1SHYA

The crystal structure of hgf beta-chain in complex with the sema domain of the met receptor.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
228
structure length
228
Chain Sequence
b'VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Crystal structure of the HGF beta-chain in complex with the Sema domain of the Met receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor/growth factor receptor
total genus 44
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2004-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1shyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1shyA01
2HVXA 5T6GA 4YTAA 5EXMA 1GMDG 1SGQE 1GBKA 3OY5U 3M7TA 1TWXB 1IQGA 1UTNA 5C5OA 1K1LA 1MBMA 4TYDA 1AY6H 2BX4A 1SLUB 5JBTA 1GI7B 3PLBA 1EX3A 4DW2U 1Y3VA 1UVPA 1MTUA 1Q2WA 4NIXA 3ATWA 5JB9S 5LGOA 1DUEA 1AB9C 4X2XA 2V3OH 2ODQA 2NWNA 2P59A 4CRGA 1DWBH 1CO7E 4MDSA 7GCHF 1OP8A 1ZJDA 1H4WA 2ZWLH 5GDSH 3S7HB 4Q7ZA 1GHAG 3KQCA 3ENSB 1LKAA 4I8LA 3G01A 1C2KA 2GTBA 1C5NH 4K1EA 1GBAA 2FLRH 2PSXA 3SJOA 4J2YB 3KEEA 3BEIB 4A1XA 5A2MH 1GVKB 3A84A 8LPRA 4MLFB 1MTNC 2A5IA 1SBWA 4UONA 1ANDA 1P2MA 3M37A 3OU0A 1CT4E 2ZDVH 4AORA 2H9TH 1B0EA 4CRCA 4DOQA 2AMDA 1OP2A 4O9VA 1BB0B 1INCA 2GT8A 3BTFE 1H8DH 3R3GB 2BQ6B 4TPYA 3HGPA 3RXSA 1JBUH 1NESE 4ABBA 4PROA 1AD8H 4K1TA 1MKWK 4AB8A 1PJPA 2ZZUH 1BT7A 1GJBB 1TMUH 4ABHA 1LVYA 1G3BA 3BG4C 4TY7A 2ZA5A 1TYNA 4DY7B 4X6OA 1EPTA 5DK1A 1JXPA 1GJ7B 1SHHB 2OBQA 3MMGA 4NA7A 1G37A 2XC0A 4DG4A 2J94A 1O3BA 1HB0B 3BTQE 4OS5A 1ZPBA 3LH3A 1HXEH 3TU7H 1EJNA 1C2EA 3SNDA 2Z94A 2ZCHP 2AMQA 2BD2A 1ABJH 1YPKH 3RMLH 3SJIA 5DPAA 3P70B 2THFB 3SHAH 3SZNA 2FDAA 4B73A 1CA0C 1ZGVA 4B2AA 4BANB 1K1OA 1A5GH 2Z7FE 2DUCA 3PLKA 6LPRA 1AFQB 2ODYB 1C1TA 1ABIH 1KIGH 5C2ZA 1ZSKA 1Z7KA 1JMOH 1IQHA 1QB9A 1TGSZ 4FXGH 2HPQH 1SGPE 2H9EH 2ZDAH 3ZZ3A 1E38B 3AVZA 4ASHA 2ZF0H 7ESTE 2JETC 1KDQA 1OWKA 1BBRH 3MH6A 3A80A 1GHZA 3SV2H 1UVOA 2XBYA 5HM9A 2PFEA 2ZU4A 3RXHA 3PWCA 3SU3A 1GJ6A 4JMYA 2OBOA 4D76A 4MG3A 3KCGH 2R3UA 3O8DA 4ABFA 2GVFA 5DP9A 3A8DA 3VB7A 4FVDA 3SU5A 4BAMB 4X6MA 3LPRA 2EA3A 3BTHE 1GGDB 2IPHA 1O2GH 1BOQA 1C1NA 1DSTA 1YKTA 3FFGA 1LPGB 1GBBA 2EI8A 4ABDA 2A4OA 1C1QA 3F1SB 1K1MA 1XXFA 1DXWA 3P8NA 1TRMA 1P05A 3SUDA 3UY9A 3GYLB 3IWMA 5C1XA 3M5LA 4BNRA 1GJ5H 2Z9GA 1NFXA 3V3MA 2FX4A 1FIZA 2UWLA 2A1DB 4VGCB 1ZJKA 2BXUH 1MTVA 3GCTF 3FZZA 1KTTB 3QWCH 1VGCC 1XXDA 1YPJH 2PKSB 3TJNA 2QXGA 3SO3A 1UVUH 4YLQH 1K1JA 3A83A 1LQDB 3ZZ5A 1UCYK 2VNTA 3PTNA 5L30H 1S5SA 2WPJS 1ELDE 1SGNE 1TX7A 2H1UA 2PWXA 1WAYB 2P94A 1LDTT 2H5CA 2VVCA 1PQ7A 1WTGH 2BD7A 2J38A 1IQIA 4IN1A 2B5TB 2FEQH 2G55A 2FLBH 2HNTF 2HRVA 3QX5H 1XX9A 1CHOG 1P06A 1WQSA 2EI7A 4E06H 2ZU3A 3BIVH 1IHSH 1OSSA 1SG8B 1MTSA 3KQDA 1JIMA 1O2QA 1HAZB 2ZG0H 4E7NA 1AVWA 1DT2A 5I25A 1C2FA 2I6SA 3IITA 5FCKA 4E05H 5CMXH 1GCDA 2BZ6H 1C5LH 1LHDH 3L33A 4IMQA 4IN2A 5AVDA 1IQLA 1VR1H 3VPKA 4AFQA 1RTLA 2GD4B 1DWEH 1ETRH 1LTOA 1XMNB 3PMBB 4IGDA 2FOMB 3KHVA 1WV7H 4AFZA 1P2KA 1KTSB 2JH6D 5GWZA 1GDQA 1XKBC 3ITIA 3LU9B 1UTOA 1TAWA 1O3PB 2ZPQA 2C8XB 3BTDE 1FAXA 1FY1A 4CREA 3RU4D 1YCPM 1MQ5A 3JZ1B 1C5YB 3T5FH 3UUZA 4K60A 3EAJA 3TK6A 3KF2A 4YESB 1ETSH 1C5OH 3H7OA 1FPCH 4AZ2B 1EPTB 3SUGA 3LGWA 1GHBF 1WYKA 2Z9JA 4NFEA 1J15A 1GBTA 1O3LA 1F92A 4JZ1A 1O2OA 3T2NA 1IAUA 4UFEH 3PWBA 4NGAH 1AFQC 3U69H 2V0BA 1SI5H 3NWUA 3RXRA 4HFPB 3RDZA 2G4TA 4OGYA 1UK2A 1UTKA 1IOEA 3SNBA 1ID5H 2ZDNA 1IQJA 2GZ8A 2TGTA 4D8NA 1S85A 2A2XH 2YNBA 1K2I1 1W3CA 2ZFPH 1QQ4A 3SJ8A 4XBBA 5DO4H 2TGPZ 1EZUC 1Y3XA 2ZQ2A 3F68H 3W94A 4KTCA 5EXNA 2OLGA 1GI8B 1BTUA 2Y80A 5HYOA 5A8XA 5ABWA 1UJ1A 4UDWH 1GJAB 2A7JA 2SGPE 4O3UA 5EOKA 3F6UH 3VXFH 1KDQB 1TNGA 3FANA 4SGBE 1PPGE 1QJ6B 1O2TA 2F3CE 5CE1A 2NU1E 2GMTB 1TNHA 5DG6A 1QA7A 3P17H 3F9HA 4KTSA 1O2VA 4ZHAA 1MU6B 5AF9H 1OWEA 4XFQA 1RTKA 2HNTE 3PB1E 5EG4A 1K28D 4VGCC 2QAAA 2AERH 2JKHA 1FUJA 5JB8S 2QA9E 2BM2A 4MNYA 1NRQH 4JYTA 3O8CA 4O97A 4BAHB 2C4FH 2BXTH 1WCZA 2P95A 2QC2A 2XXLA 2B8OH 1O2LA 1DY8A 1WSSH 1O2WA 3BG8A 1V2UT 2NU4E 4GAWA 2A7CA 1UCYE 1GBHA 3B23B 4X2VA 2P8OC 4ABIA 2C8WB 2B9LA 3KGPA 4DIIH 1MD7A 1PQ8A 4IBLH 3I77A 1PPZA 4JZEH 1EOJA 1O35A 3OTJE 1P9UA 5E0HA 3ATKA 3JZ2B 2VVVA 4AFUA 1HRTH 3FP6E 5A8ZA 1VITG 1OWIA 5DP5A 1C9PA 2BD5A 4Q80A 8GCHF 3P95A 3Q77A 3VB5A 2FOBA 3EA9A 3PROA 1D3PB 3M5MA 2J2UA 1ELVA 2FI3E 3E91A 4OS6A 1TONA 2CJIA 4NWLA 1DANH 3A7YA 1AB9B 1D4PB 1RFNA 1MZAA 1AZ8A 4Q2KA 2Z9LA 4D9QA 3N7OA 4ISNA 1TRYA 1Q3XA 3PMHB 4XE4A 1VCWA 4TWWA 1QB1A 4ZKNU 1K9OE 2HNTC 3MH5A 1QBNA 4KKDA 3PLPA 3D62A 3ZVFA 1O2JA 3U9AH 3TPIZ 1BIOA 4FUJA 3S9AA 4GUXA 1GDUA 2VIPA 3LOXA 1G3CA 2QY0B 4X8VH 1SOZA 1EPTC 3VB4A 5I46H 1RS0A 3A89A 3V0XA 2J92A 1GPZA 1O2KA 2CHAC 2RG3A 3PTBA 2F9NA 1A2CH 1GCTB 1P0SH 1TQ0B 1LHGH 2J9NA 4JZDH 1HJ8A 1EAIA 2CF8H 1Q31A 2HPPH 1DICA 2OINA 3S7KB 2GV7A 1ELTA 3RMOH 5PTPA 1LKBA 4Y0YE 3P92A 2FYRA 1ANCA 1K21H 1TNKA 1O3OA 5T6DA 2O9QA 1J14A 4HI3A 1CSOE 2FTLE 2BVRH 3VB6A 1O31A 1D3TB 3VGCB 2DE9A 4SGAE 4LZ1H 1O2SA 2TIOA 1MD8A 5FXLA 1S82A 1UTQA 3RXTA 2FOGA 2LPRA 1O2NA 3QUMP 1QRXA 1DY9A 3RP2A 9ESTA 3Q00A 3RXJA 1CA0B 3P8OA 1FONA 1FXYA 2PHBA 2VIVA 1C4Y2 5BRRE 