03A 4FUHA 2ZGXH 2H6MA 3NWUA 1VCWA 2Y5HA 3MHWU 3BTGE 3TH2H 3VXEH 4IMQA 2F9BH 2J4IA 1QQ4A 4AZ2B 1VGCB 2CJIA 1INCA 1GG6B 1EX3A 2ZFRH 1L2EA 3T62A 1C1OA 2CF8H 4NZLA 4BOHA 2J92A 3STJA 4I33A 2F9VA 2AMPA 1AIXH 1MTUA 4D9RA 3A7WA 4MQAA 2WPMS 4BAOB 1OWEA 1XM1A 3RXQA 4CRFA 5DP9A 2ZTYA 3A7ZA 2QF0A 2Z3CA 4LZ4B 1YPJH 1GI3A 5CHAC 1UTQA 1C2DA 4CRCA 2V6NA 1TONA 1D3QB 2BOHB 1C5LH 2KAIA 1WTGH 2VB0A 4YM9A 4KTCA 3S7KB 3MO9A 1ZSLA 1TGCA 2CHAC 3A86A 5EG4A 5IDKA 1KY9A 4M7GA 1C1QA 1W0ZU 4Q2KA 3SGQE 1ZOMA 1FQ3A 5HM9A 2VVUA 2G52A 1GBDA 4D76A 3SHAH 1O3LA 3KCGH 3P6ZB 1AZ8A 2XC0A 1SG8B 2SGAA 3MU5A 1SGCA 2BX3A 3NCLA 1UMAH 4LK4A 3UWJH 3F68H 1ELBA 1T8NA 4WVPE 2PGBB 3TGKE 3UQVA 1EXFA 3LIWA 2ZPSA 2BLOA 3DFJA 2WPJS 1UTNA 1EASA 3EQ0H 4I8KA 2AMQA 1K1PA 3Q3YA 2CMYA 1HAIH 2FP7B 3BTQE 1LHFH 1RGQA 1MU8B 4TPIZ 1NZQH 1O2JA 1ZSJA 4WH8A 3T26A 1VITH 1ZPZA 1SGFA 1UJ1A 3MNXA 1J17T 4H6SB 4I32A 1GHWH 2PGQB 3T25A 3BTEE 5EGMA 1O3MA 1GBLA 6GCHF 3BTHE 4AG2A 2CN0H 1O33A 1EATA 1PYTD 1O2PA 2PKAA 2QF3A 1G30B 5LPFA 3OU0A 3RXPA 1BTXA 2Z7FE 1TPSA 4K3JA 2AEIH 3A7TA 1EP6A 1BMAA 3U1IB 1FN6A 2A5KA 2TGAA 1QNJA 1F0RA 3UFAA 3EGKH 2V3HH 1LHGH 1QBOA 1UCYH 4FU9A 1QGFA 2GGVB 1V2NT 5EPNA 1HIAB 1V2VT 1MCTA 1MH0A 3ZZ8A 3O8BA 4ZH8A 1LPZB 1O2KA 1TBZH 1RD3B 2F9NA 3S7HB 3DT0H 1IQMA 3A7YA 1IAUA 3SV6A 4ZKSU 2BY6X 3PV4A 3ZZCA 3TJVA 1BTYA 3HGPA 4FVBA 1CVWH 1W3CA 1L1NA 1XUGA 2AGGX 1CGIE 2VVCA 1OYQA 3NK8A 1S6FA 3SU2A 2PSYA 2VIDA 1A61H 1C1MA 3R3GB 1LMWB 4TY7A 4HTCH 2C3SA 1P09A 1QR3E 3S9AA 1P8VC 4ABBA 2OLGA 2AFQB 2ZU2A 3VXFH 1O30A 1GWAA 1V2KT 4AFQA 4Y76A 3NUMA 1O34A 2VINA 3G01A 4D7GA 1HDTH 2G4UA 1C5UA 1Q31A 1IQJA 2WINI 4BTIB 4I8GA 1C4U2 3UWIA 1GHXH 1SPJA 3TJOA 1GBKA 3SQHE 1EJAA 4O9VA 2FYRA 1M9UA 1QJ6B 1ELGA 3RXOA 3U69H 1LHDH 1TRNA 1HAVA 1RJXB 2OC8A 4Y79A 3PM3A 1DXWA 2FIRH 3F9HA 2FOEA 3QUMP 1O3CA 1XKBC 8GCHF 3SU4A 3PTNA 1WSSH 3QX5H 1P12E 3TK5A 1D3PB 3P70B 5L2ZH 3M36A 3T29A 3S9BA 5FHTA 1ZMNA 1ZTLA 2J2UA 3ODFA 5JBCS 4OGXA 1WTHD 4AFUA 1GBFA 1ZTKA 1SLVB 1UVTH 4Y8ZA 1B7XB 3KIDU 3RXVA 4B74A 4Q7XA 3N7OA 6ESTA 1A0LA 4GVUA 5L30H 3A81A 4B2CA 1AB9B 2O9QA 2ZU1A 1CBWB 2R2MB 1KDQB 2GKVE 2ZHDA 1MKWK 3KNXA 2W3IA 5T6GA 3ZYDA 1DM4B 4X6NA 5J4QA 3EDXB 4UFDH 4Z6AH 1BTUA 1Z71A 3FP6E 1P04A 4F49A 3SV2H 2BD5A 1MUEB 5K7RA 1ETTH 1TE0A 4UFGH 4IC6A 5AFYH 3U98H 3SQEE 1BBRE 3E16B 4WMFA 1FPCH 1QTFA 1DOJA 4ISIH 3PLPA 2Y80A 1G3EA 2Z3DA 5L2YH 1LCYA 3BIUH 2ZHEH 3GDUA 2JETC 1C9PA 1EZQA 3RU4D 4CR5A 1ZRKA 1UK2A 3LDXH 3RXEA 3UR6A 1CHGA 2XW9A 1ID5H 1N6YA 1SB1H 1G36A 4JK5A 3RM2H 2BY7X 1QBNA 1O39A 3SW2B 1Z6JH 2O8LA 1A5IA 5E0JA 1A5HA 4MPXA 1HAPH 3GCTG 4DW2U 5FPTA 1PPHE 4CRDA 3UREA 1MKWH 1GCTB 3FVFB 1JXPA 5C5NA 1WCZA 4H42U 5JBBS 3UIRA 2G4TA 3BEUA 1MAYA 1QIXB 3V7TA 2HNTE 3MTYA 1WUNH 4I8HA 1GI0A 1W11U 2FYQA 2ZGHA 3HKIB 1TNLA 4INLA 1HAGE 1K22H 5F8ZA 3O8CA 3RC4A 1ESBA 5EW2H 3QLPH 5DG6A 1T8OA 2G5NA 1P2KA 2BDGA 2B8OH 3RLYH 4X8VH 1O2GH 1XXDA 3A8DA 2GZ9A 5A8ZA 3QGNB 4NIYA 1K1MA 4Y0YE 5JBAS 2GDDA 1K1JA 1BCUH 1VITG 1D6RA 2ZDVH 1OKXA 1AFQC 1LPKB 1TRYA 1P10A 2AGIX 3BTME 1EZXC 2GMTB 3GCOA 3LGWA 1MU6B 5E2OA 3MNSA 3VFEA 3UPEA 3QO6A 1FIZA 1TX6A 4R0IA 1FY3A 1F5KU 1TGTA 2B9LA 1UVPA 1S82A 2BQ7B 2VNTA 1ZLRA 2TRMA 4DVAU 1DSUA 1TNIA 1P02A 1W13U 1HGTH 2PTCE 1H8DH 2XTTB 1A0JA 3BIVH 4UONA 4WJG2 5DGJA 3VB7A 1FY8E 3TPIZ 2FOGA 1SGIB 1C2KA 3JZ1B 1FY5A 1XUKA 2ZCLP 4A6LA 3SI3H 2QAAA 1TQ0B 2Y7ZA 3T28A 3H7TA 1N8OC 1C5XB 1C2IA 1FDPA 4RSPA 2HGTH 1GI2A 1KXCA 3MH4A 1AUTC 3L33A 2H1UA 4BAMB 2CF9H 1HYLA 1NROH 3DFLA 3PMBB 1KLJH 1C4Y2 2SFAA 3MU0A 4KGAA 3LGIA 4B2BA 2QXGA 3U9AH 1W14U 2ILNA 1XVOA 2ZHQH 2ZPRA 1Z8RA 3DUXH 1PJPA 1PQ8A 3FP8E 5AHGH 1VR1H 1NTPA 1AZZA 1GBJA 3RXGA 5EOKA 3MO6A 1Y3YA 1O3EA 1MD7A 1D9IA 1G3BA 1V6DA 4WF8A 4OS2A 2FOFA 3SU6A 1BTPA 1LPGB 2XYAA 1IQFA 2OTVA 4GCHF 1KYNA 3BG8A 3ELAH 2ALPA 1ANEA 4MNWA 3HGNA 5JYIA 5AF9H 1H9LB 3T27A 2Q6FA 1WAYB 3RXDA 2QC2A 5DPAA 2R9PA 2GP9B 2FS8A 1HV7A 1O5BB 1UTLM 3MYWA 4CREA 1BJVA 2V3OH 3VB6A 1PPEE 3W94A 1ZGIA 2BVRH 5DO4H 1V2LT 3SUDA 1YPHE 2BQWB 5E8EH 1O2TA 1KTSB 2UUYA 3C27B 3QWCH 1IOEA 1O3PB 1RS0A 4WWYA 2QXHA 2P94A 1SLUB 5ESBA 1AO5A 1UHBB 1IHSH 3SJKA 2Z9KA 2QGRA 5JBTA 1NRPH 2A31A 1Q3XA 2ZECA 1Y59T 1FAKH 2QA9E 2P16A 3GICB 1GI9B 1H9IE 3M37A 4Y7BA 3B8JA 1SLXB 3SI4H 2C8WB 4UFFH 1G32B 2BD3A 4K60A 4H4FA 4XBCA 1O38A 1SGEE 1UCYE 1H1BA 2ZFQH 1EJNA 4DT7B 1V2QT 1GI8B 1C2JA 2OQUA 1HJ9A 4K2YA 2PTNA 1A7SA 1F5RA 1T4VH 3I78A 