2O8UA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q/s195a) in complex with inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
245
structure length
238
Chain Sequence
IIGGEFTTIENQPWFAAIYRRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase plasminogen activator
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 53
structure length 238
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8uA01
4DW2U 1PPFE 1O36A 4MPXA 4K1TA 3RXAA 3KL6A 2VJ1A 2W7SA 1KIGH 1GJCB 3E91A 1P8VC 1T4VH 2GD4B 4X2XA 3RP2A 3M3VA 1HGTH 3UR6A 4GLYA 4CH2B 1M9UA 1FAKH 1MBMA 2WV5A 5FHTA 3RXCA 1NS3A 3RM2H 1VR1H 3MOCA 2QCYA 4JMYA 1EJNA 6CHAC 1HFDA 4WMFA 2QAAA 4JK6A 3FP7E 1C2DA 5AFYH 2ZCKP 1A3EH 2OQUA 2BY6X 1OWKA 1HNEE 4QT8C 4LZ4B 1C1QA 1CHGA 4Y6DA 1WU1A 4MVNA 4UD9H 1GBIA 3MNXA 3LGVA 1VGCC 2B8OH 1GI3A 5I46H 1NFXA 2UUFB 2A31A 1VCQA 2NU2E 4NA7A 1O3AA 4ZKOU 3URCA 1AGJA 4AYVB 1FONA 3IITA 4B73A 2GCTB 4JZIA 1IQIA 1LCYA 3SBKA 3PMJA 3E1XB 3K9XB 1J9CH 2BMGB 1SLVB 1TBQH 1G32B 4WVPE 1WV7H 3MO9A 1KXDA 2FS8A 1ELCA 3K6YA 1D6RA 4O3TA 1TGCA 3BTDE 4K3JA 4NWKA 3SV8A 3TH3H 1L0ZA 2P3FH 1TX7A 5GXPA 4K2YA 1LPKB 1TQ7B 1YCPM 2BX3A 2Y5HA 3A89A 9LPRA 1EB2A 1HAIH 4O9VA 3ATWA 1MZAA 2F9VA 5TCCA 1UHBB 1BA8B 3GYLB 1Y5UT 3SJ8A 1S5SA 4K5ZA 1OWHA 1YLDA 3P8FA 1BMMH 1ZHPA 2PKSB 4Q7XA 1QJ7B 1BZXE 3GCNA 2R3UA 1TX8A 1AZZA 3T5FH 2CV3A 1GBCA 2PWXA 2QF0A 1O3CA 1NRNH 3KF2A 4OS4A 5EODA 4ESTE 4IN2A 1KYNA 7GCHF 3ZVFA 4H42U 1TIOA 3ZZ8A 1F0TA 2QV1A 5A2MH 5EQSA 4CRDA 3PO1B 3TIUA 1NT1A 1Z1JA 2OP9A 4YO9A 2VVVA 1O2WA 2F3CE 3V13A 4BTTB 4UFEH 3ZZ4A 3T29A 3SNDA 2BDHA 1TE0A 1Y3UA 2GDDA 1PQ7A 4FU8A 5HXFA 4I8KA 1ZPCA 4RKJB 4JZDH 2BQ6B 2HOBA 4CRFA 2VWNA 2XBVA 3STJA 2ZCHP 2EI8A 3QGJA 1TMTH 3UFAA 4ZKNU 4VGCC 1OWIA 1GJ5H 3NK8A 1TNHA 1GDQA 3HK3B 3TJNA 1DOJA 4Y79A 2RA0A 4HTCH 1D9IA 2ZZUH 3VXFH 3GCHC 4ISLA 2C8WB 1GI5A 3RU4E 2GV7A 3PROA 1BRBE 3HPTB 4Q7YA 5JBAS 1GMCF 2SGDE 4HZHA 4TPYA 1ZPZA 4MPUA 3SI4H 3QN7A 1ZHMA 3R0FA 1ETTH 3MH6A 5TCAA 2M5TA 1W2KH 1TA2A 1DY8A 3SOSA 4LZ1H 4BTIB 1F0RA 2F9UA 1LMWB 5GJ4B 3FFGA 4BANB 1Y3YA 3ATMA 1T32A 2UUYA 5G4BA 5J4QA 2BM2A 1E0FD 1QHRB 3QZQA 1QBOA 1T8MA 2BLVA 1SVPA 3S0NA 1DE7H 1A0JA 5FPSA 3LGWA 2FDAA 1HAHH 3EA7A 4UFDH 1AHTH 3UWJH 2WUBA 3MU1A 1GI6A 1ZSKA 2BD9A 3VB3A 1UJ1A 5EXNA 1ACBE 4XSKU 3RXHA 3RUOA 1UK4A 3GDUA 3A7YA 5T6FA 4JYUH 1S0QA 3PTNA 1W0ZU 1KXBA 1HB0B 1OS8A 1UTOA 3O8DA 1F5KU 1T8LA 4KTUA 4SGAE 1G36A 1LTOA 3F1SB 2JH0D 1DPOA 1LVYA 3U1IB 1MUEB 1LVBA 2ZDMA 5DP3A 1AE5A 3NZIA 3MTYA 4YM9A 4ISHH 4FUDA 3RXQA 1DT2A 4JZFH 3OU0A 1MCTA 1V2VT 1L4DA 1TPAE 4Z6AH 5B6OA 2AMQA 1O2QA 3VGCC 1N8OB 1FAXA 5ETXA 1EPTB 2AS9A 1ANCA 1O2IA 3ZZDA 2VIPA 2QC2A 3Q00A 3RU4T 3T2NA 5BRRE 2IPHA 2OD3B 1P10A 2ZGHA 1ZYOA 2H1UA 2WYJA 5DP7A 1KLIH 2EEKA 1TRNA 3S69A 3KGPA 1TNKA 3MYWA 3TU7H 4B75A 1EQ9A 2KAIA 1SR5C 2J92A 1THRH 4M7GA 1FNIA 1O34A 1O5AB 2VIQA 1F5LA 2Z6BD 1UHBA 4FVDA 1EUFA 1L2EA 1UTNA 5HGGA 1BTHH 2FWWA 1BRCE 3E0NB 1QTFA 1VZQH 1BUIA 5C1XA 7LPRA 1HAVA 2TBSA 3HKIB 2Q6GA 1IQFA 1ZMLA 3FVFB 1MAYA 1W10U 2Q1JA 2IJOB 4GVUA 3M7TA 1BMNH 1CGJE 1AY6H 2GDEH 1KSNA 2GGVB 3UNQA 1Q2WA 4X1SU 4ZAEA 1C1NA 3M5LA 1C5TA 2WINI 4MPVA 4A1TA 1TNJA 2ZO3H 1GWAA 3RXEA 2H5DA 1TABE 1FI8A 2FX4A 5IYTA 1F0SA 2A5IA 4FU9A 3EA8A 3H5CB 4GHQA 2FI3E 1IAUA 2O8WA 1ANBA 1S6FA 3Q3KA 3BTWE 3GY4A 2G8TA 3ZZBA 1C1OA 3UPEA 1TLDA 3M7UA 1WTGH 2FM2A 4WH6A 1B7XB 1O31A 3UOPA 4DGJA 1EX3A 1K1PA 3RC6A 2A5KA 2V35A 3KNXA 2J2UA 1PYTD 3E0PB 3QTOH 4DOQA 1MTSA 1YBWA 4FVBA 1AVWA 1GCDA 2G81E 2SGPE 1HAXB 3ZZAA 1CSOE 1GDNA 1JMOH 2B9LA 5DP5A 3S7KB 2XNIA 2PW8H 2ZTXA 2JH5D 1A5HA 2ALVA 3C27B 3SW2B 2ZEBA 5FPTA 1ESAA 2XBYA 1Y5AT 4FUJA 2FYRA 2J9NA 3DA9B 5FAHA 1P06A 5E0HA 4X0WU 3RXOA 1EXFA 3RMMH 1NM6A 2FO9A 3EA9A 1E34B 1O3EA 1EOLA 5E0JA 1DWBH 2CGAA 3ATIA 5JBBS 3SHCH 1GBHA 2BD5A 1DSTA 2FOAA 2Y5FA 3N7OA 1W12U 1AMHA 2AIQA 1DX5M 3OTJE 4RN6A 4R0IA 4X1QU 1WQSA 1P2IA 1CQQA 2CJIA 3CS7A 3FZDA 2BDCA 2H2ZA 1Y5BT 2CF8H 3IWMA 1ZSJA 1C5XB 2O8TA 4FUCA 2VVCA 1GI4A 1TRMA 3TLOA 4IN1A 3TK6A 4ASHA 1GBEA 3LPRA 2XC4A 1ID5H 2Y7XA 1FDPA 1P2NA 2ANWA 2FX6A 2FP7B 2VU8E 4D9QA 3ELAH 1W8BH 1G9IE 2W7UA 3HK6B 2FODA 3G01A 4NFFA 2XC0A 3U8RH 1L1JA 2XCFA 1GVLA 2BOHB 1NY22 1EPTA 2AMDA 3MH7A 3R3GB 3D49H 1YPLH 2FESH 1FLEE 1AIXH 1MD8A 3F6UH 4ZXYH 1ZZZA 4KTSA 2BY7X 1HJ9A 2BX4A 3BIUH 1DWEH 4MNXA 1E37B 3V0XA 2AEIH 1KY9A 2ZGXH 3RC4A 3STIA 2NU4E 1BBRE 1AFQC 1EASA 1OYQA 1SOZA 1RRKA 2CF9H 1GBKA 