3DSPA

Crystal structure of apo copper resistance protein copk
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative uncharacterized protein copK
publication title Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography
pubmed doi rcsb
source organism Ralstonia metallidurans
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dspA00
2KM0A 2LELA 3DSOA 3DSPA 3N7DA 2K0QA 3N7EA
chains in the Genus database with same CATH superfamily
1XXDA 2Q6FA 3TPIZ 1JIRA 1NRSH 1A46H 4FVBA 4AFQA 3R0FA 1ZHRA 3O8DA 1Z8RA 3HATH 3Q3XA 3F0OA 1MU6B 5DP8A 4IS5A 1SGRE 2ZDVH 3RXBA 1DXWA 1QGFA 1BB0B 3ZZ9A 5EW2H 1CHOG 3LH1A 2H9HA 1F92A 1EP5A 1YF4A 4JYUH 4NWKA 1LVBA 2AIPA 1GBHA 1D6WA 2BD2A 1OOKB 2FI4E 3UNRA 1ZSKA 1DE7H 3PO1C 2HVXA 4TY7A 4X8UH 3SV6A 1E34B 4BAOB 3KF2A 3BEIB 3PROA 2TPIZ 2PLXA 3A7XA 1G2LA 2HNTF 2Z94A 1E35B 1DDJA 4MNYA 1H8DH 3VEQB 1MCVA 2THFB 1SL3A 1MH0A 5E0JA 5CMXH 1ZJKA 2A7CA 4XD7D 2FOMB 2ZDNA 4WY3A 1C5SA 1SKYE 1NPMA 1KMHB 2OTVA 3Q77A 3A84A 3M35A 1PQ7A 3GY6A 4CHAC 1SBWA 3A7TA 3KGPA 1FAXA 3S7HB 1NFUA 2M5TA 4GPGA 1UHBA 2XCNA 1Y3YA 2CF8H 3P70B 4WWYA 3F9HA 5F8ZA 3EAJA 1C5NH 1GMDG 3U1JB 4DG4A 1MABB 2GMTB 1EPTB 4X6PA 5EU8A 1L4DA 2J5UA 1SI5H 3LJOA 1YKTA 2BD5A 1MAXA 4YXWD 2Q6GA 2RCEA 3TGJE 5CE1A 2ZGJA 4ASHA 1E38B 4IC5A 4JK6A 1ZSLA 1DXPA 3FOAA 1A2CH 2WV5A 4YESB 1EB1H 1F7ZA 2I6QA 2XRCA 3MNXA 3BTTE 3PM3A 4UDWH 2WPHS 2C90B 5E2PA 3MU0A 4FOUC 3A86A 1XX9A 1NESE 4MPUA 3AK5A 2O9QA 1AI8H 2VINA 1GHBG 3ZIAD 2ZI2H 1ABJH 4NZLA 1TWXB 2PSYA 1KIGH 1L4ZA 2HPPH 3S9AA 1NRQH 2BOHB 1UCYH 1ZRKA 4DVAU 2QGRA 3AW1A 5EXNA 2RDLA 1YPEH 2GV6A 4ISLA 3MYWA 3RM0H 1ELGA 2OD3B 3M3VA 1O3MA 3S7KB 1TGBA 2F4LA 1TOMH 3GY8A 1C2HA 1L1GA 5HGGA 1GDUA 2VIQA 3GISB 1RRKA 1ZJDA 5F8XA 5EW1H 4CHAB 3TJVA 1ESBA 3RXVA 2A4GA 3DUXH 2FOFA 2NU0E 2IN2A 3AVZA 3ZV9A 2VVVA 2HWLB 2TIOA 2W26A 5FX5A 2AGGX 4BANB 2OBQA 1S84A 5AF9H 3ATLA 2UUYA 1YGCH 4DJZB 3SNBA 5A8XA 1FAKH 4B73A 1GI2A 3LGVA 4D76A 1HNEE 1AKSB 1KYNA 4IN1A 3E16B 3ATKA 1NRRH 1GI7B 3WWBA 3B23B 2FO9A 1ELFA 5JBTA 1TAWA 3M61U 2V7QD 3MTYA 5DK1A 4K8YA 1S82A 2BB4A 1S85A 2Y7ZA 5E8EH 2WPLS 5EQSA 4FU9A 1BZXE 3BTQE 3GY4A 3TNTA 2G5VA 2PHBA 1WTGH 4OS6A 1GVZA 2BVSH 1GBCA 4NFEA 1NRPH 4X1RU 3JZ1B 2Z3EA 3SN8A 1FY3A 1TNLA 2BQWB 2V35A 3VXFH 2ZP0H 2VIVA 4MPWA 4X1PU 8LPRA 3P6ZB 3ZVEA 1D9IA 1A61H 5GNDA 3RLYH 1WQSA 3DSOA 4O97A 3SI4H 4DT7B 3ELAH 3PTNA 3RUOA 1SLVB 2PKSC 1EATA 3ESTA 1PPGE 1ZYOA 2G4UA 4HG6A 2G51A 1QB6A 2R2WU 2VWOA 4Z1MD 2W7SA 1V2MT 1D4PB 4JYVH 2LELA 2P59A 4I8HA 4X8VH 1L2EA 3NPSA 3PYHA 1H9HE 5I25A 2ZHDA 3PLKA 1NFXA 1K1IA 1QQ4A 4ZH8A 4X6NA 1GHAF 1LHGH 2KR7A 4GCHF 1AFQB 3SYJA 8GCHG 5EJ1A 1NFYA 3M5MA 1FPCH 5FCKA 2OQUA 2PFEA 2C8ZB 2A0QB 3NCLA 1OS8A 4DCDA 5EXMA 1NY22 1SQOA 1V2ST 2XBYA 3TGIE 2KZ4A 3KQ5A 2AMQA 1AD8H 1IQGA 2ZU2A 1HJAB 1GJ7B 1ZRBA 1NU7B 2F83A 1IQNA 3A8AA 5AVDA 4AGKA 1PQ5A 4X2VA 3TK9A 2O8TA 1HJ9A 2F9VA 1P12E 1J15A 3EA8A 4F48B 2AFQB 3NRLA 1F5KU 2J4IA 3BIVH 3UUZA 2SGFE 4XBBA 4XOJA 1ZHMA 1IQKA 1TFXA 1KLTA 3OY6U 1S5SA 3A80A 2EA3A 2K8IA 1WCZA 5I46H 1BMAA 4BTIB 2PKAA 2BQ7B 2ZO3H 1AWFH 1GJ9B 1MKWH 1AMHA 3RXMA 4GSOA 5FPYA 3GCOA 2IOTA 4I8JA 4RKOB 4AG1A 1UVPA 1W13U 4ZMAH 4AFUA 2QA9E 1IQLA 2OUAA 3OTPA 3SQHE 5GCHG 1BT7A 1CGJE 1HLTH 2SNVA 3ZVBA 1GHWH 2FPZA 2QE7D 1SG8B 1OP0A 2A32A 1C2IA 2BDAA 3RM2H 1KLIH 3RXKA 4JYTA 3V7TA 3IITA 3UTUH 3SNDA 1LPKB 1Y3UA 2FZZA 3ATMA 2EI7A 4OS2A 2XWAA 4BAHB 3W1EA 4Y8XA 2PV9B 2BY7X 1DLEA 4K60A 4ABAA 2YMSD 2JJ2D 1FN6A 1O0DH 2GP9B 4UONA 1XUGA 1O5FH 8ESTE 1AHTH 1QQUA 1GHYH 1NTPA 1QHRB 4NIYA 2YMSB 2P8OC 1HAXB 4QT8C 2WYJA 1O2RA 3F1SB 3RXAA 5K7RA 1FLEE 1GCTB 3OEED 1A7SA 2JJ1D 1FIWA 4H6TA 1VKYA 4X2YA 1O3PB 4A1XA 1AUJA 1LQDB 3MU8A 2WV4A 3IWMA 2F9NA 4O03A 1Y5UT 2XTTB 1JXPA 2ZTXA 2BLOA 3PV2A 4WMEA 1LPGB 5FPTA 1U6QA 3MH7A 4NGAH 3E0PB 3SNEA 1GPZA 2D26C 4U32A 1IQHA 1MKXH 4FU8A 1HDTH 1JIMA 1O38A 5J4SA 1VZQH 1NBME 1GI6A 2ZKSA 3SNCA 1TGCA 1OWKA 4NSYA 1ZOMA 2G55A 2PTNA 4I8LA 3SU0A 1ORFA 2VVCA 3FP8E 1WOFA 1GBJA 2WHXA 2JIZD 1GCDA 1UVTH 1GMCG 3PWBA 1O5CB 3LPRA 1AZ8A 2KCPA 3SNAA 4BTTB 2FWWA 1ESTA 4GHTA 1SC8U 3U8OH 1RTKA 2JKHA 3RXUA 3RXHA 3GICB 5JB9S 3UWJH 4MTBA 1O2SA 1WU1A 2ODPA 2FESH 4I32A 1HIAA 1WUNH 1CE5A 1RTLA 1O2VA 1SQTA 2XBVA 3A89A 1PQAA 2OQ5A 2XCFA 4B2BA 1O2JA 4DIIH 1VGCC 1MBMA 1GL1A 3E6PH 3KL6A 2EY4C 4ZKSU 4CRFA 1ZMJA 3AW0A 1ZHPA 1TGTA 1F5RA 1LHEH 1CA0C 5L6NH 3DSPA 3GY5A 1P02A 4HTCH 4WXIA 1V2QT 2ZPRA 5A0CA 3PV4A 2ZF0H 2CHAC 2TGPZ 4Q63A 1C1PA 2CGAA 4LK4A 2FODA 1W0YH 3GOVB 1O2GH 1XVMA 4UFDH 1DFPA 5FBIA 1ETRH 1Z1IA 4LXBH 3QWCH 1PPCE 2R2MB 2C8YB 3HGNA 4LOYH 1O2PA 2FTMA 1MTSA 1ZTLA 1C1OA 1O32A 1J9CH 1BCUH 3LGUA 4JCNA 1SGTA 1C5MD 1C5ZB 4KTCA 1ZPBA 1FY4A 4JZIA 5AFYH 1W2KH 3HPTB 1SGQE 1DOJA 4DY7B 1VR1H 1BQYA 4ACBA 1YLDA 1LPZB 4MLFB 1QA7A 3NK8A 3WW7A 2FIRH 3ZVFA 1EFRD 4OGXA 2BY6X 3U98H 1ELDE 1C5WB 1GVLA 3D65E 5ABWA 2KAIA 2ZFSA 1EZXC 4THNH 4B75A 5KECA 3RXRA 1GJBB 4Y8YA 3UREA 1JRTA 1SPJA 3UFAA 1E1RD 4TSFD 2GTBA 3LKWA 1ZZZA 3HGPA 4R8TB 2ODYB 1KDQB 2PP6A 4ASUD 1RFNA 1MCTA 5G4BA 1HXFH 1O36A 2GCTC 5JBBS 4ABDA 5EGMA 1K1NA 1LTOA 1ANEA 1O5BB 1PYTC 2HRVA 1K1JA 4HGCA 1O3KA 5GCHF 1RIWC 1O35A 5DKMA 3SBKA 2XC4A 4LZ4B 1C5YB 1CA8B 3BEUA 1WYKA 3BTKE 2B0FA 1P04A 1AVXA 1O2YA 1BTXA 2VBCA 3UWIA 1WAYB 2FLRH 2QXHA 1AY6H 1N8OC 1PFXC 3P8GA 2HLCA 1EP6A 4YOIA 3TU7H 3U8RH 1QBVH 2ZGBH 4JZFH 3ZYEA 2VJ1A 1YLCA 2ZGCA 2QXIA 4WH8A 1HAVA 2HALA 2F3CE 2AHME 1P9UA 1WDIA 1FN8A 5LGOA 1X7AC 2ALPA 1QL8A 1GBLA 2V6NA 1J14A 1HAYB 4NA7A 2VH0A 1DM4B 2ZDAH 2FOBA 1KXAA 1NO9H 2YOLA 5E0GA 4HFPB 2Z9LA 3D49H 1DY9A 4O9VA 3N99A 4CH8B 1TX8A 4BXSA 1FONA 2ZWLH 2A1DB 3NXPA 4O3UA 5J4QA 1D3TB 3VB7A 3GCHB 4Y79A 4X2XA 1A5GH 2J9NA 3RP2A 2OC0A 3K2UA 3BSQA 1K21H 2FS9A 1IQMA 2GMTC 1EPTC 1JWTA 1SFIA 1NM6A 2HLDD 5B6OA 2ZHWH 3U69H 1SQRA 2K1QA 3DHKH 3KYFA 4X8TH 1F5LA 1E36B 5JBAS 4ESTE 