1SHYA

The crystal structure of hgf beta-chain in complex with the sema domain of the met receptor.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
228
structure length
228
Chain Sequence
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor/growth factor receptor
molecule keywords Hepatocyte growth factor
publication title Crystal structure of the HGF beta-chain in complex with the Sema domain of the Met receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2004-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1shyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1shyA01
1ZLRA 3Q3YA 4X8UH 4NZLA 4Y0YE 1O5AB 2ZIQH 3ZVEA 1G2MA 1JMOH 1KXDA 5E2PA 4GHQA 3A7ZA 4X1PU 3ZZBA 2J2UA 4ISNA 4AX9H 1BTPA 1DFPA 5F8XA 1AVWA 3MOCA 4E05H 3MMGA 1ELCA 1G36A 3U8RH 1UTNA 2A31A 2CJIA 2PSXA 3F9EA 2G8TA 3NCLA 5AHGH 3VGCB 4FUGA 2F9PA 5A8XA 1GMCF 1VGCB 3GY7A 5GJ4B 1J9CH 5DP7A 2EA3A 5HYOA 2CF8H 4FXGH 2YNBA 4WVPE 3GCTG 2VIPA 4XBCA 1AFQB 3PTBA 3GDUA 1YP9A 4X2WA 1O2VA 1TYNA 3A82A 1CHOF 1O2LA 4BAHB 5DP4A 3SU0A 1MU6B 1KLIH 3KNXA 4Y11E 1O5FH 4LOYH 3KQBA 2ZGBH 3H5CB 1W0YH 1TB6H 4A92A 2JKHA 5EGMA 1C5ZB 1BQYA 3AW1A 5DP8A 4ZXYH 1P8VC 3H7OA 2XBWA 3OYPA 4UEHH 1P0SH 4MG3A 5EXNA 1NRRH 4YOIA 3IITA 1K21H 4FVDA 3Q00A 1EZUC 3SU4A 1MH0A 1P2KA 1FY1A 1WBGB 2BDBA 2GCHG 2Z9IA 3Q76A 3QGJA 4GCHF 1UTLM 3E3TA 1HFDA 3FVFB 1WAYB 2AMQA 3GYMA 3GDVA 1NRNH 4MNXA 1N6YA 1SFIA 3SUEA 4DGJA 5E2OA 2FO9A 3KEEA 2PKSB 1LHFH 2VGCC 3HK3B 1C5PA 1TPOA 1GBCA 1GJ8B 1LKAA 2ZFTA 2GZ8A 3F6UH 1EXFA 2PFEA 3P8NA 1S81A 5JBTA 4KTCA 1FIWA 3SU2A 1FPHH 2BOKA 3EAJA 1D3QB 3GCNA 5DP3A 1DM4B 2YNAA 2TGAA 1KDQA 2Y5FA 1DUAA 1NZQH 3K6YA 3MO9A 7LPRA 3M7QA 2ZDLA 1BIOA 5DG6A 1YYY1 1CT4E 1U6QA 1W12U 1DT2A 3RU4E 1RS0A 1VCWA 1L1NA 3RUOA 2B0FA 3KL6A 1AVGH 3GCTF 2HNTF 2G51A 1BMMH 1CGIE 3D62A 1Q2WA 3ZVAA 4ZHMU 3SOSA 1FY5A 1N1LA 3A7XA 1AU8A 1O2IA 1T4UH 3SUGA 5CHAB 4NSYA 4BTUB 4YZUA 2HRVA 1AMHA 3E90B 1ELDE 1H4WA 1DE7H 1HAZB 1T8LA 2NU2E 3MFJA 3LJJA 3RLYH 1GMDF 1ELTA 1GJ6A 1D6WA 1ZPZA 1JIMA 4CREA 2D26C 5GDSH 4TWYA 2PR3A 1Y5UT 5A2MH 1C2GA 1DY9A 4GPGA 4A1VA 4FU8A 1YPMH 3SJOA 1RIWB 3PO1B 5C5NA 4FVBA 2R0LA 3W95A 3TNSA 2OLGA 5K0HA 3EA7A 1C9TA 4OS1A 4UE7H 1O2YA 3ATKA 1PPZA 1RTFB 2BZ6H 3QK1A 1GG6C 1KXAA 2O9QA 1V2ST 1AZZA 4U01A 1HAXB 2XW9A 2QXHA 1O3IA 1Z8IB 2A7CA 2SGPE 3MU5A 2ZDMA 3QDZB 3SNEA 3M3SA 2D8WA 3WY8A 3HGPA 1SGTA 2ZGXH 1V2VT 1HJ9A 2ANWA 1GI9B 4NA9H 5DP6A 1V2UT 2FI3E 1UVOA 3BTEE 2NU1E 5HMAA 4DIIH 2PTNA 4JYTA 3FP6E 1XXDA 3TK9A 2A4QA 4D7FA 5FPSA 5DP9A 3BF6H 2A5IA 4CRFA 1ZHRA 4CRCA 3BTTE 3L6PA 3RMOH 4TYDA 3W94A 3KGPA 1T7CA 4OS7A 3UOUA 4IMQA 1C5XB 3FP7E 3U1IB 1HYLA 1CA0B 3O8BA 4NG9H 2BX3A 3TVJB 5HGGA 1XMNB 1EZSC 2NU3E 1W10U 2ZFPH 1C1TA 1GI7B 3RC5A 3T62A 1BRAA 1PPFE 3BTFE 4K2YA 1AI8H 1QBVH 3LONA 3ATWA 3S9CA 3A8DA 5GIBA 3GYLB 3BN9A 2FODA 4ABFA 1J17T 1AE5A 1LDTT 1C2IA 2Z9KA 1UMAH 4AGKA 1S82A 2BD3A 5DGJA 4XBDA 1N6XA 4CRDA 2B5TB 4OS6A 1YCPH 3ENSB 1ABJH 4X2YA 3ODDA 1BHXB 2R2WU 2ZCLP 3QO6A 1BRCE 2OC8A 1WYKA 1O30A 7ESTE 1TOCB 2Z94A 1IQIA 1O2JA 4MNWA 1IQGA 1CT2E 1UTKA 4K5ZA 1XX9A 1JRSA 2FPZA 5C2ZA 1FMGA 1L1JA 1VITG 5T6DA 1GHWH 2C8ZB 1TNJA 4ESTE 3RXLA 3QLPH 2P8OB 3SJ8A 4GUXA 1MBQA 4VGCB 1DWEH 1DWDH 4X1QU 2AGGX 5C20A 1YGCH 1UTQA 1GMHG 3VB4A 1O3GA 2SNVA 3SV2H 2GCTC 3ODFA 1BTHH 3PMHB 2VU8E 1BJUA 1YLDA 2QXIA 4NGAH 2OUAA 3RXHA 3SU1A 1LVMA 1XUJA 1UVPA 1TBZH 3GY5A 1BUIA 4INKA 3GCHC 4TPYA 3TLOA 4AB9A 2G52A 3MU8A 1GDNA 1EAWA 1DVAH 1BJVA 1SHHB 2BXTH 4CBOA 2WPJS 5BRRE 4H6SB 1LPGB 1W7GH 2VIWA 1WCZA 3TJOA 1Y5AT 1LCYA 4GVUA 3ZZCA 2Y82A 3M5LA 1J8AA 1DX5M 1GGDC 1K1PA 2ZPSA 4ISHH 1ESTA 1O5CB 1XUHA 2GV7A 3ZVDA 5A0BA 1W2KH 1VR1H 2J34A 3AASA 5IDKA 1SGPE 1YPJH 1FIZA 1UHBA 1Y3XA 1O35A 2PKAB 2OXSA 3ZVGA 3RDZA 1GI6A 1OYQA 2J95A 1EB2A 1GDQA 1UO6A 1YCPK 1OKXA 1BRBE 1A1RA 2STBE 2F9UA 3A8AA 5AVDA 3VFEA 4B2AA 3RXQA 1CE5A 1YPHC 2OBOA 2H9EH 1UVSH 2VH6A 1EB1H 1EATA 1GMHF 1HRTH 4AGJA 5CE1A 3HGNA 1SGQE 1O3KA 3NK8A 3BEFB 1E35B 2OQUA 2A4RA 4GLYA 1ZTLA 2FOGA 2AMDA 4BNRA 2BD7A 1O3EA 1HB0B 3VB7A 3LDXH 5L30H 1RGQA 4OGYA 2BDGA 2BTCE 1ARCA 1T8MA 6ESTA 2O8WA 2ZU4A 3RXPA 1ZHPA 3LIWA 2Z9GA 1GWAA 5FX6A 4IBLH 1QBOA 3PWBA 1MCTA 3SV7A 5J4QA 2OTVA 3AVZA 1TX8A 1HXEH 1Z8JB 3TNTA 1P2QA 1WQVH 2ZG0H 2WPHS 2SNWA 1KXCA 1OSSA 4XSKU 3UR6A 1HNEE 8GCHG 1G3DA 5GWZA 1DPOA 4AZ2B 1O3BA 2J94A 2ZU5A 3RMMH 1BMAA 1M9UA 1L1GA 2ZU3A 1GHYH 2R9PA 2ASUB 1IQFA 4IN1A 3RU4T 2WUBA 1S83A 1DY8A 3P6ZB 3T29A 1W14U 2Q6FA 3OSYA 1XM1A 1PPCE 2R3UA 3RXKA 1ZZZA 2UWOA 4Q2KA 4BAOB 5L2YH 4GAWA 3STIA 3GY4A 4LZ1H 2ZFFH 5A8ZA 3RXEA 6GCHG 9ESTA 3KQEA 1XKAC 1MKWH 1O2KA 1QQ4A 4I33A 3O8CA 3A87A 2UUKB 2I6QA 1NO9H 3DT0H 1TRYA 4Y8YA 1BA8B 1AQ7A 1TLDA 4FU9A 1G2LA 3SBKA 1KTTB 3TIUA 1OWJA 3QUMP 3SU5A 1P2IA 1AWFH 2FI5E 1FY4A 4UFFH 5C67A 3ATMA 1V2LT 4JYUH 1GHAF 4HZHA 2QF3A 2OC1A 1BBRE 1OWDA 1Q3XA 5EG4A 3DUXH 2RDLA 5TCCA 3QZQA 4OS2A 2F9OA 1OP8A 3BG4C 1P9UA 2VIOA 1Q31A 3VXEH 1OX1A 1O38A 1V3XA 2ZHEH 2SGQE 1O2ZA 4ABHA 3RMLH 1A3EH 1PQAA 3MU0A 1HIAA 1V2JT 1TPSA 1QRWA 2UUFB 1L4ZA 3PMBB 1K9OE 2UUJB 4K3JA 3M35A 4DG4A 1MZDA 4I8LA 3F9FA 4INLA 1Z1JA 3R3GB 4ZH8A 