3ITIA 1FV9A 5AFZH 1F5LA 3V12A 4YO9A 3A87A 2FPZA 3SORA 3OY5U 1GJCB 3K6YA 1QRXA 2G81E 1C1NA 2F9PA 1PPGE 2QV1A 1OOKB 2Y81A 3VB4A 2TGPZ 3PWBA 2IPHA 2BD2A 2OC7A 1BJUA 1ELTA 3LJJA 1PPBH 3ATKA 1YCPM 2ZPQA 2QN5T 1G2LA 5EQQA 3SNBA 2H9HA 1O2NA 1GJ4H 4ISNA 1L1JA 1C5PA 2PFEA 1KXFA 1P11E 2SNVA 2ULLA 1FMGA 5FBIA 1BITA 2C4FH 4SGAE 1ELEE 1O2ZA 1ETRH 3EAJA 4ZAEA 1O5DH 5IYTA 3SJOA 1EPTA 2Z9LA 2GVFA 1Y5BT 1ZZZA 3M3TA 1O2WA 1YCPK 3FP7E 1DWBH 4U30A 5T3HA 1GJ6A 1O5CB 3URCA 1YLDA 1Z8GA 3HK3B 4UEHH 3OTJE 1ELCA 1XUFA 2VU8E 1GI7B 1DITH 2FI3E 2F83A 1GHBG 2XWBI 2VH6A 1LDTT 4LZ1H 1GI5A 1O3GA 2ZC9H 3M3VA 4BAQB 4QT8C 3RC6A 1FNIA 2UUJB 1HAHH 3LH3A 3NPSA 4ISLA 3RXRA 1TNKA 2CV3A 4IC5A 3K2UA 4ISOA 2THFB 1O5GH 1E0FD 3BTFE 2PR3A 3B23B 1PYTC 1K1LA 3IG6B 3VB3A 1AMHA 1GVLA 1GPZA 5EODA 1KXBA 2OINA 1IQHA 2IJOB 5FX5A 1PPCE 3D65E 2Z6BD 5FCKA 2ZF0H 4OS5A 1O3AA 1GI6A 3PYHA 2H9EH 5GDSH 1AE8H 1H9HE 2ODYB 4DJZB 2BZAA 4ABGA 3KHVA 1YCPH 3ATWA 1MKXH 2GZ8A 5DJ7A 1TRMA 3RM0H 2D1JA 4X2WA 1P3EA 2ZTXA 1SGFG 1WQSA 5C1UA 1GJ9B 1KLIH 1G3DA 1Y8TA 2UUFB 5A8YA 2RA0A 3MU8A 3A7XA 1ZHRA 4K1TA 2XBYA 3M5MA 3ZYEA 1EUFA 1O3JA 2FMJA 1V2WT 2PHBA 4OS7A 1E38B 7GCHG 4ZKRU 1E36B 4Q7ZA 1GMHG 4AGJA 2XNIA 2WPKS 1A2CH 1CHOG 3KQBA 4X2VA 1DY8A 2FS9A 1HBTH 5F8TA 1BRUP 5CHAB 2ZQ1A 4YLQH 4Y10E 3LGYA 5GPIB 2GCTC 1W2KH 1C1SA 2CHAB 4X6MA 1ZR0A 4XBBA 2ANMH 2OCVB 2GCHG 1C2EA 2G00A 4FVDA 1WV7H 1IQIA 1YF4A 4FUBA 1NRRH 3QK1A 3AASA 1BUIA 3ATIA 1ZPCA 1SFIA 1AKSA 1HAOH 2Y7XA 4B2AA 2ZDAH 4Y8YA 4NGAH 4JK6A 5BRRE 2AH4X 2HNTF 2TIOA 1GBEA 1SGRE 1THRH 2A2QH 2EI6A 4MVNA 2WYGA 1O0DH 4YZUA 4Y11E 1LKAA 1XVMA 2RA3A 2VIQA 3RXFA 1AI8H 3SBKA 1UTOA 1FJSA 2FI4E 2P8OC 3GY4A 3A83A 1H8IH 1O2MA 4E05H 1P2NA 1KLTA 4ABEA 1MTNC 3BV9B 5C67A 1KXDA 3MO3A 2P95A 3BSQA 2R2WU 3TVJB 1CT4E 2P93A 1GMDG 3RU4T 1C1PA 2RDLA 2BY8X 4A5TS 1YPLH 4AB8A 5FX6A 2OD3B 2ZNKH 4AG1A 2FLBH 4MPWA 1QRZA 4U01A 3MNCA 1HUTH 1DWEH 1SFQB 3UR9A 1TA6A 1FIWA 2ZDNA 2SGPE 1RIWC 3TITA 1BTWA 2BDBA 2ZGBH 2ZU5A 4X6OA 5F03A 1OWHA 2HPPH 1S81A 2D26C 4KTUA 4ESTE 2EA3A 1ZMJA 4CHAC 4B71A 3NXPA 4MNYA 1NRQH 2O8MA 1UTPA 3VGCC 1W7GH 2GV7A 2GD4B 4OS6A 3TNTA 2ODPA 1V2MT 3RMOH 3T5FH 3SU1A 5GCHF 1XKAC 1EAWA 3EA8A 1YP9A 1CE5A 3GY2A 4GHQA 2RG3A 4OS4A 4VGCC 4BXSA 3S0NA 4MTBA 3ZZ9A 1ARBA 2ZHFH 3DD2H 2H9TH 3MH6A 3QGJA 1NRNH 3SO3A 2VVVA 1O2LA 1V2TT 3VEQB 2UWLA 1T7CA 2OBOA 5G4BA 1E34B 2R3UA 2VH0A 1QB6A 2Z9GA 4YOJA 3LT3A 3LJOA 1HCGA 2Y6TA 3TJUA 4D9QA 3P95A 4SGBE 2ZA5A 2FEQH 4ZHMU 4YT7H 1TA2A 1O2YA 1W7XH 4O97A 2BLQA 3LKWA 1CO7E 1C2LA 3ZVCA 5GWZA 3K6ZA 2BZ6H 4CH8B 1DS2E 3IITA 8KME2 3QDZB 1SGPE 1O2UA 1LVYA 3SNEA 2A45B 1S0RA 1GBHA 3BF6H 2F9UA 2Q1JA 3ZVFA 3M5LA 1VZQH 1KXEA 1GCDA 1NN6A 1ZHMA 3PMAB 1Z8JB 1O2XA 2NU2E 5K0HA 1C5YB 1IQEA 2XXLA 1FY1A 4WH6A 4DURA 2BD8A 1TMBH 4B1TA 1JRSA 4HZHA 1CA0C 3KQEA 2D8WA 4YESB 3M35A 1K28D 1BTHH 1NO9H 1C5MD 2W7SA 3M7UA 3Q3XA 4MPVA 2O8UA 3GCHC 1TB6H 3PTBA 1BIOA 4ZHAA 3MWIU 1C5OH 1JMOH 5EQRA 3GYMA 2AYWA 4WXVA 2HOBA 2R3YA 4A1VA 2GZ7A 2ZKSA 2ZZUH 3E90B 2G8TA 3SZNA 4X2XA 1QA7A 3EYDA 4THNH 5J4SA 1VITF 4MLFB 2FX4A 2FWWA 4WY3A 2BY9X 1L1GA 3KL6A 1FZZA 1NFUA 3T2NA 1C1TA 3ESTA 1K9OE 1WYKA 1WU1A 1ABJH 3P8NA 3QZRA 3R0FA 1P06A 1OWDA 1GMCG 1ESTA 2C8YB 1FUJA 1SI5H 2OUAA 1OYTH 2C93B 1GBMA 2J34A 3TGJE 1B0FA 6CHAB 1T8MA 2W7UA 1EAUA 5EPYA 3D49H 2FTMA 1LTOA 1QL8A 2HALA 5T6DA 4ABIA 3F9GA 1UK3A 2ZEBA 2A5AA 2YNAA 4JYVH 2J9NA 3RXMA 1OPHB 2SGDE 4CRBA 1BTZA 3TH3H 2UWOA 1EZSC 2PLXA 2FOMB 2TGDA 1ZJDA 1HAYB 3LC3A 2IOTA 1U6QA 1EPTC 1GDNA 1HJAC 1K1IA 4ABDA 1A0HB 1TOCB 1HLTH 1SC8U 2BD7A 1GGDC 5TCCA 3P8FA 3TIUA 1AVWA 1DLKB 1ARCA 1AQ7A 1BT7A 2JETB 5L6NH 2VJ1A 1PPFE 4F4OC 1C1UH 5HYOA 2FOAA 3GY5A 4ABJA 3P8GA 1AHTH 2QCYA 5SGAE 4J2YB 4X0WU 2FZZA 1QY6A 1RFNA 2XRCA 1NC6A 1A1RA 2K1QA 1Z8IB 5EXNA 5FPYA 1ABIH 3SN8A 1HPGA 2HRVA 3PROA 1HRTH 2BLVA 2JKHA 5DP4A 3C1KA 4TY6A 3ZV9A 5LPEA 1UVOA 1Y5AT 1O3NA 1J8AA 1UO6A 3QN7A 1Y3VA 1XUJA 3OYPA 2EI8A 1C1RA 1YLCA 4NA7A 5LH8A 2F91A 4NSYA 4H6TA 1GBBA 2EEKA 2NU4E 1HIAA 3UUZA 4RN6A 4K1EA 1K21H 1ZSKA 4TWYA 1SL3A 2BTCE 1NM6A 2NU1E 3DHKH 3S9CA 1MTSA 1SGDE 3M5NA 1TGBA 2PUXB 3KN2A 3BTKE 4D8NA 1A3BH 3H7OA 1H4WA 1ZMLA 2QYIA 3A7VA 2ZP0H 4HI3A 4YT6H 2VWOA 1Q2WA 2P3UB 4ZXXH 3ZZAA 1GJBB 1K1NA 2ZCHP 4X8SH 4YOIA 1DPOA 3EE0B 1V2ST 1XUHA 1J16A 2PKSC 1AFQB 3RC5A 2A7CA 3FZDA 2WPHS 1VCQA 2P59A 4IMZA 3A80A 2UWPA 3GDVA 3JZ2B 9LPRA 2XBWA 2H5DA 3ZZDA 4UD9H 3F1SB 