2V3OH 1S6HA 3RMNH 3A7WA 1ETTH 1O3FA 3ZVAA 1RIWB 1TONA 3TH3H 2H1UA 2K0QA 4NWLA 3A8BA 1V2PT 1ZPZA 3NKKA 5HMAA 1K1MA 5ESBA 4NIXA 2CV3A 2WINI 2SGQE 4D7FA 3SJ8A 1TALA 4ISIH 1C5VA 2NU1E 3SHAH 1LVOA 1N8OB 3BF6H 2HVYB 2ZPSA 3UY9A 2BYAX 3KEEA 3B8JA 3P8NA 1QFKH 1OWIA 3F6UH 4Q80A 1BBRE 1DANH 1H8ED 1J16A 3UPEA 2AYWA 3A7ZA 5EJLA 1W3CA 1ZPCA 3BN9A 4FXGH 3RC5A 2O8MA 4ZXXH 3GDUA 1EJNA 3BEFB 4WMDA 5L2ZH 4SGBE 1WTHD 1YCPM 9LPRA 2R3UA 3FAOA 3Q3YA 1N1LA 6GCHG 2V0BA 1UTMA 2Y82A 2BX4A 2ZA5A 5HM2A 3L33A 2BD4A 1AE5A 2OP9A 1SOTA 1CBWB 1EAIA 1P2KA 3RXOA 5F53A 1V2WT 1W0KD 2G52A 2ZECA 4YO9A 3O8BA 2ASUB 1GHAG 4GCHG 3U1IB 1P2IA 1L1JA 1P10A 3ZZBA 1BRBE 3V12A 4CRCA 1ARBA 2J98A 3K9XB 2R9PA 1UVSH 5EPNA 4INKA 1BTUA 2O8LA 3UR9A 1CT4E 3UAIC 1GDNA 5HKKD 3SZEA 2KM0A 1P2MA 1G3EA 1GBKA 2RDEA 2BTCE 4X6MA 1JBUH 3SGBE 5C1UA 1EUFA 1QCPA 3LGTA 1SOZA 5F8TA 5FHTA 1ELVA 1C1SA 1VITF 3AASA 2DE8A 1W7GH 1GJCB 2HGTH 3VG8A 1EJAA 4H4FA 4ABFA 1OWHA 1VJ9U 3SHCH 1YPKH 3B9FH 4TWYA 2ZGXH 2D1JA 2FDAA 5KEDA 1H8HD 1C9TA 1C9PA 1V2RT 1AKSA 3P95A 1MU8B 3KQCA 3RU4E 3RXSA 1EZUC 2G5NA 4WMFA 4MVNA 3KQDA 2FM2A 3WY8A 2TGTA 5HXFA 2AMPA 2CJIA 1AO5A 1S81A 2LPRA 4YOGA 5C0TA 2GT8A 4AB8A 4X8SH 4ZKNU 4FETA 1H9IE 3MI4A 3TVJB 4BAMB 4DOQA 4IMQA 3C27B 4KTUA 1F0TA 4Y76A 2EEKA 3MH5A 4XBCA 1C1MA 3BTFE 1SQAA 1BHXB 1S6LA 2BVRH 1HCGA 3P8OA 4IN2A 1INCA 4MNXA 8KME2 1P11E 2F9UA 3N7DA 3M3SA 3EDXB 5F03A 1B7XB 2GX4A 3RU4D 1CO7E 1V2JT 2ZU1A 5TJXA 2XC0A 1UK3A 1UHBB 3MWIU 4KELA 5B6LA 1RGQA 1SB1H 2J34A 4ZAEA 5C5NA 3K6YA 4BTUB 1AFQC 3QDZB 1GJDB 1GMHF 1G3DA 2WSSD 1XKBC 4ZKRU 4ZXYH 2BDGA 3M36A 3F9FA 1Q31A 4KKDA 4IBLH 4ZROA 2I6SA 1C2LA 2ZCHP 1HJAC 2FMJA 1COWD 1HFDA 2KCOA 4YZUA 2ANYA 1UTKA 3U9AH 1O2NA 1PPBH 1D6RA 2Q6DA 4UE7H 3JZ2B 3ZZCA 2C93B 3F68H 3BTWE 3F9EA 1XUJA 1A0LA 1UVOA 3LT3A 1TYNA 5GJ4B 1C2DA 1FV9A 1BRAA 3FZZA 3FKSD 4DURA 3RC6A 1TIOA 2FS8A 1TB6H 1FQ3A 2OBOA 4TPYA 1SHHB 2OC1A 3E0NB 2WUBA 3M5NA 1YPLH 1EXFA 1WV7H 2R3YA 1YCPK 4D8NA 1ID5H 1YY3A 2UWOA 3TH4H 5DP6A 3MO9A 3T29A 1MAYA 2ZFFH 3PTBA 1BBRH 1O3CA 4BXWA 7ESTE 1E0FD 4BOHA 4A1VA 1O3NA 2P93A 4Q7XA 4K5ZA 4TT3D 4XRNA 2ZTYA 3VB5A 6GCHF 1W11U 3URCA 4RKJB 2Q1JA 2STAE 1F0SA 2XBWA 1QURH 2EQNA 2Y5FA 4X1NU 2OC7A 2R0KA 1C5LH 1OWDA 3SU6A 3DD2H 2V3MA 3M7UA 1ANCA 4E7NA 4AOQA 1WBGB 5C94A 1BMNH 1HB0B 3K6ZA 3RXIA 1V3XA 3M3TA 2YMSC 3SZNA 1KXFA 1UTQA 3CS7A 2P3FH 3UOUA 3TJUA 3EE0B 3SGAE 1Z8IB 1T8NA 1O3IA 1GCTC 3SU4A 2HNTE 4UFEH 2ANWA 3UR6A 3TJNA 3F3BA 3D23A 3SU2A 4FUEA 1C1QA 4Y71A 5GWZA 3SUFA 1C2KA 1G32B 2QAAA 2GCHF 1QL9A 1C4Y2 2GZ7A 3D62A 1TLDA 1TOCB 3LH3A 2Y5GA 1G2MA 1O37A 4OS5A 2ZDMA 3EYDA 1QRZA 4I33A 3SGQE 3A85A 2Y7XA 7KMEH 1AWHB 1LVMA 1DS2E 1DVAH 3QN7A 1Z1JA 1V2TT 1AE8H 4B76A 4INHA 3RXGA 4B2CA 1BRCE 2A45B 1W8BH 1TNHA 2FOCA 4NA8A 3RU4T 1EOJA 1OWEA 3IG6B 2SGDE 3DCLA 5A8YA 4B71A 5C20A 1C1UH 2FP7B 2GKVE 1T4VH 1BBRK 5DP4A 1NS3A 4RSPA 4Y0YE 1GI9B 1BJUA 1P03A 2QC2A 3LGIA 2BD8A 2KX4A 4AC9A 3N7OA 1QZ8A 1V2NT 5C3NA 1GHVH 2VIDA 2Y81A 2Z3CA 2Z7FE 4CR5A 1FDPA 1K1LA 2VNTA 2SGPE 1HPGA 2J38A 1BJVA 3UB0A 2ULLA 4H6SB 1GI5A 3BG4B 1OP2A 2KCAA 3UNSA 2CK3D 1TE0A 3ZZ8A 1SGYE 2PWXA 3AAUA 5A2MH 3H5CB 1AVGH 1EOLA 1SLWB 5DN6D 1EX3A 4K2YA 1C5PA 3MMGA 3QTOH 3OTJE 1GVKB 3L6PA 5GXPA 2B8OH 4ACAA 5C2ZA 2BD7A 2WV9A 1K9OE 1AUTC 4A6LA 5CHAB 1D3PB 1G36A 1SHYA 2A2QH 1FPHH 2C8XB 1P09A 2FX4A 2VH6A 5LPFA 1TRYA 2ZU5A 4JZDH 4X0WU 2G4TA 3VB3A 1TMUH 1SGPE 5JPMH 1O3GA 3FN8A 1J8AA 3M7TA 3U28C 2F9OA 2QF0A 1DUAA 1Z71A 2ZIQH 1EZSC 3GDVA 1HAPH 2PKAB 3S9BA 3QUMP 4JK5A 1F0RA 2ANMH 2GZ9A 3F9GA 1N6XA 3SU3A 1GBFA 1RTFB 3VGCB 1FI8A 1ELTA 1RD3B 1O2XA 3ZZ3A 4F55A 2JH0D 2Y80A 4BAQB 4AB9A 2AMDA 2H9EH 4A92A 1ELCA 3TJOA 1DITH 5T6GA 1TNIA 5BPEA 1ZGIA 3KCGH 1NBMD 4TPIZ 1K22H 1O3LA 2VB0A 4HI3A 4OS7A 1DPOA 3MO3A 2GDEH 3STJA 1UTPA 1HJ8A 2NU3E 5EJZA 2A5KA 5FBEA 2OXSA 3SORA 3CS0A 1HUTH 2XWBI 3PMBB 1O2IA 1LQEA 1NT1A 2BM2A 5JBCS 2PGBB 3E8LA 4FUCA 1ZSJA 1XUIA 1PPZA 3DA9B 3H09A 1P2OA 2A7HA 4ZHAA 2IPQX 2QF5A 1QA0A 1EASA 1TBZH 2PUXB 1KXEA 2RG3A 1P01A 1TQ7B 3F2HA 3QK1A 4IC6A 3ZYDA 2BY8X 1GWAA 3T28A 4Z0KA 1O5AB 5DP7A 3DFLA 2BY9X 1SLXB 1XUKA 3LDXH 5GDSH 2Z9KA 5DGJA 3WWFA 3A7YA 3BV9B 3NUMA 3QO6A 4Q2KA 3SJKA 1P3CA 3ZZ5A 1KSNA 3KHVA 4ABHA 5ESTE 5C0UA 1THRH 4FUJA 3GCNA 1MTWA 3P92A 1PPEE 3QX5H 1TRMA 2J97A 3RXJA 1HAIH 5L2YH 1W10U 3RMLH 1O3EA 1TNJA 1MUEB 2BLQA 4CREA 3UQVA 1WQVH 3GCHC 1A3EH 1QIXB 2FLBH 1PPHE 4JZ1A 5IDKA 1V2UT 4F4OC 4ZHMU 4OS1A 3I77A 1O5GH 2FXRA 4Z6AH 1A0HB 1EAXA 2ZG0H 1SGIB 2W3IA 3PWCA 2P3TB 3GDSA 2ZHFH 3V13A 3M5OA 4K3JA 4OS4A 2H2ZA 2SGAA 1HIAB 2G00A 1ETSH 2QY0B 3MH4A 2JDID 1CT2E 3P8FA 3S0NA 6CHAB 2WYGA 1VITG 2JETB 1Y3VA 3UOPA 1Y5BT 1CU1A 5EXLA 4Y7BA 1IHSH 1N6YA 4MG3A 1P2QA 4B74A 2XC5A 2BD9A 5CHBA 5FX6A 2XYAA 1ELEE 1JOUB 1AGJA 1V2VT 4FUIA 2C3SA 2L74A 5BRRE 1AN1E 3E91A 1YLNA 1FY1A 1YC0A 3A81A 3MOCA 3FP7E 1C5UA 1G3CA 1MMJN 1F2SE 1O5EH 4Y6DA 1RXPA 4IW4E 4GLYA 1L0ZA 2GT7A 2W6ID 1XUHA 4BNRA 1P9SA 2CMYA 1D3DB 2JH5D 1O2TA 5JDUB 3SO3A 1LDTT 1GL0E 2DE9A 4IMZA 2TBSA 3VPKA 1UCYE 4LZ1H 3UQOA 2BDBA 2B9LA 1C5RA 1CBWC 3TK6A 3GY3A 2TGDA 2W3KA 3ZV8A 4CRBA 4KGAA 2FI3E 1FJSA 1S0QA 3ZZ4A 2KAIB 1YPGH 2UUFB 3OAAD 1E79D 2Z9IA 1GMHG 2ZU3A 1O2OA 3VFEA 1MTNB 4INLA 4B2AA 5HIZA 1G9IE 4NFFA 2BDHA 1KLJH 3LIWA 3HKJB 1THPB 1HYLA 3F2GA 3MU4A 2ZDLA 1ZMNA 1SR5C 1IQIA 3K65B 3I78A 2J92A 2XXLA 2Z3DA 3MNCA 1O2ZA 1T8OA 2W5EA 2VGCB 1GBMA 2CXVA 3F2FA 1O3AA 3NWUA 2ZTZA 5FPSA 2IJOB 4NA9H 2SNWA 1EPTA 2L6OA 1TGNA 3HK3B 1UO6A 2A4OA 3H7OA 1Y5AT 4I8KA 1BRUP 2ZQ1A 3FO8D 1IAUA 2WPIS 3SUGA 3ODFA 3OYPA 5A0AE 3MH6A 2VU8E 4TYDA 5IK2D 1MQ5A 2ZQ2A 4ZUHA 1SGEE 1EAWA 1DWDH 4AGJA 2WZQA 1C4V2 3RXDA 1HAVB 2JH6D 1FMGA 3PV5A 4YOJA 4XDEA 4CH2B 1P2NA 1SFQB 1C1WH 2QIQA 5GIBA 5A0BA 1A0JA 1P06A 3EA7A 2SGEE 4JZEH 3TLOA 1G3BA 4Q7ZA 1BITA 5PTPA 4OM9A 3UIRA 1VCQA 1YPHE 2QCYA 3HKIB 1FNIA 