1NU7B 2OQ5A 4WY3A 5PTPA 1BMNH 1F5LA 2GT7A 1AN1E 1IQEA 2OBQA 1AZ8A 3AAVA 4RKJB 1B5GH 6GCHF 3S69A 2GMTB 1EZQA 3SGAE 1OP2A 1C1RA 4Q7YA 1S5SA 1TOMH 1Z8GA 1THSH 3VGCC 5JB8S 4AN7A 1SI5H 4I8KA 1O3PB 3KCGH 4PROA 2PKAA 1VGCC 4ABAA 2TRMA 3A8BA 1PYTD 4NWLA 1LHGH 1YPHE 4TPIZ 1GVKB 3RXFA 1C5YB 5L2ZH 1ID5H 4WF8A 4WH6A 1LHEH 3SU6A 3DD2H 1O5BB 1V2TT 5F6MA 1AFQC 1MKWK 1NFYA 1XXFA 2FTLE 4I8GA 2LNCA 1QL9A 1JOUB 1J14A 1SC8U 5FPTA 4AYVB 1GI3A 4MPXA 1EP6A 1O3OA 2ZTZA 7GCHF 1GI4A 1ORFA 1QCPA 4X6NA 2BD2A 3BTME 1O31A 1BMLA 2VIQA 1C5VA 3PROA 1ZJDA 2EI8A 3SGQE 4AG1A 3RXGA 4FU7A 4X6MA 5EODA 3ATLA 5DK1A 5GCHG 1TX6A 1FAKH 1KTSB 2NWNA 2OC0A 2TPIZ 1GL1A 3MWIU 1P01A 3SJ9A 2KAIB 1PQ8A 1MBMA 2P93A 1PFXC 2PKSC 3O8RA 3UTUH 2BDAA 1IQLA 4OS4A 1FUJA 4Y79A 1OPHB 1E38B 1NFXA 1FPCH 2FS9A 3BTQE 1F0SA 4IN2A 3HK6B 3BTHE 1C2JA 1H8IH 1D3DB 3UNRA 3MU1A 1GVZA 4UFEH 1MTSA 2FOEA 2AERH 5G4BA 1C4V2 2F3CE 1MTUA 1TMTH 3KHVA 5FHTA 1AUJA 3MI4A 2PWXA 1VCPA 3RC4A 5FBEA 3ZVCA 2BX4A 3K9XB 5HM9A 1LPKB 4IMZA 2W7UA 3S0NA 3C27B 4K60A 1D6RA 2Y7XA 3E6PH 4I32A 4DVAU 3UOPA 1QIXB 1Y5BT 1SHYA 4THNH 1SL3A 5EPYA 5EXMA 1HAVA 3F9HA 4X0WU 1CQQA 4MVNA 1GHBG 1TABE 1HJ8A 1LHDH 2GV6A 4SGAE 1OYTH 4ZKOU 5CHAC 1EASA 2ZI2H 3URCA 3DA9B 4B73A 1F7ZA 1C2MA 1GJ4H 1EAXA 3EDXB 2J9NA 2ZZUH 4CR5A 3I78A 4Q7ZA 1T31A 1CU1A 1GDUA 1S85A 1AIXH 2BLOA 4HI3A 1THPB 4CH8B 1FJSA 1ZRKA 3E8LA 1RIWC 2JH5D 3PO1C 4UDWH 1TNLA 1A4WH 2W3KA 3UQOA 6CHAB 3FP8E 3ZZ8A 2Q1JA 1QRXA 4LZ4B 4NFFA 5BPEA 1AKSA 2ODPA 3B23B 1GCDA 1A5GH 1MTVA 1QRZA 1OP0A 5TJXA 4ABIA 3GY8A 3P17H 3VB3A 2H9TH 2VWNA 1JXPA 3KQDA 1DS2E 1AE8H 2P94A 3TJNA 5FPYA 4DOQA 3GY3A 2ESTE 1KXEA 4X1RU 2A2XH 2A5KA 4A1XA 3NWUA 1TGTA 1SMFE 4JZDH 1Z6JH 5E0GA 3FZDA 3TGKE 3SZNA 1C5RA 4NA8A 3RC6A 3S9AA 1C9PA 1V2RT 1AB9B 1HPGA 1XVOA 1ZTKA 5J4SA 1O3FA 1O3NA 1HJAB 1DSTA 1O2UA 4XBBA 5FBIA 1GHBF 2ZFQH 1ZPBA 4FUFA 1SOZA 4FUBA 2P59A 1O32A 1CA0C 2DE8A 2VVVA 2WPIS 3SUFA 5F03A 1Z7KA 3NZIA 1UTMA 1HXFH 4ABEA 2NU4E 2XXLA 1O2RA 1FN8A 1PYTC 1P02A 2GDDA 3M7TA 1BITA 2OINA 1MQ6A 2VJ1A 2GCHF 1P05A 1TBQH 2QY0B 5F8TA 5LGOA 1KIGH 4ABJA 2SGFE 4R8TB 1F5RA 1HAGE 1IHSH 1H9HE 2XWBI 4Y76A 3T28A 4KELA 2O8LA 4HGCA 1YC0A 3K2UA 3B8JA 2ZNKH 4CRBA 1G3CA 3EA9A 5FCKA 3IG6B 3SO3A 2SGAA 5JBBS 3E0PB 1QL8A 1TQ0B 1VZQH 1WSSH 1FZZA 1P09A 1SG8B 2BY6X 2VWMA 4B2CA 1NRQH 4CBNA 4IS5A 4TWWA 3MH7A 1C4Y2 3MO6A 2M5TA 2YOLA 4I8JA 1GBEA 1S0QA 9LPRA 1DWBH 2ZHWH 1AWHB 3QN7A 4DY7B 3V0XA 3HPTB 2P8OC 3M5MA 1GHXH 2FLBH 2HLCA 2D1JA 3G01A 1DUEA 3TGIE 1IQJA 4VGCC 1QY6A 5AFZH 4BANB 1IOEA 3SNDA 1ZMJA 1O3HA 1JRTA 2GD4B 4TY7A 4FUEA 3HKJB 2QXGA 3FANA 3PLBA 2GP9B 1DANH 3A7VA 3SQHE 1UTPA 1TQ7B 4BOHA 3UUZA 4GSOA 1GBMA 2VB0A 5EW1H 1O2NA 1ETTH 3OY5U 3P95A 2CHAB 4BXWA 5K7RA 3SNCA 1TRMA 3D49H 4OS5A 4I31A 4J1YA 1YM0A 1SPJA 2VWLA 3V3MA 2IOTA 1ZHMA 1GJAB 3LGVA 1GBHA 2BYAX 2V0BA 3TU7H 4UONA 4JZFH 1QURH 2P3TB 3BSQA 2SGEE 1VCQA 3ELAH 2CMYA 1ABIH 1C5QA 1O2GH 3BIUH 3A8CA 2BD5A 3FFGA 2QC2A 2F9NA 4TY6A 1J15A 3MO3A 2QA9E 4O3UA 1GL0E 1GVLA 2FESH 2Z9JA 1DXWA 1YPLH 2BOHB 2WPMS 4ZHLU 1FONA 2BLVA 2GT8A 2BLQA 1P9SA 3AAUA 2ZO3H 1ETRH 1F0TA 2FS8A 5JPMH 2THFB 5CMXH 4X8TH 1DOJA 4WMFA 1CGJE 4MTBA 4CR9A 3M37A 2XCNA 4A1TA 1LVOA 2QCYA 2JH6D 4Y8XA 4U30A 1HAOH 2GGVB 1V2PT 4AFUA 1ANCA 1KXFA 3ZZDA 1HLTH 1IHTH 2HOBA 4JK5A 4K1TA 2FP7B 2HVXA 3EGKH 1BTWA 1NC6A 1O2QA 2J38A 1CBWB 4ABBA 1YF4A 4H4FA 3LT3A 1ELAA 2A0QB 2AGIX 3JZ1B 3BG8A 2XC5A 1O2PA 1P11E 3GICB 2ZDNA 3BEIB 3S7HB 1TNKA 3PWCA 4WMDA 2H1UA 5JBCS 3MU4A 4YO9A 4NIXA 2ZDKA 1C1OA 1O2XA 2Y5GA 1O5DH 3SV8A 4JYVH 1GBKA 3H7TA 4R0IA 3MHWU 4MNVA 5FCRA 4KTSA 3TH4H 2ZDAH 2BHGA 2G00A 4X8VH 1TNHA 1O3CA 1UK4A 1D4PB 2R2MB 2RG3A 1G37A 4ZMAH 4YT6H 1EAUA 3RXSA 2BLWA 1MD7A 2ZECA 3UREA 2BDCA 1XUKA 3L3TA 1DXPA 2H6MA 1VITF 2WV4A 2CV3A 1A0LA 1P2NA 5T6GA 3QTOH 4A7IB 1O2MA 3PV4A 3NXPA 2EI6A 1OWKA 2FOBA 1C5MD 2VWOA 1ZSLA 5FXLA 4IC6A 1HV7A 2Z6BD 3UR9A 1SLWB 3ZV9A 4DCDA 1O3JA 2FYRA 1O5EH 4NIVA 4B76A 1K1OA 3PTNA 2ZFRH 3KIDU 1H9IE 2UWPA 2STAE 1MTNB 3I29A 3KQCA 4XFQA 1JIRA 1Y3VA 2J92A 1EJMA 2OCVB 4MPUA 1ZMLA 3UWIA 1A46H 3A81A 3A7YA 3SI4H 2O8TA 1C2KA 2G55A 1Y8TA 2JH0D 1GBBA 2Z3CA 2A4GA 1GI0A 1P12E 2FI4E 3ZV8A 1IQHA 4ZKRU 1TMUH 1G32B 3SHCH 5A0AE 2AMPA 1T32A 2BZAA 8LPRA 1GCTB 5EQRA 1E36B 1NT1A 3TPIZ 1L0ZA 5EXLA 4RSPA 2W7SA 4NA7A 2AFQB 3ZZAA 1C1MA 1YPKH 5JBAS 1L4DA 1FQ3A 4CHAB 1TX7A 3M3VA 3E91A 1NRPH 1GHZA 3VB6A 2G4UA 1IQNA 3KF2A 2FYQA 1C5TA 2TBSA 1O0DH 2XC0A 2VIVA 2ZA5A 1EAIA 3GOVB 3U8OH 1K2I1 2BQ7B 1Y3WA 1MKXH 1GBIA 2TGDA 3F9GA 1FI8A 3ZYDA 3LU9B 1P3EA 1QQUA 1BBRH 1LPZB 2GKVE 3LGWA 1IQKA 2PSYA 2GMTC 1VJAU 1SSXA 2GVFA 1G3BA 2GTBA 2BB4A 4MPWA 2VNTA 1RRKA 2J4IA 2Y80A 2QAAA 1TGBA 1CO7E 4NWKA 5E0HA 3BEUA 2AIQA 4WH8A 1DSUA 3Q3XA 1O36A 2ODQA 1OWIA 4MLFB 4XE4A 1MAXA 1V2KT 2BY5X 3A89A 1GBFA 4M7GA 1T8OA 4DT7B 1GI8B 3QTVH 1UCYE 1ZJKA 2C8XB 3TH3H 4ASHA 2XBVA 1NN6A 1Z1IA 3ZZ6A 5FAHA 2XBXA 1ESAA 1C5UA 3M5NA 1GJ7B 1C4U2 1H9LB 2ZHQH 2ZDVH 3U69H 2Y7ZA 4Y10E 1QB6A 8GCHF 4RN6A 3JZ2B 3UQVA 1FXYA 2A2QH 2FMJA 1Y3YA 2ANYA 1TGSZ 4X1NU 1EOLA 1QA0A 1C5OH 1GJDB 3LGTA 1A2CH 1ZSJA 2V3HH 3A7TA 1K22H 2GZ9A 2H5DA 2GDEH 