3DSPA

Crystal structure of apo copper resistance protein copk
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein copK
publication title Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography
pubmed doi rcsb
source organism Ralstonia metallidurans
molecule tags Metal binding protein
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dspA00
3DSPA 2K0QA 3DSOA 3N7EA 2KM0A 3N7DA 2LELA
chains in the Genus database with same CATH superfamily
1DVAH 2RG3A 3DSPA 3BTGE 1YCPK 4RI0A 1NRPH 2BD4A 2TBSA 3FP6E 1ZRKA 3M3VA 1MABB 4Z6AH 3ZZDA 3VGCB 4YT7H 3F9FA 1HFDA 4Z0KA 1MD7A 2HVYB 1NM6A 2HPPH 4I8HA 1O2VA 1OWJA 1V3XA 1A5HA 3UQVA 2FDAA 3T5FH 1T32A 1KYNA 3LGIA 2PTNA 1V2PT 3HKIB 1VKYA 8KME2 1N1LA 6CHAB 4NGAH 3RU4T 5TJXA 2SNVA 1D3PB 4ABHA 3S7KB 1P0SH 1GI6A 3MH7A 1MZAA 7GCHG 3HPTB 1FPCH 3EA8A 3SQEE 4YOJA 3SI4H 1BTXA 3UNQA 5C0TA 1LTOA 1Y59T 1BHXB 2ZU3A 1W8BH 1F2SE 5B6LA 3LGWA 1PPGE 3SJIA 1U6QA 3U8TH 4B2CA 2GT7A 1GI5A 1FNIA 1QBNA 2GVFA 3GOVB 1ZPBA 1A1RA 1P09A 1HAYB 1DY8A 1LKBA 3GYLB 4XDEA 1DUAA 3GDSA 4NG9H 1O2PA 3ZZ4A 3LJOA 3RXEA 3PLKA 4DVAU 2KZ4A 1TPPA 1FIZA 1J15A 2ZECA 1SLUB 1C2KA 2VGCB 1OOKB 2A7CA 4NZQA 2F9BH 1SL3A 1YP9A 2FTMA 3GCOA 5FHTA 1C4Y2 3D62A 2FOFA 2FZZA 1UTJA 3IITA 4ZHMU 1SLVB 2ODQA 3RMMH 5A0AE 4ACAA 1TA2A 2ZA5A 3KQCA 2H5DA 3SI3H 1ANEA 2FO9A 3NWUA 4Y8XA 5F8ZA 2QXGA 3B9FH 3A7TA 1RGQA 1NT1A 1WBGB 1GJ9B 1J9CH 3MI4A 1AIXH 4ISHH 3FZDA 2BZAA 2FOMB 5EGMA 4KTSA 3TIUA 1SOTA 1BTHH 4A1VA 1V2ST 1AMHA 2GDDA 1BHXF 1C5LH 4JK6A 2CF8H 4I8JA 2AS9A 1QJ6B 3F9HA 2BLQA 3S69A 1JWTA 4NIYA 1KXDA 2XWBI 4CRDA 1GVLA 1G37A 3RXSA 3TJUA 1Z6JH 3PRDA 3KN2A 2ESTE 3RXGA 3QGNB 5JBCS 2BY9X 5JBAS 1SOZA 4AFZA 4TYDA 3TK5A 1HAHH 4WXIA 3C27B 3GICB 2WZQA 1W14U 2Z9KA 4FVBA 1LHEH 3M5NA 5DP7A 2IJD1 3FFGA 3T62A 2Y5FA 4BTIB 4D8NA 5A2MH 1ESBA 1GJ6A 1OWIA 1TGBA 4XRNA 4XOJA 1C1RA 3K9XB 3RM2H 3S9CA 2B8OH 1BBRH 4NA7A 1IQLA 2R2WU 2FYQA 2OBOA 1O34A 3RXHA 3VXFH 3PMBB 3T2NA 2O8LA 5TCAA 1O33A 2OC8A 4A6LA 3UUZA 1LKAA 1YCPH 1HAIH 4AN7A 1KIGH 1UHBB 2ZHQH 4B6EA 3A8DA 4FUDA 1C5VA 4K1TA 1O2KA 4VGCC 1O5CB 4IC5A 3GY3A 2J98A 1HYLA 4DW2U 1GBKA 1EATA 2LNCA 3GDUA 3OTJE 1C1NA 1O5FH 4ZCNA 2SGPE 5F8XA 5EJ1A 4SGAE 1GCDA 2ZGXH 4DGJA 3MU5A 1IQHA 2FIRH 2SGEE 2M5TA 5EXLA 3SU0A 3M7TA 1O3DA 2KX4A 3PLBA 1VR1H 2A4OA 2OD3B 1QRWA 3LGTA 4BTTB 4JZ1A 3RXKA 1KDQA 1K9OE 1DWBH 4FUFA 4Y0ZE 2A45B 3BTWE 2ZDLA 4XSKU 1P2OA 2LPRA 2BLVA 1OP2A 4DOQA 1TGTA 1ZRBA 1KY9A 3SV6A 2BD7A 1CT0E 4I86A 4IN1A 2PKAA 2AHME 3F0PA 3P70B 1O2RA 1FY1A 2HGTH 1VCWA 4IN2A 2C8ZB 2CXVA 1FPHH 2FTLE 1G9IE 4DCDA 1NESE 5F53A 3MQKC 2Y80A 5FL7D 1V2QT 5T6FA 1D6RA 3KNXA 4HFPB 2XNDD 4K1EA 1BRUP 4WH8A 3MO9A 4THNH 1AWHB 3R3GB 1WDIA 1E1QD 4FVDA 3UR6A 4HG6A 3UTUH 4CH2B 4ZKOU 5LPEA 2ZDNA 2AMPA 4MTBA 7ESTE 1DSTA 1TNGA 2ZU1A 1T4UH 4OS2A 5DO4H 1CBWB 3DSOA 1QBOA 3ESTA 4DT7B 2V0BA 1GHBF 2XNIA 4E06H 1XUKA 1BTZA 1GJCB 1O2ZA 2FX4A 1P3EA 1GJ5H 4I8KA 1GCTC 4TWWA 1A0HB 2IPHA 2TGTA 1P2JA 1BUIA 1SBWA 2QN5T 3SGQE 2F9OA 2ZFRH 4BNRA 4I8LA 1K22H 3BTME 1IQFA 2ULLA 4XBDA 3RU4D 2G8TA 5C0UA 3GY2A 1QL7A 4XE4A 3VB3A 1H9IE 3QLPH 2RFKC 1BBRE 2AEIH 2LP6A 1GDNA 4MPXA 3GCTF 1A4WH 1QL9A 2WPIS 3TNTA 3SJ8A 1PYTD 4B73A 1GI7B 4IMQA 2SGAA 4Y8YA 1P9SA 3WW7A 4ZROA 1T8MA 3N7DA 1Q31A 1XUGA 2ANYA 2G51A 3ATMA 4KELA 2Y7ZA 4O3UA 5L6NH 2STAE 1C9PA 1OP0A 1KMHB 1E1RD 2R9PA 4H6SB 4Y7BA 1ESAA 4ZKRU 1C2FA 4UDWH 2EI7A 3P8OA 4IC6A 4DIHH 3LGUA 1C2DA 2WV5A 1AKSB 1AI8H 2XBVA 2GCTC 3EDXB 3TU7H 3F6UH 3M7UA 2FI3E 1GPZA 1ELDE 1C2IA 2KCYA 1RIWB 4GHQA 1JIMA 1SG8B 5GDSH 3V7TA 2P16A 2FYRA 5DSFA 5DGJA 2JETB 4ASHA 1O3KA 1UTOA 2VWLA 1NU9A 4AFQA 3E91A 4X6NA 5AFYH 1ETSH 3KYFA 1KXFA 3RC6A 1BA8B 3BG4C 4M9FA 2A5AA 3KCGH 2GGVB 2OC0A 4LOYH 1BDAA 2J5UA 1O2IA 1GMHF 1YKTA 4K5ZA 3SZNA 2GX4A 4D9QA 3KQ5A 4ZXXH 2KCAA 1GBFA 1PPFE 2B5TB 2JJ2D 1UTKA 3BTEE 5ESTE 1TNHA 3DUXH 3UIRA 4AYYB 2A4RA 1LPZB 5FAHA 1BMNH 3BEFB 1L4ZA 3BTFE 2W3KA 3EA9A 3SHAH 2HOBA 1Q2WA 2VB0A 3QTOH 2A31A 4CRCA 1KTTB 2ODPA 1VGCB 1KLIH 4OS1A 1GHBG 2A0QB 2PW8H 2W5EA 1SQRA 1C4U2 1WTHD 4FU9A 2UUKB 2XRCA 1FY8E 4UFEH 5E8EH 1Z7KA 1O3PB 4JZIA 5FXLA 2VIVA 1LDTT 3SZEA 8GCHF 2WPLS 4UD9H 2EI6A 1L1NA 4B71A 2FX6A 3V12A 2C8XB 1HAVB 4ABDA 1XXFA 4RT0A 2AGGX 1CA0C 3SO3A 2HPQH 1GHAG 1LCYA 4RKOB 1QTFA 1W2KH 2QF3A 3A8AA 4CREA 5K0HA 4ISOA 5HM9A 3R0FA 5JBTA 4Y7AA 4ISIH 2KFWA 3ZYDA 2W26A 2C4FH 3SHCH 4BAMB 2JJ1D 3BTTE 1BMLA 1MKWK 3MU8A 2BXTH 4IS5A 3SU5A 3ZYEA 3NK8A 1A3BH 3N99A 5EW2H 3UY9A 1TGNA 1O2UA 2F9VA 2XOKD 2P3UB 4I7YH 2VIQA 1HJAB 5A0BA 3SNBA 1W11U 2CK3D 3BTQE 2BY8X 1DXPA 1HXEH 2SGFE 2RCEA 4YT6H 1GBIA 2CF9H 4OGYA 4A1TA 1MMJN 2VU8E 2TRMA 4IGDA 3T26A 1G32B 1P05A 2UWLA 1AWFH 4AFUA 1TA6A 5C1UA 1JMOH 1FUJA 4CRBA 2KAIB 2FLRH 1DWDH 4GHTA 4TY6A 1CSOE 1RFNA 2BD8A 3URDA 3HGPA 1UTQA 1MTNC 2HLCA 3BN9A 4K60A 5A0CA 5JDUB 1IHTH 2ZEBA 1O3HA 1MD8A 3TPIZ 4BTUB 3H5CB 3E3TA 3S9BA 8ESTE 1AVGH 2R2MB 1CHOF 4ZHAA 3RXUA 2WV9A 1XUFA 2RA3A 1V2JT 2O8MA 5C20A 2Z9IA 4JK5A 1BRAA 3ODDA 4WXVA 1EUFA 4X6OA 3RC5A 5DKMA 3Q77A 1AN1E 1AY6H 4MPVA 4NWLA 1OSSA 2ZDKA 1HPGA 1PPCE 2OTVA 1H4WA 3EAJA 4YOIA 4TWYA 1IQNA 5KGOA 1Y3WA 1EAWA 3F3BA 1CA0B 1AZZA 1K1MA 1SVPA 3TGIE 1WQSA 1A7SA 2WYGA 3SNDA 3VGCC 1SHYA 5C17A 4AG1A 2FOBA 3LPRA 1Q3XA 3RXCA 3ZZ9A 4DURA 5GIBA 2ZNKH 4YLUA 5EJZA 3VB4A 1O3IA 4JZDH 1YPEH 5IK2D 2ZZUH 1BMAA 1BT7A 1UTMA 4J1YA 5EJLA 1NROH 3LONA 1O32A 1XKAC 5GNDA 8GCHG 3K6YA 3HKJB 1UVOA 4GPGA 2BDIA 2VIDA 2OXSA 4X8SH 3DT0H 5AF9H 3U98H 2KCOA 1FI8A 2SGDE 3JZ2B 1YM0A 4ZH8A 1P2MA 2BOKA 2PKSC 1C2MA 3A7VA 5IYTA 3ZVBA 1MTNB 2ZCKP 3L33A 5K7RA 1G3EA 1WUNH 1O2LA 2CHAC 2F43B 2J92A 4SGBE 2F4LA 4JYVH 2BMGB 1EAUA 3TGJE 3GCNA 3SU1A 4Q4LA 1O36A 5DP4A 2EQNA 2BX4A 1C5OH 1F0TA 3S0NA 1SGYE 2BXUH 3A86A 5C94A 3RXFA 4K2YA 3PO1B 1SGTA 2ZP0H 4OGXA 1LVMA 1AB9B 1V6DA 1THRH 1PQ7A 5CHAC 1UJ1A 5I25A 2ZGHA 2GDEH 1DM4B 4GAWA 