1SHYA

The crystal structure of hgf beta-chain in complex with the sema domain of the met receptor.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
228
structure length
228
Chain Sequence
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatocyte growth factor
publication title Crystal structure of the HGF beta-chain in complex with the Sema domain of the Met receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor/growth factor receptor
total genus 44
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2004-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1shyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1shyA01
1ELBA 1HLTH 1NFXA 2UWOA 4AB9A 3U8TH 1K1PA 4BXWA 4MPVA 4Y11E 5GWZA 1UCYK 2BM2A 2O8TA 1GBTA 3IITA 4IN1A 2C8ZB 2HPPH 1C5NH 2A4OA 4RN6A 4WJG2 1QB1A 4YT6H 2ZGCA 1YPJH 4QT8C 3SGBE 4GHTA 4XSKU 3AAVA 1EUFA 3UWJH 1NS3A 2F9BH 3ATMA 3RXVA 4UDWH 2OUAA 4ABFA 3SU1A 1EP5A 5EOKA 1L1GA 3EA7A 1SI5H 3UR6A 2O8WA 2Z3EA 1AY6H 2QY0B 5FCRA 1QL8A 3RC6A 4D9RA 1S6HA 2CF8H 2ZEBA 3TK5A 1GPZA 1AUTC 1JXPA 1RFNA 3TGJE 1EAUA 1G3CA 1HBTH 2BX3A 2Z3DA 3G01A 1T8NA 1BIOA 4I32A 2F3CE 3EQ0H 3A8AA 3ZZDA 5AFYH 2VIDA 2SNVA 3RU4T 1F0SA 3MU4A 1IQKA 4J1YA 3U9AH 3VB6A 3F9EA 4CRBA 1O3DA 1QB6A 1W14U 4AZ2B 3OSYA 1O2TA 4JMYA 1Z8RA 3AW1A 3UWIA 4GUXA 1GBLA 1SFQB 3QTVH 2PFEA 5H4IB 3ZYDA 1BBRH 1EX3A 4ZHLU 5JBCS 2BY7X 2J2UA 2TGDA 2AYWA 3GCHB 2XC0A 1F0UA 1DANH 1SQTA 4X1PU 2ZCKP 2FTMA 1QL7A 5JDUB 1D6RA 1UTQA 4OS1A 5FHTA 1O35A 4ISIH 2TIOA 1ZYOA 3R0FA 2VVVA 1O2JA 5TCAA 2Y7ZA 2SGAA 1O3LA 1KY9A 2AFQB 7ESTE 4INLA 1ZRKA 1K1NA 9ESTA 3UQVA 1NU9A 3RXKA 1PPZA 1NPMA 2ZU2A 1UVSH 1YPGH 2VWOA 3A7XA 4Z6AH 1MQ5A 2P8OC 2JH0D 4O3UA 4U32A 2QGRA 4NWKA 2OQ5A 4CRCA 4B1TA 4IMZA 3RXFA 2I6SA 1FQ3A 2QXGA 2NWNA 2ANMH 1WQVH 1FNIA 1VR1H 4KELA 1TMTH 4Y71A 2WV4A 1MTUA 1GG6B 5FX6A 1AWFH 1ZSKA 1ESAA 1A3EH 2STBE 3U1JB 2VIWA 2VNTA 3T62A 2TGAA 4YT7H 1EKBB 1O2RA 3KIDU 4U01A 5E8EH 1AVXA 1E34B 4LZ1H 4SGBE 4A92A 1MKWH 5TJXA 3LJOA 1GI2A 1V2PT 4R8TB 4ZMAH 1QHRB 1MQ6A 2FLRH 2V6NA 3R3GB 3SU3A 1L1NA 1Y5AT 1C5TA 1BHXF 5L30H 1TONA 4NIXA 2AEIH 1CQQA 2PKAA 2WUCA 1SMFE 2R0LA 1MBQA 3P92A 1BT7A 1CGJE 1TNHA 1SGEE 3U8OH 1VZQH 4X2XA 3QK1A 2BVRH 4WMEA 6CHAC 3KL6A 4GCHF 3BTQE 1D3TB 1O2ZA 2ZHWH 1O3JA 1CT4E 1C5RA 1OWHA 3GICB 4CBOA 4A6LA 1WUNH 3A85A 1ZGVA 2WPJS 1ELDE 1ZMJA 1SOTA 1OPHB 2B7DH 1YCPK 1P04A 3BTTE 1PQ5A 1ZHPA 2A7JA 5EQRA 5FPTA 4A1TA 1RGQA 1B0FA 4OS6A 1HFDA 2ZDLA 1FIWA 1EPTA 2BY9X 2FWWA 4NA7A 4A1XA 1P10A 2XCNA 1EOJA 1L0ZA 2A2XH 1GBKA 4YTAA 3ZVFA 5CHAB 1P05A 1A4WH 1XUJA 1OX1A 2EI7A 1QFKH 2FS8A 1AFQB 1DWEH 3MU5A 3TJOA 3MO3A 1UO6A 2XCFA 3GCHC 1A2CH 4BANB 2QF0A 2FOHA 5DP5A 1DWCH 1GWAA 4K69A 3PWBA 3RXAA 1C1TA 2QF3A 1SGRE 1ZRBA 1GJCB 2SNWA 3PV4A 3GY2A 3WY8A 3PYHA 2J9NA 2F9NA 3PWCA 3C27B 4NIYA 1DLKB 1FY3A 3SI3H 1SG8B 3D49H 1TAWA 1E35B 1F92A 3MU8A 1C4V2 2HRVA 1A5IA 3QO6A 2OXSA 1QTFA 2C8WB 1C1QA 1GJ9B 2VVCA 4TPYA 4OS5A 1JWTA 1O32A 1B0EA 1KSNA 4K1SA 1O3EA 1C5VA 1GG6C 1SC8U 5T6DA 4IN2A 4K60A 2ZHQH 1ZSLA 4DG4A 1WYKA 2BTCE 3MYWA 3O8RA 2D1JA 4IGDA 1GHYH 1TRNA 3TK9A 4BAKB 4AFUA 1EJNA 4NFEA 2ZWLH 2HNTF 2LNCA 4ZHAA 1PQ7A 4ZKRU 3EAJA 2FXRA 1NRRH 1DOJA 1HUTH 1UVOA 1Z71A 1TNGA 5IDKA 4Z0KA 1O3IA 1BMNH 2HNTE 5JB8S 1A0HB 1YKTA 2XNIA 3BIUH 2BDGA 4AGJA 4MG3A 3ENSB 4GSOA 2TRMA 2ZA5A 1W7XH 1TX8A 3S9BA 1GBBA 3DUXH 4B76A 1LCYA 4BAMB 1C2DA 2XC4A 2ZFTA 1YPHC 4CRGA 2P95A 1SGCA 1V2VT 3PMAB 1MH0A 1RTFB 3M7TA 3W94A 2BY5X 3OTJE 4YESB 1W7GH 1QL9A 4UONA 1MAXA 3UPEA 2J34A 4RSPA 3M35A 2PUQH 2GKVE 1CU1A 1HCGA 4DIIH 4CHAB 3FZZA 4OGYA 1SLXB 2ZDVH 4DIHH 1EZSC 2BXUH 3ZZ8A 1XUIA 4AYVB 5EQSA 1SGFA 5CHAC 1HAGE 1C5QA 3SJ8A 1AFQC 1DUAA 1C5XB 1AZZA 2G5NA 4ZUHA 3UOPA 1N8OC 2I6QA 1FXYA 2HWLB 3GY8A 1NESE 3SW2B 2WPLS 2CN0H 2GCHF 1LPZB 3UOUA 3GY3A 3F68H 3K6ZA 2PUXB 3LIWA 1OWJA 4NWLA 2GDEH 3I77A 2BVXH 2VIOA 3U1IB 2ZFQH 3RDZA 1OS8A 6ESTA 1ZTLA 4D8NA 3QN7A 1D3DB 2ZIQH 1ARCA 3TNSA 4X8VH 2B5TB 1TA2A 1DE7H 4TWWA 1GJ6A 1O0DH 3AAUA 4MNWA 1KTSB 5AHGH 5JPMH 5T3HA 3NWUA 1GCDA 2A45B 4I8HA 2WV5A 4H6TA 1C2GA 3UNRA 3BF6H 2V3HH 5C1UA 3HPTB 1YYY1 1C1RA 2VB0A 2ZGHA 3SV9A 5JBTA 1G32B 3SJKA 3U69H 1ELTA 1O3HA 1ANCA 1ELEE 2JH5D 1P02A 1HJ8A 5FPYA 3GCNA 1ZMNA 2Z9KA 5E0JA 5DGJA 3UNQA 2XBVA 4X8UH 3I29A 1S81A 1GMCF 1NM6A 4MLFB 1HJ9A 4WH8A 3A7WA 1GMHG 1ZTJA 1O3OA 2BOHB 3ZZBA 3DD2H 2PGQB 3Q3XA 2Y82A 4UEHH 3D23A 1FMGA 3KQEA 1TGBA 2OD3B 1TNLA 2AH4X 3QUMP 1TGCA 5GIBA 2W3KA 2TPIZ 1QR3E 1LTOA 2FX4A 4BTTB 3Q3YA 4BTUB 1UMAH 2UUKB 4AX9H 3BTHE 3N7OA 5EXNA 5A0CA 7LPRA 3KQBA 3S69A 3GDVA 3AVZA 8ESTE 2QXIA 4YZUA 2FIRH 1GJ8B 4CRDA 5EW1H 2P3TB 1GHVH 1SQAA 1XUKA 3LGUA 5C5NA 3HK6B 4FUFA 2NU4E 4B2CA 3U8RH 5IYTA 4NIWA 3GOVB 1FY4A 4WWYA 5FXLA 2ZDKA 5T6FA 4AFQA 1ZPBA 1IOEA 1O5BB 3M36A 3V13A 4X1RU 1TPAE 1C1MA 3K2UA 5F8XA 1O3NA 1P11E 1Z8IB 1W2KH 3T26A 2SGQE 2V3OH 2TBSA 1YF4A 1GBDA 1XVMA 5DKMA 2AERH 2GV7A 2R3UA 2BYAX 1D3PB 1HGTH 3T2NA 4NA8A 4ABDA 2J38A 2SGEE 4B2AA 1AB9B 4YLQH 2AMPA 1HAYB 1J16A 2IOTA 1UVTH 1DDJA 4XE4A 2GX4A 1GBEA 1GHZA 1C2KA 2HLCA 3BTWE 5HM2A 3RMOH 1TE0A 1NRPH 3ELAH 2AS9A 4UFDH 1TYNA 4THNH 3RMLH 1IHSH 1RTLA 1GHAF 