2C93B 4LK4A 1TONA 1SGRE 3UY9A 5GXPA 2R0KA 2BQ6B 3RXRA 2PHBA 4E7NA 5JB9S 4UD9H 4AORA 2Z3EA 4YOGA 1TRNA 5DO4H 1BHXF 2BDIA 2FLRH 3K6ZA 4ISIH 1V2NT 1QHRB 2JETB 4O97A 1W11U 3ZYEA 3RXOA 1W7XH 5C1UA 1TIOA 3OU0A 3DFLA 1OXGA 4QT8C 1MAYA 1EP5A 1KDQB 1SLUB 4FUIA 1GI2A 2G5NA 3SGBE 1OWHA 2F9BH 5E0JA 1DLKB 1NFUA 1KSNA 1O2WA 4ISOA 3U8TH 1N8OB 4D9QA 2A45B 1CSOE 2W5EA 4FUDA 1O5GH 2ZQ2A 1MKXK 3RP2A 1LQEA 2A1DB 1AO5A 1FN6A 1BBRK 1GMCG 2EC9H 1MUEB 2FM2A 1GBJA 4YTAA 1WTHD 5LPFA 4CH2B 1DDJA 1CVWH 1P06A 1XUIA 1ACBE 4KKDA 2Z9LA 1BCUH 1RTLA 4IGDA 4SGBE 5I46H 1MMJN 2BD9A 3UIRA 2BVXH 1H1BA 5A0CA 1ZPCA 3OTJE 3SHAH 3SNBA 2ODYB 1QL7A 4JZEH 2UWLA 1QNJA 3VXFH 4Y71A 3RXBA 4MDSA 2Y5HA 3ZZ7A 2BY8X 3SI3H 4D76A 5DKMA 1S6FA 2WV5A 4JZIA 2RA3A 3LGIA 1P57B 4Z6AH 2F9VA 1PPBH 6CHAC 3I77A 1C2FA 1FY3A 1FY8E 1Z6EA 1UVTH 4X2VA 5ESTE 2WPLS 3SNAA 1C5LH 5DPAA 2AEIH 2BXUH 3U98H 4GCHG 1W13U 1QB9A 2ZPQA 1YPGH 4WMEA 1AGJA 3LGUA 5ESBA 5EU8A 1WOFA 1O2TA 3QZRA 2WYJA 4UFDH 3PB1E 3PLPA 1MTWA 2ANKH 4AFZA 3LJOA 3BIVH 1GJ5H 3T2NA 2ZTYA 1EPTB 1NU9A 3ZVFA 1UTJA 5E8EH 2SGDE 1ANBA 3ZZ4A 2ZCKP 1D9IA 1BTYA 3RM0H 5FX5A 1V2WT 3ATIA 5A8YA 1SGEE 3HATH 3ITIA 1AB9C 1SFQB 3TH2H 1HJAC 3F1SB 3UFAA 3A7WA 2SFAA 4D7GA 1GJBB 1IAUA 2C8YB 3UWJH 1P2MA 1D3PB 1HDTH 2AS9A 3RXTA 1TA6A 3RXJA 2PGBB 4BAMB 3BTWE 3UNQA 1P2OA 2FZZA 1SGIB 3SV9A 1A5HA 2IPHA 3D65E 1HCGA 3BTKE 2V3OH 2EEKA 3DFJA 3A83A 2P95A 4ZUHA 5LPEA 1ETSH 5GCHF 1GJ9B 2ZU2A 3QWCH 4ABDA 1GMDG 2H2ZA 2PW8H 4HFPB 1UK3A 1E37B 2ZTXA 1EJNA 5ABWA 1NROH 1S6HA 5B6OA 4X6PA 4WWYA 5TCAA 5LH8A 1QA7A 5EQQA 3QGNB 3RXUA 2VIDA 1AHTH 1ZGIA 1HGTH 3TK5A 1HAPH 4K69A 1ANEA 1F2SE 4K1EA 1A61H 3MH5A 3FAOA 1SGNE 2P3UB 1GJCB 1QJ7B 3CS7A 2GZ7A 3T5FH 1C1VH 1BOQA 1C1SA 4E06H 1H8DH 1C1QA 1J16A 4AB8A 3O8DA 2Y81A 2FDAA 1Z71A 2CF9H 1GI5A 2K1QA 4MQAA 2QIQA 3RMNH 4YOJA 2H9HA 1WUNH 1ELEE 1EZXC 1F0RA 1V2QT 3NUMA 1P3CA 1XUGA 1O3AA 3PM3A 2DUCA 1C5WB 4ZHAA 1BTXA 2ZGHA 3EQ0H 2Z7FE 1ZR0A 4DW2U 3IWMA 2EI7A 4WXVA 3OX7U 3D23A 4BAKB 5LPRA 2OP9A 3VEQB 2G5VA 1HUTH 3U1JB 1XUFA 1HAYB 2RCEA 3GCOA 1VITH 3K65B 1MU8B 4A5TS 3DHKH 3URDA 2CHAC 4Q80A 1TFXA 4XDEA 3VB5A 2PTCE 3P8OA 1ARBA 3E16B 3RXCA 3C1KA 1JWTA 2VVCA 2WUCA 5JYIA 1OOKB 1GHVH 2WYGA 5DJ7A 2ALVA 2Q6DA 2VGCB 1DITH 2BY9X 1UHBB 5IYTA 2DE9A 3ZVBA 2C90B 2XRCA 4LXBH 4NIWA 1NRSH 1AUTC 3CENA 2KAIA 2TGTA 1ZSKA 3PMAB 2IN2A 1F5KU 3MYWA 1BZXE 3Q3KA 2TGPZ 1MCVA 1EQ9A 3HKIB 4ZKSU 3PYHA 4YT7H 1MZAA 4Q7XA 3SV6A 3SN8A 1HAIH 1GBTA 1S84A 1BDAA 3P92A 3MTYA 4Y6DA 5SGAE 4D8NA 5AFYH 3RXAA 1QJ6B 1MQ5A 3TGJE 1NY22 4JCNA 1E0FD 4BAQB 4YLUA 1K1MA 1SGDE 4NCYA 1B7XB 1A5IA 2A4OA 4Y7BA 3LH1A 4FUHA 4IW4E 2ZP0H 1EPTA 3ESTA 4O9VA 4B74A 1TGCA 4FUJA 2W3IA 2FIRH 4KGAA 2QN5T 1DICA 4Y0ZE 2ZGCA 1ESBA 1LHCH 3V7TA 1CBWC 1ZTJA 3P8FA 1PJPA 3NKKA 4MNYA 4AYYB 1ZOMA 3S9BA 2FEQH 1GBLA 1O3MA 2BDYA 2ZHDA 3MNSA 2ZPRA 3QX5H 1PQ5A 1TPAE 2HWLB 3BTGE 1OWEA 5C3NA 2Z3DA 2QYIA 3OY6U 2AIPA 1CA8B 1QGFA 1LMWB 2BD4A 2A5AA 4BTIB 1FV9A 3A85A 3RLWH 2V6NA 2GX4A 4U32A 4CRGA 1INCA 1GG6B 4WXIA 1P2JA 3AW0A 1YLCA 1DWCH 5EQSA 1C2EA 2ZEBA 4H42U 3LKWA 4H6TA 1HBTH 3RXDA 4NZQA 3L33A 1G9IE 3T25A 3VPKA 3T26A 2PGQB 3M5OA 1NPMA 1O33A 2AGEX 2ZF0H 1QJ1B 3V12A 1XVMA 3MNCA 4F49A 4O3TA 1DLEA 1KLTA 2BD8A 1Y59T 1A0JA 2ANMH 2A32A 2ZU1A 4ZKNU 4Z0KA 1IQMA 1A7SA 8ESTE 2HALA 5C1XA 1V2OT 4K8BA 3LC5A 2ZKSA 1RD3B 3FZZA 1NM6A 1ZRBA 5T3HA 4Y7AA 3MNXA 4NFEA 1NTPA 1MTNC 1MD8A 5T6FA 1AVXA 2BY7X 4NSVA 3P8GA 1CHGA 1QFKH 1KLJH 1WQSA 4B2BA 2BVRH 4J2YB 3EYDA 1SGCA 1FDPA 1QBNA 1D3TB 1C1WH 3RM2H 4I8HA 1GBAA 3ZZ5A 5DP5A 1ELFA 1A3BH 1LVYA 1HIAB 2Q6GA 4AOQA 1YPEH 4K1SA 1EJAA 1GCTC 2BDHA 1SGFG 2WINI 3U9AH 4DIHH 1SGFA 2XYAA 1C2HA 1YKTA 3M3TA 4D9RA 2ILNA 3S7KB 2FTMA 3PLKA 2B8OH 3E1XB 4Y8ZA 4CHAC 3RXIA 3RU4D 3UNSA 4ABGA 5I25A 1C1UH 3M7UA 2FX6A 7KMEH 3SORA 1BT7A 3STJA 1G3EA 1SQAA 2CGAA 1O2SA 1BTUA 2XBYA 4X6OA 4UFGH 1C1NA 1QTFA 1K1IA 2V35A 3GY2A 3SJKA 4AFSA 1G30B 1O3LA 2H5CA 4ZXXH 1LO6A 1B0EA 1TA2A 1RXPA 2FOHA 1K28D 1E34B 1X7AC 1SQTA 4OGXA 2R3YA 2FOCA 2C3SA 2HNTC 1TNIA 3E0NB 2XTTB 3TJUA 1Y3UA 1TNGA 3PMJA 3Q77A 4RKOB 1KXBA 5GPIB 4ZAEA 2GCTB 3A80A 3CS0A 3BV9B 2A7HA 2FOMB 2FXRA 5C5OA 2XCFA 1EX3A 1GI1A 3EA8A 2ZQ1A 3GY6A 1EOJA 1SGYE 1O2OA 4DURA 2PUQH 4AFQA 5ETXA 1YBWA 2IJOB 4X2XA 3LOXA 1WTGH 1GHAG 4INHA 4KP0A 1PPHE 3GDSA 3GCHB 5EW2H 2C8WB 1B0FA 2TIOA 1C5NH 2XWAA 2CXVA 1T8NA 2WPKS 1CGHA 2AH4X 1UJ1A 2PLXA 4GHTA 4HTCH 8KME2 1O39A 5L6NH 1AD8H 1W0ZU 1GGDB 4DJZB 3B9FH 1TGNA 2UUYA 3ZZ9A 4XOJA 4A6LA 3UPEA 4JMYA 1L2EA 1UCYH 1TAWA 4CRAA 1PPEE 3R0FA 4B75A 1FNIA 2JETC 4BXSA 3A86A 1LKBA 3LC3A 4B71A 2HPPH 2Y6TA 2ZGJA 2RA0A 1A0HB 2B9LA 2ZFSA 2BQWB 3N7OA 1K1LA 2B7DH 1RFNA 2W26A 3SUDA 1KYNA 2ZCHP 2P3FH 3SW2B 1V6DA 2ZHFH 1QB1A 1N8OC 2ZC9H 4IC5A 1HAVB 2HGTH 2QXJA 1LVBA 4JZ1A 2OD3B 3RXVA 4U2WA 1C5SA 5EPNA 4F4OC 3RXMA 3M36A 5HXFA 3ZZ3A 3TJVA 2XNIA 3CP7A 3V13A 2XC4A 1NS3A 2F91A 1YCPM 2CN0H 4AG2A 2HPQH 2ZWLH 1RJXB 3LH3A 4O03A 4NIYA 2QF0A 1XKBC 1UVUH 1Z8RA 1F0UA 1PPGE 2AYWA 2BM2A 1ANDA 1C1PA 1K1JA 1SBWA 3NPSA 4K8YA 2PUXB 4BTTB 2FX4A 3SQEE 1GPZA 1SLXB 3EE0B 3A84A 2I6SA 7GCHG 1SVPA 1EUFA 1FLEE 1UK2A 1AKSB 1ELBA 