2V6NA

Crystal structures of the sars-coronavirus main proteinase inactivated by benzotriazole compounds
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords REPLICASE POLYPROTEIN 1AB
publication title A Structural View of the Inactivation of the Sars Coronavirus Main Proteinase by Benzotriazole Esters.
pubmed doi rcsb
source organism Human sars coronavirus
total genus 85
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2v6nA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2v6nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2v6nA02
1IAUA 3ESTA 1TWXB 3TJUA 1CHOF 2OXSA 3ZZ9A 5K7RA 2ZP0H 1ELDE 3F6UH 3TH2H 3BEFB 2F83A 1C5MD 2CHAB 5EXNA 1TLDA 1TB6H 4NIXA 5CHAC 5C5OA 3BN9A 4KELA 5GIBA 1T8LA 3RXEA 1DVAH 1O3LA 1LVYA 2R3YA 5I25A 4UDWH 2Z9KA 2XC5A 1INCA 3RXOA 2VINA 2ZHQH 5FPSA 1LDTT 3M5NA 1CHOG 3SO3A 4F4OC 2R2MB 2VNTA 1WV7H 1D6WA 2FX4A 4YO9A 7LPRA 3QN7A 1C2MA 4M7GA 5JBCS 3EA8A 3VB6A 2WPKS 2GD4B 1QURH 1ESBA 1CSOE 3MH5A 5C1UA 3MH4A 2BLQA 5A8ZA 6GCHG 2HLCA 1DX5M 2XCFA 3GOVB 3S7KB 1SFIA 3K6ZA 2CN0H 5CHAB 2VJ1A 3AVZA 2G4TA 1AB9B 4Y76A 1O35A 1C1TA 4ABJA 1V2PT 1LVMA 4E06H 3BG4B 3SJIA 1A3BH 1Q31A 5C67A 2F3CE 4NSVA 3VEQB 4INHA 2J38A 2UUJB 1HB0B 2UWPA 1O2HA 2ZPQA 3ZZ6A 2BVXH 1Q3XA 1AD8H 1J17T 1F92A 1C1SA 2V6NA 1V3XA 1BHXB 1DDJA 1THRH 1F0RA 5GWZA 5DP4A 3NPSA 2PKSC 1NN6A 4CRDA 4YM9A 3SV9A 2H1UA 2VWNA 2FI3E 1K1MA 5DP5A 1C4U2 2V0BA 2VVUA 2QXJA 4IMZA 1K21H 4ZXYH 3SGBE 3U98H 1FI8A 4D7GA 1P2QA 1W2KH 4ABHA 1FIZA 2AIPA 5EPNA 1IOEA 4DCDA 4UONA 2A2XH 1MMJN 1HAOH 1HFDA 4AFSA 1YPLH 3KHVA 1PPHE 3A7XA 4RKOB 4X2WA 4K69A 5JBAS 2ZTZA 1DS2E 5IYTA 1A7SA 1VJ9U 1SGYE 3ZZ8A 1H9LB 3FAOA 4BANB 4KP0A 2G52A 5JBTA 1BOQA 3MHWU 1FAXA 1KXFA 1VITF 1MTNB 1QA7A 3MYWA 4DJZB 1GHVH 1HAIH 1YBWA 1NRRH 1TYNA 5FXLA 3T2NA 4VGCB 3DFLA 1AIXH 2QN5T 1KSNA 3RXCA 3SN8A 1RFNA 5SGAE 4YOGA 1THSH 5AFYH 1YPKH 4ABIA 3Q3YA 1E38B 1ELEE 4CR5A 3TLOA 1PPBH 2ANWA 1MCVA 2FOFA 2TGAA 1O2RA 3PMJA 3GYMA 3ZZCA 1DY9A 5TJXA 1D9IA 2CF8H 1GJ7B 1NFXA 3BTKE 4Y7BA 1V2TT 4ABEA 1SL3A 2A4GA 3G01A 5I46H 2QXGA 3UUZA 1S84A 3ZVEA 1RTFB 3A8BA 1AVXA 4BAOB 1QA0A 3L6PA 1HDTH 2Z9LA 4A6LA 1IQMA 2XNIA 4K1EA 2HNTE 2WYGA 1QNJA 1ZSKA 1Y8TA 2BLOA 1SQAA 1QGFA 2ZEBA 1Q2WA 3JZ1B 6LPRA 1QL8A 2ZHWH 1H8DH 2BLVA 1TALA 2FOGA 4UD9H 3TNSA 3GCNA 3QTVH 2EA3A 2ZCKP 3A7TA 1PYTD 3EQ0H 2AEIH 4FUIA 2ZCHP 2QCYA 3D62A 1QIXB 4AG1A 1BBRK 1P2NA 2THFB 2IJOB 3TGJE 5L30H 1GVLA 3BSQA 1SC8U 1SGFA 1ZGIA 4E05H 2VIPA 1HJ8A 2FOBA 1BHXF 5FBIA 2A45B 3SQEE 5T6GA 5EW1H 2Y7ZA 1ELVA 3QGNB 3PLBA 2OTVA 2H9HA 1ELBA 4FVDA 1GBLA 1SGCA 4X1PU 2TGPZ 4H6TA 4ZH8A 4ZHMU 3OTJE 1O37A 1OYQA 1G30B 2GMTC 2ZPSA 7GCHF 1O36A 1KIGH 1V2OT 1P3EA 1ESAA 1KDQA 3UNRA 1XMNB 3RU4D 3UNSA 3RXSA 1FLEE 1SGNE 4XSKU 4NCYA 1WTHD 3PYHA 2FZZA 3PWCA 3UPEA 4NSYA 5TCCA 1O3MA 1ID5H 1C5QA 2JH6D 1S0QA 1NFUA 2FLBH 4LOYH 1GJAB 2P8OC 4DIIH 4DW2U 2Z9GA 1T8OA 2K1QA 4LK4A 3B9FH 1EQ9A 2VIOA 2FOEA 2ZFTA 1CA0B 1DWCH 1TBRH 3ITIA 1EZXC 2QF3A 1G37A 1TBZH 3MNXA 3GDUA 3E8LA 4DIHH 2XC0A 1TPAE 3RMOH 1P2OA 3MO3A 2BXUH 2XC4A 2Z94A 1TIOA 3E0PB 3S9CA 1GVZA 1PJPA 1DE7H 4JK6A 1GI2A 3A83A 3ATLA 4MPVA 1DLEA 4I33A 3PTBA 1BRAA 5B6OA 4ABBA 1HXEH 3F9HA 2R0LA 3OYPA 5FX5A 1L0ZA 2XXLA 4FXGH 1EX3A 3OSYA 3A86A 3BG8A 3U1JB 1TFXA 1XX9A 3SHAH 3SU6A 1CE5A 2WPJS 3RXKA 1O2WA 2Y7XA 4YOIA 5T6FA 4LZ4B 1KTSB 1AMHA 1DUEA 4B2AA 2FYRA 3RXIA 2ZHFH 2F9OA 1C1OA 1DSTA 1QBOA 3QZRA 1ZYOA 2STBE 2AMQA 1C5TA 1BMNH 2A4QA 4YLQH 3URCA 3ZVGA 1ZMJA 2ZTYA 2Z9IA 1CT4E 5DKMA 3I29A 2TRMA 3VB4A 4NZLA 3RUOA 2OC7A 4RN6A 2J9NA 3M35A 3A8CA 4Y7AA 8GCHG 1SPJA 3Q76A 1MCTA 1GCTC 3LDXH 3DA9B 2ZGJA 4OS5A 3K65B 3GISB 1YCPM 2O9QA 1M9UA 1W3CA 3RC4A 3VPKA 3W95A 2CJIA 1C1MA 1FN8A 5F8XA 2FO9A 4AOQA 2FYQA 2J2UA 3U1IB 2D8WA 1AKSB 1ELTA 2ULLA 3KIDU 1W13U 1XKBC 1V2QT 1Y59T 4Y10E 1LMWB 3Q00A 1ZRBA 2QGRA 1RRKA 1CHGA 1UTKA 2PKAA 4NGAH 3HK6B 2ZFRH 3MNSA 1O5CB 1UTOA 1C2DA 1O34A 1FXYA 1K1IA 2F9NA 2WINI 3EGKH 1F0SA 4CRAA 2A7CA 3EE0B 1QBVH 4OGXA 5A09A 3HGNA 3RP2A 2BDCA 2ZCLP 1KLIH 1XXDA 2BX4A 1Y3XA 4UFEH 2QAAA 3DUXH 1QRXA 1O3NA 1DFPA 3QWCH 3SJOA 4OS2A 5T6DA 4UEHH 4X2YA 1O3EA 1HAVB 2ALVA 1TPOA 3UR6A 2OC1A 2TPIZ 3S0NA 3DHKH 3QO6A 1W0YH 4NZQA 1DWDH 4GHTA 3SI4H 4I7YH 1YLCA 3KQDA 4Y8XA 3SUDA 1ZPCA 1W11U 3UFAA 1H9IE 1VCPA 5FCKA 2ASUB 3HATH 3SU2A 4O3UA 1GMDF 1XVMA 5EXMA 2HOBA 4FUBA 4TWWA 2WPHS 3PM3A 2QY0B 1TNGA 1SGPE 1QL7A 1GGDB 2A2QH 3RC6A 5DG6A 4O03A 4FVBA 1HBTH 5LH8A 4I8GA 4X8TH 1KXDA 2BLWA 3MI4A 3L33A 3O8DA 1T4UH 1GI7B 1C5XB 2DE8A 3F68H 2VH6A 1TNLA 3U8OH 1V2RT 1EJAA 4D9QA 1Z6EA 2O8LA 4ZXXH 1DM4B 1QL9A 1B5GH 3LIWA 1RXPA 2BX3A 1HAPH 4FUEA 1ACBE 5GCHF 1TQ0B 1O3BA 1GI0A 4JCNA 1EPTC 1P9UA 1VGCB 2GCHG 1HCGA 5HYOA 3PO1C 1FZZA 3RXFA 2OP9A 1O3GA 1OOKB 3M3VA 4Q7ZA 1T7CA 1UCYK 4FU9A 3K2UA 3PTNA 1GJ9B 4I8KA 1HJAB 1V6DA 5E0GA 2OQUA 1NRQH 1WU1A 2A31A 1NU7B 2PR3A 1RTLA 1EZSC 1GBEA 1HPGA 4AG2A 2VWOA 3BTHE 3FP7E 1SLXB 2WPMS 1GJ8B 4YESB 1V2UT 1TGBA 1HJ9A 2FP7B 4ISNA 4ZUHA 1PQ7A 1FPHH 1QRWA 4MVNA 1ETSH 4ZKSU 1JRTA 1Z8IB 1OWKA 4AN7A 3PROA 2P93A 2AIQA 1ANEA 2Y80A 4FUDA 3SU0A 2W3KA 4KTUA 4NFEA 3ZZAA 2BDYA 2AGEX 2ZDAH 