1C5WB 3KCGH 4AB8A 2B0FA 3ZVBA 1THSH 2FPZA 2JETB 1P11E 5FX6A 1VITH 1O2XA 1V2MT 5EG4A 4DCDA 1O2VA 2OUAA 2RG3A 3BTGE 1N6XA 1XM1A 1SGNE 4AYYB 1OYTH 3SGAE 1SGRE 1T4UH 2AGIX 2THFB 5DG6A 1TNLA 2HLCA 3A7TA 1S85A 1CE5A 3LT3A 3LONA 5BPEA 3KQDA 1GVKB 1P2MA 1LQDB 2BXUH 4XOJA 1B0EA 3UR9A 3EQ0H 2EI7A 2CHAC 3S9BA 3S7HB 6CHAB 2O8MA 3LKWA 1T8OA 1ZTKA 5DO4H 1ANDA 1ARCA 1QIXB 4NFEA 4YT6H 1GL0E 2GKVE 4Y8ZA 7GCHG 1INCA 1NPMA 3OY6U 4ZROA 4BNRA 4BTUB 1FY3A 1S81A 1VGCB 5LPEA 1GJ4H 1QA7A 2ESTE 1GI7B 4ISNA 1QGFA 4YLQH 5DP8A 1GJDB 1NN6A 1PQ8A 3TJOA 1ZGIA 2BD3A 5C20A 4NSYA 1IHTH 1GHAF 2YNBA 1P2JA 2FS9A 4Y76A 1NROH 4K69A 1EJMA 3RXJA 3RXSA 3ZZ5A 1Z6EA 4IGDA 1EOJA 1GGDC 1OKXA 3SGQE 2PTCE 3DUXH 2P3TB 1LPGB 1BMLA 3LGIA 1C9PA 1DDJA 3SORA 1GJ8B 4AG1A 1QRWA 2VIOA 4JCNA 3SNBA 2QY0B 2PUQH 3M3TA 1TPPA 2PGBB 1SGCA 2G5NA 4K60A 1ZPBA 1GL1A 4DY7B 1C1UH 3BTFE 1PPEE 4UE7H 2XYAA 3UREA 2R3YA 1O5FH 1O3BA 2TGTA 2AMPA 2P16A 1C5RA 1F2SE 1GBDA 2FTLE 3VB6A 4ISIH 1BTWA 1LHEH 1PPBH 1P3CA 4NIXA 9ESTA 3NUMA 1MTNC 3U8TH 5DGJA 1RJXB 1ESTA 3I78A 4DJZB 4XE4A 4X8VH 1AO5A 3I29A 4XBDA 5L6NH 1D3DB 1LO6A 1T7CA 1ZMJA 4THNH 3BTHE 2AFQB 1O3FA 5CHAC 5L2ZH 4A1XA 1PPCE 4A7IB 5HM9A 3JZ1B 1GJBB 5EPYA 3KQCA 3QK1A 2ZDLA 1QBNA 2ODYB 1Q31A 2PFEA 4AORA 1GCTC 1J16A 2BVSH 1RXPA 1QCPA 1S84A 1NU9A 1G2MA 2ZP0H 1P02A 2R2WU 4GAWA 4ABAA 4CRGA 4CBNA 2XRCA 1P2OA 1QJ6B 2A2XH 4X1NU 2HNTC 3ZZCA 2NWNA 1L1GA 1XX9A 2STBE 1JRSA 4F4OC 4VGCB 1V2QT 1ZTJA 4FU7A 1SHHB 1EAXA 1BT7A 2J38A 5EGMA 3QX5H 3NKKA 1O2MA 2H6MA 2GCHF 4CREA 1GI0A 1A4WH 1BTXA 3GCHB 4K1SA 1LHCH 1QB1A 1WOFA 2ODPA 2PV9B 1XMNB 3GDSA 1YCPH 3KN2A 4ZUHA 3MH5A 5AHGH 3IG6B 2FI5E 1J14A 2R9PA 1AVXA 2BYAX 3NXPA 2ZKSA 4X6PA 3M37A 2HALA 1GBTA 5C5NA 1TBRH 4H4FA 2Z9IA 4HGCA 1C5ZB 4KELA 3DFJA 2ZIQH 1MKXH 2QXGA 5DK1A 1VJ9U 1O2PA 4AFZA 1FPHH 1RS0A 3M61U 3RXBA 1E38B 2G00A 1ZOMA 3WY8A 3TGKE 3BV9B 1IQKA 5JB9S 1TGSZ 5EXMA 1PPGE 1HXFH 2A2QH 4SGBE 3NPSA 3QZRA 4ABGA 2UWPA 1HRTH 2ZPRA 3SV6A 1MQ6A 2ZNKH 4OS2A 4Q2KA 4YT7H 5FBEA 4JZEH 1A7SA 1LHFH 4BOHA 3SUEA 1O2UA 3GCTG 1BTUA 1C5VA 1NC6A 2P59A 5FCKA 4X8TH 4MNWA 1LKAA 4B76A 1ARBA 4X6OA 2DE9A 3FANA 2F9OA 1RTFB 2F83A 2FYQA 3MNCA 1WUNH 2ZHEH 1OP2A 4JK5A 1HJ8A 2C8YB 4IC6A 3MWIU 1Z6JH 1O2RA 4IW4E 3FP8E 1WSSH 1XUKA 2B7DH 3KIDU 3FZZA 4YLUA 1HIAB 1H8DH 4D8NA 4MTBA 1HV7A 1YPMH 3RXDA 2TIOA 4DIIH 1C1PA 1G2LA 4FUFA 3RXFA 2CMYA 2VGCC 3TGIE 3RXVA 2A1DB 2GVFA 2H9EH 2ZC9H 1Y59T 4NZQA 1ELAA 5EOKA 5JYIA 1RTKA 1P3EA 3VGCB 1IQGA 2BDGA 1WAYB 3RDZA 1FIWA 1MTVA 2W3IA 4INKA 3UNSA 3E6PH 4TYDA 2P3UB 1AI8H 1DWDH 2QA9E 4X6NA 1UCYE 4A5TS 3SNAA 3V12A 1RD3B 1QQ4A 1VCWA 2Z9GA 2PSYA 1ZRKA 2K1QA 1Z7KA 2ZHWH 2LNCA 1XUHA 2ZFFH 2EA3A 4Y8YA 3SGBE 2V6NA 3OX7U 3SUGA 4K8BA 4TWYA 1HLTH 2C8XB 4ABDA 3DD2H 3TH4H 3BTKE 3GOVB 3T25A 1KTTB 5IDKA 2WPJS 1MD7A 4AZ2B 5JB8S 3O8BA 3BTEE 2AIPA 1K22H 1GJAB 1ZMNA 1A61H 3K2UA 1GI1A 3SUDA 4ZXXH 1QURH 2XXLA 5EW1H 3A87A 3RM0H 5FXLA 1BB0B 2AERH 4OGXA 1V2UT 2Y6TA 3U69H 1C5MD 3SJIA 1C2LA 1ELEE 1BIOA 4X6MA 2SNWA 5CMXH 4YZUA 3U9AH 1UTJA 1OWEA 3ZVAA 4I8GA 3RXGA 5A8ZA 1CA0C 1K28D 2SGQE 1V2RT 2FI4E 2WV4A 3TK9A 3S9CA 3W95A 1EAIA 3LH1A 3P6ZB 2P8OC 2BOKA 1TGNA 2OQ5A 1SQAA 1DY9A 3TNSA 5A09A 5TJXA 1K2I1 1Y3VA 1BTPA 1RGQA 2NU1E 2FOMB 3QWCH 1C2MA 4GSOA 1V2OT 2VWMA 2OCVB 2Y7ZA 3SU4A 1K1IA 1CU1A 4MG3A 1LDTT 1H9IE 4ABBA 2UUKB 5FX5A 1V2KT 1YPHC 1Z8JB 4JYVH 1MCVA 2ZWLH 2ZHDA 1C5YB 1JXPA 2Z9JA 3LGUA 1FY5A 4Y8XA 1MBQA 2CXVA 2ZQ2A 3EYDA 1H4WA 1THPB 4Y71A 1GJ6A 3VB7A 2ZFTA 1W3CA 2ZGJA 1HBTH 1NZQH 3TH2H 1O5EH 3VB4A 3D23A 4B2AA 1Y8TA 1MH0A 1O2OA 2ULLA 4Y0YE 3SV2H 1O5CB 1IQNA 1TGBA 3F9GA 1C2EA 1ZJDA 5FBIA 2P93A 2ASUB 3I77A 1Z8IB 4BXWA 4WF8A 4WWYA 1FN6A 1NRQH 1W7XH 3D65E 2ZU4A 4JZ1A 4INHA 1O3IA 1G3BA 3GY6A 1FN8A 1O33A 3QGNB 3ZYEA 4I8LA 1C1SA 3GCTF 1K1MA 1CGIE 4UDWH 1JIRA 1AFEH 1A5IA 2WPHS 1H1BA 1HIAA 2C4FH 3GDVA 1QL7A 1MKWH 2QN5T 3UY9A 1BBRK 1DSUA 4TY6A 1LVOA 1GI8B 4I32A 1EAWA 4LOYH 1KDQB 2C93B 2RA3A 1QQUA 1U6QA 2BTCE 3F9EA 1VCPA 2ANMH 4FUGA 1BHXB 1O3HA 1KLJH 1HAPH 4UFGH 1O3PB 2ZDAH 2AYWA 4GCHF 3T62A 1BOQA 1GHAG 1B5GH 5HM2A 2ZU1A 2LPRA 1FMGA 1GHVH 2XWBI 1UTMA 2QYIA 1K1JA 3SNCA 1KXCA 1O38A 4ISOA 2W3KA 3E8LA 3OY5U 1T31A 2OXSA 3GICB 1UTQA 4YESB 2FLRH 2W26A 1P57B 1AFQB 3A8BA 1YF4A 4FUEA 8GCHG 1P04A 5LPRA 4I8JA 2DE8A 1X7AC 2VIVA 2BLQA 1K21H 4JYTA 2BVXH 4AFUA 2OLGA 3PWCA 1C5QA 1F7ZA 1FXYA 1S83A 3A7WA 5EXLA 2BD8A 5C2ZA 2P95A 3M5NA 3TJVA 1GMDG 1CA8B 4Y0ZE 