1YF4A 2GMTC 1EATA 1O32A 2ZECA 3QK1A 4O03A 3SNAA 1C2IA 3RXKA 2BQ7B 1Z6EA 4A5TS 4BAOB 4MTBA 4WMEA 1GMCG 3ZZBA 3ZVCA 3RC4A 4WF8A 4X2YA 3SN8A 1HXFH 4AYYB 4Z6AH 4JYUH 3QZRA 1FZZA 3LGIA 1ELCA 1P2NA 2Y5HA 1TNLA 5L6NH 1SQOA 1ELBA 1MAYA 1O2HA 2STBE 3LONA 1V2WT 3SV8A 1UK3A 2UWOA 1BDAA 2ILNA 3RUOA 2WPIS 1YCPH 4A6LA 1BQYA 1HPGA 4X1NU 4WJG2 3SI4H 1AQ7A 4NSVA 2ZU2A 2VVUA 3DT0H 1FY5A 3RLWH 2XWBI 3E8LA 1C5XB 1XVMA 2VGCB 1RXPA 2ZFSA 1YC0A 3MO3A 2UUJB 3MNBA 1GJCB 1P2IA 5C20A 3LKWA 3VFEA 3ZYDA 3MO9A 1CGIE 2Z9KA 3GISB 2IJOB 2BMGB 3SNCA 4WH6A 1ELEE 4Y0ZE 1SGFG 3ATIA 1HAPH 4D7GA 1XKAC 3SBKA 3TJVA 1QY6A 1G32B 4FUHA 4Q7XA 1RTFB 3MYWA 2Q6DA 1GHWH 3KQEA 2BDYA 3ATMA 1Y5AT 1SGYE 5F8ZA 2O8UA 3RXIA 2ANYA 3GY5A 1V2JT 4OS2A 4YOGA 3TGKE 2G51A 4ZH8A 5EW2H 1VGCB 4WXVA 3SU0A 1TPAE 1BITA 1Y3YA 2SFAA 1O5BB 5LH8A 1P2OA 4KP0A 1YPLH 5K7RA 1ZGIA 3A85A 3P8FA 1TGBA 1XUGA 4MPVA 1ZZZA 4UE7H 1QIXB 1S81A 1HAVA 8KME2 1P01A 2ZP0H 2W5EA 2Z3CA 2FESH 3SHCH 1C5PA 3EQ0H 6GCHF 1NTPA 4WXIA 1LO6A 2G4UA 3DFLA 2QV1A 4FUDA 4UD9H 2TPIZ 3SQHE 5HM2A 1KXEA 4I8HA 5FBEA 4A92A 2BY6X 1XM1A 1SGTA 3RM2H 4AGJA 2FOEA 4DIHH 2ZFQH 6ESTA 1W10U 5LPRA 4AG2A 5C3NA 3ZVGA 1MCVA 1ELGA 1TGTA 2QF0A 3ODFA 2V3HH 1GJDB 2XC4A 1GCTC 3U98H 4I31A 1C9TA 1SSXA 2VWLA 4I32A 5E8EH 2UWPA 1QBVH 1HFDA 4B75A 3M61U 3ZV8A 2AGGX 1GWAA 1MKXH 2XTTB 3MU4A 5EW1H 3BSQA 1LPKB 4GSOA 3SV6A 2ZGJA 1CGHA 2C8YB 2ZFTA 2WPKS 1BMLA 1HAGE 1TQ7B 2W7SA 1T31A 1IQEA 2HLCA 3T62A 1O2XA 3H5CB 3URCA 1TLDA 2GGVB 3E1XB 1P11E 2RA3A 1HIAA 3SNEA 4NG9H 1F0UA 2ANKH 5EQSA 1NRSH 1GDNA 1UVTH 3LC5A 3ZZDA 2ALPA 2WV4A 3GY2A 4J1YA 4Y76A 3VGCC 3KNXA 1TNIA 2VIWA 1BBRK 2FTMA 1HNEE 3M7UA 1ZRKA 4DJZB 1DWCH 1NU7B 1C2GA 1CT2E 1IHTH 1GBJA 1O2YA 3MU1A 1GMDF 3B9FH 1HGTH 1BTHH 1Y8TA 5CHAB 4ABJA 2QXHA 2QYIA 2SGFE 4FUBA 2BDCA 1AU8A 3M36A 4H6TA 1DITH 1H1BA 1FI8A 1NO9H 2PSYA 2FP7B 2A7HA 2OP9A 3M7QA 5F03A 5JPMH 1CA8B 4B71A 1GHAF 1PPHE 1GI9B 1TRNA 1TOMH 3AW1A 1NPMA 3KIDU 4ABAA 1B0FA 1NN6A 1V2LT 3MNSA 3ODDA 1OYQA 1O30A 3S0NA 2FS8A 2G8TA 3TNSA 1C2DA 2Y5GA 2SGAA 1C1SA 2GCHG 3V13A 4GHTA 5C5NA 2VGCC 1K1PA 1C1OA 3F9FA 1ARCA 1W0ZU 2ZC9H 2ZIQH 3EA7A 4ZROA 2P93A 3DD2H 2PUQH 4UEHH 1GJ9B 1F7ZA 1KYNA 3RMNH 1CQQA 2FZZA 2VIQA 3PM3A 4NZLA 2ZO3H 1P2QA 1C5QA 1SFQB 3DFJA 1NT1A 4RKOB 3MI4A 1WUNH 3PO1C 1EAXA 1GHXH 3BTEE 4CR5A 2WUCA 1L2EA 4I8GA 2Y7XA 2ZTXA 2BLWA 3MH4A 2AS9A 1XUFA 1BUIA 1H9HE 1ANEA 3A7XA 3SJKA 2ZHWH 5T3HA 1GI2A 2ZTYA 1QRZA 2AFQB 4AB9A 2OTVA 4NA9H 3U8OH 2B0FA 5EU8A 2AIPA 3MU5A 5A0CA 3HK6B 1TNJA 1SGEE 3BEFB 1O3KA 1XUJA 2PV9B 5BPEA 2P8OB 5GCHG 1ZLRA 3A82A 3AAUA 1IQFA 1T4VH 1EAUA 3EE0B 3M3SA 1C5ZB 1SLVB 3SW2B 1O3DA 1OXGA 3Q3KA 1BMNH 2ALVA 3K2UA 1A5HA 2NU3E 2VH0A 1HAVB 3UOPA 2J4IA 2GV6A 2NU0E 4DVAU 2FO9A 2FI4E 3FZDA 3T25A 1MAXA 1Z71A 2XBVA 1DFPA 3FP7E 3KL6A 1C5MD 3O8BA 2WINI 1HJ9A 1BTWA 1O34A 3A81A 1A1RA 2G5NA 3BTME 2FWWA 2D8WA 3LGYA 1C5TA 3RXOA 3TJUA 2W7UA 1SOTA 1BCUH 2EEKA 1TX6A 1UCYH 1HBTH 3K65B 1S0RA 1EP5A 1VCPA 3TNTA 1F2SE 2PKAA 4MNVA 2IOTA 3MNCA 1QL9A 1KLJH 1NY22 1HV7A 4YLUA 1THPB 2BVSH 4ZXYH 2NU2E 2W3IA 5GXPA 3UPEA 1ZTLA 4WWYA 2C93B 1GG6B 1HYLA 1SQTA 4F4OC 2P3UB 3A8CA 1QTFA 4D9RA 1DS2E 3UQVA 3LC3A 2JH5D 5CHAC 1FN6A 2CHAB 5TCCA 1D3QB 2R3YA 1HIAB 5K0HA 3ZVBA 1NFYA 5E0JA 9LPRA 2CMYA 2K1QA 1O2ZA 1T7CA 1C5UA 4MPWA 1UO6A 2LNCA 1NRNH 4CRBA 3R0FA 2BOKA 1V2ST 1V2OT 3PMAB 4NWKA 1OWDA 1DOJA 4FU8A 1MBQA 3ZZ7A 1LHFH 2OCVB 4Q7YA 2P3FH 4K8YA 5TCAA 3GICB 1FY4A 3GY7A 3TK9A 3ZYEA 1L1GA 1QJ7B 2FS9A 4GLYA 1SB1H 4AYVB 3NKKA 2SNWA 1S6FA 3EYDA 4D7FA 3L6PA 1FIWA 2F9BH 7LPRA 1O39A 1OP0A 2ZPRA 2ZTZA 1EB1H 2BZAA 2DE8A 2XW9A 1D9IA 1GBLA 1GHVH 1O3IA 1O5GH 1L1JA 3ZVEA 2A45B 1AKSA 1Y5BT 1Y3UA 3BTKE 4MNWA 1CHOF 5A09A 4ZAEA 3RU4E 1GBDA 1JWTA 1H9IE 4AN7A 2WPLS 5DP8A 3ZZCA 5F6MA 1DE7H 4KGAA 1FV9A 2G5VA 1QNJA 2GKVE 1IQKA 1Z8RA 4H6SB 6CHAC 1KLIH 3S69A 1QL8A 1MUEB 1TPSA 4DCDA 1KY9A 1YYY1 5DP3A 4AX9H 5L2YH 2Y5FA 2XCFA 5HGGA 3QGNB 4TWYA 1J8AA 1VJ9U 3A7VA 2XYAA 1A46H 2Y82A 5EGMA 5FPTA 2AYWA 5LPFA 1Y5UT 3ATLA 2IN2A 1N1LA 2BD9A 1LVMA 2WV5A 4IC6A 4UFDH 2ZDMA 1SL3A 1NRPH 4ZKRU 1A3BH 1GI3A 1PPFE 1C4U2 4ZHMU 2QXJA 1F5LA 1A3EH 5FBIA 2VJ1A 1AVGH 2M5TA 2SNVA 1O5CB 1U6QA 1WQVH 1TA2A 1TOCB 3E90B 4CRDA 1S84A 1PYTD 4U30A 3T28A 1M9UA 2O8MA 2C3SA 4HGCA 1WU1A 1AE5A 1P12E 4YOIA 3BIUH 1KLTA 1S0QA 1G36A 1O5EH 2H5DA 4AFSA 1QA0A 1BRCE 1J16A 2R0KA 3SI3H 3SU1A 2CV3A 2WPHS 3STIA 3M3VA 3ZVAA 1EP6A 2TGAA 1GMHG 1CBWC 1CVWH 4XBDA 3TGIE 4FUCA 1GBMA 1UHBA 3BV9B 3NK8A 4WMDA 3RC5A 3QLPH 2YOLA 2P16A 2FMJA 1Z8JB 4ZMAH 2ZQ1A 5DGJA 2PGBB 2H6MA 5JDUB 3LJJA 1BMAA 2ZNKH 2ZHDA 3UIRA 2I6QA 1SGCA 3I29A 3STJA 3KN2A 1RJXB 1TMBH 2BQWB 1O3CA 4OGXA 1NFUA 1UVSH 3CS7A 3UWIA 1N6YA 1V3XA 3UTUH 2OUAA 1EAWA 1G3DA 4U32A 1NS3A 4WH8A 1GG6C 3ZZ6A 3RU4T 1O2MA 4R0IA 3DA9B 1NM6A 1SVPA 3AW0A 3Q76A 4XOJA 2PKAB 2CF9H 1TFXA 3M5NA 1A7SA 4RN6A 4GCHG 2BDHA 8ESTE 3I78A 1X7AC 2HALA 2VH6A 3LIWA 1ZHPA 2XC5A 2WPMS 1TALA 3M3TA 3TIUA 5A8YA 4IS5A 4OS1A 1VCQA 5ESTE 1W0YH 1EUFA 1T4UH 2Z3DA 2AGIX 1C1WH 1VZQH 4TPIZ 1ZPZA 2ZGHA 1F5KU 5JBAS 1BTZA 1HUTH 4NIWA 2BY7X 3P6ZB 4ESTE 1EQ9A 2FOFA 4LZ4B 2VIOA 1N8OB 1AFEH 4CHAB 