2VH6A 3UWJH 3MH5A 2GCHG 5EQQA 5EXMA 4AZ2B 3LGYA 1ELCA 3ELAH 1GVZA 3A7YA 1GG6B 1G2MA 1INCA 4LZ4B 4CR9A 2XC4A 1E79D 3KF2A 3AAUA 2DUCA 1O3JA 5FBEA 3S9AA 1MKWH 4Y79A 4ISLA 1TB6H 5JYIA 1SQTA 2BDHA 2Z6BD 1GBLA 4TY7A 2VWMA 4PROA 1CHOG 1HV7A 4Q2KA 4AX9H 1LHCH 4YLQH 1EZUC 2XWAA 4E7RG 1F92A 1V2WT 2XYAA 3EYDA 1ZSJA 3GY7A 1FX0B 3GYMA 3BSQA 2TGPZ 1W7XH 4AFSA 1LO6A 4K8YA 2FWWA 1P2KA 1TBZH 2ZHFH 2CMYA 1QB9A 2K0QA 5A8ZA 2PSXA 1EPTA 1QA7A 1WCZA 1SPJA 1DDJA 2FOEA 1MBMA 1A61H 3V13A 2AH4X 1TX6A 2Z3CA 4NSYA 3SORA 4AB9A 2J94A 3GDVA 2VWNA 1ZPCA 2Y5GA 4X6MA 4B2BA 1EZXC 3E0NB 1SFQB 3MFJA 1YPKH 3QO6A 3PV2A 4H42U 1W3CA 2K8IA 2PKSB 3DD2H 2ZHEH 3LGVA 1SB1H 3TH2H 1G30B 3MNXA 2ZCHP 3E6PH 3RLWH 3SYJA 3AK5A 1WTGH 5EU8A 4ASUD 3LIWA 1LVOA 2PV9B 2CHAB 4U32A 5EOKA 2C8YB 4JMYA 1F0SA 3Q3KA 2JIZD 3EE0B 5BPEA 1FAXA 1QIXB 1BTPA 3MU1A 1N6YA 2ZFSA 1SSXA 3MTYA 3V0XA 3FKSD 1F7ZA 4XD7D 5CHAB 4NZLA 1MU6B 2Y82A 4MPUA 4I32A 1EQ9A 1QNJA 1A0LA 2PR3A 4X8VH 5HKKD 3SOSA 2D8WA 1QHRB 2PTCE 2P3TB 3MU0A 4BAKB 3SUDA 3SU3A 1FIWA 4XBBA 2A1DB 5J4QA 1NBME 2BQ7B 1S5SA 5EODA 4F55A 1ZZZA 1F5LA 4HGCA 5HM2A 1QJ7B 3MHWU 1WQVH 1K21H 2BD9A 1MQ5A 5FBIA 3LOXA 3GY6A 1AE8H 1BCUH 2CN0H 1P01A 4F48B 1ANDA 2TGDA 3RUOA 1JRTA 1TNLA 3Q3XA 3LJJA 3PB1E 1HUTH 1C1TA 1NFXA 1XVOA 3O8BA 1O2WA 1T8NA 1GBHA 2XTTB 1T4VH 2FOCA 4I8GA 1O5BB 2SGQE 2V3OH 1GHYH 2JKHA 1O2JA 2Z9JA 3LU9B 1CT4E 4R0IA 4Y11E 2OINA 2AGEX 3MH6A 2ZFQH 1RJXB 1SGQE 5EW1H 2AERH 1CT2E 2BDGA 3MOCA 2DE9A 3U1JB 1WSSH 1UW7A 2G55A 3TVJB 2BD5A 4X1QU 2NU3E 3OYPA 9LPRA 3SJ9A 2BDYA 5FX5A 1OPHB 2R0LA 3W1EA 1J16A 1C5QA 1ZSKA 1SGEE 5C1YA 4D7FA 1QQ4A 3A89A 3AW1A 2WHXA 1B0FA 3Q76A 2ANWA 2WSSD 1MU8B 5HGGA 1S81A 1UVTH 2HWLB 2AYWA 1TQ0B 2PWXA 2H5CA 2FEQH 1NY22 2VIPA 1C5ZB 1HAZB 3PV5A 1V2UT 1UTLM 1YPLH 1GBEA 1N6XA 1CVWH 1J8AA 4Y0YE 1J14A 4YM9A 1K1PA 5DG6A 1CBWC 1MTUA 1O2MA 1CE5A 1Y3VA 2PUQH 2FODA 1O39A 1RRKA 3PWCA 1PQAA 2J4IA 1DWEH 4Y6DA 3OU0A 3A84A 3FN8A 1AVWA 5FCKA 1SC8U 2XBYA 2W7SA 2QY0B 1ELFA 3PROA 1L2EA 4E05H 1TLDA 4B1TA 1P11E 5DP3A 4O03A 1ZHPA 1C9TA 3NZIA 1EB1H 3KEEA 3ZZ7A 2G5VA 1P06A 5GPIB 2SFAA 4LZ1H 1EP6A 3JZ1B 2ZCLP 3P8FA 4HZHA 3RP2A 1GHWH 3C1KA 3DFLA 1NRRH 3K65B 3CS0A 3KYGA 4CBOA 1M9UA 2WV4A 5A8YA 5J4SA 1NFWA 1P04A 4NIWA 3SNAA 1G2LA 1DANH 2Y5HA 3TGKE 1UHBA 2ZF0H 1O2QA 1KXBA 2L6OA 4MLFB 2VJ1A 1P2QA 2ZU5A 3DHKH 5LPFA 4CHAB 5SGAE 3SN8A 1MTWA 3SV9A 3AVZA 3ATKA 1IQIA 4NWKA 2IOTA 2F9NA 2A4GA 2UUYA 3M5MA 3PM3A 1FXYA 1DE7H 1THPB 3LC5A 1VITH 1N8OB 1RIWC 1YPMH 3TLOA 1YLCA 1O2NA 3ENSB 1O3CA 3ZV9A 2FM2A 2ZFPH 2G4TA 1S84A 2JETC 1QY6A 2QE7D 1W10U 1LMWB 1NU7B 1VJAU 2C93B 3H09A 1BJUA 3W94A 1A0JA 1V2OT 1C1MA 4OM9A 1EOJA 1GL1A 1O2XA 1C5UA 1ANBA 2BLOA 2H2ZA 1HNEE 1NS3A 4NA8A 1G36A 1H8IH 1TBQH 4UFGH 3UPEA 1TGSZ 2G81E 1RS0A 1TGCA 3ATWA 2OCVB 1CHGA 1TMTH 4ABFA 3MMGA 5F03A 1XVMA 2AMDA 8LPRA 2EI8A 3EA7A 2K1QA 3ZZ3A 1KSNA 1S0RA 5T6GA 4A92A 1TPSA 2J38A 1UK3A 1RTFB 2GV7A 3F0OA 3SNCA 1QRXA 1W12U 1OXGA 2XW9A 1W0JD 1P12E 1SGPE 3NCLA 5GWZA 2JH6D 4FUCA 4MNVA 1VGCC 1YGCH 2ZDMA 2UUFB 3GY5A 2HNTC 3HGNA 1S85A 3ZZAA 1ELAA 3UAIC 3M5LA 1Z8RA 4D76A 1GWAA 1XKBC 4KKDA 1ACBE 4BAHB 3OE7D 2VVCA 2BB4A 3F1SB 1H9HE 2PLXA 1HIAB 1DUEA 3OY5U 1O3OA 2YMSD 2FESH 1K1LA 1TMUH 4OS5A 3ZVGA 4YTAA 1FMGA 3SU2A 3VXEH 1A46H 1Y8TA 2FP7B 2FI5E 1EX3A 4M7GA 1HJAC 1TFXA 1QGFA 3QUMP 4YOGA 2DE8A 1P8VC 4OS7A 1WAYB 1DICA 5C2ZA 5B6OA 1NRQH 2ZQ2A 4ZAEA 4KTCA 1QFKH 3RXIA 2B9LA 2D26C 2TPIZ 2ZHDA 2GTBA 4QT8C 4ABBA 1UCYK 1IQGA 1K2I1 3Q3YA 3D23A 1LHDH 2BVSH 3P95A 1F0UA 1D9IA 4TSFD 1BQYA 2NWNA 1C5NH 2ZC9H 2PSYA 5I46H 2ZTZA 5AFZH 1O2GH 4Y8ZA 2GKVE 1AKSA 2BQWB 5GXPA 4BANB 3TJNA 1EKBB 2ANMH 6ESTA 1QURH 3GY8A 1O31A 4K69A 4XBCA 1O30A 4X8UH 1X7AC 7KMEH 1SGFA 1MZDA 1C2LA 3M5OA 1Z1JA 1KLJH 2A5KA 1NO9H 2OC1A 1CQQA 2BY7X 1DLKB 3BIUH 1TABE 4OS6A 5E0JA 3ZVAA 4INKA 1S83A 3WY8A 2ZTYA 1GGDB 3F2HA 1MQ6A 2GJGA 1NTPA 1GJ8B 2ALVA 2V3MA 3MNCA 1P3CA 1SI5H 1TX8A 3ZVFA 5DJ7A 3OEHD 3U8RH 1TMBH 4FOUC 3SGAE 3GCTG 3RDZA 1YC0A 1QA0A 1PYTC 5FPSA 4F4OC 1EXFA 3GY4A 1K1NA 2QF4A 1YLDA 2ZGBH 3SJKA 4NFEA 1FJSA 3TJOA 3Q00A 5EIYA 4X6PA 2G5NA 3OAAD 2YOLA 1D6WA 1IQJA 4U01A 1WOFA 1BTUA 1HLTH 2TIOA 3M7QA 1EFRD 4A5TS 1T8LA 1OWDA 1ZPZA 5KECA 3BEUA 3E90B 1BMFD 3KQEA 1OWHA 4X2XA 2R3YA 1A5IA 1JOUB 2ZPSA 4GCHF 2J2UA 3MO6A 4NFFA 5HIYA 2KM0A 2ZKSA 5HMAA 1HAVA 1O3GA 1RD3B 1O3EA 5EXNA 1ELGA 1UMAH 1TNIA 4NCYA 1GBBA 2A4QA 1QCPA 1GI9B 4Q7ZA 3SV7A 3PYHA 1GMCF 3LH3A 3M3SA 3QGJA 3STJA 1JRSA 1VZQH 4GLYA 2I6QA 3PO1C 1G3CA 1AB9C 4WF8A 3KQBA 3U8OH 3RXJA 1DLEA 2VNTA 1C5PA 1MCVA 2ZTXA 2W6ID 1GMHG 2BD3A 2J95A 1LHFH 2Z9LA 3OFND 4KGAA 3SV8A 2BQ6B 5LH8A 1NC6A 1GG6C 1IQMA 1Y3XA 1ID5H 1O5DH 1O2HA 1T8OA 2M2AA 1C1QA 5EQSA 4A7IB 1C2GA 1DFPA 4J2YB 2OLGA 1O3LA 1UO6A 5HIZA 6GCHF 2G4UA 4YESB 1ZGIA 2WPKS 1EJMA 1RXPA 2ASUB 2A2XH 1HAPH 4WJG2 4RSPA 4XFQA 3OSYA 2Z3EA 1YCPM 2HRVA 2O9QA 1GMDF 2VIOA 3OX7U 1UK2A 1GVKB 1C1UH 1ABJH 2RDEA 1B5GH 5C67A 2EC9H 2KR7A 1GHZA 5JB8S 4K3JA 4BAQB 1BITA 3DFJA 3EGKH 1GI3A 1ANCA 2ZU4A 4AYVB 1L1GA 3N7EA 5DP8A 1D3TB 1LVYA 2TGAA 5PTPA 1MAYA 3TH3H 1UCYH 4OS4A 1O2TA 3IWMA 2G52A 4NIVA 4ZXYH 3B23B 1P2IA 2OK5A 1SQOA 2OQUA 1SGFG 1CU1A 1SQAA 1C5WB 1K0HA 2YMSB 3UWIA 1MUEB 3WWBA 4MDSA 2UWOA 1UK4A 3GCHB 2AGIX 3LT3A 3ATLA 3B8JA 3BTDE 3UOPA 3P8NA 4ABIA 2AMQA 2NU2E 1EZSC 2NU1E 2PGBB 1TONA 1GJBB 1SHHB 3FZZA 1EAXA 3F68H 1GBDA 3ZVCA 1D3QB 2D2DA 5A09A 2STBE 4BOHA 3M3TA 1JXPA 2GP9B 2ZFTA 1O3MA 3RXMA 2ILNA 1QR3E 3U1IB 1HJ9A 1FY3A 2O8TA 3A7XA 1FONA 1MKXK 2J9NA 3U9AH 1ZHMA 1ABIH 4GCHG 1HAXB 1MAXA 1EPTB 1VITF 2F83A 1NRSH 2XCNA 1YPHC 1C4V2 4MNWA 4ABAA 1AZ8A 3ZIAD 4CRAA 5CE1A 1Z71A 1BTYA 4Q7YA 5LGOA 1AD8H 3FP8E 3T27A 1LQEA 3BIVH 1EOLA 1DT2A 3QZQA 1YPGH 1HB0B 4CRFA 3BG8A 1ZGVA 1IQEA 2VWOA 3VEQB 3OEED 1CA8B 1OWKA 1ORFA 2Q1JA 2OP9A 4WMDA 4YXWD 1O3BA 1AHTH 1UVUH 1VCQA 4P02A 2ZHWH 