1YC0A 1AD8H 1GVZA 4IMZA 1MMJN 2GP9B 5DP9A 1DVAH 2ZU3A 3SU6A 3QLPH 3U8OH 3UTUH 2CHAB 1YGCH 2HPPH 2XW9A 2XC5A 1O2KA 3ODDA 3SI3H 4H6TA 1AE8H 1P0SH 2Z3CA 3MNBA 1V6DA 2Z9KA 2FEQH 1DWCH 3BTME 4NIVA 4IMQA 1DS2E 1GBMA 2O8UA 1IQMA 1ETSH 4Y10E 2B5TB 3P17H 3VEQB 4A6LA 1N6YA 1SQOA 1XXFA 2OC8A 1EPTC 4Y7AA 4DT7B 4Q80A 2YOLA 1IOEA 3URDA 2Z9LA 4IS5A 2OC7A 1FUJA 3TGJE 3UWIA 4Y11E 1GGDB 1HCGA 3E16B 2J95A 3BG4C 3TNTA 1FV9A 1A3BH 2VH6A 3KHVA 1YYY1 4E7RG 3PMAB 2PKAB 4X2WA 2WYGA 1W14U 1C2KA 2GCHG 3VXEH 1CT0E 2TGDA 1LKBA 2A0QB 2FOBA 4X2YA 1O2ZA 2ILNA 2ZF0H 4UEHH 1PQAA 3EAJA 1HXEH 1OWJA 1TOMH 3M3SA 4AN7A 4HI3A 5ESBA 4DG4A 4WJG2 3LOXA 1MTNB 3MH4A 6LPRA 3UUZA 1ETRH 1C2IA 1YPJH 1CGHA 3HGNA 1KXAA 1SC8U 2TGPZ 3LDXH 1O5BB 1GG6C 3FP6E 1ELFA 2EI6A 2P94A 5CHAB 1JOUB 2ODQA 2UUJB 4ZH8A 4BAQB 4BAMB 1TPSA 2BHGA 1QL8A 2HRVA 1GCTB 1BDAA 1SGIB 3RLYH 1TNIA 1SGFA 1F5RA 1HJAC 4WH8A 3V3MA 1C5NH 1O32A 1IQEA 3Q77A 1C2GA 3F68H 1ELDE 1KDQA 1QA0A 5T3HA 1WTHD 2V0BA 2O9QA 3MHWU 3SQHE 5F03A 1NFUA 3A7VA 2GX4A 1NESE 4O3UA 4X2VA 3VPKA 1MTWA 3GY5A 2XBXA 1CBWC 3A8DA 1O3KA 1PJPA 2FOHA 2VWOA 3SO3A 3M5OA 1WQVH 1C4U2 1NRRH 5DJ7A 1DLKB 4D7FA 4ZHLU 3SU0A 1XUFA 3A84A 3PLKA 3RXTA 1GBAA 3LU9B 4CR5A 2Q6FA 3ESTA 1AZ8A 4ZKRU 3P70B 4BXSA 3GCOA 5A8YA 5GCHG 1GHBF 1GBFA 1AWHB 1KTSB 3ZV8A 1QB9A 3Q3YA 1HDTH 1O2HA 2VVUA 4CHAC 3A8CA 1QB6A 5HMAA 3A86A 2FMJA 1SFIA 1BCUH 1AQ7A 3BF6H 5ESTE 1VITG 3SZNA 4NSVA 2BDBA 1V2JT 1O3DA 1S6HA 2WPMS 4TPIZ 1C2HA 2GMTC 3PTBA 1OPHB 1GMDF 1GMHG 3T27A 1A5GH 1TGTA 5C67A 1UK2A 3CP7A 3RMLH 4XBBA 3TJUA 1RIWC 2FOFA 1O2LA 2AGGX 4IBLH 3E90B 4ABHA 2SGAA 1V2ST 1EB1H 2ZQ1A 2ZDVH 4X8UH 1XUIA 4AFSA 3A80A 2FLBH 2GT8A 1SGFG 1UCYK 2TRMA 5A8XA 3LIWA 1C2JA 1TFXA 1A2CH 1O3OA 2BB4A 1CVWH 3QO6A 2FXRA 2TPIZ 1Z71A 3MU4A 3P8NA 1YPKH 1QFKH 1BRUP 3SJKA 2VGCB 4ABJA 3NWUA 2RCEA 1DUAA 1BJUA 4J1YA 2RDLA 3UNRA 2PKAA 3MNSA 1JRTA 1TOCB 1EP5A 1O3NA 4DIHH 4X1RU 3ZZ3A 3BEIB 1P9UA 1EZQA 2FOEA 4MQAA 6GCHF 2VWLA 1SGTA 1PPZA 4WXVA 1LHGH 1YPGH 2JETC 1CHOF 2GZ8A 3UOUA 5EQQA 1A0HB 1MTUA 4MPWA 5JPMH 1Z8RA 1SGYE 2OTVA 2ZFSA 4WXIA 4UONA 1EZSC 1PQ5A 4AGKA 1LVMA 2YNAA 4NCYA 3UQVA 1ZSLA 1SGQE 3LC5A 3JZ2B 1GDUA 1QBVH 4INLA 3O8RA 3AAUA 3AW1A 2BD2A 2A4RA 1FIZA 1AWFH 1MAXA 1QNJA 1AN1E 4U01A 1AB9C 2ANKH 4R8TB 1O39A 4ABFA 3BEUA 1W7GH 4AG2A 1V2TT 1P03A 1SPJA 2G55A 3D62A 1P05A 4KTCA 1JWTA 5C3NA 2F9BH 3GY3A 4E7NA 4YTAA 3MU5A 3MU0A 1D3TB 1O30A 1ZTLA 1A1RA 4A1VA 4ZMAH 2F91A 5E8EH 1C1TA 1CA0B 1SFQB 4GPGA 3A83A 8GCHF 2FIRH 2EC9H 1YLCA 1YCPK 1ANEA 2P8OB 2PUXB 5FCRA 1Q3XA 1ELVA 1NTPA 1XKAC 4CH8B 4MDSA 1K1OA 1WCZA 3PV4A 2WUCA 4I7YH 3LC3A 3M36A 4FUIA 3PYHA 2ZFRH 2XWAA 1SLXB 2BQ7B 1NFYA 1MKXK 1Y3XA 2KAIB 3QUMP 4ABEA 5SGAE 1UTKA 3Q3XA 3ZVEA 4GCHG 4RSPA 2D26C 2Y5GA 8ESTE 1K1NA 1FY1A 1HAVB 2Z7FE 5F6MA 1QL9A 3VFEA 2A4QA 1O3JA 1OP8A 2H5CA 2ZTYA 4B1TA 2WPIS 4TWWA 1DANH 2ZDKA 4NA8A 4CR9A 1MQ5A 5GCHF 1OP0A 1AUTC 2GTBA 1D6WA 1UO6A 1BRAA 2NU3E 3ZZ9A 1G3DA 1QRZA 3AW0A 2FOCA 1OWDA 3H7OA 4A92A 1EP6A 1O2SA 4ABIA 1VITF 3PB1E 4ZKSU 5C1UA 2A4OA 2W5EA 5PTPA 1AKSB 2ZTZA 2G4TA 5DP4A 2VB0A 4WY3A 4B71A 4E05H 1TAWA 1IQHA 1GMHF 4CRCA 2JKHA 3GY8A 4OGYA 3MFJA 4RKOB 3SV9A 3DFLA 2SFAA 1HAYB 3SJOA 3OSYA 1P01A 1SL3A 5AFZH 2PGQB 1FY4A 1V2NT 4MNVA 5F8TA 1W0YH 3SU1A 3C1KA 1N1LA 5HYOA 3ENSB 5F8XA 3RXMA 1FY8E 1LQEA 4J2YB 3A81A 3RXLA 1QR3E 2Z94A 1SGDE 5JBTA 2GCTC 4Z0KA 1O2NA 4CBOA 1DUEA 2ZI2H 3GISB 2OC0A 3T26A 2Q6DA 2G51A 1BHXF 1C9TA 2QF3A 1IQJA 3BSQA 1V2PT 2J34A 2UWOA 5CE1A 2J94A 2OBQA 2XCNA 1TQ0B 1O5DH 3OYPA 2HWLB 1QJ1B 1PPHE 4X1PU 4B74A 1GHWH 1AU8A 1O2GH 1BITA 1CO7E 3L3TA 2G5VA 1W13U 1P12E 1P2QA 2FZZA 2O8LA 4CRBA 2Z3DA 4UFFH 1O5GH 3RMNH 1V3XA 1TWXB 4PROA 3V7TA 5A0AE 1O3GA 1GHZA 3MI4A 3SJ9A 3ZZ6A 1OSSA 2BDYA 1K9OE 2C90B 1C1RA 3BIVH 1W11U 1YPEH 4AX9H 2G4UA 1J15A 1Z1IA 1FQ3A 1NRPH 1K1LA 4I31A 4YOGA 2PKSC 2OC1A 1MZDA 2PR3A 1BTZA 3SNEA 1TA6A 1ELTA 1L4ZA 3EGKH 4BAKB 1O3MA 2GV6A 3P8OA 3RXIA 1BTYA 4DURA 4GHTA 4HFPB 2GZ9A 3DT0H 1HUTH 2F9PA 3PO1C 5DKMA 3MMGA 3LGTA 1EZXC 2QGRA 2Y82A 2ZPQA 2STAE 3PLBA 1T8NA 5H4IB 1HAOH 4AFQA 1XUGA 1BBRH 2AGEX 3MU8A 1DXPA 1XKBC 1S82A 3K6ZA 2PHBA 2VNTA 2OINA 1ZGVA 1UVUH 1FJSA 2A32A 2ZDNA 1SLWB 5ABWA 5FPYA 3W94A 3AAVA 1SLUB 1SI5H 1ZR0A 1C1WH 2IOTA 1SB1H 3BG4B 5JDUB 2A5AA 2R2MB 1F92A 2SNVA 4ZHAA 3RMOH 1EJAA 1TNGA 3E3TA 2QXJA 1CT2E 2AH4X 1RTLA 1SGEE 5EQRA 3BTQE 1C4Y2 1ZHRA 1C5PA 1P2KA 4FUBA 2HNTE 3K65B 4XBCA 3ZVCA 1GBJA 