3DSPA

Crystal structure of apo copper resistance protein copk
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein copK
publication title Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography
pubmed doi rcsb
source organism Ralstonia metallidurans
molecule tags Metal binding protein
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dspA00
3DSOA 2LELA 3N7EA 3N7DA 3DSPA 2KM0A 2K0QA
chains in the Genus database with same CATH superfamily
4K1SA 1EOJA 2YMSD 1DLKB 1MKXH 1HAYB 1SQOA 4ESTE 3T2NA 2F43B 3OU0A 1W14U 3MQKC 1O3CA 1GBAA 1N6XA 2UWOA 2WV4A 3ZZ3A 2ANWA 2TBSA 1GI6A 1BRCE 4JYUH 2BD9A 1OXGA 3RXOA 1FDPA 1SGPE 3N7EA 2G4UA 1GL0E 5F8XA 4GLYA 1C1WH 1NZQH 1SFIA 2FOEA 2ZFRH 1QY6A 4IW4E 3PLPA 3FZDA 3KN2A 1YLCA 2R2WU 1QCPA 3AW1A 3MU1A 3RXRA 3K2UA 4B2BA 3KHVA 1D3DB 1RIWB 1MU6B 1NRNH 2GCTC 3KQBA 3SV6A 4ZXYH 2Z6BD 3LONA 1A61H 1SLXB 2BD8A 2Z9KA 1ANBA 2ZCKP 4UFGH 3VB7A 1Q31A 4AB9A 4BANB 1DVAH 4ZCNA 3ODDA 1E1QD 2GT7A 2LP6A 2KAIB 4GPGA 5I46H 2GDDA 1G2LA 1CBWB 1EZSC 1BTPA 5EXMA 4AFSA 2ZHQH 3SJOA 1P0SH 4F4OC 2OC8A 3RXKA 3I78A 1PPCE 1O2YA 2SNWA 1GJ9B 4AOQA 2CHAC 5J4SA 2FX4A 2P3FH 1GHXH 2FTMA 1UTJA 1MQ5A 3T28A 2AIQA 1VCWA 2GMTC 5DP8A 4CHAC 4F48B 1GJBB 2PR3A 1ZPZA 1GHAG 2A4GA 2Q1JA 3SNAA 1C5PA 3BSQA 3BV9B 2Z3DA 1CU1A 1TAWA 1NC6A 1VITH 3EGKH 1ZRBA 1NESE 2Y82A 1KXFA 2J94A 4AG2A 1TFXA 5FHTA 2FMJA 3UR6A 2J97A 5IYTA 5TJXA 1EFRD 2XNDD 1O3OA 2UWPA 2A5KA 1E36B 5FX6A 3BTWE 1LDTT 1NBMD 2QF4A 1WCZA 1ELDE 2BY6X 4YTAA 1XUFA 2F9UA 3SNBA 1HCGA 1SB1H 4ISIH 2C8YB 2VVCA 1BJVA 2QCYA 2G51A 2HVXA 3DCLA 3A80A 3H7OA 1T8MA 3GY6A 3RXBA 1L0ZA 1O38A 2FOBA 4WWYA 2AMPA 1YYY1 3OTJE 3GICB 3DFJA 1NRQH 3SYJA 1H9IE 1QBOA 1LVOA 1NS3A 2V3HH 5HKKD 4AFZA 2F9OA 4XDEA 1ZRKA 3RM2H 2B7DH 4RN6A 1MCVA 2BYAX 4P00A 5BRRE 1L4DA 3DSGA 1G32B 1KXCA 2JH5D 4ISNA 2VIWA 2IPQX 3DUXH 3CENA 3NWUA 1C1OA 3CNRA 2VIPA 4XFQA 2GV6A 2BVRH 3CP7A 1QB1A 3MNSA 1JIMA 2ANMH 2PHBA 1EATA 1YLDA 1EAXA 1U6QA 1O2ZA 1S5SA 1KTTB 1UCYE 1GJCB 2WPLS 2WYGA 4ZKNU 2B9LA 3RC4A 2JJ2D 5EXNA 1DY8A 2GGVB 5LPEA 2GZ7A 4RSPA 4MLFB 1UK2A 2BLVA 4NZQA 1O2JA 3UR9A 3O8RA 2A4OA 2AEIH 1CGIE 2GDEH 4JK5A 3W94A 2AYWA 3M3TA 1Y3VA 1MKXK 2PFEA 2A45B 4X8TH 1V2WT 1WV7H 3A83A 4NFFA 3QZRA 1C5YB 1C9TA 1PQ7A 1BBRH 2PKSC 1GBJA 4A1XA 2HALA 2KFWA 4XBDA 1OKXA 3G01A 3QUMP 3KQCA 3EQ0H 2VVVA 1ESTA 2CHAB 3H7TA 1TGCA 5T6GA 2H5DA 4NIXA 8LPRA 1H8ED 3RU4T 1HAVA 1O2MA 1VCQA 4WXIA 2OBOA 4CHAB 1AU8A 3RXMA 3C27B 3SJ8A 3TK5A 1C2MA 4I8KA 4RT1A 2H1UA 3Q3KA 2ZG0H 2PUQH 2FM2A 2C8WB 1EP5A 1Y3YA 3GISB 1E34B 2QIQA 3U69H 1IQHA 1KIGH 4ABJA 1GHAF 3UB0A 4A92A 3BG8A 2D26C 2FLRH 3P8OA 3U98H 1GMCG 2BD7A 2PTNA 1SQTA 3U1JB 3ZIAD 3SNDA 3SQHE 3N99A 4UFEH 3T5FH 9ESTA 3FAOA 3A85A 1P05A 2BX4A 4BOHA 1O5BB 1OOKB 1O30A 3U9AH 2J2UA 1C5OH 1HJAC 4Y7AA 1F2SE 1H1BA 2EC9H 5HMAA 3UAIC 2BOKA 3ZZBA 1THSH 5CHAB 4MPUA 1ZHMA 4HI3A 1MUEB 2XYAA 7GCHG 2BM2A 2ZGHA 1ABJH 2KCPA 1ZMNA 4OS6A 1YPKH 1EOLA 1G9IE 1NFWA 2H9HA 4UD9H 2ZU5A 3SZEA 5CHBA 2ZDKA 4BTTB 1LVMA 3VXEH 1CHGA 1D3TB 2PV9B 1C5WB 5C5NA 1WTHD 1EUFA 4ZHAA 1KDQB 2QXHA 2CXVA 1V2LT 2AGEX 1EPTA 2OBQA 2M5TA 4X2VA 4NGAH 3RDZA 2KM0A 1V2MT 2UWLA 4D9QA 5E0JA 2Z94A 4M7GA 4F49A 3LH1A 5PTPA 5C94A 1BQYA 2ZI2H 4B1TA 2SNVA 1WXRA 3SUEA 2PW8H 3FP8E 4B71A 2LNCA 1HBTH 1ANCA 1QL9A 1C2GA 1CVWH 1WQVH 5DP5A 1BMNH 1GBKA 1TYNA 3ZZ6A 2JKHA 3NUMA 5C0TA 3FVFB 1QJ7B 1INCA 2W7UA 2VGCC 4ABIA 2XBYA 4J2YB 3QO6A 4O3TA 1BCUH 2G5VA 3EA9A 3TVJB 3WY8A 1C1NA 4I33A 4WH6A 3HPTB 3U28C 2F83A 5KECA 2WPJS 1TNHA 3O8CA 3B23B 1BRAA 5DKMA 1GVKB 3OYPA 3BTKE 1XKBC 4YOIA 1CT2E 3JZ1B 2VIDA 4ZKRU 1Y59T 4X1NU 1QIXB 5HIYA 1Y3WA 3ZVCA 4BAOB 1NFUA 3SU5A 3H5CB 1IQKA 2G8TA 2SGAA 1XXFA 5EPNA 1IAUA 3N7OA 1SPJA 4K60A 1DITH 4O97A 1HAOH 1C5LH 1GBEA 1BTHH 1SMFE 4K69A 1QTFA 1FZZA 4IMQA 3OFND 3RXCA 1VJAU 1HGTH 2G81E 3PWBA 2ZECA 4ZHMU 1BBRK 1G30B 4FUDA 3L6PA 4OGYA 3RM0H 1ELGA 3ZVGA 3ZZAA 1GI8B 1C4V2 2ZTXA 3FKSD 1GMCF 3M5LA 3PROA 1DUEA 2WPIS 1JRSA 4Y76A 5L2YH 4TPYA 1W0KD 1MD7A 3M61U 1KXDA 3FP6E 1OP0A 1ZSKA 1UK3A 1CA8B 5A0CA 1MCTA 1DM4B 2QXJA 2PTCE 1FY1A 4B2AA 1GCDA 2BY9X 3MOCA 5DP9A 1O2PA 2F4LA 7GCHF 1Y3XA 1ELCA 1EJNA 1C5NH 5DPAA 1ARCA 1NFYA 1K21H 1DWBH 1WTGH 1BA8B 1ELFA 2V7QD 1LO6A 2FDAA 2ZGCA 1V2VT 3SW2B 3QGJA 1VZQH 2Z3EA 1BMAA 2HRVA 3RLYH 2WUCA 4GHQA 1ZTLA 4NA8A 1SLUB 2TGAA 1GBIA 2R3UA 1KTSB 1VCPA 4FUGA 3ATWA 3MI4A 5GWZA 4YLUA 4XSKU 3SGQE 2AIPA 2FIRH 1ELEE 3TK9A 2Z9JA 5DO4H 3AAVA 1QBNA 4X2WA 2P16A 2TIOA 3F2GA 3D23A 1P2IA 2C8ZB 1V2QT 2F9NA 2J4IA 1M9UA 1OYQA 1TBQH 1AWFH 1P11E 1EXFA 3KQEA 2FODA 4TY6A 4FU8A 1DE7H 1K1IA 3RU4E 1AUTC 1VGCC 2ZHDA 2BLQA 3MU0A 1W7GH 3F0PA 5LH8A 2ESTE 1S83A 1FN6A 2VB0A 3LGVA 1CQQA 1HV7A 3IWMA 3F2HA 2WPDD 1LKAA 4ZAEA 4TWYA 1D3QB 2FXRA 4ISOA 5T3HA 4CRBA 1AB9C 4XE4A 5IK2D 1O3JA 2NU4E 4Y0ZE 3K9XB 2P94A 4H6TA 4FVBA 1C1SA 4ABEA 2ZA5A 1QHRB 4JZIA 4MTBA 5KGOA 2GCHG 1TBRH 4UEHH 1O3GA 1J9CH 3A7WA 1Z6EA 2PUXB 3BEIB 3D62A 4K1EA 3T25A 4NA7A 1MKWH 2Q6GA 5HXFA 3PMJA 1SL3A 1Z8GA 1DFPA 2QF3A 1ZHRA 2G5NA 3HGNA 4VGCC 3EA8A 1V2KT 1UTKA 1SGYE 1AUJA 1GJDB 1O34A 2RA0A 1TMUH 5GPIB 4Y10E 4B6EA 3LH3A 4TY7A 4Q4LA 1HJ9A 3MO9A 4YZUA 4CRGA 3QTVH 2QF5A 2TGPZ 1AVGH 2EA3A 2XWAA 2ZDVH 2OC1A 1GJAB 5EQRA 5E0HA 4AGJA 2ZHWH 4DG4A 3FP7E 1AFQB 1AZ8A 2F3CE 2W26A 2H9TH 2Y81A 1NU9A 2UUKB 3RXQA 1IQNA 1HLTH 1JWTA 5FCRA 3PRBA 1SGIB 4I8GA 2HOBA 3L33A 4AGKA 2QXIA 4B75A 1C5ZB 2WPHS 5T1VA 2P59A 5F53A 1OX1A 3A8AA 3MYWA 2GZ9A 4YLQH 3UPEA 2OXSA 2YNBA 3LIWA 3EDXB 2L6OA 3KEEA 4KTSA 3BTTE 4JMYA 1IOEA 1A2CH 2WINI 4ISLA 4NFEA 1SOTA 3M7UA 3WW7A 1Y5BT 1BRUP 2EI6A 2ODYB 1YCPM 2V0BA 3P8GA 1ZR0A 1ZJDA 3SV2H 2ZDAH 2J9NA 3DSOA 1K0HA 2FYQA 1GJ8B 1DSUA 2GJGA 2ZU2A 4OS2A 4AN7A 2ZO3H 3P17H 3SU3A 3SOSA 3N7DA 1MAYA 1BUIA 1PQAA 4X1PU 1UTNA 3T26A 3AVZA 3MNCA 1C5UA 4HG6A 3BIUH 1HRTH 1LVBA 1LPKB 1MTNC 1V2TT 2G52A 4TWWA 1NTPA 