1ZRBA 1AWFH 2STBE 1UTKA 1O3DA 1C4V2 1P3CA 1O3HA 2KAIB 3SUEA 1SHYA 1QBVH 1C9TA 2SGFE 1WQVH 2Z94A 2DE9A 1LVBA 3O8DA 3SUFA 1E37B 4ZXYH 2BMGB 2VWLA 2A4GA 1P2QA 2UUKB 2FX6A 4JYUH 5A0BA 3GDSA 1AN1E 3SJ9A 1NFYA 3U1JB 4OGYA 1SMFE 3A82A 1BBRK 4X2YA 1N8OB 2A4RA 3SJIA 4JYTA 3URDA 3LGVA 1SLWB 2Q6DA 3SU5A 2ZI2H 1P9SA 3PLBA 4YTAA 1GHYH 2ANWA 1HB0B 4ZROA 4MNVA 5E2PA 1SQAA 1NS3A 1HNEE 1DWCH 1YGCH 2BLWA 3MU1A 2HVXA 4CBOA 2QXIA 5A09A 2OBQA 3TGIE 1TFXA 2ZGJA 3SU3A 2A7JA 4AN7A 2ANYA 1ZJKA 3M61U 4CH2B 1OP2A 3UTUH 2VIPA 1KDQA 1BB0B 3P92A 3UNRA 1EB1H 3MH7A 4GSOA 2C90B 2JH5D 3UOPA 5JB8S 5FBEA 2A0QB 3NKKA 5DK1A 1TGSZ 2BXTH 4FUEA 2PKAB 2VGCC 2AGEX 3SHCH 2BYAX 1A4WH 4IN2A 1ELDE 3HKJB 4DGJA 1F2SE 2OXSA 2V0BA 1AE5A 1A46H 4B73A 3PO1B 3K65B 2TBSA 4MNXA 4FUJA 1Y3XA 1KSNA 1C5QA 1CQQA 5I46H 2XC5A 2ZDKA 1KTTB 4AYYB 4UDWH 1HAZB 5DKMA 1S0QA 2A4OA 1CU1A 1S85A 1UK4A 1YM0A 3PB1E 4E7RG 1AD8H 1IQGA 1NT1A 2STAE 3BG4B 3LGUA 5TJXA 1OWJA 2VIWA 1N1LA 4ISHH 1A5GH 1LHCH 1HXFH 1MMJN 3STIA 4X1RU 5HM2A 1TQ7B 1NY22 1O2OA 2ZTZA 5CE1A 1WOFA 1J9CH 1DWDH 4Y0ZE 1S84A 1O3BA 1QCPA 4CRAA 2CXVA 4KKDA 4LXBH 1EKBB 1G2MA 4XSKU 4ZMAH 1L0ZA 1GHAG 2BQ6B 1GBAA 1ELFA 2BD9A 3RXCA 3FANA 1VGCC 7GCHF 1NFWA 5I25A 4YOGA 2FXRA 1QQUA 1BRCE 1GG6C 1GJAB 1GMHF 3OSYA 2ZU3A 2B5TB 1NU9A 1CHOF 1MQ5A 1OSSA 2F3CE 1LHEH 1TGNA 3BEFB 1LQDB 4NA9H 1G37A 1CSOE 3RXSA 2ZFSA 1P2OA 3PMJA 3RXLA 3EA9A 4X1SU 1OWIA 2GCHF 4BTUB 1HAVB 2HNTC 5DP5A 2JH6D 1ORFA 1DUAA 2J95A 1SHHB 1AFEH 2FOBA 2ZWLH 1ZYOA 1GJ8B 2AS9A 3RXBA 4K8BA 3SNDA 2W26A 4LOYH 1ESAA 1P9UA 3A8AA 3LC5A 3MH5A 4DIIH 4ASHA 1V3XA 3RMMH 1XUIA 1IHTH
chains in the Genus database with same CATH superfamily
3U8OH 4O3TA 2PSXA 3LGTA 1ELAA 1QA0A 1IQNA 1L4ZA 1PQ7A 1DANH 3LPRA 2K0QA 5DP3A 4TSFD 3ZZBA 4RKOB 2GDEH 3NRLA 1O5FH 4NCYA 1C5RA 3K9XB 4B75A 3HATH 4CR9A 4GPGA 4FU7A 4FUGA 1DXPA 4I8JA 2FDAA 1YKTA 2P3FH 3BTWE 1VCPA 1J15A 1ZTJA 3M3SA 4ASUD 1TBQH 1GMDF 4Y6DA 4UFEH 4BAKB 1EB2A 1TX7A 2GT8A 3F9EA 1C2HA 1P2IA 1ZPBA 1FI8A 2BY5X 4A1XA 1MZAA 4AC9A 1UTMA 3SUGA 2FO9A 5JDUB 4INKA 8LPRA 1TIOA 2BM2A 1O3IA 2M5TA 2YOLA 1C2MA 3UOUA 2A1DB 1QFKH 5F6MA 1E35B 1EOJA 1JRTA 1O3KA 1NESE 3UY9A 1GBIA 5AVDA 1Z6EA 1OHHD 1S83A 1S6HA 4ABHA 2AMDA 4K5ZA 4U2WA 1XX9A 2WUCA 2ANKH 5B6OA 4UE7H 1HAXB 2TGTA 3TJNA 4AX9H 1MQ6A 4IN1A 5FCRA 5JPMH 1EOLA 1OP0A 2R0LA 1ANCA 1BZXE 1UVSH 3ZVGA 1HFDA 1UCYK 5EU8A 1T32A 1Y3UA 3U8TH 4ABFA 4JZDH 3LH1A 1UW7A 1GI4A 2J98A 3RXUA 3SJ8A 3SV7A 4D7FA 1QZ8A 1P2JA 1O5EH 4XDEA 5A8XA 1T8LA 4X8TH 4Q7YA 1C5NH 1C5SA 4JZEH 1C5TA 3ZVAA 1FAXA 1F92A 1PPZA 3S69A 1ETSH 3TK9A 1P05A 1QURH 3V0XA 3KQDA 1AWHB 1YC0A 3TK6A 2VWNA 1O3OA 1UHBA 5TCAA 2ZDMA 1BA8B 2GCTB 4NA8A 4J1YA 3UQOA 4FUFA 1Z1IA 5CHBA 1DDJA 2XCNA 1D3DB 1H8HD 1UVUH 1TMUH 5C0TA 1BOQA 4B6EA 1T31A 3H5CB 1PFXC 4FUCA 1GL0E 4NIVA 3MMGA 5DP8A 1O2QA 4CBNA 3M7QA 1FLEE 1JWTA 1EAXA 1MD8A 1VJ9U 1P2MA 1SGNE 2QY0B 1DVAH 2RCEA 2WPLS 4NIWA 1C5ZB 1C5WB 2H5CA 1TNGA 1BMMH 1K1OA 3HK6B 1TX8A 2J94A 1VJAU 1SGQE 3FFGA 1YPHC 2AHME 3ODDA 5CMXH 1CA8B 2P8OB 2XBVA 5EXLA 2SNWA 4KTSA 1GL1A 4XE4A 1MTNB 1QB9A 5DSFA 2Y82A 3KF2A 1D3TB 1MTVA 4Y7AA 2VWMA 3QZQA 1FXYA 1CT0E 4JCNA 1DSTA 3E6PH 1IQKA 4KP0A 1X7AC 1ANDA 2NU3E 1FN8A 1V2JT 3HPTB 1O3FA 2BX4A 3PLKA 5ETXA 1VKYA 3FAOA 3VB5A 1E1QD 4JMYA 1O37A 4JZFH 4HGCA 1CGHA 1RIWB 2RDEA 1NPMA 1THSH 1EQ9A 4A7IB 5EW1H 3DA9B 3DSGA 9ESTA 1E79D 3BN9A 4A92A 3CENA 1W12U 4NWLA 4RKJB 1GMCF 1MAXA 2KR7A 1O2SA 3ATMA 1DX5M 2J38A 1N6XA 1FPHH 4CHAB 2B0FA 1SSXA 3GY7A 2GV6A 1D6WA 3A88A 5F8XA 1OWKA 3L6PA 5ESTE 3VGCB 6GCHG 4IW4E 4R8TB 4GAWA 2BOKA 3UNQA 3AW0A 3TLOA 2YNBA 4VGCB 1P57B 1TLDA 2BDAA 1K2I1 2H2ZA 1AB9C 1GJ5H 3MI4A 3D23A 1CBWC 1HXEH 1RTLA 3VG8A 4Y8XA 3GCTF 3KQCA 1TNHA 4JZIA 2EC9H 1BHXB 1EJMA 1W8BH 3RXHA 3SV9A 2FESH 2ZO3H 1DE7H 3MU4A 4DIHH 1EAIA 2ASUB 3AAVA 4O3UA 4GHTA 1JIRA 4TYDA 1SBWA 1TOMH 3GY6A 7ESTE 3FKSD 2QXJA 4BTTB 3P8OA 1SGTA 2WHXA 1O2RA 5EJ1A 2YMSC 1QB1A 2ZFFH 6CHAC 7LPRA 1TALA 2GX4A 3WY8A 1QL7A 2V35A 3M5OA 1SOTA 4TWWA 2ESTE 1GHZA 1G9IE 2A7HA 4IGDA 4BNRA 1QL9A 4ZUHA 1Z1JA 5E0HA 5GCHG 2FOHA 2OP9A 3H09A 2AIQA 1CA0B 4NSVA 1ANBA 3TU7H 2WPIS 2GT7A 4AORA 1AUJA 3QTVH 2VIVA 3GCHB 3I77A 1GCTC 2WV5A 2PW8H 3L3TA 1RTFB 1OP8A 3LU9B 1J14A 5C20A 3KEEA 3OY6U 1P01A 2BVSH 3SU0A 4DOQA 3AW1A 3ZV8A 1UTJA 1XMNB 4DY7B 1W0YH 6LPRA 2LNCA 1BDAA 2BXUH 5HMAA 5LPRA 1MTWA 1O2VA 1BHXF 4CRGA 1FY4A 5E0GA 8ESTE 1C1VH 3SZEA 2EI7A 