5C3NA 3BTHE 1LPKB 1DS2E 3OY6U 1O5GH 2AIPA 4AB8A 1TWXB 5FCRA 1LPGB 1OWEA 2FS9A 1S82A 2OQ5A 1C2HA 4JZEH 2Q6FA 2XCFA 4E7NA 1MTSA 4U30A 1SGRE 1PQ8A 4D9RA 2J97A 3I29A 4AGJA 2C3SA 6GCHG 3A7ZA 2NU4E 2ZGJA 2ZDVH 1XM1A 3A82A 1PFXC 4NIXA 1J17T 3VB6A 1GMDG 4GVUA 1XMNB 3A8BA 3QZRA 1KXAA 4BAOB 2QXHA 3MYWA 2IPQX 4ABGA 4JZFH 3P92A 3GISB 1DPOA 1DOJA 3A87A 1H8DH 3SW2B 2ZFFH 1ETRH 4KTUA 1OS8A 5DK1A 2LELA 1DSUA 3RXAA 2P93A 2WUBA 2D1JA 3QWCH 1XXDA 1NN6A 1BMMH 4UFDH 5EQRA 1SGDE 3FO8D 5EG4A 5JPMH 5L2YH 4FUIA 1K1OA 1O2OA 1ETTH 3H7OA 2ZIQH 1P10A 1UCYE 3RXLA 4ZHLU 5IDKA 4DIIH 3NUMA 1BZXE 4CH8B 1F5RA 2C8WB 1GDQA 2P59A 3RXDA 2VVVA 1SMFE 1QL8A 1YLNA 2KCPA 3HK6B 5GCHF 2FS8A 5DP5A 2NU0E 3BTKE 4X1RU 4X2YA 1TOMH 1FLEE 2QCYA 4HI3A 3ZZBA 4RN6A 1GI4A 4D7GA 4MVNA 2GD4B 2IJOB 3RXRA 3QX5H 3M36A 1C2EA 2FLBH 3GS9A 4B6FA 3G01A 1K28D 1GBAA 1EZQA 4DJZB 2XBWA 3A80A 3TITA 2BD2A 1TX7A 2H9HA 1AGJA 1VITG 1GL0E 1HAGE 1V2MT 4H6TA 3V3MA 4ISNA 1YY3A 1BTWA 3ZZCA 1E0FD 1AE5A 1E37B 4DT4A 2I6SA 3WWFA 2HLDD 3M37A 1C5MD 3L6PA 5HXFA 1P9UA 1A3EH 4CHAC 2F3CE 3QN7A 2ZGCA 1V2NT 1ZJDA 2J98B 4BXWA 4Y10E 3ZVEA 2C90B 2Q6GA 4Y76A 2P94A 1KLTA 2B0FA 4O3TA 3RXVA 2A32A 2CV3A 2HALA 1L1JA 4X8TH 1NPMA 1O3FA 1MKXH 3RLYH 3P6ZB 2BDCA 3VFEA 3K2UA 3RXBA 1N8OC 5C5NA 4ABEA 1DITH 1S6LA 1Z8JB 1WV7H 1KDQB 1BB0B 1GDUA 1AO5A 1TBRH 5AHGH 1PQ5A 2WPHS 1EASA 3BV9B 2ZO3H 2OBQA 1GI0A 5FPTA 4FETA 2QA9E 1W0ZU 3DSGA 4K1SA 2YNAA 2H1UA 1IQKA 4B76A 2FOGA 1V2RT 1W7GH 1MTVA 2FMJA 1CO7E 3E1XB 1OKXA 4Z1MD 2PKAB 1LVBA 2W7UA 3KL6A 3SGBE 4FUJA 2L74A 2OC7A 2ZG0H 3FP7E 4U2WA 4WMFA 2WPMS 3K6ZA 1FZZA 4WH6A 4X1SU 1AUTC 4TT3D 3TJVA 1C5RA 5A8XA 1C2JA 1ZSLA 2R3UA 2H6MA 3TNSA 1YBWA 3UQOA 1OYQA 1AVXA 3F2GA 1AU8A 4JCNA 1C5YB 1NRNH 2BM2A 1FN6A 1UVSH 2EA3A 1L4DA 1ZJKA 1C5TA 1O35A 5TCCA 3O8RA 2BX3A 3N7OA 2V6NA 1NFUA 4K8BA 5GCHG 1S0QA 1ZOMA 1G3DA 1Z8GA 2VIWA 2ZI2H 2XC5A 2BLWA 3RXPA 3OTPA 1K1JA 1TPOA 4H4FA 1QB1A 2IN2A 3SU6A 1HAOH 1A2CH 3O8DA 4IW4E 4Q7XA 1DY9A 3T25A 2BDAA 1PPEE 3ZZ6A 4AORA 1QJ1B 3I77A 2QF0A 4R8TB 4ZMAH 2Z7FE 4HTCH 2XXLA 1COWD 2XBXA 5CMXH 1Y3YA 2CGAA 3D65E 3I78A 3MNBA 5H4IB 1ZTLA 5FX6A 1OHHD 1CGHA 1YF4A 2BZ6H 4CBNA 2QXIA 4MQAA 1JIRA 1E34B 2QXJA 5C1XA 4UFFH 4IMZA 4YO9A 3UOUA 1ZR0A 2HNTE 5LPRA 1ELEE 1ZMNA 3KHVA 3PTBA 3RMLH 1UTNA 1IHSH 5DN6D 1T7CA 3H7TA 3SNEA 2B7DH 2ANKH 2Y6TA 1MBQA 3E0PB 2QC2A 2ZPQA 3F9GA 5JB9S 3PLPA 4P00A 2EY4C 4VGCB 3SV2H 5T3HA 1BRCE 1T31A 1TOCB 3KGPA 4X1NU 1ZYOA 3U28C 2R0KA 3M61U 3O8CA 1EB2A 1ZTJA 1THSH 4Y71A 2PGQB 4NSVA 1BJVA 3MU4A 3T28A 4AC9A 3SBKA 1HXFH 2Z9GA 3FOAA 3LC3A 1GHAF 4INHA 1O0DH 2EEKA 3KIDU 1AFQC 2PP6A 3A81A 1E38B 3LDXH 2H9EH 1V2VT 2V7QD 1RTLA 3PV4A 3FVFB 2F9PA 1GI8B 1ARBA 2RA0A 2ODYB 2PUXB 1TYNA 3AASA 1TE0A 1GGDC 1F5KU 2BVXH 1K1IA 1ESTA 1GHVH 3KQDA 2SNWA 2THFB 3DA9B 1FDPA 4LXBH 2H9TH 3RMOH 5JBBS 1FY4A 1YWUA 1BIOA 1QQUA 1VJ9U 1HJ8A 4O9VA 3S7HB 4INLA 1S6FA 1VCPA 2O8WA 1TALA 4TPIZ 3EE7A 1WYKA 1LQDB 1Y5BT 5CHBA 3L3TA 1W13U 3FANA 3SUFA 1P02A 1E35B 5C5OA 1O38A 2GMTC 2G00A 4MPWA 2BHGA 3HK3B 2VH0A 1GHXH 2QAAA 2BY5X 1KXEA 4JYUH 1EJAA 1MCTA 1V2LT 1O3AA 5E2PA 1XUHA 1PJPA 1H9LB 2BVRH 3RU4E 3A83A 3PWBA 4X0WU 2A7JA 2CJIA 1FQ3A 1HIAA 1BRBE 1P2NA 4BXSA 1GCTB 1O37A 3E8LA 1SFIA 2WUCA 3ITIA 2ZPRA 1C5SA 4MNXA 5EPYA 1PPHE 1D4PB 1C1OA 1C5XB 5DP6A 3SQHE 4B75A 3TK9A 1KXCA 1AFQB 4ZUHA 3D49H 1GBJA 1EP5A 1ELTA 3MO3A 1SLXB 2ALPA 3F9EA 1OYTH 5KEDA 3LH1A 3RXQA 3CP7A 4ZKNU 2A7HA 3PTNA 4UONA 1G3BA 2BOHB 2ZU2A 2BTCE 3LKWA 4UE7H 1UTPA 5HYOA 1A5GH 1ZLRA 2Z94A 3P17H 5E2OA 1W0KD 2QIQA 1TQ7B 3BF6H 1GI2A 3HATH 5DP9A 1NFYA 2GZ7A 3FAOA 1ELBA 4RKJB 1P57B 1E36B 3CS7A 4FUHA 5DPAA 1HGTH 5E0HA 2PHBA 1O3NA 6LPRA 3UNSA 4X1PU 1TRMA 4FUEA 1F0RA 1SLWB 4FUBA 4MG3A 4DG4A 1BOQA 4CRGA 1Z8IB 3UFAA 5BRRE 2GV6A 2BY6X 2P8OC 4O97A 3VPKA 2V35A 3PRBA 4JYTA 2GMTB 2OUAA 7LPRA 3SUEA 2BYAX 2GCTB 1Y3UA 2GZ8A 4RT1A 1TAWA 5F6MA 1C1VH 4FU8A 4I31A 3U69H 1WXRA 1ARCA 2XC0A 3NRLA 1AQ7A 2ZWLH 4WMEA 2Z3DA 3CNRA 2YMSC 3PMJA 3RC4A 3T29A 2VVUA 3ZVDA 1AFEH 2O8UA 1Z6EA 5CDFE 3GCHC 3SJOA 2HNTF 3BG4B 3RMNH 2JH5D 3CENA 5FPYA 3STIA 3QTVH 4UEHH 3EQ0H 3NKKA 4YZUA 1Y5AT 3ATIA 1TRNA 4Q80A 1GJ7B 4FXGH 2GCHF 3VG8A 1FAKH 1GJAB 2FXRA 1FN8A 1QBVH 4ABJA 4KP0A 1PPBH 4Q63A 3A85A 2PFEA 1TPAE 1HCGA 3W95A 4LK4A 1HRTH 1DXWA 2W3IA 1SR5C 1OP8A 3A8CA 3SUGA 5E0GA 1V2KT 3ZZ5A 2HVXA 1GBMA 4NA9H 1IAUA 1TIOA 4CR5A 1LHGH 3UR9A 4X2VA 3AAVA 4A1XA 1MH0A 4TPYA 2WYJA 5L30H 1UVPA 3VB5A 1CGJE 1EPTC 1P03A 2VINA 1QB6A 2J34A 4ACBA 1Z1IA 5T6DA 4AG2A 5L2ZH 1TNJA 2GT8A 2KAIA 1C1SA 2WPDD 2UUJB 3TK6A 5AVDA 3RM0H 1SKYE 4F49A 3NXPA 5ESBA 2ZQ1A 4B74A 2Y81A 1XX9A 2A5IA 3UREA 1V2TT 1YYY1 4B2AA 7GCHF 3A88A 1GJ4H 1H8HD 3UB0A 1B0EA 1GBCA 1O2SA 4FUGA 3VB7A 1H1BA 1RTKA 1QZ8A 1ZMLA 1ZHRA 2P8OB 1EAIA 3A7WA 9ESTA 1GJDB 1GBTA 3SU4A 1TNKA 4MNYA 4WY3A 5F8TA 1O5AB 1FY5A 3M35A 3NPSA 2YNBA 3ZZ8A 1FV9A 2AFQB 3TH4H 1H8ED 1XUJA 4AOQA 2V3HH 3DCLA 2GZ9A 1B7XB 4IBLH 1SGCA 2AIQA 3BEIB 1O5EH 1XUIA 2FOAA 1EJNA 5G4BA 1QRZA 6CHAC 3MNSA 2JH0D 2ZDAH 1YPHE 3E16B 4DY7B 3IG6B 2A2QH 4GUXA 4WWYA 4WVPE 5T1VA 3RXTA 1ZMJA 2WPJS 5EPNA 1WU1A 2Q6DA 2QGRA 1KTSB 4I33A 2FPZA 5ABWA 3PMHB 1C1PA 1SGNE 1DX5M 1HDTH 3PMAB 3P8GA 2QF5A 5ETXA 1C1WH 2FOHA 1O2YA 1GI1A 3F2FA 4X2WA 1NZQH 1YPJH 4GSOA 4AGKA 3AW0A 1IOEA 3QK1A 2FI4E 3ODFA 3UNRA 3ZV8A 4FU7A 3MWIU 2VBCA 2UWPA 1JBUH 2Y7XA 2BDBA 5GJ4B 2P95A 1SGIB 2F9UA 1ELVA 4ZKSU 1D3DB 2VGCC 4ESTE 1S6HA 1CGIE 1TRYA 3QDZB 1BBRK 1OX1A 2P3FH 1AUJA 3MH4A 3RXOA 1GMCG 2QYIA 3URCA 2RDLA 1DWCH 1L0ZA 1W0YH 1HBTH 1PPZA 1NBMD 1ZTKA 2WINI 2F91A 1Y5UT 2JDID 2W6JD 2QV1A
chains in the Genus database with same CATH topology