4NIVA 2PW8H 2CN0H 4JZIA 2RA0A 5GJ4B 1P57B 2R2MB 3T26A 1ELAA 2AEIH 2C90B 4F49A 1UTMA 3HKJB 3FAOA 2GDDA 1QBOA 4K1SA 5EPNA 1OPHB 1VITF 2QCYA 1PPBH 3NXPA 3RXAA 3RLYH 1L4ZA 1AVXA 1QL7A 2F91A 1GI6A 4YOJA 1J9CH 3CP7A 1MCTA 2OC1A 5AHGH 4LXBH 1BJVA 1GMHF 1CT0E 3TH2H 7GCHG 1P8VC 1AKSB 4ISHH 2XBXA 3RXEA 2FOCA 1GI5A 4HZHA 1BRAA 1O3JA 2H2ZA 1G9IE 1C1RA 5F8XA 4JYVH 4BTIB 1T8LA 1RIWB 1SHYA 4BAKB 4FUGA 2BD8A 4CH2B 2FODA 3ZVDA 1GVZA 1AMHA 4X6NA 3S9CA 5DKMA 4FVBA 1W8BH 1NC6A 1TB6H 3GY3A 1ARBA 1V2QT 1EJMA 1FN8A 2ANWA 1QHRB 1O5FH 2FOAA 2W26A 3RXVA 3URDA 2OC8A 1ZMNA 1HAYB 3HK3B 7KMEH 1AZZA 2TGDA 1P02A 1YGCH 4UFGH 2OXSA 3BN9A 3M35A 1IQMA 3TVJB 3ESTA 3A86A 3BTWE 2A31A 3LH1A 3F9EA 5SGAE 1LMWB 4CBNA 3TH3H 2F83A 1F0TA 2OQ5A 1KXAA 2A32A 2ODPA 3PO1B 1E35B 3TK5A 4MPXA 1KXDA 1SQAA 4B74A 1P09A 1AE8H 3RXCA 1OOKB 5EQRA 2UUKB 2BD3A 1LCYA 1NROH 2UUYA 2YNAA 1K1IA 2PR3A 3TITA 1W2KH 2G00A 2G81E 2UUFB 1LVBA 1AHTH 1HLTH 2Y7ZA 1B7XB 2BX3A 1ACBE 2OD3B 1MKXK 1UHBB 3RM0H 1PQAA 1MQ6A 1NZQH 1QGFA 1QRWA 2QF3A 1YLDA 5ETXA 2GCTB 3E6PH 4JK6A 4Y11E 4NSYA 4CRFA 4X8SH 1W7XH 4INLA 1P2JA 2FX6A 3CENA 4INHA 3E16B 1GMCF 1C2JA 2WUBA 1L1NA 4H4FA 5B6OA 2AGEX 1F0SA 5C1YA 1G2MA 2FI5E 2STAE 1HJAC 3MO6A 2A0QB 4AGKA 5F8TA 4XSKU 4FUIA 3MWIU 3K9XB 3LGTA 2VIDA 3GCHB 1QR3E 1JRTA 3GCNA 3BF6H 2ZDKA 1HAOH 2ZCKP 1WTHD 2HGTH 3UR9A 1OKXA 1ZRBA 1UK4A 4IW4E 4ABEA 1P3CA 1N8OC 1GI4A 3GDSA 4CHAC 5A0BA 3RC6A 3B8JA 1G2LA 2O8LA 1DX5M 2RDLA 4Y8XA 4BTUB 2D26C 2BDGA 2SGDE 2ZHEH 3V7TA 1BA8B 1XUKA 3BEUA 4H42U 4GVUA 1BTPA 1DDJA 1QCPA 2QIQA 2A2QH 3GCTG 3MFJA 3QN7A 3SGAE 1E0FD 1P3EA 3GY6A 1WBGB 1C5SA 2HWLB 2FPZA 2VWNA 4INKA 3Q3YA 1ZTKA 1C1PA 1SLWB 3RXMA 1GL1A 3PMJA 1YPMH 3Q3XA 1FY8E 3SQEE 1KSNA 1ANBA 1YBWA 4GHQA 1THRH 2GZ7A 1HAIH 1MKWH 1TPPA 3EGKH 1C1UH 2ZFRH 1QB6A 1ZHMA 3ZZAA 1P10A 3M5OA 2ZGXH 1RIWC 3SGQE 4Z0KA 2Q1JA 5LPEA 5FHTA 2ZKSA 1FNIA 1AGJA 3SUEA 3AAVA 1O3NA 3RXFA 1TGCA 1C2HA 5JBCS 4TY6A 4R8TB 2FM2A 3RXPA 1C5WB 3T27A 3PYHA 1Z1IA 1OX1A 1GL0E 4YZUA 3UQOA 1NRRH 3O8RA 1QFKH 1F0RA 3E0NB 3LJOA 2QN5T 1AWHB 5GPIB 3SGBE 1T8NA 1OYTH 4Y7AA 2BTCE 4I7YH 3OY6U 1GBCA 1O3EA 3LGVA 4X1SU 1C1MA 1AO5A 3QZQA 6CHAB 2ZU5A 3A7WA 1SLXB 1C2MA 5DP6A 1SMFE 3KQBA 1BTYA 1EKBB 3SUFA 3RXLA 1O3MA 3D49H 1MH0A 1OWJA 2B7DH 4CRAA 3SOSA 1O3HA 3CS0A 3A7ZA 3FP8E 1FAKH 4U2WA 4YT6H 2ZU1A 1CGJE 3GY4A 1V2PT 2GZ9A 1JIRA 1ZYOA 1TMTH 3HATH 3NCLA 1ETTH 1E34B 3TJOA 5FCRA 4B76A 2A4RA 3UNQA 3LT3A 2C8ZB 1A0JA 1GHBG 1O3GA 2BY8X 1C4V2 2BHGA 4UFFH 4B2BA 1PQ5A 3TLOA 3MOCA 4NCYA 1MTWA 1OWHA 2RCEA 3VXEH 1GBFA 1DSUA 1DLKB 4JK5A 4YO9A 1T32A 1OS8A 2ZEBA 4ZHLU 4ZKSU 1J17T 2BY9X 2BYAX 4AG1A 2CXVA 4X2WA 1DVAH 2GCTC 1ZTJA 3A88A 2BOHB 3HGNA 2ZGCA 2ZGBH 4ZUHA 2A4GA 1LHCH 1GI1A 4IMZA 3C27B 1TPOA 3HKIB 1SR5C 1VJAU 1O38A 4Y79A 3A8BA 1JRSA 2CGAA 2QGRA 3SU4A 1GBEA 5FAHA 2ZI2H 4B1TA 1CBWB 2XRCA 5JBBS 1XUIA 4XDEA 2Q6FA 1CU1A 1SFIA 1ZSJA 4FU9A 3GCHC 5JYIA 1W7GH 2Z9IA 5EQQA 4AOQA 2EC9H 3QTOH 2ZFFH 1BZXE 1H8IH 1V2NT 1WOFA 2GDEH 2GCHF 5FPYA 4RSPA 1A4WH 1YM0A 1K1NA 1TX8A 4DGJA 1TA6A 1AWFH 1TBRH 2ZCLP 1FLEE 1ELFA 3EDXB 4NA8A 1QQUA 1LPZB 1P9SA 3UNSA 3RXGA 4BTTB 1Z8IB 1L4DA 4NIYA 2BB4A 1A5IA 1A61H 1GJ4H 2AMPA 2FXRA 1IQNA 1SPJA 1S6HA 4ISLA 2ASUB 2ZHQH 2XWAA 2F9OA 4X6PA 2D1JA 3UREA 1H9LB 2H9HA 4I8KA 4BXSA 5ESBA 1BBRE 1P03A 2V6NA 2PTCE 4A7IB 1TIOA 4ZXXH 1Y3WA 2GX4A 1RGQA 3K6YA 2O8TA 2Y6TA 3U8TH 2KAIA 3ZV9A 3NPSA 5C67A 2F9PA 2BLVA 2ESTE 2A5KA 4THNH 4BAQB 4X0WU 2J34A 5IYTA 3LDXH 1HDTH 3P8GA 1O0DH 1FPHH 1TBQH 2JH0D 2QXIA 4DURA 2AH4X 4K8BA 5GCHF 4OS4A 1HCGA 1TE0A 8GCHG 3DUXH 1SGRE 5E2PA 1JOUB 3ZZ8A 4CBOA 1EB2A 1D3DB 3RXQA 1S83A 4FUFA 3PV4A 1MMJN 2PLXA 4B2CA 4X8UH 1YPHE 2SGQE 4K5ZA 1YLCA 3SV9A 1BTXA 1FMGA 1HAHH 2PGQB 1MU8B 1DUAA 5FX6A 4K3JA 4QT8C 5E2OA 1T8OA 2Y81A 1P04A 1W11U 5IDKA 1CHGA 1ESBA 1FQ3A 1ZOMA 3GOVB 1GGDC 4ISOA 2J95A 3F9GA 4FUEA 1N6XA 1O2UA 1YPGH 3K6ZA 1LHEH 3RMMH 1EOLA 2R2WU 1GI0A 2ZPSA 2ANMH 1C1VH 3D23A 1W14U 1PPEE 3TH4H 3WY8A 1FY3A 4KTUA 4A1TA 4X1PU 1NFWA 4CR9A 3OX7U 5DP7A 3MU8A 1EZXC 3SORA 4Y6DA 2Z3EA 3UFAA 4O3TA 3ELAH 1XVOA 2TRMA 2OC0A 2R9PA 3TGJE 1EZSC 3IG6B 4RKJB 1DPOA 1K22H 3VB3A 2SGEE 1CE5A 3AASA 2PKSC 3DHKH 3MNXA 3RXDA 3MHWU 2BLQA 2XCNA 1V2MT 1Z6JH 2P3TB 2F9UA 5J4SA 1AIXH 4X8TH 1TBZH 4K2YA 3HPTB 3UNRA 3T29A 4YM9A 2EI6A 2A5AA 3GY8A 2WYGA 4M7GA 4NFFA 1HAXB 1L0ZA 1DWDH 2R0LA 2GP9B 3L3TA 4DT7B 1YPEH 1GBIA 2PTNA 1EJAA 1O36A 1ZR0A 5TJXA 1GJ8B 2D2DA 4MNXA 2A4QA 4FU7A 1BRBE 1YPHC 2XNIA 3MH7A 3MTYA 4I8JA 2OC7A 4MQAA 5H4IB 3GYMA 4YT7H 1V2TT 3A7TA 3OSYA 5T6FA 2W3KA 4HTCH 5HMAA 1Z1JA 2FYQA 1UTPA 1O2PA 1DXPA 1V2KT 3UR6A 4X1RU 3W95A 4E7RG 1BHXF 2G52A 2VWMA 3SV7A 3QGJA 2ULLA 3NZIA 1TABE 1THSH 1O2IA 1TGNA 4ISIH 3U8RH 1GVLA 4CH8B 3QDZB 1B5GH 2WYJA 1Y59T 1W13U 3QO6A 3QTVH 2PUXB 3V12A 1BMMH 1G30B 1AI8H 1D6RA 1HJAB 1MTNB 4LK4A 5EXLA 1ZPCA 4MVNA 1KXBA 5EODA 3NUMA 4WVPE 1ZMLA 3GDUA 4BOHA 1UTLM 4A1VA 1QURH 4NZQA 3C1KA 4GPGA 2HOBA 1DLEA 1F5RA 4JCNA 1W12U 1LQEA 1V6DA 5AFZH 1Z8GA 4Y7BA 3ZZ4A 4WMFA 1LVOA 2BLOA 1KXFA 1BHXB 2ZDLA 1ZMJA 3RXUA 2ZHFH 1E36B 2Q6GA 4LOYH 4U01A 4ABGA 1O5DH 1O3AA 5G4BA 2KAIB 1DM4B 2XBWA 4Y71A 