2BHGA 2FTLE 5ABWA 5B6LA 5GJ4B 1ELVA 4HFPB 2J5UA 4E06H 1KXAA 8GCHG 3SNAA 2GJGA 3GCNA 1YWUA 2ZG0H 1EZUC 4X1PU 2ZHWH 2F9OA 2GMTC 2V7QD 1Y5UT 3MNBA 2G55A 4OS1A 3KGPA 3BEIB 4NZQA 2XWAA 2ZFTA 1BMNH 1FONA 3SNCA 1TAWA 4X1QU 1W10U 1C2GA 3E8LA 3ZZ7A 3P17H 4X6PA 2WV4A 1JIMA 1LKBA 1RXPA 3PMHB 4ACBA 2HPQH 4BAHB 1IQLA 4AFSA 1OXGA 2P3TB 3TNSA 3PWCA 1JOUB 1BRBE 1GBCA 3ZIAD 2BB4A 4MDSA 2A4QA 4U32A 3LOXA 1NBMD 1SGYE 1AVGH 1EPTB 1HJAB 1W0JD 2OC0A 2HWLB 4Y71A 4MG3A 1F0TA 2FI5E 3MOCA 1GGDB 4XBDA 2OQ5A 4MPUA 1P0SH 2ZQ2A 1OS8A 4KELA 2A2XH 3A8CA 2OC1A 1YYY1 5BPEA 2ALVA 4BANB 1DICA 3A89A 1GJDB 4FXGH 2DUCA 5A0CA 3RXTA 1TNJA 1O32A 2Z9IA 2FM2A 3ZZ6A 2R0KA 5FPSA 2ZDLA 4BXWA 1ZGVA 1O2HA 2VIOA 5DP6A 3EA7A 1O35A 2NWNA 1SQTA 3A84A 1SQOA 1MABB 2SGEE 2W3KA 2AIPA 3SGAE 4AB9A 2W5EA 1GJ7B 3E1XB 1A3EH 2FODA 2XNDD 3GY8A 2J97A 4PROA 3U8RH 3LONA 4NWKA 1O31A 2KCAA 1TPPA 2Z3EA 3B9FH 4IS5A 5GXPA 4NFFA 3CP7A 1GDQA 3F6UH 4E7NA 1GI1A 1MBMA 4I31A 5H4IB 2GTBA 2PWXA 3RXKA 3CS7A 1LQEA 4YLUA 2FOCA 1BQYA 1YPEH 3RXJA 1V2RT 1JBUH 3FZZA 1THPB 1F0UA 3F2HA 1F0SA 1V2OT 2ZU4A 3KQ5A 2WYJA 4O03A 3SOSA 4INHA 3W95A 5JB9S 4Q4LA 1SR5C 5C3NA 5FAHA 2BDIA 2ZFPH 1B0EA 3TH4H 2LPRA 3RMLH 3BTDE 1YBWA 2PKSB 5HXFA 4TPYA 1KIGH 4FUIA 3RXAA 2I6SA 2HLCA 2IN2A 1Z7KA 3ATLA 3VPKA 1B5GH 1O5AB 1NU7B 5EJZA 3IWMA 4IBLH 3GISB 1TMTH 1BMLA 4XFQA 1QJ7B 4WMEA 5FXLA 2TPIZ 5C1XA 1MBQA 5PTPA 4AFZA 3ZVDA 3D62A 3M7TA 2PV9B 4ABAA 2QE7D 1F7ZA 1DLEA 5T6FA 4ZHLU 3N7DA 3F9FA 1TPAE 4FUDA 4K1SA 3BTTE 1C2FA 3UB0A 1AKSB 3GOVB 1GHVH 5LGOA 1GHAF 2C8XB 3ZZ4A 5A2MH 2D2DA 3QTOH 2F43B 4X1NU 1BRAA 5C0UA 3Q3KA 4I7YH 1AGJA 3ZVBA 3NZIA 3RDZA 3SV8A 7KMEH 1C5VA 3RUOA 3ZZ5A 5GNDA 3O8RA 3PO1C 1L4DA 1RRKA 2WV9A 2BDYA 1DUEA 2O8TA 2Q6GA 1GHBF 1BBRH 1HJ8A 4ZKOU 3V13A 4AGKA 1GDUA 1TWXB 4JZ1A 3V3MA 4A1TA 2JH0D 5EXMA 5HGGA 2Y5GA 2BD4A 1XXFA 4DCDA 1GVZA 1PQAA 2G5VA 3DSPA 4FU8A 2XBXA 3BG4C 2Z9JA 3GYLB 1GBTA 3AAUA 4XOJA 1G3CA 2BDCA 1CT2E 1ZHPA 4X8UH 2NU0E 3CS0A 3OX7U 3ZVEA 4Q80A 1QJ1B 3E3TA 4GLYA 5EQSA 3RP2A 1DFPA 1OX1A 4K8YA 4F55A 1Y3WA 1YPGH 2JJ1D 3E0NB 1V2PT 3RU4E 3Q76A 2ZGCA 3N99A 1TPOA 5HIZA 5DP7A 1RTKA 3UNSA 1K0HA 2XCFA 1AVXA 2QIQA 2FLRH 4B76A 1O2IA 1YPMH 4ZKNU 4NFEA 1PQ5A 2G51A 4K69A 4DG4A 3E0PB 2CGAA 2QF4A 3E91A 2DE8A 2ZIQH 2A5IA 4GCHG 2VGCB 2AERH 3OEHD 5C2ZA 3Q00A 1AY6H 2ODQA 1O36A 3RXIA 1S5SA 4NIXA 2BDHA 4AOQA 2A32A 1NFXA 1QRWA 3Q77A 2O8WA 2Y5FA 2B7DH 1ACBE 5C1YA 4WMDA 1CGJE 2XC4A 3AVZA 3ENSB 3RMNH 2WUBA 1SOZA 4I8LA 2PUQH 4Z0KA 4AYVB 3RLWH 4ZCNA 3A8BA 5C5OA 1LVOA 1AU8A 1LVMA 3ZZ3A 1SVPA 4NG9H 1MZDA 1EP5A 2ZCKP 1TABE 3GY3A 4B6FA 4WXIA 4GUXA 3A85A 1MCVA 5GIBA 2C8ZB 1TYNA 3MFJA 1C1WH 2I6QA 1DY9A 1NRSH 3I29A 1TBRH 1MKXK 1LO6A 2L74A 2BVXH 5A0AE 1V2UT 3SGBE 3N7EA 1QHRB 1D4PB 1WBGB 1YPKH 1T4UH 1DT2A 1GVKB 2SGQE 1P03A 4FUHA 2ZGXH 2H6MA 3NWUA 1VCWA 2Y5HA 3MHWU 3BTGE 3TH2H 3VXEH 4Z1MD 4IMQA 2F9BH 2J4IA 1QQ4A 4AZ2B 1VGCB 2CJIA 5HKKD 1INCA 1GG6B 1EX3A 2ZFRH 1H8ED 1L2EA 3T62A 1C1OA 2CF8H 4NZLA 4BOHA 2J92A 3STJA 2LP6A 4I33A 2F9VA 2AMPA 1AIXH 1MTUA 4D9RA 3A7WA 4MQAA 2WPMS 4BAOB 1OWEA 1XM1A 3RXQA 4CRFA 5DP9A 2ZTYA 3A7ZA 2QF0A 2Z3CA 4LZ4B 1YPJH 1GI3A 5CHAC 1UTQA 1C2DA 4CRCA 2V6NA 1TONA 1D3QB 1W0KD 2BOHB 1C5LH 2KAIA 1WTGH 2VB0A 4YM9A 4KTCA 3S7KB 3MO9A 1ZSLA 1TGCA 2CHAC 3A86A 5EG4A 5IDKA 1KY9A 4M7GA 1C1QA 1W0ZU 4Q2KA 3SGQE 1ZOMA 1FQ3A 5HM9A 2VVUA 2G52A 1GBDA 4D76A 3SHAH 1O3LA 3KCGH 3OE7D 3P6ZB 1AZ8A 2XC0A 1SG8B 2SGAA 3MU5A 1SGCA 2BX3A 3NCLA 1UMAH 4LK4A 3UWJH 3F68H 1ELBA 1T8NA 4WVPE 2PGBB 2JJ2D 3TGKE 3UQVA 1EXFA 3AK5A 3LIWA 2ZPSA 2BLOA 3DFJA 2WPJS 1UTNA 1EASA 3EQ0H 4I8KA 2AMQA 1K1PA 3Q3YA 2CMYA 1HAIH 2FP7B 3BTQE 1LHFH 1RGQA 1MU8B 4TPIZ 1NZQH 1O2JA 1ZSJA 4WH8A 3T26A 1VITH 1ZPZA 1SGFA 3OFND 1UJ1A 3MNXA 4DT4A 1J17T 4H6SB 4I32A 1GHWH 2PGQB 3T25A 3BTEE 5EGMA 1O3MA 1GBLA 6GCHF 3BTHE 4AG2A 2CN0H 1O33A 1EATA 1PYTD 1O2PA 2PKAA 2QF3A 1G30B 5LPFA 3OU0A 3RXPA 1BTXA 2Z7FE 1TPSA 4K3JA 2AEIH 3A7TA 1EP6A 1BMAA 3U1IB 5KECA 1FN6A 2A5KA 2TGAA 1QNJA 1F0RA 3UFAA 3EGKH 2V3HH 1LHGH 1QBOA 1UCYH 4FU9A 1QGFA 2GGVB 1V2NT 5EPNA 1HIAB 5KGOA 1V2VT 1MCTA 1MH0A 3ZZ8A 3O8BA 4ZH8A 1LPZB 1O2KA 1TBZH 1RD3B 2F9NA 3S7HB 3DT0H 1IQMA 3A7YA 1IAUA 3SV6A 4ZKSU 2BY6X 3PV4A 3ZZCA 3TJVA 1BTYA 3HGPA 4FVBA 1CVWH 1W3CA 1L1NA 1XUGA 2AGGX 1CGIE 2VVCA 1OYQA 3NK8A 1S6FA 3SU2A 2PSYA 3EE7A 2VIDA 1A61H 1C1MA 3R3GB 1LMWB 4TY7A 4HTCH 2C3SA 1P09A 1QR3E 3S9AA 1P8VC 4ABBA 