9LPRA 1MZAA 4OS1A 4U30A 5GPIB 4KTSA 1MH0A 2M5TA 1PPEE 1QY6A 4Y8YA 1HAZB 2SGQE 1MUEB 3EA7A 1GHBF 4FUGA 3UOUA 1LCYA 3EYDA 2BY9X 4D76A 4WH6A 1B0EA 1TE0A 4RKJB 1N8OB 2WPLS 3UY9A 3DT0H 1OSSA 2OC8A 1YPHC 4Q7YA 1E36B 1OWEA 5FCRA 2FOAA 4Y0YE 2VGCB 1W7XH 3TNTA 2PLXA 3AASA 1P10A 2ZGCA 1C5VA 1G3DA 2SGPE 1Z71A 4B74A 3KN2A 1J9CH 1V2ST 1NU9A 2PUXB 1ANCA 1KXBA 1VCWA 1GI5A 1D6RA 4FUHA 5L6NH 1TOMH 1TGNA 2SGFE 1RIWC 2VWMA 2Z3EA 3RLWH 4X8SH 5C3NA 2ODPA 2J34A 2XYAA 2ZDLA 7ESTE 1EAWA 3KNXA 2RA3A 3CS7A 1W8BH 2FS8A 1O38A 3U69H 1WCZA 1DWBH 4AORA 1C5RA 3TU7H 3T29A 4D9RA 2WV4A 3GDSA 1P06A 4SGAE 3U9AH 1BTYA 1AI8H 1VJAU 1O2QA 1YYY1 4YZUA 6CHAB 1NTPA 2SGAA 1C1UH 4DGJA 2GT7A 1KY9A 1O31A 5C1XA 5JB9S 3MU5A 3RU4T 1O2SA 1IQIA 1Z1IA 1THPB 2ANYA 3MU8A 2BQ7B 2V35A 2GZ7A 3A87A 1C2GA 2ANMH 2NU0E 3SUFA 1BTHH 5E0JA 6GCHF 2VVVA 3KQCA 3LGWA 2WYJA 3V3MA 1FY1A 1O2IA 2YNAA 1LTOA 1AE5A 3ZZ4A 2AERH 5PTPA 1C2IA 3ZVAA 1IQNA 1O2OA 1FUJA 1LPZB 1GJBB 5LPEA 1SB1H 1EXFA 1NS3A 1NRNH 3TK5A 3OY6U 4GVUA 2PSYA 1ARCA 4WWYA 3MU4A 1LVBA 3RXDA 2QC2A 3ELAH 2D26C 2GDDA 4X2VA 1XM1A 5GJ4B 2ZU5A 2ZQ2A 2ZU1A 1PQAA 1FY4A 4K8YA 1MU6B 3Q3XA 1A5GH 4ISOA 3SGQE 1SGTA 1OXGA 1TQ7B 2Y82A 1GBBA 1O5EH 1GDUA 2I6QA 5C1YA 3GCOA 1FDPA 2NU1E 1TRNA 3RXVA 4FUCA 3ATWA 3F9GA 2D2DA 1P8VC 4GPGA 1EP6A 3CS0A 5LGOA 3SI3H 2XWBI 2Q6DA 3SHCH 1LHFH 1IQEA 2ZU3A 3E91A 1TNKA 3QGJA 1A5HA 2HNTF 5C20A 1RTKA 1K1JA 1MKXH 1KYNA 2ZO3H 1GMCG 1KTTB 2UWLA 2ZZUH 1LQEA 2OUAA 2EI8A 1UTLM 1E0FD 1OP8A 2DE9A 2ESTE 3ZZDA 1P04A 2D1JA 1BCUH 3GYLB 4UFGH 3MH6A 4X1NU 3T25A 4ZKRU 1PPZA 2XBWA 3ZZ7A 1CU1A 3TJVA 1NY22 2GP9B 1GDNA 1GG6C 1O2YA 1O5GH 1MQ5A 1O3CA 1EASA 1FN6A 4WH8A 5HXFA 1O5DH 2H9EH 3A8DA 3FP6E 3SORA 3RMNH 1NC6A 1G3CA 1GBKA 1YGCH 4ZMAH 4ZROA 1ZMLA 2PFEA 2PKSB 3PMBB 3LONA 3AW1A 1A61H 1QRZA 2ZG0H 4I8JA 2P3UB 4FU7A 1QJ7B 2V3HH 3DFJA 3TH4H 2YOLA 5HMAA 1SOZA 2FODA 2FS9A 1E35B 1DITH 3B23B 3C1KA 5AVDA 3ENSB 1WTGH 5HM9A 1AFEH 2OC0A 4BNRA 2OINA 1GG6B 3GY6A 4XE4A 2VB0A 1YCPH 5DJ7A 3KCGH 4UE7H 3ZVFA 1EJNA 1XXFA 3SU5A 2BDIA 5DO4H 2A5AA 1QTFA 1C1RA 4XBCA 1AN1E 1DXWA 1V2MT 1Z8RA 4JK5A 3I78A 5E2PA 2Y5HA 2ZDKA 4NA9H 3BTQE 4MDSA 3VGCC 4B73A 4GHQA 3UREA 1FAKH 4Z6AH 3Q3KA 1J8AA 3P92A 2SNWA 3A80A 1ZPBA 3SV8A 4WF8A 2F9VA 1PYTC 1NM6A 1DSUA 1O5FH 2A0QB 4Y11E 4I8LA 2TBSA 1HAGE 1BB0B 2IN2A 4KGAA 3KGPA 5IDKA 1L1NA 1YPEH 1GPZA 1C5ZB 4Y8ZA 1UO6A 1RGQA 2F9UA 4CBNA 4FUJA 1SLWB 3RXAA 1GJ5H 1ZZZA 3KL6A 2G81E 4JYTA 1O3FA 5E8EH 5JPMH 1EATA 1XUJA 1AFQC 5EG4A 4B2CA 1LPGB 1NFYA 4TWYA 1V2NT 2SGEE 4OGYA 3SBKA 1UVOA 3ZV8A 4X0WU 1VCQA 3M7QA 1YPHE 1UTMA 2BQWB 3TK9A 2QIQA 1FMGA 1WSSH 2XBYA 4YOJA 3E16B 4JZEH 2HPQH 1JBUH 3HGPA 3SU1A 2EC9H 1K22H 1RD3B 1O3KA 2TGTA 1S5SA 3SU4A 1P2IA 1C2JA 4A92A 3E1XB 5DGJA 1AHTH 1Z7KA 1C1NA 1SGQE 3R3GB 1EUFA 1UHBB 1CGHA 3K9XB 1AU8A 3M5OA 2UUKB 4H4FA 1IQLA 3RMLH 1C5YB 3P8NA 2GCTC 3RMMH 4K3JA 4MPXA 4ASHA 1IQJA 1EP5A 2EEKA 4K60A 5DK1A 3MU0A 3M61U 2BY7X 2C4FH 4NIVA 1AGJA 1LKBA 1MKWK 2HRVA 3MH7A 3TPIZ 4CH8B 1C4V2 1CGJE 4E7NA 4BTUB 2QF0A 5ABWA 2IPHA 3GDVA 4JZFH 3TIUA 2ZFPH 1ZTJA 1WQSA 1PQ8A 1BQYA 2A5KA 2ILNA 4NFFA 1BTWA 1T8NA 1TPSA 2C93B 2GMTB 1Y3WA 4YLUA 4Q80A 1WBGB 2J95A 5A0AE 2BXTH 1FY3A 3PLKA 3IG6B 1FPCH 1QB6A 2GCTB 1AWFH 1FY8E 4H42U 1HXFH 2HPPH 1W12U 4WMDA 1O3IA 3HKIB 4IN2A 3GCHC 5A0CA 2GDEH 1JXPA 1ELAA 2XWAA 4K2YA 2P3FH 3VB7A 2A4RA 4JYUH 3V13A 2P8OB 1O2GH 2GV7A 1MBQA 2BMGB 2WUCA 1ZR0A 2FM2A 1N6YA 1NRSH 2B8OH 2BY8X 3SNDA 1SHYA 1TNJA 3GICB 5JB8S 1QJ1B 1T31A 8GCHF 3TK6A 1GWAA 2KAIB 1GBHA 1P09A 3BTGE 1SQTA 2G55A 2O8MA 2Z7FE 4WY3A 1EAIA 4ABFA 5G4BA 4K5ZA 3RXTA 3F1SB 3BTME 1UTQA 4FUFA 3MNCA 1BIOA 1MU8B 4GLYA 4Y71A 1O2TA 1LVOA 1MAYA 2AMDA 3M3TA 3HPTB 1JRSA 3LT3A 5F8ZA 1W0ZU 1ARBA 1UVPA 1TA2A 4A5TS 1YF4A 2C8YB 3T28A 1TGTA 4AFQA 1C2HA 4A7IB 5EODA 3SNAA 3EDXB 1F7ZA 2FEQH 3LGYA 2H6MA 3LGUA 4MPUA 1XKAC 1TX6A 2V3OH 3NKKA 1GJ6A 1SGFG 3A89A 2KAIA 3RLYH 1QQUA 4E7RG 1TRMA 2TGDA 4U32A 2W7UA 2BZAA 1NPMA 2ZGBH 2JKHA 1AY6H 2FI5E 1SGEE 1GHYH 2ZPRA 1TAWA 4X1RU 3KEEA 5E2OA 4XOJA 1GBFA 1OPHB 2H5DA 1C9TA 1GCTB 3E0NB 1ZLRA 3AAVA 3UWJH 2PUQH 1TGCA 1L1JA 5F03A 3VXFH 1GHWH 1HGTH 1BBRH 2ZDNA 1BTPA 3S69A 2WV5A 1KXEA 3GY2A 1A0JA 1EJMA 3ATIA 1O2KA 1DWEH 3LKWA 1KLJH 2TIOA 1Y5UT 2A7HA 2B7DH 3RXGA 4BOHA 1AKSA 1TMBH 3RXBA 2ZFFH 4K1TA 2BHGA 1GJCB 1O3PB 4H6SB 3MO9A 4CRFA 4OS7A 4IN1A 3QDZB 1SI5H 2AYWA 2RDLA 4B2BA 3P8FA 1JWTA 1O30A 2R2WU 1LHGH 1EZQA 5ETXA 5EOKA 2ZGXH 3VB3A 5BPEA 2RCEA 2ZGHA 3NXPA 1UTJA 2ZKSA 2Z3CA 4WMFA 4AGJA 3SNCA 2ZU2A 1FJSA 4BAHB 2GCHF 1IHSH 1O3HA 1MTUA 2LIZA 5FPYA 2ZHEH 1WAYB 1Y3YA 2DUCA 3QLPH 1C5SA 4DG4A 1UMAH 1BMAA 2VU8E 1HAVA 3TVJB 2ZF0H 3P8OA 1IHTH 1ABJH 3QTOH 4MNVA 1C5OH 1O2LA 3MO6A 2FLRH 3OU0A 3TGIE 1VR1H 1G3EA 4OS4A 1A46H 1LKAA 1NROH 1TX8A 4IBLH 1YLDA 1G32B 1GJ4H 1BUIA 2Q6GA 2C8WB 2PTNA 5ESBA 1OYTH 2QA9E 4Y6DA 2ZNKH 3FFGA 4MPWA 3SW2B 2C3SA 3S9AA 3LOXA 4WMEA 3SV7A 1YP9A 1SSXA 1EZUC 1DOJA 1G3BA 1BMMH 1C4Y2 3PMHB 3PB1E 1GBDA 2P59A 3SGAE 1QQ4A 4GCHG 1MD8A 3LH1A 3A7WA 5FAHA 2PW8H 3L3TA 2BDAA 4I31A 3PMAB 3RXUA 1O3DA 1S6FA 2O8TA 1ZGVA 1P57B 1B0FA 5FX6A 4LXBH 1EPTB 1BMLA 1FONA 1BTXA 