1HAZB 2H9HA 3A7ZA 1E35B 5C1YA 3PM3A 5J4SA 2D8WA 1O0DH 3SUFA 5L2YH 4KP0A 7ESTE 2BY8X 1TYNA 3TVJB 1AUJA 4D7GA 8KME2 4GUXA 1SHYA 3SQEE 8LPRA 1H9HE 1LHDH 3L33A 1GBLA 2FOGA 1C1MA 1GI9B 4OS7A 5E0GA 3BEFB 4O97A 3GYMA 3ATLA 1GHBG 1A0LA 2ZFQH 1RFNA 1EAUA 1PFXC 1CT4E 3SU3A 4Y7BA 1GG6B 3ZVDA 1D4PB 1AKSA 2ALPA 2I6QA 3LJOA 1JBUH 3B9FH 1DITH 3M7QA 1MKWK 3Q76A 4B2BA 5EU8A 1MU6B 1XVMA 3O8CA 5JBCS 3A8AA 4WMEA 3UIRA 3KQBA 1YP9A 1DFPA 4ZHMU 2HPQH 1DLEA 3L6PA 1ESBA 2IN2A 3SU2A 1C2FA 4BAOB 2V3OH 3HATH 1SGPE 1HJAB 5AVDA 3T28A 2GT7A 2F9NA 1D3QB 1UVOA 4OS1A 5K0HA 5DPAA 3RU4D 1H8IH 2ANYA 2BD7A 2FTMA 4D76A 5LGOA 1QY6A 3ZYDA 4NZLA 4NG9H 2ZU5A 4U2WA 5GIBA 3P92A 2HNTF 1FZZA 3QDZB 4LXBH 1C5OH 1QRXA 4H6SB 1CBWB 1UTPA 4K1EA 1ZRBA 1GJ7B 2OBOA 5EPNA 3SHAH 3UQOA 1EATA 2BZ6H 1N8OC 1O2TA 1F0UA 1KXEA 5EW2H 1DXWA 2D1JA 2TGAA 3GY7A 1ORFA 3LGYA 1KLTA 3TK5A 4YOJA 1G3EA 3F9HA 1H9LB 4AGJA 6GCHG 2BDIA 1XUJA 1ABIH 1UVPA 3ITIA 5DP6A 4O03A 2ZPSA 2VIDA 2ZA5A 2DUCA 1NU7B 3U98H 2SGFE 3LH3A 4MLFB 1CHOG 1Z8GA 4AB9A 4CHAB 1J17T 3SN8A 1EZUC 1UK3A 3BG8A 3P95A 2ZHQH 4MNYA 1XXDA 3A82A 1P09A 2V3HH 1TMUH 1B0FA 1E36B 2NU0E 1SG8B 2PSXA 5GDSH 1WBGB 1UVSH 1GJ9B 1KXFA 4I8HA 4AOQA 2GMTB 4IC5A 2JH6D 2C3SA 2WPKS 5K7RA 2A7JA 2SGEE 2VINA 1TMBH 1YM0A 1TONA 2Y80A 1GHXH 1RIWB 3AVZA 1SQTA 1MU8B 1C5UA 1SOTA 3VB5A 3ZVGA 3RLWH 3BTTE 3CS0A 2PLXA 2HGTH 4K8YA 4CRAA 2BD4A 1YKTA 3A88A 1SSXA 1GBBA 2ZGCA 3GY2A 3RXUA 3M35A 3A7XA 2A7CA 1EKBB 1AVGH 4TY7A 2A7HA 4KKDA 1PYTC 3FAOA 1IHSH 2BVRH 1O2JA 1TPOA 4LK4A 4XFQA 1TALA 3PMBB 3QTVH 1J8AA 1G30B 2XTTB 2BLWA 5F8ZA 4X8SH 3AASA 1OOKB 4D9RA 1ZJKA 1HAGE 1BMAA 1NRSH 4Q7ZA 2A45B 2Z3EA 1XVOA 1TX6A 1ELBA 1S0RA 3B23B 2H9TH 1SMFE 4NA9H 3F9FA 3RXPA 1O3LA 1TBZH 3BN9A 2ZCLP 5A0CA 1HYLA 1V2WT 1SBWA 2BY5X 3U1JB 2BXTH 3PMHB 2CN0H 1WYKA 1AB9B 3SU5A 1YPHE 2PTNA 1OXGA 3PLPA 3KQEA 3SV7A 3RXKA 1C5SA 5I25A 3MO6A 4NIWA 2ZHFH 1ELGA 5L30H 3ZZ7A 1DICA 4NIYA 1HPGA 1A46H 3TPIZ 4BAHB 2Y81A 7KMEH 4FUHA 1O35A 1TRYA 1ABJH 1C1VH 5LH8A 1LPZB 4I33A 3ATKA 6ESTA 2ZFPH 3A85A 5E2PA 5AF9H 2UWLA 2BDAA 4WMDA 3ZV9A 4FXGH 2ZECA 1G37A 2BY9X 4DVAU 3MO3A 1OX1A 1NO9H 5E2OA 3HKJB 1DM4B 1GPZA 3KEEA 1UCYH 2XBWA 1O37A 1V2LT 4U30A 4U32A 2R0KA 2BLOA 2GZ7A 3EDXB 5T6GA 1C5LH 5LPFA 1GI2A 4B2CA 1P9SA 4KGAA 2ZG0H 1UVTH 2VH0A 3EE0B 4OS5A 2VIWA 1NFWA 2ZGBH 5T6DA 4OS6A 1FPCH 4E06H 1BJVA 1G3CA 5GWZA 3M5MA 1GMCG 2A4GA 2G52A 2ZU2A 3NCLA 2HVXA 1UTLM 3ODFA 3H7TA 2BQWB 3TITA 3B8JA 3CENA 4F49A 2I6SA 1D3PB 1O2YA 3DHKH 1VJAU 2QXIA 2C8ZB 2QIQA 3HGPA 3RC5A 2R0LA 1UMAH 3LJJA 1ZLRA 4XDEA 1BQYA 3S9AA 2QXHA 2D2DA 4NGAH 1C4V2 4YOIA 1Y3WA 2BZAA 4NWLA 3PWBA 5A0BA 2WPLS 2J4IA 1GHYH 3P8GA 1TB6H 5C5OA 1IQLA 1JIMA 1L1NA 5GPIB 3RXRA
chains in the Genus database with same CATH superfamily
4DW2U 1PPFE 1O36A 4MPXA 4K1TA 1W0JD 3RXAA 3KL6A 2VJ1A 2W7SA 1KIGH 1GJCB 3E91A 1P8VC 1T4VH 2GD4B 4X2XA 3RP2A 3M3VA 1HGTH 3UR6A 4GLYA 4CH2B 1M9UA 1FAKH 1MBMA 2WV5A 5FHTA 3RXCA 1NS3A 3RM2H 1VR1H 3MOCA 2QCYA 4JMYA 1EJNA 6CHAC 1HFDA 4WMFA 2QAAA 4JK6A 3FP7E 1C2DA 5AFYH 2ZCKP 1A3EH 2OQUA 2BY6X 1OWKA 1HNEE 4QT8C 4LZ4B 1C1QA 1CHGA 4Y6DA 1WU1A 4MVNA 4UD9H 1GBIA 3MNXA 3LGVA 1VGCC 2B8OH 1GI3A 5I46H 1NFXA 2UUFB 2A31A 1VCQA 2NU2E 4NA7A 1O3AA 4ZKOU 3F2FA 3URCA 1AGJA 3OTPA 4AYVB 1FONA 3IITA 4B73A 2GCTB 4JZIA 1IQIA 2WHXA 1LCYA 3SBKA 3PMJA 3E1XB 3K9XB 1J9CH 2BMGB 1SLVB 1TBQH 1G32B 5GNDA 4WVPE 1WV7H 3MO9A 1KXDA 2YMSD 2FS8A 2LELA 1ELCA 3K6YA 1D6RA 4O3TA 1TGCA 3BTDE 4K3JA 4NWKA 3SV8A 3TH3H 1L0ZA 2P3FH 1TX7A 5GXPA 4K2YA 1LPKB 1TQ7B 1YCPM 2BX3A 2Y5HA 3A89A 9LPRA 1EB2A 1HAIH 4O9VA 3ATWA 1MZAA 3F0PA 2F9VA 5TCCA 1UHBB 1BA8B 3GYLB 1Y5UT 3SJ8A 1S5SA 4K5ZA 1SKYE 1OWHA 1YLDA 3P8FA 5EIYA 1BMMH 1ZHPA 2PKSB 4Q7XA 1QJ7B 1BZXE 3GCNA 2R3UA 1TX8A 1AZZA 3T5FH 2CV3A 1GBCA 2PWXA 2QF0A 1O3CA 1NRNH 3KF2A 4OS4A 5EODA 4ESTE 4IN2A 1KYNA 7GCHF 3ZVFA 4H42U 1TIOA 3ZZ8A 1F0TA 2QV1A 5A2MH 5EQSA 1E79D 4CRDA 4ZCNA 3PO1B 3TIUA 1NT1A 1Z1JA 2OP9A 4YO9A 2VVVA 1O2WA 2F3CE 3V13A 4BTTB 4UFEH 3ZZ4A 3T29A 3SNDA 2BDHA 1TE0A 1Y3UA 2GDDA 1PQ7A 4FU8A 5HXFA 4I8KA 1ZPCA 4RKJB 4JZDH 2BQ6B 2HOBA 4CRFA 2EQNA 2VWNA 2XBVA 3STJA 2ZCHP 2EI8A 3QGJA 1TMTH 3UFAA 4ZKNU 4VGCC 1OWIA 1GJ5H 3NK8A 1TNHA 1GDQA 3HK3B 3TJNA 1DOJA 4Y79A 2RA0A 4HTCH 1D9IA 2ZZUH 3VXFH 3GCHC 4ISLA 2C8WB 1GI5A 3RU4E 2GV7A 3PROA 1BRBE 3HPTB 1EFRD 4Q7YA 1GMCF 2SGDE 5JBAS 4HZHA 4TPYA 1ZPZA 4MPUA 3SI4H 3QN7A 5HKKD 1ZHMA 1S6LA 3R0FA 1ETTH 3MH6A 5TCAA 