2UUJB 1AQ7A 1NRQH 1FJSA 1F5RA 2J4IA 4XBBA 1O2KA 2SGFE 4GPGA 1TGTA 1UK3A 1VCPA 2RA3A 2ZDNA 1J17T 1KXEA 4Q7XA 3T27A 1GHBG 1XX9A 1ANEA 3LH3A 4E05H 1EOLA 2FI3E 2HOBA 1V2NT 2WPHS 1IQLA 2Y6TA 2A31A 4NFFA 1EAWA 4I31A 1E38B 4AORA 4RKOB 1QBVH 1JBUH 3M7QA 3KQCA 2FM2A 2GCHG 3O8CA 1C5MD 3VGCC 2CMYA 5DP7A 1C5OH 1V2UT 2G4TA 1PYTC 2O8LA 4XDEA 1S82A 2EI6A 1VGCB 2B0FA 2G00A 3V3MA 1AGJA 4UD9H 2OQUA 1QJ6B 1BMMH 1T8LA 2Q1JA 3KGPA 3BEFB 1BOQA 2A4GA 3P17H 1EZUC 3EDXB 3H7OA 1SB1H 1HAXB 1UVPA 2M5TA 4WMFA 3MNBA 1ACBE 2K1QA 4AFSA 2A32A 1TGSZ 1IQJA 5EW2H 2D8WA 1A46H 1UTJA 1Y59T 3SHAH 3VB4A 1UJ1A 1C1PA 1C2FA 1P3EA 2CXVA 2H5DA 3K6YA 2AIPA 1SGQE 1ELAA 2BVSH 4X0WU 4ISNA 3P8NA 4IC6A 1TGNA 5A2MH 3MTYA 3ODDA 1P9UA 3PO1B 1UTNA 4D9QA 1GDUA 4WXIA 1KLJH 1NY22 2GT7A 1ZR0A 1FV9A 1EPTC 1LHEH 2Z6BD 1G3DA 4M7GA 2ZU1A 3L3TA 4WXVA 1FLEE 3A8DA 1YPMH 3SN8A 1GMCG 3SNAA 1HAPH 1N6YA 3BTDE 4B71A 3NPSA 4NG9H 1TX7A 4KP0A 1DSTA 3UREA 1O33A 3U98H 1MKXK 3MH7A 1BTHH 2ZQ2A 3EYDA 4FUIA 2A5KA 2UWPA 4OGXA 1GGDB 1IQMA 1QRWA 1S0RA 1BUIA 1X7AC 1OYTH 3ZVBA 5DP3A 5I46H 1H9LB 1KTTB 4ZKSU 1AI8H 1LPKB 3TH2H 1QRXA 1TMUH 3BG8A 5DK1A 4ISOA 5F8TA 2J95A 1GI1A 1XXFA 3ZZ6A 2VIQA 2Y5HA 1GI3A 1O2QA 1AU8A 3NUMA 1O34A 2F91A 1L2EA 1WBGB 2C4FH 3ATWA 2RG3A 1T4UH 1CE5A 2IPHA 2ZHDA 1T8OA 2VWLA 2OBQA 2QCYA 3SV2H 1Y5UT 1ZHRA 2BD5A 1PPGE 2FOCA 3P95A 1O3FA 2RCEA 3RU4E 1OP2A 3B23B 3VB3A 1EASA 2G81E 2VIVA 1G2LA 1PQ8A 4FUJA 2VU8E 1RIWC 2ZC9H 5JYIA 3M3VA 1WCZA 4U2WA 1O3BA 3FANA 1W3CA 3SJIA 1MTVA 1VCQA 3P8OA 1H4WA 3L33A 2HVXA 4UE7H 3RXIA 3SUFA 1UCYE 4ZKNU 1MZDA 3OX7U 2PSXA 2RDLA 4FU7A 1EP6A 3S9CA 1LQDB 1RJXB 1GHAG 3AASA 5DP9A 1GBMA 2FO9A 2O9QA 1SLVB 5SGAE 2NU1E 1ZMLA 1ETRH 1SBWA 2BD4A 1XXDA 3LU9B 1AE5A 5EXMA 4TPIZ 2F9OA 3Q3KA 3RXLA 3GDUA 3RM0H 1AD8H 1O31A 4Y7BA 2AMDA 3SQHE 4WMDA 1HJAB 4JYVH 1NFUA 5FX5A 3EA8A 1CA0B 3PLKA 5DJ7A 5EG4A 1ARBA 1IHTH 2HPQH 1MTWA 1W0ZU 2XRCA 1P2IA 1Z7KA 3PO1C 3V12A 3RC4A 3E6PH 2WPKS 1CT2E 1GJ5H 3BSQA 1EJAA 3EA9A 5E2PA 4BTIB 2W7UA 5ABWA 4HTCH 4WVPE 4KTCA 8GCHF 1YPLH 1OYQA 2WPIS 1Q3XA 1GBHA 4X2VA 1T4VH 3M3SA 3A7YA 2GZ8A 1HXFH 5LPFA 3SOSA 2ZHEH 2VH6A 4TY7A 3SUGA 1Z8JB 1K1MA 1MBMA 3GCTG 3GISB 3NXPA 1DUEA 3RMNH 3SV8A 1P57B 2QXHA 5J4QA 3A89A 4ABHA 1ELVA 1P12E 4X6PA 1WV7H 1QBOA 1DXWA 3A7ZA 2JETB 5PTPA 1A0LA 2A7HA 4Y8XA 1Q2WA 1UVUH 1G3EA 2ZECA 4UFEH 1O2OA 4KTSA 2EC9H 3E90B 1LVBA 1G2MA 1HIAB 1HAIH 1F2SE 2R9PA 2ZI2H 4E7RG 5FAHA 1H1BA 1GMHF 1EZXC 4ZAEA 1ABJH 3UQOA 3SV7A 2QIQA 2BMGB 1CHOG 3GCOA 5F6MA 5DP6A 1MAYA 4LXBH 2Y5GA 1SHHB 2KAIB 2FI5E 2Z9IA 1O2MA 1NZQH 2ZPRA 4MPWA 1V2LT 1MMJN 1BCUH 4Y8ZA 3ATIA 1BRBE 3DHKH 1CSOE 1F0RA 4O97A 5EQQA 1ABIH 3RXQA 1O2NA 3QX5H 1FI8A 2QC2A 3HGNA 2FI4E 3RM2H 1NRNH 4Y76A 1AE8H 1BRCE 2F9PA 1GDNA 2D2DA 2GMTB 1BMLA 1P09A 4Y7AA 3B8JA 1C1SA 3GDSA 1P9SA 3P8FA 1HAHH 1O2PA 2P3FH 3RXOA 2FX6A 1O3GA 5DP8A 5AVDA 1W10U 3SORA 1LMWB 1LO6A 1EJMA 1UTOA 1P06A 4SGAE 1ZJKA 2PV9B 4MDSA 2ZFPH 2FS9A 1SQOA 1IAUA 1ZOMA 4OS2A 1GL1A 2Y5FA 1BBRK 1BDAA 1VCWA 3LT3A 3M5NA 2A2QH 3UNSA 1WSSH 4NSYA 1TPPA 1QJ1B 3Q77A 4AG2A 1Z1IA 2VIPA 4BAOB 1HJAC 3JZ1B 1CA0C 3RU4D 1YP9A 1BITA 1S83A 3B9FH 1NU7B 1MTNB 2Z9JA 5I25A 1DX5M 2FTLE 1LQEA 1TBRH 1AKSB 1Y5BT 3ATLA 1QY6A 1GCTB 2BY6X 1BMAA 1B7XB 5GDSH 1G3BA 4B2BA 4ESTE 3TGIE 2GD4B 3RXDA 2GZ9A 5JBBS 4BAQB 2PKSB 3A8BA 4YO9A 5G4BA 1THSH 1KIGH 2H6MA 2XBYA 3A81A 1O2YA 1K1JA 3HATH 1GVZA 5T6GA 1TWXB 1W8BH 7GCHG 1DWBH 3A7TA 1GJBB 1SGIB 4TWYA 1ELGA 5FPSA 2BDYA 1C2IA 1GHBF 1HV7A 2BDAA 4X2YA 4B74A 3FP6E 1Z6EA 2ALPA 2ILNA 1SGNE 3T29A 3ZV8A 1A7SA 3RXGA 5F8ZA 3K65B 1RTKA 2JETC 4GLYA 1WAYB 4ABJA 3SBKA 3S7HB 3CP7A 3SUEA 4ZKOU 2OC8A 1INCA 1C1UH 1PQAA 1RS0A 4O3TA 4IW4E 4AN7A 1MKWK 5GPIB 3BTKE 1P8VC 1ETTH 3VEQB 1C5PA 2J94A 3SNDA 2DUCA 4HI3A 1G9IE 8GCHG 4JYTA 1MU8B 3CS0A 1MU6B 2FP7B 2XWBI 2FYRA 1S5SA 2DE8A 3OU0A 2ESTE 3UUZA 3RXBA 1K9OE 1UCYH 3RLYH 1V2QT 2W5EA 1YLCA 2FLBH 2NU0E 1IQIA 2AIQA 1MCVA 1ZPCA 2BZ6H 1A61H 3MH6A 5EXLA 3RXEA 4CRAA 1LVMA 2GCTB 3BN9A 1L4DA 3VXEH 2PWXA 1FAXA 3KF2A 3QLPH 2GMTC 3SZNA 3T25A 2ZKSA 4UFFH 1TOMH 2ANYA 2BLVA 2ZDMA 1SGTA 3LH1A 1YPKH 1TQ0B 3C1KA 1LKAA 1V2KT 1UHBB 3SNEA 3OYPA 1VITF 1DXPA 3M5OA 3NKKA 5E0GA 1J15A 1NROH 2O8UA 1T7CA 5FCKA 3D62A 3MO6A 3DT0H 5AFZH 4Q7YA 1K2I1 4WH6A 1A5GH 1ZHMA 2XTTB 2C8YB 2FOGA 4IC5A 1CT0E 1LVYA 4LOYH 1HDTH 2BZAA 2Q6DA 2TGPZ 2WYGA 4HZHA 2AGEX 2THFB 1D6WA 1FY1A 1LHGH 1YBWA 3QTOH 1FDPA 4IS5A 5L6NH 4DURA 1O2HA 5F03A 1YPHE 2BQ7B 1CBWB 2FMJA 3PMJA 1K22H 4CREA 1K1OA 1C1NA 3ATKA 4XBCA 3DA9B 1QBNA 1YC0A 3LONA 1AN1E 3M5LA 4YLUA 2IN2A 1LHDH 3E16B 4PROA 1S85A 3SJOA 1FAKH 3I78A 1PPHE 2XYAA 4B73A 1MD8A 2BD2A 1XUGA 4CHAC 1C2HA 1ZGIA 1O5FH 3F9FA 4MNYA 5ETXA 2NU2E 3V7TA 1ORFA 1SLUB 1KLTA 3O8DA 5EPYA 4INKA 1O2XA 1O2LA 1PJPA 2CF9H 2ZFRH 3M61U 3ZV9A 4FU8A 3GYMA 1GI0A 1BHXB 1THPB 1DPOA 2ZPQA 4AG1A 3LC3A 1UTKA 1SR5C 2ZGXH 2A5AA 2ZGBH 3FFGA 1C5ZB 3PROA 4ABBA 1SGFG 5C2ZA 4ZHMU 5HXFA 1C4U2 4OS4A 4Y10E 1GI5A 5A0BA 3SUDA 3DFJA 3ITIA 3KN2A 3BV9B 1S0QA 4O9VA 1GMDF 3DFLA 1QJ7B 3A83A 1TIOA 1C9PA 2R2MB 1V2OT 1GI8B 1O5DH 1GJDB 1HIAA 4Q7ZA 4FUEA 1GJ7B 1SL3A 2W3IA 1T32A 3FZDA 3TLOA 2OC0A 3IWMA 