1PFXC 3BG4B 3E0PB 1FJSA 5E0GA 5FX5A 1EZQA 2VB0A 5DP4A 1UMAH 3SU6A 2BDIA 1YCPK 1ORFA 1SC8U 2FIRH 1VITH 4ZKOU 2BDAA 2V35A 1O2RA 2AIQA 1YP9A 3ZZ9A 2VINA 1ESTA 2BD4A 1C5RA 5HXFA 1V2RT 1EXFA 1RD3B 1UTJA 4XBCA 3EA8A 3UWJH 1FDPA 1SGDE 1G3EA 1NU9A 1SGFA 3U1IB 1E37B 2VU8E 1T8MA 2GT7A 3U1JB 3GDVA 1KXCA 6GCHG 5DJ7A 1PYTC 3E3TA 3LGUA 2F9VA 3MU0A 1A0HB 4JZFH 4Y10E 3GCOA 3H7TA 1AN1E 4BXWA 3A8AA 4WY3A 3VEQB 4IC5A 1A0LA 2BVXH 2O8WA 3SU2A 2BY5X 3D65E 1RRKA 1O5AB 4I33A 1PPCE 5C1UA 2JETB 4Y8YA 3FVFB 3A87A 2OQUA 5L2ZH 4MPUA 2FOHA 3OYPA 4K69A 1QJ1B 4KELA 1O37A 5AFYH 3RXBA 2Z6BD 3BTTE 1BRUP 4GCHF 5A0AE 4OS7A 1ZSLA 1C2LA 3S9BA 1GHYH 1O3FA 2BDBA 5J4QA 1SGIB 4X1QU 1MZDA 1ESAA 5GIBA 1BJUA 1EASA 3BTGE 1AUJA 1XUHA 1ZHRA 5EPYA 1O33A 1C5VA 2VWOA 1V2VT 1AUTC 2TBSA 5FPSA 3UOUA 4Y8ZA 3SJ9A 1D6WA
chains in the Genus database with same CATH superfamily
3H09A 2HVXA 5T6GA 4YTAA 5EXMA 1GMDG 1SGQE 1GBKA 3OY5U 1QZ8A 3M7TA 1TWXB 1IQGA 1UTNA 5C5OA 1K1LA 1YY3A 1MBMA 4TYDA 1AY6H 2BX4A 1SLUB 5JBTA 1GI7B 3PLBA 1EX3A 4DW2U 1Y3VA 1UVPA 1MTUA 1Q2WA 4NIXA 3ATWA 2VBCA 5JB9S 5LGOA 1DUEA 1AB9C 4X2XA 5EJ1A 2V3OH 2ODQA 1S6LA 2NWNA 2P59A 2J98B 4CRGA 1DWBH 1CO7E 4MDSA 7GCHF 1OP8A 4ZCNA 1ZJDA 1H4WA 2ZWLH 5GDSH 3S7HB 4Q7ZA 1GHAG 3KQCA 3ENSB 1LKAA 4F48B 4I8LA 5IK2D 3G01A 1C2KA 2GTBA 1C5NH 4K1EA 1GBAA 2FLRH 2PSXA 3SJOA 4J2YB 3KEEA 3BEIB 4A1XA 5A2MH 1GVKB 3A84A 8LPRA 4MLFB 1MTNC 2A5IA 1SBWA 4UONA 1ANDA 1P2MA 2QF5A 3M37A 3OU0A 1CT4E 2ZDVH 4AORA 4M9FA 2H9TH 1B0EA 4CRCA 4DOQA 2AMDA 1OP2A 4O9VA 1BB0B 1INCA 2GT8A 3BTFE 1H8DH 3R3GB 2BQ6B 4TPYA 3HGPA 3RXSA 1JBUH 1NESE 4ABBA 4PROA 1AD8H 4K1TA 1MKWK 4AB8A 1PJPA 2ZZUH 1E1QD 1BT7A 1GJBB 1TMUH 4ABHA 1LVYA 1G3BA 3BG4C 4TY7A 2ZA5A 1TYNA 4DY7B 3OAAD 1EPTA 4X6OA 5DK1A 1JXPA 3N7EA 1GJ7B 1SHHB 2HLDD 2OBQA 3MMGA 4NA7A 1G37A 2XC0A 4DG4A 2J94A 1O3BA 3EE7A 1HB0B 3BTQE 4OS5A 4RT1A 2XNDD 1ZPBA 3LH3A 1HXEH 3TU7H 1EJNA 1C2EA 3SNDA 2Z94A 2ZCHP 2AMQA 2BD2A 1ABJH 1YPKH 3RMLH 3SJIA 5DPAA 3P70B 2THFB 3SHAH 1YLNA 3SZNA 2FDAA 4B73A 1CA0C 1ZGVA 4B2AA 4BANB 1K1OA 1A5GH 2Z7FE 2DUCA 3PLKA 6LPRA 1AFQB 2ODYB 1C1TA 1ABIH 1KIGH 5C2ZA 1ZSKA 1Z7KA 1JMOH 1IQHA 1QB9A 1TGSZ 4FXGH 2HPQH 1SGPE 2H9EH 2ZDAH 3ZZ3A 1E38B 3AVZA 4ASHA 2ZF0H 7ESTE 2JETC 1KDQA 1OWKA 1BBRH 3MH6A 3A80A 4Q4LA 1GHZA 3SV2H 1UVOA 2XBYA 5HM9A 2PFEA 2ZU4A 3RXHA 3PWCA 3SU3A 1GJ6A 4JMYA 2OBOA 4AC9A 4D76A 4MG3A 3KCGH 2R3UA 3O8DA 4ABFA 2GVFA 4F55A 5DP9A 3A8DA 3VB7A 1E79D 4FVDA 3SU5A 4BAMB 4X6MA 3LPRA 3F0PA 2EA3A 3BTHE 1GGDB 2IPHA 1O2GH 1BOQA 1C1NA 1DSTA 1YKTA 3FFGA 1LPGB 1GBBA 2EI8A 4ABDA 2A4OA 1C1QA 3F1SB 1K1MA 1XXFA 1DXWA 3P8NA 1TRMA 1P05A 3SUDA 3UY9A 3GYLB 3IWMA 5C1XA 3M5LA 4BNRA 1GJ5H 2Z9GA 1NFXA 3V3MA 2FX4A 1FIZA 2UWLA 2A1DB 4VGCB 1ZJKA 2BXUH 1MTVA 2F4LA 3GCTF 3FZZA 1KTTB 3QWCH 1VGCC 1XXDA 1YPJH 2PKSB 3TJNA 2QXGA 3SO3A 1UVUH 3KQ5A 4YLQH 5HKKD 1K1JA 3A83A 1LQDB 3ZZ5A 1UCYK 3FKSD 2VNTA 4B6FA 3PTNA 5L30H 1S5SA 2WPJS 1ELDE 1SGNE 1TX7A 2H1UA 2PWXA 1WAYB 2P94A 1LDTT 2H5CA 2VVCA 1PQ7A 1WTGH 2BD7A 2J38A 1IQIA 4IN1A 2B5TB 2FEQH 2G55A 2FLBH 2HNTF 3WWFA 2HRVA 3QX5H 1XX9A 1CHOG 1P06A 1WQSA 2EI7A 4E06H 2ZU3A 3BIVH 1IHSH 1OSSA 1SG8B 1MTSA 3KQDA 1JIMA 1O2QA 1HAZB 2ZG0H 4E7NA 1AVWA 1DT2A 5I25A 1C2FA 2I6SA 3IITA 5FCKA 1E1RD 4E05H 5CMXH 1GCDA 2BZ6H 1C5LH 1LHDH 3L33A 4IMQA 4IN2A 5AVDA 1IQLA 2KCYA 2YMSD 1VR1H 2KCOA 3VPKA 4AFQA 1RTLA 2GD4B 1DWEH 1ETRH 1LTOA 1XMNB 3PMBB 4IGDA 2FOMB 3KHVA 1WV7H 4AFZA 1P2KA 1KTSB 2JH6D 5GWZA 1GDQA 1XKBC 3ITIA 3LU9B 1UTOA 2JJ1D 1TAWA 1O3PB 2ZPQA 2C8XB 3BTDE 1FAXA 1FY1A 4CREA 3RU4D 1YCPM 1MQ5A 3JZ1B 1C5YB 3T5FH 3UUZA 4K60A 3EAJA 3TK6A 3KF2A 4YESB 1ETSH 1C5OH 3H7OA 1FPCH 4AZ2B 1EPTB 3SUGA 3LGWA 1GHBF 1WYKA 2Z9JA 3OEHD 4NFEA 1J15A 1GBTA 1O3LA 1F92A 4JZ1A 1O2OA 3T2NA 1IAUA 4UFEH 3PWBA 4NGAH 1AFQC 3U69H 2V0BA 1SI5H 3NWUA 3RXRA 3U28C 4HFPB 3RDZA 2G4TA 4OGYA 1UK2A 1UTKA 1IOEA 3SNBA 1ID5H 2ZDNA 1IQJA 2GZ8A 2TGTA 4D8NA 1S85A 2A2XH 2YNBA 1K2I1 1W3CA 2ZFPH 1QQ4A 3SJ8A 4XBBA 5DO4H 2TGPZ 1EZUC 3N7DA 1Y3XA 2ZQ2A 3F68H 3W94A 4KTCA 5EXNA 2OLGA 1GI8B 1BTUA 2Y80A 2L6OA 5HYOA 5A8XA 5ABWA 1UJ1A 4UDWH 1GJAB 2A7JA 2SGPE 4O3UA 5EOKA 3F6UH 3VXFH 1KDQB 1TNGA 3FANA 4SGBE 1PPGE 1QJ6B 1O2TA 2F3CE 5CE1A 2NU1E 5GNDA 2GMTB 1TNHA 5DG6A 1QA7A 3P17H 3F9HA 4KTSA 1O2VA 4ZHAA 1MU6B 5AF9H 1OWEA 4XFQA 1RTKA 2HNTE 3PB1E 5EG4A 1K28D 2LP6A 3OE7D 4VGCC 2QAAA 2AERH 2JKHA 1FUJA 5JB8S 2QA9E 2BM2A 4MNYA 1NRQH 5HIZA 4JYTA 3O8CA 4O97A 4ASUD 4BAHB 5KECA 2C4FH 2BXTH 1WCZA 2P95A 2QC2A 1NBME 2XXLA 2B8OH 1O2LA 1DY8A 1WSSH 1O2WA 3BG8A 1V2UT 2NU4E 4GAWA 2A7CA 1UCYE 1GBHA 3B23B 4X2VA 2P8OC 4ABIA 4XRNA 2C8WB 2B9LA 3KGPA 4DIIH 1MD7A 1PQ8A 4IBLH 2WSSD 3I77A 1PPZA 4JZEH 1EOJA 1O35A 3OTJE 1P9UA 5E0HA 3ATKA 3JZ2B 1EFRD 2VVVA 4AFUA 1HRTH 1WDIA 3FP6E 5A8ZA 1VITG 1OWIA 5DP5A 1C9PA 2BD5A 4Q80A 8GCHF 3P95A 3Q77A 3VB5A 2FOBA 3EA9A 3PROA 1D3PB 3M5MA 1WXRA 2J2UA 1ELVA 2FI3E 2KCAA 3E91A 4OS6A 1TONA 2CJIA 4NWLA 1DANH 3A7YA 1AB9B 1D4PB 1RFNA 1MZAA 1AZ8A 4Q2KA 2Z9LA 4D9QA 3N7OA 4ISNA 1TRYA 1Q3XA 3PMHB 4XE4A 1VCWA 4TWWA 1QB1A 4ZKNU 1K9OE 2HNTC 3MH5A 1QBNA 4KKDA 3PLPA 3ZIAD 3D62A 3ZVFA 1O2JA 3U9AH 