2OLGA 2AFQB 2ZU2A 3VXFH 1O30A 1GWAA 1V2KT 4AFQA 4Y76A 3NUMA 1O34A 2VINA 3G01A 4D7GA 1HDTH 3F0PA 2G4UA 1C5UA 1Q31A 1IQJA 2WINI 4BTIB 4I8GA 1C4U2 3UWIA 1GHXH 1SPJA 3TJOA 1GBKA 1SQRA 3SQHE 1EJAA 4O9VA 2FYRA 1M9UA 1QJ6B 1ELGA 3RXOA 3U69H 1LHDH 1TRNA 1HAVA 1RJXB 2OC8A 4Y79A 3PM3A 1DXWA 2FIRH 3F9HA 2FOEA 3QUMP 1O3CA 1XKBC 8GCHF 3SU4A 3PTNA 1WSSH 3QX5H 1P12E 2HLDD 3TK5A 4M9FA 1D3PB 3P70B 3FN8A 4FOUC 5L2ZH 3M36A 3T29A 3S9BA 5FHTA 1ZMNA 1ZTLA 2J2UA 3ODFA 5JBCS 4OGXA 1WTHD 4AFUA 1GBFA 1ZTKA 1SLVB 1UVTH 4Y8ZA 1B7XB 3KIDU 3RXVA 4B74A 4Q7XA 3N7OA 6ESTA 1A0LA 4GVUA 2KFWA 5L30H 3A81A 4B2CA 1AB9B 2O9QA 2QF5A 2ZU1A 1CBWB 2R2MB 1KDQB 2GKVE 2ZHDA 1MKWK 3KNXA 2W3IA 5T6GA 3ZYDA 1DM4B 4X6NA 5J4QA 3EDXB 4UFDH 4Z6AH 1BTUA 1Z71A 3FP6E 1P04A 4F49A 3SV2H 2BD5A 1MUEB 5K7RA 1ETTH 1TE0A 4UFGH 4IC6A 5AFYH 3U98H 3SQEE 1BBRE 3E16B 4WMFA 1FPCH 1QTFA 1DOJA 4ISIH 3PLPA 2Y80A 1G3EA 2Z3DA 5L2YH 1LCYA 3BIUH 2ZHEH 3GDUA 2JETC 1KMHB 1C9PA 1EZQA 3RU4D 4CR5A 1ZRKA 2YMSB 1UK2A 3LDXH 3RXEA 3UR6A 1CHGA 2XW9A 1ID5H 1N6YA 1SB1H 1G36A 4JK5A 3RM2H 2BY7X 1QBNA 1O39A 3SW2B 1Z6JH 1A5IA 2O8LA 5E0JA 5EJLA 1A5HA 4MPXA 1HAPH 3GCTG 4DW2U 5FPTA 1PPHE 4CRDA 3UREA 1MKWH 1GCTB 3FVFB 1JXPA 5C5NA 1WCZA 4H42U 5JBBS 3UIRA 2G4TA 3BEUA 1MAYA 1QIXB 3V7TA 2HNTE 3MTYA 1WUNH 4I8HA 1GI0A 1W11U 2FYQA 2ZGHA 3HKIB 1TNLA 4INLA 1HAGE 1K22H 5F8ZA 3O8CA 3RC4A 1ESBA 5EW2H 3QLPH 5DG6A 1T8OA 2G5NA 1P2KA 2BDGA 3F3BA 2B8OH 3RLYH 4X8VH 3F2FA 1O2GH 1XXDA 3A8DA 2GZ9A 5A8ZA 3QGNB 4NIYA 1K1MA 4Y0YE 1COWD 5JBAS 5T1VA 2GDDA 1K1JA 1BCUH 1VITG 1D6RA 2ZDVH 1OKXA 1AFQC 1LPKB 1TRYA 1P10A 2AGIX 3BTME 1EZXC 2GMTB 2YMSD 3GCOA 3LGWA 1MU6B 5E2OA 3MNSA 3VFEA 3UPEA 3QO6A 1FIZA 1TX6A 4R0IA 1FY3A 1F5KU 1TGTA 2B9LA 1UVPA 1S82A 2BQ7B 2VNTA 2CK3D 1ZLRA 2TRMA 4DVAU 1DSUA 1TNIA 1P02A 1W13U 1HGTH 2PTCE 4F48B 1H8DH 2XTTB 1A0JA 3BIVH 4UONA 3W1EA 4WJG2 5DGJA 3VB7A 1FY8E 3TPIZ 2FOGA 1SGIB 1C2KA 3JZ1B 1FY5A 1XUKA 4FETA 2ZCLP 4A6LA 3F0OA 3SI3H 2QAAA 1TQ0B 2Y7ZA 3T28A 3H7TA 1N8OC 1C5XB 1C2IA 1FDPA 4RSPA 2HGTH 1GI2A 1KXCA 3MH4A 1AUTC 3L33A 2H1UA 4BAMB 2CF9H 1HYLA 1NROH 3DFLA 3PMBB 1KLJH 1C4Y2 2SFAA 3MU0A 3KYGA 4KGAA 3LGIA 3KYFA 4B2BA 2QXGA 3U9AH 1W14U 2ILNA 1XVOA 2ZHQH 2ZPRA 1Z8RA 2F4LA 3DUXH 1PJPA 1PQ8A 3FP8E 5AHGH 1VR1H 1NTPA 5CDFE 1AZZA 1GBJA 3RXGA 5EOKA 3MO6A 3PV2A 1Y3YA 1O3EA 1MD7A 1D9IA 1G3BA 1V6DA 4WF8A 4OS2A 5C94A 2FOFA 3SU6A 1BTPA 1LPGB 2XYAA 1IQFA 2OTVA 4GCHF 1KYNA 3BG8A 3ELAH 2ALPA 1ANEA 4MNWA 3HGNA 5JYIA 5AF9H 1H9LB 3T27A 2Q6FA 1WAYB 3RXDA 2QC2A 5DPAA 2R9PA 2GP9B 2FS8A 1HV7A 1O5BB 2J98B 3F2GA 1UTLM 3MYWA 4CREA 1BJVA 2V3OH 3VB6A 1PPEE 3W94A 1ZGIA 2BVRH 5DO4H 1V2LT 3SUDA 1YPHE 2BQWB 5E8EH 1O2TA 1KTSB 2UUYA 3C27B 3QWCH 1IOEA 1O3PB 4Q63A 1RS0A 4WWYA 2QXHA 2P94A 1SLUB 5ESBA 1AO5A 1UHBB 1IHSH 3SJKA 2Z9KA 2QGRA 5JBTA 1NRPH 2A31A 1Q3XA 2ZECA 1Y59T 1FAKH 2QA9E 2P16A 3GICB 1GI9B 1H9IE 3M37A 4Y7BA 3B8JA 1SLXB 3SI4H 2C8WB 3FO8D 4UFFH 4XRNA 1G32B 2BD3A 4K60A 4H4FA 4XBCA 1O38A 1SGEE 1UCYE 1H1BA 2ZFQH 1EJNA 4DT7B 1V2QT 1GI8B 1C2JA 2OQUA 1HJ9A 4K2YA 2PTNA 1A7SA 1F5RA 1T4VH 3I78A 3ITIA 1FV9A 1S6LA 5AFZH 1F5LA 3V12A 4YO9A 5HIYA 3A87A 2FPZA 3SORA 3OY5U 1GJCB 3K6YA 1QRXA 2G81E 1C1NA 2F9PA 2KZ4A 1PPGE 2QV1A 1OOKB 2Y81A 3VB4A 2TGPZ 3PWBA 2IPHA 2BD2A 2OC7A 1BJUA 1ELTA 3LJJA 1PPBH 3ATKA 1YCPM 2W6ID 2ZPQA 2QN5T 1G2LA 5EQQA 3SNBA 2H9HA 1O2NA 1GJ4H 4ISNA 1L1JA 1C5PA 2PFEA 1KXFA 1P11E 2SNVA 2ULLA 1FMGA 3OAAD 1BITA 5FBIA 2C4FH 4SGAE 1ELEE 1O2ZA 2OK5A 1ETRH 3EAJA 4ZAEA 1O5DH 5IYTA 3SJOA 1EPTA 2Z9LA 2GVFA 1Y5BT 1ZZZA 3M3TA 1O2WA 1YCPK 3FP7E 1DWBH 4U30A 5T3HA 1GJ6A 1O5CB 3URCA 1YLDA 1Z8GA 3HK3B 4UEHH 3OTJE 1ELCA 1XUFA 2VU8E 1GI7B 1DITH 2FI3E 2F83A 1GHBG 4RI0A 2XWBI 2VH6A 1LDTT 4LZ1H 1GI5A 1O3GA 2ZC9H 3M3VA 4BAQB 4QT8C 3RC6A 1FNIA 2UUJB 1HAHH 3LH3A 3NPSA 4ISLA 3RXRA 1TNKA 4I86A 2CV3A 4IC5A 3K2UA 1YLNA 4ISOA 2THFB 1O5GH 1E0FD 3BTFE 3WWBA 2PR3A 5DN6D 3B23B 1PYTC 1K1LA 3IG6B 3VB3A 1AMHA 1GVLA 1GPZA 5EODA 1KXBA 2OINA 1IQHA 2IJOB 5FX5A 1PPCE 3D65E 2Z6BD 5FCKA 2ZF0H 4OS5A 1O3AA 1GI6A 3PYHA 2H9EH 5GDSH 1AE8H 1H9HE 2ODYB 2PP6A 4DJZB 2BZAA 4ABGA 3KHVA 1YCPH 3ATWA 1MKXH 2GZ8A 5DJ7A 1TRMA 3RM0H 2D1JA 4X2WA 1P3EA 2ZTXA 1SGFG 1WQSA 5C1UA 1GJ9B 1KLIH 1G3DA 1Y8TA 2UUFB 5A8YA 2RA0A 3MU8A 3A7XA 1ZHRA 4K1TA 2XBYA 3M5MA 3ZYEA 1EUFA 1O3JA 2FMJA 1V2WT 2PHBA 4OS7A 1E38B 7GCHG 4ZKRU 1E36B 4Q7ZA 1GMHG 4AGJA 2XNIA 2WPKS 1A2CH 1CHOG 3KQBA 