1AKSA 1C1UH 1HXEH 1BTWA 2ALVA 1QL8A 3S9CA 1D6RA 1GBMA 1AB9B 1BMFD 3TJVA 1IQJA 1TIOA 3NCLA 2QYIA 5DP6A 4HGCA 1SG8B 1HAPH 4LZ1H 2YMSB 2HPQH 3VB6A 3IITA 1XUIA 4JZ1A 2K8IA 3F6UH 1BMLA 2G55A 3NPSA 4FETA 3RXIA 5ETXA 1LPGB 1O5FH 3QTOH 4K8YA 3RXEA 2A32A 4TSFD 2Z7FE 3RXFA 4CH2B 1BRBE 4AB8A 4K2YA 1V2NT 3BTDE 1AGJA 1N1LA 2GCHF 1ORFA 1C4Y2 2NU0E 1GJ4H 1OS8A 2ZFSA 1GPZA 1O3AA 5G4BA 2HPPH 1GVLA 1AVWA 2BTCE 3SORA 1O3NA 4O03A 2VIVA 1TNLA 1D9IA 2ZDLA 2ZGBH 1FAKH 1Z8JB 4YESB 1C2IA 3MH5A 5C20A 2ZCLP 1TBZH 1Z1IA 2GTBA 1E1RD 2JIZD 1XX9A 3VGCC 5HM9A 1JMOH 2P3UB 3PO1C 1FQ3A 5AF9H 4FUEA 2WPMS 1UCYH 2BQ6B 2AGGX 4OS4A 2BVXH 3A7TA 1TALA 2HNTF 1TE0A 1V2ST 1AQ7A 1P9SA 5DP7A 4ABBA 1QURH 1K9OE 1MKWK 2OC7A 3V3MA 4B2CA 1WU1A 2V35A 1DWDH 4K3JA 4Q7YA 1QGFA 1D6WA 2P8OC 4X0WU 1O3FA 2D8WA 3PV4A 1SGEE 1MQ6A 2BB4A 1TA2A 5L6NH 2BQ7B 4MNXA 1XM1A 1VR1H 4OM9A 5EG4A 4LOYH 5E2PA 3UUZA 2ZIQH 2J5UA 4AG1A 5FX5A 2JH6D 4IN2A 4BAQB 1QJ6B 3NXPA 1YY3A 4AORA 1GBBA 1SGFG 2Q6DA 1AD8H 2XRCA 1P2OA 4H4FA 1YC0A 3RXGA 1A0LA 3PLKA 1AHTH 1OWEA 1KLTA 3MHWU 3ELAH 1P09A 1SHHB 1SVPA 3L3TA 1P2QA 1SBWA 1S0QA 1WDIA 5EODA 3BEFB 2A7HA 4FUBA 4FUIA 4DGJA 4X8VH 4IS5A 1LKBA 1ETTH 1P06A 1FPHH 2XBVA 1ELBA 3MTYA 2ZQ1A 2ZGJA 5GDSH 1BB0B 4Y8ZA 5F03A 1FN8A 4X6NA 1GI2A 2FOMB 1YPGH 2BY7X 2GKVE 2Z9IA 1YM0A 1EZQA 1XUHA 1AI8H 1EAIA 1W3CA 1SGRE 5EXLA 1ZHPA 3HK6B 1LVYA 1OWKA 1KDQA 3B9FH 1FAXA 2LPRA 1HUTH 1YKTA 3JZ2B 4Z1MD 3KYFA 1WUNH 1GI5A 1D3PB 2Y7XA 4XRNA 1PPFE 1GI7B 1ZYOA 2YOLA 1BITA 2AS9A 3HKIB 4MQAA 4ASHA 3BTME 3R3GB 3F1SB 1T8OA 2XC4A 1TX7A 2ZDMA 3FN8A 1T32A 3RXTA 1FY3A 3FANA 3KIDU 4YOJA 1EJMA 2EEKA 5SGAE 2ZWLH 3TPIZ 4MNVA 4O9VA 4Q7XA 3KYGA 3LGYA 1GI0A 4ZKSU 3GYLB 2BY5X 5F6MA 2RA3A 3GY3A 1P2KA 1Q3XA 3RC6A 1E37B 1KY9A 1Y3UA 1ZPBA 5HYOA 1FXYA 2GT8A 1GG6C 4MNWA 1LHFH 3M5MA 5T6DA 3A87A 2PP6A 2A4RA 1FMGA 1AWHB 2GCTB 4B74A 4KTCA 1COWD 4ZXXH 1HAXB 3QN7A 3E1XB 1GI3A 1DXWA 3SGAE 3M35A 1SFQB 2PKAA 1SGQE 2ZP0H 3STJA 4X8UH 4CBNA 1TRNA 5EQQA 1NPMA 3A81A 3ZYDA 4X6MA 5FAHA 2BVSH 1OYTH 1GBDA 1UVSH 1T31A 1ZSJA 2XBWA 1CT0E 1FI8A 5EJZA 1QRWA 1YWUA 2BZ6H 5GXPA 1BJUA 1PJPA 5JYIA 5EW2H 1K2I1 5L2ZH 3CS0A 4TPIZ 3SU6A 5DSFA 4I31A 4PROA 2ZHEH 2XC5A 2BDYA 5EW1H 1A46H 2C8XB 3UY9A 3V7TA 4I8LA 2VNTA 3ZZCA 3ZYEA 2KCOA 1F5RA 2VBCA 1GBHA 2IPHA 2GMTB 2VWOA 2P3TB 1UVPA 1UCYK 2FS8A 3LC5A 1DT2A 1F92A 4WJG2 3UIRA 2O8WA 1C1PA 1O2GH 5EJLA 2SGFE 3MH7A 3SUGA 4JCNA 1VJ9U 4Z6AH 1TPOA 1NO9H 3S7HB 3TJNA 1UTPA 1C2HA 2STBE 1O3LA 1SGCA 2A1DB 3OSYA 4A6LA 2HLDD 3A88A 1NROH 2THFB 3MNXA 3VB5A 3UNRA 3MU4A 4AX9H 1UTMA 1WOFA 2CN0H 1O3BA 1TX8A 3RXSA 4ABFA 5LPRA 1XXDA 4BTIB 1O3EA 3A7YA 1V2RT 1TGSZ 1E79D 4FXGH 1O31A 4P02A 1TNJA 3E90B 4J1YA 5C67A 2W6ID 1AE8H 4Z0KA 2OD3B 2EY4C 2ZEBA 2K1QA 1J15A 1FY5A 1C1VH 5C2ZA 1RJXB 1V2JT 1MBQA 1GJ7B 4DOQA 1TONA 3RP2A 3KCGH 1HFDA 2CJIA 2L74A 4M9FA 1V2UT 3FZZA 3SUFA 4MG3A 1P3EA 5A0AE 1SOZA 1BDAA 3AASA 3RU4D 2QA9E 1GG6B 5L30H 2BDIA 3GCNA 3QX5H 3NK8A 2WV9A 2B0FA 4DURA 1HDTH 1S81A 1C5SA 1GHYH 1UHBA 1LCYA 1TNGA 1O2LA 1IQIA 1ZGIA 4AYVB 3S7KB 1L1GA 2F9BH 5EIYA 2EQNA 1OP8A 4XBCA 1W13U 1CGJE 2PKSB 4NWLA 4F55A 1T4UH 4FUCA 5A09A 1EAUA 2BLOA 5CMXH 3SBKA 2QN5T 2A5AA 4A1TA 1SQRA 3P8FA 3UTUH 1HNEE 4AFQA 2ULLA 5EU8A 3A7XA 5E0GA 1O5AB 4I7YH 3E16B 3PB1E 2O8UA 4ASUD 2J95A 5AFZH 1O3MA 1P3CA 3OX7U 1Q2WA 3A89A 3SV9A 1QZ8A 1EPTC 4AFUA 3WWFA 2V3MA 2ALPA 4YO9A 2ZC9H 3M36A 3W1EA 3TJUA 2FOFA 3RMLH 1EP6A 1AFEH 1K1LA 4DW2U 4ZKOU 1JOUB 3U1IB 1P03A 2ZU3A 5JBCS 4Y8XA 3S0NA 2PSYA 3LGTA 2ZPQA 1G2MA 1TPPA 3UWIA 1K1OA 4WY3A 3RXJA 2AFQB 3RMOH 1AIXH 1O2RA 3M5NA 2J98A 4INHA 2XBXA 1RTKA 7KMEH 1HJAB 2ASUB 2FI3E 4Q2KA 3GOVB 1Z1JA 5EGMA 2PWXA 2G00A 3SJ9A 1AY6H 1BHXB 1HAZB 1WAYB 4Y7BA 4LZ4B 3ODFA 2BX3A 4SGBE 1O37A 1TQ7B 8KME2 2J92A 1B5GH 1C4U2 1HIAB 4Y6DA 1QL7A 1K1JA 3TK6A 1T7CA 3UWJH 1F0RA 1MZDA 3P70B 1J14A 2OTVA 4Q80A 1HAVB 1O2VA 2STAE 3V12A 2VVUA 1H8DH 1KXAA 1GBLA 4CREA 1O2IA 2ZGXH 1Y8TA 3SHCH 5ESTE 3ZV9A 2WYJA 3ITIA 1EAWA 4ZH8A 5BPEA 4Y79A 3VFEA 3F9FA 4H6SB 1HAIH 2K0QA 5EQSA 1GL1A 1O2OA 1W0JD 3FFGA 3KQDA 1FIWA 1ARBA 3MFJA 1UTQA 3BG4C 4RI0A 1DPOA 1N8OC 4FU9A 2BHGA 5E8EH 2V3OH 2KR7A 2UUJB 1AZZA 4GSOA 1LHEH 3ZVAA 5DN6D 1SSXA 2A0QB 1CHOG 1K22H 6ESTA 1FJSA 1C2JA 4FUFA 2ZNKH 1OSSA 2HWLB 3B8JA 1IQLA 2VGCB 5DG6A 1H8IH 1PPEE 3VG8A 4KP0A 3MO6A 1RFNA 4K1TA 2HLCA 5DK1A 4ZROA 4NG9H 1T8NA 3RXVA 1QA7A 1RRKA 1P2JA 2VWNA 2P95A 3ZZ4A 2Y5GA 1LHGH 3MMGA 3AAUA 1NN6A 3TU7H 1MAXA 2B5TB 5C1YA 1CA0C 1UTOA 3SNCA 1ZSLA 1C5VA 2ODPA 1FPCH 1QR3E 3PTBA 4X1QU 3ESTA 4OGXA 1BT7A 1NRRH 1DS2E 3OEHD 3RUOA 2YNAA 2OUAA 4Y71A 4YT7H 1O36A 1LQDB 2R2MB 3V13A 1NRPH 2BMGB 1EPTB 3LKWA 4OS1A 1NFXA 1T8LA 3RMMH 2WZQA 2A4QA 1L4ZA 1AO5A 1J16A 1MTSA 1YPHC 4ABAA 2ZU4A 2VWMA 1B0FA 3OE7D 3KNXA 4UFFH 4YXWD 4CH8B 1IHSH 3DD2H 1GHZA 2HGTH 2R9PA 3OY6U 3F2FA 3NZIA 1G3CA 4WXVA 2ZQ2A 2C4FH 2O9QA 3S9AA 1J17T 3ATKA 3LU9B 5B6LA 3ZZ7A 3SU4A 1BTZA 2ODQA 1FV9A 1UVTH 4YM9A 3TGJE 3OAAD 2P93A 1RTLA 2FZZA 4FUJA 3FO8D 3M3SA 2W3IA 1WSSH 1KMHB 1P10A 1IHTH 1B0EA 2A7CA 2ZHFH 1FONA 4KGAA 2KAIA 1K1NA 1EZUC 4GHTA 4LK4A 1MH0A 2CV3A 2ANKH 3ATIA 3ENSB 1TABE 1VITG 1A3BH 1TQ0B 3UOUA 1WYKA 4INLA 1F7ZA 1OPHB 1EZXC 3E0NB 4XOJA 2EI7A 4QT8C 3T29A 1OWJA 1EQ9A 5CE1A 3VXFH 2I6QA 4X6PA 2A31A 1O2TA 1OWDA 5GCHG 1DICA 1K1PA 5JBBS 1DWCH 1N8OB 1S0RA 2J34A 1O2NA 2Z3CA 3A82A 4NSYA 2PGQB 3RMNH 2DUCA 2HNTC 4UE7H 4FOUC 1P9UA 2VINA 1QFKH 1B7XB 1O35A 3EE7A 3AW0A 1FUJA 1RIWC 2SGEE 1PYTC 3Q00A 4Q7ZA 3U8OH 3LJJA 3UREA 1QBVH 4NIWA 1ZGVA 1ZZZA 1EKBB 1UJ1A 1GI4A 1CHOF 3RLWH 1HJ8A 1TX6A 1ELAA 4GAWA 2Z9LA 1EB2A 1K28D 1O5GH 1VGCB 5EOKA 2O8LA 2TGDA 1CGHA 3I77A 2RDLA 1Z71A 1A4WH 2BDHA 4SGAE 1TA6A 1YPJH 2BD2A 3Q76A 1MTVA 1Y5AT 4NZLA 4RKOB 1A5IA 3E6PH 3KQ5A 2KCAA 1SLVB 2F9PA 3PMBB 1NT1A 1Z8RA 4GCHG 3TGKE 1UW7A 2KZ4A 1LQEA 3S69A 9LPRA 1O3HA 4BAHB 1V2OT 