3TPIZ 1BIOA 4FUJA 3S9AA 2JDID 4GUXA 1GDUA 2VIPA 3LOXA 1G3CA 2JIZD 2QY0B 4X8VH 1SOZA 1EPTC 3VB4A 5I46H 1RS0A 3A89A 3V0XA 2J92A 1GPZA 1O2KA 2CHAC 2RG3A 3F0OA 3PTBA 2F9NA 4B6EA 1A2CH 1GCTB 1P0SH 1TQ0B 1LHGH 2J9NA 4JZDH 1HJ8A 1EAIA 2CF8H 1Q31A 2HPPH 1DICA 2OINA 3S7KB 2GV7A 1ELTA 3RMOH 5PTPA 5HIYA 1LKBA 4Y0YE 3P92A 2FYRA 1ANCA 1K21H 1TNKA 1O3OA 5T6DA 2O9QA 1J14A 4HI3A 1CSOE 2FTLE 2BVRH 3VB6A 1O31A 1D3TB 3VGCB 2DE9A 4SGAE 4LZ1H 1O2SA 2TIOA 4OM9A 1MD8A 5FXLA 1S82A 1UTQA 3FO8D 3RXTA 2FOGA 2LPRA 1O2NA 3QUMP 1QRXA 1DY9A 3RP2A 9ESTA 3Q00A 3RXJA 1CA0B 3P8OA 1FONA 1FXYA 2PHBA 2VIVA 1C4Y2 5BRRE 1YF4A 2GMTC 1EATA 1O32A 2ZECA 3QK1A 4O03A 5KGOA 3SNAA 1C2IA 3RXKA 2BQ7B 1Z6EA 4A5TS 4BAOB 4MTBA 4WMEA 1GMCG 3ZZBA 3ZVCA 3RC4A 4FETA 4WF8A 4X2YA 3SN8A 1HXFH 4AYYB 4Z6AH 4JYUH 3QZRA 1FZZA 3LGIA 1ELCA 1P2NA 2Y5HA 1TNLA 5L6NH 1SQOA 1ELBA 1MAYA 1O2HA 2STBE 3LONA 1V2WT 3SV8A 1UK3A 2UWOA 1BDAA 2ILNA 2WPDD 3RUOA 2WPIS 1YCPH 4A6LA 1BQYA 1HPGA 4X1NU 4WJG2 1H8ED 3SI4H 4P00A 1AQ7A 4NSVA 2ZU2A 2VVUA 3DT0H 1FY5A 3RLWH 2XWBI 3E8LA 1C5XB 1XVMA 2VGCB 1RXPA 2ZFSA 1YC0A 3MO3A 2UUJB 3MNBA 1GJCB 1P2IA 5C20A 3LKWA 3VFEA 3ZYDA 3MO9A 1CGIE 2Z9KA 3FN8A 3GISB 2IJOB 2BMGB 3SNCA 4WH6A 1ELEE 4Y0ZE 1SGFG 3ATIA 1HAPH 4D7GA 1XKAC 3SBKA 3TJVA 1QY6A 1G32B 4FUHA 4Q7XA 1RTFB 3MYWA 2Q6DA 1GHWH 3KQEA 2BDYA 3ATMA 1Y5AT 1SGYE 5F8ZA 2O8UA 3RXIA 2ANYA 3GY5A 3OFND 1V2JT 4OS2A 4YOGA 3TGKE 2G51A 4ZH8A 5EW2H 1VGCB 4WXVA 4DT4A 3SU0A 1TPAE 1BITA 1Y3YA 2SFAA 1O5BB 5LH8A 1P2OA 4KP0A 1YPLH 5K7RA 1ZGIA 3A85A 3P8FA 1TGBA 1XUGA 4MPVA 1ZZZA 4UE7H 1QIXB 1S81A 1HAVA 8KME2 1P01A 2ZP0H 2W5EA 2Z3CA 2FESH 3SHCH 1C5PA 3EQ0H 6GCHF 1NTPA 4WXIA 1LO6A 2G4UA 3DFLA 2QV1A 4FUDA 4UD9H 2TPIZ 3SQHE 5HM2A 1KXEA 4Z1MD 4I8HA 5FBEA 4A92A 2BY6X 1XM1A 1SGTA 3RM2H 4AGJA 2FOEA 4DIHH 2ZFQH 6ESTA 1W10U 5LPRA 4AG2A 5C3NA 3ZVGA 1MCVA 1ELGA 1TGTA 2QF0A 3ODFA 2V3HH 1GJDB 2XC4A 1GCTC 1MABB 3U98H 4I31A 1C9TA 1SSXA 2VWLA 4I32A 5E8EH 4YXWD 2UWPA 1QBVH 1HFDA 4B75A 3M61U 3ZV8A 2AGGX 1GWAA 1MKXH 2XTTB 3MU4A 5EW1H 3BSQA 1LPKB 4GSOA 3SV6A 2ZGJA 1CGHA 2C8YB 2ZFTA 2WPKS 1BMLA 1HAGE 1TQ7B 2W7SA 1T31A 1IQEA 2HLCA 3T62A 1O2XA 3H5CB 3URCA 1TLDA 2GGVB 3DSPA 3E1XB 1P11E 2RA3A 1HIAA 3OEED 3SNEA 4NG9H 1F0UA 2ANKH 5EQSA 1NRSH 1GDNA 1UVTH 3LC5A 3ZZDA 2ALPA 2WV4A 3GY2A 4J1YA 4Y76A 3VGCC 3KNXA 1TNIA 2VIWA 1BBRK 2FTMA 1HNEE 3M7UA 1ZRKA 4DJZB 1DWCH 1NU7B 1C2GA 1CT2E 1IHTH 1GBJA 1O2YA 3MU1A 1GMDF 3B9FH 1HGTH 1BTHH 1Y8TA 5CHAB 2K8IA 4ABJA 2J97A 2QXHA 2HVYB 2QYIA 2SGFE 4FUBA 2BDCA 1AU8A 3M36A 4H6TA 1DITH 1H1BA 1FI8A 1NO9H 2PSYA 2FP7B 2A7HA 2OP9A 3M7QA 5F03A 5JPMH 1CA8B 4B71A 1GHAF 1PPHE 1GI9B 1TRNA 1TOMH 3AW1A 1NPMA 3KIDU 4ABAA 1B0FA 1NN6A 1V2LT 3MNSA 3ODDA 1OYQA 1O30A 3CNRA 2PP6A 2FS8A 2G8TA 3S0NA 3TNSA 1C2DA 2Y5GA 2SGAA 1C1SA 2GCHG 3V13A 4GHTA 5C5NA 2VGCC 1K1PA 1C1OA 3F9FA 1ARCA 1W0ZU 2ZC9H 2ZIQH 3EA7A 4ZROA 2P93A 3DD2H 2PUQH 4UEHH 1GJ9B 1F7ZA 1KYNA 3RMNH 1CQQA 2FZZA 2VIQA 3PM3A 4NZLA 2ZO3H 1P2QA 1C5QA 1SFQB 3DFJA 1NT1A 4RKOB 3MI4A 1WUNH 3PO1C 2IJD1 1EAXA 1GHXH 3BTEE 4CR5A 2WUCA 1L2EA 4I8GA 2Y7XA 2ZTXA 2BLWA 3GS9A 3MH4A 2AS9A 1XUFA 1BUIA 1H9HE 1ANEA 3A7XA 3SJKA 3WWBA 3F2HA 2ZHWH 5T3HA 1GI2A 2ZTYA 1QRZA 2AFQB 4AB9A 2OTVA 4NA9H 3U8OH 2B0FA 5EU8A 2AIPA 3MU5A 5A0CA 3HK6B 1TNJA 1SGEE 3BEFB 1O3KA 1XUJA 2PV9B 5BPEA 2YMSB 2P8OB 5GCHG 1ZLRA 3A82A 3AAUA 1IQFA 1T4VH 1EAUA 3EE0B 3M3SA 1C5ZB 1SLVB 3SW2B 1O3DA 1OXGA 3Q3KA 1BMNH 2ALVA 3K2UA 1A5HA 2NU3E 2VH0A 1HAVB 3UOPA 1UW7A 2QF4A 2J4IA 2GV6A 2NU0E 4DVAU 2FO9A 2FI4E 3FZDA 3T25A 1MAXA 1Z71A 2W6ID 1DFPA 2XBVA 3FP7E 1C5MD 3KL6A 3O8BA 2WINI 1HJ9A 1BTWA 1O34A 3A81A 1A1RA 2G5NA 3BTME 2FWWA 2D8WA 3LGYA 1C5TA 3RXOA 4ACAA 3TJUA 2W7UA 1SOTA 1BCUH 5EJZA 2EEKA 1TX6A 1UCYH 1HBTH 3K65B 1S0RA 1EP5A 1VCPA 3TNTA 1F2SE 2PKAA 4MNVA 2IOTA 3MNCA 1QL9A 1KLJH 1NY22 1HV7A 4YLUA 1THPB 2BVSH 4ZXYH 2NU2E 2W3IA 5GXPA 3UPEA 1VKYA 1ZTLA 4WWYA 3PV2A 2C93B 1GG6B 1HYLA 3DSGA 1SQTA 4F4OC 2P3UB 3A8CA 1QTFA 4D9RA 1DS2E 3UQVA 3LC3A 2JH5D 5CHAC 1FN6A 2CHAB 5TCCA 1D3QB 2R3YA 1HIAB 5K0HA 3ZVBA 1NFYA 5E0JA 9LPRA 2CMYA 2K1QA 1O2ZA 1T7CA 1C5UA 4MPWA 1UO6A 2LNCA 1NRNH 4CRBA 3R0FA 2BOKA 1V2ST 1V2OT 3PMAB 4NWKA 1OWDA 1DOJA 4FU8A 1MBQA 3ZZ7A 1LHFH 2OCVB 4Q7YA 2P3FH 4K8YA 5TCAA 3GICB 1FY4A 3GY7A 3TK9A 3ZYEA 1L1GA 1QJ7B 2FS9A 2F43B 1SB1H 4GLYA 4AYVB 3NKKA 2SNWA 1S6FA 3EYDA 4D7FA 3L6PA 2OK5A 1FIWA 2F9BH 7LPRA 1O39A 1OP0A 2ZPRA 2ZTZA 1EB1H 2BZAA 2DE8A 2XW9A 1D9IA 1GBLA 1GHVH 1O3IA 1O5GH 1L1JA 3ZVEA 2A45B 1AKSA 1Y5BT 1Y3UA 3BTKE 4MNWA 1CHOF 5A09A 1KMHB 4ZAEA 1GBDA 3RU4E 1JWTA 1H9IE 4AN7A 2WPLS 5DP8A 3ZZCA 5F6MA 1DE7H 2WHXA 1H8HD 4KGAA 2KCPA 1FV9A 2G5VA 1QNJA 2GKVE 1IQKA 1Z8RA 4H6SB 6CHAC 1KLIH 3S69A 1QL8A 1MUEB 1NBMD 1TPSA 4DCDA 1KY9A 1YYY1 5DP3A 4AX9H 5L2YH 2Y5FA 2XCFA 5HGGA 3QGNB 4TWYA 1J8AA 1VJ9U 3A7VA 2XYAA 1A46H 2V3MA 2Y82A 5EGMA 5FPTA 2AYWA 5LPFA 1Y5UT 3ATLA 2IN2A 1N1LA 2BD9A 1LVMA 2WV5A 4IC6A 4UFDH 2ZDMA 1SL3A 3KYFA 1NRPH 4ZKRU 1A3BH 1GI3A 4ACBA 1PPFE 1C4U2 4ZHMU 3SZEA 2QXJA 1F5LA 1A3EH 5FBIA 2VJ1A 1AVGH 2EY4C 2M5TA 2SNVA 2YMSC 1O5CB 1U6QA 1WQVH 3FOAA 1TA2A 1TOCB 3E90B 4CRDA 2KM0A 