2O8MA 1T4VH 2QGRA 4MPVA 5H4IB 5A09A 4WJG2 1SR5C 3KN2A 2VVUA 1TE0A 3GISB 1HAHH 2VH0A 1P10A 2PV9B 1ZYOA 1PQ7A 1P03A 4YESB 5AF9H 2P16A 3MH4A 3SU3A 1NFWA 1ELVA 2F83A 2O8UA 3A88A 1UTOA 1ELGA 4FUCA 1WV7H 2G4TA 1LTOA 1S0RA 3M61U 4X1SU 3BTDE 2LPRA 4ZROA 2FOFA 4X8SH 1EPTC 2OC7A 4I7YH 4KTUA 4B1TA 1LQDB 1AY6H 2BMGB 1UCYK 1ZMNA 1TWXB 4ISLA 1CT0E 1O3DA 3MNBA 3TITA 5HM2A 2FOAA 5EOKA 1W8BH 2HNTE 3SJIA 1O34A 1TALA 2C4FH 4E7RG 6LPRA 2NU0E 1QR3E 1RTKA 1BTZA 1SOTA 2FWWA 1BB0B 1THRH 5F8ZA 3T27A 3LGYA 4JK6A 1O2HA 1TMBH 2ULLA 1P04A 1TBRH 1VJ9U 1EKBB 3LPRA 1FAXA 1CHOG 1NESE 2G81E 2ALPA 1W3CA 1C2LA 1F92A 3P70B 3BG4B 1OS8A 1ZGVA 5JDUB 1SQOA 2D2DA 2VINA 3TK6A 1SLVB 1KY9A 4YLQH 2A7JA 3MH6A 1GBDA 4YM9A 1JBUH 2QV1A 1TPPA 1BRUP 5C1YA 1O37A 1C2DA 1V2MT 1WU1A 2BVSH 3F68H 1SB1H 1AFEH 1K1NA
chains in the Genus database with same CATH superfamily
1ZLRA 3Q3YA 4X8UH 4NZLA 4Y0YE 1O5AB 2ZIQH 3ZVEA 1G2MA 1JMOH 1KXDA 5E2PA 4GHQA 3A7ZA 4X1PU 3ZZBA 2J2UA 4ISNA 4AX9H 1BTPA 1DFPA 5F8XA 1AVWA 3MOCA 4E05H 3MMGA 1ELCA 1G36A 3U8RH 1UTNA 2A31A 1QZ8A 2CJIA 2PSXA 3F9EA 2G8TA 3NCLA 5AHGH 3VGCB 4FUGA 2F9PA 5A8XA 1GMCF 1VGCB 3GY7A 5GJ4B 1J9CH 5DP7A 2EA3A 5HYOA 5C17A 2CF8H 4FXGH 2YNBA 4WVPE 1SQRA 3GCTG 2VIPA 4XBCA 1AFQB 3PTBA 3GDUA 1YP9A 4X2WA 1O2VA 1TYNA 3A82A 1CHOF 1O2LA 4Q63A 5DP4A 3SU0A 4BAHB 1MU6B 1KLIH 3KNXA 4Y11E 1O5FH 4LOYH 3KQBA 2ZGBH 3H5CB 1W0YH 1TB6H 4A92A 2JKHA 5EGMA 1C5ZB 1BQYA 3PV2A 3AW1A 5DP8A 4ZXYH 1P8VC 3H7OA 2XBWA 3OYPA 4UEHH 1H8HD 1P0SH 4MG3A 5EXNA 1NRRH 4YOIA 3IITA 1K21H 4FVDA 2HLDD 3Q00A 1EZUC 3N99A 3SU4A 1MH0A 1P2KA 1FY1A 1WBGB 2BDBA 2GCHG 2Z9IA 3Q76A 3QGJA 4GCHF 1UTLM 3E3TA 1HFDA 2QF5A 1WAYB 3FVFB 2AMQA 3GYMA 3GDVA 1NRNH 4MNXA 1N6YA 1SFIA 3SUEA 4DGJA 5E2OA 2FO9A 3KEEA 2PKSB 1LHFH 3F3BA 2KM0A 2VGCC 3HK3B 1C5PA 1TPOA 1GBCA 1GJ8B 1LKAA 3DSGA 2ZFTA 2GZ8A 3F6UH 1EXFA 2PFEA 3P8NA 1S81A 2CK3D 5JBTA 4KTCA 1FIWA 3SU2A 1FPHH 2BOKA 3EAJA 1D3QB 3GCNA 5DP3A 1DM4B 2YNAA 4DT4A 2TGAA 1KDQA 2Y5FA 1DUAA 1NZQH 3K6YA 3MO9A 7LPRA 3M7QA 2ZDLA 1BIOA 5DG6A 1YYY1 1CT4E 1U6QA 1W12U 1DT2A 3RU4E 1RS0A 1VCWA 1L1NA 3RUOA 2B0FA 3KL6A 1AVGH 3GCTF 2HNTF 2G51A 1BMMH 1CGIE 3D62A 1Q2WA 3ZVAA 4ZHMU 3SOSA 4P00A 1FY5A 1N1LA 3A7XA 1AU8A 1O2IA 1T4UH 3SUGA 2J98B 5CHAB 4NSYA 4BTUB 4YZUA 2HRVA 1AMHA 3E90B 1ELDE 1H4WA 1DE7H 1HAZB 1T8LA 2NU2E 3MFJA 3LJJA 3RLYH 1GMDF 1ELTA 1GJ6A 1D6WA 1ZPZA 1JIMA 4CREA 2D26C 5GDSH 4TWYA 2PR3A 1Y5UT 5A2MH 1C2GA 1DY9A 4GPGA 4A1VA 4FU8A 1YPMH 1COWD 3SJOA 1RIWB 3PO1B 5C5NA 4FVBA 2R0LA 3W95A 3TNSA 2OLGA 5K0HA 3EA7A 1C9TA 4OS1A 4UE7H 1O2YA 3ATKA 1PPZA 1RTFB 2BZ6H 3QK1A 1GG6C 1KXAA 2O9QA 1V2ST 1AZZA 4U01A 1HAXB 2QF4A 2XW9A 2QXHA 1O3IA 1Z8IB 2A7CA 2SGPE 3MU5A 5EJZA 2ZDMA 3QDZB 3SNEA 3M3SA 5T1VA 2D8WA 3WY8A 3HGPA 1SGTA 2ZGXH 1V2VT 1HJ9A 2ANWA 1GI9B 4NA9H 5DP6A 4ACAA 1V2UT 2FI3E 1UVOA 3BTEE 2NU1E 5HMAA 4DIIH 2PTNA 4JYTA 3FP6E 1XXDA 3TK9A 2A4QA 4D7FA 5FPSA 5DP9A 3BF6H 2A5IA 4CRFA 1ZHRA 4CRCA 3BTTE 3L6PA 3RMOH 4TYDA 3W94A 3KGPA 1T7CA 4OS7A 3UOUA 4IMQA 1C5XB 3FP7E 3U1IB 1HYLA 1CA0B 3O8BA 4NG9H 2LELA 3DSPA 2BX3A 3TVJB 5HGGA 1XMNB 1EZSC 1W10U 2NU3E 2ZFPH 1C1TA 1GI7B 3RC5A 3T62A 1BRAA 1PPFE 3BTFE 4K2YA 1AI8H 1QBVH 3LONA 3ATWA 3S9CA 3A8DA 5GIBA 3GYLB 3BN9A 2FODA 4ABFA 1J17T 1AE5A 1LDTT 1C2IA 2Z9KA 1UMAH 4AGKA 1S82A 3UB0A 2BD3A 5DGJA 4XBDA 1N6XA 4CRDA 2B5TB 4OS6A 1YCPH 1SKYE 3ENSB 1ABJH 4X2YA 3ODDA 1BHXB 2R2WU 2ZCLP 3QO6A 1BRCE 2OC8A 1WYKA 1O30A 7ESTE 1TOCB 5C0TA 2Z94A 1IQIA 1O2JA 4MNWA 1IQGA 1CT2E 1UTKA 4K5ZA 1XX9A 1JRSA 2FPZA 5C2ZA 1FMGA 1L1JA 1VITG 5T6DA 1GHWH 2C8ZB 1TNJA 4ESTE 3RXLA 3QLPH 2P8OB 3SJ8A 4GUXA 1MBQA 4VGCB 1NBME 1DWEH 1DWDH 4X1QU 2GJGA 2AGGX 5C20A 1YGCH 1UTQA 1GMHG 3VB4A 1O3GA 2SNVA 3SV2H 2GCTC 2RFKC 3ODFA 5KGOA 1BTHH 3PMHB 2VU8E 1BJUA 1YLDA 2QXIA 4NGAH 2OUAA 3RXHA 3SU1A 1LVMA 1XUJA 3KYGA 1UVPA 1TBZH 2RDEA 3GY5A 2J98A 1BUIA 4INKA 3GCHC 4TPYA 3TLOA 4AB9A 2G52A 3MU8A 1GDNA 1EAWA 5EIYA 1DVAH 1BJVA 1SHHB 2BXTH 4CBOA 2WPJS 5BRRE 4H6SB 1LPGB 1W7GH 2J5UA 2VIWA 1WCZA 3TJOA 1Y5AT 1LCYA 4GVUA 3ZZCA 2Y82A 3M5LA 1J8AA 1DX5M 1GGDC 1K1PA 2ZPSA 4ISHH 1ESTA 1O5CB 1XUHA 2GV7A 3ZVDA 5A0BA 1W2KH 1VR1H 2J34A 3AASA 5IDKA 1SGPE 1YPJH 2VBCA 1FIZA 1UHBA 1Y3XA 1O35A 2WHXA 2PKAB 2OXSA 3ZVGA 3RDZA 1GI6A 1OYQA 3U28C 2J95A 1EB2A 1GDQA 1UO6A 1YCPK 1OKXA 1BRBE 1A1RA 2STBE 2F9UA 3A8AA 5AVDA 3VFEA 4B2AA 3RXQA 1CE5A 1YPHC 2OBOA 2H9EH 1UVSH 2VH6A 1EB1H 1EATA 1GMHF 1HRTH 4AGJA 5CE1A 3HGNA 1SGQE 3OAAD 1O3KA 3NK8A 3BEFB 1E35B 2OQUA 2A4RA 4GLYA 1ZTLA 2FOGA 2AMDA 4BNRA 2BD7A 1O3EA 1HB0B 3VB7A 3LDXH 5L30H 1RGQA 4OGYA 2BDGA 2BTCE 1ARCA 1T8MA 6ESTA 2O8WA 2ZU4A 3RXPA 1ZHPA 3LIWA 2Z9GA 1GWAA 5FX6A 4IBLH 1QBOA 2F4LA 2K0QA 3PWBA 1MCTA 3SV7A 5J4QA 2OTVA 3AVZA 1TX8A 1HXEH 1Z8JB 3TNTA 1P2QA 1WQVH 2ZG0H 2WPHS 2SNWA 1KXCA 1OSSA 4XSKU 3UR6A 1HNEE 8GCHG 1G3DA 5GWZA 1DPOA 4AZ2B 1O3BA 2J94A 2ZU5A 3RMMH 1BMAA 1M9UA 1L1GA 2ZU3A 1GHYH 2R9PA 2ASUB 1IQFA 4IN1A 3RU4T 2WUBA 1S83A 1DY8A 3P6ZB 3T29A 1W14U 2Q6FA 3OSYA 1XM1A 1PPCE 2R3UA 3RXKA 1ZZZA 2UWOA 4Q2KA 4RT0A 4BAOB 5L2YH 4GAWA 3STIA 3H09A 3GY4A 4LZ1H 2ZFFH 5A8ZA 3RXEA 6GCHG 9ESTA 3KQEA 3OTPA 1XKAC 