2TRMA 1NU9A 3FANA 4UFGH 3U8TH 1DWBH 4B1TA 4VGCC 4DW2U 4BAKB 1ZLRA 4P00A 5IYTA 1ACBE 3SV9A 3OY5U 1GJ4H 1MD7A 2IPHA 1C2JA 3EE7A 4U2WA 3SOSA 3MHWU 2OK5A 2PR3A 3QTVH 1RJXB 3T62A 4RT1A 3SI3H 3PMHB 3BTEE 1MTVA 4DGJA 4NG9H 2RA3A 1C1NA 1DICA 3LGWA 2NU4E 5A8ZA 5FAHA 5K0HA 1QRXA 2BZ6H 4MNVA 4I7YH 1ZR0A 2ZCKP 2M2AA 4ISHH 1QJ1B 5C5OA 5KGOA 2OCVB 4O3TA 5DPAA 2ESTE 2GCHG 3SUDA 1OX1A 4ISOA 2TGAA 2IJD1 3O8CA 2O8UA 4D9QA 1TPAE 1DY8A 5HIYA 3SV2H 4YLUA 3RXQA 1KXCA 2AEIH 3A7VA 1RS0A 1TA2A 2UWLA 1QY6A 3LJJA 1A3BH 4AZ2B 5EIYA 4A7IB 1O2LA 1XKAC 5A09A 1C5OH 1FY8E 1G30B 1O31A 1Y59T 1UMAH 3ATWA 3F0PA 3T2NA 4AYVB 2BVXH 1A4WH 2WUCA 2STBE 5HYOA 1C5QA 2GDDA 1YPJH 3OEHD 2LNCA 1PJPA 1AB9B 1TNGA 1NC6A 2O8WA 2B7DH 3A8CA 5DP9A 4TY6A 1GJAB 1QJ6B 4PROA 1VCPA 5JB8S 3PMJA 3RLWH 1XMNB 1GBIA 1YCPH 3R3GB 4CRDA 1AVWA 1DWEH 1M9UA 2NU2E 2C8WB 1O3OA 2YNAA 5H4IB 1J17T 2VWLA 1C2FA 2QF3A 2YNBA 4XBDA 3RXLA 4NSVA 1AQ7A 1EAUA 3SU5A 1C1RA 3SJOA 1UTJA 5AHGH 1C5XB 1TBQH 2BXUH 5F6MA 3PO1B 3S9CA 4VGCB 3QZQA 1JMOH 4NIWA 1Y3WA 4KTSA 1EJMA 1K1PA 3KYGA 4CBOA 2SFAA 2FYRA 2WPKS 4X1SU 5C1XA 1TPPA 1P0SH 1E37B 2AERH 2FI5E 3SW2B 3SJIA 3SU1A 1NRNH 2J98B 2ZGHA 1GI8B 1B0EA 2F9BH 2HOBA 2QXGA 1YYY1 1T4UH 1ANBA 1HAGE 4K1EA 2AS9A 3I29A 3CNRA 4MDSA 1FZZA 2J94A 6ESTA 4CRGA 4FVDA 1GI0A 3UNQA 4AN7A 5TCCA 3ITIA 3VXEH 1Z8JB 4RN6A 1O39A 4AFZA 2ZCLP 2RFKC 1WSSH 1Y3XA 5L30H 2BDIA 1GHZA 3SV7A 5SGAE 2WPDD 1IHTH 3GY7A 2Y5HA 4HZHA 4KP0A 1E1QD 3LOXA 5T3HA 3KN2A 1QTFA 2PSXA 1BTWA 3M37A 2F43B 1OYQA 2BX3A 2V3HH 3MNSA 2ZU4A 3RXTA 2FYQA 1SVPA 2AGEX 1OYTH 2BLWA 1TABE 2HNTC 1S6FA 1TPSA 1BIOA 3KIDU 3OX7U 3OFND 1TQ0B 4CR9A 2J2UA 3FP6E 5AFZH 2AH4X 3P17H 2P3UB 1B5GH 4X1QU 5C1YA 3BG8A 1BTZA 1W0JD 1OPHB 2D8WA 3H7TA 5EOKA 1DX5M 1UTOA 1TNKA 1OHHD 2XOKD 1CHOF 2B5TB 1LMWB 2D2DA 3Q76A 1UW7A 1V6DA 3OU0A 1C4U2 2QV1A 1BA8B 1GI4A 1H1BA 4SGAE 4Q4LA 2R0LA 5LPEA 1C5TA 1HAOH 3KQBA 2G81E 2QF4A 1V2KT 3MQKC 3T26A 1UCYK 1DWCH 1O3DA 4WJG2 1O3HA 2BLVA 2G8TA 3EA9A 4RT0A 2HPQH 3O8RA 3BG4C 2ZFRH 2J95A 3BTDE 6LPRA 1SGFA 4M7GA 1LO6A 1EKBB 3RC4A 2Z9GA 1GG6C 4ZCNA 1BUIA 2ANKH 5ETXA 4ABEA 2BZAA 1NN6A 1OKXA 2BMGB 2CF9H 4XSKU 4E06H 4FU7A 1W0ZU 1T8LA 1F0UA 3FFGA 1TPOA 5C67A 4UFFH 2ZFPH 1GJ5H 1LKBA 1MD8A 5CHAC 3BTGE 1K0HA 2ILNA 5DG6A 3URDA 1O5DH 1GHXH 3MFJA 1GBAA 1YP9A 2H6MA 1GMDF 1QBOA 3T5FH 3KNXA 1LHDH 1CQQA 1T32A 1QB9A 4GVUA 3T25A 1KTTB 2GD4B 3V0XA 1CVWH 2VWNA 4D7GA 2GVFA 3PLBA 3BIUH 4MPXA 3GY2A 1OSSA 4ABGA 4Y7AA 2VIOA 2OC8A 4ABIA 1ESAA 1GGDC 1HGTH 2A5AA 2EI8A 3ZZDA 4K69A 4ZHLU 4M9FA 3VGCC 1VCWA 3MO6A 1Z7KA 1ABIH 2BQ6B 2ALVA 1QBNA 2FOAA 1GBBA 3LC3A 1HV7A 5EQRA 1WXRA 3QGNB 3TIUA 1UVUH 5C17A 3E90B 1GHBF 2QXJA 3PMAB 1C1TA 2KFWA 5EODA 1PPFE 3QZRA 3RXCA 4A5TS 1XXFA 1Z6JH 1KTSB 1W14U 3VB4A 1QL7A 3ODDA 2UUJB 2PKSB 2GJGA 2XBXA 2VIPA 4ZKOU 1UK2A 3AAVA 3QGJA 1VJAU 3TITA 1Y8TA 2EI6A 2XNDD 1IQJA 1OXGA 3FVFB 2BDCA 3LU9B 1Q2WA 4Y0ZE 3VB6A 4AORA 1OWJA 1GG6B 2A4QA 4Y8ZA 5FL7D 3G01A 1NFWA 3SV8A 7GCHG 2PUQH 4I31A 1P2JA 1GDQA 1HXEH 3FZDA 1O2HA 1O2KA 4FUDA 5EPYA 5E2OA 4UEHH 4IGDA 2W6JD 1NZQH 4NZQA 1BTHH 2QN5T 1TBRH 2A31A 1O2UA 1FIZA 1PQ8A 2UWPA 1HRTH 2VWMA 1LCYA 3W95A 3LONA 1EQ9A 4X6OA 1O2QA 2ZZUH 4Y11E 2KCYA 5DJ7A 4FUGA 1T7CA 5E0HA 1DUEA 1QR3E 4XE4A 3RMOH 1XUFA 1AIXH 2XW9A 3RXFA 3TNSA 1GGDB 2FOHA 4D9RA 1GJ8B 2OLGA 1OP8A 4YTAA 2BHGA 1W12U 1JRSA 1O2WA 3EQ0H 3GCTG 1ZMLA 3W94A 1UTLM 2DUCA 3M5LA 3V3MA 1ZGVA 3PLPA 4GHQA 2FEQH 3A88A 3TH2H 5DSFA 2P95A 5EG4A 4TWWA 4OGYA 2FTLE 3Q00A 1GBDA 6CHAC 2JETC 1C2EA 1C2MA 1DLKB 1MKWK 4NCYA 1BDAA 1A1RA 3OE7D 3E3TA 2FX6A 1LHCH 1THSH 1Z8GA 1KDQA 4ABJA 4B6EA 2H5DA 2LP6A 5EQQA 3A8DA 1ARCA 4MQAA 4AYYB 1YWUA 1D3QB 3MU5A 3SJ9A 4B6FA 5TCAA 1CGHA 1SLUB 4P02A 3S69A 1KXBA 1AZZA 2AIQA 4RI0A 2PW8H 1ELBA 5DP5A 3STIA 1O33A 3DT0H 3TK5A 4GAWA 4YM9A 2ZEBA 4FUFA 2GV7A 1KXDA 2C4FH 3Q3KA 1O2MA 1FX0B 5T6DA 1MQ6A 3OSYA 1IOEA 2F9PA 1O34A 3A82A 1GJ6A 3PRBA 1HAHH 3RXPA 1DSUA 1BMLA 1AU8A 2BXTH 4CRAA 1H4WA 3M7QA 1TMTH 3LGYA 1CHGA 1TA6A 2P8OB 1AFEH 2ZHQH 1V2LT 3ZZ7A 1Q3XA 8GCHF 5LH8A 3DSGA 3TGKE 1LVYA 3PRDA 4YT7H 1L1NA 4WVPE 4Q7YA 2WPMS 1BTPA 4MPVA 3NZIA 2BOKA 1QJ7B 4CBNA 1UK4A 2P16A 2ZPQA 4I86A 1SSXA 3DFJA 2A4RA 1CSOE 1GI3A 2ZC9H 4F49A 1BMMH 1MTNC 4NIVA 2ZHEH 3HK6B 1MKXK 4A1TA 3GS9A 1HAZB 1SGFG 2FOGA 2AGIX 1H8IH 1SGCA 1S0RA 2ODQA 4WH6A 4DT4A 9ESTA 2F91A 7LPRA 3CP7A 3SQEE 4Y10E 1BHXF 1ZTKA 3ZZAA 1CGIE 1DSTA 1P8VC 1GBEA 3PB1E 4K1TA 3EGKH 3C1KA 3ZVCA 4H42U 4GUXA 2XNIA 2VGCC 1SMFE 2Z9JA 3GYMA 1P57B 4K1SA 1YPMH 5T6FA 3RDZA 3QLPH 4E7RG 5HM9A 3ZZ6A 3A87A 1V2OT 1H9LB 1ELAA 1TGSZ 1VITH 1XM1A 1MZAA 1QB1A 2VVUA 1TRNA 2QYIA 4ISNA 1C2GA 2FOEA 1QRWA 4WF8A 4MNWA 1EB2A 1FY5A 3LC5A 1C1VH 1GBTA 3GYLB 3RMMH 1MTUA 1O3BA 4FUHA 2BDYA 1GI1A 1P05A 1K28D 4JMYA 2W7UA 1G37A 4U30A 2BY5X 1MBQA 1NROH 5JYIA 2H9TH 1HBTH 3RXEA 3L3TA 1VGCB 1T31A 2Z6BD 2NWNA 1EZQA 1ANDA 1IQEA 1CA0B 7GCHF 5LPRA 3BTHE 1BOQA 2BD3A 2CHAB 3E1XB 2OINA 4K8BA 5T1VA 1TMBH 2GGVB 3CENA 1XVOA 3MNBA 5FXLA 2ZFTA 3ATIA 1DT2A 1S83A 2A5IA 2UUKB 2PGQB 4J2YB 4AG2A 4UD9H 4X2WA 1A5HA 3N7EA 1KY9A 1YM0A 2EC9H 4YT6H 3BTME 2WPJS 4R0IA 5GPIB 4XFQA 4FUBA 2ZNKH 2GZ8A 4WXVA 2VIWA 1CT0E 1O3JA 1O30A 1T8MA 1B0FA 2Y6TA 3GCTF 4E05H 3A83A 4YLQH 1FUJA 1BMFD 1Z6EA 2PTCE 2P94A 2ZDKA 1TX6A 3MU1A 1IQFA 1P3EA 4AFSA 4DIHH 2A2XH 5DP3A 1SGDE 5CDFE 3ZVDA 1K2I1 5FCRA 1YPHC 1BTYA 1QNJA 2RA0A 1W7XH 3KQEA 4I8GA 1GMCF 2A7JA 1PYTD 1YBWA 3ENSB 3ZVGA 4ABBA 4AX9H 1UJ1A 4U01A 1SGNE 1MZDA 4J1YA 1LKAA 2CN0H 5DO4H 1LHFH 1K1OA 2GCTB 3SUEA 1A5IA 3T27A 1TX7A 1ZTJA 1UTNA 2H5CA 2ZFQH 1FXYA 1AB9C
chains in the Genus database with same CATH topology