2M5TA 1W2KH 1QZ8A 1TA2A 1DY8A 3SOSA 2AHME 4LZ1H 4BTIB 1F0RA 2F9UA 1LMWB 2YMSC 5GJ4B 3FFGA 4BANB 1Y3YA 3ATMA 1T32A 2UUYA 5G4BA 5J4QA 2BM2A 1E0FD 1QHRB 3QZQA 1QBOA 1T8MA 2BLVA 5HIZA 1SVPA 3S0NA 1DE7H 1A0JA 5FPSA 3LGWA 2FDAA 1HAHH 3EA7A 4UFDH 1AHTH 4TSFD 3UWJH 2WUBA 3MU1A 1GI6A 1ZSKA 2BD9A 3VB3A 1UJ1A 5EXNA 1ACBE 4XSKU 3RXHA 3RUOA 1UK4A 3GDUA 3A7YA 5T6FA 4JYUH 1S0QA 2CK3D 1W0ZU 3PTNA 1KXBA 1HB0B 1OS8A 1UTOA 3O8DA 1F5KU 1T8LA 4KTUA 4SGAE 1G36A 1LTOA 3F1SB 2JH0D 1DPOA 1LVYA 3U1IB 1MUEB 1LVBA 2ZDMA 5DP3A 1AE5A 3NZIA 3WW7A 3MTYA 4YM9A 4ISHH 4FUDA 3RXQA 1DT2A 4JZFH 3OU0A 1MCTA 1V2VT 1L4DA 1TPAE 4Z6AH 5B6OA 2AMQA 1O2QA 3VGCC 1N8OB 1FAXA 5ETXA 1EPTB 2AS9A 1ANCA 1O2IA 3ZZDA 2VIPA 2QC2A 3Q00A 3RU4T 3T2NA 5BRRE 2IPHA 2OD3B 1P10A 2ZGHA 1ZYOA 2H1UA 2WYJA 5DP7A 1KLIH 2EEKA 1TRNA 3S69A 3KGPA 1TNKA 1SQRA 3MYWA 3TU7H 4B75A 1EQ9A 2KAIA 1SR5C 2J92A 1THRH 4M7GA 1FNIA 1O34A 1O5AB 2VIQA 1F5LA 2Z6BD 1UHBA 4FVDA 1EUFA 1L2EA 1UTNA 5HGGA 1BTHH 2FWWA 1BRCE 3E0NB 1QTFA 1VZQH 1BUIA 5C1XA 7LPRA 1HAVA 2TBSA 3HKIB 2Q6GA 1IQFA 1ZMLA 3FVFB 1MAYA 1W10U 2Q1JA 2IJOB 4GVUA 3M7TA 1BMNH 1CGJE 1AY6H 2GDEH 1KSNA 2GGVB 3UNQA 1Q2WA 4X1SU 4ZAEA 1C1NA 3M5LA 3OE7D 1C5TA 2WINI 4MPVA 4A1TA 1TNJA 2ZO3H 1GWAA 3RXEA 2H5DA 1TABE 1FI8A 2FX4A 5IYTA 1F0SA 2A5IA 4FU9A 3EA8A 3H5CB 4GHQA 2FI3E 4Z1MD 1IAUA 2O8WA 1ANBA 1S6FA 3Q3KA 3BTWE 3GY4A 2G8TA 3ZZBA 1C1OA 3UPEA 1TLDA 3M7UA 1WTGH 2FM2A 4WH6A 1B7XB 3W1EA 1O31A 3UOPA 4DGJA 1EX3A 1K1PA 3RC6A 2A5KA 2V35A 3KNXA 2J2UA 1PYTD 3E0PB 3QTOH 4DOQA 1MTSA 1YBWA 4FVBA 1AVWA 1GCDA 2G81E 2SGPE 1HAXB 3ZZAA 1CSOE 1GDNA 1JMOH 2B9LA 5DP5A 2RFKC 3S7KB 2XNIA 2PW8H 2ZTXA 2JH5D 1A5HA 2ALVA 3C27B 3SW2B 2ZEBA 3WWBA 5FPTA 1ESAA 2XBYA 2V3MA 4HG6A 1Y5AT 4FUJA 2FYRA 2J9NA 4RT1A 3DA9B 5FAHA 1P06A 5E0HA 3VG8A 4X0WU 3RXOA 4FETA 1EXFA 3RMMH 1NM6A 2FO9A 4RT0A 3EA9A 1E34B 1O3EA 1EOLA 5E0JA 1DWBH 2CGAA 3ATIA 5JBBS 3SHCH 1GBHA 2BD5A 1DSTA 2FOAA 2Y5FA 3N7OA 1W12U 1AMHA 2AIQA 1DX5M 3OTJE 4RN6A 4R0IA 4X1QU 1WQSA 1P2IA 1CQQA 2CJIA 3CS7A 3FZDA 2BDCA 2H2ZA 1Y5BT 2CF8H 3IWMA 1ZSJA 1C5XB 2O8TA 4FUCA 2VVCA 1GI4A 1TRMA 3TLOA 4IN1A 3TK6A 4ASHA 1GBEA 3LPRA 2XC4A 1ID5H 2Y7XA 1FDPA 1P2NA 2ANWA 2FX6A 2FP7B 2VU8E 4D9QA 3ELAH 1W8BH 1G9IE 2W7UA 3HK6B 2FODA 3G01A 4NFFA 2XC0A 3U8RH 1L1JA 2XCFA 1GVLA 2BOHB 1NY22 1EPTA 2AMDA 2KCOA 3MH7A 3R3GB 3D49H 1YPLH 2FESH 1FLEE 1AIXH 1MD8A 3DCLA 3F6UH 4ZXYH 1ZZZA 4KTSA 2J5UA 2BY7X 1HJ9A 2BX4A 3BIUH 1DWEH 4MNXA 1E37B 3V0XA 2AEIH 4YXWD 1KY9A 2ZGXH 3RC4A 3STIA 2NU4E 4Q63A 1BBRE 1AFQC 1EASA 1OYQA 1SOZA 1RRKA 2CF9H 1GBKA 1C5WB 3KCGH 4AB8A 2B0FA 3ZVBA 1THSH 2FPZA 2JETB 1P11E 5FX6A 1VITH 1O2XA 1V2MT 5EG4A 4DCDA 1O2VA 2OUAA 2RG3A 3BTGE 1N6XA 1XM1A 1SGNE 4AYYB 1OYTH 3SGAE 1SGRE 1T4UH 2AGIX 2THFB 5DG6A 1TNLA 2HLCA 3A7TA 1S85A 1CE5A 2JDID 3LT3A 3LONA 5BPEA 3KQDA 1GVKB 1P2MA 1LQDB 2BXUH 4XOJA 1B0EA 3UR9A 3EQ0H 2EI7A 2CHAC 3S9BA 5F53A 3S7HB 6CHAB 2O8MA 2K0QA 3LKWA 1T8OA 1ZTKA 5DO4H 1ANDA 1ARCA 1QIXB 4NFEA 4YT6H 1GL0E 2GKVE 4Y8ZA 7GCHG 1INCA 1NPMA 3OY6U 4ZROA 4BNRA 4BTUB 1FY3A 1S81A 1VGCB 5LPEA 1GJ4H 1QA7A 2ESTE 1GI7B 4ISNA 1QGFA 3N7DA 4YLQH 5DP8A 1GJDB 1NN6A 1PQ8A 3TJOA 1ZGIA 2BD3A 5C20A 4NSYA 1IHTH 1GHAF 2YNBA 1P2JA 2FS9A 4Y76A 2EY4C 5C94A 1NROH 4K69A 1EJMA 3RXJA 3RXSA 5DN6D 3OFND 1Z6EA 4IGDA 3ZZ5A 1EOJA 1GGDC 1OKXA 3SGQE 2PTCE 3DUXH 2P3TB 1LPGB 1BMLA 3LGIA 1C9PA 1DDJA 3SORA 1GJ8B 4AG1A 1QRWA 2VIOA 4JCNA 3SNBA 2QY0B 2PUQH 3M3TA 3KQ5A 1TPPA 2PGBB 1SGCA 2G5NA 4K60A 1ZPBA 1GL1A 4DY7B 1C1UH 3BTFE 1PPEE 4UE7H 2XYAA 3UREA 2R3YA 1O5FH 1O3BA 2TGTA 2AMPA 2P16A 1C5RA 1F2SE 1GBDA 2FTLE 3VB6A 4ISIH 1BTWA 1LHEH 1PPBH 1P3CA 3PRBA 4NIXA 9ESTA 3NUMA 1MTNC 3U8TH 2IJD1 5DGJA 1RJXB 1ESTA 3I78A 2V7QD 4DJZB 4XE4A 4X8VH 1AO5A 3I29A 4XBDA 5L6NH 1D3DB 1LO6A 1T7CA 1ZMJA 4THNH 3BTHE 2AFQB 1O3FA 5CHAC 5L2ZH 4A1XA 1PPCE 4A7IB 5HM9A 3JZ1B 1GJBB 5EPYA 3KQCA 3QK1A 2ZDLA 1QBNA 2ODYB 1Q31A 2PFEA 4AORA 1GCTC 1J16A 2BVSH 4B6FA 1RXPA 1QCPA 3KYFA 1S84A 1NU9A 1G2MA 2ZP0H 2F43B 1P02A 1VKYA 2R2WU 4GAWA 4ABAA 4CRGA 4CBNA 2XRCA 1P2OA 1QJ6B 4OM9A 2A2XH 4X1NU 2HNTC 3ZZCA 2NWNA 1L1GA 1XX9A 2STBE 5KEDA 1JRSA 4F4OC 4VGCB 1V2QT 1ZTJA 4FU7A 1SHHB 1EAXA 1BT7A 2J38A 5EGMA 3QX5H 3NKKA 1O2MA 2H6MA 2GCHF 4CREA 3FKSD 1GI0A 1A4WH 1BTXA 3GCHB 4K1SA 1LHCH 1QB1A 1WOFA 2ODPA 2PV9B 1XMNB 3GDSA 1YCPH 3KN2A 4ZUHA 3MH5A 5AHGH 3IG6B 2FI5E 1J14A 2R9PA 1AVXA 2BYAX 3NXPA 2ZKSA 4X6PA 3M37A 2HALA 1GBTA 