3A8AA 2RA0A 3PO1B 3FANA 1PQ5A 1SGIB 4JYVH 3EBNA 1GMHG 4R0IA 1HRTH 4A1VA 1TMUH 2BM2A 2FESH 1WUNH 2ODQA 1CGIE 1SFQB 2HWLB 3PLPA 4X6MA 2P94A 8ESTE 1O2PA 3UIRA 4YT7H 1TABE 4RSPA 5L2ZH 1XUGA 1TMTH 1ZSJA 2BD7A 9ESTA 3N7OA 3A7ZA 2PGQB 1CA8B 1GI6A 3UTUH 1CT0E 4HGCA 1MTVA 1P9SA 3V7TA 4X6NA 4F49A 1G2LA 4Y79A 1O2NA 4NA8A 1Z1JA 3ZVBA 1O3AA 4WVPE 3MFJA 3RXJA 4HZHA 2AFQB 3RM2H 3T26A 1TONA 1KXAA 1HAYB 1SVPA 1YPMH 2BD4A 3OY5U 3P70B 2BD5A 1N6XA 4QT8C 2VH0A 3TH3H 4DY7B 1A1RA 2NU3E 1E37B 2VIVA 3A7VA 3BF6H 3STIA 3LC5A 1QB1A 2W7SA 2NU2E 2ZI2H 1AWHB 1UTNA 1O5AB 3TITA 3AAUA 1AE8H 2Q6FA 2PSXA 3LJOA 3NCLA 4A1TA 2H5CA 3TJOA 4D8NA 3P6ZB 2B0FA 1PFXC 4X1QU 2JETC 1GBCA 1GCDA 2Z3DA 1O2ZA 2CHAC 3TGKE 3BEUA 1SGRE 4AFUA 1OX1A 1PPFE 2PV9B 2EI6A 2ZC9H 3LGIA 5EU8A 1DY8A 4BXSA 3BTWE 4BTTB 1XUFA 3DD2H 4ZAEA 3ZZBA 1RIWB 1GI8B 1F5LA 1Y5BT 4TPYA 1KXCA 2BDGA 3SOSA 2J4IA 3D23A 1UK3A 1GBTA 3CP7A 3LGTA 1Y3UA 3V12A 1UTPA 4O9VA 2FIRH 3AW0A 1TA6A 1SHHB 2BDBA 4I8HA 1P2KA 1RS0A 3O8RA 3QX5H 3IWMA 4NIYA 1NZQH 1JIRA 2JETB 3UOPA 3GY7A 5EQRA 2AMPA 1P12E 4FU8A 4ISLA 1EB1H 4AGKA 1QBNA 1P03A 1IQKA 2VIWA 1BRBE 4ABGA 1QJ6B 2BVSH 2ALPA 4AX9H 3OX7U 1ETTH 1ZPZA 1AB9C 1C1WH 1S85A 5FHTA 3D49H 2JH0D 3BG4C 2I6SA 3MOCA 1HV7A 4HFPB 4MNWA 1J14A 4MNXA 4WJG2 4X6OA 3GY3A 3M5MA 1GMCF 3GY4A 1WOFA 1JIMA 1P02A 4XBDA 1P0SH 1UJ1A 2BY5X 3RXRA 1IQGA 2FDAA 1ZJDA 4MQAA 2VVCA 1TGSZ 2GX4A 4AZ2B 1BJUA 1C5NH 2BQ6B 4SGBE 4O97A 3MWIU 4INKA 3LPRA 1T8MA 3QZQA 4YT6H 3EAJA 4CHAC 1Z8GA 1UCYH 2Q1JA 4B75A 1ABIH 1J15A 2Y5FA 3STJA 4GAWA 4BAQB 5GDSH 3W94A 5J4SA 3Q77A 2AH4X 1SLUB 1HNEE 1ANDA 3M37A 4XFQA 1ELFA 1F5RA 1K28D 2A4OA 2UWOA 3CENA 2GKVE 1RJXB 2XCNA 3M7UA 4JZDH 5HGGA 3RC5A 2FX6A 1GI9B 4THNH 2UUFB 2Y5GA 1A5IA 1O2XA 4LZ1H 1BA8B 3RXPA 3H5CB 1NFWA 2GVFA 1BDAA 2BD2A 4CHAB 2HVXA 1EKBB 4A1XA 1GDQA 2YNBA 1QR3E 1MTNC 2SFAA 1G9IE 4ZKNU 3PWBA 1UVTH 3BV9B 4MLFB 4VGCC 3SJKA 3UWIA 2FOMB 1ZRKA 3H7TA 1AVWA 1YPJH 4U2WA 1X7AC 4ISIH 1LO6A 1UK4A 3GY8A 4ABDA 2J94A 2BTCE 4WXVA 1MAXA 3A85A 2G5NA 1TOCB 3ZVCA 2GGVB 1K2I1 3QK1A 2C90B 1A0LA 4GUXA 2P3TB 1BRUP 1OP2A 3ZVDA 3LU9B 2ZECA 1ORFA 3ODFA 4X2XA 3P17H 1C1QA 4ABAA 3HKJB 4R8TB 2Z9JA 4X8UH 3H7OA 2ZWLH 1GL1A 2CXVA 3LGVA 4X8VH 4NWKA 1DLKB 4AB9A 3S9BA 1C2EA 4XBBA 4MNYA 3M36A 1N1LA 1Y3VA 1WQVH 1C5WB 3LC3A 3P95A 1S81A 2A7JA 4ZHLU 4JZIA 1TPPA 4B1TA 5DP6A 1C1PA 1LHEH 1VITG 1O2UA 2BYAX 4DURA 3RXLA 3EA9A 1G36A 1V2WT 1QFKH 2G51A 4O3TA 1S83A 1LPKB 1P01A 3BIVH 4WXIA 3BIUH 4TY7A 4IMQA 1SG8B 3PV4A 3QUMP 1NT1A 5E0HA 1MD7A 3A7YA 3FZZA 4TYDA 1QCPA 1BRCE 3VGCB 4DOQA 1OWJA 1F0UA 2ZFSA 1GBMA 8KME2 1V2VT 5J4QA 3FVFB 1A4WH 4B76A 2BY6X 4CH2B 1S0RA 1H1BA 2OD3B 1QHRB 1H8IH 1P3CA 1T4VH 1D3TB 1KDQB 1O32A 1UVSH 1JOUB 4K8BA 2BDHA 1ZMNA 4IGDA 2ZIQH 3O8BA 4IC6A 2O8WA 4NG9H 5HM2A 1ZTKA 1ESTA 2BD3A 2R9PA 2VIQA 2ODYB 2OBOA 1A0HB 2GT8A 2FMJA 3A82A 4HI3A 2A32A 3ODDA 5BRRE 1AFQB 1CT2E 1ANBA 4JMYA 2UUYA 1DICA 2OCVB 1XUIA 2B9LA 4TPIZ 1PPGE 2ANKH 1CA0C 2BVRH 4BAKB 4Y0ZE 3TJNA 4CR9A 1ZJKA 5A8XA 1EAXA 1BBRE 3MNBA 1V2JT 1SBWA 3T5FH 5DP3A 5AFZH 4OS6A 3F9EA 1O33A 2H2ZA 1OP0A 1AQ7A 1UHBA 1OS8A 5JBBS 3ZZ3A 3SZNA 1A3EH 1LHCH 1BT7A 2B5TB 2LPRA 5H4IB 2F9PA 1HLTH 1L4ZA 7GCHG 3KF2A 1DXPA 2G4UA 2AGGX 1YC0A 1FQ3A 1MZDA 2FOCA 4Z0KA 1O3JA 1UK2A 1G2MA 1YKTA 3BTFE 3SUEA 1AVGH 1BJVA 2A1DB 4AFZA 3NWUA 1ELGA 1MTWA 5L2YH 3VFEA 1AZZA 4D7FA 4JZ1A 2ZA5A 1AZ8A 2Y81A 1UVUH 3E6PH 3GCHB 3RXQA 1MBMA 2PGBB 1O0DH 1DPOA 4X1SU 3B8JA 4CRBA 2EI7A 1PPCE 4BAMB 2ZDMA 5C2ZA 1MTSA 4B71A 1EB2A 1XUHA 5TCAA 2BD9A 3WY8A 4ESTE 2GZ9A 1TRYA 3NZIA 2XBXA 1K1PA 2JH5D 3E90B 1OWHA 2F91A 3URDA 1MQ6A 4J1YA 2PHBA 2XRCA 1C2FA 2C8XB 1HAHH 2P95A 2PKAB 3NUMA 5DPAA 1GJDB 1A2CH 2HGTH 2R3UA 1NESE 4AYYB 4U01A 1DT2A 4DT7B 2PWXA 1DUAA 2VWLA 5EQSA 1VITH 1LHDH 4IC5A 2XBVA 1W10U 5FPTA 1O5BB 1L1GA 1GVKB 2QXIA 1F2SE 2FTLE 3MTYA 3T27A 5A8YA 2VIDA 2AS9A 1ZHRA 2BOKA 1V2KT 7KMEH 5DP7A 1W7GH 1C2LA 2ZHDA 2CF9H 1TBQH 3RDZA 1BTUA 1Z6JH 5CMXH 3BTEE 4ZKOU 4I32A 1QB9A 2C8ZB 3BEIB 5F6MA 1C5PA 4NWLA 1C2KA 3P8GA 5LPFA 3ZYDA 1D3QB 4Q7XA 3U8TH 1FIWA 2RG3A 1K9OE 1NRPH 1AUTC 1T32A 1GBJA 3SJ8A 1K1LA 2O8UA 1F0TA 1BITA 1CQQA 3LJJA 1O2MA 1GI1A 5C5NA 3GCTF 1O3OA 3RXHA 2GV6A 2BD8A 3ZZ5A 1GBAA 3U8RH 1U6QA 1EOLA 1GGDC 2QXHA 3M3SA 1SMFE 3I77A 3IITA 1SGDE 4Q2KA 1AUJA 2BZ6H 1XVOA 4KKDA 2ZTXA 3KQBA 2STAE 5AF9H 1SR5C 2FXRA 2BB4A 1TX7A 1ELCA 3D65E 2ZDVH 3A81A 2GTBA 1FY5A 1FNIA 1GBIA 1NO9H 3GCTG 1ZSLA 2OBQA 1MKWH 3LH3A 4IS5A 1GHAF 1ZHMA 2WPIS 1E34B 5EQQA 2AGIX 1BTZA 1CVWH 1K1OA 5FBEA 5EW2H 1TNHA 1WYKA 1D4PB 1EAUA 4AB8A 5A2MH 1VGCC 3E3TA 3NK8A 4GCHF 1KLTA 4CBOA 1HYLA 2W26A 2FI4E 5DP8A 4NA7A 5JYIA 1S82A 3S7HB 2HALA 1HJAC 1K1NA 1JMOH 2G8TA 3T62A 2A5IA 3MU1A 2NWNA 1GL0E 3FZDA 3GY5A 1BZXE 4INLA 1L2EA 1OKXA 1HUTH 1CO7E 5A0BA 2QV1A 4BXWA 2CMYA 1GHAG 1S6HA 1GMDG 1AO5A 1ZTLA 1ZOMA 2H9TH 4X6PA 4DVAU 3SJ9A 5AHGH 2K7XA 1GMHF 2XTTB 4KTCA 3O8CA 1FV9A 3HK3B 1D3DB 2SGDE 6ESTA 2W3IA 4XDEA 2J92A 3FP8E 1H9HE 3R0FA 5F8TA 2G00A 2ZFQH 4IW4E 1C1VH 1MKXK 2F9BH 4MG3A 1SLVB 2OLGA 2P16A 3RU4E 1Y5AT 1J16A 3UQOA 1P05A 1F5KU 1IQHA 3M5LA 2SNVA 1O39A 4CRGA 4K1SA 1SOTA 3SU3A 