2KM0A 3KNXA 3DCLA 2LELA 2W6ID 5GJ4B 4B71A 3ZIAD 3SV9A 2YMSB 2FP7B 2P59A 3FKSD 3O8DA 4KTCA 2OC0A 3F0OA 3M5LA 1NS3A 3RC6A 2GVFA 2OBOA 3OEED 2OC1A 2OK5A 2JJ1D 1DXWA 2HLDD 3H09A 5DSFA 4WF8A 4A1XA 3M5NA 2K1QA 2QF5A 2OC8A 3VG8A 3WW7A 4NWKA 4M9FA 3SV7A 3F2HA 1EFRD 1JXPA 2WPDD 3PV2A 4JMYA 2KR7A 5FPTA 1A1RA 1H8HD 3OE7D 3SYJA 4B75A 1E1QD 3M5MA 2M2AA 3LOXA 2F4LA 3KN2A 3UB0A 4A1VA 1E1RD 4TSFD 3WWFA 2F43B 4B6EA 3SV6A 3OAAD 5EQQA 2K0QA 4TT3D 2KCAA 1E79D 3KF2A 3LKWA 4NWLA 4R8TB 5EQRA 2CK3D 1NBME 2FM2A 3SUDA 4ASUD 2KZ4A 2IJD1 5ESBA 4B6FA 3SU0A 5C0UA 1WXRA 3O8CA 5C0TA 1DY8A 4RI0A 2A4GA 2OC7A 2OINA 5C17A 4FETA 3SU6A 3E90B 5DN6D 4K8BA 2WHXA 5T1VA 2GGVB 3OFND 3F2GA 3L6PA 2JIZD 2KFWA 4XD7D 1FX0B 2FOMB 2WV9A 1SKYE 3PRBA 2OBQA 3KEEA 2KCPA 2YMSC 1W0JD 1KMHB 3P8NA 2F9VA 1S6LA 3N7EA 3F0PA 3P8OA 1OHHD 2XOKD 5IDKA 1H8ED 3F2FA 3NRLA 2F9UA 5GPIB 3OEHD 3N7DA 5FPSA 3SU4A 2IJOB 2XNDD 4B73A 2XCNA 2QV1A 2VBCA 1W3CA 3F3BA 3SU2A 4I32A 2L6OA 3RC5A 3FN8A 2K8IA 2O8MA 3M5OA 4Q4LA 3U1JB 3SUFA 1RTLA 2A4QA 3WWBA 3PRDA 5B6LA 1MABB 1RGQA 2QF4A 2XCFA 5FL7D 2V7QD 1N1LA 5H4IB 5FPYA 3SV8A 5EQSA 2J5UA 3FO8D 4I31A 1BMFD 3SUGA 3OYPA 4WH8A 2JDID 2WSSD 5EPYA 4YXWD 4TYDA 5IK2D 2AHME 3O8RA 3SU3A 2W6JD 2A4RA 1CU1A 3OTPA 5F53A 1BT7A 2WZQA 1W0KD 4F55A 5CDFE 2QE7D 3DSPA 3EYDA 3PV5A 3SU5A 3RC4A 4B74A 3O8BA 1DXPA 3FOAA 5CHBA 4A92A 3LONA 4ZCNA 4I33A 4A1TA 4Q63A 5ETXA 3GS9A 2YOLA 4DT4A 3U1IB 1COWD 4WH6A 2KCOA 4U01A 2KCYA 1NBMD 5GNDA 4B76A 3DSOA 3W1EA 5EPNA 1DY9A 3SUEA 2YMSD 2JJ2D 3N99A 4OM9A 2XNIA 3AK5A 3SU1A 5HKKD 3SZEA 4Z1MD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KM0 A;  2LEL A;  3DSO A;  3DSP A;  3N7D A;  2K0Q A;  3N7E A; 
#chains in the Genus database with same CATH topology
 1XXD A;  2Q6F A;  3TPI Z;  1JIR A;  1NRS H;  1A46 H;  4FVB A;  4AFQ A;  3R0F A;  1ZHR A;  3O8D A;  1Z8R A;  3HAT H;  3Q3X A;  3F0O A;  1MU6 B;  5DP8 A;  4IS5 A;  1SGR E;  2ZDV H;  3RXB A;  1DXW A;  1QGF A;  1BB0 B;  3ZZ9 A;  5EW2 H;  1CHO G;  3LH1 A;  2H9H A;  1F92 A;  1EP5 A;  1YF4 A;  4JYU H;  4NWK A;  1LVB A;  2AIP A;  1GBH A;  1D6W A;  2BD2 A;  1OOK B;  2FI4 E;  3UNR A;  1ZSK A;  1DE7 H;  3PO1 C;  2HVX A;  4TY7 A;  4X8U H;  3SV6 A;  1E34 B;  4BAO B;  3KF2 A;  3BEI B;  3PRO A;  2TPI Z;  2PLX A;  3A7X A;  1G2L A;  2HNT F;  2Z94 A;  1E35 B;  1DDJ A;  4MNY A;  1H8D H;  3VEQ B;  1MCV A;  2THF B;  1SL3 A;  1MH0 A;  5E0J A;  5CMX H;  1ZJK A;  2A7C A;  4XD7 D;  2FOM B;  2ZDN A;  4WY3 A;  1C5S A;  1SKY E;  1NPM A;  1KMH B;  2OTV A;  3Q77 A;  3A84 A;  3M35 A;  1PQ7 A;  3GY6 A;  4CHA C;  1SBW A;  3A7T A;  3KGP A;  1FAX A;  3S7H B;  1NFU A;  2M5T A;  4GPG A;  1UHB A;  2XCN A;  1Y3Y A;  2CF8 H;  3P70 B;  4WWY A;  3F9H A;  5F8Z A;  3EAJ A;  1C5N H;  1GMD G;  3U1J B;  4DG4 A;  1MAB B;  2GMT B;  1EPT B;  4X6P A;  5EU8 A;  1L4D A;  2J5U A;  1SI5 H;  3LJO A;  1YKT A;  2BD5 A;  1MAX A;  4YXW D;  2Q6G A;  2RCE A;  3TGJ E;  5CE1 A;  2ZGJ A;  4ASH A;  1E38 B;  4IC5 A;  4JK6 A;  1ZSL A;  1DXP A;  3FOA A;  1A2C H;  2WV5 A;  4YES B;  1EB1 H;  1F7Z A;  2I6Q A;  2XRC A;  3MNX A;  3BTT E;  3PM3 A;  4UDW H;  2WPH S;  2C90 B;  5E2P A;  3MU0 A;  4FOU C;  3A86 A;  1XX9 A;  1NES E;  4MPU A;  3AK5 A;  2O9Q A;  1AI8 H;  2VIN A;  1GHB G;  3ZIA D;  2ZI2 H;  1ABJ H;  4NZL A;  1TWX B;  2PSY A;  1KIG H;  1L4Z A;  2HPP H;  3S9A A;  1NRQ H;  2BOH B;  1UCY H;  1ZRK A;  4DVA U;  2QGR A;  3AW1 A;  5EXN A;  2RDL A;  1YPE H;  2GV6 A;  4ISL A;  3MYW A;  3RM0 H;  1ELG A;  2OD3 B;  3M3V A;  1O3M A;  3S7K B;  1TGB A;  2F4L A;  1TOM H;  3GY8 A;  1C2H A;  1L1G A;  5HGG A;  1GDU A;  2VIQ A;  3GIS B;  1RRK A;  1ZJD A;  5F8X A;  5EW1 H;  4CHA B;  3TJV A;  1ESB A;  3RXV A;  2A4G A;  3DUX H;  2FOF A;  2NU0 E;  2IN2 A;  3AVZ A;  3ZV9 A;  2VVV A;  2HWL B;  2TIO A;  2W26 A;  5FX5 A;  2AGG X;  4BAN B;  2OBQ A;  1S84 A;  5AF9 H;  3ATL A;  2UUY A;  1YGC H;  4DJZ B;  3SNB A;  5A8X A;  1FAK H;  4B73 A;  1GI2 A;  3LGV A;  4D76 A;  1HNE E;  1AKS B;  1KYN A;  4IN1 A;  3E16 B;  3ATK A;  1NRR H;  1GI7 B;  3WWB A;  3B23 B;  2FO9 A;  1ELF A;  5JBT A;  1TAW A;  3M61 U;  2V7Q D;  3MTY A;  5DK1 A;  4K8Y A;  1S82 A;  2BB4 A;  1S85 A;  2Y7Z A;  5E8E H;  2WPL S;  5EQS A;  4FU9 A;  1BZX E;  3BTQ E;  3GY4 A;  3TNT A;  2G5V A;  2PHB A;  1WTG H;  4OS6 A;  1GVZ A;  2BVS H;  1GBC A;  4NFE A;  1NRP H;  4X1R U;  3JZ1 B;  2Z3E A;  3SN8 A;  1FY3 A;  1TNL A;  2BQW B;  2V35 A;  3VXF H;  2ZP0 H;  2VIV A;  4MPW A;  4X1P U;  8LPR A;  3P6Z B;  3ZVE A;  1D9I A;  1A61 H;  5GND A;  3RLY H;  1WQS A;  3DSO A;  4O97 A;  3SI4 H;  4DT7 B;  3ELA H;  3PTN A;  3RUO A;  1SLV B;  2PKS C;  1EAT A;  3EST A;  1PPG E;  1ZYO A;  2G4U A;  4HG6 A;  2G51 A;  1QB6 A;  2R2W U;  2VWO A;  4Z1M D;  2W7S A;  1V2M T;  1D4P B;  4JYV H;  2LEL A;  2P59 A;  4I8H A;  4X8V H;  1L2E A;  3NPS A;  3PYH A;  1H9H E;  5I25 A;  2ZHD A;  3PLK A;  1NFX A;  1K1I A;  1QQ4 A;  4ZH8 A;  4X6N A;  1GHA F;  1LHG H;  2KR7 A;  4GCH F;  1AFQ B;  3SYJ A;  8GCH G;  5EJ1 A;  1NFY A;  3M5M A;  1FPC H;  5FCK A;  2OQU A;  2PFE A;  2C8Z B;  2A0Q B;  3NCL A;  1OS8 A;  4DCD A;  5EXM A;  1NY2 2;  1SQO A;  1V2S T;  2XBY A;  3TGI E;  2KZ4 A;  3KQ5 A;  2AMQ A;  1AD8 H;  1IQG A;  2ZU2 A;  1HJA B;  1GJ7 B;  1ZRB A;  1NU7 B;  2F83 A;  1IQN A;  3A8A A;  5AVD A;  4AGK A;  1PQ5 A;  4X2V A;  3TK9 A;  2O8T A;  1HJ9 A;  2F9V A;  1P12 E;  1J15 A;  3EA8 A;  4F48 B;  2AFQ B;  3NRL A;  1F5K U;  2J4I A;  3BIV H;  3UUZ A;  2SGF E;  4XBB A;  4XOJ A;  1ZHM A;  1IQK A;  1TFX A;  1KLT A;  3OY6 U;  1S5S A;  3A80 A;  2EA3 A;  2K8I A;  1WCZ A;  5I46 H;  1BMA A;  4BTI B;  2PKA A;  2BQ7 B;  2ZO3 H;  1AWF H;  1GJ9 B;  1MKW H;  1AMH A;  3RXM A;  4GSO A;  5FPY A;  3GCO A;  2IOT A;  4I8J A;  4RKO B;  4AG1 A;  1UVP A;  1W13 U;  4ZMA H;  4AFU A;  2QA9 E;  1IQL A;  2OUA A;  3OTP A;  3SQH E;  5GCH G;  1BT7 A;  1CGJ E;  1HLT H;  2SNV A;  3ZVB A;  1GHW H;  2FPZ A;  2QE7 D;  1SG8 B;  1OP0 A;  2A32 A;  1C2I A;  2BDA A;  3RM2 H;  1KLI H;  3RXK A;  4JYT