1MKWH 1O2KA 1QQ4A 4I33A 3O8CA 2JJ2D 3A87A 2UUKB 2I6QA 1NO9H 3DT0H 1TRYA 4Y8YA 1BA8B 2PP6A 1AQ7A 1TLDA 4FU9A 1G2LA 3SBKA 1KTTB 3TIUA 1OWJA 3QUMP 3SU5A 1P2IA 1AWFH 2FI5E 1FY4A 4UFFH 5EJLA 5C67A 3ATMA 1V2LT 4JYUH 1GHAF 4HZHA 2QF3A 2OC1A 1BBRE 1OWDA 1Q3XA 3PV5A 3WWBA 5EG4A 3DUXH 2RDLA 5TCCA 3QZQA 4OS2A 2F9OA 4ZCNA 1OP8A 3BG4C 1P9UA 2VIOA 1Q31A 3VXEH 1OX1A 1O38A 1V3XA 2ZHEH 3VG8A 2SGQE 1O2ZA 4ABHA 3RMLH 1A3EH 1PQAA 3MU0A 3GS9A 1HIAA 1V2JT 1TPSA 1H8ED 3DSOA 1QRWA 2UUFB 1L4ZA 3PMBB 1K9OE 2UUJB 4K3JA 3M35A 3PRDA 4DG4A 1MZDA 4I8LA 3F9FA 4INLA 1Z1JA 3R3GB 4ZH8A 1NU7B 2OQ5A 4WY3A 5PTPA 1BMNH 1F5LA 2GT7A 1AN1E 1IQEA 2OBQA 1AZ8A 3AAVA 4RKJB 1B5GH 6GCHF 3S69A 2GMTB 1EZQA 3SGAE 1OP2A 1C1RA 5FL7D 4Q7YA 1S5SA 1TOMH 1Z8GA 1THSH 2F43B 3VGCC 5JB8S 4AN7A 1SI5H 4I8KA 1O3PB 3KCGH 4PROA 4B6FA 2PKAA 1VGCC 4ABAA 2TRMA 3A8BA 1PYTD 4NWLA 1LHGH 1E79D 1YPHE 4TPIZ 1GVKB 3RXFA 1C5YB 5L2ZH 1ID5H 4WF8A 4WH6A 1LHEH 3SU6A 3DD2H 5C0UA 1O5BB 1V2TT 5F6MA 1AFQC 1MKWK 1NFYA 1XXFA 2FTLE 4I8GA 2LNCA 1QL9A 1JOUB 1J14A 1SC8U 5FPTA 4AYVB 2WZQA 1GI3A 4MPXA 1YLNA 1EP6A 4RI0A 1O3OA 3FOAA 2ZTZA 7GCHF 1GI4A 1ORFA 1QCPA 4X6NA 2BD2A 3BTME 1O31A 1BMLA 2VIQA 1C5VA 3PROA 1ZJDA 2EI8A 2LP6A 3SGQE 4AG1A 3RXGA 4FU7A 4X6MA 5EODA 3ATLA 5DK1A 5GCHG 1TX6A 1FAKH 1KTSB 3SYJA 2NWNA 2OC0A 2TPIZ 1GL1A 3MWIU 1P01A 3SJ9A 2KAIB 1PQ8A 1MBMA 2P93A 1PFXC 2PKSC 3O8RA 3UTUH 2BDAA 1IQLA 4OS4A 1FUJA 2W6JD 4Y79A 1OPHB 1E38B 1NFXA 1FPCH 2FS9A 3BTQE 1F0SA 4IN2A 3HK6B 3BTHE 1C2JA 1H8IH 1D3DB 3UNRA 3MU1A 1GVZA 4UFEH 1MTSA 2FOEA 2AERH 5G4BA 1C4V2 2F3CE 1MTUA 1TMTH 3KHVA 5FHTA 1AUJA 3MI4A 2PWXA 1VCPA 3RC4A 5FBEA 3ZVCA 2BX4A 3K9XB 5HM9A 1LPKB 2JJ1D 4IMZA 2W7UA 3S0NA 3C27B 4K60A 1D6RA 2Y7XA 3E6PH 4I32A 4M9FA 4DVAU 3UOPA 1QIXB 1Y5BT 1SHYA 4THNH 1SL3A 5EPYA 5EXMA 1HAVA 3F9HA 4X0WU 1CQQA 4MVNA 1GHBG 1TABE 1HJ8A 1LHDH 2GV6A 4SGAE 1OYTH 4ZKOU 5CHAC 5EJ1A 1EASA 2ZI2H 3URCA 3DA9B 4B73A 1F7ZA 2KZ4A 1C2MA 1GJ4H 1EAXA 3EDXB 2J9NA 2ZZUH 4CR5A 3I78A 4Q7ZA 1T31A 1CU1A 1GDUA 1S85A 1AIXH 2BLOA 4HI3A 1THPB 4CH8B 1FJSA 1ZRKA 3E8LA 1RIWC 2JH5D 3PO1C 4UDWH 1TNLA 1A4WH 2W3KA 3UQOA 6CHAB 3FP8E 3ZZ8A 2Q1JA 1QRXA 4LZ4B 4NFFA 5BPEA 1AKSA 2ODPA 3B23B 1GCDA 1A5GH 1MTVA 1QRZA 1OP0A 5TJXA 4ABIA 3GY8A 3P17H 3VB3A 2H9TH 2VWNA 1JXPA 3KQDA 1DS2E 1AE8H 2P94A 3TJNA 5FPYA 4DOQA 3GY3A 2ESTE 1KXEA 4X1RU 3F2GA 2A2XH 2A5KA 4A1XA 3NWUA 1TGTA 1SMFE 3NRLA 4JZDH 1Z6JH 5E0GA 3FZDA 3TGKE 3SZNA 1C5RA 4NA8A 3RC6A 3S9AA 1C9PA 1V2RT 1AB9B 1HPGA 1XVOA 1ZTKA 5J4SA 1O3FA 2YMSB 1O3NA 1HJAB 1DSTA 1O2UA 4XBBA 3WW7A 5FBIA 1GHBF 2ZFQH 1ZPBA 4P02A 4FUFA 1SOZA 4FUBA 2P59A 1O32A 1CA0C 1OHHD 2DE8A 2VVVA 2WPIS 3SUFA 5F03A 5CDFE 1Z7KA 3NZIA 2JIZD 1UTMA 1HXFH 4ABEA 2NU4E 2XXLA 1O2RA 1FN8A 1PYTC 1P02A 2GDDA 3M7TA 1BITA 2OINA 1MQ6A 2VJ1A 1W0JD 1P05A 1TBQH 2GCHF 2QY0B 5F8TA 1KIGH 5LGOA 4ABJA 2SGFE 4R8TB 1F5RA 1HAGE 1IHSH 1H9HE 2XWBI 4Y76A 3T28A 4KELA 2O8LA 4HGCA 1YC0A 3K2UA 3B8JA 3N7EA 2ZNKH 4CRBA 1G3CA 3EA9A 5FCKA 2HVYB 3IG6B 3SO3A 2SGAA 5JBBS 3E0PB 1QL8A 1TQ0B 1VZQH 1WSSH 1FZZA 1P09A 1SG8B 2BY6X 2VWMA 4B2CA 1NRQH 4CBNA 5IK2D 4IS5A 4TWWA 3MH7A 1C4Y2 3MO6A 2M5TA 2YOLA 4I8JA 1GBEA 1S0QA 9LPRA 5F53A 1DWBH 2ZHWH 1AWHB 3QN7A 4DY7B 3V0XA 3HPTB 2P8OC 3M5MA 1GHXH 2FLBH 2HLCA 2D1JA 3G01A 1DUEA 3TGIE 1IQJA 4VGCC 1QY6A 5AFZH 4BANB 1IOEA 3OEED 3SNDA 1ZMJA 1O3HA 2WPDD 1JRTA 3UAIC 2GD4B 4TY7A 4FUEA 3HKJB 2QXGA 3FANA 3PLBA 2GP9B 1DANH 3A7VA 3SQHE 1UTPA 1TQ7B 4BOHA 3UUZA 4GSOA 1GBMA 2VB0A 3MQKC 5EW1H 1O2NA 1ETTH 3OY5U 3P95A 2CHAB 4BXWA 5K7RA 3SNCA 1TRMA 3D49H 4OS5A 4I31A 4J1YA 1YM0A 3ZIAD 1SPJA 2VWLA 3V3MA 2IOTA 1ZHMA 1GJAB 3LGVA 1GBHA 2BYAX 2V0BA 3TU7H 4UONA 4JZFH 1QURH 2P3TB 3BSQA 2SGEE 1VCQA 3ELAH 2CMYA 1ABIH 1C5QA 1O2GH 3BIUH 3A8CA 2BD5A 3FFGA 2QC2A 2F9NA 4TY6A 1J15A 3MO3A 2QA9E 4O3UA 1GL0E 1GVLA 2FESH 2Z9JA 1DXWA 1YPLH 2BOHB 2WPMS 4ZHLU 1FONA 2BLVA 2GT8A 2BLQA 1P9SA 3AAUA 2ZO3H 1ETRH 1F0TA 2FS8A 5JPMH 2THFB 5CMXH 4X8TH 1DOJA 4WMFA 1CGJE 4MTBA 4CR9A 3M37A 2XCNA 4A1TA 1LVOA 2QCYA 2JH6D 4Y8XA 4U30A 1HAOH 2GGVB 1V2PT 4AFUA 1ANCA 1KXFA 3ZZDA 1HLTH 1IHTH 2HOBA 4JK5A 4K1TA 2FP7B 2HVXA 3EGKH 1BTWA 1NC6A 1O2QA 2J38A 1CBWB 4ABBA 1YF4A 4H4FA 3LT3A 1ELAA 2A0QB 2AGIX 3JZ1B 3BG8A 2XC5A 1O2PA 1P11E 3GICB 2ZDNA 3BEIB 3S7HB 1TNKA 3PWCA 4WMDA 2H1UA 5JBCS 3MU4A 4YO9A 4NIXA 2ZDKA 1C1OA 1O2XA 2Y5GA 1O5DH 3SV8A 4JYVH 1GBKA 3H7TA 4R0IA 3MHWU 4MNVA 5FCRA 4KTSA 3TH4H 2ZDAH 2BHGA 2G00A 4X8VH 1TNHA 5KECA 1O3CA 1UK4A 1D4PB 2R2MB 2RG3A 2KCAA 1G37A 4ZMAH 4YT6H 1EAUA 3RXSA 2BLWA 1MD7A 2ZECA 3UREA 2BDCA 1XUKA 3L3TA 1DXPA 2H6MA 1VITF 2WV4A 2CV3A 3OFND 1A0LA 1P2NA 5T6GA 3QTOH 4A7IB 1O2MA 3PV4A 3NXPA 2EI6A 1OWKA 1MABB 2FOBA 1C5MD 2VWOA 1ZSLA 5FXLA 3F0PA 4IC6A 1HV7A 2Z6BD 3UR9A 1SLWB 3ZV9A 4DCDA 1O3JA 2FYRA 1O5EH 4NIVA 4Q4LA 4B76A 1K1OA 3WWFA 3PTNA 2ZFRH 3KIDU 1H9IE 2UWPA 2STAE 1MTNB 3I29A 3KQCA 4XFQA 1JIRA 1Y3VA 2J92A 1EJMA 2OCVB 4MPUA 1ZMLA 3UWIA 1A46H 3A81A 3A7YA 3SI4H 2KCYA 2O8TA 1C2KA 2G55A 1Y8TA 2JH0D 1GBBA 2Z3CA 2A4GA 1GI0A 1P12E 2FI4E 3ZV8A 1IQHA 4ZKRU 1TMUH 1G32B 3SHCH 5A0AE 2AMPA 1T32A 2BZAA 8LPRA 1GCTB 5EQRA 1E36B 1NT1A 3TPIZ 