3SU1A 3DSPA 4Q4LA 1NBME 3N7EA 4F55A 2AHME 3F0PA 4RI0A 5EPYA 3KEEA 2KCYA 1MABB 3OEHD 1S6LA 4B75A 5GPIB 2WPDD 1SKYE 3M5LA 2OK5A 3SUDA 5DSFA 1CU1A 3LOXA 5ESBA 5F53A 3PRDA 5FPSA 4B74A 2YMSB 3KN2A 5FL7D 3KNXA 3WWBA 2XNDD 3OE7D 2QF4A 4TYDA 2LELA 4WH8A 3RC6A 1H8HD 2OBQA 4M9FA 5EQQA 4FETA 5FPTA 2GGVB 3O8CA 3LKWA 2OC0A 3UB0A 1E1QD 2YOLA 3OAAD 3P8NA 2YMSD 4B76A 3O8BA 2J5UA 1N1LA 2WV9A 2WZQA 3FO8D 1W0KD 4U01A 5EQRA 1EFRD 3M5NA 4Z1MD 2KCAA 2IJD1 1E79D 2O8MA 3FOAA 3KF2A 3SU2A 2JJ2D 3SU4A 2OC7A 3DSOA 2A4RA 2L6OA 3RC5A 5IDKA 3E90B 2FP7B 4WH6A 1BMFD 2V7QD 2XNIA 1RTLA 5C0TA 1H8ED 4NWLA 4TT3D 3SV9A 1JXPA 3DCLA 2KM0A 2OBOA 2P59A 2OINA 3EYDA 5B6LA 2KCPA 1FX0B 4A1VA 4NWKA 2A4QA 2A4GA 3F2GA 3U1IB 3F3BA 3M5MA 3U1JB 3SV7A 4KTCA 2OC8A 2K0QA 3PRBA 2GVFA 1A1RA 3SUEA 1DY8A 3OYPA 3O8RA 2XCNA 2IJOB 5T1VA 4B6EA 4I31A 4K8BA 4WF8A 3W1EA 5C17A 1WXRA 5EPNA 2FM2A 2KZ4A 3GS9A 3NRLA 3SZEA 4B6FA 5C0UA 3ZIAD 2QE7D 2YMSC 4I33A 2W6ID 3H09A 3OTPA 3PV2A 4TSFD 1W3CA 2K8IA 3RC4A 2WHXA 4B71A 2WSSD 4OM9A 5CDFE 5CHBA 3SUFA 3SU6A 2QF5A 5ETXA 3OFND 5IK2D 3SYJA 4ZCNA 3AK5A 3SV8A 4ASUD 3O8DA 5FPYA 4B73A 3OEED 1BT7A 3F2FA 1NS3A 1DY9A 3PV5A 4JMYA 3LONA 5GNDA 5EQSA 3SU0A 2M2AA 4YXWD 2KFWA 3VG8A 3WW7A 2JJ1D 4DT4A 3N7DA 3WWFA 2HLDD 4R8TB 2JIZD 2VBCA 2KCOA 3L6PA 3SU5A 5GJ4B 4Q63A 2F9UA 3N99A 1COWD 3M5OA 1KMHB 1E1RD 2K1QA 2F9VA 1DXWA 2XOKD 3FKSD 5H4IB 1RGQA 3FN8A 4A92A 2OC1A 1OHHD 2CK3D 4XD7D 3SUGA 2XCFA 3F0OA 3P8OA 1DXPA 2FOMB 4I32A 5HKKD 2F43B 1W0JD 2KR7A 2F4LA 1NBMD 4A1TA 4A1XA 3SV6A 2JDID 3F2HA 3SU3A 5DN6D 2W6JD 2QV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSP A;  2K0Q A;  3DSO A;  3N7E A;  2KM0 A;  3N7D A;  2LEL A; 
#chains in the Genus database with same CATH topology
 1DVA H;  2RG3 A;  3DSP A;  3BTG E;  1YCP K;  4RI0 A;  1NRP H;  2BD4 A;  2TBS A;  3FP6 E;  1ZRK A;  3M3V A;  1MAB B;  4Z6A H;  3ZZD A;  3VGC B;  4YT7 H;  3F9F A;  1HFD A;  4Z0K A;  1MD7 A;  2HVY B;  1NM6 A;  2HPP H;  4I8H A;  1O2V A;  1OWJ A;  1V3X A;  1A5H A;  3UQV A;  2FDA A;  3T5F H;  1T32 A;  1KYN A;  3LGI A;  2PTN A;  1V2P T;  3HKI B;  1VKY A;  8KME 2;  1N1L A;  6CHA B;  4NGA H;  3RU4 T;  5TJX A;  2SNV A;  1D3P B;  4ABH A;  3S7K B;  1P0S H;  1GI6 A;  3MH7 A;  1MZA A;  7GCH G;  3HPT B;  1FPC H;  3EA8 A;  3SQE E;  4YOJ A;  3SI4 H;  1BTX A;  3UNQ A;  5C0T A;  1LTO A;  1Y59 T;  1BHX B;  2ZU3 A;  1W8B H;  1F2S E;  5B6L A;  3LGW A;  1PPG E;  3SJI A;  1U6Q A;  3U8T H;  4B2C A;  2GT7 A;  1GI5 A;  1FNI A;  1QBN A;  2GVF A;  3GOV B;  1ZPB A;  1A1R A;  1P09 A;  1HAY B;  1DY8 A;  1LKB A;  3GYL B;  4XDE A;  1DUA A;  3GDS A;  4NG9 H;  1O2P A;  3ZZ4 A;  3LJO A;  3RXE A;  3PLK A;  4DVA U;  2KZ4 A;  1TPP A;  1FIZ A;  1J15 A;  2ZEC A;  1SLU B;  1C2K A;  2VGC B;  1OOK B;  2A7C A;  4NZQ A;  2F9B H;  1SL3 A;  1YP9 A;  2FTM A;  3GCO A;  5FHT A;  1C4Y 2;  3D62 A;  2FOF A;  2FZZ A;  1UTJ A;  3IIT A;  4ZHM U;  1SLV B;  2ODQ A;  3RMM H;  5A0A E;  4ACA A;  1TA2 A;  2ZA5 A;  3KQC A;  2H5D A;  3SI3 H;  1ANE A;  2FO9 A;  3NWU A;  4Y8X A;  5F8Z A;  2QXG A;  3B9F H;  3A7T A;  1RGQ A;  1NT1 A;  1WBG B;  1GJ9 B;  1J9C H;  3MI4 A;  1AIX H;  4ISH H;  3FZD A;  2BZA A;  2FOM B;  5EGM A;  4KTS A;  3TIU A;  1SOT A;  1BTH H;  4A1V A;  1V2S T;  1AMH A;  2GDD A;  1BHX F;  1C5L H;  4JK6 A;  2CF8 H;  4I8J A;  2AS9 A;  1QJ6 B;  3F9H A;  2BLQ A;  3S69 A;  1JWT A;  4NIY A;  1KXD A;  2XWB I;  4CRD A;  1GVL A;  1G37 A;  3RXS A;  3TJU A;  1Z6J H;  3PRD A;  3KN2 A;  2EST E;  3RXG A;  3QGN B;  5JBC S;  2BY9 X;  5JBA S;  1SOZ A;  4AFZ A;  4TYD A;  3TK5 A;  1HAH H;  4WXI A;  3C27 B;  3GIC B;  2WZQ A;  1W14 U;  2Z9K A;  4FVB A;  1LHE H;  3M5N A;  5DP7 A;  2IJD 1;  3FFG A;  3T62 A;  2Y5F A;  4BTI B;  4D8N A;  5A2M H;  1ESB A;  1GJ6 A;  1OWI A;  1TGB A;  4XRN A;  4XOJ A;  1C1R A;  3K9X B;  3RM2 H;  3S9C A;  2B8O H;  1BBR H;  4NA7 A;  1IQL A;  2R2W U;  2FYQ A;  2OBO A;  1O34 A;  3RXH A;  3VXF H;  3PMB B;  3T2N A;  2O8L A;  5TCA A;  1O33 A;  2OC8 A;  4A6L A;  3UUZ A;  1LKA A;  1YCP H;  1HAI H;  4AN7 A;  1KIG H;  1UHB B;  2ZHQ H;  4B6E A;  3A8D A;  4FUD A;  1C5V A;  4K1T A;  1O2K A;  4VGC C;  1O5C B;  4IC5 A;  3GY3 A;  2J98 A;  1HYL A;  4DW2 U;  1GBK A;  1EAT A;  2LNC A;  3GDU A;  3OTJ E;  1C1N A;  1O5F H;  4ZCN A;  2SGP E;  5F8X A;  5EJ1 A;  4SGA E;  1GCD A;  2ZGX H;  4DGJ A;  3MU5 A;  1IQH A;  2FIR H;  2SGE E;  2M5T A;  5EXL A;  3SU0 A;  3M7T A;  1O3D A;  2KX4 A;  3PLB A;  1VR1 H;  2A4O A;  2OD3 B;  1QRW A;  3LGT A;  4BTT B;  4JZ1 A;  3RXK A;  1KDQ A;  1K9O E;  1DWB H;  4FUF A;  4Y0Z E;  2A45 B;  3BTW E;  2ZDL A;  4XSK U;  1P2O A;  2LPR A;  2BLV A;  1OP2 A;  4DOQ A;  1TGT A;  1ZRB A;  1KY9 A;  3SV6 A;  2BD7 A;  1CT0 E;  4I86 A;  4IN1 A;  2PKA A;  2AHM E;  3F0P A;  3P70 B;  1O2R A;  1FY1 A;  2HGT H;  1VCW A;  4IN2 A;  2C8Z B;  2CXV A;  1FPH H;  2FTL E;  1G9I E;  4DCD A;  1NES E;  5F53 A;  3MQK C;  2Y80 A;  5FL7 D;  1V2Q T;  5T6F A;  1D6R A;  3KNX A;  4HFP B;  2XND D;  4K1E A;  1BRU P;  4WH8 A;  3MO9 A;  4THN H;  1AWH B;  3R3G B;  1WDI A;  1E1Q D;  4FVD A;  3UR6 A;  4HG6 A;  3UTU H;  4CH2 B;  4ZKO U;  5LPE A;  2ZDN A;  2AMP A;  4MTB A;  7EST E;  1DST A;  1TNG A;  2ZU1 A;  1T4U H;  4OS2 A;  5DO4 H;  1CBW B;  3DSO A;  1QBO A;  3EST A;  4DT7 B;  2V0B A;  1GHB F;  2XNI A;  4E06 H;  1XUK A;  1BTZ A;  1GJC B;  1O2Z A;  2FX4 A;  1P3E A;  1GJ5 H;  4I8K A;  1GCT C;  4TWW A;  1A0H B;  2IPH A;  2TGT A;  1P2J A;  1BUI A;  1SBW A;  2QN5 T;  3SGQ E;  2F9O A;  2ZFR H;  4BNR A;  4I8L A;  1K22 H;  3BTM E;  1IQF A;  2ULL A;  4XBD A;  3RU4 D;  2G8T A;  5C0U A;  3GY2 A;  1QL7 A;  4XE4 A;  3VB3 A;  1H9I E;  3QLP H;  2RFK C;  1BBR E;  2AEI H;  2LP6 A;  1GDN A;  4MPX A;  3GCT F;  1A4W H;  1QL9 A;  2WPI S;  3TNT A;  3SJ8 A;  1PYT D;  4B73 A;  1GI7 B;  4IMQ A;  2SGA A;  4Y8Y A;  1P9S A;  3WW7 A;  4ZRO A;  1T8M A;  3N7D A;  1Q31 A;  1XUG A;  2ANY A;  2G51 A;  3ATM A;  4KEL A;  2Y7Z A;  4O3U A;  5L6N H;  2STA E;  1C9P A;  1OP0 A;  1KMH B;  