A;  3V7T A;  3IIT A;  3UTU H;  3SND A;  1LPK B;  1Y3U A;  2FZZ A;  3ATM A;  2EI7 A;  4OS2 A;  2XWA A;  4BAH B;  3W1E A;  4Y8X A;  2PV9 B;  2BY7 X;  1DLE A;  4K60 A;  4ABA A;  2YMS D;  2JJ2 D;  1FN6 A;  1O0D H;  2GP9 B;  4UON A;  1XUG A;  1O5F H;  8EST E;  1AHT H;  1QQU A;  1GHY H;  1NTP A;  1QHR B;  4NIY A;  2YMS B;  2P8O C;  1HAX B;  4QT8 C;  2WYJ A;  1O2R A;  3F1S B;  3RXA A;  5K7R A;  1FLE E;  1GCT B;  3OEE D;  1A7S A;  2JJ1 D;  1FIW A;  4H6T A;  1VKY A;  4X2Y A;  1O3P B;  4A1X A;  1AUJ A;  1LQD B;  3MU8 A;  2WV4 A;  3IWM A;  2F9N A;  4O03 A;  1Y5U T;  2XTT B;  1JXP A;  2ZTX A;  2BLO A;  3PV2 A;  4WME A;  1LPG B;  5FPT A;  1U6Q A;  3MH7 A;  4NGA H;  3E0P B;  3SNE A;  1GPZ A;  2D26 C;  4U32 A;  1IQH A;  1MKX H;  4FU8 A;  1HDT H;  1JIM A;  1O38 A;  5J4S A;  1VZQ H;  1NBM E;  1GI6 A;  2ZKS A;  3SNC A;  1TGC A;  1OWK A;  4NSY A;  1ZOM A;  2G55 A;  2PTN A;  4I8L A;  3SU0 A;  1ORF A;  2VVC A;  3FP8 E;  1WOF A;  1GBJ A;  2WHX A;  2JIZ D;  1GCD A;  1UVT H;  1GMC G;  3PWB A;  1O5C B;  3LPR A;  1AZ8 A;  2KCP A;  3SNA A;  4BTT B;  2FWW A;  1EST A;  4GHT A;  1SC8 U;  3U8O H;  1RTK A;  2JKH A;  3RXU A;  3RXH A;  3GIC B;  5JB9 S;  3UWJ H;  4MTB A;  1O2S A;  1WU1 A;  2ODP A;  2FES H;  4I32 A;  1HIA A;  1WUN H;  1CE5 A;  1RTL A;  1O2V A;  1SQT A;  2XBV A;  3A89 A;  1PQA A;  2OQ5 A;  2XCF A;  4B2B A;  1O2J A;  4DII H;  1VGC C;  1MBM A;  1GL1 A;  3E6P H;  3KL6 A;  2EY4 C;  4ZKS U;  4CRF A;  1ZMJ A;  3AW0 A;  1ZHP A;  1TGT A;  1F5R A;  1LHE H;  1CA0 C;  5L6N H;  3DSP A;  3GY5 A;  1P02 A;  4HTC H;  4WXI A;  1V2Q T;  2ZPR A;  5A0C A;  3PV4 A;  2ZF0 H;  2CHA C;  2TGP Z;  4Q63 A;  1C1P A;  2CGA A;  4LK4 A;  2FOD A;  1W0Y H;  3GOV B;  1O2G H;  1XVM A;  4UFD H;  1DFP A;  5FBI A;  1ETR H;  1Z1I A;  4LXB H;  3QWC H;  1PPC E;  2R2M B;  2C8Y B;  3HGN A;  4LOY H;  1O2P A;  2FTM A;  1MTS A;  1ZTL A;  1C1O A;  1O32 A;  1J9C H;  1BCU H;  3LGU A;  4JCN A;  1SGT A;  1C5M D;  1C5Z B;  4KTC A;  1ZPB A;  1FY4 A;  4JZI A;  5AFY H;  1W2K H;  3HPT B;  1SGQ E;  1DOJ A;  4DY7 B;  1VR1 H;  1BQY A;  4ACB A;  1YLD A;  1LPZ B;  4MLF B;  1QA7 A;  3NK8 A;  3WW7 A;  2FIR H;  3ZVF A;  1EFR D;  4OGX A;  2BY6 X;  3U98 H;  1ELD E;  1C5W B;  1GVL A;  3D65 E;  5ABW A;  2KAI A;  2ZFS A;  1EZX C;  4THN H;  4B75 A;  5KEC A;  3RXR A;  1GJB B;  4Y8Y A;  3URE A;  1JRT A;  1SPJ A;  3UFA A;  1E1R D;  4TSF D;  2GTB A;  3LKW A;  1ZZZ A;  3HGP A;  4R8T B;  2ODY B;  1KDQ B;  2PP6 A;  4ASU D;  1RFN A;  1MCT A;  5G4B A;  1HXF H;  1O36 A;  2GCT C;  5JBB S;  4ABD A;  5EGM A;  1K1N A;  1LTO A;  1ANE A;  1O5B B;  1PYT C;  2HRV A;  1K1J A;  4HGC A;  1O3K A;  5GCH F;  1RIW C;  1O35 A;  5DKM A;  3SBK A;  2XC4 A;  4LZ4 B;  1C5Y B;  1CA8 B;  3BEU A;  1WYK A;  3BTK E;  2B0F A;  1P04 A;  1AVX A;  1O2Y A;  1BTX A;  2VBC A;  3UWI A;  1WAY B;  2FLR H;  2QXH A;  1AY6 H;  1N8O C;  1PFX C;  3P8G A;  2HLC A;  1EP6 A;  4YOI A;  3TU7 H;  3U8R H;  1QBV H;  2ZGB H;  4JZF H;  3ZYE A;  2VJ1 A;  1YLC A;  2ZGC A;  2QXI A;  4WH8 A;  1HAV A;  2HAL A;  2F3C E;  2AHM E;  1P9U A;  1WDI A;  1FN8 A;  5LGO A;  1X7A C;  2ALP A;  1QL8 A;  1GBL A;  2V6N A;  1J14 A;  1HAY B;  4NA7 A;  2VH0 A;  1DM4 B;  2ZDA H;  2FOB A;  1KXA A;  1NO9 H;  2YOL A;  5E0G A;  4HFP B;  2Z9L A;  3D49 H;  1DY9 A;  4O9V A;  3N99 A;  4CH8 B;  1TX8 A;  4BXS A;  1FON A;  2ZWL H;  2A1D B;  3NXP A;  4O3U A;  5J4Q A;  1D3T B;  3VB7 A;  3GCH B;  4Y79 A;  4X2X A;  1A5G H;  2J9N A;  3RP2 A;  2OC0 A;  3K2U A;  3BSQ A;  1K21 H;  2FS9 A;  1IQM A;  2GMT C;  1EPT C;  1JWT A;  1SFI A;  1NM6 A;  2HLD D;  5B6O A;  2ZHW H;  3U69 H;  1SQR A;  2K1Q A;  3DHK H;  3KYF A;  4X8T H;  1F5L A;  1E36 B;  5JBA S;  4EST E;  2V3O H;  1S6H A;  3RMN H;  3A7W A;  1ETT H;  1O3F A;  3ZVA A;  1RIW B;  1TON A;  3TH3 H;  2H1U A;  2K0Q A;  4NWL A;  3A8B A;  1V2P T;  1ZPZ A;  3NKK A;  5HMA A;  1K1M A;  5ESB A;  4NIX A;  2CV3 A;  2WIN I;  2SGQ E;  4D7F A;  3SJ8 A;  1TAL A;  4ISI H;  1C5V A;  2NU1 E;  3SHA H;  1LVO A;  1N8O B;  3BF6 H;  2HVY B;  2ZPS A;  3UY9 A;  2BYA X;  3KEE A;  3B8J A;  3P8N A;  1QFK H;  1OWI A;  3F6U H;  4Q80 A;  1BBR E;  1DAN H;  1H8E D;  1J16 A;  3UPE A;  2AYW A;  3A7Z A;  5EJL A;  1W3C A;  1ZPC A;  3BN9 A;  4FXG H;  3RC5 A;  2O8M A;  4ZXX H;  3GDU A;  1EJN A;  3BEF B;  4WMD A;  5L2Z H;  4SGB E;  1WTH D;  1YCP M;  9LPR A;  2R3U A;  3FAO A;  3Q3Y A;  1N1L A;  6GCH G;  2V0B A;  1UTM A;  2Y82 A;  2BX4 A;  2ZA5 A;  5HM2 A;  3L33 A;  2BD4 A;  1AE5 A;  2OP9 A;  1SOT A;  1CBW B;  1EAI A;  1P2K A;  3RXO A;  5F53 A;  1V2W T;  1W0K D;  2G52 A;  2ZEC A;  4YO9 A;  3O8B A;  2ASU B;  1GHA G;  4GCH G;  3U1I B;  1P2I A;  1L1J A;  1P10 A;  3ZZB A;  1BRB E;  3V12 A;  4CRC A;  1ARB A;  2J98 A;  3K9X B;  2R9P A;  1UVS H;  5EPN A;  4INK A;  1BTU A;  2O8L A;  3UR9 A;  1CT4 E;  3UAI C;  1GDN A;  5HKK D;  3SZE A;  2KM0 A;  1P2M A;  1G3E A;  1GBK A;  2RDE A;  2BTC E;  4X6M A;  1JBU H;  3SGB E;  5C1U A;  1EUF A;  1QCP A;  3LGT A;  1SOZ A;  5F8T A;  5FHT A;  1ELV A;  1C1S A;  1VIT F;  3AAS A;  2DE8 A;  1W7G H;  1GJC B;  2HGT H;  3VG8 A;  1EJA A;  4H4F A;  4ABF A;  1OWH A;  1VJ9 U;  3SHC H;  1YPK H;  3B9F H;  4TWY A;  2ZGX H;  2D1J A;  2FDA A;  5KED A;  1H8H D;  1C9T A;  1C9P A;  1V2R T;  1AKS A;  3P95 A;  1MU8 B;  3KQC A;  3RU4 E;  3RXS A;  1EZU C;  2G5N A;  4WMF A;  4MVN A;  3KQD A;  2FM2 A;  3WY8 A;  2TGT A;  5HXF A;  2AMP A;  2CJI A;  1AO5 A;  1S81 A;  2LPR A;  4YOG A;  5C0T A;  2GT8 A;  4AB8 A;  4X8S H;  4ZKN U;  4FET A;  1H9I E;  3MI4 A;  3TVJ B;  4BAM B;  4DOQ A;  4IMQ A;  3C27 B;  4KTU A;  1F0T A;  4Y76 A;  2EEK A;  3MH5 A;  4XBC A;  1C1M A;  3BTF E;  1SQA A;  1BHX B;  1S6L A;  2BVR H;  1HCG A;  3P8O A;  4IN2 A;  1INC A;  4MNX A;  8KME 2;  1P11 E;  2F9U