1L0ZA 5EXLA 4RSPA 2W7SA 4NA7A 2AFQB 3ZZAA 1C1MA 1YPKH 5JBAS 1L4DA 1FQ3A 4CHAB 1TX7A 3M3VA 3E91A 4F55A 1NRPH 1GHZA 3VB6A 2G4UA 1IQNA 3KF2A 2FYQA 1C5TA 2TBSA 1O0DH 2XC0A 5KEDA 2VIVA 2ZA5A 1EAIA 3GOVB 3U8OH 1K2I1 2BQ7B 1Y3WA 1MKXH 1GBIA 2TGDA 3F9GA 1FI8A 3ZYDA 3LU9B 1WXRA 2YMSD 1P3EA 1QQUA 1BBRH 1LPZB 2GKVE 2KX4A 3LGWA 1IQKA 2PSYA 2GMTC 1VJAU 1SSXA 2GVFA 1G3BA 2GTBA 2BB4A 4MPWA 2VNTA 1RRKA 2J4IA 2Y80A 2QAAA 1TGBA 1CO7E 4NWKA 5E0HA 3BEUA 2AIQA 4WH8A 1DSUA 3Q3XA 2L6OA 1O36A 2ODQA 2KCPA 2W6ID 1OWIA 3SZEA 4MLFB 4XE4A 1MAXA 1V2KT 2BY5X 3A89A 1GBFA 4M7GA 1T8OA 4DT7B 1GI8B 3QTVH 1UCYE 1ZJKA 2C8XB 3OEHD 2OK5A 3TH3H 4ASHA 2XBVA 1NN6A 3FO8D 1Z1IA 3ZZ6A 5FAHA 2XBXA 1ESAA 1C5UA 3M5NA 1GJ7B 1C4U2 1H9LB 2ZHQH 2ZDVH 3U69H 2Y7ZA 4Y10E 1QB6A 8GCHF 4RN6A 3JZ2B 3UQVA 1FXYA 2A2QH 2FMJA 1Y3YA 2ANYA 1TGSZ 4X1NU 1EOLA 1QA0A 1C5OH 1GJDB 3LGTA 1A2CH 1ZSJA 2V3HH 3A7TA 1K22H 2GZ9A 2H5DA 3W1EA 2GDEH 2C93B 4LK4A 1TONA 1SGRE 3UY9A 5GXPA 2R0KA 2BQ6B 3RXRA 2PHBA 4E7NA 5JB9S 4UD9H 4AORA 2Z3EA 4YOGA 1TRNA 3KYFA 5DO4H 1BHXF 2BDIA 2FLRH 3K6ZA 4ISIH 1V2NT 1QHRB 2JETB 4O97A 1W11U 3ZYEA 3RXOA 1W7XH 5C1UA 1TIOA 3OU0A 3DFLA 1OXGA 1W0KD 4QT8C 3F0OA 1MAYA 1EP5A 1KDQB 1SLUB 4FUIA 1GI2A 2G5NA 3SGBE 1OWHA 2F9BH 5E0JA 1DLKB 1NFUA 2KFWA 1KSNA 1O2WA 4ISOA 3U8TH 1N8OB 4D9QA 2A45B 1CSOE 2W5EA 2XNDD 4FUDA 2V7QD 1O5GH 2ZQ2A 1MKXK 3RP2A 3FN8A 1LQEA 2A1DB 1AO5A 1FN6A 1BBRK 1GMCG 2EC9H 1MUEB 2FM2A 4FOUC 1GBJA 4YTAA 1WTHD 5LPFA 4CH2B 1DDJA 1CVWH 1P06A 1XUIA 1ACBE 4KKDA 2Z9LA 1BCUH 1RTLA 4IGDA 4SGBE 5I46H 1MMJN 2BD9A 3UIRA 2BVXH 1H1BA 5A0CA 1ZPCA 3OTJE 3SHAH 3SNBA 2ODYB 1QL7A 4JZEH 2UWLA 1QNJA 3VXFH 4Y71A 3RXBA 4MDSA 2Y5HA 3ZZ7A 2BY8X 3SI3H 4D76A 5DKMA 1S6FA 2WV5A 4JZIA 2RA3A 3LGIA 1P57B 4Z6AH 2F9VA 1PPBH 6CHAC 3I77A 1C2FA 5HIYA 1FY3A 1FY8E 1Z6EA 1UVTH 4X2VA 5ESTE 2WPLS 3SNAA 1C5LH 5DPAA 2AEIH 2BXUH 3U98H 4GCHG 1W13U 1QB9A 2ZPQA 1YPGH 4WMEA 1AGJA 3LGUA 5ESBA 5EU8A 1WOFA 1O2TA 3QZRA 2WYJA 4UFDH 1E1QD 3PB1E 3PLPA 1MTWA 2ANKH 4AFZA 3LJOA 3BIVH 1GJ5H 3T2NA 2ZTYA 1EPTB 1NU9A 3ZVFA 1UTJA 5E8EH 2SGDE 1ANBA 3ZZ4A 2ZCKP 1D9IA 1BTYA 3RM0H 4I86A 5FX5A 1V2WT 3ATIA 5A8YA 1SGEE 3HATH 3ITIA 1AB9C 1SFQB 3TH2H 2YMSC 1HJAC 3F1SB 3UFAA 3A7WA 2SFAA 4D7GA 1GJBB 1IAUA 2C8YB 3UWJH 1P2MA 3F2FA 1D3PB 1HDTH 2AS9A 3RXTA 1TA6A 3RXJA 2PGBB 4BAMB 3BTWE 3UNQA 1P2OA 4Z1MD 2FZZA 1SGIB 3SV9A 1A5HA 2IPHA 3D65E 1HCGA 3BTKE 2V3OH 2EEKA 3DFJA 3A83A 2P95A 4ZUHA 5LPEA 1ETSH 5GCHF 1GJ9B 2ZU2A 3QWCH 4ABDA 1GMDG 2H2ZA 2PW8H 4HFPB 3CNRA 1UK3A 2KR7A 1E37B 2ZTXA 5CHBA 1EJNA 5ABWA 1NROH 1S6HA 5B6OA 4X6PA 4WWYA 5TCAA 5LH8A 3EE7A 1QA7A 5EQQA 3QGNB 3RXUA 2VIDA 1YWUA 1AHTH 1ZGIA 1HGTH 3TK5A 1HAPH 4K69A 1ANEA 1F2SE 4K1EA 1A61H 3MH5A 3FAOA 1SGNE 2P3UB 1GJCB 1QJ7B 1VKYA 3CS7A 4B6EA 2GZ7A 3T5FH 1C1VH 1BOQA 1C1SA 4E06H 1H8DH 1C1QA 1J16A 4AB8A 3O8DA 2Y81A 1E1RD 2IJD1 2FDAA 1Z71A 1GI5A 2K1QA 2CF9H 4MQAA 2QIQA 3RMNH 4YOJA 2H9HA 1WUNH 1ELEE 1EZXC 1F0RA 1V2QT 3NUMA 1P3CA 1XUGA 1O3AA 3PM3A 2DUCA 1C5WB 4ZHAA 1BTXA 2ZGHA 3EQ0H 2Z7FE 1ZR0A 4DW2U 3IWMA 2EI7A 4WXVA 3OX7U 3DCLA 3D23A 4BAKB 5LPRA 2OP9A 3VEQB 2G5VA 1HUTH 3U1JB 1XUFA 1HAYB 2RCEA 3GCOA 1VITH 3K65B 1MU8B 2EQNA 4A5TS 3DHKH 3URDA 2CHAC 2JDID 4Q80A 1TFXA 4XDEA 3VB5A 2PTCE 3P8OA 1ARBA 3KQ5A 3E16B 3RXCA 3C1KA 1JWTA 2VVCA 2WUCA 5JYIA 1OOKB 1GHVH 2WYGA 5DJ7A 2ALVA 2Q6DA 2VGCB 1DITH 2BY9X 1UHBB 5IYTA 2DE9A 3ZVBA 2C90B 2XRCA 4LXBH 2K8IA 4NIWA 4XD7D 1NRSH 1AUTC 3CENA 2KAIA 4XRNA 2TGTA 1ZSKA 3PMAB 2IN2A 1F5KU 3MYWA 1BZXE 3Q3KA 2TGPZ 1MCVA 1EQ9A 3HKIB 4ZKSU 3PYHA 4YT7H 1MZAA 4Q7XA 3SV6A 3AK5A 3SN8A 1HAIH 1GBTA 1S84A 1BDAA 3P92A 3MTYA 4Y6DA 5SGAE 4D8NA 5AFYH 3RXAA 1QJ6B 1MQ5A 3TGJE 1NY22 4JCNA 1E0FD 4BAQB 4YLUA 1K1MA 1SGDE 4NCYA 1B7XB 1A5IA 2A4OA 4Y7BA 3LH1A 4FUHA 4IW4E 2ZP0H 1EPTA 1WDIA 3ESTA 4O9VA 4B74A 1TGCA 4FUJA 4YXWD 2W3IA 2FIRH 3N7DA 4KGAA 2QN5T 1DICA 4Y0ZE 2ZGCA 1ESBA 1LHCH 3V7TA 1CBWC 1ZTJA 3P8FA 1PJPA 3NKKA 4MNYA 4AYYB 1ZOMA 3S9BA 2FEQH 1GBLA 1O3MA 2BDYA 2ZHDA 3MNSA 2ZPRA 3QX5H 4FETA 4RT1A 1PQ5A 1TPAE 2HWLB 3BTGE 2QE7D 1OWEA 5C3NA 1UW7A 2Z3DA 2QYIA 3OY6U 2AIPA 1CA8B 1QGFA 1LMWB 2BD4A 2A5AA 4BTIB 1FV9A 3A85A 3RLWH 2V6NA 2GX4A 2J97A 4U32A 2AHME 4CRGA 1INCA 1GG6B 4WXIA 1P2JA 3AW0A 1YLCA 1DWCH 5EQSA 1C2EA 2ZEBA 4H42U 3LKWA 4H6TA 1HBTH 3RXDA 2EY4C 4NZQA 3L33A 1G9IE 4ASUD 4ACBA 3T25A 3VPKA 3T26A 2PGQB 3M5OA 1NPMA 1O33A 2AGEX 2ZF0H 5HKKD 1QJ1B 3V12A 1XVMA 3MNCA 4F49A 4O3TA 1DLEA 1KLTA 2BD8A 1Y59T 1A0JA 2ANMH 2A32A 2ZU1A 4ZKNU 4Z0KA 2WSSD 1IQMA 1A7SA 8ESTE 2HALA 4TT3D 5C1XA 1V2OT 4K8BA 3LC5A 2ZKSA 1RD3B 3FZZA 1NM6A 1ZRBA 5T3HA 4Y7AA 3MNXA 4NFEA 1NTPA 1MTNC 1MD8A 5T6FA 1AVXA 2BY7X 4NSVA 3P8GA 1CHGA 1QFKH 1KLJH 1WQSA 4B2BA 2BVRH 4J2YB 3EYDA 1SGCA 1FDPA 1QBNA 1D3TB 1C1WH 3RM2H 4I8HA 1GBAA 3ZZ5A 5DP5A 1ELFA 1A3BH 1LVYA 1HIAB 2Q6GA 4AOQA 1YPEH 4K1SA 1EJAA 1GCTC 2BDHA 1SGFG 2WINI 3U9AH 4DIHH 1SGFA 2XOKD 2XYAA 1C2HA 1YKTA 3M3TA 4D9RA 2ILNA 3S7KB 1FX0B 2FTMA 3PLKA 2B8OH 3E1XB 4Y8ZA 4CHAC 3RXIA 3RU4D 3UNSA 4ABGA 5I25A 1C1UH 3M7UA 2FX6A 7KMEH 3SORA 1BT7A 3STJA 5B6LA 1G3EA 1SQAA 2CGAA 2V3MA 1O2SA 1BTUA 2XBYA 4X6OA 4UFGH 1C1NA 