5LPRA 2PTCE 2HNTC 2BOHB 1CBWC 1N8OC 1P2JA 5GCHG 2G5VA 2Y6TA 1ZHPA 1VZQH 3SV2H 4YTAA 3UQVA 3V0XA 3BTTE 3SNEA 4CRCA 1GHXH 1H4WA 5CE1A 2VGCC 3UNQA 3SV6A 1DANH 1HAXB 3BTDE 3VB5A 1OWIA 2ZQ1A 1SQOA 2IOTA 3A84A 1B7XB 2CGAA 2CV3A 3JZ2B 1UCYE 3ZV9A 2FPZA 5EPYA 1EPTA 1HIAB 3KQEA 1ETRH 1C5UA 5DP9A 5ESTE 2GZ8A 1W14U 1CBWB 1YM0A 3UR9A 3C27B 4MTBA 3K6YA 2ZU4A 2WUBA 2LNCA 3MMGA 4AYVB 4ZHAA 2XW9A 4BTIB 5GXPA 5K0HA 2Z6BD 2FOHA 1O2JA 2QYIA 1TNIA 1IQFA 3ATMA 3F9FA 3SNBA 5EXLA 1YCPK 2NU4E 3SQHE 3VXEH 1XUKA 2OQ5A 1L4DA 5T3HA 1O2VA 4GSOA 6CHAC 1EOJA 3RXMA 4NIWA 1GHBG 1GHZA 5JDUB 4J2YB 3A88A 1C5LH 1YPGH 4TY6A 3SUGA 4UFFH 1LQDB 1V2LT 1HIAA 3ATKA 1Z8JB 1GI4A 2FTMA 4HTCH 4ISHH 1C9PA 3ZYEA 2FWWA 1D3PB 2R0KA 1GI3A 3M7TA 5EGMA 8LPRA 4UFDH 4PROA 1P2MA 1P11E 3RM0H 2W5EA 4CREA 1OWDA
chains in the Genus database with same CATH superfamily
1IAUA 3ESTA 1TWXB 1SQRA 3TJUA 1CHOF 4FETA 2OXSA 3ZZ9A 5K7RA 2QF5A 2ZP0H 1ELDE 3F6UH 3TH2H 3BEFB 2F83A 1C5MD 2CHAB 5EXNA 1TLDA 1TB6H 4NIXA 5CHAC 5C5OA 3BN9A 4KELA 5GIBA 1T8LA 3RXEA 1DVAH 1O3LA 1LVYA 2R3YA 5I25A 4UDWH 2Z9KA 2XC5A 1INCA 3RXOA 2VINA 2ZHQH 5FPSA 1EFRD 1LDTT 3M5NA 1CHOG 3SO3A 4F4OC 2R2MB 2VNTA 1WV7H 1D6WA 2FX4A 4YO9A 7LPRA 3QN7A 1C2MA 4M7GA 5JBCS 3EA8A 3VB6A 2WPKS 2GD4B 1QURH 1ESBA 1CSOE 3MH5A 5C1UA 3MH4A 2BLQA 5A8ZA 6GCHG 2HLCA 1DX5M 2XCFA 3GOVB 3S7KB 1SFIA 3K6ZA 2CN0H 5CHAB 3F3BA 3FOAA 2VJ1A 3AVZA 2G4TA 4ASUD 1AB9B 4Y76A 1O35A 1C1TA 4ABJA 1V2PT 1LVMA 4E06H 3BG4B 3SJIA 1A3BH 1Q31A 5C67A 2F3CE 4NSVA 3VEQB 4INHA 2J38A 2UUJB 1HB0B 2UWPA 1O2HA 2ZPQA 3ZZ6A 2BVXH 1Q3XA 1AD8H 1J17T 1F92A 1C1SA 2V6NA 1V3XA 1BHXB 1DDJA 1THRH 1F0RA 5GWZA 5DP4A 3NPSA 4M9FA 2PKSC 1NN6A 4CRDA 4YM9A 3SV9A 2H1UA 2VWNA 2FI3E 1K1MA 5DP5A 1C4U2 2V0BA 2VVUA 1E1RD 2QXJA 1K21H 4IMZA 4ZXYH 3SGBE 3U98H 1FI8A 4D7GA 1P2QA 1W2KH 4ABHA 1FIZA 2AIPA 5EPNA 1IOEA 4DCDA 4UONA 2A2XH 1MMJN 3PRBA 1HAOH 4TT3D 1HFDA 4AFSA 1YPLH 3KHVA 1PPHE 3A7XA 4RKOB 4X2WA 4K69A 2IJD1 5JBAS 2ZTZA 1DS2E 5IYTA 1A7SA 1VJ9U 1SGYE 3ZZ8A 1H9LB 3FAOA 4BANB 4KP0A 2G52A 2W6ID 5JBTA 1BOQA 4RI0A 3MHWU 1QZ8A 1FAXA 1KXFA 1VITF 1MTNB 1QA7A 1H8HD 3MYWA 1GHVH 1HAIH 1YBWA 2HLDD 4DJZB 1NRRH 1TYNA 5FXLA 1WXRA 3T2NA 4VGCB 3DFLA 1AIXH 2QN5T 1KSNA 3RXCA 3SN8A 1RFNA 5SGAE 4YOGA 1THSH 5AFYH 1YPKH 4ABIA 3Q3YA 1E38B 1ELEE 4CR5A 3TLOA 1PPBH 2ANWA 1MCVA 2FOFA 2TGAA 1O2RA 5FL7D 3PMJA 3GYMA 3SYJA 3ZZCA 1DY9A 5TJXA 1D9IA 2CF8H 1GJ7B 1NFXA 3BTKE 4Y7BA 1V2TT 4ABEA 1SL3A 2A4GA 3G01A 5I46H 2QXGA 3UUZA 1S84A 3ZVEA 1RTFB 3A8BA 1AVXA 4BAOB 1QA0A 3L6PA 1HDTH 2Z9LA 4A6LA 1IQMA 2XNIA 4K1EA 2HNTE 2WYGA 1QNJA 1ZSKA 1Y8TA 2BLOA 1SQAA 1QGFA 2ZEBA 1Q2WA 3JZ1B 6LPRA 1QL8A 2ZHWH 4B6EA 1H8DH 2BLVA 1BMFD 1TALA 2FOGA 4UD9H 3TNSA 3GCNA 3QTVH 2EA3A 2ZCKP 3A7TA 1PYTD 3EQ0H 2AEIH 4FUIA 2ZCHP 2QCYA 3D62A 1YLNA 1QIXB 4AG1A 1BBRK 1P2NA 2THFB 2IJOB 3TGJE 5L30H 1GVLA 3BSQA 1SC8U 1SGFA 1ZGIA 4E05H 2VIPA 1HJ8A 2FOBA 2CK3D 1BHXF 5FBIA 2A45B 3SQEE 5T6GA 5EW1H 2Y7ZA 1ELVA 3QGNB 3PLBA 3VG8A 2OTVA 2H9HA 4TSFD 1ELBA 4FVDA 1GBLA 1SGCA 4X1PU 2TGPZ 4H6TA 5EJ1A 4ZH8A 4ZHMU 3OTJE 5GNDA 1O37A 1OYQA 1G30B 2GMTC 2ZPSA 7GCHF 3SZEA 1O36A 1KIGH 1V2OT 1P3EA 1ESAA 1KDQA 3UNRA 1XMNB 3RU4D 3UNSA 3RXSA 1FLEE 1SGNE 4XSKU 4NCYA 1WTHD 3PYHA 2FZZA 3PWCA 3UPEA 2F4LA 4NSYA 5TCCA 1O3MA 3KYGA 1ID5H 1C5QA 2JH6D 1S0QA 1NFUA 2FLBH 4LOYH 1GJAB 2P8OC 4DIIH 4DW2U 2Z9GA 1T8OA 2K1QA 4LK4A 3B9FH 1EQ9A 2VIOA 2FOEA 2J97A 2ZFTA 1CA0B 1DWCH 1TBRH 3ITIA 1EZXC 3PRDA 2QF3A 1G37A 1TBZH 3MNXA 3GDUA 3E8LA 4DIHH 2XC0A 1TPAE 3RMOH 1P2OA 3MO3A 2BXUH 2XC4A 2Z94A 1TIOA 2KCYA 3E0PB 3S9CA 1GVZA 1PJPA 1DE7H 4JK6A 1GI2A 3A83A 3ATLA 4MPVA 1DLEA 4I33A 3PTBA 1BRAA 5B6OA 4ABBA 1HXEH 3F9HA 2R0LA 3OYPA 5FX5A 1L0ZA 2XXLA 4FXGH 1EX3A 3OSYA 3A86A 3BG8A 3U1JB 1TFXA 1XX9A 3SHAH 3SU6A 1CE5A 2WPJS 3RXKA 1O2WA 2Y7XA 4YOIA 5T6FA 4LZ4B 1KTSB 1AMHA 1DUEA 3F2FA 2FYRA 4B2AA 3RXIA 2ZHFH 2F9OA 1C1OA 5EJZA 1DSTA 1QBOA 3QZRA 1ZYOA 2STBE 2GJGA 2AMQA 1C5TA 1BMNH 2A4QA 4YLQH 3URCA 3ZVGA 1ZMJA 2ZTYA 2Z9IA 1CT4E 5DKMA 3I29A 2TRMA 3VB4A 4NZLA 3RUOA 2OC7A 4RN6A 2J9NA 3M35A 3A8CA 4Y7AA 8GCHG 1SPJA 3Q76A 1MCTA 1GCTC 3LDXH 3DA9B 2ZGJA 4OS5A 3K65B 3GISB 1WDIA 1YCPM 2O9QA 1M9UA 1W3CA 3RC4A 3VPKA 3W95A 2CJIA 1C1MA 1FN8A 4YXWD 5F8XA 2FO9A 4AOQA 2FYQA 2J2UA 3U1IB 2D8WA 1AKSB 1ELTA 2ULLA 3KIDU 1W13U 1XKBC 1V2QT 1Y59T 4Y10E 1LMWB 3Q00A 1ZRBA 2QGRA 1RRKA 1CHGA 1UTKA 2PKAA 4NGAH 3HK6B 2ZFRH 3MNSA 1O5CB 1UTOA 1C2DA 1O34A 1FXYA 1K1IA 2F9NA 2WINI 3EGKH 1F0SA 4CRAA 2A7CA 3EE0B 1QBVH 4OGXA 5A09A 3HGNA 3RP2A 2BDCA 1FX0B 2ZCLP 1KLIH 1XXDA 2BX4A 1Y3XA 2RFKC 4UFEH 2QAAA 3DUXH 1QRXA 1O3NA 1DFPA 3QWCH 3SJOA 4OS2A 5T6DA 4UEHH 4X2YA 1O3EA 1HAVB 2ALVA 1TPOA 3UR6A 2OC1A 2TPIZ 3S0NA 3DHKH 3QO6A 1W0YH 4NZQA 1DWDH 4GHTA 3SI4H 4I7YH 1YLCA 3KQDA 4Y8XA 3SUDA 1ZPCA 1OHHD 1W11U 3UFAA 1H9IE 1VCPA 5FCKA 2ASUB 3HATH 3SU2A 4O3UA 1GMDF 1XVMA 5EXMA 2HOBA 4FUBA 4TWWA 2WPHS 3PM3A 2QY0B 1TNGA 1SGPE 1QL7A 1GGDB 2A2QH 3RC6A 5DG6A 4O03A 4FVBA 1HBTH 5LH8A 4I8GA 4X8TH 1KXDA 2BLWA 3MI4A 3L33A 3O8DA 1T4UH 1GI7B 1C5XB 2DE8A 3F68H 2VH6A 1TNLA 3U8OH 1V2RT 1EJAA 4D9QA 1Z6EA 2O8LA 4ZXXH 1DM4B 