A;  3N7D A;  3M3S A;  3EDX B;  5F03 A;  1B7X B;  2GX4 A;  3RU4 D;  1CO7 E;  1V2J T;  2ZU1 A;  5TJX A;  2XC0 A;  1UK3 A;  1UHB B;  3MWI U;  4KEL A;  5B6L A;  1RGQ A;  1SB1 H;  2J34 A;  4ZAE A;  5C5N A;  3K6Y A;  4BTU B;  1AFQ C;  3QDZ B;  1GJD B;  1GMH F;  1G3D A;  2WSS D;  1XKB C;  4ZKR U;  4ZXY H;  2BDG A;  3M36 A;  3F9F A;  1Q31 A;  4KKD A;  4IBL H;  4ZRO A;  2I6S A;  1C2L A;  2ZCH P;  1HJA C;  2FMJ A;  1COW D;  1HFD A;  2KCO A;  4YZU A;  2ANY A;  1UTK A;  3U9A H;  1O2N A;  1PPB H;  1D6R A;  2Q6D A;  4UE7 H;  3JZ2 B;  3ZZC A;  2C93 B;  3F68 H;  3BTW E;  3F9E A;  1XUJ A;  1A0L A;  1UVO A;  3LT3 A;  1TYN A;  5GJ4 B;  1C2D A;  1FV9 A;  1BRA A;  3FZZ A;  3FKS D;  4DUR A;  3RC6 A;  1TIO A;  2FS8 A;  1TB6 H;  1FQ3 A;  2OBO A;  4TPY A;  1SHH B;  2OC1 A;  3E0N B;  2WUB A;  3M5N A;  1YPL H;  1EXF A;  1WV7 H;  2R3Y A;  1YCP K;  4D8N A;  1ID5 H;  1YY3 A;  2UWO A;  3TH4 H;  5DP6 A;  3MO9 A;  3T29 A;  1MAY A;  2ZFF H;  3PTB A;  1BBR H;  1O3C A;  4BXW A;  7EST E;  1E0F D;  4BOH A;  4A1V A;  1O3N A;  2P93 A;  4Q7X A;  4K5Z A;  4TT3 D;  4XRN A;  2ZTY A;  3VB5 A;  6GCH F;  1W11 U;  3URC A;  4RKJ B;  2Q1J A;  2STA E;  1F0S A;  2XBW A;  1QUR H;  2EQN A;  2Y5F A;  4X1N U;  2OC7 A;  2R0K A;  1C5L H;  1OWD A;  3SU6 A;  3DD2 H;  2V3M A;  3M7U A;  1ANC A;  4E7N A;  4AOQ A;  1WBG B;  5C94 A;  1BMN H;  1HB0 B;  3K6Z A;  3RXI A;  1V3X A;  3M3T A;  2YMS C;  3SZN A;  1KXF A;  1UTQ A;  3CS7 A;  2P3F H;  3UOU A;  3TJU A;  3EE0 B;  3SGA E;  1Z8I B;  1T8N A;  1O3I A;  1GCT C;  3SU4 A;  2HNT E;  4UFE H;  2ANW A;  3UR6 A;  3TJN A;  3F3B A;  3D23 A;  3SU2 A;  4FUE A;  1C1Q A;  4Y71 A;  5GWZ A;  3SUF A;  1C2K A;  1G32 B;  2QAA A;  2GCH F;  1QL9 A;  1C4Y 2;  2GZ7 A;  3D62 A;  1TLD A;  1TOC B;  3LH3 A;  2Y5G A;  1G2M A;  1O37 A;  4OS5 A;  2ZDM A;  3EYD A;  1QRZ A;  4I33 A;  3SGQ E;  3A85 A;  2Y7X A;  7KME H;  1AWH B;  1LVM A;  1DS2 E;  1DVA H;  3QN7 A;  1Z1J A;  1V2T T;  1AE8 H;  4B76 A;  4INH A;  3RXG A;  4B2C A;  1BRC E;  2A45 B;  1W8B H;  1TNH A;  2FOC A;  4NA8 A;  3RU4 T;  1EOJ A;  1OWE A;  3IG6 B;  2SGD E;  3DCL A;  5A8Y A;  4B71 A;  5C20 A;  1C1U H;  2FP7 B;  2GKV E;  1T4V H;  1BBR K;  5DP4 A;  1NS3 A;  4RSP A;  4Y0Y E;  1GI9 B;  1BJU A;  1P03 A;  2QC2 A;  3LGI A;  2BD8 A;  2KX4 A;  4AC9 A;  3N7O A;  1QZ8 A;  1V2N T;  5C3N A;  1GHV H;  2VID A;  2Y81 A;  2Z3C A;  2Z7F E;  4CR5 A;  1FDP A;  1K1L A;  2VNT A;  2SGP E;  1HPG A;  2J38 A;  1BJV A;  3UB0 A;  2ULL A;  4H6S B;  1GI5 A;  3BG4 B;  1OP2 A;  2KCA A;  3UNS A;  2CK3 D;  1TE0 A;  3ZZ8 A;  1SGY E;  2PWX A;  3AAU A;  5A2M H;  3H5C B;  1AVG H;  1EOL A;  1SLW B;  5DN6 D;  1EX3 A;  4K2Y A;  1C5P A;  3MMG A;  3QTO H;  3OTJ E;  1GVK B;  3L6P A;  5GXP A;  2B8O H;  4ACA A;  5C2Z A;  2BD7 A;  2WV9 A;  1K9O E;  1AUT C;  4A6L A;  5CHA B;  1D3P B;  1G36 A;  1SHY A;  2A2Q H;  1FPH H;  2C8X B;  1P09 A;  2FX4 A;  2VH6 A;  5LPF A;  1TRY A;  2ZU5 A;  4JZD H;  4X0W U;  2G4T A;  3VB3 A;  1TMU H;  1SGP E;  5JPM H;  1O3G A;  3FN8 A;  1J8A A;  3M7T A;  3U28 C;  2F9O A;  2QF0 A;  1DUA A;  1Z71 A;  2ZIQ H;  1EZS C;  3GDV A;  1HAP H;  2PKA B;  3S9B A;  3QUM P;  4JK5 A;  1F0R A;  2ANM H;  2GZ9 A;  3F9G A;  1N6X A;  3SU3 A;  1GBF A;  1RTF B;  3VGC B;  1FI8 A;  1ELT A;  1RD3 B;  1O2X A;  3ZZ3 A;  4F55 A;  2JH0 D;  2Y80 A;  4BAQ B;  4AB9 A;  2AMD A;  2H9E H;  4A92 A;  1ELC A;  3TJO A;  1DIT H;  5T6G A;  1TNI A;  5BPE A;  1ZGI A;  3KCG H;  1NBM D;  4TPI Z;  1K22 H;  1O3L A;  2VB0 A;  4HI3 A;  4OS7 A;  1DPO A;  3MO3 A;  2GDE H;  3STJ A;  1UTP A;  1HJ8 A;  2NU3 E;  5EJZ A;  2A5K A;  5FBE A;  2OXS A;  3SOR A;  3CS0 A;  1HUT H;  2XWB I;  3PMB B;  1O2I A;  1LQE A;  1NT1 A;  2BM2 A;  5JBC S;  2PGB B;  3E8L A;  4FUC A;  1ZSJ A;  1XUI A;  1PPZ A;  3DA9 B;  3H09 A;  1P2O A;  2A7H A;  4ZHA A;  2IPQ X;  2QF5 A;  1QA0 A;  1EAS A;  1TBZ H;  2PUX B;  1KXE A;  2RG3 A;  1P01 A;  1TQ7 B;  3F2H A;  3QK1 A;  4IC6 A;  3ZYD A;  2BY8 X;  1GWA A;  3T28 A;  4Z0K A;  1O5A B;  5DP7 A;  3DFL A;  2BY9 X;  1SLX B;  1XUK A;  3LDX H;  5GDS H;  2Z9K A;  5DGJ A;  3WWF A;  3A7Y A;  3BV9 B;  3NUM A;  3QO6 A;  4Q2K A;  3SJK A;  1P3C A;  3ZZ5 A;  1KSN A;  3KHV A;  4ABH A;  5EST E;  5C0U A;  1THR H;  4FUJ A;  3GCN A;  1MTW A;  3P92 A;  1PPE E;  3QX5 H;  1TRM A;  2J97 A;  3RXJ A;  1HAI H;  5L2Y H;  1W10 U;  3RML H;  1O3E A;  1TNJ A;  1MUE B;  2BLQ A;  4CRE A;  3UQV A;  1WQV H;  3GCH C;  1A3E H;  1QIX B;  2FLB H;  1PPH E;  4JZ1 A;  5IDK A;  1V2U T;  4F4O C;  4ZHM U;  4OS1 A;  3I77 A;  1O5G H;  2FXR A;  4Z6A H;  1A0H B;  1EAX A;  2ZG0 H;  1SGI B;  2W3I A;  3PWC A;  2P3T B;  3GDS A;  2ZHF H;  3V13 A;  3M5O A;  4K3J A;  4OS4 A;  2H2Z A;  2SGA A;  1HIA B;  2G00 A;  1ETS H;  2QY0 B;  3MH4 A;  2JDI D;  1CT2 E;  3P8F A;  3S0N A;  6CHA B;  2WYG A;  1VIT G;  2JET B;  1Y3V A;  3UOP A;  1Y5B T;  1CU1 A;  5EXL A;  4Y7B A;  1IHS H;  1N6Y A;  4MG3 A;  1P2Q A;  4B74 A;  2XC5 A;  2BD9 A;  5CHB A;  5FX6 A;  2XYA A;  1ELE E;  1JOU B;  1AGJ A;  1V2V T;  4FUI A;  2C3S A;  2L74 A;  5BRR E;  1AN1 E;  3E91 A;  1YLN A;  1FY1 A;  1YC0 A;  3A81 A;  3MOC A;  3FP7 E;  1C5U A;  1G3C A;  1MMJ N;  1F2S E;  1O5E H;  4Y6D A;  1RXP A;  4IW4 E;  4GLY A;  1L0Z A;  2GT7 A;  2W6I D;  1XUH A;  4BNR A;  1P9S A;  2CMY A;  1D3D B;  2JH5 D;  1O2T A;  5JDU B;  3SO3 A;  1LDT T;  1GL0 E;  2DE9 A;  4IMZ A;  2TBS A;  3VPK A;  1UCY E;  4LZ1 H;  3UQO A;  2BDB A;  2B9L A;  1C5R A;  1CBW C;  3TK6 A;  3GY3 A;  2TGD A;  2W3K A;  3ZV8 A;  4CRB A;  4KGA A;  2FI3 E;  1FJS A;  1S0Q A;  3ZZ4 A;  2KAI B;  1YPG H;  2UUF B;  3OAA D;  1E79 D;  2Z9I A;  1GMH G;  2ZU3 A;  1O2O A;  3VFE A;  1MTN B;  4INL A;  4B2A A;  5HIZ A;  1G9I E;  4NFF A;  2BDH A;  1KLJ H;  3LIW A;  3HKJ B;  1THP B;  1HYL A;  3F2G