6CHAC 1LTOA 1W7XH 4ABHA 1C5XB 2UUFB 1L1NA 4A5TS 1MABB 1RTFB 1TOCB 3ZVBA 8ESTE 4INKA 1ESAA 2B8OH 3BN9A 2OK5A 1NRSH 5LPFA 1IQEA 4VGCB 1L2EA 1WQSA 5F8ZA 1AVXA 2J38A 1IQMA 1DANH 5KEDA 2ZFQH 3ZZ5A 1C5QA 2OCVB 1K1MA 1DY9A 1V3XA 2R0LA 2FO9A 1A0HB 1QB9A 2AH4X 1P2NA 4ZMAH 1Z7KA 1GCTC 2FWWA 2A7JA 1PFXC 4BNRA 3QK1A 2BY8X 1PQ5A 2BLWA 3GCOA 3HGPA 1H9LB 3TIUA 1JRTA 2GV7A 2M2AA 1GJ6A 1KXEA 1YPMH 1KSNA 1TOMH 2OC0A 1O2WA 2IN2A 5FPSA 1XKAC 1LHCH 1TRMA 2Z9GA 4D76A 2PGBB 1H8HD 2A2XH 1SGFA 1XVOA 2UUYA 4WMFA 2D2DA 2QV1A 1VITF 1UMAH 2ZFPH 1BTUA 1KYNA 3PRDA 1TNKA 3PYHA 2QGRA 5DGJA 5AFYH 2WPKS 1O2XA 1O32A 4X2XA 3PMAB 5FBEA 3BTEE 5F8TA 2BDGA 5GCHF 2IJOB 2QY0B 2VIQA 3DFLA 4CR9A 1J8AA 4LXBH 3F68H 2GX4A 1TGBA 4KTUA 3VPKA 1PYTD 1W8BH 4DCDA 3LGUA 5IDKA 3UQVA 1HPGA 1FY4A 1TPAE 4JZDH 1SR5C 4O3UA 1UO6A 1V6DA 1ABIH 1MTNB 4AC9A 1RXPA 1CSOE 4U30A 3HKJB 1TLDA 4TT3D 5A8ZA 4Y0YE 2AERH 4XD7D 2FOCA 2TGTA 1ZJKA 7LPRA 4YOGA 3QLPH 3BIVH 1SI5H 3I29A 1W2KH 3OY5U 5FPYA 3MWIU 4X2YA 1BTXA 1ETSH 3CS7A 1P8VC 2RDEA 2XOKD 4UFDH 4CRFA 3LDXH 1TGNA 1MMJN 2XW9A 2FPZA 6CHAB 2W3KA 1YP9A 3M3VA 3K65B 1ELVA 2SGDE 1C1TA 2FTLE 1IQGA 2A2QH 1MTWA 1OWHA 2IOTA 2BQWB 4GCHF 1F0SA 2ILNA 3BTGE 4DY7B 1XMNB 2FLBH 4MDSA 5C3NA 2ZTZA 2FI5E 3RXUA 3TNSA 5FL7D 1FLEE 1YBWA 4NCYA 1OHHD 1G36A 2FYRA 4BAMB 4CRAA 4U01A 5I25A 1A0JA 1TB6H 1NM6A 1GCTB 1ZMLA 5GIBA 4FU7A 4MNYA 5JBAS 1HXFH 3UNQA 2BDBA 4TYDA 2CGAA 1MZAA 2XXLA 1MTUA 3VGCB 3SGBE 1P12E 3PO1B 1AKSB 1BZXE 3MO3A 4FVDA 1P02A 2C90B 3D65E 3EAJA 3A7ZA 5CHAC 1ZTKA 2CF9H 2XCFA 1GMHG 4WH8A 3HK3B 1UVOA 4B73A 1F0TA 3STIA 1DWEH 1A3EH 5A2MH 3TH4H 1YPHE 2Q6FA 2ZFTA 5H4IB 4ACBA 4E05H 1THPB 3S9BA 2FI4E 2JETC 2CMYA 4AZ2B 4Q63A 1S6HA 2P8OB 3VEQB 2XC0A 1YF4A 2NU3E 2QE7D 1ESBA 3QDZB 1D4PB 2ZTYA 1QB6A 3LT3A 5C5OA 1QA0A 3SJKA 2FEQH 4I86A 3K6YA 2EI8A 2R3YA 3GY7A 1O2SA 1YPEH 2BD4A 1E0FD 3DSPA 4X8SH 3ZVFA 4R0IA 4D8NA 1Y5UT 5HGGA 1GWAA 1F0UA 1P04A 2BXTH 3AK5A 4RT0A 3DA9B 3D49H 2VWLA 3SZNA 4R8TB 3O8DA 5HIZA 1GHVH 4B6FA 2BXUH 2SFAA 4IGDA 3SI3H 4NIVA 2JDID 1O5DH 4IC6A 1GDUA 1O2QA 4BTUB 1MBMA 1G3BA 1O33A 1CO7E 2AMDA 3P8NA 5CDFE 1O0DH 1W0ZU 1HIAA 2Y5HA 1ZLRA 3A86A 4A7IB 2FOHA 1Z8IB 4OS5A 2BZAA 1HB0B 2VIOA 3SQEE 2HNTE 1GVZA 4ABGA 1SC8U 4WF8A 1UK4A 5J4QA 1AMHA 3TJOA 1S85A 1RGQA 3Q3XA 2XCNA 1O3DA 1T4VH 2BDAA 1ZOMA 1GMDG 2VJ1A 1YPLH 4Y11E 3PLBA 3RXDA 5C17A 1LHDH 6GCHG 3F9GA 4D7GA 1P57B 8GCHG 2Y5FA 3BF6H 1N6YA 3LOXA 1G3EA 1FX0B 1MU8B 3E8LA 3QGNB 5E2OA 3UNSA 4ABDA 1GJ5H 1C2LA 1O39A 3ZZ8A 1S84A 1SGDE 4ISHH 3RXLA 2A5IA 4MVNA 4E7NA 3MU5A 3WWBA 4JK6A 3V0XA 5TCAA 5GNDA 1BOQA 2JH0D 3EYDA 4MPWA 3C1KA 5DP3A 1W0YH 2NU2E 1LMWB 3SO3A 4DVAU 1C2FA 1O5CB 2JETB 3GDVA 3M5OA 2F9VA 3ZZ9A 1GMHF 1NBME 3RXHA 4AYYB 4IMZA 2FESH 4KKDA 2XWBI 1XUKA 3E0PB 3SHAH 2CK3D 1O2KA 3MNBA 4K5ZA 5B6OA 2ZPSA 3HATH 1PPBH 3SI4H 3T62A 4I32A 4HZHA 3URCA 3M7TA 4BAKB 3BTFE 3OEED 2PLXA 5A8XA 1DLEA 1GI9B 1A1RA 3F0OA 1XVMA 3BTQE 4GVUA 4E06H 1H9HE 1QJ1B 1RD3B 2Y80A 5JDUB 3ATLA 3TITA 4E7RG 2ZF0H 3Q3YA 4FUHA 1EB1H 1BBRE 3MH6A 1GI1A 3SU2A 3KGPA 3RXPA 3GCTG 5C1UA 6LPRA 2V6NA 3DHKH 2SGQE 3F9EA 3GY2A 1DX5M 1VKYA 1BIOA 4JZFH 1C5TA 1GDQA 1O3KA 1G37A 3UFAA 2KX4A 2PKAB 3RXAA 4UDWH 2DE8A 3RC5A 1ELTA 2RFKC 1PQ8A 1TMBH 2WHXA 4NSVA 3GY5A 3TH2H 3GCHC 3VB4A 3QZQA 1BMMH 1SLWB 2LELA 1GBFA 3ZZDA 2G4TA 1GHWH 3A8BA 1HAHH 3TNTA 2Y7ZA 1PPHE 2FOAA 1YLNA 2SGPE 1C5MD 1BHXF 2XNIA 1FNIA 4IN1A 3UQOA 4MPXA 1GMDF 1O5EH 1W11U 2H5CA 4WVPE 4WMDA 1GGDC 3MU8A 1L1JA 2GD4B 3O8BA 1PPGE 1TNIA 2BDCA 6GCHF 3LGIA 3SV7A 4KELA 8GCHF 1W12U 4NIYA 1GBTA 5T6FA 1ZTJA 4X1SU 3M37A 5EPYA 1AE5A 2VH6A 2TRMA 1AFQC 4NA9H 3W95A 2FS9A 1GDNA 2XTTB 1DDJA 2ZZUH 1RS0A 1JIRA 5AHGH 1FY8E 1SHYA 5A0BA 1JXPA 3A8DA 3PV5A 3TGIE 4K8BA 1XUGA 5JPMH 3SV8A 3QWCH 1YCPH 5JBTA 5DJ7A 5LGOA 1TWXB 1PPZA 4U2WA 2TPIZ 4D9RA 2W7SA 3ZV8A 2GZ8A 1DOJA 1EJAA 2OQUA 4JYTA 2NU1E 1V2PT 1TGTA 2BD3A 2BD5A 4HFPB 1MD8A 4MPVA 5FPTA 1ETRH 2CF8H 2W6JD 4CR5A 1OP2A 1A5GH 1GHBG 3H09A 4DJZB 5FCKA 1S6FA 3FOAA 3KF2A 1TRYA 4UONA 4YT6H 5K7RA 1FIZA 2WUBA 3A84A 1C1QA 5FXLA 5ABWA 1EX3A 3P92A 3P6ZB 1CT4E 2FX6A 1P01A 3F9HA 2R0KA 4JZEH 1C2EA 2ZKSA 1SGTA 3E3TA 1EASA 4XBBA 3GCTF 2H6MA 1X7AC 1UHBB 4ZUHA 1C1RA 2QF0A 3LC3A 3LGWA 2DE9A 4IC5A 3PM3A 1OWIA 3GCHB 1F5LA 1ACBE 1LPZB 1O2UA 5C0UA 1S6LA 5K0HA 4I8HA 1G3DA 1THRH 3VB3A 1ZMJA 4THNH 2QAAA 5TCCA 1KLIH 3BTHE 2D1JA 2H9EH 3A8CA 2YMSC 1O3IA 3A7VA 3IG6B 1C5RA 2QXGA 1W10U 1SGNE 1E38B 2I6SA 1KLJH 1QQ4A 3LJOA 1GGDB 2AHME 1QQUA 4DIHH 4CRDA 5C1XA 4U32A 1C1MA 4DT7B 2VU8E 2HVYB 3PV2A 1Z6JH 2GVFA 3E91A 4X1RU 1C9PA 2C93B 1H4WA 1UVUH 2H2ZA 4H42U 5ESBA 2JJ1D 3GDSA 3BG4B 1DUAA 2ZFFH 3ATMA 1CE5A 2WSSD 2ZDNA 4RKJB 2Y6TA 4GUXA 4CBOA 3MH4A 2ZCHP 3GYMA 5JB9S 3DT0H 5JB8S 2OLGA 1P2MA 3TLOA 3OTPA 1QNJA 1ZPCA 1TMTH 3URDA 1WBGB 3GDUA 3BEUA 4WMEA 3SU0A 1GBCA 3NKKA 4A1VA 5HM2A 2GP9B 2W5EA 1AN1E 2J98B 3TH3H 1DXPA 3K6ZA 1A7SA 1C2DA 2O8TA 1HYLA 1ID5H 2KCYA 2C3SA 2PSXA 1XUJA 2WV5A 4D7FA 1C2KA 4I8JA 2ZPRA 3Q77A 3SUDA 4DT4A 1F5KU 3UOPA 1QRZA 1CA0B 1TPSA 4JYVH 1JBUH 2F91A 2OINA 2RG3A 1CBWC 1A5HA 5FBIA 3EA7A 3SNEA 4CRCA 2QC2A 5GJ4B 1SQAA 1O2HA 3GY4A 4X6OA 2FP7B 3SJIA 2OP9A 2FOGA 4ACAA 1ANDA 1IQFA 1GHBF 4NWKA 3R0FA 1O3PB 5EJ1A 1E35B 3LPRA 2IJD1 4BXWA 1BTYA 3GS9A 3PMHB 1KXBA 1YCPK 2ZU1A 3ZVEA 3SU1A 3U8TH 2RCEA 2AMQA 4DIIH 1YGCH 3M7QA 1QRXA 3NRLA 2VH0A 3GY8A 3KL6A 3PTNA 1S82A 4Y8YA 1HAGE 3EE0B 4BXSA 2NWNA 5DP4A 1DSTA 3F3BA 3SN8A 5AVDA 1ANEA 1NY22 3T27A 2ANYA 2AGIX 3PWCA 4OS7A 5A8YA 2BOHB 4HTCH 3U8RH 4IBLH 4B76A 4ZHLU 1NU7B 3P95A 7ESTE 2O8MA 2OQ5A 3ZVDA 1SKYE 1UTLM
chains in the Genus database with same CATH topology