1QL9A 1B5GH 3LIWA 1RXPA 2BX3A 1HAPH 4FUEA 1ACBE 5GCHF 1TQ0B 3CNRA 1O3BA 1GI0A 4JCNA 1EPTC 1P9UA 1VGCB 2GCHG 1HCGA 5HYOA 3PV2A 3PO1C 3OAAD 1FZZA 3RXFA 2OP9A 1O3GA 1OOKB 3M3VA 4Q7ZA 1T7CA 1UCYK 4FU9A 3K2UA 3PTNA 1GJ9B 4I8KA 1HJAB 1V6DA 5E0GA 2OQUA 1NRQH 1WU1A 2A31A 1NU7B 2KFWA 5DN6D 2PR3A 1RTLA 1E1QD 1EZSC 1GBEA 1HPGA 4AG2A 2VWOA 3BTHE 3FP7E 1SLXB 2WPMS 1GJ8B 4YESB 1UW7A 1V2UT 1TGBA 1HJ9A 2FP7B 4ISNA 4ZUHA 1PQ7A 1FPHH 1QRWA 4MVNA 1ETSH 4ZKSU 1JRTA 1Z8IB 1OWKA 4AN7A 3PROA 2P93A 2AIQA 1ANEA 2Y80A 4FUDA 3SU0A 2W3KA 4KTUA 4NFEA 3ZZAA 2BDYA 2AGEX 2ZDAH 9LPRA 1MZAA 4OS1A 4U30A 5GPIB 4KTSA 1MH0A 2M5TA 1PPEE 1QY6A 4Y8YA 1HAZB 2J5UA 2SGQE 1MUEB 3EA7A 1GHBF 4FUGA 3UOUA 1LCYA 3EYDA 2BY9X 4D76A 4WH6A 1B0EA 1TE0A 2YMSC 4RKJB 1N8OB 2WPLS 3UY9A 3DT0H 1OSSA 2OC8A 1YPHC 4Q7YA 1E36B 1OWEA 5FCRA 2FOAA 2KCOA 4Y0YE 2VGCB 1W7XH 3TNTA 2PLXA 3AASA 3OEED 1P10A 2ZGCA 1C5VA 1G3DA 2SGPE 1Z71A 4B74A 3KN2A 1J9CH 1V2ST 1NU9A 2PUXB 5B6LA 1ANCA 1KXBA 1VCWA 1GI5A 1D6RA 4FUHA 5L6NH 1TOMH 1TGNA 2SGFE 1RIWC 2VWMA 2Z3EA 3RLWH 4X8SH 5C3NA 2ODPA 2J34A 2XYAA 2ZDLA 7ESTE 1EAWA 3KNXA 2RA3A 3CS7A 1W8BH 2FS8A 1O38A 3U69H 2W6JD 1WCZA 1DWBH 4AORA 1C5RA 3TU7H 3T29A 4D9RA 2WV4A 3GDSA 1P06A 4SGAE 3U9AH 1BTYA 1AI8H 1VJAU 1O2QA 1YYY1 4YZUA 6CHAB 1NTPA 2SGAA 1C1UH 4DGJA 2GT7A 1KY9A 1O31A 5C1XA 5JB9S 5CDFE 1COWD 3MU5A 3RU4T 1O2SA 1IQIA 1Z1IA 1THPB 2ANYA 3MU8A 2BQ7B 2V35A 2GZ7A 3A87A 1C2GA 2ANMH 2NU0E 3SUFA 1BTHH 5E0JA 6GCHF 2VVVA 3KQCA 3LGWA 2WYJA 3V3MA 1FY1A 1O2IA 2YNAA 1LTOA 1AE5A 3ZZ4A 2AERH 5PTPA 1MABB 1C2IA 3ZVAA 1IQNA 1O2OA 1FUJA 1LPZB 1GJBB 5LPEA 1SB1H 1EXFA 1NS3A 1NRNH 3TK5A 3OY6U 4GVUA 2PSYA 1ARCA 4WWYA 3MU4A 1LVBA 5KGOA 3RXDA 2QC2A 3ELAH 2D26C 2GDDA 4X2VA 1XM1A 5GJ4B 2KCPA 5C0TA 2ZU5A 2ZQ2A 2ZU1A 1PQAA 1FY4A 4K8YA 1MU6B 3Q3XA 1A5GH 4ISOA 3SGQE 1SGTA 1OXGA 1TQ7B 2Y82A 1GBBA 1O5EH 1GDUA 2I6QA 5C1YA 4B6FA 3GCOA 1FDPA 2J98B 2NU1E 1TRNA 3RXVA 4FUCA 3ATWA 3F9GA 2D2DA 1P8VC 4GPGA 1EP6A 3CS0A 5LGOA 3SI3H 2XWBI 2Q6DA 3SHCH 1LHFH 1IQEA 2ZU3A 3E91A 1TNKA 3QGJA 1A5HA 2HNTF 5C20A 1RTKA 1K1JA 1MKXH 1KYNA 2ZO3H 1GMCG 1KTTB 2UWLA 2ZZUH 1LQEA 2OUAA 2K8IA 2EI8A 1UTLM 1E0FD 1OP8A 2PP6A 2DE9A 2ESTE 3ZZDA 1P04A 2D1JA 1BCUH 3GYLB 4UFGH 3MH6A 4X1NU 3T25A 4ZKRU 1PPZA 2XBWA 3ZZ7A 1CU1A 3TJVA 1NY22 2GP9B 1GDNA 1GG6C 1O2YA 1O5GH 5F53A 1MQ5A 1O3CA 1EASA 1FN6A 4WH8A 5HXFA 1O5DH 2H9EH 3A8DA 3FP6E 3SORA 3RMNH 1NC6A 1G3CA 1GBKA 1YGCH 4ZMAH 4ZROA 1ZMLA 2PFEA 2PKSB 3PMBB 3LONA 3AW1A 1A61H 1QRZA 2ZG0H 4I8JA 2P3UB 3DSPA 4FU7A 1QJ7B 2V3HH 3DFJA 3OFND 3TH4H 2YOLA 5HMAA 1SOZA 2FODA 2FS9A 1E35B 1DITH 2EQNA 3B23B 3C1KA 5AVDA 3ENSB 1WTGH 5HM9A 1AFEH 2OC0A 4BNRA 2OINA 1GG6B 3GY6A 4RT1A 4XE4A 2VB0A 1YCPH 5DJ7A 3KCGH 4UE7H 3ZVFA 1EJNA 1XXFA 3SU5A 2BDIA 5DO4H 2A5AA 1QTFA 1C1RA 4XBCA 1AN1E 1DXWA 1V2MT 1Z8RA 3UB0A 4JK5A 3I78A 5E2PA 2Y5HA 5IK2D 2ZDKA 4NA9H 1W0JD 3BTQE 4F55A 4MDSA 3VGCC 4B73A 4GHQA 3UREA 1FAKH 4Z6AH 3Q3KA 1J8AA 3P92A 2SNWA 3A80A 1ZPBA 2JDID 3SV8A 4WF8A 2F9VA 1PYTC 1NM6A 1DSUA 1O5FH 2A0QB 4Y11E 4I8LA 2TBSA 1HAGE 1BB0B 2IN2A 4KGAA 3KGPA 5IDKA 1L1NA 1YPEH 1GPZA 1C5ZB 4Y8ZA 1UO6A 1RGQA 2F9UA 4CBNA 4FUJA 1SLWB 4Q4LA 3RXAA 1GJ5H 1ZZZA 2KCAA 3KL6A 2G81E 4JYTA 1O3FA 5E8EH 5JPMH 1EATA 1XUJA 3UAIC 1AFQC 5EG4A 4B2CA 1LPGB 1NFYA 4TWYA 1V2NT 2SGEE 4OGYA 3SBKA 1UVOA 3ZV8A 3OEHD 4X0WU 1VCQA 3M7QA 1YPHE 1UTMA 2BQWB 3TK9A 2QIQA 1FMGA 1WSSH 2XBYA 4YOJA 3E16B 4JZEH 1NBMD 2HPQH 1JBUH 3OTPA 3HGPA 3SU1A 2EC9H 4OM9A 1K22H 1RD3B 1O3KA 2TGTA 1S5SA 3SU4A 1P2IA 1C2JA 4A92A 3E1XB 5DGJA 1AHTH 1Z7KA 1C1NA 1YWUA 1SGQE 3R3GB 1EUFA 1UHBB 1CGHA 3K9XB 1AU8A 3M5OA 2UUKB 4H4FA 1IQLA 3RMLH 1C5YB 3P8NA 4F48B 2GCTC 3RMMH 4K3JA 4MPXA 4ASHA 1IQJA 1EP5A 2EEKA 4K60A 5DK1A 3MQKC 3MU0A 3M61U 2BY7X 2C4FH 4NIVA 1AGJA 1LKBA 1MKWK 2HRVA 3MH7A 3TPIZ 4CH8B 1C4V2 1CGJE 4E7NA 4BTUB 2QF0A 5ABWA 2IPHA 3GDVA 4JZFH 3TIUA 2ZFPH 1ZTJA 1WQSA 1PQ8A 1BQYA 2A5KA 2ILNA 4NFFA 1BTWA 1T8NA 1TPSA 2C93B 2GMTB 1Y3WA 4YLUA 4Q80A 1WBGB 2J95A 5A0AE 2BXTH 1FY3A 3PLKA 3IG6B 1FPCH 1QB6A 2GCTB 1AWFH 1FY8E 4H42U 1HXFH 2HPPH 1W12U 4WMDA 1O3IA 1W0KD 3HKIB 4IN2A 3GCHC 5A0CA 2GDEH 1JXPA 1ELAA 2XWAA 4K2YA 2P3FH 1SKYE 3VB7A 2A4RA 4JYUH 3V13A 2P8OB 3OE7D 1O2GH 2GV7A 1MBQA 2BMGB 2WUCA 1ZR0A 2FM2A 1N6YA 1NRSH 2B8OH 2BY8X 3SNDA 1SHYA 1TNJA 3GICB 5JB8S 1QJ1B 1T31A 8GCHF 3TK6A 1GWAA 2KAIB 1GBHA 1P09A 3BTGE 1SQTA 2G55A 2O8MA 2Z7FE 4WY3A 1EAIA 2K0QA 4ABFA 5G4BA 4K5ZA 3RXTA 3F1SB 3BTME 1UTQA 4FUFA 3ZIAD 3MNCA 1BIOA 1MU8B 2AHME 4GLYA 1O2TA 4Y71A 3WWBA 1LVOA 1MAYA 2AMDA 3M3TA 3HPTB 1JRSA 3LT3A 5F8ZA 4P00A 1W0ZU 1ARBA 5HIYA 1UVPA 2XNDD 1TA2A 3NRLA 4A5TS 1YF4A 2C8YB 3T28A 1TGTA 4AFQA 1C2HA 4A7IB 5EODA 3SNAA 3EDXB 1F7ZA 2HVYB 2FEQH 3LGYA 2H6MA 3LGUA 4MPUA 1XKAC 1TX6A 2V3OH 3NKKA 1GJ6A 1SGFG 3A89A 2KAIA 3RLYH 1QQUA 4E7RG 1TRMA 1KMHB 2KM0A 2TGDA 4U32A 2W7UA 2BZAA 5KECA 1NPMA 2ZGBH 2JKHA 1AY6H 2FI5E 1SGEE 1GHYH 1VKYA 2ZPRA 1TAWA 4X1RU 3KEEA 5E2OA 4XOJA 1GBFA 4DT4A 1OPHB 2H5DA 1C9TA 2JJ1D 1GCTB 3E0NB 1ZLRA 3AAVA 3UWJH 2PUQH 1TGCA 1L1JA 5F03A 3FN8A 3VXFH 1GHWH 1HGTH 1BBRH 2ZDNA 1BTPA 3N7EA 4P02A 3S69A 2WV5A 1KXEA 