1E1R D;  2R9P A;  4H6S B;  4Y7B A;  1ESA A;  4ZKR U;  1C2F A;  4UDW H;  2EI7 A;  3P8O A;  4IC6 A;  4DIH H;  3LGU A;  1C2D A;  2WV5 A;  1AKS B;  1AI8 H;  2XBV A;  2GCT C;  3EDX B;  3TU7 H;  3F6U H;  3M7U A;  2FI3 E;  1GPZ A;  1ELD E;  1C2I A;  2KCY A;  1RIW B;  4GHQ A;  1JIM A;  1SG8 B;  5GDS H;  3V7T A;  2P16 A;  2FYR A;  5DSF A;  5DGJ A;  2JET B;  4ASH A;  1O3K A;  1UTO A;  2VWL A;  1NU9 A;  4AFQ A;  3E91 A;  4X6N A;  5AFY H;  1ETS H;  3KYF A;  1KXF A;  3RC6 A;  1BA8 B;  3BG4 C;  4M9F A;  2A5A A;  3KCG H;  2GGV B;  2OC0 A;  4LOY H;  1BDA A;  2J5U A;  1O2I A;  1GMH F;  1YKT A;  4K5Z A;  3SZN A;  2GX4 A;  4D9Q A;  3KQ5 A;  4ZXX H;  2KCA A;  1GBF A;  1PPF E;  2B5T B;  2JJ2 D;  1UTK A;  3BTE E;  5EST E;  1TNH A;  3DUX H;  3UIR A;  4AYY B;  2A4R A;  1LPZ B;  5FAH A;  1BMN H;  3BEF B;  1L4Z A;  3BTF E;  2W3K A;  3EA9 A;  3SHA H;  2HOB A;  1Q2W A;  2VB0 A;  3QTO H;  2A31 A;  4CRC A;  1KTT B;  2ODP A;  1VGC B;  1KLI H;  4OS1 A;  1GHB G;  2A0Q B;  2PW8 H;  2W5E A;  1SQR A;  1C4U 2;  1WTH D;  4FU9 A;  2UUK B;  2XRC A;  1FY8 E;  4UFE H;  5E8E H;  1Z7K A;  1O3P B;  4JZI A;  5FXL A;  2VIV A;  1LDT T;  3SZE A;  8GCH F;  2WPL S;  4UD9 H;  2EI6 A;  1L1N A;  4B71 A;  2FX6 A;  3V12 A;  2C8X B;  1HAV B;  4ABD A;  1XXF A;  4RT0 A;  2AGG X;  1CA0 C;  3SO3 A;  2HPQ H;  1GHA G;  1LCY A;  4RKO B;  1QTF A;  1W2K H;  2QF3 A;  3A8A A;  4CRE A;  5K0H A;  4ISO A;  5HM9 A;  3R0F A;  5JBT A;  4Y7A A;  4ISI H;  2KFW A;  3ZYD A;  2W26 A;  2C4F H;  3SHC H;  4BAM B;  2JJ1 D;  3BTT E;  1BML A;  1MKW K;  3MU8 A;  2BXT H;  4IS5 A;  3SU5 A;  3ZYE A;  3NK8 A;  1A3B H;  3N99 A;  5EW2 H;  3UY9 A;  1TGN A;  1O2U A;  2F9V A;  2XOK D;  2P3U B;  4I7Y H;  2VIQ A;  1HJA B;  5A0B A;  3SNB A;  1W11 U;  2CK3 D;  3BTQ E;  2BY8 X;  1DXP A;  1HXE H;  2SGF E;  2RCE A;  4YT6 H;  1GBI A;  2CF9 H;  4OGY A;  4A1T A;  1MMJ N;  2VU8 E;  2TRM A;  4IGD A;  3T26 A;  1G32 B;  1P05 A;  2UWL A;  1AWF H;  4AFU A;  1TA6 A;  5C1U A;  1JMO H;  1FUJ A;  4CRB A;  2KAI B;  2FLR H;  1DWD H;  4GHT A;  4TY6 A;  1CSO E;  1RFN A;  2BD8 A;  3URD A;  3HGP A;  1UTQ A;  1MTN C;  2HLC A;  3BN9 A;  4K60 A;  5A0C A;  5JDU B;  1IHT H;  2ZEB A;  1O3H A;  1MD8 A;  3TPI Z;  4BTU B;  3H5C B;  3E3T A;  3S9B A;  8EST E;  1AVG H;  2R2M B;  1CHO F;  4ZHA A;  3RXU A;  2WV9 A;  1XUF A;  2RA3 A;  1V2J T;  2O8M A;  5C20 A;  2Z9I A;  4JK5 A;  1BRA A;  3ODD A;  4WXV A;  1EUF A;  4X6O A;  3RC5 A;  5DKM A;  3Q77 A;  1AN1 E;  1AY6 H;  4MPV A;  4NWL A;  1OSS A;  2ZDK A;  1HPG A;  1PPC E;  2OTV A;  1H4W A;  3EAJ A;  4YOI A;  4TWY A;  1IQN A;  5KGO A;  1Y3W A;  1EAW A;  3F3B A;  1CA0 B;  1AZZ A;  1K1M A;  1SVP A;  3TGI E;  1WQS A;  1A7S A;  2WYG A;  3SND A;  3VGC C;  1SHY A;  5C17 A;  4AG1 A;  2FOB A;  3LPR A;  1Q3X A;  3RXC A;  3ZZ9 A;  4DUR A;  5GIB A;  2ZNK H;  4YLU A;  5EJZ A;  3VB4 A;  1O3I A;  4JZD H;  1YPE H;  5IK2 D;  2ZZU H;  1BMA A;  1BT7 A;  1UTM A;  4J1Y A;  5EJL A;  1NRO H;  3LON A;  1O32 A;  1XKA C;  5GND A;  8GCH G;  3K6Y A;  3HKJ B;  1UVO A;  4GPG A;  2BDI A;  2VID A;  2OXS A;  4X8S H;  3DT0 H;  5AF9 H;  3U98 H;  2KCO A;  1FI8 A;  2SGD E;  3JZ2 B;  1YM0 A;  4ZH8 A;  1P2M A;  2BOK A;  2PKS C;  1C2M A;  3A7V A;  5IYT A;  3ZVB A;  1MTN B;  2ZCK P;  3L33 A;  5K7R A;  1G3E A;  1WUN H;  1O2L A;  2CHA C;  2F43 B;  2J92 A;  4SGB E;  2F4L A;  4JYV H;  2BMG B;  1EAU A;  3TGJ E;  3GCN A;  3SU1 A;  4Q4L A;  1O36 A;  5DP4 A;  2EQN A;  2BX4 A;  1C5O H;  1F0T A;  3S0N A;  1SGY E;  2BXU H;  3A86 A;  5C94 A;  3RXF A;  4K2Y A;  3PO1 B;  1SGT A;  2ZP0 H;  4OGX A;  1LVM A;  1AB9 B;  1V6D A;  1THR H;  1PQ7 A;  5CHA C;  1UJ1 A;  5I25 A;  2ZGH A;  2GDE H;  1DM4 B;  4GAW A;  2VH6 A;  3UWJ H;  3MH5 A;  2GCH G;  5EQQ A;  5EXM A;  4AZ2 B;  3LGY A;  1ELC A;  3ELA H;  1GVZ A;  3A7Y A;  1GG6 B;  1G2M A;  1INC A;  4LZ4 B;  4CR9 A;  2XC4 A;  1E79 D;  3KF2 A;  3AAU A;  2DUC A;  1O3J A;  5FBE A;  3S9A A;  1MKW H;  4Y79 A;  4ISL A;  1TB6 H;  5JYI A;  1SQT A;  2BDH A;  2Z6B D;  1GBL A;  4TY7 A;  2VWM A;  4PRO A;  1CHO G;  1HV7 A;  4Q2K A;  4AX9 H;  1LHC H;  4YLQ H;  1EZU C;  2XWA A;  4E7R G;  1F92 A;  1V2W T;  2XYA A;  3EYD A;  1ZSJ A;  3GY7 A;  1FX0 B;  3GYM A;  3BSQ A;  2TGP Z;  1W7X H;  4AFS A;  1LO6 A;  4K8Y A;  2FWW A;  1P2K A;  1TBZ H;  2ZHF H;  2CMY A;  1QB9 A;  2K0Q A;  5A8Z A;  2PSX A;  1EPT A;  1QA7 A;  1WCZ A;  1SPJ A;  1DDJ A;  2FOE A;  1MBM A;  1A61 H;  3V13 A;  2AH4 X;  1TX6 A;  2Z3C A;  4NSY A;  3SOR A;  4AB9 A;  2J94 A;  3GDV A;  2VWN A;  1ZPC A;  2Y5G A;  4X6M A;  4B2B A;  1EZX C;  3E0N B;  1SFQ B;  3MFJ A;  1YPK H;  3QO6 A;  3PV2 A;  4H42 U;  1W3C A;  2K8I A;  2PKS B;  3DD2 H;  2ZHE H;  3LGV A;  1SB1 H;  3TH2 H;  1G30 B;  3MNX A;  2ZCH P;  3E6P H;  3RLW H;  3SYJ A;  3AK5 A;  1WTG H;  5EU8 A;  4ASU D;  3LIW A;  1LVO A;  2PV9 B;  2CHA B;  4U32 A;  5EOK A;  2C8Y B;  4JMY A;  1F0S A;  3Q3K A;  2JIZ D;  3EE0 B;  5BPE A;  1FAX A;  1QIX B;  1BTP A;  3MU1 A;  1N6Y A;  2ZFS A;  1SSX A;  3MTY A;  3V0X A;  3FKS D;  1F7Z A;  4XD7 D;  5CHA B;  4NZL A;  1MU6 B;  2Y82 A;  4MPU A;  4I32 A;  1EQ9 A;  1QNJ A;  1A0L A;  2PR3 A;  4X8V H;  5HKK D;  3SOS A;  2D8W A;  1QHR B;  2PTC E;  2P3T B;  3MU0 A;  4BAK B;  3SUD A;  3SU3 A;  1FIW A;  4XBB A;  2A1D B;  5J4Q A;  1NBM E;  2BQ7 B;  1S5S A;  5EOD A;  4F55 A;  1ZZZ A;  1F5L A;  4HGC A;  5HM2 A;  1QJ7 B;  3MHW U;  1WQV H;  1K21 H;  2BD9 A;  1MQ5 A;  5FBI A;  3LOX A;  3GY6 A;  1AE8 H;  1BCU H;  2CN0 H;  1P01 A;  4F48 B;  1AND A;  2TGD A;  3RUO A;  1JRT A;  1TNL A;  3Q3X A;  3LJJ A;  3PB1 E;  1HUT H;  1C1T A;  1NFX A;  1XVO A;  3O8B A;  1O2W A;  1T8N A;  1GBH A;  2XTT B;  1T4V H;  2FOC A;  4I8G A;  1O5B B;  2SGQ E;  2V3O H;  1GHY H;  2JKH A;  1O2J A;  2Z9J A;  3LU9 B;  