4X2VA 1DY8A 2FS9A 1HBTH 5F8TA 1BRUP 3DCLA 5CHAB 2ZQ1A 4YLQH 4Y10E 3LGYA 5GPIB 2GCTC 1W2KH 1C1SA 2CHAB 4X6MA 1ZR0A 4XBBA 2ANMH 2OCVB 2GCHG 1C2EA 3MQKC 2G00A 4FVDA 1WV7H 1IQIA 1YF4A 4FUBA 1NRRH 3QK1A 3AASA 1BUIA 3ATIA 1ZPCA 1SFIA 1AKSA 1HAOH 2Y7XA 4B2AA 2ZDAH 4Y8YA 4NGAH 4JK6A 5BRRE 2AH4X 2HNTF 2TIOA 1GBEA 1SGRE 2WPDD 1THRH 2A2QH 2EI6A 4MVNA 2WYGA 1O0DH 4YZUA 4Y11E 1LKAA 1XVMA 2RA3A 2VIQA 3RXFA 1AI8H 3SBKA 1UTOA 1FJSA 2FI4E 2P8OC 3GY4A 3A83A 1H8IH 1O2MA 4E05H 1P2NA 1KLTA 4ABEA 1MTNC 4P02A 3BV9B 5C67A 1KXDA 3MO3A 2P95A 3BSQA 2R2WU 3TVJB 1CT4E 2P93A 1GMDG 3RU4T 1C1PA 2RDLA 2BY8X 4A5TS 1YPLH 4AB8A 5FX6A 2OD3B 2ZNKH 4AG1A 2FLBH 4MPWA 1QRZA 4U01A 3MNCA 1HUTH 1DWEH 4RT0A 1SFQB 3UR9A 1TA6A 1FIWA 2ZDNA 2SGPE 2KX4A 1RIWC 3TITA 1BTWA 2BDBA 2ZGBH 2ZU5A 4X6OA 5F03A 1OWHA 2HPPH 1S81A 2D26C 4KTUA 4ESTE 2EA3A 4RT1A 1ZMJA 4CHAC 4YXWD 4B71A 3NXPA 4MNYA 1NRQH 2O8MA 1UTPA 3VGCC 1W7GH 2GV7A 2GD4B 4OS6A 3TNTA 2ODPA 5EIYA 1V2MT 3RMOH 3T5FH 3SU1A 5GCHF 1XKAC 1EAWA 3EA8A 1YP9A 1CE5A 3GY2A 4GHQA 3UAIC 2RG3A 4OS4A 4VGCC 4BXSA 3S0NA 4MTBA 3ZZ9A 1ARBA 2KCPA 2ZHFH 2H9TH 3MH6A 3DD2H 3QGJA 1NRNH 3SO3A 2VVVA 1O2LA 3CNRA 1V2TT 3VEQB 2UWLA 2IPQX 1T7CA 2OBOA 5G4BA 1E34B 2R3UA 2VBCA 2VH0A 1QB6A 2Z9GA 4YOJA 3LT3A 3LJOA 1HCGA 2Y6TA 3TJUA 4D9QA 3P95A 4SGBE 2ZA5A 2FEQH 4ZHMU 4YT7H 1TA2A 1O2YA 1W7XH 4O97A 2BLQA 3LKWA 1CO7E 1C2LA 3ZVCA 4OM9A 3K6ZA 5GWZA 2BZ6H 4CH8B 1DS2E 3IITA 8KME2 3QDZB 1SGPE 1O2UA 1LVYA 1WDIA 4ACAA 3SNEA 2A45B 3U28C 1S0RA 1GBHA 3BF6H 2F9UA 2Q1JA 3ZVFA 3M5LA 1VZQH 1KXEA 1GCDA 1NN6A 1ZHMA 3PMAB 1Z8JB 1O2XA 2NU2E 5K0HA 1C5YB 1IQEA 2XXLA 2JDID 1E1RD 4XD7D 1FY1A 4WH6A 2M2AA 4DURA 2BD8A 1TMBH 4B1TA 1JRSA 4HZHA 1CA0C 3KQEA 2D8WA 4YESB 3M35A 1K28D 1BTHH 1NO9H 1C5MD 2W7SA 3M7UA 3Q3XA 4MPVA 2O8UA 3GCHC 1TB6H 3PTBA 1BIOA 4ZHAA 3MWIU 2EY4C 1C5OH 1JMOH 5EQRA 3GYMA 2AYWA 4WXVA 2HOBA 2R3YA 4A1VA 2GZ7A 2ZKSA 2ZZUH 3E90B 2G8TA 3SZNA 4X2XA 1QA7A 3EYDA 4THNH 5J4SA 1VITF 4MLFB 2LELA 2FX4A 2FWWA 4WY3A 2BY9X 1L1GA 3KL6A 1FZZA 1NFUA 3T2NA 1C1TA 3ESTA 3SYJA 1K9OE 1WYKA 1WU1A 1ABJH 3P8NA 3QZRA 3R0FA 1P06A 2XOKD 1OWDA 1GMCG 1ESTA 2C8YB 1FUJA 1SI5H 2OUAA 1OYTH 2C93B 1GBMA 2J34A 3TGJE 1B0FA 2WZQA 6CHAB 1T8MA 2W7UA 1EAUA 5EPYA 3D49H 2FTMA 1LTOA 1QL8A 2HALA 5T6DA 4ABIA 3F9GA 1UK3A 2ZEBA 2A5AA 4HG6A 2YNAA 4JYVH 2J9NA 3RXMA 1OPHB 2SGDE 2V3MA 4CRBA 1BTZA 3TH3H 2UWOA 1EZSC 2PLXA 2FOMB 2TGDA 1ZJDA 1HAYB 3LC3A 2IOTA 1U6QA 1EPTC 1FX0B 1GDNA 1HJAC 1K1IA 4ABDA 1A0HB 1TOCB 1HLTH 1SC8U 2BD7A 1BMFD 1GGDC 5TCCA 3P8FA 3WW7A 3TIUA 1AVWA 1DLKB 1ARCA 1AQ7A 1BT7A 2JETB 5L6NH 2HVYB 2W6JD 2VJ1A 1PPFE 4F4OC 1C1UH 5HYOA 2L6OA 2FOAA 3GY5A 4ABJA 3P8GA 1AHTH 2QCYA 5SGAE 4J2YB 4X0WU 2FZZA 1QY6A 1RFNA 2XRCA 1NC6A 1WXRA 1A1RA 2K1QA 1Z8IB 5EXNA 5FPYA 1ABIH 3SN8A 1HPGA 2HRVA 3PROA 1HRTH 2BLVA 2JKHA 5DP4A 3C1KA 4TY6A 3ZV9A 5LPEA 1UVOA 1Y5AT 1O3NA 1J8AA 1UO6A 3QN7A 1Y3VA 1XUJA 3OYPA 2EI8A 1C1RA 1YLCA 3PV5A 4NA7A 5LH8A 2F91A 4NSYA 4H6TA 1GBBA 2EEKA 2NU4E 1HIAA 3UUZA 4RN6A 4K1EA 1K21H 1ZSKA 4TWYA 1SL3A 2BTCE 1NM6A 2NU1E 3DHKH 3PRBA 3S9CA 1MTSA 1YY3A 1SGDE 3M5NA 1TGBA 2PUXB 3KN2A 3BTKE 4D8NA 1A3BH 3H7OA 1H4WA 1ZMLA 2QYIA 3A7VA 2ZP0H 4HI3A 3GS9A 4YT6H 2KCYA 2VWOA 1Q2WA 2P3UB 4ZXXH 3ZZAA 1GJBB 1K1NA 2ZCHP 4X8SH 4YOIA 1DPOA 3EE0B 1V2ST 1XUHA 1J16A 2PKSC 1AFQB 3RC5A 2A7CA 3FZDA 2WPHS 1VCQA 2P59A 5IK2D 4IMZA 3A80A 2UWPA 3GDVA 3JZ2B 9LPRA 2XBWA 2H5DA 3ZZDA 4UD9H 3F1SB 1ZRBA 1AWFH 2STBE 1UTKA 1O3DA 1C4V2 1P3CA 1O3HA 2KAIB 3SUEA 1SHYA 1QBVH 1C9TA 2SGFE 1WQVH 2Z94A 2DE9A 1LVBA 3O8DA 3SUFA 1E37B 4ZXYH 2BMGB 2VWLA 2A4GA 1P2QA 2UUKB 2FX6A 4JYUH 5A0BA 3GDSA 1AN1E 3SJ9A 1NFYA 3U1JB 4OGYA 1SMFE 3A82A 1BBRK 4X2YA 1N8OB 2A4RA 3SJIA 4JYTA 3OEED 3URDA 3LGVA 1SLWB 2Q6DA 2WSSD 3SU5A 2ZI2H 1P9SA 3PLBA 4YTAA 1GHYH 2ANWA 1HB0B 4ZROA 4MNVA 5E2PA 4TT3D 1SQAA 1NS3A 1HNEE 1DWCH 1YGCH 2BLWA 3MU1A 2HVXA 4CBOA 2QXIA 5A09A 2OBQA 3TGIE 1TFXA 2ZGJA 3SU3A 2A7JA 1SKYE 4AN7A 2ANYA 1ZJKA 3M61U 4CH2B 1OP2A 3UTUH 2VIPA 2JIZD 1KDQA 1BB0B 3P92A 3UNRA 2IJD1 1EB1H 3MH7A 4GSOA 2C90B 2JH5D 3UOPA 5JB8S 5FBEA 2KCOA 5FL7D 2A0QB 3NKKA 5DK1A 1TGSZ 2BXTH 2EQNA 4FUEA 2PKAB 2VGCC 2AGEX 3SHCH 2BYAX 1A4WH 4IN2A 1ELDE 3HKJB 4DGJA 1F2SE 5KEDA 2OXSA 2V0BA 1AE5A 1A46H 3PRDA 4B73A 3PO1B 3K65B 2TBSA 4MNXA 4FUJA 1Y3XA 1KSNA 1C5QA 1CQQA 5I46H 2XC5A 2ZDKA 1KTTB 4AYYB 4UDWH 1HAZB 5DKMA 1S0QA 2A4OA 1CU1A 1S85A 1UK4A 1YM0A 3PB1E 