2KCOA 3EYDA 3N99A 2YMSD 2VBCA 5IK2D 3PV2A 4Q63A 5EPYA 3DCLA 3OFND 3SU2A 2QE7D 2F43B 2GVFA 2IJOB 1BMFD 3L6PA 3M5OA 2F9VA 4ASUD 1NBME 5ESBA 2FOMB 2JJ1D 3SYJA 3SUGA 1NS3A 1W3CA 3N7EA 2WSSD 2YMSB 5HKKD 2CK3D 3FKSD 3M5LA 1JXPA 5IDKA 3PV5A 1BT7A 4K8BA 2K8IA 3SV8A 3SV9A 3OEHD 4FETA 3WWFA 3OTPA 5ETXA 3DSPA 3KN2A 3W1EA 2KCPA 1W0KD 4I32A 4TSFD 3SU0A 4A1VA 3LKWA 5GPIB 4B6EA 4Z1MD 3AK5A 3SZEA 3OEED 1N1LA 5CHBA 4R8TB 1A1RA 2HLDD 3F0OA 1DXPA 2WZQA 2A4QA 3O8DA 4Q4LA 4TT3D 2KCAA 3U1IB 4B6FA 2QF5A 2YOLA 4XD7D 2JDID 2KCYA 2OC1A 3SV6A 5FPTA 5EQRA 3OE7D 3KNXA 4YXWD 2KZ4A 2W6JD 3LONA 2OBQA 3SUDA 4DT4A 1E79D 3FN8A 5FPYA 2KM0A 2JJ2D 3RC4A 1DY8A 2GGVB 3E90B 3H09A 3M5NA 2F4LA 2W6ID 2XOKD 3F2FA 3FOAA 3KF2A 3P8NA 5CDFE 2OINA 2K1QA 4ZCNA 3O8RA 3PRBA 2JIZD 1E1QD 1E1RD 1MABB 1WXRA 3SUEA 5B6LA 3SU4A 4B75A 4B71A 2V7QD 5GJ4B 2OK5A 3OAAD 5T1VA 1RTLA 2P59A 5F53A 3FO8D 4M9FA 2FP7B 4WF8A 3RC6A 2OC8A 3SUFA 4A1XA 1KMHB 2KFWA 5C0TA 1RGQA 3M5MA 2L6OA 3KEEA 3RC5A 2XCNA 4JMYA 1DY9A 4NWKA 2A4RA 5FL7D 4B74A 2OC7A 2WHXA 2IJD1 3WW7A 3GS9A 1OHHD 4KTCA 1COWD 5C17A 4I33A 4WH6A 2LELA 4U01A 3U1JB 3O8CA 3F2GA 3SU1A 1DXWA 3OYPA 2A4GA 2WV9A 3NRLA 5EQQA 2K0QA 1H8ED 3DSOA 2M2AA 5EQSA 2OC0A 1W0JD 1CU1A 2OBOA 4OM9A 5C0UA 1S6LA 4TYDA 5FPSA 4RI0A 2J5UA 3F3BA 3SU3A 3LOXA 1FX0B 1H8HD 2YMSC 3SU5A 2KR7A 2XNIA 3N7DA 2FM2A 3SU6A 5DN6D 1EFRD 3F0PA 5DSFA 2XNDD 2XCFA 3O8BA 2QV1A 4WH8A 5EPNA 4NWLA 4B76A 4I31A 4B73A 4F55A 1NBMD 2O8MA 3UB0A 2AHME 2QF4A 4A92A 3PRDA 3SV7A 3P8OA 2F9UA 5H4IB 3VG8A 3WWBA 3F2HA 2WPDD 1SKYE 4A1TA 3ZIAD 5GNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSO A;  2LEL A;  3N7E A;  3N7D A;  3DSP A;  2KM0 A;  2K0Q A; 
#chains in the Genus database with same CATH topology
 4K1S A;  1EOJ A;  2YMS D;  1DLK B;  1MKX H;  1HAY B;  1SQO A;  4EST E;  3T2N A;  2F43 B;  3OU0 A;  1W14 U;  3MQK C;  1O3C A;  1GBA A;  1N6X A;  2UWO A;  2WV4 A;  3ZZ3 A;  2ANW A;  2TBS A;  1GI6 A;  1BRC E;  4JYU H;  2BD9 A;  1OXG A;  3RXO A;  1FDP A;  1SGP E;  3N7E A;  2G4U A;  1GL0 E;  5F8X A;  4GLY A;  1C1W H;  1NZQ H;  1SFI A;  2FOE A;  2ZFR H;  1QY6 A;  4IW4 E;  3PLP A;  3FZD A;  3KN2 A;  1YLC A;  2R2W U;  1QCP A;  3AW1 A;  3MU1 A;  3RXR A;  3K2U A;  4B2B A;  3KHV A;  1D3D B;  1RIW B;  1MU6 B;  1NRN H;  2GCT C;  3KQB A;  3SV6 A;  4ZXY H;  2Z6B D;  3LON A;  1A61 H;  1SLX B;  2BD8 A;  2Z9K A;  1ANB A;  2ZCK P;  4UFG H;  3VB7 A;  1Q31 A;  4AB9 A;  4BAN B;  1DVA H;  4ZCN A;  3ODD A;  1E1Q D;  2GT7 A;  2LP6 A;  2KAI B;  4GPG A;  5I46 H;  2GDD A;  1G2L A;  1CBW B;  1EZS C;  1BTP A;  5EXM A;  4AFS A;  2ZHQ H;  3SJO A;  1P0S H;  4F4O C;  2OC8 A;  3RXK A;  3I78 A;  1PPC E;  1O2Y A;  2SNW A;  1GJ9 B;  4AOQ A;  2CHA C;  5J4S A;  2FX4 A;  2P3F H;  1GHX H;  2FTM A;  1UTJ A;  1MQ5 A;  3T28 A;  2AIQ A;  1VCW A;  2GMT C;  5DP8 A;  4CHA C;  4F48 B;  1GJB B;  2PR3 A;  1ZPZ A;  1GHA G;  2A4G A;  2Q1J A;  3SNA A;  1C5P A;  3BSQ A;  3BV9 B;  2Z3D A;  1CU1 A;  1TAW A;  1NC6 A;  1VIT H;  3EGK H;  1ZRB A;  1NES E;  2Y82 A;  1KXF A;  2J94 A;  4AG2 A;  1TFX A;  5FHT A;  2FMJ A;  3UR6 A;  2J97 A;  5IYT A;  5TJX A;  1EFR D;  2XND D;  1O3O A;  2UWP A;  2A5K A;  1E36 B;  5FX6 A;  3BTW E;  1LDT T;  1NBM D;  2QF4 A;  1WCZ A;  1ELD E;  2BY6 X;  4YTA A;  1XUF A;  2F9U A;  3SNB A;  1HCG A;  1SB1 H;  4ISI H;  2C8Y B;  2VVC A;  1BJV A;  2QCY A;  2G51 A;  2HVX A;  3DCL A;  3A80 A;  3H7O A;  1T8M A;  3GY6 A;  3RXB A;  1L0Z A;  1O38 A;  2FOB A;  4WWY A;  2AMP A;  1YYY 1;  3OTJ E;  3GIC B;  3DFJ A;  1NRQ H;  3SYJ A;  1H9I E;  1QBO A;  1LVO A;  1NS3 A;  2V3H H;  5HKK D;  4AFZ A;  2F9O A;  4XDE A;  1ZRK A;  3RM2 H;  2B7D H;  4RN6 A;  1MCV A;  2BYA X;  4P00 A;  5BRR E;  1L4D A;  3DSG A;  1G32 B;  1KXC A;  2JH5 D;  4ISN A;  2VIW A;  2IPQ X;  3DUX H;  3CEN A;  3NWU A;  1C1O A;  3CNR A;  2VIP A;  4XFQ A;  2GV6 A;  2BVR H;  3CP7 A;  1QB1 A;  3MNS A;  1JIM A;  2ANM H;  2PHB A;  1EAT A;  1YLD A;  1EAX A;  1U6Q A;  1O2Z A;  1S5S A;  1KTT B;  1UCY E;  1GJC B;  2WPL S;  2WYG A;  4ZKN U;  2B9L A;  3RC4 A;  2JJ2 D;  5EXN A;  1DY8 A;  2GGV B;  5LPE A;  2GZ7 A;  4RSP A;  4MLF B;  1UK2 A;  2BLV A;  4NZQ A;  1O2J A;  3UR9 A;  3O8R A;  2A4O A;  2AEI H;  1CGI E;  2GDE H;  4JK5 A;  3W94 A;  2AYW A;  3M3T A;  1Y3V A;  1MKX K;  2PFE A;  2A45 B;  4X8T H;  1V2W T;  1WV7 H;  3A83 A;  4NFF A;  3QZR A;  1C5Y B;  1C9T A;  1PQ7 A;  1BBR H;  2PKS C;  1GBJ A;  4A1X A;  2HAL A;  2KFW A;  4XBD A;  1OKX A;  3G01 A;  3QUM P;  3KQC A;  3EQ0 H;  2VVV A;  1EST A;  2CHA B;  3H7T A;  1TGC A;  5T6G A;  2H5D A;  4NIX A;  8LPR A;  1H8E D;  3RU4 T;  1HAV A;  1O2M A;  1VCQ A;  4WXI A;  2OBO A;  4CHA B;  1AU8 A;  3RXM A;  3C27 B;  3SJ8 A;  3TK5 A;  1C2M A;  4I8K A;  4RT1 A;  2H1U A;  3Q3K A;  2ZG0 H;  2PUQ H;  2FM2 A;  2C8W B;  1EP5 A;  1Y3Y A;  3GIS B;  1E34 B;  2QIQ A;  3U69 H;  1IQH A;  1KIG H;  4ABJ A;  1GHA F;  3UB0 A;  4A92 A;  3BG8 A;  2D26 C;  2FLR H;  3P8O A;  3U98 H;  1GMC G;  2BD7 A;  2PTN A;  1SQT A;  3U1J B;  3ZIA D;  3SND A;  3SQH E;  3N99 A;  4UFE H;  3T5F H;  9EST A;  3FAO A;  3A85 A;  1P05 A;  2BX4 A;  4BOH A;  1O5B B;  1OOK B;  1O30 A;  3U9A H;  2J2U A;  1C5O H;  1HJA C;  4Y7A A;  1F2S E;  1H1B A;  2EC9 H;  5HMA A;  3UAI C;  2BOK A;  3ZZB A;  1THS H;  5CHA B;  4MPU A;  1ZHM A;  4HI3 A;  1MUE B;  2XYA A;  7GCH G;  2BM2 A;  2ZGH A;  1ABJ H;  2KCP A;  1ZMN A;  4OS6 A;  1YPK H;  1EOL A;  1G9I E;  1NFW A;  2H9H A;  4UD9 H;  2ZU5 A;  3SZE A;  5CHB A;  2ZDK A;  4BTT B;  1LVM A;  3VXE H;  1CHG A;  1D3T B;  2PV9 B;  1C5W B;  5C5N A;  1WTH D;  1EUF A;  4ZHA A;  1KDQ B;  2QXH A;  2CXV A;  1V2L T;  2AGE X;  1EPT A;  2OBQ A;  2M5T A;  4X2V A;  4NGA H;  3RDZ A;  2KM0 A;  1V2M T;  2UWL A;  4D9Q A;  5E0J A;  2Z94 A;  4M7G A;  4F49 A;  3LH1 A;  5PTP A;  5C94 A;  1BQY A;  2ZI2 H;  4B1T A;  2SNV A;  1WXR A;  3SUE A;  2PW8 H;  3FP8 E;  4B71 A;  2LNC A;  1HBT H;  1ANC A;  1QL9 A;  1C2G A;  1CVW H;  1WQV H;  5DP5 A;  1BMN H;  1GBK A;  1TYN A;  