5C5NA 1TBRH 1W0KD 4H4FA 2Z9IA 4HGCA 1C5ZB 4KELA 3DFJA 2ZIQH 1MKXH 2QXGA 5DK1A 1VJ9U 1O2PA 4AFZA 1FPHH 1RS0A 3M61U 3RXBA 1E38B 2YMSB 2G00A 1ZOMA 3WY8A 3TGKE 3BV9B 2KX4A 1IQKA 5JB9S 1TGSZ 5EXMA 1PPGE 1HXFH 2A2QH 4SGBE 3NPSA 3QZRA 4ABGA 2UWPA 1HRTH 2ZPRA 3SV6A 1MQ6A 2ZNKH 4OS2A 4Q2KA 4YT7H 5FBEA 4JZEH 1A7SA 1LHFH 4BOHA 3SUEA 1O2UA 3GCTG 1BTUA 1C5VA 1NC6A 2P59A 5FCKA 4X8TH 4MNWA 1LKAA 4B76A 1ARBA 4X6OA 2DE9A 3FANA 2J97A 2F9OA 1RTFB 2F83A 2FYQA 3MNCA 1WUNH 2ZHEH 1OP2A 4JK5A 1HJ8A 2C8YB 4IC6A 3MWIU 1Z6JH 1O2RA 4IW4E 3FP8E 1WSSH 1XUKA 2B7DH 3KIDU 3FZZA 4YLUA 1HIAB 1H8DH 4D8NA 4MTBA 1HV7A 1YPMH 3RXDA 2TIOA 4DIIH 1C1PA 1G2LA 4FUFA 3RXFA 2CMYA 2VGCC 3TGIE 3RXVA 2A1DB 2GVFA 2H9EH 2ZC9H 1Y59T 4NZQA 1ELAA 5EOKA 5JYIA 1RTKA 1P3EA 3VGCB 1IQGA 2KR7A 2BDGA 1WAYB 3RDZA 1FIWA 1MTVA 3NRLA 1H8ED 2W3IA 4INKA 3UNSA 3E6PH 4TYDA 2P3UB 1AI8H 1DWDH 2QA9E 4X6NA 1UCYE 3PV5A 3SNAA 4A5TS 3V12A 1RD3B 1OHHD 1QQ4A 1VCWA 2Z9GA 2PSYA 1ZRKA 2K1QA 1Z7KA 2ZHWH 2LNCA 1XUHA 2ZFFH 2EA3A 4Y8YA 3SGBE 2V6NA 3OX7U 3SUGA 4K8BA 4RI0A 1HLTH 4TWYA 2C8XB 4ABDA 3DD2H 3TH4H 3BTKE 3GOVB 3T25A 1KTTB 5IDKA 2WPJS 1MD7A 4AZ2B 5JB8S 3O8BA 3BTEE 2AIPA 2HVYB 1K22H 1GJAB 1ZMNA 1A61H 3K2UA 1NBMD 1GI1A 3SUDA 4ZXXH 3ZIAD 1QURH 2XXLA 5EW1H 3A87A 3RM0H 5FXLA 1BB0B 4DT4A 2AERH 4OGXA 1V2UT 2Y6TA 3U69H 1C5MD 3SJIA 1C2LA 3FO8D 1ELEE 1BIOA 4X6MA 2SNWA 5CMXH 4FOUC 4YZUA 3U9AH 1UTJA 1OWEA 3ZVAA 4I8GA 3RXGA 5A8ZA 1CA0C 1K28D 2SGQE 1V2RT 2FI4E 2WV4A 3TK9A 3S9CA 3W95A 1EAIA 3LH1A 3P6ZB 2P8OC 2BOKA 1TGNA 2OQ5A 2IPQX 1SQAA 1DY9A 3TNSA 5A09A 5TJXA 1K2I1 1Y3VA 1BTPA 1RGQA 2NU1E 2FOMB 3QWCH 1C2MA 4GSOA 1V2OT 5C0UA 2VWMA 2OCVB 2Y7ZA 3SU4A 1K1IA 1CU1A 4MG3A 1LDTT 1H9IE 1E1QD 4ABBA 2UUKB 5FX5A 1V2KT 1YPHC 1Z8JB 4JYVH 1MCVA 2ZWLH 2ZHDA 1C5YB 1JXPA 2Z9JA 3LGUA 1FY5A 4Y8XA 1MBQA 2CXVA 2ZQ2A 3EYDA 1H4WA 1THPB 4Y71A 1GJ6A 3VB7A 2ZFTA 4ACBA 1W3CA 5KECA 2ZGJA 3KYGA 1HBTH 1NZQH 3TH2H 1O5EH 3VB4A 3D23A 4B2AA 1Y8TA 1MH0A 1O2OA 2ULLA 4Y0YE 3SV2H 1O5CB 1IQNA 1TGBA 3F9GA 4XD7D 1C2EA 1ZJDA 5FBIA 2P93A 2ASUB 3I77A 1Z8IB 4BXWA 4WF8A 4WWYA 1FN6A 1NRQH 1W7XH 3D65E 2ZU4A 4JZ1A 4INHA 1O3IA 1G3BA 3GY6A 1FN8A 3OEED 1O33A 5B6LA 5EJLA 3QGNB 3ZYEA 4I8LA 1C1SA 3GCTF 1K1MA 1CGIE 4UDWH 1JIRA 1AFEH 1A5IA 2WPHS 3F2GA 1H1BA 1HIAA 2C4FH 3GDVA 3OAAD 1QL7A 1MKWH 2QN5T 3UY9A 1BBRK 1DSUA 4TY6A 1LVOA 1GI8B 4I32A 1EAWA 4LOYH 4P00A 1KDQB 2C93B 2RA3A 1QQUA 4TT3D 4F48B 1U6QA 2BTCE 3FOAA 3F9EA 1VCPA 2ANMH 4FUGA 1BHXB 1O3HA 5T1VA 1KLJH 1HAPH 4UFGH 3N99A 1O3PB 2ZDAH 2AYWA 4GCHF 3T62A 1BOQA 1GHAG 1B5GH 5HM2A 2ZU1A 2LPRA 1FMGA 1GHVH 2XWBI 1UTMA 2QYIA 1K1JA 3SNCA 1KXCA 1O38A 4ISOA 2W3KA 3E8LA 3OY5U 1T31A 2OXSA 3EE7A 3GICB 1UTQA 4YESB 2FLRH 2W26A 1P57B 2WPDD 1AFQB 3GS9A 3A8BA 1YF4A 4FUEA 8GCHG 1P04A 5LPRA 4I8JA 2DE8A 1X7AC 2VIVA 2BLQA 1K21H 4JYTA 2BVXH 4AFUA 2OLGA 3PWCA 1KMHB 1C5QA 1F7ZA 1FXYA 1S83A 3A7WA 5EXLA 2BD8A 5C2ZA 2P95A 3M5NA 3TJVA 1GMDG 1CA8B 4Y0ZE 1YC0A 1AD8H 1GVZA 4IMZA 1MMJN 2GP9B 5DP9A 4XRNA 1DVAH 2OK5A 2ZU3A 3SU6A 5EJZA 3QLPH 3U8OH 3UTUH 2CHAB 1YGCH 2HPPH 2XW9A 2XC5A 1O2KA 3ODDA 3SI3H 4H6TA 1AE8H 1P0SH 2Z3CA 3MNBA 1V6DA 2Z9KA 2FEQH 1DWCH 3BTME 4NIVA 4IMQA 1DS2E 1GBMA 2O8UA 1IQMA 5KGOA 1ETSH 4Y10E 2B5TB 3P17H 4P02A 3VEQB 1MABB 4A6LA 1N6YA 1SQOA 1XXFA 2OC8A 1EPTC 4Y7AA 4DT7B 4Q80A 2YOLA 1IOEA 3AK5A 3URDA 2Z9LA 4IS5A 2OC7A 1FUJA 3TGJE 3UWIA 4Y11E 1GGDB 1HCGA 3SZEA 3E16B 2J95A 3BG4C 3TNTA 1FV9A 1A3BH 2VH6A 3KHVA 1YYY1 2K8IA 4E7RG 3PMAB 2PKAB 4X2WA 2WYGA 1W14U 1C2KA 2GCHG 3H09A 3VXEH 3DSGA 1CT0E 2TGDA 1LKBA 2A0QB 2FOBA 4X2YA 1O2ZA 2ILNA 2ZF0H 4UEHH 1PQAA 3EAJA 1HXEH 1OWJA 1TOMH 3M3SA 4AN7A 3UB0A 4HI3A 5ESBA 4DG4A 4WJG2 3LOXA 3U28C 1MTNB 3MH4A 6LPRA 3UUZA 1ETRH 1C2IA 1YPJH 1CGHA 3HGNA 1KXAA 1SC8U 2TGPZ 3LDXH 1O5BB 1GG6C 3FP6E 1ELFA 2EI6A 2KCYA 3MQKC 2P94A 5CHAB 1JOUB 2ODQA 2UUJB 4ZH8A 4BAQB 4BAMB 1TPSA 2BHGA 1QL8A 2HRVA 1GCTB 1BDAA 1SGIB 3RLYH 1TNIA 1SGFA 1F5RA 1HJAC 4WH8A 3V3MA 1C5NH 1O32A 1IQEA 3Q77A 1C2GA 3F68H 1ELDE 1KDQA 1QA0A 5T3HA 1WTHD 2V0BA 2O9QA 3MHWU 3SQHE 5F03A 1NFUA 3A7VA 3N7EA 2GX4A 1NESE 4O3UA 4X2VA 3VPKA 1MTWA 3GY5A 2XBXA 1CBWC 3A8DA 1O3KA 1PJPA 2J98B 2FOHA 2VWOA 3SO3A 3M5OA 1WQVH 2F4LA 1C4U2 1NRRH 5DJ7A 2KCPA 1DLKB 4D7FA 4ZHLU 3SU0A 1XUFA 3A84A 3PLKA 3RXTA 1GBAA 3DSPA 3LU9B 4Q4LA 4CR5A 2Q6FA 3ESTA 1AZ8A 4ZKRU 3P70B 4BXSA 3GCOA 5A8YA 5GCHG 1GHBF 1GBFA 1AWHB 1KTSB 3ZV8A 1QB9A 3Q3YA 1HDTH 1O2HA 2VVUA 4CHAC 