1QTFA 1K1IA 2V35A 3GY2A 3SJKA 4AFSA 1G30B 1O3LA 2H5CA 4ZXXH 1LO6A 1B0EA 1TA2A 1RXPA 2FOHA 1K28D 1E34B 5GNDA 1X7AC 1SQTA 4OGXA 2R3YA 2FOCA 3PRBA 2C3SA 2HNTC 1TNIA 3E0NB 2XTTB 3TJUA 1Y3UA 1TNGA 3PMJA 3Q77A 4RKOB 1KXBA 5GPIB 2IPQX 4ZAEA 2GCTB 3A80A 3CS0A 3BV9B 2A7HA 2FOMB 2FXRA 5C5OA 2XCFA 1EX3A 1GI1A 3EA8A 2ZQ1A 3GY6A 1EOJA 1SGYE 1O2OA 4DURA 2PUQH 4AFQA 5ETXA 1EFRD 1YBWA 2IJOB 4X2XA 3LOXA 1WTGH 1GHAG 4INHA 4KP0A 1PPHE 3GDSA 3GCHB 5EW2H 2WV9A 2C8WB 1B0FA 2TIOA 1C5NH 2XWAA 2CXVA 1T8NA 2WPKS 1CGHA 2AH4X 1UJ1A 2L74A 2PLXA 4GHTA 4HTCH 8KME2 1O39A 5L6NH 1AD8H 1W0ZU 1GGDB 4DJZB 3B9FH 1TGNA 2UUYA 3ZZ9A 4XOJA 4A6LA 3UPEA 4JMYA 1L2EA 1UCYH 1TAWA 4CRAA 1PPEE 3R0FA 4OM9A 4B75A 1FNIA 2JETC 4BXSA 3A86A 1LKBA 3LC3A 4B71A 2HPPH 2Y6TA 2ZGJA 2RA0A 1A0HB 2B9LA 2ZFSA 2BQWB 3N7OA 1K1LA 2B7DH 1RFNA 2W26A 3SUDA 1KYNA 2ZCHP 2P3FH 3SW2B 1V6DA 2ZHFH 1QB1A 1N8OC 2ZC9H 4IC5A 1HAVB 2HGTH 2QXJA 1LVBA 4JZ1A 2OD3B 3RXVA 4U2WA 1C5SA 4HG6A 5EPNA 1S6LA 4F4OC 3RXMA 3M36A 5HXFA 3ZZ3A 3TJVA 2XNIA 3CP7A 3V13A 2XC4A 1NS3A 2F91A 1YCPM 2CN0H 4AG2A 2HPQH 2ZWLH 1RJXB 3LH3A 4O03A 4NIYA 2QF0A 1XKBC 5HIZA 1UVUH 1Z8RA 1F0UA 1PPGE 2AYWA 2M2AA 2BM2A 1ANDA 1C1PA 1K1JA 1SBWA 3NPSA 4K8YA 2PUXB 4BTTB 2FX4A 3SQEE 1GPZA 1SLXB 3EE0B 3A84A 2I6SA 7GCHG 1SVPA 1EUFA 1FLEE 1UK2A 1AKSB 1ELBA 2O8MA 1T4VH 2QGRA 4MPVA 5H4IB 5A09A 4WJG2 1SR5C 1KMHB 3KN2A 2VVUA 5C94A 1TE0A 3GISB 5DN6D 1NBMD 1HAHH 5DSFA 2VH0A 1P10A 2PV9B 1ZYOA 1PQ7A 1P03A 4YESB 5AF9H 2P16A 3MH4A 3SU3A 1NFWA 1ELVA 2F83A 2O8UA 3A88A 1UTOA 1ELGA 4FUCA 1WV7H 2G4TA 1LTOA 1S0RA 3M61U 4X1SU 3BTDE 2LPRA 4ZROA 2FOFA 4X8SH 1EPTC 2OC7A 4I7YH 4KTUA 4B1TA 1LQDB 1AY6H 2KCOA 3F2HA 2BMGB 3OE7D 1UCYK 1ZMNA 1TWXB 4ISLA 1CT0E 1O3DA 3MNBA 3FKSD 3TITA 5HM2A 2FOAA 5EOKA 1W8BH 2HNTE 3SJIA 1O34A 1TALA 2C4FH 4E7RG 6LPRA 2NU0E 1QR3E 1RTKA 1YY3A 1K0HA 1BTZA 1SOTA 2FWWA 1BB0B 1THRH 5F8ZA 3T27A 3LGYA 4JK6A 1O2HA 1TMBH 2ULLA 1P04A 1TBRH 1VJ9U 1EKBB 3LPRA 1FAXA 1CHOG 1NESE 2G81E 4TSFD 2ALPA 4F48B 1BMFD 1W3CA 1C2LA 1F92A 3P70B 3BG4B 1OS8A 1ZGVA 5JDUB 1SQOA 2D2DA 2VINA 3TK6A 1SLVB 1KY9A 4YLQH 2A7JA 3MH6A 1GBDA 4YM9A 1JBUH 2QV1A 1TPPA 1BRUP 5C1YA 4AC9A 1O37A 1C2DA 1V2MT 1WU1A 2BVSH 3F68H 1SB1H 1AFEH 1K1NA
chains in the Genus database with same CATH topology
1ZLRA 3Q3YA 4X8UH 4NZLA 4Y0YE 1O5AB 2ZIQH 3ZVEA 1G2MA 1JMOH 1KXDA 5E2PA 4GHQA 3A7ZA 4X1PU 3ZZBA 2J2UA 4ISNA 4AX9H 1BTPA 1DFPA 5F8XA 1AVWA 3MOCA 4E05H 3MMGA 1ELCA 1G36A 3U8RH 1UTNA 2A31A 2CJIA 2PSXA 3F9EA 2G8TA 3NCLA 5AHGH 3VGCB 4FUGA 2F9PA 5A8XA 1GMCF 1VGCB 3GY7A 5GJ4B 1J9CH 5DP7A 2EA3A 5HYOA 2CF8H 4FXGH 2YNBA 4WVPE 3GCTG 2VIPA 4XBCA 1AFQB 3PTBA 3GDUA 1YP9A 4X2WA 1O2VA 1TYNA 3A82A 1CHOF 1O2LA 4BAHB 5DP4A 3SU0A 1MU6B 1KLIH 3KNXA 4Y11E 1O5FH 4LOYH 3KQBA 2ZGBH 3H5CB 1W0YH 1TB6H 4A92A 2JKHA 5EGMA 1C5ZB 1BQYA 3AW1A 5DP8A 4ZXYH 1P8VC 3H7OA 2XBWA 3OYPA 4UEHH 1P0SH 4MG3A 5EXNA 1NRRH 4YOIA 3IITA 1K21H 4FVDA 3Q00A 1EZUC 3SU4A 1MH0A 1P2KA 1FY1A 1WBGB 2BDBA 2GCHG 2Z9IA 3Q76A 3QGJA 4GCHF 1UTLM 3E3TA 1HFDA 3FVFB 1WAYB 2AMQA 3GYMA 3GDVA 1NRNH 4MNXA 1N6YA 1SFIA 3SUEA 4DGJA 5E2OA 2FO9A 3KEEA 2PKSB 1LHFH 2VGCC 3HK3B 1C5PA 1TPOA 1GBCA 1GJ8B 1LKAA 2ZFTA 2GZ8A 3F6UH 1EXFA 2PFEA 3P8NA 1S81A 5JBTA 4KTCA 1FIWA 3SU2A 1FPHH 2BOKA 3EAJA 1D3QB 3GCNA 5DP3A 1DM4B 2YNAA 2TGAA 1KDQA 2Y5FA 1DUAA 1NZQH 3K6YA 3MO9A 7LPRA 3M7QA 2ZDLA 1BIOA 5DG6A 1YYY1 1CT4E 1U6QA 1W12U 1DT2A 3RU4E 1RS0A 1VCWA 1L1NA 3RUOA 2B0FA 3KL6A 1AVGH 3GCTF 2HNTF 2G51A 1BMMH 1CGIE 3D62A 1Q2WA 3ZVAA 4ZHMU 3SOSA 1FY5A 1N1LA 3A7XA 1AU8A 1O2IA 1T4UH 3SUGA 5CHAB 4NSYA 4BTUB 4YZUA 2HRVA 1AMHA 3E90B 1ELDE 1H4WA 1DE7H 1HAZB 1T8LA 2NU2E 3MFJA 3LJJA 3RLYH 1GMDF 1ELTA 1GJ6A 1D6WA 1ZPZA 1JIMA 4CREA 2D26C 5GDSH 4TWYA 2PR3A 1Y5UT 5A2MH 1C2GA 1DY9A 4GPGA 4A1VA 4FU8A 1YPMH 3SJOA 1RIWB 3PO1B 5C5NA 4FVBA 2R0LA 3W95A 3TNSA 2OLGA 5K0HA 3EA7A 1C9TA 4OS1A 4UE7H 1O2YA 3ATKA 1PPZA 1RTFB 2BZ6H 3QK1A 1GG6C 1KXAA 2O9QA 1V2ST 1AZZA 4U01A 1HAXB 2XW9A 2QXHA 1O3IA 1Z8IB 2A7CA 2SGPE 3MU5A 2ZDMA 3QDZB 3SNEA 3M3SA 2D8WA 3WY8A 3HGPA 1SGTA 2ZGXH 1V2VT 1HJ9A 2ANWA 1GI9B 4NA9H 5DP6A 1V2UT 2FI3E 1UVOA 3BTEE 2NU1E 5HMAA 4DIIH 2PTNA 4JYTA 3FP6E 1XXDA 3TK9A 2A4QA 4D7FA 5FPSA 5DP9A 3BF6H 2A5IA 4CRFA 1ZHRA 4CRCA 3BTTE 3L6PA 3RMOH 4TYDA 3W94A 3KGPA 1T7CA 4OS7A 3UOUA 4IMQA 1C5XB 3FP7E 3U1IB 1HYLA 1CA0B 3O8BA 4NG9H 2BX3A 3TVJB 5HGGA 1XMNB 1EZSC 2NU3E 1W10U 2ZFPH 1C1TA 1GI7B 3RC5A 3T62A 1BRAA 1PPFE 3BTFE 4K2YA 1AI8H 1QBVH 3LONA 3ATWA 3S9CA 3A8DA 5GIBA 3GYLB 3BN9A 2FODA 4ABFA 1J17T 1AE5A 1LDTT 1C2IA 2Z9KA 1UMAH 4AGKA 1S82A 2BD3A 5DGJA 4XBDA 1N6XA 4CRDA 2B5TB 4OS6A 1YCPH 3ENSB 1ABJH 4X2YA 3ODDA 1BHXB 2R2WU 2ZCLP 3QO6A 1BRCE 2OC8A 1WYKA 1O30A 7ESTE 1TOCB 2Z94A 1IQIA 1O2JA 4MNWA 1IQGA 1CT2E 1UTKA 4K5ZA 1XX9A 1JRSA 2FPZA 5C2ZA 1FMGA 1L1JA 1VITG 5T6DA 1GHWH 2C8ZB 1TNJA 4ESTE 3RXLA 3QLPH 2P8OB 3SJ8A 4GUXA 1MBQA 4VGCB 1DWEH 1DWDH 4X1QU 2AGGX 5C20A 1YGCH 1UTQA 1GMHG 3VB4A 1O3GA 2SNVA 3SV2H 2GCTC 3ODFA 1BTHH 3PMHB 2VU8E 1BJUA 1YLDA 2QXIA 4NGAH 2OUAA 3RXHA 3SU1A 1LVMA 1XUJA 1UVPA 1TBZH 3GY5A 1BUIA 4INKA 3GCHC 4TPYA 3TLOA 4AB9A 2G52A 3MU8A 1GDNA 