3ZZ6 A;  2JKH A;  3NUM A;  5C0T A;  3FVF B;  1QJ7 B;  1INC A;  2W7U A;  2VGC C;  4ABI A;  2XBY A;  4J2Y B;  3QO6 A;  4O3T A;  1BCU H;  2G5V A;  3EA9 A;  3TVJ B;  3WY8 A;  1C1N A;  4I33 A;  4WH6 A;  3HPT B;  3U28 C;  2F83 A;  5KEC A;  2WPJ S;  1TNH A;  3O8C A;  3B23 B;  1BRA A;  5DKM A;  1GVK B;  3OYP A;  3BTK E;  1XKB C;  4YOI A;  1CT2 E;  3JZ1 B;  2VID A;  4ZKR U;  1Y59 T;  4X1N U;  1QIX B;  5HIY A;  1Y3W A;  3ZVC A;  4BAO B;  1NFU A;  3SU5 A;  3H5C B;  1IQK A;  2G8T A;  2SGA A;  1XXF A;  5EPN A;  1IAU A;  3N7O A;  1SPJ A;  4K60 A;  1DIT H;  4O97 A;  1HAO H;  1C5L H;  1GBE A;  1BTH H;  1SMF E;  4K69 A;  1QTF A;  1FZZ A;  4IMQ A;  3OFN D;  3RXC A;  1VJA U;  1HGT H;  2G81 E;  3PWB A;  2ZEC A;  4ZHM U;  1BBR K;  1G30 B;  4FUD A;  3L6P A;  4OGY A;  3RM0 H;  1ELG A;  3ZVG A;  3ZZA A;  1GI8 B;  1C4V 2;  2ZTX A;  3FKS D;  1GMC F;  3M5L A;  3PRO A;  1DUE A;  2WPI S;  1JRS A;  4Y76 A;  5L2Y H;  4TPY A;  1W0K D;  1MD7 A;  3M61 U;  1KXD A;  3FP6 E;  1OP0 A;  1ZSK A;  1UK3 A;  1CA8 B;  5A0C A;  1MCT A;  1DM4 B;  2QXJ A;  2PTC E;  1FY1 A;  4B2A A;  1GCD A;  2BY9 X;  3MOC A;  5DP9 A;  1O2P A;  2F4L A;  7GCH F;  1Y3X A;  1ELC A;  1EJN A;  1C5N H;  5DPA A;  1ARC A;  1NFY A;  1K21 H;  1DWB H;  1WTG H;  1BA8 B;  1ELF A;  2V7Q D;  1LO6 A;  2FDA A;  2ZGC A;  1V2V T;  3SW2 B;  3QGJ A;  1VZQ H;  2Z3E A;  1BMA A;  2HRV A;  3RLY H;  2WUC A;  4GHQ A;  1ZTL A;  4NA8 A;  1SLU B;  2TGA A;  1GBI A;  2R3U A;  1KTS B;  1VCP A;  4FUG A;  3ATW A;  3MI4 A;  5GWZ A;  4YLU A;  4XSK U;  3SGQ E;  2AIP A;  2FIR H;  1ELE E;  3TK9 A;  2Z9J A;  5DO4 H;  3AAV A;  1QBN A;  4X2W A;  2P16 A;  2TIO A;  3F2G A;  3D23 A;  1P2I A;  2C8Z B;  1V2Q T;  2F9N A;  2J4I A;  1M9U A;  1OYQ A;  1TBQ H;  1AWF H;  1P11 E;  1EXF A;  3KQE A;  2FOD A;  4TY6 A;  4FU8 A;  1DE7 H;  1K1I A;  3RU4 E;  1AUT C;  1VGC C;  2ZHD A;  2BLQ A;  3MU0 A;  1W7G H;  3F0P A;  5LH8 A;  2EST E;  1S83 A;  1FN6 A;  2VB0 A;  3LGV A;  1CQQ A;  1HV7 A;  3IWM A;  3F2H A;  2WPD D;  1LKA A;  4ZAE A;  4TWY A;  1D3Q B;  2FXR A;  4ISO A;  5T3H A;  4CRB A;  1AB9 C;  4XE4 A;  5IK2 D;  1O3J A;  2NU4 E;  4Y0Z E;  3K9X B;  2P94 A;  4H6T A;  4FVB A;  1C1S A;  4ABE A;  2ZA5 A;  1QHR B;  4JZI A;  4MTB A;  5KGO A;  2GCH G;  1TBR H;  4UEH H;  1O3G A;  1J9C H;  3A7W A;  1Z6E A;  2PUX B;  3BEI B;  3D62 A;  4K1E A;  3T25 A;  4NA7 A;  1MKW H;  2Q6G A;  5HXF A;  3PMJ A;  1SL3 A;  1Z8G A;  1DFP A;  2QF3 A;  1ZHR A;  2G5N A;  3HGN A;  4VGC C;  3EA8 A;  1V2K T;  1UTK A;  1SGY E;  1AUJ A;  1GJD B;  1O34 A;  2RA0 A;  1TMU H;  5GPI B;  4Y10 E;  4B6E A;  3LH3 A;  4TY7 A;  4Q4L A;  1HJ9 A;  3MO9 A;  4YZU A;  4CRG A;  3QTV H;  2QF5 A;  2TGP Z;  1AVG H;  2EA3 A;  2XWA A;  2ZDV H;  2OC1 A;  1GJA B;  5EQR A;  5E0H A;  4AGJ A;  2ZHW H;  4DG4 A;  3FP7 E;  1AFQ B;  1AZ8 A;  2F3C E;  2W26 A;  2H9T H;  2Y81 A;  1NU9 A;  2UUK B;  3RXQ A;  1IQN A;  1HLT H;  1JWT A;  5FCR A;  3PRB A;  1SGI B;  4I8G A;  2HOB A;  3L33 A;  4AGK A;  2QXI A;  4B75 A;  1C5Z B;  2WPH S;  5T1V A;  2P59 A;  5F53 A;  1OX1 A;  3A8A A;  3MYW A;  2GZ9 A;  4YLQ H;  3UPE A;  2OXS A;  2YNB A;  3LIW A;  3EDX B;  2L6O A;  3KEE A;  4KTS A;  3BTT E;  4JMY A;  1IOE A;  1A2C H;  2WIN I;  4ISL A;  4NFE A;  1SOT A;  3M7U A;  3WW7 A;  1Y5B T;  1BRU P;  2EI6 A;  2ODY B;  1YCP M;  2V0B A;  3P8G A;  1ZR0 A;  1ZJD A;  3SV2 H;  2ZDA H;  2J9N A;  3DSO A;  1K0H A;  2FYQ A;  1GJ8 B;  1DSU A;  2GJG A;  2ZU2 A;  4OS2 A;  4AN7 A;  2ZO3 H;  3P17 H;  3SU3 A;  3SOS A;  3N7D A;  1MAY A;  1BUI A;  1PQA A;  4X1P U;  1UTN A;  3T26 A;  3AVZ A;  3MNC A;  1C5U A;  4HG6 A;  3BIU H;  1HRT H;  1LVB A;  1LPK B;  1MTN C;  1V2T T;  2G52 A;  4TWW A;  1NTP A;  1AKS A;  1C1U H;  1HXE H;  1BTW A;  2ALV A;  1QL8 A;  3S9C A;  1D6R A;  1GBM A;  1AB9 B;  1BMF D;  3TJV A;  1IQJ A;  1TIO A;  3NCL A;  2QYI A;  5DP6 A;  4HGC A;  1SG8 B;  1HAP H;  4LZ1 H;  2YMS B;  2HPQ H;  3VB6 A;  3IIT A;  1XUI A;  4JZ1 A;  2K8I A;  3F6U H;  1BML A;  2G55 A;  3NPS A;  4FET A;  3RXI A;  5ETX A;  1LPG B;  1O5F H;  3QTO H;  4K8Y A;  3RXE A;  2A32 A;  4TSF D;  2Z7F E;  3RXF A;  4CH2 B;  1BRB E;  4AB8 A;  4K2Y A;  1V2N T;  3BTD E;  1AGJ A;  1N1L A;  2GCH F;  1ORF A;  1C4Y 2;  2NU0 E;  1GJ4 H;  1OS8 A;  2ZFS A;  1GPZ A;  1O3A A;  5G4B A;  2HPP H;  1GVL A;  1AVW A;  2BTC E;  3SOR A;  1O3N A;  4O03 A;  2VIV A;  1TNL A;  1D9I A;  2ZDL A;  2ZGB H;  1FAK H;  1Z8J B;  4YES B;  1C2I A;  3MH5 A;  5C20 A;  2ZCL P;  1TBZ H;  1Z1I A;  2GTB A;  1E1R D;  2JIZ D;  1XX9 A;  3VGC C;  5HM9 A;  1JMO H;  2P3U B;  3PO1 C;  1FQ3 A;  5AF9 H;  4FUE A;  2WPM S;  1UCY H;  2BQ6 B;  2AGG X;  4OS4 A;  2BVX H;  3A7T A;  1TAL A;  2HNT F;  1TE0 A;  1V2S T;  1AQ7 A;  1P9S A;  5DP7 A;  4ABB A;  1QUR H;  1K9O E;  1MKW K;  2OC7 A;  3V3M A;  4B2C A;  1WU1 A;  2V35 A;  1DWD H;  4K3J A;  4Q7Y A;  1QGF A;  1D6W A;  2P8O C;  4X0W U;  1O3F A;  2D8W A;  3PV4 A;  1SGE E;  1MQ6 A;  2BB4 A;  1TA2 A;  5L6N H;  2BQ7 B;  4MNX A;  1XM1 A;  1VR1 H;  4OM9 A;  5EG4 A;  4LOY H;  5E2P A;  3UUZ A;  2ZIQ H;  2J5U A;  4AG1 A;  5FX5 A;  2JH6 D;  4IN2 A;  4BAQ B;  1QJ6 B;  3NXP A;  1YY3 A;  4AOR A;  1GBB A;  1SGF G;  2Q6D A;  1AD8 H;  2XRC A;  1P2O A;  4H4F A;  1YC0 A;  3RXG A;  1A0L A;  3PLK A;  1AHT H;  1OWE A;  1KLT A;  3MHW U;  3ELA H;  1P09 A;  1SHH B;  1SVP A;  3L3T A;  1P2Q A;  1SBW A;  1S0Q A;  1WDI A;  5EOD A;  3BEF B;  2A7H A;  4FUB A;  4FUI A;  4DGJ A;  4X8V H;  4IS5 A;  1LKB A;  1ETT H;  1P06 A;  1FPH H;  2XBV A;  1ELB A;  3MTY A;  2ZQ1 A;  2ZGJ A;  5GDS H;  1BB0 B;  4Y8Z A;  5F03 A;  1FN8 A;  4X6N A;  1GI2 A;  2FOM B;  1YPG H;  2BY7 X;  2GKV E;  2Z9I A;  1YM0 A;  1EZQ A;  1XUH A;  1AI8 H;  1EAI A;  1W3C A;  1SGR E;  5EXL A;  1ZHP A;  3HK6 B;  1LVY A;  1OWK A;  