5F53A 4E7RG 1AD8H 3WWFA 1IQGA 1NT1A 2STAE 3BG4B 3LGUA 5TJXA 5C17A 1OWJA 2K8IA 1N1LA 2VIWA 4ISHH 1A5GH 1LHCH 1HXFH 1MMJN 3STIA 4X1RU 5HM2A 1TQ7B 1NY22 1O2OA 2ZTZA 5CE1A 1WOFA 1J9CH 1DWDH 4Y0ZE 1S84A 1O3BA 2RFKC 1QCPA 4CRAA 2CXVA 4KKDA 4LXBH 1EKBB 4P00A 1G2MA 4XSKU 4ZMAH 1L0ZA 1GHAG 2BQ6B 1GBAA 1ELFA 2BD9A 3DSOA 3RXCA 3FANA 1VGCC 7GCHF 1NFWA 5I25A 4YOGA 2FXRA 1QQUA 1BRCE 1GG6C 1GJAB 1GMHF 3OSYA 2ZU3A 2B5TB 1NU9A 1CHOF 1MQ5A 1OSSA 2F3CE 1LHEH 1TGNA 2KM0A 3BEFB 1NBME 1LQDB 4NA9H 1G37A 1CSOE 3RXSA 2ZFSA 1P2OA 3PMJA 3RXLA 1EFRD 3EA9A 3OTPA 4X1SU 1OWIA 2GCHF 4BTUB 1HAVB 2HNTC 5DP5A 2JH6D 1ORFA 1DUAA 2J95A 1SHHB 1AFEH 2FOBA 2ZWLH 1ZYOA 1GJ8B 2AS9A 3RXBA 4K8BA 3SNDA 2W26A 4LOYH 1ESAA 1P9UA 3A8AA 3LC5A 3MH5A 4DIIH 4ASHA 1V3XA 3RMMH 1XUIA 3FOAA 1IHTH
chains in the Genus database with same CATH topology
3U8OH 4O3TA 2PSXA 3LGTA 1ELAA 1QA0A 1IQNA 1L4ZA 1PQ7A 1DANH 3LPRA 5DP3A 3ZZBA 4RKOB 2GDEH 1O5FH 4NCYA 1C5RA 3K9XB 4B75A 3HATH 4CR9A 4GPGA 4FU7A 4FUGA 1DXPA 4I8JA 2FDAA 1YKTA 2P3FH 3BTWE 1VCPA 1J15A 1ZTJA 3M3SA 1TBQH 1GMDF 4Y6DA 4UFEH 4BAKB 1EB2A 1TX7A 2GT8A 3F9EA 1C2HA 1P2IA 1ZPBA 1FI8A 2BY5X 4A1XA 1MZAA 1UTMA 3SUGA 2FO9A 5JDUB 4INKA 8LPRA 1TIOA 2BM2A 1O3IA 2M5TA 2YOLA 1C2MA 3UOUA 2A1DB 1QFKH 5F6MA 1E35B 1EOJA 1JRTA 1O3KA 1NESE 3UY9A 1GBIA 5AVDA 1Z6EA 1S83A 1S6HA 4ABHA 2AMDA 4K5ZA 4U2WA 1XX9A 2WUCA 2ANKH 5B6OA 4UE7H 1HAXB 2TGTA 3TJNA 4AX9H 1MQ6A 4IN1A 5FCRA 5JPMH 1EOLA 1OP0A 2R0LA 1ANCA 1BZXE 1UVSH 3ZVGA 1HFDA 1UCYK 5EU8A 1T32A 1Y3UA 3U8TH 4ABFA 4JZDH 3LH1A 1GI4A 3SJ8A 3RXUA 3SV7A 4D7FA 1P2JA 1O5EH 4XDEA 5A8XA 1T8LA 4X8TH 4Q7YA 1C5NH 1C5SA 4JZEH 1C5TA 3ZVAA 1FAXA 1F92A 1PPZA 3S69A 1ETSH 3TK9A 1P05A 1QURH 3V0XA 3KQDA 1AWHB 1YC0A 3TK6A 2VWNA 1O3OA 1UHBA 5TCAA 2ZDMA 1BA8B 2GCTB 4NA8A 4J1YA 3UQOA 4FUFA 1Z1IA 1DDJA 2XCNA 1D3DB 1UVUH 1TMUH 1BOQA 1T31A 3H5CB 1PFXC 4FUCA 1GL0E 4NIVA 3MMGA 5DP8A 1O2QA 4CBNA 3M7QA 1FLEE 1JWTA 1EAXA 1MD8A 1VJ9U 1P2MA 1SGNE 2QY0B 1DVAH 2RCEA 2WPLS 4NIWA 1C5ZB 1C5WB 2H5CA 1TNGA 1BMMH 1K1OA 3HK6B 1TX8A 2J94A 1VJAU 1SGQE 3FFGA 1YPHC 3ODDA 5CMXH 1CA8B 2P8OB 2XBVA 5EXLA 2SNWA 4KTSA 1GL1A 4XE4A 1MTNB 1QB9A 2Y82A 3KF2A 1D3TB 1MTVA 4Y7AA 2VWMA 3QZQA 1FXYA 1CT0E 4JCNA 1DSTA 3E6PH 1IQKA 4KP0A 1X7AC 1ANDA 2NU3E 1FN8A 1V2JT 3HPTB 1O3FA 2BX4A 3PLKA 5ETXA 3FAOA 3VB5A 4JMYA 1O37A 4JZFH 4HGCA 1CGHA 1RIWB 1NPMA 1THSH 1EQ9A 4A7IB 5EW1H 3DA9B 9ESTA 4A92A 3BN9A 3CENA 1W12U 4NWLA 4RKJB 1GMCF 1MAXA 1O2SA 3ATMA 1DX5M 2J38A 1N6XA 1FPHH 4CHAB 2B0FA 1SSXA 3GY7A 2GV6A 1D6WA 3A88A 5F8XA 1OWKA 3L6PA 5ESTE 3VGCB 6GCHG 4IW4E 4R8TB 4GAWA 2BOKA 3UNQA 3AW0A 3TLOA 2YNBA 4VGCB 1P57B 1TLDA 2BDAA 1K2I1 2H2ZA 1AB9C 1GJ5H 3MI4A 3D23A 1CBWC 1HXEH 1RTLA 4Y8XA 3GCTF 3KQCA 1TNHA 4JZIA 2EC9H 1BHXB 1EJMA 1W8BH 3RXHA 3SV9A 2FESH 2ZO3H 1DE7H 3MU4A 4DIHH 1EAIA 2ASUB 3AAVA 4O3UA 4GHTA 1JIRA 4TYDA 1SBWA 1TOMH 3GY6A 7ESTE 2QXJA 4BTTB 3P8OA 1SGTA 1O2RA 1QB1A 2ZFFH 6CHAC 7LPRA 1TALA 2GX4A 3WY8A 1QL7A 2V35A 3M5OA 1SOTA 4TWWA 2ESTE 1GHZA 1G9IE 2A7HA 4IGDA 4BNRA 1QL9A 4ZUHA 1Z1JA 5E0HA 5GCHG 2FOHA 2OP9A 2AIQA 1CA0B 4NSVA 1ANBA 3TU7H 2WPIS 2GT7A 4AORA 1AUJA 3QTVH 2VIVA 3GCHB 3I77A 1GCTC 2WV5A 2PW8H 3L3TA 1RTFB 1OP8A 3LU9B 1J14A 5C20A 3KEEA 3OY6U 1P01A 2BVSH 3SU0A 4DOQA 3AW1A 3ZV8A 1UTJA 1XMNB 4DY7B 1W0YH 6LPRA 2LNCA 1BDAA 2BXUH 5HMAA 5LPRA 1MTWA 1O2VA 1BHXF 4CRGA 1FY4A 5E0GA 8ESTE 1C1VH 2EI7A 2BHGA 2FTLE 5ABWA 5GJ4B 1ELVA 4HFPB 4E06H 1KXAA 8GCHG 3SNAA 3GCNA 2ZG0H 1EZUC 4X1PU 2ZHWH 2F9OA 2GMTC 1Y5UT 3MNBA 2G55A 4OS1A 3KGPA 3BEIB 4NZQA 2XWAA 2ZFTA 1BMNH 1FONA 3SNCA 1TAWA 4X1QU 1W10U 1C2GA 3E8LA 3ZZ7A 3P17H 4X6PA 2WV4A 1JIMA 1LKBA 1RXPA 3PMHB 2HPQH 4BAHB 1IQLA 4AFSA 1OXGA 2P3TB 3TNSA 3PWCA 1JOUB 1BRBE 1GBCA 2BB4A 4MDSA 2A4QA 4U32A 3LOXA 1SGYE 1AVGH 1EPTB 1HJAB 2OC0A 2HWLB 4Y71A 4MG3A 1F0TA 2FI5E 3MOCA 1GGDB 4XBDA 2OQ5A 4MPUA 1P0SH 2ZQ2A 1OS8A 4KELA 2A2XH 3A8CA 2OC1A 1YYY1 5BPEA 2ALVA 4BANB 1DICA 3A89A 1GJDB 4FXGH 2DUCA 5A0CA 3RXTA 1TNJA 1O32A 2Z9IA 2FM2A 3ZZ6A 2R0KA 5FPSA 2ZDLA 4BXWA 1ZGVA 1O2HA 2VIOA 5DP6A 3EA7A 1O35A 2NWNA 1SQTA 3A84A 1SQOA 2SGEE 2W3KA 2AIPA 3SGAE 4AB9A 2W5EA 1GJ7B 3E1XB 1A3EH 2FODA 3GY8A 4PROA 3U8RH 3LONA 4NWKA 1O31A 1TPPA 2Z3EA 3B9FH 4IS5A 5GXPA 4NFFA 3CP7A 1GDQA 3F6UH 4E7NA 1GI1A 1MBMA 4I31A 5H4IB 2GTBA 2PWXA 3RXKA 3CS7A 1LQEA 4YLUA 2FOCA 1BQYA 1YPEH 3RXJA 1V2RT 1JBUH 3FZZA 1THPB 1F0UA 1F0SA 1V2OT 2ZU4A 2WYJA 