1CT4 E;  4R0I A;  4Y11 E;  2OIN A;  2AGE X;  3MH6 A;  2ZFQ H;  1RJX B;  1SGQ E;  5EW1 H;  2AER H;  1CT2 E;  2BDG A;  3MOC A;  2DE9 A;  3U1J B;  1WSS H;  1UW7 A;  2G55 A;  3TVJ B;  2BD5 A;  4X1Q U;  2NU3 E;  3OYP A;  9LPR A;  3SJ9 A;  2BDY A;  5FX5 A;  1OPH B;  2R0L A;  3W1E A;  1J16 A;  1C5Q A;  1ZSK A;  1SGE E;  5C1Y A;  4D7F A;  1QQ4 A;  3A89 A;  3AW1 A;  2WHX A;  1B0F A;  3Q76 A;  2ANW A;  2WSS D;  1MU8 B;  5HGG A;  1S81 A;  1UVT H;  2HWL B;  2AYW A;  1TQ0 B;  2PWX A;  2H5C A;  2FEQ H;  1NY2 2;  2VIP A;  1C5Z B;  1HAZ B;  3PV5 A;  1V2U T;  1UTL M;  1YPL H;  1GBE A;  1N6X A;  1CVW H;  1J8A A;  4Y0Y E;  1J14 A;  4YM9 A;  1K1P A;  5DG6 A;  1CBW C;  1MTU A;  1O2M A;  1CE5 A;  1Y3V A;  2PUQ H;  2FOD A;  1O39 A;  1RRK A;  3PWC A;  1PQA A;  2J4I A;  1DWE H;  4Y6D A;  3OU0 A;  3A84 A;  3FN8 A;  1AVW A;  5FCK A;  1SC8 U;  2XBY A;  2W7S A;  2QY0 B;  1ELF A;  3PRO A;  1L2E A;  4E05 H;  1TLD A;  4B1T A;  1P11 E;  5DP3 A;  4O03 A;  1ZHP A;  1C9T A;  3NZI A;  1EB1 H;  3KEE A;  3ZZ7 A;  2G5V A;  1P06 A;  5GPI B;  2SFA A;  4LZ1 H;  1EP6 A;  3JZ1 B;  2ZCL P;  3P8F A;  4HZH A;  3RP2 A;  1GHW H;  3C1K A;  3DFL A;  1NRR H;  3K65 B;  3CS0 A;  3KYG A;  4CBO A;  1M9U A;  2WV4 A;  5A8Y A;  5J4S A;  1NFW A;  1P04 A;  4NIW A;  3SNA A;  1G2L A;  1DAN H;  2Y5H A;  3TGK E;  1UHB A;  2ZF0 H;  1O2Q A;  1KXB A;  2L6O A;  4MLF B;  2VJ1 A;  1P2Q A;  2ZU5 A;  3DHK H;  5LPF A;  4CHA B;  5SGA E;  3SN8 A;  1MTW A;  3SV9 A;  3AVZ A;  3ATK A;  1IQI A;  4NWK A;  2IOT A;  2F9N A;  2A4G A;  2UUY A;  3M5M A;  3PM3 A;  1FXY A;  1DE7 H;  1THP B;  3LC5 A;  1VIT H;  1N8O B;  1RIW C;  1YPM H;  3TLO A;  1YLC A;  1O2N A;  3ENS B;  1O3C A;  3ZV9 A;  2FM2 A;  2ZFP H;  2G4T A;  1S84 A;  2JET C;  1QY6 A;  2QE7 D;  1W10 U;  1LMW B;  1NU7 B;  1VJA U;  2C93 B;  3H09 A;  1BJU A;  3W94 A;  1A0J A;  1V2O T;  1C1M A;  4OM9 A;  1EOJ A;  1GL1 A;  1O2X A;  1C5U A;  1ANB A;  2BLO A;  2H2Z A;  1HNE E;  1NS3 A;  4NA8 A;  1G36 A;  1H8I H;  1TBQ H;  4UFG H;  3UPE A;  1TGS Z;  2G81 E;  1RS0 A;  1TGC A;  3ATW A;  2OCV B;  1CHG A;  1TMT H;  4ABF A;  3MMG A;  5F03 A;  1XVM A;  2AMD A;  8LPR A;  2EI8 A;  3EA7 A;  2K1Q A;  3ZZ3 A;  1KSN A;  1S0R A;  5T6G A;  4A92 A;  1TPS A;  2J38 A;  1UK3 A;  1RTF B;  2GV7 A;  3F0O A;  3SNC A;  1QRX A;  1W12 U;  1OXG A;  2XW9 A;  1W0J D;  1P12 E;  1SGP E;  3NCL A;  5GWZ A;  2JH6 D;  4FUC A;  4MNV A;  1VGC C;  1YGC H;  2ZDM A;  2UUF B;  3GY5 A;  2HNT C;  3HGN A;  1S85 A;  3ZZA A;  1ELA A;  3UAI C;  3M5L A;  1Z8R A;  4D76 A;  1GWA A;  1XKB C;  4KKD A;  1ACB E;  4BAH B;  3OE7 D;  2VVC A;  2BB4 A;  3F1S B;  1H9H E;  2PLX A;  1HIA B;  1DUE A;  3OY5 U;  1O3O A;  2YMS D;  2FES H;  1K1L A;  1TMU H;  4OS5 A;  3ZVG A;  4YTA A;  1FMG A;  3SU2 A;  3VXE H;  1A46 H;  1Y8T A;  2FP7 B;  2FI5 E;  1EX3 A;  4M7G A;  1HJA C;  1TFX A;  1QGF A;  3QUM P;  4YOG A;  2DE8 A;  1P8V C;  4OS7 A;  1WAY B;  1DIC A;  5C2Z A;  5B6O A;  1NRQ H;  2ZQ2 A;  4ZAE A;  4KTC A;  1QFK H;  3RXI A;  2B9L A;  2D26 C;  2TPI Z;  2ZHD A;  2GTB A;  4QT8 C;  4ABB A;  1UCY K;  1IQG A;  1K2I 1;  3Q3Y A;  3D23 A;  1LHD H;  2BVS H;  3P95 A;  1F0U A;  1D9I A;  4TSF D;  1BQY A;  2NWN A;  1C5N H;  2ZC9 H;  2PSY A;  5I46 H;  2ZTZ A;  5AFZ H;  1O2G H;  4Y8Z A;  2GKV E;  1AKS A;  2BQW B;  5GXP A;  4BAN B;  3TJN A;  1EKB B;  2ANM H;  6EST A;  1QUR H;  3GY8 A;  1O31 A;  4K69 A;  4XBC A;  1O30 A;  4X8U H;  1X7A C;  7KME H;  1SGF A;  1MZD A;  1C2L A;  3M5O A;  1Z1J A;  1KLJ H;  2A5K A;  1NO9 H;  2OC1 A;  1CQQ A;  2BY7 X;  1DLK B;  3BIU H;  1TAB E;  4OS6 A;  5E0J A;  3ZVA A;  4INK A;  1S83 A;  3WY8 A;  2ZTY A;  1GGD B;  3F2H A;  1MQ6 A;  2GJG A;  1NTP A;  1GJ8 B;  2ALV A;  2V3M A;  3MNC A;  1P3C A;  1SI5 H;  1TX8 A;  3ZVF A;  5DJ7 A;  3OEH D;  3U8R H;  1TMB H;  4FOU C;  3SGA E;  3GCT G;  3RDZ A;  1YC0 A;  1QA0 A;  1PYT C;  5FPS A;  4F4O C;  1EXF A;  3GY4 A;  1K1N A;  2QF4 A;  1YLD A;  2ZGB H;  3SJK A;  4NFE A;  1FJS A;  3TJO A;  3Q00 A;  5EIY A;  4X6P A;  2G5N A;  3OAA D;  2YOL A;  1D6W A;  1IQJ A;  4U01 A;  1WOF A;  1BTU A;  1HLT H;  2TIO A;  3M7Q A;  1EFR D;  4A5T S;  1T8L A;  1OWD A;  1ZPZ A;  5KEC A;  3BEU A;  3E90 B;  1BMF D;  3KQE A;  1OWH A;  4X2X A;  2R3Y A;  1A5I A;  1JOU B;  2ZPS A;  4GCH F;  2J2U A;  3MO6 A;  4NFF A;  5HIY A;  2KM0 A;  2ZKS A;  5HMA A;  1HAV A;  1O3G A;  1RD3 B;  1O3E A;  5EXN A;  1ELG A;  1UMA H;  1TNI A;  4NCY A;  1GBB A;  2A4Q A;  1QCP A;  1GI9 B;  4Q7Z A;  3SV7 A;  3PYH A;  1GMC F;  3LH3 A;  3M3S A;  3QGJ A;  3STJ A;  1JRS A;  1VZQ H;  4GLY A;  2I6Q A;  3PO1 C;  1G3C A;  1AB9 C;  4WF8 A;  3KQB A;  3U8O H;  3RXJ A;  1DLE A;  2VNT A;  1C5P A;  1MCV A;  2ZTX A;  2W6I D;  1GMH G;  2BD3 A;  2J95 A;  1LHF H;  2Z9L A;  3OFN D;  4KGA A;  3SV8 A;  2BQ6 B;  5LH8 A;  1NC6 A;  1GG6 C;  1IQM A;  1Y3X A;  1ID5 H;  1O5D H;  1O2H A;  1T8O A;  2M2A A;  1C1Q A;  5EQS A;  4A7I B;  1C2G A;  1DFP A;  4J2Y B;  2OLG A;  1O3L A;  1UO6 A;  5HIZ A;  6GCH F;  2G4U A;  4YES B;  1ZGI A;  2WPK S;  1EJM A;  1RXP A;  2ASU B;  2A2X H;  1HAP H;  4WJG 2;  4RSP A;  4XFQ A;  3OSY A;  2Z3E A;  1YCP M;  2HRV A;  2O9Q A;  1GMD F;  2VIO A;  3OX7 U;  1UK2 A;  1GVK B;  1C1U H;  1ABJ H;  2RDE A;  1B5G H;  5C67 A;  2EC9 H;  2KR7 A;  1GHZ A;  5JB8 S;  4K3J A;  4BAQ B;  1BIT A;  3DFJ A;  3EGK H;  1GI3 A;  1ANC A;  2ZU4 A;  4AYV B;  1L1G A;  3N7E A;  5DP8 A;  1D3T B;  1LVY A;  2TGA A;  5PTP A;  1MAY A;  3TH3 H;  1UCY H;  4OS4 A;  1O2T A;  3IWM A;  2G52 A;  4NIV A;  4ZXY H;  3B23 B;  1P2I A;  2OK5 A;  1SQO A;  2OQU A;  1SGF G;  1CU1 A;  1SQA A;  1C5W B;  1K0H A;  2YMS B;  3UWI A;  1MUE B;  3WWB A;  4MDS A;  2UWO A;  1UK4 A;  3GCH B;  2AGI X;  3LT3 A;  3ATL A;  3B8J A;  3BTD E;  3UOP A;  3P8N A;  4ABI A;  2AMQ A;  2NU2 E;  1EZS C;  2NU1 E;  2PGB B;  1TON A;  1GJB B;  1SHH B;  3FZZ A;  1EAX A;  3F68 H;  1GBD A;  3ZVC A;  1D3Q B;  2D2D A;  5A09 A;  2STB E;  4BOH A;  3M3T A;  1JXP A;  2GP9 B;  2ZFT A;  1O3M A;  3RXM A;  2ILN A;  1QR3 E;  3U1I B;  1HJ9 A;  1FY3 A;  2O8T A;  3A7X A;  1FON A;  1MKX K;  2J9N A;  3U9A H;  1ZHM A;  1ABI H;  4GCH G;  1HAX B;  1MAX A;  1EPT B;  1VIT F;  2F83 A;  1NRS H;  2XCN A;  1YPH C;  1C4V 2;  4MNW A;  4ABA A;  1AZ8 A;  3ZIA D;  4CRA A;  5CE1 A;  1Z71 A;  1BTY A;  4Q7Y A;  5LGO A;  1AD8 H;  3FP8 E;  3T27 A;  1LQE A;  3BIV H;  1EOL A;  1DT2 A;  3QZQ A;  1YPG H;  1HB0 B;  4CRF A;  3BG8 A;  1ZGV A;  1IQE A;  2VWO A;  3VEQ B;  3OEE D;  1CA8 B;  1OWK A;  1ORF A;  2Q1J A;  2OP9 A;  4WMD A;  4YXW D;  1O3B A;  1AHT H;  1UVU H;  1VCQ A;  4P02 A;  2ZHW H;  5C3N A;  3BTH E;  1LPK B;  1DS2 E;  3OY6 U;  1O5G H;  2AIP A;  4AB8 A;  1TWX B;  5FCR A;  1LPG B;  1OWE A;  2FS9 A;  1S82 A;  2OQ5 A;  1C2H A;  4JZE H;  2Q6F A;  2XCF A;  4E7N A;  1MTS A;  4U30 A;  1SGR E;  1PQ8 A;  4D9R A;  2J97 A;  3I29 A;  4AGJ A;  2C3S A;  6GCH G;  3A7Z A;  2NU4 E;  2ZGJ A;  2ZDV H;  1XM1 A;  3A82 A;  1PFX C;  4NIX A;  1J17 T;  3VB6 A;  1GMD G;  4GVU A;  1XMN B;  3A8B A;  3QZR A;  1KXA A;  4BAO B;  2QXH A;  3MYW A;  2IPQ X;  4ABG A;  4JZF H;  3P92 A;  3GIS B;  1DPO A;  1DOJ A;  3A87 A;  1H8D H;  3SW2 B;  2ZFF H;  1ETR H;  4KTU A;  1OS8 A;  5DK1 A;  2LEL A;  1DSU A;  3RXA A;  2P93 A;  2WUB A;  2D1J A;  3QWC H;  1XXD A;  1NN6 A;  1BMM H;  4UFD H;  5EQR A;  1SGD E;  3FO8 D;  5EG4 A;  5JPM H;  5L2Y H;  4FUI A;  1K1O A;  1O2O A;  1ETT H;  3H7O A;  2ZIQ H;  1P10 A;  1UCY E;  3RXL A;  4ZHL U;  5IDK A;  4DII H;  3NUM A;  1BZX E;  4CH8 B;  1F5R A;  2C8W B;  1GDQ A;  2P59 A;  3RXD A;  2VVV A;  1SMF E;  1QL8 A;  1YLN A;  2KCP A;  3HK6 B;  5GCH F;  2FS8 A;  5DP5 A;  2NU0 E;  3BTK E;  4X1R U;  4X2Y A;  1TOM H;  1FLE E;  2QCY A;  4HI3 A;  3ZZB A;  4RN6 A;  1GI4 A;  4D7G A;  4MVN A;  2GD4 B;  2IJO B;  3RXR A;  3QX5 H;  3M36 A;  1C2E A;  2FLB H;  3GS9 A;  4B6F A;  3G01 A;  1K28 D;  1GBA A;  1EZQ A;  4DJZ B;  2XBW A;  3A80 A;  3TIT A;  2BD2 A;  1TX7 A;  2H9H A;  1AGJ A;  1VIT G;  1GL0 E;  1HAG E;  1V2M T;  4H6T A;  3V3M A;  4ISN A;  1YY3 A;  1BTW A;  3ZZC A;  1E0F D;  1AE5 A;  1E37 B;  4DT4 A;  2I6S A;  3WWF A;  2HLD D;  3M37 A;  1C5M D;  3L6P A;  5HXF A;  1P9U A;  1A3E H;  4CHA C;  2F3C E;  3QN7 A;  2ZGC A;  1V2N T;  1ZJD A;  2J98 B;  4BXW A;  4Y10 E;  3ZVE A;  2C90 B;  2Q6G A;  4Y76 A;  2P94 A;  1KLT A;  2B0F A;  4O3T A;  3RXV A;  2A32 A;  2CV3 A;  2HAL A;  1L1J A;  4X8T H;  1NPM A;  1O3F A;  1MKX H;  3RLY H;  3P6Z B;  2BDC A;  3VFE A;  3K2U A;  3RXB A;  1N8O C;  5C5N A;  4ABE A;  1DIT H;  1S6L A;  1Z8J B;  1WV7 H;  1KDQ B;  1BB0 B;  1GDU A;  1AO5 A;  1TBR H;  5AHG H;  1PQ5 A;  2WPH S;  1EAS A;  3BV9 B;  2ZO3 H;  2OBQ A;  1GI0 A;  5FPT A;  4FET A;  2QA9 E;  1W0Z U;  3DSG A;  4K1S A;  2YNA A;  2H1U A;  1IQK A;  4B76 A;  2FOG A;  1V2R T;  1W7G H;  1MTV A;  2FMJ A;  1CO7 E;  3E1X B;  1OKX A;  4Z1M D;  2PKA B;  1LVB A;  2W7U A;  3KL6 A;  3SGB E;  4FUJ A;  2L74 A;  2OC7 A;  2ZG0 H;  3FP7 E;  4U2W A;  4WMF A;  2WPM S;  3K6Z A;  1FZZ A;  4WH6 A;  4X1S U;  1AUT C;  4TT3 D;  3TJV A;  1C5R A;  5A8X A;  1C2J A;  1ZSL A;  2R3U A;  2H6M A;  3TNS A;  1YBW A;  3UQO A;  1OYQ A;  1AVX A;  3F2G A;  1AU8 A;  4JCN A;  1C5Y B;  1NRN H;  2BM2 A;  1FN6 A;  1UVS H;  2EA3 A;  1L4D A;  1ZJK A;  1C5T A;  1O35 A;  5TCC A;  3O8R A;  2BX3 A;  3N7O A;  2V6N A;  1NFU A;  4K8B A;  5GCH G;  1S0Q A;  1ZOM A;  1G3D A;  1Z8G A;  2VIW A;  2ZI2 H;  2XC5 A;  2BLW A;  3RXP A;  3OTP A;  1K1J A;  1TPO A;  4H4F A;  1QB1 A;  2IN2 A;  3SU6 A;  1HAO H;  1A2C H;  3O8D A;  4IW4 E;  4Q7X A;  1DY9 A;  3T25 A;  2BDA A;  1PPE E;  3ZZ6 A;  4AOR A;  1QJ1 B;  3I77 A;  2QF0 A;  4R8T B;  4ZMA H;  2Z7F E;  4HTC H;  2XXL A;  1COW D;  2XBX A;  5CMX H;  1Y3Y A;  2CGA A;  3D65 E;  3I78 A;  3MNB A;  5H4I B;  1ZTL A;  5FX6 A;  1OHH D;  1CGH A;  1YF4 A;  2BZ6 H;  4CBN A;  2QXI A;  4MQA A;  1JIR A;  1E34 B;  2QXJ A;  5C1X A;  4UFF H;  4IMZ A;  4YO9 A;  3UOU A;  1ZR0 A;  2HNT E;  5LPR A;  1ELE E;  1ZMN A;  3KHV A;  3PTB A;  3RML H;  1UTN A;  1IHS H;  5DN6 D;  1T7C A;  3H7T A;  3SNE A;  2B7D H;  2ANK H;  2Y6T A;  1MBQ A;  3E0P B;  2QC2 A;  2ZPQ A;  3F9G A;  5JB9 S;  3PLP A;  4P00 A;  2EY4 C;  4VGC B;  3SV2 H;  5T3H A;  1BRC E;  1T31 A;  1TOC B;  3KGP A;  4X1N U;  1ZYO A;  3U28 C;  2R0K A;  3M61 U;  3O8C A;  1EB2 A;  1ZTJ A;  1THS H;  4Y71 A;  2PGQ B;  4NSV A;  1BJV A;  3MU4 A;  3T28 A;  4AC9 A;  3SBK A;  1HXF H;  2Z9G A;  3FOA A;  3LC3 A;  1GHA F;  4INH A;  1O0D H;  2EEK A;  3KID U;  1AFQ C;  2PP6 A;  3A81 A;  1E38 B;  3LDX H;  2H9E H;  1V2V T;  2V7Q D;  1RTL A;  3PV4 A;  3FVF B;  2F9P A;  1GI8 B;  1ARB A;  2RA0 A;  2ODY B;  2PUX B;  1TYN A;  3AAS A;  1TE0 A;  1GGD C;  1F5K U;  2BVX H;  1K1I A;  1EST A;  1GHV H;  3KQD A;  2SNW A;  2THF B;  3DA9 B;  1FDP A;  4LXB H;  2H9T H;  3RMO H;  5JBB S;  1FY4 A;  1YWU A;  1BIO A;  1QQU A;  1VJ9 U;  1HJ8 A;  4O9V A;  3S7H B;  4INL A;  1S6F A;  1VCP A;  2O8W A;  1TAL A;  4TPI Z;  3EE7 A;  1WYK A;  1LQD B;  1Y5B T;  5CHB A;  3L3T A;  1W13 U;  3FAN A;  3SUF A;  1P02 A;  1E35 B;  5C5O A;  1O38 A;  2GMT C;  2G00 A;  4MPW A;  2BHG A;  3HK3 B;  2VH0 A;  1GHX H;  2QAA A;  2BY5 X;  1KXE A;  4JYU H;  1EJA A;  1MCT A;  1V2L T;  1O3A A;  5E2P A;  1XUH A;  1PJP A;  1H9L B;  2BVR H;  3RU4 E;  3A83 A;  3PWB A;  4X0W U;  2A7J A;  2CJI A;  1FQ3 A;  1HIA A;  1BRB E;  1P2N A;  4BXS A;  1GCT B;  1O37 A;  3E8L A;  1SFI A;  2WUC A;  3ITI A;  2ZPR A;  1C5S A;  4MNX A;  5EPY A;  1PPH E;  1D4P B;  1C1O A;  1C5X B;  5DP6 A;  3SQH E;  4B75 A;  3TK9 A;  1KXC A;  1AFQ B;  4ZUH