1KDQ A;  3B9F H;  1FAX A;  2LPR A;  1HUT H;  1YKT A;  3JZ2 B;  4Z1M D;  3KYF A;  1WUN H;  1GI5 A;  1D3P B;  2Y7X A;  4XRN A;  1PPF E;  1GI7 B;  1ZYO A;  2YOL A;  1BIT A;  2AS9 A;  3HKI B;  4MQA A;  4ASH A;  3BTM E;  3R3G B;  3F1S B;  1T8O A;  2XC4 A;  1TX7 A;  2ZDM A;  3FN8 A;  1T32 A;  3RXT A;  1FY3 A;  3FAN A;  3KID U;  4YOJ A;  1EJM A;  2EEK A;  5SGA E;  2ZWL H;  3TPI Z;  4MNV A;  4O9V A;  4Q7X A;  3KYG A;  3LGY A;  1GI0 A;  4ZKS U;  3GYL B;  2BY5 X;  5F6M A;  2RA3 A;  3GY3 A;  1P2K A;  1Q3X A;  3RC6 A;  1E37 B;  1KY9 A;  1Y3U A;  1ZPB A;  5HYO A;  1FXY A;  2GT8 A;  1GG6 C;  4MNW A;  1LHF H;  3M5M A;  5T6D A;  3A87 A;  2PP6 A;  2A4R A;  1FMG A;  1AWH B;  2GCT B;  4B74 A;  4KTC A;  1COW D;  4ZXX H;  1HAX B;  3QN7 A;  3E1X B;  1GI3 A;  1DXW A;  3SGA E;  3M35 A;  1SFQ B;  2PKA A;  1SGQ E;  2ZP0 H;  3STJ A;  4X8U H;  4CBN A;  1TRN A;  5EQQ A;  1NPM A;  3A81 A;  3ZYD A;  4X6M A;  5FAH A;  2BVS H;  1OYT H;  1GBD A;  1UVS H;  1T31 A;  1ZSJ A;  2XBW A;  1CT0 E;  1FI8 A;  5EJZ A;  1QRW A;  1YWU A;  2BZ6 H;  5GXP A;  1BJU A;  1PJP A;  5JYI A;  5EW2 H;  1K2I 1;  5L2Z H;  3CS0 A;  4TPI Z;  3SU6 A;  5DSF A;  4I31 A;  4PRO A;  2ZHE H;  2XC5 A;  2BDY A;  5EW1 H;  1A46 H;  2C8X B;  3UY9 A;  3V7T A;  4I8L A;  2VNT A;  3ZZC A;  3ZYE A;  2KCO A;  1F5R A;  2VBC A;  1GBH A;  2IPH A;  2GMT B;  2VWO A;  2P3T B;  1UVP A;  1UCY K;  2FS8 A;  3LC5 A;  1DT2 A;  1F92 A;  4WJG 2;  3UIR A;  2O8W A;  1C1P A;  1O2G H;  5EJL A;  2SGF E;  3MH7 A;  3SUG A;  4JCN A;  1VJ9 U;  4Z6A H;  1TPO A;  1NO9 H;  3S7H B;  3TJN A;  1UTP A;  1C2H A;  2STB E;  1O3L A;  1SGC A;  2A1D B;  3OSY A;  4A6L A;  2HLD D;  3A88 A;  1NRO H;  2THF B;  3MNX A;  3VB5 A;  3UNR A;  3MU4 A;  4AX9 H;  1UTM A;  1WOF A;  2CN0 H;  1O3B A;  1TX8 A;  3RXS A;  4ABF A;  5LPR A;  1XXD A;  4BTI B;  1O3E A;  3A7Y A;  1V2R T;  1TGS Z;  1E79 D;  4FXG H;  1O31 A;  4P02 A;  1TNJ A;  3E90 B;  4J1Y A;  5C67 A;  2W6I D;  1AE8 H;  4Z0K A;  2OD3 B;  2EY4 C;  2ZEB A;  2K1Q A;  1J15 A;  1FY5 A;  1C1V H;  5C2Z A;  1RJX B;  1V2J T;  1MBQ A;  1GJ7 B;  4DOQ A;  1TON A;  3RP2 A;  3KCG H;  1HFD A;  2CJI A;  2L74 A;  4M9F A;  1V2U T;  3FZZ A;  3SUF A;  4MG3 A;  1P3E A;  5A0A E;  1SOZ A;  1BDA A;  3AAS A;  3RU4 D;  2QA9 E;  1GG6 B;  5L30 H;  2BDI A;  3GCN A;  3QX5 H;  3NK8 A;  2WV9 A;  2B0F A;  4DUR A;  1HDT H;  1S81 A;  1C5S A;  1GHY H;  1UHB A;  1LCY A;  1TNG A;  1O2L A;  1IQI A;  1ZGI A;  4AYV B;  3S7K B;  1L1G A;  2F9B H;  5EIY A;  2EQN A;  1OP8 A;  4XBC A;  1W13 U;  1CGJ E;  2PKS B;  4NWL A;  4F55 A;  1T4U H;  4FUC A;  5A09 A;  1EAU A;  2BLO A;  5CMX H;  3SBK A;  2QN5 T;  2A5A A;  4A1T A;  1SQR A;  3P8F A;  3UTU H;  1HNE E;  4AFQ A;  2ULL A;  5EU8 A;  3A7X A;  5E0G A;  1O5A B;  4I7Y H;  3E16 B;  3PB1 E;  2O8U A;  4ASU D;  2J95 A;  5AFZ H;  1O3M A;  1P3C A;  3OX7 U;  1Q2W A;  3A89 A;  3SV9 A;  1QZ8 A;  1EPT C;  4AFU A;  3WWF A;  2V3M A;  2ALP A;  4YO9 A;  2ZC9 H;  3M36 A;  3W1E A;  3TJU A;  2FOF A;  3RML H;  1EP6 A;  1AFE H;  1K1L A;  4DW2 U;  4ZKO U;  1JOU B;  3U1I B;  1P03 A;  2ZU3 A;  5JBC S;  4Y8X A;  3S0N A;  2PSY A;  3LGT A;  2ZPQ A;  1G2M A;  1TPP A;  3UWI A;  1K1O A;  4WY3 A;  3RXJ A;  2AFQ B;  3RMO H;  1AIX H;  1O2R A;  3M5N A;  2J98 A;  4INH A;  2XBX A;  1RTK A;  7KME H;  1HJA B;  2ASU B;  2FI3 E;  4Q2K A;  3GOV B;  1Z1J A;  5EGM A;  2PWX A;  2G00 A;  3SJ9 A;  1AY6 H;  1BHX B;  1HAZ B;  1WAY B;  4Y7B A;  4LZ4 B;  3ODF A;  2BX3 A;  4SGB E;  1O37 A;  1TQ7 B;  8KME 2;  2J92 A;  1B5G H;  1C4U 2;  1HIA B;  4Y6D A;  1QL7 A;  1K1J A;  3TK6 A;  1T7C A;  3UWJ H;  1F0R A;  1MZD A;  3P70 B;  1J14 A;  2OTV A;  4Q80 A;  1HAV B;  1O2V A;  2STA E;  3V12 A;  2VVU A;  1H8D H;  1KXA A;  1GBL A;  4CRE A;  1O2I A;  2ZGX H;  1Y8T A;  3SHC H;  5EST E;  3ZV9 A;  2WYJ A;  3ITI A;  1EAW A;  4ZH8 A;  5BPE A;  4Y79 A;  3VFE A;  3F9F A;  4H6S B;  1HAI H;  2K0Q A;  5EQS A;  1GL1 A;  1O2O A;  1W0J D;  3FFG A;  3KQD A;  1FIW A;  1ARB A;  3MFJ A;  1UTQ A;  3BG4 C;  4RI0 A;  1DPO A;  1N8O C;  4FU9 A;  2BHG A;  5E8E H;  2V3O H;  2KR7 A;  2UUJ B;  1AZZ A;  4GSO A;  1LHE H;  3ZVA A;  5DN6 D;  1SSX A;  2A0Q B;  1CHO G;  1K22 H;  6EST A;  1FJS A;  1C2J A;  4FUF A;  2ZNK H;  1OSS A;  2HWL B;  3B8J A;  1IQL A;  2VGC B;  5DG6 A;  1H8I H;  1PPE E;  3VG8 A;  4KP0 A;  3MO6 A;  1RFN A;  4K1T A;  2HLC A;  5DK1 A;  4ZRO A;  4NG9 H;  1T8N A;  3RXV A;  1QA7 A;  1RRK A;  1P2J A;  2VWN A;  2P95 A;  3ZZ4 A;  2Y5G A;  1LHG H;  3MMG A;  3AAU A;  1NN6 A;  3TU7 H;  1MAX A;  2B5T B;  5C1Y A;  1CA0 C;  1UTO A;  3SNC A;  1ZSL A;  1C5V A;  2ODP A;  1FPC H;  1QR3 E;  3PTB A;  4X1Q U;  3EST A;  4OGX A;  1BT7 A;  1NRR H;  1DS2 E;  3OEH D;  3RUO A;  2YNA A;  2OUA A;  4Y71 A;  4YT7 H;  1O36 A;  1LQD B;  2R2M B;  3V13 A;  1NRP H;  2BMG B;  1EPT B;  3LKW A;  4OS1 A;  1NFX A;  1T8L A;  3RMM H;  2WZQ A;  2A4Q A;  1L4Z A;  1AO5 A;  1J16 A;  1MTS A;  1YPH C;  4ABA A;  2ZU4 A;  2VWM A;  1B0F A;  3OE7 D;  3KNX A;  4UFF H;  4YXW D;  4CH8 B;  1IHS H;  3DD2 H;  1GHZ A;  2HGT H;  2R9P A;  3OY6 U;  3F2F A;  3NZI A;  1G3C A;  4WXV A;  2ZQ2 A;  2C4F H;  2O9Q A;  3S9A A;  1J17 T;  3ATK A;  3LU9 B;  5B6L A;  3ZZ7 A;  3SU4 A;  1BTZ A;  2ODQ A;  1FV9 A;  1UVT H;  4YM9 A;  3TGJ E;  3OAA D;  2P93 A;  1RTL A;  2FZZ A;  4FUJ A;  3FO8 D;  3M3S A;  2W3I A;  1WSS H;  1KMH B;  1P10 A;  1IHT H;  1B0E A;  2A7C A;  2ZHF H;  1FON A;  4KGA A;  2KAI A;  1K1N A;  1EZU C;  4GHT A;  4LK4 A;  1MH0 A;  2CV3 A;  2ANK H;  3ATI A;  3ENS B;  1TAB E;  1VIT G;  1A3B H;  1TQ0 B;  3UOU A;  1WYK A;  4INL A;  1F7Z A;  1OPH B;  1EZX C;  3E0N B;  4XOJ A;  2EI7 A;  4QT8 C;  3T29 A;  1OWJ A;  1EQ9 A;  5CE1 A;  3VXF H;  2I6Q A;  4X6P A;  2A31 A;  1O2T A;  1OWD A;  5GCH G;  1DIC A;  1K1P A;  5JBB S;  1DWC H;  1N8O B;  1S0R A;  2J34 A;  1O2N A;  2Z3C A;  3A82 A;  4NSY A;  2PGQ B;  3RMN H;  2DUC A;  2HNT C;  4UE7 H;  4FOU C;  1P9U A;  2VIN A;  1QFK H;  1B7X B;  1O35 A;  3EE7 A;  3AW0 A;  1FUJ A;  1RIW C;  2SGE E;  1PYT C;  3Q00 A;  4Q7Z A;  3U8O H;  3LJJ A;  3URE A;  1QBV H;  4NIW A;  1ZGV A;  1ZZZ A;  1EKB B;  1UJ1 A;  1GI4 A;  1CHO F;  3RLW H;  1HJ8 A;  1TX6 A;  1ELA A;  4GAW A;  2Z9L A;  1EB2 A;  1K28 D;  1O5G H;  1VGC B;  5EOK A;  2O8L A;  2TGD A;  1CGH A;  3I77 A;  2RDL A;  1Z71 A;  1A4W H;  2BDH A;  4SGA E;  1TA6 A;  1YPJ H;  2BD2 A;  3Q76 A;  1MTV A;  1Y5A T;  4NZL A;  4RKO B;  1A5I A;  3E6P H;  3KQ5 A;  2KCA A;  1SLV B;  2F9P A;  3PMB B;  1NT1 A;  1Z8R A;  4GCH G;  3TGK E;  1UW7 A;  2KZ4 A;  1LQE A;  3S69 A;  9LPR A;  1O3H A;  4BAH B;  1V2O T;  6CHA C;  1LTO A;  1W7X H;  4ABH A;  1C5X B;  2UUF B;  1L1N A;  4A5T S;  1MAB B;  1RTF B;  1TOC B;  3ZVB A;  8EST E;  4INK A;  1ESA A;  2B8O H;  3BN9 A;  2OK5 A;  1NRS H;  5LPF A;  1IQE A;  4VGC B;  1L2E A;  1WQS A;  5F8Z A;  1AVX A;  2J38 A;  1IQM A;  1DAN H;  5KED A;  2ZFQ H;  3ZZ5 A;  1C5Q A;  2OCV B;  1K1M A;  1DY9 A;  1V3X A;  2R0L A;  2FO9 A;  1A0H B;  1QB9 A;  2AH4 X;  1P2N A;  4ZMA H;  1Z7K A;  1GCT C;  2FWW A;  2A7J A;  1PFX C;  4BNR A;  3QK1 A;  2BY8 X;  1PQ5 A;  2BLW A;  3GCO A;  3HGP A;  1H9L B;  3TIU A;  1JRT A;  2GV7 A;  2M2A A;  1GJ6 A;  1KXE A;  1YPM H;  1KSN A;  1TOM H;  2OC0 A;  1O2W A;  2IN2 A;  5FPS A;  1XKA C;  1LHC H;  1TRM A;  2Z9G A;  4D76 A;  2PGB B;  1H8H D;  2A2X H;  1SGF A;  1XVO A;  2UUY A;  4WMF A;  2D2D A;  2QV1 A;  1VIT F;  1UMA H;  2ZFP H;  1BTU A;  1KYN A;  3PRD A;  1TNK A;  3PYH A;  2QGR A;  5DGJ A;  5AFY H;  2WPK S;  1O2X A;  1O32 A;  4X2X A;  3PMA B;  5FBE A;  3BTE E;  5F8T A;  2BDG A;  5GCH F;  2IJO B;  2QY0 B;  2VIQ A;  3DFL A;  4CR9 A;  1J8A A;  4LXB H;  3F68 H;  2GX4 A;  1TGB A;  4KTU A;  3VPK A;  1PYT D;  1W8B H;  4DCD A;  3LGU A;  5IDK A;  3UQV A;  1HPG A;  1FY4 A;  1TPA E;  4JZD H;  1SR5 C;  4O3U A;  1UO6 A;  1V6D A;  1ABI H;  1MTN B;  4AC9 A;  1RXP A;  1CSO E;  4U30 A;  3HKJ B;  1TLD A;  4TT3 D;  5A8Z A;  4Y0Y E;  2AER H;  4XD7 D;  2FOC A;  2TGT A;  1ZJK A;  7LPR A;  4YOG A;  3QLP H;  3BIV H;  1SI5 H;  3I29 A;  1W2K H;  3OY5 U;  5FPY A;  3MWI U;  4X2Y A;  1BTX A;  1ETS H;  3CS7 A;  1P8V C;  2RDE A;  2XOK D;  4UFD H;  4CRF A;  3LDX H;  1TGN A;  1MMJ N;  2XW9 A;  2FPZ A;  6CHA B;  2W3K A;  1YP9 A;  3M3V A;  3K65 B;  1ELV A;  2SGD E;  1C1T A;  2FTL E;  1IQG A;  2A2Q H;  1MTW A;  1OWH A;  2IOT A;  2BQW B;  4GCH F;  1F0S A;  2ILN A;  3BTG E;  4DY7 B;  1XMN B;  2FLB H;  4MDS A;  5C3N A;  2ZTZ A;  2FI5 E;  3RXU A;  3TNS A;  5FL7 D;  1FLE E;  1YBW A;  4NCY A;  1OHH D;  1G36 A;  2FYR A;  4BAM B;  4CRA A;  4U01 A;  5I25 A;  1A0J A;  1TB6 H;  1NM6 A;  1GCT B;  1ZML A;  5GIB A;  4FU7 A;  4MNY A;  5JBA S;  1HXF H;  3UNQ A;  2BDB A;  4TYD A;  2CGA A;  1MZA A;  2XXL A;  1MTU A;  3VGC B;  3SGB E;  1P12 E;  3PO1 B;  1AKS B;  1BZX E;  3MO3 A;  4FVD A;  1P02 A;  2C90 B;  3D65 E;  3EAJ A;  3A7Z A;  5CHA C;  1ZTK A;  2CF9 H;  2XCF A;  1GMH G;  4WH8 A;  3HK3 B;  1UVO A;  4B73 A;  1F0T A;  3STI A;  1DWE H;  1A3E H;  5A2M H;  3TH4 H;  1YPH E;  2Q6F A;  2ZFT A;  5H4I B;  4ACB A;  4E05 H;  1THP B;  3S9B A;  2FI4 E;  2JET C;  2CMY A;  4AZ2 B;  4Q63 A;  1S6H A;  2P8O B;  3VEQ B;  2XC0 A;  1YF4 A;  2NU3 E;  2QE7 D;  1ESB A;  3QDZ B;  1D4P B;  2ZTY A;  1QB6 A;  3LT3 A;  5C5O A;  1QA0 A;  3SJK A;  2FEQ H;  4I86 A;  3K6Y A;  2EI8 A;  2R3Y A;  3GY7 A;  1O2S A;  1YPE H;  2BD4 A;  1E0F D;  3DSP A;  4X8S H;  3ZVF A;  4R0I A;  4D8N A;  1Y5U T;  5HGG A;  1GWA A;  1F0U A;  1P04 A;  2BXT H;  3AK5 A;  4RT0 A;  3DA9 B;  3D49 H;  2VWL A;  3SZN A;  4R8T B;  3O8D A;  5HIZ A;  1GHV H;  4B6F A;  2BXU H;  2SFA A;  4IGD A;  3SI3 H;  4NIV A;  2JDI D;  1O5D H;  4IC6 A;  1GDU A;  1O2Q A;  4BTU B;  1MBM A;  1G3B A;  1O33 A;  1CO7 E;  2AMD A;  3P8N A;  5CDF E;  1O0D H;  1W0Z U;  1HIA A;  2Y5H A;  1ZLR A;  3A86 A;  4A7I B;  2FOH A;  1Z8I B;  4OS5 A;  2BZA A;  1HB0 B;  2VIO A;  3SQE E;  2HNT E;  1GVZ A;  4ABG A;  1SC8 U;  4WF8 A;  1UK4 A;  5J4Q A;  1AMH A;  3TJO A;  1S85 A;  1RGQ A;  3Q3X A;  2XCN A;  1O3D A;  1T4V H;  2BDA A;  1ZOM A;  1GMD G;  2VJ1 A;  1YPL H;  4Y11 E;  3PLB A;  3RXD A;  5C17 A;  1LHD H;  6GCH G;  3F9G A;  4D7G A;  1P57 B;  8GCH G;  2Y5F A;  3BF6 H;  1N6Y A;  3LOX A;  1G3E A;  1FX0 B;  1MU8 B;  3E8L A;  3QGN B;  5E2O A;  3UNS A;  4ABD A;  1GJ5 H;  1C2L A;  1O39 A;  3ZZ8 A;  1S84 A;  1SGD E;  4ISH H;  3RXL A;  2A5I A;  4MVN A;  4E7N A;  3MU5 A;  3WWB A;  4JK6 A;  3V0X A;  5TCA A;  5GND A;  1BOQ A;  2JH0 D;  3EYD A;  4MPW A;  3C1K A;  5DP3 A;  1W0Y H;  2NU2 E;  1LMW B;  3SO3 A;  4DVA U;  1C2F A;  1O5C B;  2JET B;  3GDV A;  3M5O A;  2F9V A;  3ZZ9 A;  1GMH F;  1NBM E;  3RXH A;  4AYY B;  4IMZ A;  2FES H;  4KKD A;  2XWB I;  1XUK A;  3E0P B;  3SHA H;  2CK3 D;  1O2K A;  3MNB A;  4K5Z A;  5B6O A;  2ZPS A;  3HAT H;  1PPB H;  3SI4 H;  3T62 A;  4I32 A;  4HZH A;  3URC A;  3M7T A;  4BAK B;  3BTF E;  3OEE D;  2PLX A;  5A8X A;  1DLE A;  1GI9 B;  1A1R A;  3F0O A;  1XVM A;  3BTQ E;  4GVU A;  4E06 H;  1H9H E;  1QJ1 B;  1RD3 B;  2Y80 A;  5JDU B;  3ATL A;  3TIT A;  4E7R G;  2ZF0 H;  3Q3Y A;  4FUH A;  1EB1 H;  1BBR E;  3MH6 A;  1GI1 A;  3SU2 A;  3KGP A;  3RXP A;  3GCT G;  5C1U A;  6LPR A;  2V6N A;  3DHK H;  2SGQ E;  3F9E A;  3GY2 A;  1DX5 M;  1VKY A;  1BIO A;  4JZF H;  1C5T A;  1GDQ A;  1O3K A;  1G37 A;  3UFA A;  2KX4 A;  2PKA B;  3RXA A;  4UDW H;  2DE8 A;  3RC5 A;  1ELT A;  2RFK C;  1PQ8 A;  1TMB H;  2WHX A;  4NSV A;  3GY5 A;  3TH2 H;  3GCH C;  3VB4 A;  3QZQ A;  1BMM H;  1SLW B;  2LEL A;  1GBF A;  3ZZD A;  2G4T A;  1GHW H;  3A8B A;  1HAH