3GY2A 1A0JA 1EJMA 3ATIA 1O2KA 1DWEH 3LKWA 1KLJH 2TIOA 1Y5UT 2A7HA 2B7DH 3RXGA 4BOHA 1AKSA 1TMBH 3RXBA 2ZFFH 4K1TA 2BHGA 1GJCB 1O3PB 4H6SB 3MO9A 4CRFA 4OS7A 4IN1A 3QDZB 1SI5H 2AYWA 1YY3A 2RDLA 4B2BA 3P8FA 1JWTA 1O30A 2R2WU 1LHGH 1EZQA 5ETXA 5EOKA 2ZGXH 3VB3A 5BPEA 2RCEA 2ZGHA 3NXPA 4HG6A 1UTJA 2ZKSA 2Z3CA 4WMFA 4AGJA 3N99A 3SNCA 2ZU2A 1FJSA 4BAHB 2GCHF 1IHSH 1O3HA 1MTUA 2LIZA 5FPYA 2ZHEH 1WAYB 1Y3YA 2DUCA 3QLPH 1C5SA 4DG4A 1UMAH 1BMAA 2VU8E 1HAVA 3TVJB 2ZF0H 3P8OA 1IHTH 1ABJH 3QTOH 4MNVA 1C5OH 1O2LA 3MO6A 2FLRH 3OU0A 3FO8D 3TGIE 1VR1H 1G3EA 4OS4A 1A46H 1LKAA 1NROH 1TX8A 4IBLH 1YLDA 1G32B 1GJ4H 1BUIA 2Q6GA 2C8WB 2PTNA 5ESBA 1OYTH 2QA9E 4Y6DA 2ZNKH 3FFGA 4MPWA 3SW2B 2C3SA 3S9AA 3LOXA 5C94A 4WMEA 3SV7A 1YP9A 1SSXA 1EZUC 1DOJA 2L6OA 1G3BA 1BMMH 1C4Y2 3PMHB 3PB1E 1GBDA 2P59A 3SGAE 1QQ4A 4GCHG 1MD8A 3LH1A 3A7WA 5FAHA 2PW8H 3L3TA 2BDAA 4I31A 3PMAB 3RXUA 1O3DA 1S6FA 2O8TA 1ZGVA 2WSSD 1P57B 1B0FA 5FX6A 4LXBH 1EPTB 1BMLA 1FONA 1BTXA 3A8AA 2RA0A 3PO1B 3FANA 1PQ5A 1SGIB 4FOUC 4JYVH 3EBNA 1GMHG 4R0IA 1HRTH 4A1VA 1TMUH 2BM2A 2FESH 1WUNH 2ODQA 1CGIE 1SFQB 2HWLB 3PLPA 4X6MA 2P94A 8ESTE 1O2PA 3UIRA 4YT7H 1TABE 4RSPA 5L2ZH 1XUGA 1TMTH 1ZSJA 2BD7A 5CHBA 9ESTA 3N7OA 3A7ZA 2PGQB 1CA8B 1GI6A 3UTUH 1CT0E 4HGCA 1MTVA 1P9SA 3V7TA 4X6NA 4F49A 1G2LA 4Y79A 1O2NA 4NA8A 1Z1JA 3ZVBA 1O3AA 4WVPE 3MFJA 3RXJA 4HZHA 2AFQB 3RM2H 3T26A 1TONA 1KXAA 1HAYB 1SVPA 1YPMH 2BD4A 3OY5U 3P70B 2BD5A 1N6XA 4QT8C 2VH0A 3TH3H 4DY7B 1A1RA 2NU3E 1E37B 2VIVA 3A7VA 3BF6H 3STIA 3LC5A 1QB1A 2YMSB 2W7SA 2NU2E 2ZI2H 1AWHB 1UTNA 1O5AB 3TITA 3AAUA 1AE8H 2Q6FA 2PSXA 3LJOA 3NCLA 4A1TA 2H5CA 3TJOA 4D8NA 2IPQX 3P6ZB 2B0FA 1PFXC 4X1QU 2JETC 1GBCA 1GCDA 2Z3DA 1O2ZA 2CHAC 3TGKE 3BEUA 1SGRE 4AFUA 1OX1A 1PPFE 2PV9B 2EI6A 3F2GA 2ZC9H 3LGIA 5EU8A 1DY8A 4BXSA 5C0UA 5KEDA 3BTWE 4BTTB 1XUFA 3DD2H 4ZAEA 3ZZBA 1RIWB 1GI8B 1F5LA 1Y5BT 4TPYA 1KXCA 2BDGA 3SOSA 2J4IA 3D23A 1UK3A 1GBTA 3CP7A 3LGTA 1Y3UA 3V12A 1UTPA 4O9VA 2FIRH 3AW0A 1TA6A 1SHHB 2BDBA 4I8HA 1P2KA 1RS0A 3O8RA 3QX5H 3IWMA 4NIYA 2QF4A 1NZQH 1JIRA 2JETB 2V3MA 3UOPA 3GY7A 2EY4C 5EQRA 2AMPA 1P12E 4FU8A 4ISLA 1EB1H 4AGKA 1QBNA 1P03A 1IQKA 2VIWA 1BRBE 4ABGA 1QJ6B 2BVSH 2ALPA 4AX9H 3OX7U 1ETTH 1ZPZA 1AB9C 1C1WH 1S85A 5FHTA 3D49H 2JH0D 3BG4C 2I6SA 3MOCA 1HV7A 4HFPB 4MNWA 1J14A 4MNXA 3KYFA 4WJG2 4X6OA 3GY3A 3M5MA 1GMCF 3GY4A 1WOFA 1JIMA 1P02A 4XBDA 1P0SH 1UJ1A 2BY5X 3RXRA 1IQGA 2FDAA 1ZJDA 4MQAA 2VVCA 1TGSZ 2GX4A 1E79D 4AZ2B 4ACAA 1BJUA 1C5NH 2BQ6B 4SGBE 4O97A 3MWIU 4INKA 3LPRA 1T8MA 3QZQA 2L74A 4YT6H 3EAJA 4CHAC 2VBCA 1Z8GA 1UCYH 2Q1JA 4B75A 1ABIH 1J15A 2Y5FA 3STJA 4GAWA 4BAQB 5GDSH 3W94A 5J4SA 3Q77A 3EE7A 2AH4X 1SLUB 1HNEE 1ANDA 3M37A 4XFQA 1ELFA 3GS9A 1F5RA 1K28D 2A4OA 2UWOA 3CENA 2XOKD 1H8ED 2GKVE 1RJXB 2XCNA 3N7DA 2J98A 3M7UA 4JZDH 5HGGA 3RC5A 2FX6A 1GI9B 4THNH 2UUFB 2Y5GA 4I86A 1A5IA 1O2XA 4LZ1H 1BA8B 3RXPA 3H5CB 1NFWA 2GVFA 1BDAA 2BD2A 4CHAB 2HVXA 1EKBB 4A1XA 1GDQA 3F0OA 2F43B 2YNBA 1QR3E 1MTNC 2SFAA 1G9IE 4ZKNU 3PWBA 1UVTH 3BV9B 4MLFB 4VGCC 3SJKA 3UWIA 2FOMB 1ZRKA 3H7TA 1AVWA 1YPJH 4U2WA 1X7AC 4ISIH 1LO6A 1UK4A 3GY8A 4ABDA 2J94A 2BTCE 4WXVA 1MAXA 3A85A 2G5NA 1TOCB 3ZVCA 2KR7A 2GGVB 1K2I1 3QK1A 2C90B 1A0LA 4GUXA 5C17A 2P3TB 1BRUP 1S6LA 1OP2A 2LELA 3ZVDA 3LU9B 2ZECA 1ORFA 3ODFA 4X2XA 3P17H 1C1QA 4ABAA 3HKJB 4R8TB 2Z9JA 4X8UH 3H7OA 2ZWLH 1GL1A 2CXVA 3LGVA 4X8VH 4NWKA 1DLKB 4AB9A 3S9BA 1C2EA 4XBBA 4MNYA 3M36A 3AK5A 1N1LA 1Y3VA 1WQVH 1C5WB 3LC3A 3P95A 1S81A 2A7JA 4ZHLU 2JJ2D 4JZIA 1TPPA 4B1TA 5DP6A 1C1PA 1LHEH 1VITG 1O2UA 2BYAX 4DURA 3RXLA 3EA9A 1G36A 1V2WT 1QFKH 2G51A 4O3TA 1S83A 1LPKB 1P01A 3BIVH 4WXIA 3BIUH 4TY7A 4IMQA 1SG8B 3DSOA 3PV4A 1NT1A 3QUMP 5E0HA 1MD7A 3A7YA 3FZZA 4TYDA 1QCPA 1BRCE 3VGCB 4DOQA 1OWJA 1F0UA 2ZFSA 1GBMA 8KME2 1V2VT 5J4QA 3FVFB 1A4WH 4B76A 2BY6X 5T1VA 4CH2B 1S0RA 2WPDD 1H1BA 2OD3B 1QHRB 1H8IH 1P3CA 1T4VH 1D3TB 1KDQB 4XRNA 1O32A 1UVSH 1JOUB 4K8BA 2BDHA 1ZMNA 4IGDA 3W1EA 2ZIQH 3O8BA 4IC6A 2O8WA 4NG9H 3H09A 5HM2A 1ZTKA 1ESTA 2BD3A 2R9PA 2RDEA 2VIQA 2ODYB 2OBOA 1A0HB 2GT8A 4Z1MD 2FMJA 3A82A 4HI3A 2A32A 3ODDA 5BRRE 1AFQB 1CT2E 1ANBA 4JMYA 2M2AA 2UUYA 1DICA 2OCVB 1XUIA 2B9LA 4TPIZ 1PPGE 2ANKH 1CA0C 2BVRH 4BAKB 4Y0ZE 3TJNA 4CR9A 1ZJKA 5A8XA 1EAXA 1BBRE 3MNBA 1V2JT 2JIZD 1SBWA 3T5FH 4AC9A 5EIYA 5DP3A 5AFZH 4OS6A 3F9EA 1O33A 2H2ZA 1OP0A 1AQ7A 3F0PA 1UHBA 1OS8A 2WHXA 5JBBS 3ZZ3A 3SZNA 1A3EH 1LHCH 3DCLA 1BT7A 2B5TB 2LPRA 5H4IB 2F9PA 1HLTH 1L4ZA 7GCHG 3KF2A 1DXPA 2G4UA 2AGGX 1YC0A 1FQ3A 1MZDA 2FOCA 4Z0KA 1O3JA 1UK2A 1G2MA 1YKTA 3BTFE 3SUEA 1AVGH 3DSGA 1BJVA 2A1DB 4AFZA 3NWUA 1ELGA 1MTWA 5L2YH 3VFEA 1AZZA 4D7FA 4JZ1A 2ZA5A 1AZ8A 3WWFA 2Y81A 1UVUH 3E6PH 3GCHB 3RXQA 1MBMA 2PGBB 1O0DH 1DPOA 4X1SU 3B8JA 4CRBA 2EI7A 1PPCE 3FKSD 4BAMB 2ZDMA 5C2ZA 1MTSA 4B71A 1EB2A 1XUHA 5TCAA 2BD9A 3WY8A 4ESTE 2GZ9A 1TRYA 3NZIA 2XBXA 1K1PA 2JH5D 3E90B 3PV5A 1OWHA 2F91A 3URDA 1MQ6A 4J1YA 2PHBA 2XRCA 1C2FA 2C8XB 1HAHH 2P95A 2PKAB 3NUMA 5DPAA 1GJDB 1A2CH 4RT0A 2HGTH 2R3UA 1NESE 4AYYB 4U01A 1DT2A 4DT7B 2PWXA 1DUAA 2VWLA 5EQSA 1VITH 1LHDH 4IC5A 2XBVA 1W10U 5FPTA 1O5BB 1L1GA 