1S84A 1PYTD 4U30A 3T28A 1M9UA 2O8MA 3PRDA 2C3SA 4HGCA 1WU1A 5CDFE 1AE5A 1P12E 4YOIA 3BIUH 1KLTA 1S0QA 1G36A 1O5EH 2H5DA 4AFSA 1QA0A 1BRCE 1J16A 2R0KA 3SI3H 3SU1A 2CV3A 2WPHS 3STIA 3M3VA 3ZVAA 1EP6A 2TGAA 1GMHG 2RDEA 1CBWC 1CVWH 4XBDA 3TGIE 4FUCA 1GBMA 1UHBA 3BV9B 3NK8A 4WMDA 3RC5A 3QLPH 2YOLA 2P16A 2FMJA 1Z8JB 4ZMAH 2ZQ1A 5DGJA 2PGBB 2H6MA 5JDUB 3LJJA 1BMAA 2ZNKH 2ZHDA 3UIRA 2I6QA 1SGCA 3I29A 3STJA 3KN2A 1RJXB 1TMBH 2BQWB 1O3CA 4OGXA 1NFUA 1UVSH 3CS7A 3UWIA 1N6YA 1V3XA 2KX4A 3UTUH 2OUAA 2CK3D 1EAWA 1G3DA 4U32A 1NS3A 4WH8A 1GG6C 3ZZ6A 3RU4T 1O2MA 4R0IA 3DA9B 1NM6A 1SVPA 3AW0A 3Q76A 4XOJA 2PKAB 2CF9H 1TFXA 3M5NA 1A7SA 4RN6A 4GCHG 2BDHA 8ESTE 3I78A 1X7AC 2HALA 2VH6A 3LIWA 1ZHPA 2XC5A 2WPMS 1TALA 3M3TA 3TIUA 5A8YA 4IS5A 1SQRA 4OS1A 3VG8A 1K0HA 1VCQA 5ESTE 1W0YH 1EUFA 1T4UH 2Z3DA 2AGIX 1C1WH 1VZQH 4TPIZ 1ZPZA 2ZGHA 1F5KU 5JBAS 1BTZA 1HUTH 4NIWA 2BY7X 3P6ZB 4ESTE 1EQ9A 2EQNA 2FOFA 4LZ4B 2VIOA 1N8OB 1AFEH 4CHAB 4NIVA 2PW8H 2CN0H 4JZIA 2RA0A 5GJ4B 1P57B 2R2MB 3T26A 1ELAA 2AEIH 2C90B 4F49A 1UTMA 3HKJB 3FAOA 2GDDA 1QBOA 4K1SA 5EPNA 1OPHB 1VITF 2QCYA 1PPBH 3NXPA 5F53A 3RXAA 3RLYH 1L4ZA 1AVXA 1QL7A 3F3BA 2F91A 1GI6A 4YOJA 1OHHD 1J9CH 3CP7A 1MCTA 2OC1A 5AHGH 4LXBH 1BJVA 1GMHF 1CT0E 3TH2H 7GCHG 1P8VC 1AKSB 4ISHH 2XBXA 3RXEA 2FOCA 1GI5A 4HZHA 1BRAA 1O3JA 2H2ZA 1G9IE 1C1RA 5F8XA 3AK5A 4JYVH 4BTIB 1T8LA 2KZ4A 1RIWB 1SHYA 4BAKB 4FUGA 2BD8A 3KYGA 4CH2B 2FODA 3ZVDA 5EJLA 2AHME 1GVZA 1AMHA 4X6NA 3S9CA 5DKMA 4FVBA 1W8BH 1NC6A 1TB6H 3GY3A 1ARBA 1V2QT 1EJMA 1FN8A 2ANWA 1QHRB 1O5FH 2FOAA 2W26A 3RXVA 3URDA 2OC8A 1ZMNA 1HAYB 3HK3B 7KMEH 2L74A 1AZZA 2TGDA 1P02A 1YGCH 4UFGH 2OXSA 3BN9A 3M35A 1IQMA 3TVJB 3ESTA 3A86A 3BTWE 2A31A 3LH1A 3F9EA 5SGAE 1LMWB 1W0KD 4CBNA 3TH3H 2F83A 1F0TA 2OQ5A 1KXAA 2A32A 2ODPA 3PO1B 1E35B 3TK5A 4MPXA 1KXDA 1SQAA 4B74A 1P09A 1AE8H 3RXCA 1OOKB 5EQRA 2UUKB 2BD3A 1LCYA 1YWUA 1NROH 2UUYA 2YNAA 1K1IA 2PR3A 3TITA 1W2KH 2G00A 2G81E 2UUFB 1LVBA 1AHTH 1HLTH 2Y7ZA 1B7XB 2BX3A 1ACBE 2KFWA 2OD3B 1MKXK 1UHBB 3RM0H 1PQAA 1MQ6A 1NZQH 1QGFA 1QRWA 2QF3A 5EIYA 1YLDA 5ETXA 2V7QD 4RI0A 2GCTB 3E6PH 4JK6A 4Y11E 2WV9A 4NSYA 4CRFA 5C17A 4X8SH 1W7XH 4INLA 1P2JA 2FX6A 3CENA 4INHA 3E16B 1GMCF 1C2JA 2WUBA 1L1NA 4H4FA 5B6OA 2AGEX 1F0SA 3DSOA 5C1YA 1G2MA 2FI5E 5T1VA 2STAE 1HJAC 3MO6A 1W0JD 2A0QB 2XOKD 4AGKA 5F8TA 4XSKU 4FUIA 3MWIU 3K9XB 3LGTA 3NRLA 2VIDA 3GCHB 1QR3E 1JRTA 3GCNA 3BF6H 2ZDKA 1HAOH 2ZCKP 1WTHD 2HGTH 3UR9A 1OKXA 1ZRBA 1UK4A 2QE7D 4IW4E 4ABEA 1P3CA 4P02A 1N8OC 1GI4A 3GDSA 4CHAC 5A0BA 3RC6A 3B8JA 1G2LA 2O8LA 1DX5M 2RDLA 4Y8XA 4BTUB 2D26C 2BDGA 2SGDE 2ZHEH 3V7TA 1BA8B 1XUKA 3BEUA 4H42U 4GVUA 1BTPA 1DDJA 1QCPA 2QIQA 2A2QH 3GCTG 3MFJA 3QN7A 3SGAE 1E0FD 1P3EA 3GY6A 1WBGB 1C5SA 2HWLB 2FPZA 2VWNA 4INKA 3Q3YA 1ZTKA 1C1PA 1SLWB 3RXMA 1GL1A 3PMJA 1YPMH 3Q3XA 1FY8E 3SQEE 1KSNA 1ANBA 1YBWA 4GHQA 1THRH 2GZ7A 1HAIH 1MKWH 1TPPA 3EGKH 1C1UH 2ZFRH 1QB6A 1ZHMA 3ZZAA 1P10A 3M5OA 2ZGXH 1RIWC 3SGQE 3PRBA 1BMFD 4Z0KA 2Q1JA 5LPEA 5FHTA 4TT3D 2ZKSA 1FNIA 1AGJA 3SUEA 3AAVA 1O3NA 3RXFA 1TGCA 1C2HA 5JBCS 4TY6A 4R8TB 2FM2A 3RXPA 1C5WB 3T27A 3PYHA 1Z1IA 1OX1A 1GL0E 4YZUA 3UQOA 1NRRH 3O8RA 1QFKH 1F0RA 3E0NB 3LJOA 2QN5T 1AWHB 1COWD 5GPIB 3SGBE 1T8NA 1OYTH 4Y7AA 2BTCE 4I7YH 3OY6U 1GBCA 1O3EA 3LGVA 4X1SU 1C1MA 1AO5A 3QZQA 6CHAB 2ZU5A 3A7WA 1SLXB 1C2MA 5DP6A 1SMFE 3KQBA 1BTYA 1EKBB 3SUFA 3RXLA 4HG6A 1O3MA 3D49H 1MH0A 1OWJA 2B7DH 4CRAA 3SOSA 1O3HA 3CS0A 3A7ZA 3FP8E 1FAKH 4U2WA 4YT6H 2ZU1A 1CGJE 3GY4A 1V2PT 2GZ9A 3UAIC 1JIRA 1ZYOA 1TMTH 3HATH 3NCLA 2RFKC 1ETTH 1E34B 3TJOA 5FCRA 3MQKC 4B76A 2A4RA 3UNQA 3LT3A 2C8ZB 1A0JA 1GHBG 1O3GA 2BY8X 1C4V2 2BHGA 4UFFH 4B2BA 1PQ5A 3TLOA 3MOCA 4NCYA 1MTWA 1OWHA 2RCEA 3VXEH 1GBFA 1DSUA 1DLKB 4JK5A 4YO9A 1T32A 1OS8A 2ZEBA 4ZHLU 4ZKSU 1J17T 2BY9X 2BYAX 4AG1A 2CXVA 4X2WA 1DVAH 2GCTC 1ZTJA 3A88A 2BOHB 3HGNA 2ZGCA 2ZGBH 4ZUHA 2A4GA 1LHCH 1GI1A 4IMZA 3C27B 1TPOA 3HKIB 1SR5C 1VJAU 1O38A 2KR7A 4Y79A 4I86A 3A8BA 1JRSA 2CGAA 2QGRA 3SU4A 1GBEA 5FAHA 3F2FA 2ZI2H 4B1TA 1CBWB 2XRCA 5JBBS 1XUIA 4XDEA 2Q6FA 1CU1A 1SFIA 1ZSJA 4FU9A 3GCHC 5JYIA 5B6LA 1W7GH 2Z9IA 5EQQA 4AOQA 2EC9H 3QTOH 2ZFFH 1BZXE 1H8IH 1V2NT 1WOFA 2GDEH 2GCHF 5FPYA 4RSPA 1A4WH 1YM0A 1K1NA 1TX8A 4DGJA 1TA6A 1AWFH 1TBRH 2ZCLP 1FLEE 1ELFA 3EDXB 4NA8A 4XD7D 5C0UA 1QQUA 1LPZB 1P9SA 3UNSA 3RXGA 4BTTB 1Z8IB 1L4DA 4NIYA 2BB4A 1A5IA 1A61H 1GJ4H 2AMPA 2FXRA 1IQNA 1SPJA 1S6HA 1SKYE 4ISLA 2ASUB 2ZHQH 2XWAA 2J5UA 2F9OA 4X6PA 2D1JA 3UREA 1H9LB 2H9HA 4I8KA 4BXSA 5ESBA 1BBRE 1P03A 2V6NA 2PTCE 4A7IB 1TIOA 4ZXXH 1Y3WA 2GX4A 1RGQA 3K6YA 2O8TA 2Y6TA 2LELA 3U8TH 4RT0A 2KAIA 3ZV9A 3NPSA 5C67A 2F9PA 2BLVA 2ESTE 2A5KA 4THNH 4BAQB 4X0WU 2J34A 5IYTA 3LDXH 1HDTH 3P8GA 1O0DH 1FPHH 1TBQH 2JH0D 2QXIA 4DURA 2AH4X 4K8BA 5GCHF 4OS4A 1HCGA 1TE0A 8GCHG 3DUXH 2W6JD 1SGRE 5E2PA 1JOUB 2GJGA 3ZZ8A 4CBOA 1EB2A 1D3DB 3RXQA 1S83A 5C0TA 4FUFA 3PV4A 1MMJN 2PLXA 4B2CA 4X8UH 1YPHE 2SGQE 4K5ZA 1YLCA 3SV9A 1BTXA 3W1EA 1FMGA 1HAHH 2PGQB 1MU8B 1DUAA 5FX6A 4K3JA 4QT8C 5E2OA 1T8OA 2Y81A 1P04A 1W11U 3N99A 5IDKA 1CHGA 1ESBA 1FQ3A 1ZOMA 3GOVB 1GGDC 4ISOA 2J95A 3F9GA 