1Y3VA 2P16A 1QA0A 3SJ9A 1MTSA 4Y8YA 4CRFA 2G55A 3VPKA 2GCTC 2CV3A 2KAIA 1P2KA 1IQGA 5L2ZH 1LKBA 1C5WB 2BD7A 4A1VA 2A7CA 4AFZA 3FP8E 4E06H 1N6XA 2OINA 1AMHA 3MU0A 1QB9A 3MHWU 4JZFH 1O36A 1Z8GA 1O39A 1NN6A 3KEEA 1IQEA 2J92A 1HNEE 3ZZ9A 5LPEA 2P8OB 1YCPH 1HXEH 1P0SH 2BLQA 1GL0E 4DGJA 1BTUA 3TH4H 1KDQB 2G4UA 1AFEH 1BB0B 3LGWA 1L1JA 1O2SA 1P2NA 1J9CH 1V2WT 1UK2A 1Y3YA 1AZ8A 1ZZZA 5LPRA 1P3CA 4WF8A 1W11U 3GCTF 1RXPA 1UTPA 2A0QB 1SHYA 1BTYA 1YLDA 2FOBA 3MNCA 5ESBA 2BHGA 1GBFA 3JZ2B 4GAWA 3EGKH 4J2YB 4Y0ZE 3P70B 3A82A 1RD3B 1XUHA 1ZSJA 2WYJA 2ZFFH 2GGVB 3SGQE 4CH2B 1BRUP 1EB1H 4HFPB 3MNXA 1YPEH 3TU7H 1W12U 1CBWC 3BG4B 2PW8H 2G52A 4H4FA 1YM0A 4X1QU 2FOEA 4ASHA 1TBZH 1KXFA 1AHTH 3P8GA 4ISLA 1H8DH 3MO9A 2BLWA 1AKSA 1TBQH 1OKXA 2ZTXA 1CHOF 2OP9A 1VITG 3ZZ3A 1FZZA 4D7FA 4DJZB 2H9EH 2ZU5A 3E91A 3ZVCA 4FXGH 4YOIA 3OY6U 4YOJA 1XKBC 2OLGA 1P2QA 3F6UH 2PHBA 2XBXA 1OWEA 3SNBA 2VVUA 6CHAB 2ZDAH 1S84A 3SGAE 4D76A 1O2UA 4DCDA 4FVDA 1GBJA 3ZVDA 2WINI 1A3BH 4K1EA 2GT8A 3TITA 1TQ7B 4MPXA 2FESH 1DT2A 1KXBA 1SGPE 3EE0B 1EQ9A 5EPNA 1EZQA 2C8XB 3LC5A 1XVOA 2XW9A 1AB9C 3LKWA 5GCHF 1HPGA 2A1DB 2VWMA 3RLWH 3ESTA 1LDTT 2QN5T 1IQHA 3GY6A 1WOFA 3PLPA 5AF9H 1CGHA 1OXGA 1QGFA 1BTZA 1Z6JH 1C2EA 2BX4A 2P93A 3QDZB 1C5LH 2JKHA 1FIZA 1BJVA 2BXTH 3RXSA 3BTFE 3IG6B 2VJ1A 4FUHA 2FEQH 3ZYEA 1CVWH 1O5GH 3TK6A 4FUGA 4X6OA 3LOXA 5K7RA 1GBIA 4BXSA 4NIVA 2W7SA 1HB0B 2EA3A 2A4QA 1VITH 4MQAA 3HGPA 3PTBA 1JOUB 1TMBH 1WTHD 1UK4A 3KQDA 5JB9S 5CE1A 3FAOA 2PR3A 1KXCA 2ZG0H 5EODA 3SU6A 4JZDH 4DW2U 3S7KB 1AWHB 3RXJA 1O2GH 2CJIA 1TB6H 2H5CA 2R2WU 1ZTKA 2BDIA 4K1TA 4JYUH 1ELCA 1PPFE 1DICA 3GY5A 3Q76A 4E7NA 5C67A 1ID5H 5A09A 3MWIU 4X8TH 1D9IA 1TX6A 2ULLA 3LGVA 4X2WA 3MOCA 1BTXA 1VGCC 2DE9A 1O30A 2FDAA 1GMDG 1IQFA 1V2TT 1OP8A 1UHBA 1YGCH 2A4RA 7GCHF 1XM1A 1C1OA 2XWAA 2FYQA 1O5CB 3F9HA 4ISHH 1HRTH 1F5KU 1O5AB 3H7TA 4K8BA 1DITH 1MZAA 1C1VH 1V3XA 5E2OA 1ANBA 3UIRA 2V0BA 5L2YH 5B6OA 3TPIZ 1D3QB 2F9VA 1C4Y2 1OSSA 1QNJA 1UTMA 3VFEA 1ESTA 3MMGA 3L6PA 1TABE 1HAVB 1TALA 3BG4C 1P2JA 4FVBA 2H9TH 2PLXA 1UTLM 2R0KA 3V0XA 4H6SB 2ZTZA 5EU8A 3BEIB 1O2WA 3TVJB 2FOAA 1FY5A 1DSUA 4AYYB 1ANDA 3RXMA 5A8YA 1J8AA 4AB8A 3LPRA 2ZU4A 2YNBA 1BRAA 4X6MA 4CR9A 1EAXA 2BDBA 1DLEA 2ZP0H 4MNXA 1W13U 1FUJA 2HNTC 6LPRA 1NRSH 2PTNA 5C1YA 4BAHB 1PFXC 5HGGA 3HK3B 4XOJA 2CHAB 4F4OC 2PSYA 2ZHFH 3URCA 3ZZ7A 3ZZAA 3URDA 3BTEE 2QYIA 2G8TA 1C2LA 1GGDC 3A80A 1A1RA 4Q2KA 4O03A 1H8IH 3STJA 2RA0A 1O3MA 1MUEB 1QRZA 2BQ6B 1GBAA 2P94A 1Y3XA 3STIA 4JK6A 6GCHG 1JIMA 2ZQ1A 1OWIA 1TNKA 2OTVA 1A0JA 7KMEH 5A0AE 1WU1A 2Y7XA 1AO5A 4K3JA 3RXHA 1K28D 1CA8B 2BD9A 3UFAA 4JCNA 5BRRE 3M37A 2ZCHP 1AIXH 3LDXH 5HM9A 2CGAA 3LGYA 1GI9B 4R0IA 1Z1JA 1E36B 3A84A 1LHFH 3D65E 1F0TA 3GY7A 4X1SU 4DOQA 4ZXYH 1N8OB 2V35A 4VGCB 1ZPZA 1GJ4H 2ZPSA 3M3TA 1YCPM 4TYDA 1VJAU 1C5UA 2Z94A 3RP2A 1SPJA 1OOKB 2W26A 5K0HA 5DO4H 2OCVB 1JMOH 2ZNKH 4JZ1A 4JZEH 5LH8A 1FPCH 1AVGH 1FONA 3UR9A 2QXJA 4FUBA 3TH3H 1EATA 3M5MA 5GJ4B 3TIUA 2BDCA 4UFGH 1VJ9U 4CH8B 3TJNA 2YNAA 2ZTYA 3RXPA 4JZIA 5CMXH 4ABIA 1MD7A 2YOLA 3VB5A 2ZFSA 3SV6A 1KYNA 2AGIX 5GCHG 1BQYA 2ALVA 3A7VA 4NA9H 1QA7A 5GXPA 3SU4A 3F1SB 1TRMA 1GHWH 1QQUA 5DPAA 4ZH8A 1EB2A 1L4ZA 2BQWB 4XFQA 4CBNA 1M9UA 2G5VA 1DM4B 2SGDE 1O3KA 4ABEA 1XKAC 4I33A 2ZZUH 1V2ST 4NGAH 1FN6A 1E0FD 1RRKA 3GYLB 1C5YB 3AW0A 4K2YA 1KDQA 2H1UA 5A8XA 4IBLH 4JK5A 2VH0A 3UTUH 2QV1A 2C3SA 2Y81A 3E8LA 3T28A 3SQEE 2F9UA 1DS2E 2Z9GA 4ZXXH 3E1XB 1WQSA 3T5FH 1F7ZA 4D7GA 2QAAA 5FBIA 1PYTD 3RXUA 3GY4A 3OY5U 1PPBH 1O3PB 2VWNA 1Y3UA 2H9HA 1KXDA 5FBEA 3TJVA 1K1LA 3NCLA 3HKIB 2ANKH 1O5EH 1V2MT 8LPRA 2WPMS 2GV6A 1NO9H 2EI8A 4AGKA 4A5TS 3SO3A 5JBAS 2CHAC 1JIRA 1Q31A 1GI6A 3QWCH 2ZCLP 3SI4H 3ZVEA 1ZJDA 1TNJA 2TGTA 4AOQA 2NU3E 3QGJA 1BTPA 1HAZB 1JRTA 3MH5A 4DVAU 1E37B 4FUCA 2BLOA 4FU9A 3RXTA 2GTBA 1TLDA 1BJUA 2AGGX 1N1LA 1V2RT 1O3CA 3ZZCA 2B9LA 2O8MA 2F83A 5C1XA 3Q00A 4DY7B 2G51A 3MFJA 4U30A 3E0PB 4XBDA 2GZ7A 3P6ZB 3TGKE 4Y6DA 1C1WH 1P2OA 3ZVAA 2VGCB 1T8MA 2FODA 1SFIA 2BD8A 2FOMB 1G30B 4MVNA 4MNVA 1ELFA 1DY8A 3E3TA 3LJJA 1NTPA 4WY3A 4BNRA 1OWKA 4I7YH 1K21H 1CGIE 1GDQA 4VGCC 1C5SA 1U6QA 4Y0YE 1LPGB 1W0YH 1BZXE 1GVLA 3W95A 3LGTA 4YOGA 2OC7A 1S6FA 1SSXA 4GCHG 3VXFH 2ODQA 3RXCA 1OP0A 2Y80A 4K5ZA 3K9XB 3RUOA 1HAOH 3MI4A 2BD3A 4NZLA 2AMQA 1G36A 3O8BA 2JH6D 3ODFA 1F5LA 3SU2A 4ZROA 1TA6A 4CR5A 2Z3CA 1THRH 2BY8X 2LPRA 2QA9E 3CENA 3VB7A 5LGOA 1NC6A 3A88A 3A86A 1OWDA 1QIXB 4X6NA 5C20A 1KXAA 4MPUA 1TPSA 1DFPA 4X1NU 1P03A 5A8ZA 3H5CB 5DP4A 4F49A 1KLIH 2GVFA 4GVUA 1FN8A 2SGPE 1BBRE 4A7IB 4I8GA 1SVPA 1NT1A 1ZLRA 2XBWA 2Z9LA 5TCCA 1MKXH 4KKDA 5ESTE 3HKJB 3RXRA 2A5IA 3LGIA 1GI4A 2OBOA 3CS7A 2HGTH 2UUYA 2UWLA 2XC5A 2FZZA 2VINA 3VGCB 3SU5A 1MTNC 1GCTC 1WTGH 1TNIA 1GI7B 5DG6A 1C2MA 2PKAB 4DT7B 4HGCA 3TNTA 1V2JT 4Q80A 1HAVA 3PTNA 3SU0A 1NFYA 2PKSC 2PGBB 1PPEE 1QQ4A 4I8KA 4X8SH 2BDHA 3M7UA 4YM9A 3PMBB 3RMMH 2ANWA 1Y3WA 1DY9A 3NZIA 4GHQA 3F9GA 2BB4A 2D26C 1CO7E 5E0HA 4ABGA 3PMHB 2IJOB 1FY8E 1A5HA 1TPOA 3BTGE 5HYOA 1MCTA 1PPCE 4INHA 2ZU3A 2C90B 2GDDA 3MU1A 2H2ZA 4MTBA 4I8JA 2BOKA 2Z7FE 1DVAH 1H9IE 1O2VA 4K8YA 1QURH 1NFWA 