1GVKB 2QXIA 1F2SE 2FTLE 3MTYA 3T27A 5A8YA 2VIDA 2AS9A 1ZHRA 2BOKA 1V2KT 7KMEH 5DP7A 1W7GH 1C2LA 2ZHDA 2CF9H 1TBQH 3RDZA 1BTUA 1Z6JH 5CMXH 3BTEE 4ZKOU 4I32A 1QB9A 2C8ZB 3BEIB 5F6MA 1C5PA 4NWLA 1C2KA 3P8GA 5LPFA 4Q63A 3ZYDA 1D3QB 4Q7XA 3U8TH 1FIWA 2RG3A 1K9OE 1NRPH 1AUTC 1T32A 1GBJA 3SJ8A 1K1LA 2O8UA 1F0TA 1BITA 1CQQA 3LJJA 1O2MA 1GI1A 5C5NA 3GCTF 1O3OA 3RXHA 2GV6A 2BD8A 3ZZ5A 1GBAA 3U8RH 1U6QA 1EOLA 1GGDC 2QXHA 3M3SA 2KX4A 1SMFE 3I77A 3IITA 1SGDE 4Q2KA 1AUJA 2BZ6H 1XVOA 4KKDA 2ZTXA 3KQBA 2STAE 5AF9H 1SR5C 2FXRA 2BB4A 5DSFA 1TX7A 1ELCA 3D65E 2ZDVH 3A81A 2GTBA 1FY5A 1FNIA 1GBIA 1NO9H 3GCTG 1ZSLA 2OBQA 1MKWH 3LH3A 4IS5A 3U28C 1GHAF 1ZHMA 2WPIS 1E34B 5EQQA 2AGIX 1BTZA 1CVWH 1K1OA 5FBEA 5HIZA 5EW2H 1TNHA 1WYKA 1D4PB 1EAUA 2WV9A 4AB8A 5A2MH 1VGCC 3E3TA 3NK8A 4GCHF 1KLTA 4CBOA 1HYLA 2W26A 2FI4E 5DP8A 4NA7A 5JYIA 1S82A 3F2HA 3S7HB 2HALA 1HJAC 1K1NA 1JMOH 2G8TA 3T62A 2A5IA 2QE7D 3MU1A 2NWNA 1GL0E 3FZDA 3GY5A 1BZXE 4INLA 1L2EA 1OKXA 1HUTH 1CO7E 5A0BA 2QV1A 4BXWA 2CMYA 1GHAG 1S6HA 1GMDG 1AO5A 1ZTLA 1ZOMA 2H9TH 4X6PA 4DVAU 3SJ9A 5AHGH 1NBME 2K7XA 1GMHF 2XTTB 4KTCA 3O8CA 1FV9A 3HK3B 1D3DB 2SGDE 6ESTA 2W3IA 4XDEA 2J92A 3FP8E 1H9HE 2V7QD 3R0FA 5F8TA 2G00A 2ZFQH 4IW4E 1C1VH 1MKXK 2F9BH 4MG3A 1SLVB 2OLGA 2P16A 3RU4E 1Y5AT 1J16A 3UQOA 1P05A 1F5KU 1IQHA 3M5LA 2SNVA 1O39A 4CRGA 4K1SA 1SOTA 3SU3A 5LPRA 2PTCE 2HNTC 2BOHB 1CBWC 1N8OC 1P2JA 5GCHG 2G5VA 2Y6TA 1ZHPA 1VZQH 3SV2H 4YTAA 3UQVA 3V0XA 3BTTE 3SNEA 4CRCA 2OK5A 1GHXH 1H4WA 5CE1A 2VGCC 3UNQA 3SV6A 5EJLA 1DANH 1HAXB 3BTDE 3VB5A 1OWIA 2ZQ1A 1SQOA 2IOTA 3A84A 4XD7D 1B7XB 2CGAA 2CV3A 3JZ2B 1UCYE 3ZV9A 2FPZA 5EPYA 2KZ4A 1EPTA 1HIAB 3KQEA 1ETRH 1C5UA 5DP9A 5ESTE 2GZ8A 1W14U 1CBWB 1YM0A 3UR9A 3C27B 4MTBA 3K6YA 2ZU4A 2WUBA 2LNCA 3MMGA 4AYVB 4ZHAA 2XW9A 4BTIB 5GXPA 5K0HA 2YMSD 5HKKD 2Z6BD 2FOHA 1O2JA 2QYIA 1TNIA 1IQFA 3ATMA 3F9FA 3SNBA 5EXLA 1YCPK 2NU4E 3SQHE 3VXEH 1XUKA 2OQ5A 1L4DA 5T3HA 1O2VA 4GSOA 6CHAC 1EOJA 3RXMA 4NIWA 1GHBG 1GHZA 5JDUB 4J2YB 3A88A 1C5LH 1YPGH 4TY6A 3SUGA 4UFFH 4ZCNA 2LP6A 1LQDB 1V2LT 1HIAA 3ATKA 1Z8JB 1GI4A 2FTMA 4HTCH 3KQ5A 4ISHH 1C9PA 3ZYEA 3WW7A 2FWWA 1D3PB 2R0KA 1GI3A 3M7TA 5EGMA 8LPRA 4UFDH 4PROA 1K0HA 1P2MA 2WZQA 1P11E 3RM0H 2W5EA 4CREA 4ACBA 1OWDA
chains in the Genus database with same CATH topology
1IAUA 3ESTA 1TWXB 3TJUA 1CHOF 2OXSA 3ZZ9A 5K7RA 2ZP0H 1ELDE 3F6UH 3TH2H 3BEFB 2F83A 1C5MD 2CHAB 5EXNA 1TLDA 1TB6H 4NIXA 5CHAC 5C5OA 3BN9A 4KELA 5GIBA 1T8LA 3RXEA 1DVAH 1O3LA 1LVYA 2R3YA 5I25A 4UDWH 2Z9KA 2XC5A 1INCA 3RXOA 2VINA 2ZHQH 5FPSA 1LDTT 3M5NA 1CHOG 3SO3A 4F4OC 2R2MB 2VNTA 1WV7H 1D6WA 2FX4A 4YO9A 7LPRA 3QN7A 1C2MA 4M7GA 5JBCS 3EA8A 3VB6A 2WPKS 2GD4B 1QURH 1ESBA 1CSOE 3MH5A 5C1UA 3MH4A 2BLQA 5A8ZA 6GCHG 2HLCA 1DX5M 2XCFA 3GOVB 3S7KB 1SFIA 3K6ZA 2CN0H 5CHAB 2VJ1A 3AVZA 2G4TA 1AB9B 4Y76A 1O35A 1C1TA 4ABJA 1V2PT 1LVMA 4E06H 3BG4B 3SJIA 1A3BH 1Q31A 5C67A 2F3CE 4NSVA 3VEQB 4INHA 2J38A 2UUJB 1HB0B 2UWPA 1O2HA 2ZPQA 3ZZ6A 2BVXH 1Q3XA 1AD8H 1J17T 1F92A 1C1SA 2V6NA 1V3XA 1BHXB 1DDJA 1THRH 1F0RA 5GWZA 5DP4A 3NPSA 2PKSC 1NN6A 4CRDA 4YM9A 3SV9A 2H1UA 2VWNA 2FI3E 1K1MA 5DP5A 1C4U2 2V0BA 2VVUA 2QXJA 4IMZA 1K21H 4ZXYH 3SGBE 3U98H 1FI8A 4D7GA 1P2QA 1W2KH 4ABHA 1FIZA 2AIPA 5EPNA 1IOEA 4DCDA 4UONA 2A2XH 1MMJN 1HAOH 1HFDA 4AFSA 1YPLH 3KHVA 1PPHE 3A7XA 4RKOB 4X2WA 4K69A 5JBAS 2ZTZA 1DS2E 5IYTA 1A7SA 1VJ9U 1SGYE 3ZZ8A 1H9LB 3FAOA 4BANB 4KP0A 2G52A 5JBTA 1BOQA 3MHWU 1FAXA 1KXFA 1VITF 1MTNB 1QA7A 3MYWA 4DJZB 1GHVH 1HAIH 1YBWA 1NRRH 1TYNA 5FXLA 3T2NA 4VGCB 3DFLA 1AIXH 2QN5T 1KSNA 3RXCA 3SN8A 1RFNA 5SGAE 4YOGA 1THSH 5AFYH 1YPKH 4ABIA 3Q3YA 1E38B 1ELEE 4CR5A 3TLOA 1PPBH 2ANWA 1MCVA 2FOFA 2TGAA 1O2RA 3PMJA 3GYMA 3ZZCA 1DY9A 5TJXA 1D9IA 2CF8H 1GJ7B 1NFXA 3BTKE 4Y7BA 1V2TT 4ABEA 1SL3A 2A4GA 3G01A 5I46H 2QXGA 3UUZA 1S84A 3ZVEA 1RTFB 3A8BA 1AVXA 4BAOB 1QA0A 3L6PA 1HDTH 2Z9LA 4A6LA 1IQMA 2XNIA 4K1EA 2HNTE 2WYGA 1QNJA 1ZSKA 1Y8TA 2BLOA 1SQAA 1QGFA 2ZEBA 1Q2WA 3JZ1B 6LPRA 1QL8A 2ZHWH 1H8DH 2BLVA 1TALA 2FOGA 4UD9H 3TNSA 3GCNA 3QTVH 2EA3A 2ZCKP 3A7TA 1PYTD 3EQ0H 2AEIH 4FUIA 2ZCHP 2QCYA 3D62A 1QIXB 4AG1A 1BBRK 1P2NA 2THFB 2IJOB 3TGJE 5L30H 1GVLA 3BSQA 1SC8U 1SGFA 1ZGIA 4E05H 2VIPA 1HJ8A 2FOBA 1BHXF 5FBIA 2A45B 3SQEE 5T6GA 5EW1H 2Y7ZA 1ELVA 3QGNB 3PLBA 2OTVA 2H9HA 1ELBA 4FVDA 1GBLA 1SGCA 4X1PU 2TGPZ 4H6TA 4ZH8A 4ZHMU 3OTJE 1O37A 1OYQA 1G30B 2GMTC 2ZPSA 7GCHF 1O36A 1KIGH 1V2OT 1P3EA 1ESAA 1KDQA 3UNRA 1XMNB 3RU4D 3UNSA 3RXSA 1FLEE 1SGNE 4XSKU 4NCYA 1WTHD 3PYHA 2FZZA 3PWCA 3UPEA 4NSYA 5TCCA 1O3MA 1ID5H 1C5QA 2JH6D 1S0QA 1NFUA 2FLBH 4LOYH 1GJAB 2P8OC 4DIIH 4DW2U 2Z9GA 1T8OA 2K1QA 4LK4A 3B9FH 1EQ9A 2VIOA 2FOEA 2ZFTA 1CA0B 1DWCH 1TBRH 3ITIA 1EZXC 2QF3A 1G37A 1TBZH 3MNXA 3GDUA 3E8LA 4DIHH 2XC0A 1TPAE 3RMOH 1P2OA 3MO3A 2BXUH 2XC4A 2Z94A 1TIOA 3E0PB 3S9CA 1GVZA 1PJPA 1DE7H 4JK6A 1GI2A 3A83A 3ATLA 4MPVA 1DLEA 4I33A 3PTBA 1BRAA 5B6OA 4ABBA 1HXEH 3F9HA 2R0LA 3OYPA 5FX5A 1L0ZA 2XXLA 4FXGH 1EX3A 3OSYA 3A86A 3BG8A 3U1JB 1TFXA 1XX9A 3SHAH 3SU6A 1CE5A 2WPJS 3RXKA 1O2WA 2Y7XA 4YOIA 5T6FA 4LZ4B 1KTSB 1AMHA 1DUEA 4B2AA 2FYRA 3RXIA 2ZHFH 