3A8CA 1QB6A 5HMAA 3A86A 2FMJA 1SFIA 1BCUH 1AQ7A 3BF6H 5ESTE 1VITG 3SZNA 4NSVA 2BDBA 2WZQA 1V2JT 1O3DA 1S6HA 2WPMS 4TPIZ 1C2HA 2GMTC 3PTBA 1OPHB 1GMDF 1GMHG 3T27A 1A5GH 1TGTA 5C67A 1UK2A 3CP7A 3RMLH 4XBBA 3TJUA 1RIWC 2FOFA 1O2LA 2AGGX 4IBLH 3E90B 4ABHA 2SGAA 1V2ST 1EB1H 2ZQ1A 2ZDVH 4X8UH 1XUIA 4AFSA 3A80A 2FLBH 2GT8A 2KCAA 1SGFG 1UCYK 2TRMA 5A8XA 3LIWA 1C2JA 1TFXA 1A2CH 1O3OA 1NBME 2BB4A 1CVWH 3QO6A 2FXRA 2TPIZ 1Z71A 3MU4A 3P8NA 1YPKH 1QFKH 1BRUP 3SJKA 2VGCB 4ABJA 3NWUA 2RCEA 1DUAA 1BJUA 4J1YA 2RDLA 3UNRA 2PKAA 3MNSA 1JRTA 1TOCB 1EP5A 1O3NA 4DIHH 4X1RU 3ZZ3A 3BEIB 1P9UA 1EZQA 2FOEA 4MQAA 6GCHF 2VWLA 1SGTA 1PPZA 4WXVA 1LHGH 1YPGH 2JETC 1CHOF 2GZ8A 3UOUA 5EQQA 1COWD 2KFWA 1A0HB 1MTUA 4MPWA 4M9FA 5JPMH 1Z8RA 1SGYE 2QF5A 2OTVA 2ZFSA 4AC9A 4WXIA 4UONA 1EZSC 1PQ5A 4AGKA 1LVMA 2YNAA 4NCYA 3UQVA 1ZSLA 1SGQE 3LC5A 1E1RD 3JZ2B 1GDUA 1QBVH 4INLA 3O8RA 3AAUA 3AW1A 2BD2A 2A4RA 1FIZA 1AWFH 1MAXA 1QNJA 1AN1E 4F55A 4U01A 2GJGA 1AB9C 2ANKH 2RDEA 4R8TB 1O39A 4ABFA 3BEUA 1WXRA 1W7GH 4AG2A 1V2TT 1P03A 5EJ1A 1SPJA 2G55A 3D62A 1P05A 4KTCA 1JWTA 5C3NA 2F9BH 3GY3A 4E7NA 4YTAA 2JJ1D 3MU5A 1D3TB 3MU0A 1O30A 1ZTLA 1A1RA 4A1VA 1YLNA 4ZMAH 2F91A 5E8EH 1C1TA 1CA0B 1FX0B 1SFQB 4GPGA 3A83A 8GCHF 2FIRH 2EC9H 1YLCA 1YCPK 1ANEA 2J98A 2P8OB 2PUXB 1Q3XA 5FCRA 1ELVA 1NTPA 1XKAC 4CH8B 4MDSA 1K0HA 1K1OA 1WCZA 3PV4A 2WUCA 4I7YH 3LC3A 3M36A 4FUIA 3PYHA 2ZFRH 2XWAA 1SLXB 2BQ7B 5CHBA 1NFYA 1MKXK 1Y3XA 2KAIB 3QUMP 4ABEA 5SGAE 1UTKA 3Q3XA 3ZVEA 4GCHG 2KM0A 4ACAA 4RSPA 2D26C 3FN8A 2Y5GA 8ESTE 1K1NA 1FY1A 1HAVB 2Z7FE 5F6MA 1QL9A 3VFEA 2A4QA 1O3JA 1OP8A 2H5CA 3UAIC 2ZTYA 3PV2A 4B1TA 2WPIS 4TWWA 1DANH 2ZDKA 4NA8A 4CR9A 1MQ5A 5GCHF 1OP0A 1AUTC 2GTBA 1D6WA 1UO6A 1BRAA 2NU3E 3ZZ9A 1G3DA 1QRZA 3AW0A 2FOCA 1OWDA 3H7OA 4A92A 1EP6A 1O2SA 2QE7D 4ABIA 1VITF 3PB1E 4ZKSU 5C1UA 2A4OA 2W5EA 5PTPA 1AKSB 2ZTZA 2G4TA 5DP4A 2M2AA 2VB0A 4WY3A 4B71A 4E05H 1TAWA 1IQHA 1GMHF 4CRCA 2JKHA 3GY8A 4OGYA 3MFJA 4RKOB 3SV9A 3DFLA 2SFAA 1HAYB 3SJOA 3OSYA 1P01A 1SL3A 1YWUA 2PGQB 1FY4A 1V2NT 4MNVA 5AFZH 1W0YH 5F8TA 3SU1A 3C1KA 1N1LA 5HYOA 3ENSB 5F8XA 3RXMA 1FY8E 1LQEA 4J2YB 3A81A 3RXLA 1QR3E 2Z94A 2XOKD 1SGDE 5JBTA 2GCTC 4Z0KA 1O2NA 4CBOA 1DUEA 2ZI2H 3GISB 2OC0A 3T26A 2Q6DA 2G51A 1BHXF 1C9TA 2QF3A 1IQJA 3BSQA 1V2PT 2J34A 2UWOA 5C17A 5CE1A 2J94A 2OBQA 1WDIA 2XCNA 1TQ0B 1H8HD 1O5DH 3OYPA 2HWLB 1QJ1B 1PPHE 4X1PU 4B74A 2WV9A 1GHWH 1AU8A 2JJ2D 1O2GH 1BITA 1CO7E 3L3TA 2G5VA 1W13U 1P12E 1P2QA 2FZZA 2O8LA 4CRBA 2Z3DA 4UFFH 1O5GH 3RMNH 1V3XA 1TWXB 4PROA 3V7TA 5A0AE 1O3GA 1GHZA 3MI4A 3SJ9A 3ZZ6A 1OSSA 2BDYA 1K9OE 2C90B 1C1RA 3BIVH 1W11U 1YPEH 4AX9H 2G4UA 1J15A 1Z1IA 1FQ3A 1NRPH 1K1LA 4I31A 4YOGA 2PKSC 2OC1A 1MZDA 2PR3A 1BTZA 5FL7D 3SNEA 1TA6A 1ELTA 1L4ZA 3EGKH 4BAKB 1O3MA 2GV6A 3P8OA 3RXIA 1BTYA 4DURA 4GHTA 4HFPB 2GZ9A 3DT0H 1HUTH 2F9PA 3PO1C 5DKMA 3MMGA 3LGTA 1EZXC 2QGRA 2Y82A 2ZPQA 2STAE 3PLBA 1T8NA 5H4IB 1HAOH 4AFQA 1XUGA 1BBRH 2AGEX 3MU8A 1DXPA 1XKBC 1S82A 3K6ZA 2PHBA 2VNTA 2OINA 1ZGVA 1UVUH 1FJSA 2A32A 2ZDNA 1SLWB 5ABWA 5FPYA 3W94A 3AAVA 1SLUB 1SI5H 1ZR0A 1C1WH 2IOTA 1SB1H 3BG4B 5JDUB 2A5AA 2R2MB 1F92A 2SNVA 4ZHAA 3RMOH 1EJAA 1TNGA 3E3TA 2QXJA 1CT2E 2AH4X 1RTLA 1SGEE 5EQRA 3BTQE 1C4Y2 1ZHRA 1C5PA 1P2KA 4FUBA 2HNTE 3K65B 4XBCA 3ZVCA 1GBJA 1HAZB 2H9HA 3A7ZA 1E35B 5C1YA 3PM3A 5J4SA 2D8WA 1O0DH 3SUFA 5L2YH 4KP0A 7ESTE 2BY8X 1TYNA 3TVJB 1AUJA 4D7GA 8KME2 4GUXA 3F3BA 1SHYA 3SQEE 8LPRA 1H9HE 1LHDH 3L33A 1GBLA 2FOGA 1C1MA 1GI9B 4OS7A 5E0GA 3BEFB 4O97A 3GYMA 3ATLA 1GHBG 1A0LA 2ZFQH 1RFNA 1EAUA 1PFXC 1CT4E 3SU3A 4Y7BA 1BMFD 1GG6B 3ZVDA 1D4PB 1AKSA 2ALPA 2I6QA 3LJOA 1JBUH 3B9FH 1DITH 3M7QA 1MKWK 3Q76A 4B2BA 5EU8A 1MU6B 1XVMA 3O8CA 5JBCS 3A8AA 4WMEA 3UIRA 3KQBA 1YP9A 1DFPA 4ZHMU 2HPQH 1DLEA 3L6PA 1ESBA 2IN2A 2W6JD 1C2FA 3SU2A 2V3OH 4BAOB 3HATH 1SGPE 1HJAB 5AVDA 3T28A 2GT7A 2F9NA 2XNDD 1D3QB 1UVOA 4OS1A 5K0HA 5DPAA 3RU4D 2L6OA 1H8IH 2ANYA 2BD7A 2FTMA 4D76A 5LGOA 1QY6A 3ZYDA 2PP6A 4NZLA 4NG9H 2ZU5A 4U2WA 5GIBA 3P92A 2HNTF 1FZZA 3QDZB 4LXBH 1C5OH 1QRXA 4H6SB 1CBWB 5C0TA 1UTPA 4K1EA 1ZRBA 1GJ7B 2OBOA 5EPNA 3SHAH 3UQOA 1EATA 2BZ6H 1N8OC 3DSOA 1O2TA 1F0UA 1KXEA 5EW2H 5IK2D 2KZ4A 1DXWA 2D1JA 2TGAA 3GY7A 1ORFA 3PRDA 3LGYA 1KLTA 3TK5A 4YOJA 1G3EA 3F9HA 1H9LB 4AGJA 6GCHG 2BDIA 1XUJA 1ABIH 1UVPA 3ITIA 5DP6A 4O03A 2ZPSA 2VIDA 2ZA5A 2DUCA 1NU7B 3U98H 2SGFE 3LH3A 4MLFB 2HLDD 5DSFA 1CHOG 1Z8GA 4AB9A 4CHAB 1J17T 