1EPTB 4B75A 1O2IA 1SGDE 2XXLA 1J14A 1EAIA 1EXFA 4Y79A 2HALA 2EEKA 4I8LA 3NK8A 2P59A 2VGCC 1V6DA 9LPRA 3UY9A 1XMNB 2ZF0H 1TFXA 3BTME 3PB1E 1BTWA 3S0NA 4LZ4B 3S9AA 3KCGH 2SFAA 1AUJA 3RC5A 4H42U 3PM3A 1Y8TA 4RKJB 4NSVA 4KGAA 1HYLA 1D4PB 1XUFA 2FOFA 1TRYA 2WUBA 2ASUB 4TY6A 1O3AA 3BEUA 4KTUA 2ZGJA 3FP7E 2OC1A 2Q6GA 3SHCH 3A8CA 5HMAA 1B5GH 1O37A 1C2JA 5EGMA 3KNXA 4NCYA 3KHVA 2ODPA 1AVWA 2B8OH 1DWDH 1SLWB 2UUFB 3MNSA 3FVFB 1SGYE 1O38A 1G37A 2C93B 1TOCB 2P3UB 2STAE 3ZZ5A 4ABAA 1CHGA 8KME2 1T31A 4OS7A 3QGNB 5C3NA 1ETSH 1P01A 5J4SA 1IQNA 2Q6FA 4FUDA 3ZVGA 1BA8B 3BIVH 1GHXH 1K1IA 2GP9B 1QCPA 3TJUA 3ZZ4A 2R3YA 1H9HE 4BOHA 5BPEA 1LVOA 1GVKB 1FPHH 3E0NB 2PTCE 1ESBA 2ODYB 4IMQA 4LK4A 1SOZA 3QZQA 4NZQA 1GBCA 1RIWB 3QZRA 5C5OA 2ZO3H 1JRSA 1LHCH 2FPZA 3PLBA 3A87A 3MH4A 3SNCA 1GJAB 6GCHF 1P2MA 1C9TA
chains in the Genus database with same CATH superfamily
1ELBA 1HLTH 1NFXA 2UWOA 4AB9A 3U8TH 1K1PA 4BXWA 4MPVA 4Y11E 5GWZA 1UCYK 2BM2A 2O8TA 1GBTA 3IITA 4IN1A 2C8ZB 2HPPH 1C5NH 3F3BA 1H8HD 2A4OA 4RN6A 4WJG2 1QB1A 4YT6H 2ZGCA 1YPJH 4QT8C 3SGBE 4GHTA 4XSKU 3AAVA 1EUFA 3UWJH 3NRLA 1NS3A 2F9BH 3ATMA 3RXVA 4UDWH 2OUAA 4ABFA 3SU1A 2XNDD 1EP5A 5EOKA 1L1GA 3EA7A 1SI5H 3UR6A 2O8WA 2Z3EA 1AY6H 2QY0B 5FCRA 1QL8A 3RC6A 4D9RA 1S6HA 2CF8H 2ZEBA 3TK5A 1GPZA 1AUTC 1JXPA 1RFNA 3TGJE 3N7DA 1EAUA 1G3CA 1HBTH 2BX3A 2Z3DA 3G01A 1T8NA 1BIOA 4I32A 2F3CE 3EQ0H 3A8AA 3ZZDA 5AFYH 2VIDA 2SNVA 3RU4T 1F0SA 3MU4A 1IQKA 4J1YA 3U9AH 4ACBA 4ACAA 3VB6A 3F9EA 4CRBA 1O3DA 1QB6A 1W14U 4AZ2B 3OSYA 1O2TA 4JMYA 1Z8RA 3AW1A 3UWIA 4GUXA 1GBLA 1SFQB 3QTVH 2PFEA 5H4IB 3ZYDA 1BBRH 1EX3A 4ZHLU 5JBCS 2BY7X 2J2UA 2TGDA 2AYWA 3GCHB 2XC0A 1F0UA 1DANH 1SQTA 4X1PU 2ZCKP 2FTMA 1QL7A 5JDUB 2RFKC 1D6RA 1UTQA 4OS1A 5FHTA 1O35A 4ISIH 2TIOA 1ZYOA 3R0FA 2VVVA 1O2JA 5TCAA 2Y7ZA 2SGAA 1O3LA 1KY9A 2AFQB 7ESTE 4INLA 1ZRKA 1K1NA 9ESTA 3UQVA 1NU9A 3RXKA 1PPZA 1NPMA 2ZU2A 1UVSH 1YPGH 2VWOA 3A7XA 2RDEA 4Z6AH 1MQ5A 2P8OC 2JH0D 4O3UA 4U32A 2QGRA 4NWKA 2OQ5A 4CRCA 4B1TA 4HG6A 4IMZA 3RXFA 2I6SA 1FQ3A 2QXGA 5IK2D 2NWNA 2ANMH 1WQVH 1FNIA 1VR1H 4KELA 1TMTH 4Y71A 2WV4A 1MTUA 1GG6B 5FX6A 1AWFH 1ZSKA 1ESAA 1A3EH 2STBE 3U1JB 2VIWA 2VNTA 3T62A 2TGAA 4YT7H 1EKBB 1O2RA 3KIDU 4U01A 5E8EH 1AVXA 1E34B 4LZ1H 4SGBE 4A92A 1MKWH 5TJXA 1OHHD 3LJOA 1GI2A 1V2PT 4R8TB 4ZMAH 1QHRB 1MQ6A 2HLDD 2FLRH 2V6NA 3R3GB 3SU3A 1L1NA 1Y5AT 1C5TA 1BHXF 5L30H 1TONA 4NIXA 2AEIH 1CQQA 2PKAA 2WUCA 1SMFE 2R0LA 1MBQA 3P92A 1BT7A 1MABB 1CGJE 1TNHA 1SGEE 3U8OH 1VZQH 4X2XA 3QK1A 2BVRH 4WMEA 6CHAC 3KL6A 4GCHF 3BTQE 1D3TB 1O2ZA 2ZHWH 2KX4A 1O3JA 1CT4E 1C5RA 1OWHA 3GICB 4CBOA 4A6LA 1WUNH 3A85A 1ZGVA 2WPJS 1ELDE 1ZMJA 1SOTA 2B7DH 1OPHB 3H09A 1YCPK 1P04A 3BTTE 1PQ5A 1ZHPA 2A7JA 5EQRA 5FPTA 4A1TA 1RGQA 1B0FA 4OS6A 1HFDA 2ZDLA 1FIWA 1EPTA 2BY9X 2FWWA 4NA7A 4A1XA 1P10A 2XCNA 1EOJA 1L0ZA 2A2XH 1GBKA 4YTAA 3ZVFA 5CHAB 1P05A 1A4WH 1XUJA 1OX1A 2EI7A 1QFKH 2FS8A 1AFQB 1DWEH 3MU5A 2J98A 3TJOA 3WWFA 3MO3A 1UO6A 2XCFA 3GCHC 1A2CH 4BANB 2QF0A 2FOHA 5DP5A 1DWCH 1GWAA 2W6JD 4K69A 3PWBA 3RXAA 1C1TA 2QF3A 1SGRE 1ZRBA 1GJCB 2SNWA 3PV4A 3GY2A 3WY8A 3PYHA 2J9NA 2F9NA 3PWCA 3C27B 4NIYA 1DLKB 1FY3A 3SI3H 1YLNA 1SG8B 3D49H 1TAWA 1E35B 1F92A 3MU8A 1C4V2 2HRVA 1A5IA 3QO6A 2OXSA 3SYJA 1QTFA 2C8WB 1C1QA 1GJ9B 1WXRA 2VVCA 4TPYA 4OS5A 1JWTA 1O32A 1B0EA 1KSNA 4K1SA 1O3EA 1C5VA 1GG6C 3U28C 1SC8U 5T6DA 4IN2A 4K60A 2ZHQH 1ZSLA 4DG4A 1WYKA 2BTCE 3MYWA 3O8RA 2D1JA 4IGDA 1GHYH 1TRNA 3TK9A 2WPDD 4AFUA 4BAKB 1EJNA 4NFEA 2ZWLH 2HNTF 2LNCA 4ZHAA 1PQ7A 4ZKRU 3EAJA 2FXRA 1NRRH 1DOJA 1HUTH 1UVOA 1Z71A 1TNGA 4F48B 5IDKA 4Z0KA 1O3IA 1BMNH 2HNTE 5JB8S 1A0HB 1YKTA 2XNIA 3BIUH 2BDGA 4AGJA 4MG3A 3ENSB 4GSOA 2TRMA 2ZA5A 1W7XH 1TX8A 3S9BA 1GBBA 3DUXH 4B76A 1LCYA 4BAMB 1C2DA 2XC4A 2ZFTA 1YPHC 4CRGA 2P95A 1SGCA 1V2VT 3PMAB 3PV5A 1MH0A 1RTFB 3M7TA 3W94A 2BY5X 3OTJE 4YESB 1W7GH 1QL9A 4UONA 1MAXA 3UPEA 2J34A 4RSPA 3M35A 2PUQH 3F0OA 2GKVE 1CU1A 1HCGA 4DIIH 4CHAB 3FZZA 4OGYA 1SLXB 2ZDVH 4DIHH 1EZSC 2BXUH 3ZZ8A 1XUIA 4AYVB 5EQSA 1SGFA 5CHAC 1HAGE 1C5QA 3SJ8A 1AFQC 2IJD1 1DUAA 1C5XB 1AZZA 2G5NA 1KMHB 4ZUHA 3UOPA 1N8OC 2I6QA 1FXYA 2HWLB 3GY8A 1NESE 3SW2B 2WPLS 2CN0H 2GCHF 1LPZB 3UOUA 3GY3A 3F68H 3K6ZA 2PUXB 3LIWA 1OWJA 4NWLA 2GDEH 3I77A 2BVXH 2VIOA 3U1IB 2ZFQH 3RDZA 1OS8A 6ESTA 1ZTLA 4D8NA 3QN7A 1D3DB 2ZIQH 1ARCA 3TNSA 4X8VH 2B5TB 1TA2A 1DE7H 4TWWA 1GJ6A 1O0DH 2F4LA 3AAUA 4MNWA 1KTSB 5AHGH 5JPMH 5T3HA 3NWUA 3OEHD 1GCDA 2A45B 1W0KD 4I8HA 2WV5A 3WWBA 2WZQA 4H6TA 5GNDA 1C2GA 3UNRA 3BF6H 2V3HH 5C1UA 5F53A 3HPTB 1YYY1 1C1RA 2VB0A 2ZGHA 3SV9A 5JBTA 1G32B 3SJKA 3U69H 1ELTA 5T1VA 1O3HA 1ANCA 1ELEE 2JH5D 1P02A 1HJ8A 5FPYA 3GCNA 1ZMNA 2Z9KA 5E0JA 5DGJA 3UNQA 2XBVA 4X8UH 3I29A 1S81A 1GMCF 1NM6A 4MLFB 1HJ9A 4WH8A 3A7WA 1GMHG 1ZTJA 4Z1MD 1O3OA 2BOHB 3ZZBA 3DD2H 2PGQB 3Q3XA 2Y82A 4UEHH 3D23A 1FMGA 3KQEA 2KFWA 1TGBA 2OD3B 1TNLA 2AH4X 3QUMP 1TGCA 5GIBA 2W3KA 2TPIZ 1QR3E 1LTOA 2FX4A 4BTTB 3Q3YA 4BTUB 1UMAH 2UUKB 4AX9H 2YMSB 3BTHE 3N7OA 2M2AA 5EXNA 5A0CA 7LPRA 3KQBA 3S69A 3GDVA 3AVZA 8ESTE 2QXIA 4YZUA 2FIRH 1GJ8B 4CRDA 5EW1H 2P3TB 1GHVH 1SQAA 1XUKA 1EFRD 3LGUA 