1EAWA 1DVAH 1BJVA 1SHHB 2BXTH 4CBOA 2WPJS 5BRRE 4H6SB 1LPGB 1W7GH 2VIWA 1WCZA 3TJOA 1Y5AT 1LCYA 4GVUA 3ZZCA 2Y82A 3M5LA 1J8AA 1DX5M 1GGDC 1K1PA 2ZPSA 4ISHH 1ESTA 1O5CB 1XUHA 2GV7A 3ZVDA 5A0BA 1W2KH 1VR1H 2J34A 3AASA 5IDKA 1SGPE 1YPJH 1FIZA 1UHBA 1Y3XA 1O35A 2PKAB 2OXSA 3ZVGA 3RDZA 1GI6A 1OYQA 2J95A 1EB2A 1GDQA 1UO6A 1YCPK 1OKXA 1BRBE 1A1RA 2STBE 2F9UA 3A8AA 5AVDA 3VFEA 4B2AA 3RXQA 1CE5A 1YPHC 2OBOA 2H9EH 1UVSH 2VH6A 1EB1H 1EATA 1GMHF 1HRTH 4AGJA 5CE1A 3HGNA 1SGQE 1O3KA 3NK8A 3BEFB 1E35B 2OQUA 2A4RA 4GLYA 1ZTLA 2FOGA 2AMDA 4BNRA 2BD7A 1O3EA 1HB0B 3VB7A 3LDXH 5L30H 1RGQA 4OGYA 2BDGA 2BTCE 1ARCA 1T8MA 6ESTA 2O8WA 2ZU4A 3RXPA 1ZHPA 3LIWA 2Z9GA 1GWAA 5FX6A 4IBLH 1QBOA 3PWBA 1MCTA 3SV7A 5J4QA 2OTVA 3AVZA 1TX8A 1HXEH 1Z8JB 3TNTA 1P2QA 1WQVH 2ZG0H 2WPHS 2SNWA 1KXCA 1OSSA 4XSKU 3UR6A 1HNEE 8GCHG 1G3DA 5GWZA 1DPOA 4AZ2B 1O3BA 2J94A 2ZU5A 3RMMH 1BMAA 1M9UA 1L1GA 2ZU3A 1GHYH 2R9PA 2ASUB 1IQFA 4IN1A 3RU4T 2WUBA 1S83A 1DY8A 3P6ZB 3T29A 1W14U 2Q6FA 3OSYA 1XM1A 1PPCE 2R3UA 3RXKA 1ZZZA 2UWOA 4Q2KA 4BAOB 5L2YH 4GAWA 3STIA 3GY4A 4LZ1H 2ZFFH 5A8ZA 3RXEA 6GCHG 9ESTA 3KQEA 1XKAC 1MKWH 1O2KA 1QQ4A 4I33A 3O8CA 3A87A 2UUKB 2I6QA 1NO9H 3DT0H 1TRYA 4Y8YA 1BA8B 1AQ7A 1TLDA 4FU9A 1G2LA 3SBKA 1KTTB 3TIUA 1OWJA 3QUMP 3SU5A 1P2IA 1AWFH 2FI5E 1FY4A 4UFFH 5C67A 3ATMA 1V2LT 4JYUH 1GHAF 4HZHA 2QF3A 2OC1A 1BBRE 1OWDA 1Q3XA 5EG4A 3DUXH 2RDLA 5TCCA 3QZQA 4OS2A 2F9OA 1OP8A 3BG4C 1P9UA 2VIOA 1Q31A 3VXEH 1OX1A 1O38A 1V3XA 2ZHEH 2SGQE 1O2ZA 4ABHA 3RMLH 1A3EH 1PQAA 3MU0A 1HIAA 1V2JT 1TPSA 1QRWA 2UUFB 1L4ZA 3PMBB 1K9OE 2UUJB 4K3JA 3M35A 4DG4A 1MZDA 4I8LA 3F9FA 4INLA 1Z1JA 3R3GB 4ZH8A 1NU7B 2OQ5A 4WY3A 5PTPA 1BMNH 1F5LA 2GT7A 1AN1E 1IQEA 2OBQA 1AZ8A 3AAVA 4RKJB 1B5GH 6GCHF 3S69A 2GMTB 1EZQA 3SGAE 1OP2A 1C1RA 4Q7YA 1S5SA 1TOMH 1Z8GA 1THSH 3VGCC 5JB8S 4AN7A 1SI5H 4I8KA 1O3PB 3KCGH 4PROA 2PKAA 1VGCC 4ABAA 2TRMA 3A8BA 1PYTD 4NWLA 1LHGH 1YPHE 4TPIZ 1GVKB 3RXFA 1C5YB 5L2ZH 1ID5H 4WF8A 4WH6A 1LHEH 3SU6A 3DD2H 1O5BB 1V2TT 5F6MA 1AFQC 1MKWK 1NFYA 1XXFA 2FTLE 4I8GA 2LNCA 1QL9A 1JOUB 1J14A 1SC8U 5FPTA 4AYVB 1GI3A 4MPXA 1EP6A 1O3OA 2ZTZA 7GCHF 1GI4A 1ORFA 1QCPA 4X6NA 2BD2A 3BTME 1O31A 1BMLA 2VIQA 1C5VA 3PROA 1ZJDA 2EI8A 3SGQE 4AG1A 3RXGA 4FU7A 4X6MA 5EODA 3ATLA 5DK1A 5GCHG 1TX6A 1FAKH 1KTSB 2NWNA 2OC0A 2TPIZ 1GL1A 3MWIU 1P01A 3SJ9A 2KAIB 1PQ8A 1MBMA 2P93A 1PFXC 2PKSC 3O8RA 3UTUH 2BDAA 1IQLA 4OS4A 1FUJA 4Y79A 1OPHB 1E38B 1NFXA 1FPCH 2FS9A 3BTQE 1F0SA 4IN2A 3HK6B 3BTHE 1C2JA 1H8IH 1D3DB 3UNRA 3MU1A 1GVZA 4UFEH 1MTSA 2FOEA 2AERH 5G4BA 1C4V2 2F3CE 1MTUA 1TMTH 3KHVA 5FHTA 1AUJA 3MI4A 2PWXA 1VCPA 3RC4A 5FBEA 3ZVCA 2BX4A 3K9XB 5HM9A 1LPKB 4IMZA 2W7UA 3S0NA 3C27B 4K60A 1D6RA 2Y7XA 3E6PH 4I32A 4DVAU 3UOPA 1QIXB 1Y5BT 1SHYA 4THNH 1SL3A 5EPYA 5EXMA 1HAVA 3F9HA 4X0WU 1CQQA 4MVNA 1GHBG 1TABE 1HJ8A 1LHDH 2GV6A 4SGAE 1OYTH 4ZKOU 5CHAC 1EASA 2ZI2H 3URCA 3DA9B 4B73A 1F7ZA 1C2MA 1GJ4H 1EAXA 3EDXB 2J9NA 2ZZUH 4CR5A 3I78A 4Q7ZA 1T31A 1CU1A 1GDUA 1S85A 1AIXH 2BLOA 4HI3A 1THPB 4CH8B 1FJSA 1ZRKA 3E8LA 1RIWC 2JH5D 3PO1C 4UDWH 1TNLA 1A4WH 2W3KA 3UQOA 6CHAB 3FP8E 3ZZ8A 2Q1JA 1QRXA 4LZ4B 4NFFA 5BPEA 1AKSA 2ODPA 3B23B 1GCDA 1A5GH 1MTVA 1QRZA 1OP0A 5TJXA 4ABIA 3GY8A 3P17H 3VB3A 2H9TH 2VWNA 1JXPA 3KQDA 1DS2E 1AE8H 2P94A 3TJNA 5FPYA 4DOQA 3GY3A 2ESTE 1KXEA 4X1RU 2A2XH 2A5KA 4A1XA 3NWUA 1TGTA 1SMFE 4JZDH 1Z6JH 5E0GA 3FZDA 3TGKE 3SZNA 1C5RA 4NA8A 3RC6A 3S9AA 1C9PA 1V2RT 1AB9B 1HPGA 1XVOA 1ZTKA 5J4SA 1O3FA 1O3NA 1HJAB 1DSTA 1O2UA 4XBBA 5FBIA 1GHBF 2ZFQH 1ZPBA 4FUFA 1SOZA 4FUBA 2P59A 1O32A 1CA0C 2DE8A 2VVVA 2WPIS 3SUFA 5F03A 1Z7KA 3NZIA 1UTMA 1HXFH 4ABEA 2NU4E 2XXLA 1O2RA 1FN8A 1PYTC 1P02A 2GDDA 3M7TA 1BITA 2OINA 1MQ6A 2VJ1A 2GCHF 1P05A 1TBQH 2QY0B 5F8TA 5LGOA 1KIGH 4ABJA 2SGFE 4R8TB 1F5RA 1HAGE 1IHSH 1H9HE 2XWBI 4Y76A 3T28A 4KELA 2O8LA 4HGCA 1YC0A 3K2UA 3B8JA 2ZNKH 4CRBA 1G3CA 3EA9A 5FCKA 3IG6B 3SO3A 2SGAA 5JBBS 3E0PB 1QL8A 1TQ0B 1VZQH 1WSSH 1FZZA 1P09A 1SG8B 2BY6X 2VWMA 4B2CA 1NRQH 4CBNA 4IS5A 4TWWA 3MH7A 1C4Y2 3MO6A 2M5TA 2YOLA 4I8JA 1GBEA 1S0QA 9LPRA 1DWBH 2ZHWH 1AWHB 3QN7A 4DY7B 3V0XA 3HPTB 2P8OC 3M5MA 1GHXH 2FLBH 2HLCA 2D1JA 3G01A 1DUEA 3TGIE 1IQJA 4VGCC 1QY6A 5AFZH 4BANB 1IOEA 3SNDA 1ZMJA 1O3HA 1JRTA 2GD4B 4TY7A 4FUEA 3HKJB 2QXGA 3FANA 3PLBA 2GP9B 1DANH 3A7VA 3SQHE 1UTPA 1TQ7B 4BOHA 3UUZA 4GSOA 1GBMA 2VB0A 5EW1H 1O2NA 1ETTH 3OY5U 3P95A 2CHAB 4BXWA 5K7RA 3SNCA 1TRMA 3D49H 4OS5A 4I31A 4J1YA 1YM0A 1SPJA 2VWLA 3V3MA 2IOTA 1ZHMA 1GJAB 3LGVA 1GBHA 2BYAX 2V0BA 3TU7H 4UONA 4JZFH 1QURH 2P3TB 3BSQA 2SGEE 1VCQA 3ELAH 2CMYA 1ABIH 1C5QA 1O2GH 3BIUH 3A8CA 2BD5A 3FFGA 2QC2A 2F9NA 4TY6A 1J15A 3MO3A 2QA9E 4O3UA 1GL0E 1GVLA 2FESH 2Z9JA 1DXWA 1YPLH 2BOHB 2WPMS 4ZHLU 1FONA 2BLVA 2GT8A 2BLQA 1P9SA 3AAUA 2ZO3H 1ETRH 1F0TA 2FS8A 5JPMH 2THFB 5CMXH 4X8TH 1DOJA 4WMFA 1CGJE 4MTBA 4CR9A 3M37A 2XCNA 4A1TA 1LVOA 2QCYA 2JH6D 4Y8XA 4U30A 1HAOH 2GGVB 1V2PT 4AFUA 1ANCA 1KXFA 3ZZDA 1HLTH 1IHTH 2HOBA 4JK5A 4K1TA 2FP7B 2HVXA 3EGKH 1BTWA 1NC6A 1O2QA 2J38A 1CBWB 4ABBA 1YF4A 4H4FA 3LT3A 1ELAA 2A0QB 2AGIX 3JZ1B 3BG8A 2XC5A 1O2PA 1P11E 3GICB 2ZDNA 3BEIB 3S7HB 1TNKA