A;  3MU4 A;  2ZDL A;  1ZMN A;  1SR5 C;  1IQI A;  3K65 B;  3I78 A;  2J92 A;  2XXL A;  2Z3D A;  3MNC A;  1O2Z A;  1T8O A;  2W5E A;  2VGC B;  1GBM A;  2CXV A;  3F2F A;  1O3A A;  3NWU A;  2ZTZ A;  5FPS A;  2IJO B;  4NA9 H;  2SNW A;  1EPT A;  2L6O A;  1TGN A;  3HK3 B;  1UO6 A;  2A4O A;  3H7O A;  1Y5A T;  4I8K A;  1BRU P;  2ZQ1 A;  3FO8 D;  1IAU A;  2WPI S;  3SUG A;  3ODF A;  3OYP A;  5A0A E;  3MH6 A;  2VU8 E;  4TYD A;  5IK2 D;  1MQ5 A;  2ZQ2 A;  4ZUH A;  1SGE E;  1EAW A;  1DWD H;  4AGJ A;  2WZQ A;  1C4V 2;  3RXD A;  1HAV B;  2JH6 D;  1FMG A;  3PV5 A;  4YOJ A;  4XDE A;  4CH2 B;  1P2N A;  1SFQ B;  1C1W H;  2QIQ A;  5GIB A;  5A0B A;  1A0J A;  1P06 A;  3EA7 A;  2SGE E;  4JZE H;  3TLO A;  1G3B A;  4Q7Z A;  1BIT A;  5PTP A;  4OM9 A;  3UIR A;  1VCQ A;  1YPH E;  2QCY A;  3HKI B;  1FNI A;  2TRM A;  1NU9 A;  3FAN A;  4UFG H;  3U8T H;  1DWB H;  4B1T A;  4VGC C;  4DW2 U;  4BAK B;  1ZLR A;  4P00 A;  5IYT A;  1ACB E;  3SV9 A;  3OY5 U;  1GJ4 H;  1MD7 A;  2IPH A;  1C2J A;  3EE7 A;  4U2W A;  3SOS A;  3MHW U;  2OK5 A;  2PR3 A;  3QTV H;  1RJX B;  3T62 A;  4RT1 A;  3SI3 H;  3PMH B;  3BTE E;  1MTV A;  4DGJ A;  4NG9 H;  2RA3 A;  1C1N A;  1DIC A;  3LGW A;  2NU4 E;  5A8Z A;  5FAH A;  5K0H A;  1QRX A;  2BZ6 H;  4MNV A;  4I7Y H;  1ZR0 A;  2ZCK P;  2M2A A;  4ISH H;  1QJ1 B;  5C5O A;  5KGO A;  2OCV B;  4O3T A;  5DPA A;  2EST E;  2GCH G;  3SUD A;  1OX1 A;  4ISO A;  2TGA A;  2IJD 1;  3O8C A;  2O8U A;  4D9Q A;  1TPA E;  1DY8 A;  5HIY A;  3SV2 H;  4YLU A;  3RXQ A;  1KXC A;  2AEI H;  3A7V A;  1RS0 A;  1TA2 A;  2UWL A;  1QY6 A;  3LJJ A;  1A3B H;  4AZ2 B;  5EIY A;  4A7I B;  1O2L A;  1XKA C;  5A09 A;  1C5O H;  1FY8 E;  1G30 B;  1O31 A;  1Y59 T;  1UMA H;  3ATW A;  3F0P A;  3T2N A;  4AYV B;  2BVX H;  1A4W H;  2WUC A;  2STB E;  5HYO A;  1C5Q A;  2GDD A;  1YPJ H;  3OEH D;  2LNC A;  1PJP A;  1AB9 B;  1TNG A;  1NC6 A;  2O8W A;  2B7D H;  3A8C A;  5DP9 A;  4TY6 A;  1GJA B;  1QJ6 B;  4PRO A;  1VCP A;  5JB8 S;  3PMJ A;  3RLW H;  1XMN B;  1GBI A;  1YCP H;  3R3G B;  4CRD A;  1AVW A;  1DWE H;  1M9U A;  2NU2 E;  2C8W B;  1O3O A;  2YNA A;  5H4I B;  1J17 T;  2VWL A;  1C2F A;  2QF3 A;  2YNB A;  4XBD A;  3RXL A;  4NSV A;  1AQ7 A;  1EAU A;  3SU5 A;  1C1R A;  3SJO A;  1UTJ A;  5AHG H;  1C5X B;  1TBQ H;  2BXU H;  5F6M A;  3PO1 B;  3S9C A;  4VGC B;  3QZQ A;  1JMO H;  4NIW A;  1Y3W A;  4KTS A;  1EJM A;  1K1P A;  3KYG A;  4CBO A;  2SFA A;  2FYR A;  2WPK S;  4X1S U;  5C1X A;  1TPP A;  1P0S H;  1E37 B;  2AER H;  2FI5 E;  3SW2 B;  3SJI A;  3SU1 A;  1NRN H;  2J98 B;  2ZGH A;  1GI8 B;  1B0E A;  2F9B H;  2HOB A;  2QXG A;  1YYY 1;  1T4U H;  1ANB A;  1HAG E;  4K1E A;  2AS9 A;  3I29 A;  3CNR A;  4MDS A;  1FZZ A;  2J94 A;  6EST A;  4CRG A;  4FVD A;  1GI0 A;  3UNQ A;  4AN7 A;  5TCC A;  3ITI A;  3VXE H;  1Z8J B;  4RN6 A;  1O39 A;  4AFZ A;  2ZCL P;  2RFK C;  1WSS H;  1Y3X A;  5L30 H;  2BDI A;  1GHZ A;  3SV7 A;  5SGA E;  2WPD D;  1IHT H;  3GY7 A;  2Y5H A;  4HZH A;  4KP0 A;  1E1Q D;  3LOX A;  5T3H A;  3KN2 A;  1QTF A;  2PSX A;  1BTW A;  3M37 A;  2F43 B;  1OYQ A;  2BX3 A;  2V3H H;  3MNS A;  2ZU4 A;  3RXT A;  2FYQ A;  1SVP A;  2AGE X;  1OYT H;  2BLW A;  1TAB E;  2HNT C;  1S6F A;  1TPS A;  1BIO A;  3KID U;  3OX7 U;  3OFN D;  1TQ0 B;  4CR9 A;  2J2U A;  3FP6 E;  5AFZ H;  2AH4 X;  3P17 H;  2P3U B;  1B5G H;  4X1Q U;  5C1Y A;  3BG8 A;  1BTZ A;  1W0J D;  1OPH B;  2D8W A;  3H7T A;  5EOK A;  1DX5 M;  1UTO A;  1TNK A;  1OHH D;  2XOK D;  1CHO F;  2B5T B;  1LMW B;  2D2D A;  3Q76 A;  1UW7 A;  1V6D A;  3OU0 A;  1C4U 2;  2QV1 A;  1BA8 B;  1GI4 A;  1H1B A;  4SGA E;  4Q4L A;  2R0L A;  5LPE A;  1C5T A;  1HAO H;  3KQB A;  2G81 E;  2QF4 A;  1V2K T;  3MQK C;  3T26 A;  1UCY K;  1DWC H;  1O3D A;  4WJG 2;  1O3H A;  2BLV A;  2G8T A;  3EA9 A;  4RT0 A;  2HPQ H;  3O8R A;  3BG4 C;  2ZFR H;  2J95 A;  3BTD E;  6LPR A;  1SGF A;  4M7G A;  1LO6 A;  1EKB B;  3RC4 A;  2Z9G A;  1GG6 C;  4ZCN A;  1BUI A;  2ANK H;  5ETX A;  4ABE A;  2BZA A;  1NN6 A;  1OKX A;  2BMG B;  2CF9 H;  4XSK U;  4E06 H;  4FU7 A;  1W0Z U;  1T8L A;  1F0U A;  3FFG A;  1TPO A;  5C67 A;  4UFF H;  2ZFP H;  1GJ5 H;  1LKB A;  1MD8 A;  5CHA C;  3BTG E;  1K0H A;  2ILN A;  5DG6 A;  3URD A;  1O5D H;  1GHX H;  3MFJ A;  1GBA A;  1YP9 A;  2H6M A;  1GMD F;  1QBO A;  3T5F H;  3KNX A;  1LHD H;  1CQQ A;  1T32 A;  1QB9 A;  4GVU A;  3T25 A;  1KTT B;  2GD4 B;  3V0X A;  1CVW H;  2VWN A;  4D7G A;  2GVF A;  3PLB A;  3BIU H;  4MPX A;  3GY2 A;  1OSS A;  4ABG A;  4Y7A A;  2VIO A;  2OC8 A;  4ABI A;  1ESA A;  1GGD C;  1HGT H;  2A5A A;  2EI8 A;  3ZZD A;  4K69 A;  4ZHL U;  4M9F A;  3VGC C;  1VCW A;  3MO6 A;  1Z7K A;  1ABI H;  2BQ6 B;  2ALV A;  1QBN A;  2FOA A;  1GBB A;  3LC3 A;  1HV7 A;  5EQR A;  1WXR A;  3QGN B;  3TIU A;  1UVU H;  5C17 A;  3E90 B;  1GHB F;  2QXJ A;  3PMA B;  1C1T A;  2KFW A;  5EOD A;  1PPF E;  3QZR A;  3RXC A;  4A5T S;  1XXF A;  1Z6J H;  1KTS B;  1W14 U;  3VB4 A;  1QL7 A;  3ODD A;  2UUJ B;  2PKS B;  2GJG A;  2XBX A;  2VIP A;  4ZKO U;  1UK2 A;  3AAV A;  3QGJ A;  1VJA U;  3TIT A;  1Y8T A;  2EI6 A;  2XND D;  1IQJ A;  1OXG A;  3FVF B;  2BDC A;  3LU9 B;  1Q2W A;  4Y0Z E;  3VB6 A;  4AOR A;  1OWJ A;  1GG6 B;  2A4Q A;  4Y8Z A;  5FL7 D;  3G01 A;  1NFW A;  3SV8 A;  7GCH G;  2PUQ H;  4I31 A;  1P2J A;  1GDQ A;  1HXE H;  3FZD A;  1O2H A;  1O2K A;  4FUD A;  5EPY A;  5E2O A;  4UEH H;  4IGD A;  2W6J D;  1NZQ H;  4NZQ A;  1BTH H;  2QN5 T;  1TBR H;  2A31 A;  1O2U A;  1FIZ A;  1PQ8 A;  2UWP A;  1HRT H;  2VWM A;  1LCY A;  3W95 A;  3LON A;  1EQ9 A;  4X6O A;  1O2Q A;  2ZZU H;  4Y11 E;  2KCY A;  5DJ7 A;  4FUG A;  1T7C A;  5E0H A;  1DUE A;  1QR3 E;  4XE4 A;  3RMO H;  1XUF A;  1AIX H;  2XW9 A;  3RXF A;  3TNS A;  1GGD B;  2FOH A;  4D9R A;  1GJ8 B;  2OLG A;  1OP8 A;  4YTA A;  