5C5NA 3HK6B 4FUFA 2NU4E 4B2CA 3U8RH 5IYTA 4NIWA 3GOVB 1FY4A 4WWYA 5FXLA 2ZDKA 5T6FA 4AFQA 1ZPBA 1IOEA 1O5BB 3M36A 3V13A 4X1RU 1TPAE 1C1MA 3K2UA 5F8XA 1O3NA 1P11E 1Z8IB 1W2KH 3T26A 2SGQE 2V3OH 2TBSA 1YF4A 1GBDA 1XVMA 5DKMA 2AERH 2GV7A 2R3UA 1FX0B 2BYAX 1D3PB 1HGTH 3T2NA 4NA8A 4ABDA 2J38A 2SGEE 4B2AA 1AB9B 4YLQH 2AMPA 2WV9A 1HAYB 1E1RD 1J16A 2IOTA 1UVTH 1DDJA 4XE4A 2GX4A 1GBEA 1GHZA 1C2KA 2HLCA 3BTWE 5HM2A 3RMOH 1QZ8A 1TE0A 1NRPH 3ELAH 2AS9A 4UFDH 1TYNA 4THNH 5KGOA 3RMLH 1IHSH 1RTLA 1GHAF 2UUJB 1AQ7A 1NRQH 1FJSA 3F0PA 1F5RA 2J4IA 4XBBA 5C17A 1O2KA 3DSPA 2SGFE 2F43B 4GPGA 1TGTA 1UK3A 1VCPA 2RA3A 2ZDNA 1J17T 1KXEA 4Q7XA 3T27A 1GHBG 1XX9A 1ANEA 3LH3A 4E05H 1EOLA 2FI3E 2HOBA 1V2NT 2WPHS 3KYFA 1IQLA 2Y6TA 2A31A 4NFFA 1EAWA 4I31A 1E38B 4AORA 4RKOB 1QBVH 1JBUH 3M7QA 3KQCA 2FM2A 3PV2A 2GCHG 3O8CA 1C5MD 3VGCC 2CMYA 5DP7A 1C5OH 1V2UT 3PRBA 2G4TA 1PYTC 2O8LA 4XDEA 1S82A 2EI6A 1VGCB 2JJ1D 2B0FA 2G00A 3V3MA 1AGJA 4UD9H 2OQUA 1QJ6B 1BMMH 1T8LA 2Q1JA 3KGPA 3BEFB 1BOQA 5B6LA 2A4GA 3P17H 1EZUC 3EDXB 3H7OA 1SB1H 1HAXB 1UVPA 2M5TA 4I86A 4WMFA 3MNBA 1ACBE 2K1QA 4RT1A 4AFSA 2A32A 1TGSZ 1IQJA 5EW2H 2D8WA 1A46H 1UTJA 1Y59T 2YMSC 3SHAH 3VB4A 1UJ1A 1C1PA 3OTPA 1C2FA 1P3EA 2CXVA 2H5DA 3K6YA 2AIPA 1SGQE 1ELAA 2BVSH 4X0WU 4ISNA 3P8NA 4IC6A 1TGNA 5A2MH 3MTYA 3ODDA 1P9UA 3PO1B 1UTNA 4D9QA 3OAAD 1GDUA 4WXIA 1KLJH 1NY22 2GT7A 1ZR0A 3F2GA 1FV9A 1EPTC 1LHEH 2Z6BD 1G3DA 4M7GA 2ZU1A 3L3TA 4WXVA 1FLEE 3A8DA 1YPMH 2J97A 3SN8A 1GMCG 3SNAA 1HAPH 1N6YA 3BTDE 4Q63A 4B71A 3NPSA 4NG9H 1TX7A 4KP0A 1DSTA 3UREA 1O33A 3U98H 1MKXK 3MH7A 1BTHH 2ZQ2A 3EYDA 4FUIA 2A5KA 2UWPA 4OGXA 1SKYE 1GGDB 1IQMA 3OEED 1QRWA 1S0RA 1BUIA 1X7AC 1OYTH 3ZVBA 5DP3A 5I46H 1H9LB 1KTTB 4ZKSU 1AI8H 1LPKB 3TH2H 1QRXA 1TMUH 3BG8A 5DK1A 4ISOA 5F8TA 2J95A 1GI1A 1XXFA 3ZZ6A 2VIQA 2Y5HA 1GI3A 1O2QA 1AU8A 3F2FA 3NUMA 1O34A 2F91A 1L2EA 1WBGB 2C4FH 3ATWA 5HKKD 2RG3A 1T4UH 1CE5A 2IPHA 2ZHDA 1NBME 1T8OA 2VWLA 2OBQA 5KEDA 2QCYA 3SV2H 1Y5UT 1ZHRA 2BD5A 2AHME 1PPGE 5DSFA 2FOCA 3P95A 1O3FA 2RCEA 3RU4E 5KECA 1OP2A 3B23B 3VB3A 1EASA 2G81E 2VIVA 1G2LA 1PQ8A 4FUJA 2VU8E 1RIWC 2ZC9H 5JYIA 3M3VA 1WCZA 4U2WA 2JJ2D 1O3BA 3FANA 1W3CA 3SJIA 1MTVA 1VCQA 3P8OA 1H4WA 3L33A 4FOUC 2HVXA 4UE7H 3RXIA 3SUFA 1UCYE 4ZKNU 1MZDA 3OX7U 2PSXA 2RDLA 4FU7A 1EP6A 3S9CA 1LQDB 1RJXB 1GHAG 3AASA 5DP9A 1GBMA 2FO9A 2O9QA 1SLVB 5SGAE 2NU1E 1ZMLA 1ETRH 1SBWA 2BD4A 1XXDA 3LU9B 1AE5A 5EXMA 4TPIZ 2F9OA 3Q3KA 3RXLA 4TSFD 3GDUA 3RM0H 1AD8H 1O31A 4Y7BA 2AMDA 3SQHE 4WMDA 4F55A 1HJAB 4JYVH 1NFUA 5FX5A 3EA8A 1CA0B 3PLKA 5DJ7A 5EG4A 1ARBA 1IHTH 2HPQH 1MTWA 1W0ZU 2XRCA 1P2IA 1Z7KA 3PO1C 3V12A 3RC4A 3E6PH 2WPKS 1CT2E 1GJ5H 3BSQA 5EJLA 1EJAA 3EA9A 5E2PA 4BTIB 2W7UA 5ABWA 4HTCH 4WVPE 4KTCA 8GCHF 1YPLH 1OYQA 2WPIS 1Q3XA 1GBHA 2JDID 4X2VA 1T4VH 3M3SA 3A7YA 2XOKD 2GZ8A 1HXFH 5LPFA 3SOSA 2ZHEH 2VH6A 4TY7A 3SUGA 1Z8JB 1K1MA 4RI0A 1MBMA 3GCTG 3GISB 3DSOA 3NXPA 1DUEA 2OK5A 4ASUD 3RMNH 3SV8A 1P57B 2QXHA 5J4QA 3A89A 4ABHA 1ELVA 1P12E 4X6PA 1W0JD 1WV7H 1QBOA 1DXWA 3A7ZA 2JETB 5PTPA 1A0LA 2A7HA 4Y8XA 1Q2WA 1UVUH 1G3EA 2ZECA 4UFEH 1O2OA 4KTSA 2EC9H 3E90B 1LVBA 1G2MA 1HIAB 1HAIH 1F2SE 2R9PA 2ZI2H 4E7RG 5FAHA 1H1BA 1GMHF 1EZXC 4ZAEA 1ABJH 3UQOA 3SV7A 2QIQA 3MQKC 2BMGB 1CHOG 2JIZD 3GCOA 5F6MA 5DP6A 1MAYA 4LXBH 2Y5GA 1K0HA 1SHHB 2KCPA 2KAIB 2FI5E 2Z9IA 1O2MA 1NZQH 2ZPRA 4MPWA 1V2LT 1MMJN 1BCUH 4Y8ZA 3ATIA 1BRBE 3DHKH 1CSOE 1F0RA 4O97A 5EQQA 1ABIH 3RXQA 1O2NA 3QX5H 1FI8A 2QC2A 3HGNA 2FI4E 3RM2H 1NRNH 4Y76A 1AE8H 1BRCE 2F9PA 1GDNA 2D2DA 2GMTB 1BMLA 1P09A 4Y7AA 3B8JA 1C1SA 3GDSA 1P9SA 3P8FA 1E1QD 1HAHH 1O2PA 2P3FH 3RXOA 2FX6A 1O3GA 5DP8A 5AVDA 1W10U 3SORA 1LMWB 1LO6A 1EJMA 1UTOA 1P06A 4SGAE 1ZJKA 2PV9B 4MDSA 2ZFPH 2FS9A 1SQOA 1IAUA 1NBMD 2VBCA 1ZOMA 4OS2A 1GL1A 2Y5FA 1BBRK 1BDAA 1VCWA 3LT3A 3M5NA 2A2QH 3UNSA 1WSSH 4NSYA 1TPPA 1QJ1B 3Q77A 4AG2A 1Z1IA 2VIPA 4BAOB 1HJAC 3JZ1B 4YXWD 1CA0C 3RU4D 1YP9A 2IPQX 1BITA 1S83A 3B9FH 1NU7B 1VKYA 1MTNB 2Z9JA 5I25A 1DX5M 2FTLE 1LQEA 1TBRH 1AKSB 1Y5BT 5C0UA 3ATLA 1QY6A 1GCTB 2BY6X 1BMAA 1B7XB 5GDSH 1G3BA 4B2BA 4ESTE 3TGIE 2GD4B 1YY3A 3RXDA 2GZ9A 5JBBS 4BAQB 3OFND 2PKSB 3A8BA 2LP6A 4YO9A 5G4BA 1THSH 1KIGH 2H6MA 2XBYA 3A81A 3F2HA 1O2YA 1K1JA 3HATH 1GVZA 5T6GA 1TWXB 1W8BH 7GCHG 1DWBH 3A7TA 1GJBB 1SGIB 4TWYA 1ELGA 5FPSA 2BDYA 1C2IA 5EJZA 1GHBF 1HV7A 2BDAA 4X2YA 4B74A 3FP6E 1Z6EA 2ALPA 2ILNA 1SGNE 3T29A 3ZV8A 1A7SA 3RXGA 5F8ZA 3K65B 1RTKA 2JETC 5HIZA 4GLYA 1WAYB 4ABJA 3SBKA 3S7HB 3CP7A 3SUEA 4ZKOU 2OC8A 1INCA 1C1UH 1PQAA 1RS0A 5EJ1A 4O3TA 4IW4E 4AN7A 1MKWK 5GPIB 3BTKE 1P8VC 1ETTH 3VEQB 5CDFE 1C5PA 2J94A 3SNDA 2DUCA 4HI3A 1G9IE 8GCHG 4JYTA 1MU8B 3VG8A 3CS0A 1MU6B 2FP7B 2XWBI 2FYRA 1S5SA 2DE8A 3OU0A 2ESTE 3UUZA 5C94A 3RXBA 1K9OE 1UCYH 3RLYH 1V2QT 2W5EA 1YLCA 2FLBH 2NU0E 1IQIA 2AIQA 1MCVA 1ZPCA 2BZ6H 1A61H 3MH6A 5EXLA 3RXEA 4CRAA 1LVMA 2GCTB 3BN9A 1L4DA 3VXEH 2PWXA 1FAXA 3KF2A 3QLPH 2GMTC 3SZNA 3T25A 2ZKSA 4UFFH 1TOMH 2ANYA 2BLVA 2ZDMA 1SGTA 3LH1A 1YPKH 1TQ0B 3C1KA 1LKAA 1V2KT 1UHBB 3SNEA 3OYPA 1VITF 1DXPA 3M5OA 3NKKA 5E0GA 1J15A 1NROH 2O8UA 1T7CA 5FCKA 3D62A 3MO6A 3DT0H 5AFZH 