2F9OA 1C1OA 1DSTA 1QBOA 3QZRA 1ZYOA 2STBE 2AMQA 1C5TA 1BMNH 2A4QA 4YLQH 3URCA 3ZVGA 1ZMJA 2ZTYA 2Z9IA 1CT4E 5DKMA 3I29A 2TRMA 3VB4A 4NZLA 3RUOA 2OC7A 4RN6A 2J9NA 3M35A 3A8CA 4Y7AA 8GCHG 1SPJA 3Q76A 1MCTA 1GCTC 3LDXH 3DA9B 2ZGJA 4OS5A 3K65B 3GISB 1YCPM 2O9QA 1M9UA 1W3CA 3RC4A 3VPKA 3W95A 2CJIA 1C1MA 1FN8A 5F8XA 2FO9A 4AOQA 2FYQA 2J2UA 3U1IB 2D8WA 1AKSB 1ELTA 2ULLA 3KIDU 1W13U 1XKBC 1V2QT 1Y59T 4Y10E 1LMWB 3Q00A 1ZRBA 2QGRA 1RRKA 1CHGA 1UTKA 2PKAA 4NGAH 3HK6B 2ZFRH 3MNSA 1O5CB 1UTOA 1C2DA 1O34A 1FXYA 1K1IA 2F9NA 2WINI 3EGKH 1F0SA 4CRAA 2A7CA 3EE0B 1QBVH 4OGXA 5A09A 3HGNA 3RP2A 2BDCA 2ZCLP 1KLIH 1XXDA 2BX4A 1Y3XA 4UFEH 2QAAA 3DUXH 1QRXA 1O3NA 1DFPA 3QWCH 3SJOA 4OS2A 5T6DA 4UEHH 4X2YA 1O3EA 1HAVB 2ALVA 1TPOA 3UR6A 2OC1A 2TPIZ 3S0NA 3DHKH 3QO6A 1W0YH 4NZQA 1DWDH 4GHTA 3SI4H 4I7YH 1YLCA 3KQDA 4Y8XA 3SUDA 1ZPCA 1W11U 3UFAA 1H9IE 1VCPA 5FCKA 2ASUB 3HATH 3SU2A 4O3UA 1GMDF 1XVMA 5EXMA 2HOBA 4FUBA 4TWWA 2WPHS 3PM3A 2QY0B 1TNGA 1SGPE 1QL7A 1GGDB 2A2QH 3RC6A 5DG6A 4O03A 4FVBA 1HBTH 5LH8A 4I8GA 4X8TH 1KXDA 2BLWA 3MI4A 3L33A 3O8DA 1T4UH 1GI7B 1C5XB 2DE8A 3F68H 2VH6A 1TNLA 3U8OH 1V2RT 1EJAA 4D9QA 1Z6EA 2O8LA 4ZXXH 1DM4B 1QL9A 1B5GH 3LIWA 1RXPA 2BX3A 1HAPH 4FUEA 1ACBE 5GCHF 1TQ0B 1O3BA 1GI0A 4JCNA 1EPTC 1P9UA 1VGCB 2GCHG 1HCGA 5HYOA 3PO1C 1FZZA 3RXFA 2OP9A 1O3GA 1OOKB 3M3VA 4Q7ZA 1T7CA 1UCYK 4FU9A 3K2UA 3PTNA 1GJ9B 4I8KA 1HJAB 1V6DA 5E0GA 2OQUA 1NRQH 1WU1A 2A31A 1NU7B 2PR3A 1RTLA 1EZSC 1GBEA 1HPGA 4AG2A 2VWOA 3BTHE 3FP7E 1SLXB 2WPMS 1GJ8B 4YESB 1V2UT 1TGBA 1HJ9A 2FP7B 4ISNA 4ZUHA 1PQ7A 1FPHH 1QRWA 4MVNA 1ETSH 4ZKSU 1JRTA 1Z8IB 1OWKA 4AN7A 3PROA 2P93A 2AIQA 1ANEA 2Y80A 4FUDA 3SU0A 2W3KA 4KTUA 4NFEA 3ZZAA 2BDYA 2AGEX 2ZDAH 9LPRA 1MZAA 4OS1A 4U30A 5GPIB 4KTSA 1MH0A 2M5TA 1PPEE 1QY6A 4Y8YA 1HAZB 2SGQE 1MUEB 3EA7A 1GHBF 4FUGA 3UOUA 1LCYA 3EYDA 2BY9X 4D76A 4WH6A 1B0EA 1TE0A 4RKJB 1N8OB 2WPLS 3UY9A 3DT0H 1OSSA 2OC8A 1YPHC 4Q7YA 1E36B 1OWEA 5FCRA 2FOAA 4Y0YE 2VGCB 1W7XH 3TNTA 2PLXA 3AASA 1P10A 2ZGCA 1C5VA 1G3DA 2SGPE 1Z71A 4B74A 3KN2A 1J9CH 1V2ST 1NU9A 2PUXB 1ANCA 1KXBA 1VCWA 1GI5A 1D6RA 4FUHA 5L6NH 1TOMH 1TGNA 2SGFE 1RIWC 2VWMA 2Z3EA 3RLWH 4X8SH 5C3NA 2ODPA 2J34A 2XYAA 2ZDLA 7ESTE 1EAWA 3KNXA 2RA3A 3CS7A 1W8BH 2FS8A 1O38A 3U69H 1WCZA 1DWBH 4AORA 1C5RA 3TU7H 3T29A 4D9RA 2WV4A 3GDSA 1P06A 4SGAE 3U9AH 1BTYA 1AI8H 1VJAU 1O2QA 1YYY1 4YZUA 6CHAB 1NTPA 2SGAA 1C1UH 4DGJA 2GT7A 1KY9A 1O31A 5C1XA 5JB9S 3MU5A 3RU4T 1O2SA 1IQIA 1Z1IA 1THPB 2ANYA 3MU8A 2BQ7B 2V35A 2GZ7A 3A87A 1C2GA 2ANMH 2NU0E 3SUFA 1BTHH 5E0JA 6GCHF 2VVVA 3KQCA 3LGWA 2WYJA 3V3MA 1FY1A 1O2IA 2YNAA 1LTOA 1AE5A 3ZZ4A 2AERH 5PTPA 1C2IA 3ZVAA 1IQNA 1O2OA 1FUJA 1LPZB 1GJBB 5LPEA 1SB1H 1EXFA 1NS3A 1NRNH 3TK5A 3OY6U 4GVUA 2PSYA 1ARCA 4WWYA 3MU4A 1LVBA 3RXDA 2QC2A 3ELAH 2D26C 2GDDA 4X2VA 1XM1A 5GJ4B 2ZU5A 2ZQ2A 2ZU1A 1PQAA 1FY4A 4K8YA 1MU6B 3Q3XA 1A5GH 4ISOA 3SGQE 1SGTA 1OXGA 1TQ7B 2Y82A 1GBBA 1O5EH 1GDUA 2I6QA 5C1YA 3GCOA 1FDPA 2NU1E 1TRNA 3RXVA 4FUCA 3ATWA 3F9GA 2D2DA 1P8VC 4GPGA 1EP6A 3CS0A 5LGOA 3SI3H 2XWBI 2Q6DA 3SHCH 1LHFH 1IQEA 2ZU3A 3E91A 1TNKA 3QGJA 1A5HA 2HNTF 5C20A 1RTKA 1K1JA 1MKXH 1KYNA 2ZO3H 1GMCG 1KTTB 2UWLA 2ZZUH 1LQEA 2OUAA 2EI8A 1UTLM 1E0FD 1OP8A 2DE9A 2ESTE 3ZZDA 1P04A 2D1JA 1BCUH 3GYLB 4UFGH 3MH6A 4X1NU 3T25A 4ZKRU 1PPZA 2XBWA 3ZZ7A 1CU1A 3TJVA 1NY22 2GP9B 1GDNA 1GG6C 1O2YA 1O5GH 1MQ5A 1O3CA 1EASA 1FN6A 4WH8A 5HXFA 1O5DH 2H9EH 3A8DA 3FP6E 3SORA 3RMNH 1NC6A 1G3CA 1GBKA 1YGCH 4ZMAH 4ZROA 1ZMLA 2PFEA 2PKSB 3PMBB 3LONA 3AW1A 1A61H 1QRZA 2ZG0H 4I8JA 2P3UB 4FU7A 1QJ7B 2V3HH 3DFJA 3TH4H 2YOLA 5HMAA 1SOZA 2FODA 2FS9A 1E35B 1DITH 3B23B 3C1KA 5AVDA 3ENSB 1WTGH 5HM9A 1AFEH 2OC0A 4BNRA 2OINA 1GG6B 3GY6A 4XE4A 2VB0A 1YCPH 5DJ7A 3KCGH 4UE7H 3ZVFA 1EJNA 1XXFA 3SU5A 2BDIA 5DO4H 2A5AA 1QTFA 1C1RA 4XBCA 1AN1E 1DXWA 1V2MT 1Z8RA 4JK5A 3I78A 5E2PA 2Y5HA 2ZDKA 4NA9H 3BTQE 4MDSA 3VGCC 4B73A 4GHQA 3UREA 1FAKH 4Z6AH 3Q3KA 1J8AA 3P92A 2SNWA 3A80A 1ZPBA 3SV8A 4WF8A 2F9VA 1PYTC 1NM6A 1DSUA 1O5FH 2A0QB 4Y11E 4I8LA 2TBSA 1HAGE 1BB0B 2IN2A 4KGAA 3KGPA 5IDKA 1L1NA 1YPEH 1GPZA 1C5ZB 4Y8ZA 1UO6A 1RGQA 2F9UA 4CBNA 4FUJA 1SLWB 3RXAA 1GJ5H 1ZZZA 3KL6A 2G81E 4JYTA 1O3FA 5E8EH 5JPMH 1EATA 1XUJA 1AFQC 5EG4A 4B2CA 1LPGB 1NFYA 4TWYA 1V2NT 2SGEE 4OGYA 3SBKA 1UVOA 3ZV8A 4X0WU 1VCQA 3M7QA 1YPHE 1UTMA 2BQWB 3TK9A 2QIQA 1FMGA 1WSSH 2XBYA 4YOJA 3E16B 4JZEH 2HPQH 1JBUH 3HGPA 3SU1A 2EC9H 1K22H 1RD3B 1O3KA 2TGTA 1S5SA 3SU4A 1P2IA 1C2JA 4A92A 3E1XB 5DGJA 1AHTH 1Z7KA 1C1NA 1SGQE 3R3GB 1EUFA 1UHBB 1CGHA 3K9XB 1AU8A 3M5OA 2UUKB 4H4FA 1IQLA 3RMLH 1C5YB 3P8NA 2GCTC 3RMMH 4K3JA 4MPXA 4ASHA 1IQJA 1EP5A 2EEKA 4K60A 5DK1A 3MU0A 3M61U 2BY7X 2C4FH 4NIVA 1AGJA 1LKBA 1MKWK 2HRVA 3MH7A 3TPIZ 4CH8B 1C4V2 1CGJE 4E7NA 4BTUB 2QF0A 5ABWA 2IPHA 3GDVA 4JZFH 3TIUA 2ZFPH 1ZTJA 1WQSA 1PQ8A 1BQYA 2A5KA 2ILNA 4NFFA 1BTWA 1T8NA 1TPSA 2C93B 2GMTB 1Y3WA 4YLUA 4Q80A 1WBGB 2J95A 5A0AE 2BXTH 1FY3A 3PLKA 3IG6B 1FPCH 1QB6A 2GCTB 1AWFH 1FY8E 4H42U 1HXFH 2HPPH 1W12U 4WMDA 1O3IA 3HKIB 4IN2A 3GCHC 5A0CA 2GDEH 1JXPA 1ELAA 2XWAA 4K2YA 2P3FH 3VB7A 2A4RA 4JYUH 3V13A 2P8OB 1O2GH 2GV7<