2BHG A;  1W12 U;  1JRS A;  1O2W A;  3EQ0 H;  3GCT G;  1ZML A;  3W94 A;  1UTL M;  2DUC A;  3M5L A;  3V3M A;  1ZGV A;  3PLP A;  4GHQ A;  2FEQ H;  3A88 A;  3TH2 H;  5DSF A;  2P95 A;  5EG4 A;  4TWW A;  4OGY A;  2FTL E;  3Q00 A;  1GBD A;  6CHA C;  2JET C;  1C2E A;  1C2M A;  1DLK B;  1MKW K;  4NCY A;  1BDA A;  1A1R A;  3OE7 D;  3E3T A;  2FX6 A;  1LHC H;  1THS H;  1Z8G A;  1KDQ A;  4ABJ A;  4B6E A;  2H5D A;  2LP6 A;  5EQQ A;  3A8D A;  1ARC A;  4MQA A;  4AYY B;  1YWU A;  1D3Q B;  3MU5 A;  3SJ9 A;  4B6F A;  5TCA A;  1CGH A;  1SLU B;  4P02 A;  3S69 A;  1KXB A;  1AZZ A;  2AIQ A;  4RI0 A;  2PW8 H;  1ELB A;  5DP5 A;  3STI A;  1O33 A;  3DT0 H;  3TK5 A;  4GAW A;  4YM9 A;  2ZEB A;  4FUF A;  2GV7 A;  1KXD A;  2C4F H;  3Q3K A;  1O2M A;  1FX0 B;  5T6D A;  1MQ6 A;  3OSY A;  1IOE A;  2F9P A;  1O34 A;  3A82 A;  1GJ6 A;  3PRB A;  1HAH H;  3RXP A;  1DSU A;  1BML A;  1AU8 A;  2BXT H;  4CRA A;  1H4W A;  3M7Q A;  1TMT H;  3LGY A;  1CHG A;  1TA6 A;  2P8O B;  1AFE H;  2ZHQ H;  1V2L T;  3ZZ7 A;  1Q3X A;  8GCH F;  5LH8 A;  3DSG A;  3TGK E;  1LVY A;  3PRD A;  4YT7 H;  1L1N A;  4WVP E;  4Q7Y A;  2WPM S;  1BTP A;  4MPV A;  3NZI A;  2BOK A;  1QJ7 B;  4CBN A;  1UK4 A;  2P16 A;  2ZPQ A;  4I86 A;  1SSX A;  3DFJ A;  2A4R A;  1CSO E;  1GI3 A;  2ZC9 H;  4F49 A;  1BMM H;  1MTN C;  4NIV A;  2ZHE H;  3HK6 B;  1MKX K;  4A1T A;  3GS9 A;  1HAZ B;  1SGF G;  2FOG A;  2AGI X;  1H8I H;  1SGC A;  1S0R A;  2ODQ A;  4WH6 A;  4DT4 A;  9EST A;  2F91 A;  7LPR A;  3CP7 A;  3SQE E;  4Y10 E;  1BHX F;  1ZTK A;  3ZZA A;  1CGI E;  1DST A;  1P8V C;  1GBE A;  3PB1 E;  4K1T A;  3EGK H;  3C1K A;  3ZVC A;  4H42 U;  4GUX A;  2XNI A;  2VGC C;  1SMF E;  2Z9J A;  3GYM A;  1P57 B;  4K1S A;  1YPM H;  5T6F A;  3RDZ A;  3QLP H;  4E7R G;  5HM9 A;  3ZZ6 A;  3A87 A;  1V2O T;  1H9L B;  1ELA A;  1TGS Z;  1VIT H;  1XM1 A;  1MZA A;  1QB1 A;  2VVU A;  1TRN A;  2QYI A;  4ISN A;  1C2G A;  2FOE A;  1QRW A;  4WF8 A;  4MNW A;  1EB2 A;  1FY5 A;  3LC5 A;  1C1V H;  1GBT A;  3GYL B;  3RMM H;  1MTU A;  1O3B A;  4FUH A;  2BDY A;  1GI1 A;  1P05 A;  1K28 D;  4JMY A;  2W7U A;  1G37 A;  4U30 A;  2BY5 X;  1MBQ A;  1NRO H;  5JYI A;  2H9T H;  1HBT H;  3RXE A;  3L3T A;  1VGC B;  1T31 A;  2Z6B D;  2NWN A;  1EZQ A;  1AND A;  1IQE A;  1CA0 B;  7GCH F;  5LPR A;  3BTH E;  1BOQ A;  2BD3 A;  2CHA B;  3E1X B;  2OIN A;  4K8B A;  5T1V A;  1TMB H;  2GGV B;  3CEN A;  1XVO A;  3MNB A;  5FXL A;  2ZFT A;  3ATI A;  1DT2 A;  1S83 A;  2A5I A;  2UUK B;  2PGQ B;  4J2Y B;  4AG2 A;  4UD9 H;  4X2W A;  1A5H A;  3N7E A;  1KY9 A;  1YM0 A;  2EC9 H;  4YT6 H;  3BTM E;  2WPJ S;  4R0I A;  5GPI B;  4XFQ A;  4FUB A;  2ZNK H;  2GZ8 A;  4WXV A;  2VIW A;  1CT0 E;  1O3J A;  1O30 A;  1T8M A;  1B0F A;  2Y6T A;  3GCT F;  4E05 H;  3A83 A;  4YLQ H;  1FUJ A;  1BMF D;  1Z6E A;  2PTC E;  2P94 A;  2ZDK A;  1TX6 A;  3MU1 A;  1IQF A;  1P3E A;  4AFS A;  4DIH H;  2A2X H;  5DP3 A;  1SGD E;  5CDF E;  3ZVD A;  1K2I 1;  5FCR A;  1YPH C;  1BTY A;  1QNJ A;  2RA0 A;  1W7X H;  3KQE A;  4I8G A;  1GMC F;  2A7J A;  1PYT D;  1YBW A;  3ENS B;  3ZVG A;  4ABB A;  4AX9 H;  1UJ1 A;  4U01 A;  1SGN E;  1MZD A;  4J1Y A;  1LKA A;  2CN0 H;  5DO4 H;  1LHF H;  1K1O A;  2GCT B;  3SUE A;  1A5I A;  3T27 A;  1TX7 A;  1ZTJ A;  1UTN A;  2H5C A;  2ZFQ H;  1FXY A;  1AB9 C; 
#chains in the Genus database with same CATH homology
 2KM0 A;  3KNX A;  3DCL A;  2LEL A;  2W6I D;  5GJ4 B;  4B71 A;  3ZIA D;  3SV9 A;  2YMS B;  2FP7 B;  2P59 A;  3FKS D;  3O8D A;  4KTC A;  2OC0 A;  3F0O A;  3M5L A;  1NS3 A;  3RC6 A;  2GVF A;  2OBO A;  3OEE D;  2OC1 A;  2OK5 A;  2JJ1 D;  1DXW A;  2HLD D;  3H09 A;  5DSF A;  4WF8 A;  4A1X A;  3M5N A;  2K1Q A;  2QF5 A;  2OC8 A;  3VG8 A;  3WW7 A;  4NWK A;  4M9F A;  3SV7 A;  3F2H A;  1EFR D;  1JXP A;  2WPD D;  3PV2 A;  4JMY A;  2KR7 A;  5FPT A;  1A1R A;  1H8H D;  3OE7 D;  3SYJ A;  4B75 A;  1E1Q D;  3M5M A;  2M2A A;  3LOX A;  2F4L A;  3KN2 A;  3UB0 A;  4A1V A;  1E1R D;  4TSF D;  3WWF A;  2F43 B;  4B6E A;  3SV6 A;  3OAA D;  5EQQ A;  2K0Q A;  4TT3 D;  2KCA A;  1E79 D;  3KF2 A;  3LKW A;  4NWL A;  4R8T B;  5EQR A;  2CK3 D;  1NBM E;  2FM2 A;  3SUD A;  4ASU D;  2KZ4 A;  2IJD 1;  5ESB A;  4B6F A;  3SU0 A;  5C0U A;  1WXR A;  3O8C A;  5C0T A;  1DY8 A;  4RI0 A;  2A4G A;  2OC7 A;  2OIN A;  5C17 A;  4FET A;  3SU6 A;  3E90 B;  5DN6 D;  4K8B A;  2WHX A;  5T1V A;  2GGV B;  3OFN D;  3F2G A;  3L6P A;  2JIZ D;  2KFW A;  4XD7 D;  1FX0 B;  2FOM B;  2WV9 A;  1SKY E;  3PRB A;  2OBQ A;  3KEE A;  2KCP A;  2YMS C;  1W0J D;  1KMH B;  3P8N A;  2F9V A;  1S6L A;  3N7E A;  3F0P A;  3P8O A;  1OHH D;  2XOK D;  5IDK A;  1H8E D;  3F2F A;  3NRL A;  2F9U A;  5GPI B;  3OEH D;  3N7D A;  5FPS A;  3SU4 A;  2IJO B;  2XND D;  4B73 A;  2XCN A;  2QV1 A;  2VBC A;  1W3C A;  3F3B A;  3SU2 A;  4I32 A;  2L6O A;  3RC5 A;  3FN8 A;  2K8I A;  2O8M A;  3M5O A;  4Q4L A;  3U1J B;  3SUF A;  1RTL A;  2A4Q A;  3WWB A;  3PRD A;  5B6L A;  1MAB B;  1RGQ A;  2QF4 A;  2XCF A;  5FL7 D;  2V7Q D;  1N1L A;  5H4I B;  5FPY A;  3SV8 A;  5EQS A;  2J5U A;  3FO8 D;  4I31 A;  1BMF D;  3SUG A;  3OYP A;  4WH8 A;  2JDI D;  2WSS D;  5EPY A;  4YXW D;  4TYD A;  5IK2 D;  2AHM E;  3O8R A;  3SU3 A;  2W6J D;  2A4R A;  1CU1 A;  3OTP A;  5F53 A;  1BT7 A;  2WZQ A;  1W0K D;  4F55 A;  5CDF E;  2QE7 D;  3DSP A;  3EYD A;  3PV5 A;  3SU5 A;  3RC4 A;  4B74 A;  3O8B A;  1DXP A;  3FOA A;  5CHB A;  4A92 A;  3LON A;  4ZCN A;  4I33 A;  4A1T A;  4Q63 A;  5ETX A;  3GS9 A;  2YOL A;  4DT4 A;  3U1I B;  1COW D;  4WH6 A;  2KCO A;  4U01 A;  2KCY A;  1NBM D;  5GND A;  4B76 A;  3DSO A;  3W1E A;  5EPN A;  1DY9 A;  3SUE A;  2YMS D;  2JJ2 D;  3N99 A;  4OM9 A;  2XNI A;  3AK5 A;  3SU1 A;  5HKK D;  3SZE A;  4Z1M D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...