4Q7YA 1K2I1 4WH6A 1A5GH 1ZHMA 2XTTB 2C8YB 2FOGA 4IC5A 1CT0E 1LVYA 4LOYH 1H8ED 1HDTH 2BZAA 2Q6DA 2TGPZ 2WYGA 4HZHA 3WW7A 2AGEX 2THFB 1D6WA 1FY1A 1LHGH 1YBWA 3QTOH 1FDPA 4IS5A 5L6NH 4DURA 1O2HA 2L6OA 5F03A 1YPHE 2KCYA 2BQ7B 1CBWB 2FMJA 3PMJA 1K22H 4CREA 1K1OA 1C1NA 3ATKA 4XBCA 3DA9B 1QBNA 1YC0A 3LONA 1AN1E 3M5LA 4YLUA 2IN2A 1LHDH 3E16B 4PROA 1S85A 3SJOA 1FAKH 3I78A 2GJGA 1PPHE 2XYAA 4B73A 1MD8A 2BD2A 1XUGA 2PP6A 4CHAC 1C2HA 1ZGIA 1O5FH 3F9FA 4MNYA 5ETXA 2NU2E 3V7TA 1ORFA 1SLUB 1KLTA 3O8DA 5EPYA 4INKA 1O2XA 1O2LA 1PJPA 2CF9H 2ZFRH 3M61U 3ZV9A 3KYGA 4FU8A 3GYMA 1GI0A 1BHXB 1THPB 1DPOA 2ZPQA 3UB0A 4AG1A 3LC3A 1UTKA 1SR5C 2ZGXH 2A5AA 2ZGBH 3FFGA 1C5ZB 3PROA 4ABBA 1SGFG 5C2ZA 4ZHMU 5HXFA 1C4U2 4OS4A 4Y10E 1GI5A 5A0BA 3SUDA 3DFJA 3PRDA 3ITIA 3KN2A 3BV9B 1S0QA 4O9VA 1GMDF 3DFLA 1QJ7B 3A83A 1TIOA 1C9PA 2R2MB 1V2OT 4ZCNA 1GI8B 1O5DH 1GJDB 1HIAA 4Q7ZA 4FUEA 1GJ7B 1SL3A 2W3IA 1T32A 3FZDA 3TLOA 3ZIAD 2OC0A 3IWMA 1Y3VA 2P16A 1QA0A 3SJ9A 1MTSA 4Y8YA 4CRFA 2G55A 3VPKA 2GCTC 2CV3A 2KAIA 1P2KA 1IQGA 5L2ZH 2L74A 1LKBA 1C5WB 2BD7A 4FETA 2HVYB 4A1VA 2A7CA 4AFZA 3FP8E 4E06H 1N6XA 2OINA 1AMHA 3MU0A 1QB9A 3MHWU 4JZFH 1O36A 1Z8GA 1O39A 1NN6A 3KEEA 1IQEA 2J92A 1HNEE 3ZZ9A 5LPEA 2P8OB 1YCPH 1HXEH 1P0SH 2BLQA 1GL0E 4DGJA 1BTUA 3TH4H 1KDQB 2G4UA 1AFEH 1BB0B 3LGWA 1L1JA 1O2SA 1P2NA 1J9CH 1V2WT 1UK2A 1Y3YA 1AZ8A 1ZZZA 5LPRA 1P3CA 4WF8A 1W11U 3GCTF 1RXPA 1UTPA 2A0QB 1SHYA 1BTYA 1YLDA 2FOBA 3MNCA 5ESBA 2BHGA 1GBFA 3JZ2B 4GAWA 3FKSD 3EGKH 4J2YB 2EQNA 4Y0ZE 3P70B 3A82A 1ZSJA 1RD3B 1XUHA 2WYJA 2ZFFH 2GGVB 3SGQE 4CH2B 1BRUP 1EB1H 4HFPB 3MNXA 1YPEH 3TU7H 1W12U 1CBWC 3BG4B 2PW8H 2G52A 4H4FA 1YM0A 4X1QU 3AK5A 2FOEA 4ASHA 1TBZH 1KXFA 1AHTH 3P8GA 4ISLA 4RT0A 1H8DH 3MO9A 2BLWA 1AKSA 1TBQH 1OKXA 2ZTXA 1CHOF 4M9FA 2OP9A 1VITG 3ZZ3A 1FZZA 4D7FA 4DJZB 2H9EH 2ZU5A 3E91A 3ZVCA 4FXGH 4YOIA 3OY6U 4YOJA 4DT4A 1XKBC 2OLGA 1P2QA 1S6LA 1UW7A 3F6UH 2PHBA 2XBXA 1OWEA 3SNBA 2VVUA 6CHAB 2ZDAH 1S84A 3SGAE 4D76A 1O2UA 4DCDA 4FVDA 1GBJA 3ZVDA 2WINI 1A3BH 4K1EA 2GT8A 3TITA 1TQ7B 4MPXA 4B6EA 2FESH 1DT2A 1KXBA 1SGPE 3EE0B 1EQ9A 5EPNA 1EZQA 2C8XB 3LC5A 1XVOA 2K8IA 1AB9C 2XW9A 3LKWA 5GCHF 1HPGA 2A1DB 2VWMA 3RLWH 3ESTA 1LDTT 2QN5T 1IQHA 3GY6A 1WOFA 3PLPA 5AF9H 1CGHA 1OXGA 1QGFA 1BTZA 1Z6JH 1C2EA 2BX4A 2CK3D 2P93A 3QDZB 1C5LH 2JKHA 1FIZA 2WHXA 1BJVA 2BXTH 3RXSA 3BTFE 3IG6B 2VJ1A 4FUHA 2FEQH 3ZYEA 1CVWH 1O5GH 3TK6A 4FUGA 4X6OA 3LOXA 5K7RA 1GBIA 4BXSA 4NIVA 2W7SA 1HB0B 2EA3A 2A4QA 1VITH 4MQAA 3HGPA 3PTBA 2QF5A 1JOUB 1TMBH 1WTHD 1UK4A 3KQDA 5JB9S 5CE1A 3FAOA 2PR3A 1KXCA 2ZG0H 5EODA 3SU6A 1YWUA 4JZDH 4DW2U 1COWD 5HIYA 3S7KB 1AWHB 3RXJA 1O2GH 2CJIA 1TB6H 2H5CA 2R2WU 1ZTKA 2BDIA 4K1TA 4JYUH 1ELCA 1PPFE 1DICA 3GY5A 3Q76A 4E7NA 5C67A 1ID5H 5A09A 3MWIU 4X8TH 1D9IA 1TX6A 2ULLA 3LGVA 4X2WA 3MOCA 1BTXA 1VGCC 2DE9A 1O30A 2FDAA 2KR7A 1GMDG 1IQFA 1V2TT 1OP8A 1UHBA 1YGCH 2A4RA 7GCHF 1XM1A 1C1OA 2XWAA 2FYQA 1O5CB 3F9HA 4ISHH 1HRTH 1F5KU 1O5AB 3H7TA 4K8BA 1DITH 5EIYA 4XD7D 1MZAA 1C1VH 1V3XA 5E2OA 1ANBA 3UIRA 2V0BA 5L2YH 5B6OA 3TPIZ 1D3QB 2F9VA 1C4Y2 1OSSA 1QNJA 1UTMA 3VFEA 5FL7D 1ESTA 2J5UA 3MMGA 3L6PA 1TABE 1HAVB 1TALA 3BG4C 2KZ4A 1P2JA 4FVBA 2H9TH 2PLXA 1UTLM 2R0KA 3V0XA 4H6SB 2ZTZA 5EU8A 3BEIB 1O2WA 3TVJB 2FOAA 2W6ID 1FY5A 3SZEA 1DSUA 4AYYB 2EY4C 1ANDA 3RXMA 5A8YA 1J8AA 4AB8A 3LPRA 2ZU4A 2YNBA 1BRAA 4X6MA 4CR9A 3FO8D 1EAXA 2BDBA 1DLEA 2ZP0H 4MNXA 3FN8A 1W13U 1FUJA 2HNTC 6LPRA 1NRSH 2PTNA 5C1YA 4BAHB 1PFXC 5HGGA 3HK3B 4XOJA 2CHAB 4AC9A 4F4OC 2PSYA 2ZHFH 3URCA 3ZZ7A 3ZZAA 3URDA 3BTEE 2QYIA 2G8TA 1C2LA 1GGDC 3A80A 1A1RA 4Q2KA 3DSGA 4O03A 1H8IH 3STJA 2RA0A 1O3MA 1MUEB 1QRZA 2BQ6B 1GBAA 2P94A 1Y3XA 3STIA 4JK6A 6GCHG 1JIMA 2ZQ1A 1OWIA 1TNKA 2LELA 2OTVA 1A0JA 7KMEH 5A0AE 1WU1A 2Y7XA 1AO5A 4K3JA 3RXHA 1K28D 1CA8B 2BD9A 3UFAA 4JCNA 5BRRE 3M37A 2ZCHP 1AIXH 3LDXH 4Q4LA 5HM9A 2CGAA 3LGYA 1GI9B 4R0IA 1Z1JA 1E36B 3A84A 1LHFH 3D65E 1F0TA 3GY7A 4X1SU 4DOQA 4ZXYH 1N8OB 2V35A 4VGCB 1ZPZA 1GJ4H 2ZPSA 3M3TA 1YCPM 4TYDA 1VJAU 1C5UA 2Z94A 3RP2A 1SPJA 1OOKB 2W26A 5K0HA 5DO4H 2OCVB 1JMOH 2ZNKH 4JZ1A 4JZEH 5LH8A 1FPCH 1AVGH 1FONA 3UR9A 2QXJA 4FUBA 3TH3H 1EATA 3M5MA 5GJ4B 3TIUA 2BDCA 4UFGH 1VJ9U 4CH8B 3TJNA 2YNAA 2ZTYA 3RXPA 4JZIA 5CMXH 4ABIA 1MD7A 2YOLA 3VB5A 2ZFSA 3SV6A 1KYNA 2AGIX 5GCHG 1BQYA 2ALVA 3A7VA 4NA9H 1QA7A 5GXPA 3SU4A 3F1SB 1TRMA 1GHWH 1QQUA 5DPAA 1WDIA 4ZH8A 1EB2A 1L4ZA 2BQWB 4XFQA 4CBNA 1M9UA 2G5VA 1DM4B 2SGDE 5DN6D 1O3KA 4ABEA 1XKAC 4I33A 2ZZUH 1V2ST 2V3MA 4NGAH 1FN6A 1E0FD 1RRKA 3GYLB 1C5YB 3N7EA 3OE7D 5CHBA 3AW0A 4K2YA 1KDQA 2H1UA 5A8XA 4IBLH 4JK5A 2VH0A 3UTUH 2QV1A 2C3SA 2Y81A 3E8LA 3T28A 3SQEE 2F9UA 1DS2E 2Z9GA 4ZXXH 3E1XB 1WQSA 3T5FH 1F7ZA 4D7GA 2QAAA 5FBIA 1PYTD 3RXUA 3GY4A 3OY5U 1PPBH 1O3PB 2VWNA 1Y3UA 2H9HA 1KXDA 5FBEA 3TJVA 1K1LA 3NCLA 3HKIB 2ANKH 1O5EH 1V2MT 8LPRA 2WPMS 2GV6A 1NO9H 2EI8A 4AGKA 4A5TS 3SO3A 5JBAS 1BMFD 2CHAC 1JIRA 1Q31A 1GI6A 3QWCH 2ZCLP 3SI4H 3DCLA 3ZVEA 1ZJDA 1TNJA 2TGTA 4AOQA 2NU3E 3QGJA 1BTPA 1HAZB 1JRTA 2YMSD 3MH5A 4DVAU 1E37B 4FUCA 2BLOA 4FU9A 3RXTA 2GTBA 1TLDA 1BJUA 2AGGX 1N1LA 1V2RT 1O3CA 3ZZCA 2B9LA 2O8MA 