4FUEA 1N6XA 1O2UA 1YPGH 3K6ZA 1LHEH 3RMMH 1EOLA 2R2WU 1GI0A 2ZPSA 2ANMH 1C1VH 3D23A 1W14U 1PPEE 3TH4H 3WY8A 1FY3A 4KTUA 3UB0A 4A1TA 4X1PU 1NFWA 4CR9A 3OX7U 5DP7A 3MU8A 1EZXC 3SORA 4Y6DA 2Z3EA 3UFAA 4O3TA 3ELAH 1XVOA 2TRMA 2OC0A 2R9PA 3TGJE 1EZSC 3IG6B 4RKJB 1DPOA 1K22H 3VB3A 2SGEE 1CE5A 3AASA 2PKSC 3DHKH 3MNXA 3RXDA 3MHWU 2BLQA 2XCNA 1V2MT 1Z6JH 2P3TB 2F9UA 5J4SA 1AIXH 4X8TH 1TBZH 4K2YA 3HPTB 3UNRA 3T29A 3SYJA 4YM9A 2EI6A 2A5AA 3GY8A 2WYGA 4M7GA 4NFFA 1HAXB 4FOUC 1L0ZA 1DWDH 2R0LA 2GP9B 3L3TA 4DT7B 1YPEH 1GBIA 2PTNA 1EJAA 1O36A 1ZR0A 5TJXA 1GJ8B 2D2DA 4MNXA 2A4QA 4FU7A 1BRBE 5FL7D 1YPHC 2J98A 2XNIA 3MH7A 3MTYA 4I8JA 2OC7A 4MQAA 5H4IB 3GYMA 4YT7H 1V2TT 3A7TA 3OSYA 5T6FA 2W3KA 4HTCH 5HMAA 1Z1JA 2FYQA 1UTPA 1O2PA 1DXPA 1V2KT 3UR6A 4X1RU 3W95A 4E7RG 1BHXF 2G52A 2VWMA 3SV7A 3QGJA 2ULLA 2WZQA 3NZIA 1TABE 1THSH 1O2IA 1TGNA 4ISIH 3U8RH 1GVLA 4CH8B 3QDZB 1B5GH 2WYJA 1Y59T 1W13U 5DN6D 3QO6A 3QTVH 2PUXB 3V12A 1BMMH 1G30B 1AI8H 1D6RA 1HJAB 1MTNB 4LK4A 5EXLA 5KEDA 1ZPCA 4MVNA 5DSFA 1KXBA 5EODA 3NUMA 4WVPE 1ZMLA 3GDUA 4BOHA 1UTLM 4A1VA 1QURH 4NZQA 3C1KA 4GPGA 2HOBA 1DLEA 1F5RA 4JCNA 1W12U 1LQEA 1V6DA 2K0QA 5AFZH 1Z8GA 4Y7BA 3ZZ4A 4WMFA 1LVOA 2BLOA 1KXFA 1BHXB 2ZDLA 1ZMJA 3RXUA 2ZHFH 1E36B 2Q6GA 4LOYH 4U01A 4ABGA 1O5DH 1O3AA 5G4BA 2KAIB 1DM4B 2XBWA 4Y71A 1PFXC 3BG4B 3E0PB 1FJSA 5E0GA 5FX5A 1EZQA 2VB0A 5DP4A 1UMAH 3SU6A 2BDIA 1YCPK 1ORFA 1SC8U 2FIRH 1VITH 4ZKOU 2BDAA 2V35A 1O2RA 2AIQA 1YP9A 3ZZ9A 2VINA 1ESTA 2BD4A 1C5RA 5HXFA 1V2RT 1EXFA 3OTPA 1RD3B 1UTJA 4XBCA 3EA8A 3UWJH 1FDPA 1SGDE 4Q63A 1G3EA 1NU9A 1SGFA 3U1IB 1E37B 2VU8E 1T8MA 2GT7A 3U1JB 3GDVA 1KXCA 6GCHG 5DJ7A 1PYTC 3E3TA 3LGUA 2F9VA 3MU0A 1A0HB 4JZFH 4Y10E 3GCOA 3H7TA 1AN1E 4BXWA 3A8AA 3PV5A 4WY3A 3VEQB 4IC5A 3WW7A 2JJ2D 2M2AA 1A0LA 2BVXH 2O8WA 3F2GA 3SU2A 2BY5X 3D65E 1RRKA 1O5AB 4I33A 1PPCE 5C1UA 2JETB 4Y8YA 3FVFB 3A87A 4TSFD 2OQUA 5L2ZH 3DCLA 4MPUA 2FOHA 3OYPA 4K69A 1QJ1B 5CHBA 4KELA 1O37A 5AFYH 3RXBA 5C94A 2Z6BD 3BTTE 1BRUP 4GCHF 2IPQX 5A0AE 4OS7A 1ZSLA 1C2LA 3S9BA 1GHYH 1O3FA 2BDBA 5J4QA 1SGIB 4X1QU 1MZDA 1ESAA 5GIBA 1BJUA 1EASA 3BTGE 1FX0B 1AUJA 1XUHA 1ZHRA 5EPYA 1O33A 1C5VA 2VWOA 1V2VT 1AUTC 2TBSA 5FPSA 3UOUA 4Y8ZA 3SJ9A 1D6WA
chains in the Genus database with same CATH topology
2HVXA 5T6GA 4YTAA 5EXMA 1GMDG 1SGQE 1GBKA 3OY5U 3M7TA 1TWXB 1IQGA 1UTNA 5C5OA 1K1LA 1MBMA 4TYDA 1AY6H 2BX4A 1SLUB 5JBTA 1GI7B 3PLBA 1EX3A 4DW2U 1Y3VA 1UVPA 1MTUA 1Q2WA 4NIXA 3ATWA 5JB9S 5LGOA 1DUEA 1AB9C 4X2XA 2V3OH 2ODQA 2NWNA 2P59A 4CRGA 1DWBH 1CO7E 4MDSA 7GCHF 1OP8A 1ZJDA 1H4WA 2ZWLH 5GDSH 3S7HB 4Q7ZA 1GHAG 3KQCA 3ENSB 1LKAA 4I8LA 3G01A 1C2KA 2GTBA 1C5NH 4K1EA 1GBAA 2FLRH 2PSXA 3SJOA 4J2YB 3KEEA 3BEIB 4A1XA 5A2MH 1GVKB 3A84A 8LPRA 4MLFB 1MTNC 2A5IA 1SBWA 4UONA 1ANDA 1P2MA 3M37A 3OU0A 1CT4E 2ZDVH 4AORA 2H9TH 1B0EA 4CRCA 4DOQA 2AMDA 1OP2A 4O9VA 1BB0B 1INCA 2GT8A 3BTFE 1H8DH 3R3GB 2BQ6B 4TPYA 3HGPA 3RXSA 1JBUH 1NESE 4ABBA 4PROA 1AD8H 4K1TA 1MKWK 4AB8A 1PJPA 2ZZUH 1BT7A 1GJBB 1TMUH 4ABHA 1LVYA 1G3BA 3BG4C 4TY7A 2ZA5A 1TYNA 4DY7B 4X6OA 1EPTA 5DK1A 1JXPA 1GJ7B 1SHHB 2OBQA 3MMGA 4NA7A 1G37A 2XC0A 4DG4A 2J94A 1O3BA 1HB0B 3BTQE 4OS5A 1ZPBA 3LH3A 1HXEH 3TU7H 1EJNA 1C2EA 3SNDA 2Z94A 2ZCHP 2AMQA 2BD2A 1ABJH 1YPKH 3RMLH 3SJIA 5DPAA 3P70B 2THFB 3SHAH 3SZNA 2FDAA 4B73A 1CA0C 1ZGVA 4B2AA 4BANB 1K1OA 1A5GH 2Z7FE 2DUCA 3PLKA 6LPRA 1AFQB 2ODYB 1C1TA 1ABIH 1KIGH 5C2ZA 1ZSKA 1Z7KA 1JMOH 1IQHA 1QB9A 1TGSZ 4FXGH 2HPQH 1SGPE 2H9EH 2ZDAH 3ZZ3A 1E38B 3AVZA 4ASHA 2ZF0H 7ESTE 2JETC 1KDQA 1OWKA 1BBRH 3MH6A 3A80A 1GHZA 3SV2H 1UVOA 2XBYA 5HM9A 2PFEA 2ZU4A 3RXHA 3PWCA 3SU3A 1GJ6A 4JMYA 2OBOA 4D76A 4MG3A 3KCGH 2R3UA 3O8DA 4ABFA 2GVFA 5DP9A 3A8DA 3VB7A 4FVDA 3SU5A 4BAMB 4X6MA 3LPRA 2EA3A 3BTHE 1GGDB 2IPHA 1O2GH 1BOQA 1C1NA 1DSTA 1YKTA 3FFGA 1LPGB 1GBBA 2EI8A 4ABDA 2A4OA 1C1QA 3F1SB 1K1MA 1XXFA 1DXWA 3P8NA 1TRMA 1P05A 3SUDA 3UY9A 3GYLB 3IWMA 5C1XA 3M5LA 4BNRA 1GJ5H 2Z9GA 1NFXA 3V3MA 2FX4A 1FIZA 2UWLA 2A1DB 4VGCB 1ZJKA 2BXUH 1MTVA 3GCTF 3FZZA 1KTTB 3QWCH 1VGCC 1XXDA 1YPJH 2PKSB 3TJNA 2QXGA 3SO3A 1UVUH 4YLQH 1K1JA 3A83A 1LQDB 3ZZ5A 1UCYK 2VNTA 3PTNA 5L30H 1S5SA 2WPJS 1ELDE 1SGNE 1TX7A 2H1UA 2PWXA 1WAYB 2P94A 1LDTT 2H5CA 2VVCA 1PQ7A 1WTGH 2BD7A 2J38A 1IQIA 4IN1A 2B5TB 2FEQH 2G55A 2FLBH 2HNTF 2HRVA 3QX5H 1XX9A 1CHOG 1P06A 1WQSA 2EI7A 4E06H 2ZU3A 3BIVH 1IHSH 1OSSA 1SG8B 1MTSA 3KQDA 1JIMA 1O2QA 1HAZB 2ZG0H 4E7NA 1AVWA 1DT2A 5I25A 1C2FA 2I6SA 3IITA 5FCKA 4E05H 5CMXH 1GCDA 2BZ6H 1C5LH 1LHDH 3L33A 4IMQA 4IN2A 5AVDA 1IQLA 1VR1H 3VPKA 4AFQA 1RTLA 2GD4B 1DWEH 1ETRH 1LTOA 1XMNB 3PMBB 4IGDA 2FOMB 3KHVA 1WV7H 4AFZA 1P2KA 1KTSB 2JH6D 5GWZA 1GDQA 1XKBC 3ITIA 3LU9B 1UTOA 1TAWA 1O3PB 2ZPQA 2C8XB 3BTDE 1FAXA 1FY1A 4CREA 3RU4D 1YCPM 1MQ5A 3JZ1B 1C5YB 3T5FH 3UUZA 4K60A 3EAJA 3TK6A 3KF2A 4YESB 1ETSH 1C5OH 3H7OA 1FPCH 4AZ2B 1EPTB 3SUGA 3LGWA 1GHBF 1WYKA 2Z9JA 4NFEA 1J15A 1GBTA 1O3LA 1F92A 4JZ1A 1O2OA 3T2NA 1IAUA 4UFEH 3PWBA 4NGAH 1AFQC 3U69H 2V0BA 1SI5H 3NWUA 3RXRA 4HFPB 3RDZA 2G4TA 4OGYA 1UK2A 1UTKA 1IOEA 3SNBA 1ID5H 2ZDNA 1IQJA 2GZ8A 2TGTA 4D8NA 1S85A 2A2XH 2YNBA 1K2I1 1W3CA 