4O03A 3SOSA 4INHA 3W95A 5JB9S 1SR5C 5C3NA 5FAHA 2BDIA 2ZFPH 1B0EA 3TH4H 2LPRA 3RMLH 3BTDE 1YBWA 2PKSB 5HXFA 4TPYA 1KIGH 4FUIA 3RXAA 2I6SA 2HLCA 2IN2A 1Z7KA 3ATLA 3VPKA 1B5GH 1O5AB 1NU7B 3IWMA 4IBLH 3GISB 1TMTH 1BMLA 4XFQA 1QJ7B 4WMEA 5FXLA 2TPIZ 5C1XA 1MBQA 5PTPA 4AFZA 3ZVDA 3D62A 3M7TA 2PV9B 4ABAA 1F7ZA 1DLEA 5T6FA 4ZHLU 3F9FA 1TPAE 4FUDA 4K1SA 3BTTE 1C2FA 1AKSB 3GOVB 1GHVH 5LGOA 1GHAF 2C8XB 3ZZ4A 5A2MH 2D2DA 3QTOH 4X1NU 1BRAA 3Q3KA 4I7YH 1AGJA 3ZVBA 3NZIA 3RDZA 3SV8A 7KMEH 1C5VA 3RUOA 3ZZ5A 3O8RA 3PO1C 1L4DA 1RRKA 2BDYA 1DUEA 2O8TA 2Q6GA 1GHBF 1BBRH 1HJ8A 4ZKOU 3V13A 4AGKA 1GDUA 1TWXB 4JZ1A 3V3MA 4A1TA 2JH0D 5EXMA 5HGGA 2Y5GA 2BD4A 1XXFA 4DCDA 1GVZA 1PQAA 2G5VA 4FU8A 2XBXA 3BG4C 2Z9JA 3GYLB 1GBTA 3AAUA 4XOJA 1G3CA 2BDCA 1CT2E 1ZHPA 4X8UH 2NU0E 3CS0A 3OX7U 3ZVEA 4Q80A 1QJ1B 3E3TA 4GLYA 5EQSA 3RP2A 1DFPA 1OX1A 4K8YA 1Y3WA 1YPGH 3E0NB 1V2PT 3RU4E 3Q76A 2ZGCA 1TPOA 5DP7A 1RTKA 3UNSA 2XCFA 1AVXA 2QIQA 2FLRH 4B76A 1O2IA 1YPMH 4ZKNU 4NFEA 1PQ5A 2G51A 4K69A 4DG4A 3E0PB 2CGAA 3E91A 2DE8A 2ZIQH 2A5IA 4GCHG 2VGCB 2AERH 5C2ZA 3Q00A 1AY6H 2ODQA 1O36A 3RXIA 1S5SA 4NIXA 2BDHA 4AOQA 2A32A 1NFXA 1QRWA 3Q77A 2O8WA 2Y5FA 2B7DH 1ACBE 5C1YA 4WMDA 1CGJE 2XC4A 3AVZA 3ENSB 3RMNH 2WUBA 1SOZA 4I8LA 2PUQH 4Z0KA 4AYVB 3RLWH 3A8BA 5C5OA 1LVOA 1AU8A 1LVMA 3ZZ3A 1SVPA 4NG9H 1MZDA 1EP5A 2ZCKP 1TABE 3GY3A 4WXIA 4GUXA 3A85A 1MCVA 5GIBA 2C8ZB 1TYNA 3MFJA 1C1WH 2I6QA 1DY9A 1NRSH 3I29A 1TBRH 1MKXK 1LO6A 2BVXH 5A0AE 1V2UT 3SGBE 1QHRB 1D4PB 1WBGB 1YPKH 1T4UH 1DT2A 1GVKB 2SGQE 1P03A 4FUHA 2ZGXH 2H6MA 3NWUA 1VCWA 2Y5HA 3MHWU 3BTGE 3TH2H 3VXEH 4IMQA 2F9BH 2J4IA 1QQ4A 4AZ2B 1VGCB 2CJIA 1INCA 1GG6B 1EX3A 2ZFRH 1L2EA 3T62A 1C1OA 2CF8H 4NZLA 4BOHA 2J92A 3STJA 4I33A 2F9VA 2AMPA 1AIXH 1MTUA 4D9RA 3A7WA 4MQAA 2WPMS 4BAOB 1OWEA 1XM1A 3RXQA 4CRFA 5DP9A 2ZTYA 3A7ZA 2QF0A 2Z3CA 4LZ4B 1YPJH 1GI3A 5CHAC 1UTQA 1C2DA 4CRCA 2V6NA 1TONA 1D3QB 2BOHB 1C5LH 2KAIA 1WTGH 2VB0A 4YM9A 4KTCA 3S7KB 3MO9A 1ZSLA 1TGCA 2CHAC 3A86A 5EG4A 5IDKA 1KY9A 4M7GA 1C1QA 1W0ZU 4Q2KA 3SGQE 1ZOMA 1FQ3A 5HM9A 2VVUA 2G52A 1GBDA 4D76A 3SHAH 1O3LA 3KCGH 3P6ZB 1AZ8A 2XC0A 1SG8B 2SGAA 3MU5A 1SGCA 2BX3A 3NCLA 1UMAH 4LK4A 3UWJH 3F68H 1ELBA 1T8NA 4WVPE 2PGBB 3TGKE 3UQVA 1EXFA 3LIWA 2ZPSA 2BLOA 3DFJA 2WPJS 1UTNA 1EASA 3EQ0H 4I8KA 2AMQA 1K1PA 3Q3YA 2CMYA 1HAIH 2FP7B 3BTQE 1LHFH 1RGQA 1MU8B 4TPIZ 1NZQH 1O2JA 1ZSJA 4WH8A 3T26A 1VITH 1ZPZA 1SGFA 1UJ1A 3MNXA 1J17T 4H6SB 4I32A 1GHWH 2PGQB 3T25A 3BTEE 5EGMA 1O3MA 1GBLA 6GCHF 3BTHE 4AG2A 2CN0H 1O33A 1EATA 1PYTD 1O2PA 2PKAA 2QF3A 1G30B 5LPFA 3OU0A 3RXPA 1BTXA 2Z7FE 1TPSA 4K3JA 2AEIH 3A7TA 1EP6A 1BMAA 3U1IB 1FN6A 2A5KA 2TGAA 1QNJA 1F0RA 3UFAA 3EGKH 2V3HH 1LHGH 1QBOA 1UCYH 4FU9A 1QGFA 2GGVB 1V2NT 5EPNA 1HIAB 1V2VT 1MCTA 1MH0A 3ZZ8A 3O8BA 4ZH8A 1LPZB 1O2KA 1TBZH 1RD3B 2F9NA 3S7HB 3DT0H 1IQMA 3A7YA 1IAUA 3SV6A 4ZKSU 2BY6X 3PV4A 3ZZCA 3TJVA 1BTYA 3HGPA 4FVBA 1CVWH 1W3CA 1L1NA 1XUGA 2AGGX 1CGIE 2VVCA 1OYQA 3NK8A 1S6FA 3SU2A 2PSYA 2VIDA 1A61H 1C1MA 3R3GB 1LMWB 4TY7A 4HTCH 2C3SA 1P09A 1QR3E 3S9AA 1P8VC 4ABBA 2OLGA 2AFQB 2ZU2A 3VXFH 1O30A 1GWAA 1V2KT 4AFQA 4Y76A 3NUMA 1O34A 2VINA 3G01A 4D7GA 1HDTH 2G4UA 1C5UA 1Q31A 1IQJA 2WINI 4BTIB 4I8GA 1C4U2 3UWIA 1GHXH 1SPJA 3TJOA 1GBKA 3SQHE 1EJAA 4O9VA 2FYRA 1M9UA 1QJ6B 1ELGA 3RXOA 3U69H 1LHDH 1TRNA 1HAVA 1RJXB 2OC8A 4Y79A 3PM3A 1DXWA 2FIRH 3F9HA 2FOEA 3QUMP 1O3CA 1XKBC 8GCHF 3SU4A 3PTNA 1WSSH 3QX5H 1P12E 3TK5A 1D3PB 3P70B 5L2ZH 3M36A 3T29A 3S9BA 5FHTA 1ZMNA 1ZTLA 2J2UA 3ODFA 5JBCS 4OGXA 1WTHD 4AFUA 1GBFA 1ZTKA 1SLVB 1UVTH 4Y8ZA 1B7XB 3KIDU 3RXVA 4B74A 4Q7XA 3N7OA 6ESTA 1A0LA 4GVUA 5L30H 3A81A 4B2CA 1AB9B 2O9QA 2ZU1A 1CBWB 2R2MB 1KDQB 2GKVE 2ZHDA 1MKWK 3KNXA 2W3IA 5T6GA 3ZYDA 1DM4B 4X6NA 5J4QA 3EDXB 4UFDH 4Z6AH 1BTUA 1Z71A 3FP6E 1P04A 4F49A 3SV2H 2BD5A 1MUEB 5K7RA 1ETTH 1TE0A 4UFGH 4IC6A 5AFYH 3U98H 3SQEE 1BBRE 3E16B 4WMFA 1FPCH 1QTFA 1DOJA 4ISIH 3PLPA 2Y80A 1G3EA 2Z3DA 5L2YH 1LCYA 3BIUH 2ZHEH 3GDUA 2JETC 1C9PA 1EZQA 3RU4D 4CR5A 1ZRKA 1UK2A 3LDXH 3RXEA 3UR6A 1CHGA 2XW9A 1ID5H 1N6YA 1SB1H 1G36A 4JK5A 3RM2H 2BY7X 1QBNA 1O39A 3SW2B 1Z6JH 2O8LA 1A5IA 5E0JA 1A5HA 4MPXA 1HAPH 3GCTG 4DW2U 5FPTA 1PPHE 4CRDA 3UREA 1MKWH 1GCTB 3FVFB 1JXPA 5C5NA 1WCZA 4H42U 5JBBS 3UIRA 2G4TA 3BEUA 1MAYA 1QIXB 3V7TA 2HNTE 3MTYA 1WUNH 4I8HA 1GI0A 1W11U 2FYQA 2ZGHA 3HKIB 1TNLA 4INLA 1HAGE 1K22H 5F8ZA 3O8CA 3RC4A 1ESBA 5EW2H