2F83A 5C1XA 3Q00A 4DY7B 2G51A 3MFJA 4U30A 3E0PB 4XBDA 2GZ7A 3P6ZB 3TGKE 4Y6DA 1C1WH 1P2OA 3ZVAA 2VGCB 1T8MA 2FODA 1SFIA 2BD8A 2FOMB 2WSSD 1G30B 4MVNA 4MNVA 1ELFA 1DY8A 3E3TA 3LJJA 4OM9A 1NTPA 4WY3A 4BNRA 1OWKA 4I7YH 1K21H 1CGIE 1GDQA 4VGCC 1C5SA 1U6QA 4Y0YE 1LPGB 1SQRA 1W0YH 1BZXE 1GVLA 3W95A 3LGTA 4YOGA 2OC7A 1S6FA 1SSXA 4GCHG 3VXFH 2ODQA 3RXCA 1OP0A 2Y80A 4K5ZA 3K9XB 3RUOA 1HAOH 3MI4A 2BD3A 4NZLA 2AMQA 1G36A 3O8BA 2JH6D 3ODFA 1F5LA 3SU2A 4ZROA 2QE7D 1TA6A 4CR5A 2Z3CA 1THRH 2BY8X 2LPRA 2QA9E 3CENA 3VB7A 5LGOA 1NC6A 3A88A 3A86A 1OWDA 1QIXB 4X6NA 5C20A 1KXAA 4MPUA 1TPSA 4B6FA 1DFPA 4X1NU 1P03A 5A8ZA 3H5CB 5DP4A 4F49A 1KLIH 2GVFA 4GVUA 1FN8A 2SGPE 4P00A 1BBRE 4A7IB 4I8GA 1SVPA 1NT1A 1ZLRA 2XBWA 2Z9LA 5TCCA 1MKXH 4KKDA 5ESTE 3HKJB 3RXRA 2A5IA 3LGIA 2QF4A 1GI4A 2K0QA 2OBOA 3CS7A 2HGTH 2UUYA 2UWLA 2XC5A 2FZZA 2VINA 3VGCB 3SU5A 1MTNC 1GCTC 3KQ5A 1WTGH 1TNIA 1E79D 1GI7B 5DG6A 1C2MA 2PKAB 4DT7B 4HGCA 3TNTA 1V2JT 4Q80A 1HAVA 3PTNA 3SU0A 1NFYA 2PKSC 2PGBB 1PPEE 1QQ4A 4I8KA 4X8SH 2BDHA 5C0TA 3M7UA 4YM9A 3PMBB 4P02A 3RMMH 2ANWA 1Y3WA 1DY9A 3NZIA 4GHQA 3F9GA 2BB4A 2D26C 3UAIC 1CO7E 5E0HA 4ABGA 3PMHB 2IJOB 1FY8E 1A5HA 1TPOA 3BTGE 5HYOA 1MCTA 1PPCE 4INHA 2ZU3A 2C90B 2GDDA 3MU1A 2H2ZA 3FOAA 4TT3D 4MTBA 4I8JA 2BOKA 2Z7FE 1DVAH 1H9IE 1O2VA 4K8YA 1QURH 1NFWA 1EPTB 4B75A 1O2IA 1SGDE 2XXLA 1J14A 1EAIA 1EXFA 4Y79A 2KCOA 2HALA 2EEKA 4I8LA 3NK8A 2P59A 2VGCC 1V6DA 9LPRA 3UY9A 1XMNB 2J98B 2ZF0H 1TFXA 3BTME 3PB1E 1BTWA 3S0NA 4LZ4B 3S9AA 3KCGH 2SFAA 1AUJA 3RC5A 4H42U 3PM3A 1Y8TA 4RKJB 4NSVA 4KGAA 1HYLA 2KCAA 1D4PB 1XUFA 2FOFA 1TRYA 2WUBA 2ASUB 4TY6A 1O3AA 3BEUA 4KTUA 2ZGJA 3FP7E 2OC1A 2Q6GA 3SHCH 3A8CA 5HMAA 1B5GH 1O37A 1C2JA 5EGMA 3CNRA 3KNXA 4NCYA 3KHVA 3N99A 2ODPA 1AVWA 2B8OH 1DWDH 1SLWB 2UUFB 3MNSA 3FVFB 1SGYE 1O38A 1G37A 2C93B 1TOCB 2P3UB 2STAE 3ZZ5A 4ABAA 1CHGA 8KME2 1T31A 4OS7A 4XRNA 3QGNB 5C3NA 1ETSH 1P01A 5J4SA 1IQNA 2Q6FA 4FUDA 3ZVGA 1BA8B 3BIVH 1GHXH 1K1IA 3EE7A 2GP9B 1QCPA 3TJUA 3ZZ4A 2R3YA 1H9HE 4BOHA 5BPEA 1LVOA 1GVKB 1FPHH 3E0NB 2PTCE 1ESBA 2KM0A 2ODYB 4IMQA 4LK4A 1SOZA 3W1EA 3QZQA 4NZQA 1GBCA 1RIWB 3QZRA 5C5OA 2ZO3H 1JRSA 1LHCH 2FPZA 2V7QD 3PLBA 3A87A 3MH4A 3SNCA 1GJAB 6GCHF 3GS9A 1P2MA 1C9TA
chains in the Genus database with same CATH topology
1ELBA 1HLTH 1NFXA 2UWOA 4AB9A 3U8TH 1K1PA 4BXWA 4MPVA 4Y11E 5GWZA 1UCYK 2BM2A 2O8TA 1GBTA 3IITA 4IN1A 2C8ZB 2HPPH 1C5NH 2A4OA 4RN6A 4WJG2 1QB1A 4YT6H 2ZGCA 1YPJH 4QT8C 3SGBE 4GHTA 4XSKU 3AAVA 1EUFA 3UWJH 1NS3A 2F9BH 3ATMA 3RXVA 4UDWH 2OUAA 4ABFA 3SU1A 1EP5A 5EOKA 1L1GA 3EA7A 1SI5H 3UR6A 2O8WA 2Z3EA 1AY6H 2QY0B 5FCRA 1QL8A 3RC6A 4D9RA 1S6HA 2CF8H 2ZEBA 3TK5A 1GPZA 1AUTC 1JXPA 1RFNA 3TGJE 1EAUA 1G3CA 1HBTH 2BX3A 2Z3DA 3G01A 1T8NA 1BIOA 4I32A 2F3CE 3EQ0H 3A8AA 3ZZDA 5AFYH 2VIDA 2SNVA 3RU4T 1F0SA 3MU4A 1IQKA 4J1YA 3U9AH 3VB6A 3F9EA 4CRBA 1O3DA 1QB6A 1W14U 4AZ2B 3OSYA 1O2TA 4JMYA 1Z8RA 3AW1A 3UWIA 4GUXA 1GBLA 1SFQB 3QTVH 2PFEA 5H4IB 3ZYDA 1BBRH 1EX3A 4ZHLU 5JBCS 2BY7X 2J2UA 2TGDA 2AYWA 3GCHB 2XC0A 1F0UA 1DANH 1SQTA 4X1PU 2ZCKP 2FTMA 1QL7A 5JDUB 1D6RA 1UTQA 4OS1A 5FHTA 1O35A 4ISIH 2TIOA 1ZYOA 3R0FA 2VVVA 1O2JA 5TCAA 2Y7ZA 2SGAA 1O3LA 1KY9A 2AFQB 7ESTE 4INLA 1ZRKA 1K1NA 9ESTA 3UQVA 1NU9A 3RXKA 1PPZA 1NPMA 2ZU2A 1UVSH 1YPGH 2VWOA 3A7XA 4Z6AH 1MQ5A 2P8OC 2JH0D 4O3UA 4U32A 2QGRA 4NWKA 2OQ5A 4CRCA 4B1TA 4IMZA 3RXFA 2I6SA 1FQ3A 2QXGA 2NWNA 2ANMH 1WQVH 1FNIA 1VR1H 4KELA 1TMTH 4Y71A 2WV4A 1MTUA 1GG6B 5FX6A 1AWFH 1ZSKA 1ESAA 1A3EH 2STBE 3U1JB 2VIWA 2VNTA 3T62A 2TGAA 4YT7H 1EKBB 1O2RA 3KIDU 4U01A 5E8EH 1AVXA 1E34B 4LZ1H 4SGBE 4A92A 1MKWH 5TJXA 3LJOA 1GI2A 1V2PT 4R8TB 4ZMAH 1QHRB 1MQ6A 2FLRH 2V6NA 3R3GB 3SU3A 1L1NA 1Y5AT 1C5TA 1BHXF 5L30H 1TONA 4NIXA 2AEIH 1CQQA 2PKAA 2WUCA 1SMFE 2R0LA 1MBQA 3P92A 1BT7A 1CGJE 1TNHA 1SGEE 3U8OH 1VZQH 4X2XA 3QK1A 2BVRH 4WMEA 6CHAC 3KL6A 4GCHF 3BTQE 1D3TB 1O2ZA 2ZHWH 1O3JA 1CT4E 1C5RA 1OWHA 3GICB 4CBOA 4A6LA 1WUNH 3A85A 1ZGVA 2WPJS 1ELDE 1ZMJA 1SOTA 1OPHB 2B7DH 1YCPK 1P04A 3BTTE 1PQ5A 1ZHPA 2A7JA 5EQRA 5FPTA 4A1TA 1RGQA 1B0FA 4OS6A 1HFDA 2ZDLA 1FIWA 1EPTA 2BY9X 2FWWA 4NA7A 4A1XA 1P10A 2XCNA 1EOJA 1L0ZA 2A2XH 1GBKA 4YTAA 3ZVFA 5CHAB 1P05A 1A4WH 1XUJA 1OX1A 2EI7A 1QFKH 2FS8A 1AFQB 1DWEH 3MU5A 3TJOA 3MO3A 1UO6A 2XCFA 3GCHC 1A2CH 4BANB 2QF0A 2FOHA 5DP5A 1DWCH 1GWAA 4K69A 3PWBA 3RXAA 1C1TA 2QF3A 1SGRE 1ZRBA 1GJCB 2SNWA 3PV4A 3GY2A 3WY8A 3PYHA 2J9NA 2F9NA 3PWCA 3C27B 4NIYA 1DLKB 1FY3A 3SI3H 1SG8B 3D49H 1TAWA 1E35B 1F92A 3MU8A 1C4V2 2HRVA 1A5IA 3QO6A 2OXSA 1QTFA 2C8WB 1C1QA 1GJ9B 2VVCA 4TPYA 4OS5A 1JWTA 1O32A 1B0EA 1KSNA 4K1SA 1O3EA 1C5VA 1GG6C 1SC8U 5T6DA 4IN2A 4K60A 2ZHQH 1ZSLA 4DG4A 1WYKA 2BTCE 3MYWA 3O8RA 2D1JA 4IGDA 1GHYH 1TRNA 3TK9A 4BAKB 4AFUA 1EJNA 4NFEA 2ZWLH 2HNTF 2LNCA 4ZHAA 1PQ7A 4ZKRU 3EAJA 2FXRA 1NRRH 1DOJA 1HUTH 1UVOA 1Z71A 1TNGA 5IDKA 4Z0KA 1O3IA 1BMNH 2HNTE 5JB8S 1A0HB 1YKTA 2XNIA 3BIUH 2BDGA 4AGJA 4MG3A 3ENSB 4GSOA 2TRMA 2ZA5A 1W7XH 1TX8A 3S9BA 1GBBA 3DUXH 4B76A 1LCYA 4BAMB 1C2DA 2XC4A 2ZFTA 1YPHC 4CRGA 2P95A 1SGCA 1V2VT 3PMAB 1MH0A 1RTFB 3M7TA 3W94A 2BY5X 3OTJE 4YESB 1W7GH 1QL9A 4UONA 1MAXA 