A;  3D49 H;  1GBJ A;  1EP5 A;  1ELT A;  3MO3 A;  1SLX B;  2ALP A;  3F9E A;  1OYT H;  5KED A;  3LH1 A;  3RXQ A;  3CP7 A;  4ZKN U;  2A7H A;  3PTN A;  4UON A;  1G3B A;  2BOH B;  2ZU2 A;  2BTC E;  3LKW A;  4UE7 H;  1UTP A;  5HYO A;  1A5G H;  1ZLR A;  2Z94 A;  3P17 H;  5E2O A;  1W0K D;  2QIQ A;  1TQ7 B;  3BF6 H;  1GI2 A;  3HAT H;  5DP9 A;  1NFY A;  2GZ7 A;  3FAO A;  1ELB A;  4RKJ B;  1P57 B;  1E36 B;  3CS7 A;  4FUH A;  5DPA A;  1HGT H;  5E0H A;  2PHB A;  1O3N A;  6LPR A;  3UNS A;  4X1P U;  1TRM A;  4FUE A;  1F0R A;  1SLW B;  4FUB A;  4MG3 A;  4DG4 A;  1BOQ A;  4CRG A;  1Z8I B;  3UFA A;  5BRR E;  2GV6 A;  2BY6 X;  2P8O C;  4O97 A;  3VPK A;  2V35 A;  3PRB A;  4JYT A;  2GMT B;  2OUA A;  7LPR A;  3SUE A;  2BYA X;  2GCT B;  1Y3U A;  2GZ8 A;  4RT1 A;  1TAW A;  5F6M A;  1C1V H;  4FU8 A;  4I31 A;  3U69 H;  1WXR A;  1ARC A;  2XC0 A;  3NRL A;  1AQ7 A;  2ZWL H;  4WME A;  2Z3D A;  3CNR A;  2YMS C;  3PMJ A;  3RC4 A;  3T29 A;  2VVU A;  3ZVD A;  1AFE H;  2O8U A;  1Z6E A;  5CDF E;  3GCH C;  3SJO A;  2HNT F;  3BG4 B;  3RMN H;  2JH5 D;  3CEN A;  5FPY A;  3STI A;  3QTV H;  4UEH H;  3EQ0 H;  3NKK A;  4YZU A;  1Y5A T;  3ATI A;  1TRN A;  4Q80 A;  1GJ7 B;  4FXG H;  2GCH F;  3VG8 A;  1FAK H;  1GJA B;  2FXR A;  1FN8 A;  1QBV H;  4ABJ A;  4KP0 A;  1PPB H;  4Q63 A;  3A85 A;  2PFE A;  1TPA E;  1HCG A;  3W95 A;  4LK4 A;  1HRT H;  1DXW A;  2W3I A;  1SR5 C;  1OP8 A;  3A8C A;  3SUG A;  5E0G A;  1V2K T;  3ZZ5 A;  2HVX A;  1GBM A;  4NA9 H;  1IAU A;  1TIO A;  4CR5 A;  1LHG H;  3UR9 A;  4X2V A;  3AAV A;  4A1X A;  1MH0 A;  4TPY A;  2WYJ A;  5L30 H;  1UVP A;  3VB5 A;  1CGJ E;  1EPT C;  1P03 A;  2VIN A;  1QB6 A;  2J34 A;  4ACB A;  1Z1I A;  5T6D A;  4AG2 A;  5L2Z H;  1TNJ A;  2GT8 A;  2KAI A;  1C1S A;  2WPD D;  2UUJ B;  3TK6 A;  5AVD A;  3RM0 H;  1SKY E;  4F49 A;  3NXP A;  5ESB A;  2ZQ1 A;  4B74 A;  2Y81 A;  1XX9 A;  2A5I A;  3URE A;  1V2T T;  1YYY 1;  4B2A A;  7GCH F;  3A88 A;  1GJ4 H;  1H8H D;  3UB0 A;  1B0E A;  1GBC A;  1O2S A;  4FUG A;  3VB7 A;  1H1B A;  1RTK A;  1QZ8 A;  1ZML A;  1ZHR A;  2P8O B;  1EAI A;  3A7W A;  9EST A;  1GJD B;  1GBT A;  3SU4 A;  1TNK A;  4MNY A;  4WY3 A;  5F8T A;  1O5A B;  1FY5 A;  3M35 A;  3NPS A;  2YNB A;  3ZZ8 A;  1FV9 A;  2AFQ B;  3TH4 H;  1H8E D;  1XUJ A;  4AOQ A;  2V3H H;  3DCL A;  2GZ9 A;  1B7X B;  4IBL H;  1SGC A;  2AIQ A;  3BEI B;  1O5E H;  1XUI A;  2FOA A;  1EJN A;  5G4B A;  1QRZ A;  6CHA C;  3MNS A;  2JH0 D;  2ZDA H;  1YPH E;  3E16 B;  4DY7 B;  3IG6 B;  2A2Q H;  4GUX A;  4WWY A;  4WVP E;  5T1V A;  3RXT A;  1ZMJ A;  2WPJ S;  5EPN A;  1WU1 A;  2Q6D A;  2QGR A;  1KTS B;  4I33 A;  2FPZ A;  5ABW A;  3PMH B;  1C1P A;  1SGN E;  1DX5 M;  1HDT H;  3PMA B;  3P8G A;  2QF5 A;  5ETX A;  1C1W H;  2FOH A;  1O2Y A;  1GI1 A;  3F2F A;  4X2W A;  1NZQ H;  1YPJ H;  4GSO A;  4AGK A;  3AW0 A;  1IOE A;  3QK1 A;  2FI4 E;  3ODF A;  3UNR A;  3ZV8 A;  4FU7 A;  3MWI U;  2VBC A;  2UWP A;  1JBU H;  2Y7X A;  2BDB A;  5GJ4 B;  2P95 A;  1SGI B;  2F9U A;  1ELV A;  4ZKS U;  1D3D B;  2VGC C;  4EST E;  1S6H A;  1CGI E;  1TRY A;  3QDZ B;  1BBR K;  1OX1 A;  2P3F H;  1AUJ A;  3MH4 A;  3RXO A;  1GMC G;  2QYI A;  3URC A;  2RDL A;  1DWC H;  1L0Z A;  1W0Y H;  1HBT H;  1PPZ A;  1NBM D;  1ZTK A;  2WIN I;  2F91 A;  1Y5U T;  2JDI D;  2W6J D;  2QV1 A; 
#chains in the Genus database with same CATH homology
 3SU1 A;  3DSP A;  4Q4L A;  1NBM E;  3N7E A;  4F55 A;  2AHM E;  3F0P A;  4RI0 A;  5EPY A;  3KEE A;  2KCY A;  1MAB B;  3OEH D;  1S6L A;  4B75 A;  5GPI B;  2WPD D;  1SKY E;  3M5L A;  2OK5 A;  3SUD A;  5DSF A;  1CU1 A;  3LOX A;  5ESB A;  5F53 A;  3PRD A;  5FPS A;  4B74 A;  2YMS B;  3KN2 A;  5FL7 D;  3KNX A;  3WWB A;  2XND D;  3OE7 D;  2QF4 A;  4TYD A;  2LEL A;  4WH8 A;  3RC6 A;  1H8H D;  2OBQ A;  4M9F A;  5EQQ A;  4FET A;  5FPT A;  2GGV B;  3O8C A;  3LKW A;  2OC0 A;  3UB0 A;  1E1Q D;  2YOL A;  3OAA D;  3P8N A;  2YMS D;  4B76 A;  3O8B A;  2J5U A;  1N1L A;  2WV9 A;  2WZQ A;  3FO8 D;  1W0K D;  4U01 A;  5EQR A;  1EFR D;  3M5N A;  4Z1M D;  2KCA A;  2IJD 1;  1E79 D;  2O8M A;  3FOA A;  3KF2 A;  3SU2 A;  2JJ2 D;  3SU4 A;  2OC7 A;  3DSO A;  2A4R A;  2L6O A;  3RC5 A;  5IDK A;  3E90 B;  2FP7 B;  4WH6 A;  1BMF D;  2V7Q D;  2XNI A;  1RTL A;  5C0T A;  1H8E D;  4NWL A;  4TT3 D;  3SV9 A;  1JXP A;  3DCL A;  2KM0 A;  2OBO A;  2P59 A;  2OIN A;  3EYD A;  5B6L A;  2KCP A;  1FX0 B;  4A1V A;  4NWK A;  2A4Q A;  2A4G A;  3F2G A;  3U1I B;  3F3B A;  3M5M A;  3U1J B;  3SV7 A;  4KTC A;  2OC8 A;  2K0Q A;  3PRB A;  2GVF A;  1A1R A;  3SUE A;  1DY8 A;  3OYP A;  3O8R A;  2XCN A;  2IJO B;  5T1V A;  4B6E A;  4I31 A;  4K8B A;  4WF8 A;  3W1E A;  5C17 A;  1WXR A;  5EPN A;  2FM2 A;  2KZ4 A;  3GS9 A;  3NRL A;  3SZE A;  4B6F A;  5C0U A;  3ZIA D;  2QE7 D;  2YMS C;  4I33 A;  2W6I D;  3H09 A;  3OTP A;  3PV2 A;  4TSF D;  1W3C A;  2K8I A;  3RC4 A;  2WHX A;  4B71 A;  2WSS D;  4OM9 A;  5CDF E;  5CHB A;  3SUF A;  3SU6 A;  2QF5 A;  5ETX A;  3OFN D;  5IK2 D;  3SYJ A;  4ZCN A;  3AK5 A;  3SV8 A;  4ASU D;  3O8D A;  5FPY A;  4B73 A;  3OEE D;  1BT7 A;  3F2F A;  1NS3 A;  1DY9 A;  3PV5 A;  4JMY A;  3LON A;  5GND A;  5EQS A;  3SU0 A;  2M2A A;  4YXW D;  2KFW A;  3VG8 A;  3WW7 A;  2JJ1 D;  4DT4 A;  3N7D A;  3WWF A;  2HLD D;  4R8T B;  2JIZ D;  2VBC A;  2KCO A;  3L6P A;  3SU5 A;  5GJ4 B;  4Q63 A;  2F9U A;  3N99 A;  1COW D;  3M5O A;  1KMH B;  1E1R D;  2K1Q A;  2F9V A;  1DXW A;  2XOK D;  3FKS D;  5H4I B;  1RGQ A;  3FN8 A;  4A92 A;  2OC1 A;  1OHH D;  2CK3 D;  4XD7 D;  3SUG A;  2XCF A;  3F0O A;  3P8O A;  1DXP A;  2FOM B;  4I32 A;  5HKK D;  2F43 B;  1W0J D;  2KR7 A;  2F4L A;  1NBM D;  4A1T A;  4A1X A;  3SV6 A;  2JDI D;  3F2H A;  3SU3 A;  5DN6 D;  2W6J D;  2QV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...