H;  3TNT A;  2Y7Z A;  1PPH E;  2FOA A;  1YLN A;  2SGP E;  1C5M D;  1BHX F;  2XNI A;  1FNI A;  4IN1 A;  3UQO A;  4MPX A;  1GMD F;  1O5E H;  1W11 U;  2H5C A;  4WVP E;  4WMD A;  1GGD C;  3MU8 A;  1L1J A;  2GD4 B;  3O8B A;  1PPG E;  1TNI A;  2BDC A;  6GCH F;  3LGI A;  3SV7 A;  4KEL A;  8GCH F;  1W12 U;  4NIY A;  1GBT A;  5T6F A;  1ZTJ A;  4X1S U;  3M37 A;  5EPY A;  1AE5 A;  2VH6 A;  2TRM A;  1AFQ C;  4NA9 H;  3W95 A;  2FS9 A;  1GDN A;  2XTT B;  1DDJ A;  2ZZU H;  1RS0 A;  1JIR A;  5AHG H;  1FY8 E;  1SHY A;  5A0B A;  1JXP A;  3A8D A;  3PV5 A;  3TGI E;  4K8B A;  1XUG A;  5JPM H;  3SV8 A;  3QWC H;  1YCP H;  5JBT A;  5DJ7 A;  5LGO A;  1TWX B;  1PPZ A;  4U2W A;  2TPI Z;  4D9R A;  2W7S A;  3ZV8 A;  2GZ8 A;  1DOJ A;  1EJA A;  2OQU A;  4JYT A;  2NU1 E;  1V2P T;  1TGT A;  2BD3 A;  2BD5 A;  4HFP B;  1MD8 A;  4MPV A;  5FPT A;  1ETR H;  2CF8 H;  2W6J D;  4CR5 A;  1OP2 A;  1A5G H;  1GHB G;  3H09 A;  4DJZ B;  5FCK A;  1S6F A;  3FOA A;  3KF2 A;  1TRY A;  4UON A;  4YT6 H;  5K7R A;  1FIZ A;  2WUB A;  3A84 A;  1C1Q A;  5FXL A;  5ABW A;  1EX3 A;  3P92 A;  3P6Z B;  1CT4 E;  2FX6 A;  1P01 A;  3F9H A;  2R0K A;  4JZE H;  1C2E A;  2ZKS A;  1SGT A;  3E3T A;  1EAS A;  4XBB A;  3GCT F;  2H6M A;  1X7A C;  1UHB B;  4ZUH A;  1C1R A;  2QF0 A;  3LC3 A;  3LGW A;  2DE9 A;  4IC5 A;  3PM3 A;  1OWI A;  3GCH B;  1F5L A;  1ACB E;  1LPZ B;  1O2U A;  5C0U A;  1S6L A;  5K0H A;  4I8H A;  1G3D A;  1THR H;  3VB3 A;  1ZMJ A;  4THN H;  2QAA A;  5TCC A;  1KLI H;  3BTH E;  2D1J A;  2H9E H;  3A8C A;  2YMS C;  1O3I A;  3A7V A;  3IG6 B;  1C5R A;  2QXG A;  1W10 U;  1SGN E;  1E38 B;  2I6S A;  1KLJ H;  1QQ4 A;  3LJO A;  1GGD B;  2AHM E;  1QQU A;  4DIH H;  4CRD A;  5C1X A;  4U32 A;  1C1M A;  4DT7 B;  2VU8 E;  2HVY B;  3PV2 A;  1Z6J H;  2GVF A;  3E91 A;  4X1R U;  1C9P A;  2C93 B;  1H4W A;  1UVU H;  2H2Z A;  4H42 U;  5ESB A;  2JJ1 D;  3GDS A;  3BG4 B;  1DUA A;  2ZFF H;  3ATM A;  1CE5 A;  2WSS D;  2ZDN A;  4RKJ B;  2Y6T A;  4GUX A;  4CBO A;  3MH4 A;  2ZCH P;  3GYM A;  5JB9 S;  3DT0 H;  5JB8 S;  2OLG A;  1P2M A;  3TLO A;  3OTP A;  1QNJ A;  1ZPC A;  1TMT H;  3URD A;  1WBG B;  3GDU A;  3BEU A;  4WME A;  3SU0 A;  1GBC A;  3NKK A;  4A1V A;  5HM2 A;  2GP9 B;  2W5E A;  1AN1 E;  2J98 B;  3TH3 H;  1DXP A;  3K6Z A;  1A7S A;  1C2D A;  2O8T A;  1HYL A;  1ID5 H;  2KCY A;  2C3S A;  2PSX A;  1XUJ A;  2WV5 A;  4D7F A;  1C2K A;  4I8J A;  2ZPR A;  3Q77 A;  3SUD A;  4DT4 A;  1F5K U;  3UOP A;  1QRZ A;  1CA0 B;  1TPS A;  4JYV H;  1JBU H;  2F91 A;  2OIN A;  2RG3 A;  1CBW C;  1A5H A;  5FBI A;  3EA7 A;  3SNE A;  4CRC A;  2QC2 A;  5GJ4 B;  1SQA A;  1O2H A;  3GY4 A;  4X6O A;  2FP7 B;  3SJI A;  2OP9 A;  2FOG A;  4ACA A;  1AND A;  1IQF A;  1GHB F;  4NWK A;  3R0F A;  1O3P B;  5EJ1 A;  1E35 B;  3LPR A;  2IJD 1;  4BXW A;  1BTY A;  3GS9 A;  3PMH B;  1KXB A;  1YCP K;  2ZU1 A;  3ZVE A;  3SU1 A;  3U8T H;  2RCE A;  2AMQ A;  4DII H;  1YGC H;  3M7Q A;  1QRX A;  3NRL A;  2VH0 A;  3GY8 A;  3KL6 A;  3PTN A;  1S82 A;  4Y8Y A;  1HAG E;  3EE0 B;  4BXS A;  2NWN A;  5DP4 A;  1DST A;  3F3B A;  3SN8 A;  5AVD A;  1ANE A;  1NY2 2;  3T27 A;  2ANY A;  2AGI X;  3PWC A;  4OS7 A;  5A8Y A;  2BOH B;  4HTC H;  3U8R H;  4IBL H;  4B76 A;  4ZHL U;  1NU7 B;  3P95 A;  7EST E;  2O8M A;  2OQ5 A;  3ZVD A;  1SKY E;  1UTL M; 
#chains in the Genus database with same CATH homology
 2KCO A;  3EYD A;  3N99 A;  2YMS D;  2VBC A;  5IK2 D;  3PV2 A;  4Q63 A;  5EPY A;  3DCL A;  3OFN D;  3SU2 A;  2QE7 D;  2F43 B;  2GVF A;  2IJO B;  1BMF D;  3L6P A;  3M5O A;  2F9V A;  4ASU D;  1NBM E;  5ESB A;  2FOM B;  2JJ1 D;  3SYJ A;  3SUG A;  1NS3 A;  1W3C A;  3N7E A;  2WSS D;  2YMS B;  5HKK D;  2CK3 D;  3FKS D;  3M5L A;  1JXP A;  5IDK A;  3PV5 A;  1BT7 A;  4K8B A;  2K8I A;  3SV8 A;  3SV9 A;  3OEH D;  4FET A;  3WWF A;  3OTP A;  5ETX A;  3DSP A;  3KN2 A;  3W1E A;  2KCP A;  1W0K D;  4I32 A;  4TSF D;  3SU0 A;  4A1V A;  3LKW A;  5GPI B;  4B6E A;  4Z1M D;  3AK5 A;  3SZE A;  3OEE D;  1N1L A;  5CHB A;  4R8T B;  1A1R A;  2HLD D;  3F0O A;  1DXP A;  2WZQ A;  2A4Q A;  3O8D A;  4Q4L A;  4TT3 D;  2KCA A;  3U1I B;  4B6F A;  2QF5 A;  2YOL A;  4XD7 D;  2JDI D;  2KCY A;  2OC1 A;  3SV6 A;  5FPT A;  5EQR A;  3OE7 D;  3KNX A;  4YXW D;  2KZ4 A;  2W6J D;  3LON A;  2OBQ A;  3SUD A;  4DT4 A;  1E79 D;  3FN8 A;  5FPY A;  2KM0 A;  2JJ2 D;  3RC4 A;  1DY8 A;  2GGV B;  3E90 B;  3H09 A;  3M5N A;  2F4L A;  2W6I D;  2XOK D;  3F2F A;  3FOA A;  3KF2 A;  3P8N A;  5CDF E;  2OIN A;  2K1Q A;  4ZCN A;  3O8R A;  3PRB A;  2JIZ D;  1E1Q D;  1E1R D;  1MAB B;  1WXR A;  3SUE A;  5B6L A;  3SU4 A;  4B75 A;  4B71 A;  2V7Q D;  5GJ4 B;  2OK5 A;  3OAA D;  5T1V A;  1RTL A;  2P59 A;  5F53 A;  3FO8 D;  4M9F A;  2FP7 B;  4WF8 A;  3RC6 A;  2OC8 A;  3SUF A;  4A1X A;  1KMH B;  2KFW A;  5C0T A;  1RGQ A;  3M5M A;  2L6O A;  3KEE A;  3RC5 A;  2XCN A;  4JMY A;  1DY9 A;  4NWK A;  2A4R A;  5FL7 D;  4B74 A;  2OC7 A;  2WHX A;  2IJD 1;  3WW7 A;  3GS9 A;  1OHH D;  4KTC A;  1COW D;  5C17 A;  4I33 A;  4WH6 A;  2LEL A;  4U01 A;  3U1J B;  3O8C A;  3F2G A;  3SU1 A;  1DXW A;  3OYP A;  2A4G A;  2WV9 A;  3NRL A;  5EQQ A;  2K0Q A;  1H8E D;  3DSO A;  2M2A A;  5EQS A;  2OC0 A;  1W0J D;  1CU1 A;  2OBO A;  4OM9 A;  5C0U A;  1S6L A;  4TYD A;  5FPS A;  4RI0 A;  2J5U A;  3F3B A;  3SU3 A;  3LOX A;  1FX0 B;  1H8H D;  2YMS C;  3SU5 A;  2KR7 A;  2XNI A;  3N7D A;  2FM2 A;  3SU6 A;  5DN6 D;  1EFR D;  3F0P A;  5DSF A;  2XND D;  2XCF A;  3O8B A;  2QV1 A;  4WH8 A;  5EPN A;  4NWL A;  4B76 A;  4I31 A;  4B73 A;  4F55 A;  1NBM D;  2O8M A;  3UB0 A;  2AHM E;  2QF4 A;  4A92 A;  3PRD A;  3SV7 A;  3P8O A;  2F9U A;  5H4I B;  3VG8 A;  3WWB A;  3F2H A;  2WPD D;  1SKY E;  4A1T A;  3ZIA D;  5GND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...