3UPEA 2J34A 4RSPA 3M35A 2PUQH 2GKVE 1CU1A 1HCGA 4DIIH 4CHAB 3FZZA 4OGYA 1SLXB 2ZDVH 4DIHH 1EZSC 2BXUH 3ZZ8A 1XUIA 4AYVB 5EQSA 1SGFA 5CHAC 1HAGE 1C5QA 3SJ8A 1AFQC 1DUAA 1C5XB 1AZZA 2G5NA 4ZUHA 3UOPA 1N8OC 2I6QA 1FXYA 2HWLB 3GY8A 1NESE 3SW2B 2WPLS 2CN0H 2GCHF 1LPZB 3UOUA 3GY3A 3F68H 3K6ZA 2PUXB 3LIWA 1OWJA 4NWLA 2GDEH 3I77A 2BVXH 2VIOA 3U1IB 2ZFQH 3RDZA 1OS8A 6ESTA 1ZTLA 4D8NA 3QN7A 1D3DB 2ZIQH 1ARCA 3TNSA 4X8VH 2B5TB 1TA2A 1DE7H 4TWWA 1GJ6A 1O0DH 3AAUA 4MNWA 1KTSB 5AHGH 5JPMH 5T3HA 3NWUA 1GCDA 2A45B 4I8HA 2WV5A 4H6TA 1C2GA 3UNRA 3BF6H 2V3HH 5C1UA 3HPTB 1YYY1 1C1RA 2VB0A 2ZGHA 3SV9A 5JBTA 1G32B 3SJKA 3U69H 1ELTA 1O3HA 1ANCA 1ELEE 2JH5D 1P02A 1HJ8A 5FPYA 3GCNA 1ZMNA 2Z9KA 5E0JA 5DGJA 3UNQA 2XBVA 4X8UH 3I29A 1S81A 1GMCF 1NM6A 4MLFB 1HJ9A 4WH8A 3A7WA 1GMHG 1ZTJA 1O3OA 2BOHB 3ZZBA 3DD2H 2PGQB 3Q3XA 2Y82A 4UEHH 3D23A 1FMGA 3KQEA 1TGBA 2OD3B 1TNLA 2AH4X 3QUMP 1TGCA 5GIBA 2W3KA 2TPIZ 1QR3E 1LTOA 2FX4A 4BTTB 3Q3YA 4BTUB 1UMAH 2UUKB 4AX9H 3BTHE 3N7OA 5EXNA 5A0CA 7LPRA 3KQBA 3S69A 3GDVA 3AVZA 8ESTE 2QXIA 4YZUA 2FIRH 1GJ8B 4CRDA 5EW1H 2P3TB 1GHVH 1SQAA 1XUKA 3LGUA 5C5NA 3HK6B 4FUFA 2NU4E 4B2CA 3U8RH 5IYTA 4NIWA 3GOVB 1FY4A 4WWYA 5FXLA 2ZDKA 5T6FA 4AFQA 1ZPBA 1IOEA 1O5BB 3M36A 3V13A 4X1RU 1TPAE 1C1MA 3K2UA 5F8XA 1O3NA 1P11E 1Z8IB 1W2KH 3T26A 2SGQE 2V3OH 2TBSA 1YF4A 1GBDA 1XVMA 5DKMA 2AERH 2GV7A 2R3UA 2BYAX 1D3PB 1HGTH 3T2NA 4NA8A 4ABDA 2J38A 2SGEE 4B2AA 1AB9B 4YLQH 2AMPA 1HAYB 1J16A 2IOTA 1UVTH 1DDJA 4XE4A 2GX4A 1GBEA 1GHZA 1C2KA 2HLCA 3BTWE 5HM2A 3RMOH 1TE0A 1NRPH 3ELAH 2AS9A 4UFDH 1TYNA 4THNH 3RMLH 1IHSH 1RTLA 1GHAF 2UUJB 1AQ7A 1NRQH 1FJSA 1F5RA 2J4IA 4XBBA 1O2KA 2SGFE 4GPGA 1TGTA 1UK3A 1VCPA 2RA3A 2ZDNA 1J17T 1KXEA 4Q7XA 3T27A 1GHBG 1XX9A 1ANEA 3LH3A 4E05H 1EOLA 2FI3E 2HOBA 1V2NT 2WPHS 1IQLA 2Y6TA 2A31A 4NFFA 1EAWA 4I31A 1E38B 4AORA 4RKOB 1QBVH 1JBUH 3M7QA 3KQCA 2FM2A 2GCHG 3O8CA 1C5MD 3VGCC 2CMYA 5DP7A 1C5OH 1V2UT 2G4TA 1PYTC 2O8LA 4XDEA 1S82A 2EI6A 1VGCB 2B0FA 2G00A 3V3MA 1AGJA 4UD9H 2OQUA 1QJ6B 1BMMH 1T8LA 2Q1JA 3KGPA 3BEFB 1BOQA 2A4GA 3P17H 1EZUC 3EDXB 3H7OA 1SB1H 1HAXB 1UVPA 2M5TA 4WMFA 3MNBA 1ACBE 2K1QA 4AFSA 2A32A 1TGSZ 1IQJA 5EW2H 2D8WA 1A46H 1UTJA 1Y59T 3SHAH 3VB4A 1UJ1A 1C1PA 1C2FA 1P3EA 2CXVA 2H5DA 3K6YA 2AIPA 1SGQE 1ELAA 2BVSH 4X0WU 4ISNA 3P8NA 4IC6A 1TGNA 5A2MH 3MTYA 3ODDA 1P9UA 3PO1B 1UTNA 4D9QA 1GDUA 4WXIA 1KLJH 1NY22 2GT7A 1ZR0A 1FV9A 1EPTC 1LHEH 2Z6BD 1G3DA 4M7GA 2ZU1A 3L3TA 4WXVA 1FLEE 3A8DA 1YPMH 3SN8A 1GMCG 3SNAA 1HAPH 1N6YA 3BTDE 4B71A 3NPSA 4NG9H 1TX7A 4KP0A 1DSTA 3UREA 1O33A 3U98H 1MKXK 3MH7A 1BTHH 2ZQ2A 3EYDA 4FUIA 2A5KA 2UWPA 4OGXA 1GGDB 1IQMA 1QRWA 1S0RA 1BUIA 1X7AC 1OYTH 3ZVBA 5DP3A 5I46H 1H9LB 1KTTB 4ZKSU 1AI8H 1LPKB 3TH2H 1QRXA 1TMUH 3BG8A 5DK1A 4ISOA 5F8TA 2J95A 1GI1A 1XXFA 3ZZ6A 2VIQA 2Y5HA 1GI3A 1O2QA 1AU8A 3NUMA 1O34A 2F91A 1L2EA 1WBGB 2C4FH 3ATWA 2RG3A 1T4UH 1CE5A 2IPHA 2ZHDA 1T8OA 2VWLA 2OBQA 2QCYA 3SV2H 1Y5UT 1ZHRA 2BD5A 1PPGE 2FOCA 3P95A 1O3FA 2RCEA 3RU4E 1OP2A 3B23B 3VB3A 1EASA 2G81E 2VIVA 1G2LA 1PQ8A 4FUJA 2VU8E 1RIWC 2ZC9H 5JYIA 3M3VA 1WCZA 4U2WA 1O3BA 3FANA 1W3CA 3SJIA 1MTVA 1VCQA 3P8OA 1H4WA 3L33A 2HVXA 4UE7H 3RXIA 3SUFA 1UCYE 4ZKNU 1MZDA 3OX7U 2PSXA 2RDLA 4FU7A 1EP6A 3S9CA 1LQDB 1RJXB 1GHAG 3AASA 5DP9A 1GBMA 2FO9A 2O9QA 1SLVB 5SGAE 2NU1E 1ZMLA 1ETRH 1SBWA 2BD4A 1XXDA 3LU9B 1AE5A 5EXMA 4TPIZ 2F9OA 3Q3KA 3RXLA 3GDUA 3RM0H 1AD8H 1O31A 4Y7BA 2AMDA 3SQHE 4WMDA 1HJAB 4JYVH 1NFUA 5FX5A 3EA8A 1CA0B 3PLKA 5DJ7A 5EG4A 1ARBA 1IHTH 2HPQH 1MTWA 1W0ZU 2XRCA 1P2IA 1Z7KA 3PO1C 3V12A 3RC4A 3E6PH 2WPKS 1CT2E 1GJ5H 3BSQA 1EJAA 3EA9A 5E2PA 4BTIB 2W7UA 5ABWA 4HTCH 4WVPE 4KTCA 8GCHF 1YPLH 1OYQA 2WPIS 1Q3XA 1GBHA 4X2VA 1T4VH 3M3SA 3A7YA 2GZ8A 1HXFH 5LPFA 3SOSA 2ZHEH 2VH6A 4TY7A 3SUGA 1Z8JB 1K1MA 1MBMA 3GCTG 3GISB 3NXPA 1DUEA 3RMNH 3SV8A 1P57B 2QXHA 5J4QA 3A89A 4ABHA 1ELVA 1P12E 4X6PA 1WV7H 1QBOA 1DXWA 3A7ZA 2JETB 5PTPA 1A0LA 2A7HA 4Y8XA 1Q2WA 1UVUH 1G3EA 2ZECA 4UFEH 1O2OA 4KTSA 2EC9H 3E90B 1LVBA 1G2MA 1HIAB 1HAIH 1F2SE 2R9PA 2ZI2H 4E7RG 5FAHA 1H1BA 1GMHF 1EZXC 4ZAEA 1ABJH 3UQOA 3SV7A 2QIQA 2BMGB 1CHOG 3GCOA 5F6MA 5DP6A 1MAYA 4LXBH 2Y5GA 1SHHB 2KAIB 2FI5E 2Z9IA 1O2MA 1NZQH 2ZPRA 4MPWA 1V2LT 1MMJN 1BCUH 4Y8ZA 3ATIA 1BRBE 3DHKH 1CSOE 1F0RA 4O97A 5EQQA 1ABIH 3RXQA 1O2NA 3QX5H 1FI8A 2QC2A 3HGNA 2FI4E 3RM2H 1NRNH 4Y76A 1AE8H 1BRCE 2F9PA 1GDNA 2D2DA 2GMTB 1BMLA 1P09A 4Y7AA 3B8JA 1C1SA 3GDSA 1P9SA 3P8FA 1HAHH 1O2PA 2P3FH 3RXOA 2FX6A 1O3GA 5DP8A 5AVDA 1W10U 3SORA 1LMWB 1LO6A 1EJMA 1UTOA 1P06A 4SGAE 1ZJKA 2PV9B 4MDSA 2ZFPH 2FS9A 1SQOA 1IAUA 1ZOMA 4OS2A 1GL1A 2Y5FA 1BBRK 1BDAA 1VCWA 3LT3A 3M5NA 2A2QH 3UNSA 1WSSH 4NSYA 1TPPA 1QJ1B 3Q77A 4AG2A 1Z1IA 2VIPA 4BAOB 1HJAC 3JZ1B 1CA0C 3RU4D 1YP9A 1BITA 1S83A 3B9FH 1NU7B 1MTNB 2Z9JA 5I25A 1DX5M 2FTLE 1LQEA 1TBRH 1AKSB 1Y5BT 3ATLA 1QY6A 1GCTB 2BY6X 1BMAA 1B7XB 5GDSH 1G3BA 4B2BA 4ESTE 3TGIE 2GD4B 3RXDA 2GZ9A 5JBBS 4BAQB 2PKSB 3A8BA 4YO9A 5G4BA 1THSH 1KIGH 2H6MA 2XBYA 3A81A 1O2YA 1K1JA 3HATH 1GVZA 5T6GA 1TWXB 1W8BH 7GCHG 1DWBH 3A7TA 1GJBB 1SGIB 4TWYA 1ELGA 5FPSA 2BDYA 1C2IA 1GHBF 1HV7A 2BDAA 4X2YA 4B74A 3FP6E