2ZFPH 1QQ4A 3SJ8A 4XBBA 5DO4H 2TGPZ 1EZUC 1Y3XA 2ZQ2A 3F68H 3W94A 4KTCA 5EXNA 2OLGA 1GI8B 1BTUA 2Y80A 5HYOA 5A8XA 5ABWA 1UJ1A 4UDWH 1GJAB 2A7JA 2SGPE 4O3UA 5EOKA 3F6UH 3VXFH 1KDQB 1TNGA 3FANA 4SGBE 1PPGE 1QJ6B 1O2TA 2F3CE 5CE1A 2NU1E 2GMTB 1TNHA 5DG6A 1QA7A 3P17H 3F9HA 4KTSA 1O2VA 4ZHAA 1MU6B 5AF9H 1OWEA 4XFQA 1RTKA 2HNTE 3PB1E 5EG4A 1K28D 4VGCC 2QAAA 2AERH 2JKHA 1FUJA 5JB8S 2QA9E 2BM2A 4MNYA 1NRQH 4JYTA 3O8CA 4O97A 4BAHB 2C4FH 2BXTH 1WCZA 2P95A 2QC2A 2XXLA 2B8OH 1O2LA 1DY8A 1WSSH 1O2WA 3BG8A 1V2UT 2NU4E 4GAWA 2A7CA 1UCYE 1GBHA 3B23B 4X2VA 2P8OC 4ABIA 2C8WB 2B9LA 3KGPA 4DIIH 1MD7A 1PQ8A 4IBLH 3I77A 1PPZA 4JZEH 1EOJA 1O35A 3OTJE 1P9UA 5E0HA 3ATKA 3JZ2B 2VVVA 4AFUA 1HRTH 3FP6E 5A8ZA 1VITG 1OWIA 5DP5A 1C9PA 2BD5A 4Q80A 8GCHF 3P95A 3Q77A 3VB5A 2FOBA 3EA9A 3PROA 1D3PB 3M5MA 2J2UA 1ELVA 2FI3E 3E91A 4OS6A 1TONA 2CJIA 4NWLA 1DANH 3A7YA 1AB9B 1D4PB 1RFNA 1MZAA 1AZ8A 4Q2KA 2Z9LA 4D9QA 3N7OA 4ISNA 1TRYA 1Q3XA 3PMHB 4XE4A 1VCWA 4TWWA 1QB1A 4ZKNU 1K9OE 2HNTC 3MH5A 1QBNA 4KKDA 3PLPA 3D62A 3ZVFA 1O2JA 3U9AH 3TPIZ 1BIOA 4FUJA 3S9AA 4GUXA 1GDUA 2VIPA 3LOXA 1G3CA 2QY0B 4X8VH 1SOZA 1EPTC 3VB4A 5I46H 1RS0A 3A89A 3V0XA 2J92A 1GPZA 1O2KA 2CHAC 2RG3A 3PTBA 2F9NA 1A2CH 1GCTB 1P0SH 1TQ0B 1LHGH 2J9NA 4JZDH 1HJ8A 1EAIA 2CF8H 1Q31A 2HPPH 1DICA 2OINA 3S7KB 2GV7A 1ELTA 3RMOH 5PTPA 1LKBA 4Y0YE 3P92A 2FYRA 1ANCA 1K21H 1TNKA 1O3OA 5T6DA 2O9QA 1J14A 4HI3A 1CSOE 2FTLE 2BVRH 3VB6A 1O31A 1D3TB 3VGCB 2DE9A 4SGAE 4LZ1H 1O2SA 2TIOA 1MD8A 5FXLA 1S82A 1UTQA 3RXTA 2FOGA 2LPRA 1O2NA 3QUMP 1QRXA 1DY9A 3RP2A 9ESTA 3Q00A 3RXJA 1CA0B 3P8OA 1FONA 1FXYA 2PHBA 2VIVA 1C4Y2 5BRRE 1YF4A 2GMTC 1EATA 1O32A 2ZECA 3QK1A 4O03A 3SNAA 1C2IA 3RXKA 2BQ7B 1Z6EA 4A5TS 4BAOB 4MTBA 4WMEA 1GMCG 3ZZBA 3ZVCA 3RC4A 4WF8A 4X2YA 3SN8A 1HXFH 4AYYB 4Z6AH 4JYUH 3QZRA 1FZZA 3LGIA 1ELCA 1P2NA 2Y5HA 1TNLA 5L6NH 1SQOA 1ELBA 1MAYA 1O2HA 2STBE 3LONA 1V2WT 3SV8A 1UK3A 2UWOA 1BDAA 2ILNA 3RUOA 2WPIS 1YCPH 4A6LA 1BQYA 1HPGA 4X1NU 4WJG2 3SI4H 1AQ7A 4NSVA 2ZU2A 2VVUA 3DT0H 1FY5A 3RLWH 2XWBI 3E8LA 1C5XB 1XVMA 2VGCB 1RXPA 2ZFSA 1YC0A 3MO3A 2UUJB 3MNBA 1GJCB 1P2IA 5C20A 3LKWA 3VFEA 3ZYDA 3MO9A 1CGIE 2Z9KA 3GISB 2IJOB 2BMGB 3SNCA 4WH6A 1ELEE 4Y0ZE 1SGFG 3ATIA 1HAPH 4D7GA 1XKAC 3SBKA 3TJVA 1QY6A 1G32B 4FUHA 4Q7XA 1RTFB 3MYWA 2Q6DA 1GHWH 3KQEA 2BDYA 3ATMA 1Y5AT 1SGYE 5F8ZA 2O8UA 3RXIA 2ANYA 3GY5A 1V2JT 4OS2A 4YOGA 3TGKE 2G51A 4ZH8A 5EW2H 1VGCB 4WXVA 3SU0A 1TPAE 1BITA 1Y3YA 2SFAA 1O5BB 5LH8A 1P2OA 4KP0A 1YPLH 5K7RA 1ZGIA 3A85A 3P8FA 1TGBA 1XUGA 4MPVA 1ZZZA 4UE7H 1QIXB 1S81A 1HAVA 8KME2 1P01A 2ZP0H 2W5EA 2Z3CA 2FESH 3SHCH 1C5PA 3EQ0H 6GCHF 1NTPA 4WXIA 1LO6A 2G4UA 3DFLA 2QV1A 4FUDA 4UD9H 2TPIZ 3SQHE 5HM2A 1KXEA 4I8HA 5FBEA 4A92A 2BY6X 1XM1A 1SGTA 3RM2H 4AGJA 2FOEA 4DIHH 2ZFQH 6ESTA 1W10U 5LPRA 4AG2A 5C3NA 3ZVGA 1MCVA 1ELGA 1TGTA 2QF0A 3ODFA 2V3HH 1GJDB 2XC4A 1GCTC 3U98H 4I31A 1C9TA 1SSXA 2VWLA 4I32A 5E8EH 2UWPA 1QBVH 1HFDA 4B75A 3M61U 3ZV8A 2AGGX 1GWAA 1MKXH 2XTTB 3MU4A 5EW1H 3BSQA 1LPKB 4GSOA 3SV6A 2ZGJA 1CGHA 2C8YB 2ZFTA 2WPKS 1BMLA 1HAGE 1TQ7B 2W7SA 1T31A 1IQEA 2HLCA 3T62A 1O2XA 3H5CB 3URCA 1TLDA 2GGVB 3E1XB 1P11E 2RA3A 1HIAA 3SNEA 4NG9H 1F0UA 2ANKH 5EQSA 1NRSH 1GDNA 1UVTH 3LC5A 3ZZDA 2ALPA 2WV4A 3GY2A 4J1YA 4Y76A 3VGCC 3KNXA 1TNIA 2VIWA 1BBRK 2FTMA 1HNEE 3M7UA 1ZRKA 4DJZB 1DWCH 1NU7B 1C2GA 1CT2E 1IHTH 1GBJA 1O2YA 3MU1A 1GMDF 3B9FH 1HGTH 1BTHH 1Y8TA 5CHAB 4ABJA 2QXHA 2QYIA 2SGFE 4FUBA 2BDCA 1AU8A 3M36A 4H6TA 1DITH 1H1BA 1FI8A 1NO9H 2PSYA 2FP7B 2A7HA 2OP9A 3M7QA 5F03A 5JPMH 1CA8B 4B71A 1GHAF 1PPHE 1GI9B 1TRNA 1TOMH 3AW1A 1NPMA 3KIDU 4ABAA 1B0FA 1NN6A 1V2LT 3MNSA 3ODDA 1OYQA 1O30A 3S0NA 2FS8A 2G8TA 3TNSA 1C2DA 2Y5GA 2SGAA 1C1SA 2GCHG 3V13A 4GHTA 5C5NA 2VGCC 1K1PA 1C1OA 3F9FA 1ARCA 1W0ZU 2ZC9H 2ZIQH 3EA7A 4ZROA 2P93A 3DD2H 2PUQH 4UEHH 1GJ9B 1F7ZA 1KYNA 3RMNH 1CQQA 2FZZA 2VIQA 3PM3A 4NZLA 2ZO3H 1P2QA 1C5QA 1SFQB 3DFJA 1NT1A 4RKOB 3MI4A 1WUNH 3PO1C 1EAXA 1GHXH 3BTEE 4CR5A 2WUCA 1L2EA 4I8GA 2Y7XA 2ZTXA 2BLWA 3MH4A 2AS9A 1XUFA 1BUIA 1H9HE 1ANEA 3A7XA 3SJKA 2ZHWH 5T3HA 1GI2A 2ZTYA 1QRZA 2AFQB 4AB9A 2OTVA 4NA9H 3U8OH 2B0FA 5EU8A 2AIPA 3MU5A 5A0CA 3HK6B 1TNJA 1SGEE 3BEFB 1O3KA 1XUJA 2PV9B 5BPEA 2P8OB 5GCHG 1ZLRA 3A82A 3AAUA 1IQFA 1T4VH 1EAUA 3EE0B 3M3SA 1C5ZB 1SLVB 3SW2B 1O3DA 1OXGA 3Q3KA 1BMNH 2ALVA 3K2UA 1A5HA 2NU3E 2VH0A 1HAVB 3UOPA 2J4IA 2GV6A 2NU0E 4DVAU 2FO9A 2FI4E 3FZDA 3T25A 1MAXA 1Z71A 2XBVA 1DFPA 3FP7E 3KL6A 1C5MD 3O8BA 2WINI 1HJ9A 1BTWA 1O34A 3A81A 1A1RA 2G5NA 3BTME 2FWWA 2D8WA 3LGYA 1C5TA 3RXOA 3TJUA 2W7UA 1SOTA 1BCUH 2EEKA 1TX6A 1UCYH 1HBTH 3K65B 1S0RA 1EP5A 1VCPA 3TNTA 1F2SE 2PKAA 4MNVA 2IOTA 3MNCA 1QL9A 1KLJH 1NY22 1HV7A 4YLUA 1THPB 2BVSH 4ZXYH 2NU2E 2W3IA 5GXPA 3UPEA 1ZTLA 4WWYA 2C93B 1GG6B 1HYLA 1SQTA 4F4OC 2P3UB 3A8CA 1QTFA 4D9RA 1DS2E 3UQVA 3LC3A 2JH5D 5CHAC 1FN6A 2CHAB 5TCCA 1D3QB 2R3YA 1HIAB 5K0HA 3ZVBA 1NFYA 5E0JA 9LPRA 2CMYA 2K1QA 1O2ZA 1T7CA 1C5UA 4MPWA 1UO6A 2LNCA 1NRNH 4CRBA 3R0FA 2BOKA 1V2ST 1V2OT 3PMAB 4NWKA 1OWDA 1DOJA 4FU8A 1MBQA 3ZZ7A 1LHFH 2OCVB 4Q7YA 2P3FH 4K8YA 5TCAA 3GICB 1FY4A 3GY7A 3TK9A 3ZYEA 1L1GA 1QJ7B