3SN8A 1EZUC 1UK3A 3BG8A 3P95A 2ZHQH 4MNYA 1XXDA 3A82A 1P09A 2V3HH 1TMUH 1B0FA 1E36B 2NU0E 1SG8B 2PSXA 5GDSH 1WBGB 1UVSH 1GJ9B 1KXFA 4I8HA 4AOQA 2GMTB 4IC5A 2JH6D 2C3SA 2WPKS 5K7RA 2A7JA 2SGEE 2VINA 4B6EA 1TMBH 1YM0A 1TONA 2WSSD 2Y80A 1GHXH 1UW7A 1RIWB 3AVZA 1SQTA 1MU8B 1C5UA 1SOTA 3VB5A 3ZVGA 3RLWH 3BTTE 3CS0A 2PLXA 2HGTH 4K8YA 4CRAA 3WWFA 2BD4A 4I86A 1YKTA 3A88A 1SSXA 4ASUD 1GBBA 2ZGCA 3GY2A 3RXUA 3M35A 3A7XA 2A7CA 1EKBB 1AVGH 4TY7A 2A7HA 4KKDA 1PYTC 3FAOA 1IHSH 2BVRH 1O2JA 1TPOA 4LK4A 4XFQA 1TALA 2W6ID 3PMBB 3F0OA 3QTVH 1J8AA 1G30B 3CNRA 2XTTB 2BLWA 5F8ZA 4X8SH 3AASA 1OOKB 4D9RA 1ZJKA 1HAGE 1BMAA 1NRSH 4Q7ZA 2A45B 2Z3EA 1XVOA 1TX6A 1ELBA 1S0RA 3B23B 2H9TH 1SMFE 4NA9H 3F9FA 3RXPA 1O3LA 1TBZH 3BN9A 2JIZD 2ZCLP 5A0CA 1HYLA 1V2WT 1SBWA 2BY5X 3U1JB 2BXTH 3PMHB 2CN0H 1WYKA 1AB9B 3SU5A 1YPHE 2PTNA 1OXGA 3PLPA 3KQEA 3SV7A 3RXKA 1C5SA 5I25A 3MO6A 4NIWA 2ZHFH 1ELGA 5L30H 3ZZ7A 1DICA 4NIYA 1HPGA 5HIYA 1A46H 3TPIZ 4BAHB 2Y81A 7KMEH 4FUHA 1O35A 1TRYA 1ABJH 1C1VH 5LH8A 1LPZB 4I33A 3ATKA 6ESTA 2ZFPH 3A85A 5E2PA 5AF9H 2UWLA 2BDAA 4WMDA 3ZV9A 4FXGH 2ZECA 1G37A 2BY9X 2VBCA 4DVAU 3MO3A 1OX1A 2LP6A 1NO9H 5E2OA 3HKJB 1DM4B 1GPZA 2L74A 3KEEA 1UCYH 2XBWA 1O37A 1V2LT 4U30A 4U32A 2R0KA 2BLOA 2GZ7A 3EDXB 5T6GA 1C5LH 5CDFE 5LPFA 1GI2A 4B2CA 3SYJA 1P9SA 4KGAA 2ZG0H 1UVTH 2VH0A 3EE0B 4OS5A 2VIWA 1NFWA 2ZGBH 5T6DA 4OS6A 1FPCH 4E06H 1BJVA 1G3CA 5GWZA 3M5MA 1GMCG 2A4GA 2G52A 2QF4A 2ZU2A 3NCLA 2HVXA 1UTLM 3ODFA 3H7TA 2BQWB 3TITA 3B8JA 3CENA 4F49A 2I6SA 1D3PB 1O2YA 3DHKH 1VJAU 2QXIA 2C8ZB 2QIQA 3HGPA 3OEHD 3RC5A 2R0LA 1UMAH 3F2HA 3LJJA 1ZLRA 4XDEA 1BQYA 3S9AA 2QXHA 2D2DA 4NGAH 1C4V2 4YOIA 1Y3WA 2BZAA 4NWLA 1YY3A 3PWBA 5A0BA 2WPLS 2J4IA 1GHYH 3P8GA 1TB6H 5C5OA 1IQLA 1JIMA 1L1NA 5GPIB 3RXRA
chains in the Genus database with same CATH topology
4DW2U 1PPFE 1O36A 4MPXA 4K1TA 3RXAA 3KL6A 2VJ1A 2W7SA 1KIGH 1GJCB 3E91A 1P8VC 1T4VH 2GD4B 4X2XA 3RP2A 3M3VA 1HGTH 3UR6A 4GLYA 4CH2B 1M9UA 1FAKH 1MBMA 2WV5A 5FHTA 3RXCA 1NS3A 3RM2H 1VR1H 3MOCA 2QCYA 4JMYA 1EJNA 6CHAC 1HFDA 4WMFA 2QAAA 4JK6A 3FP7E 1C2DA 5AFYH 2ZCKP 1A3EH 2OQUA 2BY6X 1OWKA 1HNEE 4QT8C 4LZ4B 1C1QA 1CHGA 4Y6DA 1WU1A 4MVNA 4UD9H 1GBIA 3MNXA 3LGVA 1VGCC 2B8OH 1GI3A 5I46H 1NFXA 2UUFB 2A31A 1VCQA 2NU2E 4NA7A 1O3AA 4ZKOU 3URCA 1AGJA 4AYVB 1FONA 3IITA 4B73A 2GCTB 4JZIA 1IQIA 1LCYA 3SBKA 3PMJA 3E1XB 3K9XB 1J9CH 2BMGB 1SLVB 1TBQH 1G32B 4WVPE 1WV7H 3MO9A 1KXDA 2FS8A 1ELCA 3K6YA 1D6RA 4O3TA 1TGCA 3BTDE 4K3JA 4NWKA 3SV8A 3TH3H 1L0ZA 2P3FH 1TX7A 5GXPA 4K2YA 1LPKB 1TQ7B 1YCPM 2BX3A 2Y5HA 3A89A 9LPRA 1EB2A 1HAIH 4O9VA 3ATWA 1MZAA 2F9VA 5TCCA 1UHBB 1BA8B 3GYLB 1Y5UT 3SJ8A 1S5SA 4K5ZA 1OWHA 1YLDA 3P8FA 1BMMH 1ZHPA 2PKSB 4Q7XA 1QJ7B 1BZXE 3GCNA 2R3UA 1TX8A 1AZZA 3T5FH 2CV3A 1GBCA 2PWXA 2QF0A 1O3CA 1NRNH 3KF2A 4OS4A 5EODA 4ESTE 4IN2A 1KYNA 7GCHF 3ZVFA 4H42U 1TIOA 3ZZ8A 1F0TA 2QV1A 5A2MH 5EQSA 4CRDA 3PO1B 3TIUA 1NT1A 1Z1JA 2OP9A 4YO9A 2VVVA 1O2WA 2F3CE 3V13A 4BTTB 4UFEH 3ZZ4A 3T29A 3SNDA 2BDHA 1TE0A 1Y3UA 2GDDA 1PQ7A 4FU8A 5HXFA 4I8KA 1ZPCA 4RKJB 4JZDH 2BQ6B 2HOBA 4CRFA 2VWNA 2XBVA 3STJA 2ZCHP 2EI8A 3QGJA 1TMTH 3UFAA 4ZKNU 4VGCC 1OWIA 1GJ5H 3NK8A 1TNHA 1GDQA 3HK3B 3TJNA 1DOJA 4Y79A 2RA0A 4HTCH 1D9IA 2ZZUH 3VXFH 3GCHC 4ISLA 2C8WB 1GI5A 3RU4E 2GV7A 3PROA 1BRBE 3HPTB 4Q7YA 5JBAS 1GMCF 2SGDE 4HZHA 4TPYA 1ZPZA 4MPUA 3SI4H 3QN7A 1ZHMA 3R0FA 1ETTH 3MH6A 5TCAA 2M5TA 1W2KH 1TA2A 1DY8A 3SOSA 4LZ1H 4BTIB 1F0RA 2F9UA 1LMWB 5GJ4B 3FFGA 4BANB 1Y3YA 3ATMA 1T32A 2UUYA 5G4BA 5J4QA 2BM2A 1E0FD 1QHRB 3QZQA 1QBOA 1T8MA 2BLVA 1SVPA 3S0NA 1DE7H 1A0JA 5FPSA 3LGWA 2FDAA 1HAHH 3EA7A 4UFDH 1AHTH 3UWJH 2WUBA 3MU1A 1GI6A 1ZSKA 2BD9A 3VB3A 1UJ1A 5EXNA 1ACBE 4XSKU 3RXHA 3RUOA 1UK4A 3GDUA 3A7YA 5T6FA 4JYUH 1S0QA 3PTNA 1W0ZU 1KXBA 1HB0B 1OS8A 1UTOA 3O8DA 1F5KU 1T8LA 4KTUA 4SGAE 1G36A 1LTOA 3F1SB 2JH0D 1DPOA 1LVYA 3U1IB 1MUEB 1LVBA 2ZDMA 5DP3A 1AE5A 3NZIA 3MTYA 4YM9A 4ISHH 4FUDA 3RXQA 1DT2A 4JZFH 3OU0A 1MCTA 1V2VT 1L4DA 1TPAE 4Z6AH 5B6OA 2AMQA 1O2QA 3VGCC 1N8OB 1FAXA 5ETXA 1EPTB 2AS9A 1ANCA 1O2IA 3ZZDA 2VIPA 2QC2A 3Q00A 3RU4T 3T2NA 5BRRE 2IPHA 2OD3B 1P10A 2ZGHA 1ZYOA 2H1UA 2WYJA 5DP7A 1KLIH 2EEKA 1TRNA 3S69A 3KGPA 1TNKA 3MYWA 3TU7H 4B75A 1EQ9A 2KAIA 1SR5C 2J92A 1THRH 4M7GA 1FNIA 1O34A 1O5AB 2VIQA 1F5LA 2Z6BD 1UHBA 4FVDA 1EUFA 1L2EA 1UTNA 5HGGA 1BTHH 2FWWA 1BRCE 3E0NB 1QTFA 1VZQH 1BUIA 5C1XA 7LPRA 1HAVA 2TBSA 3HKIB 2Q6GA 1IQFA 1ZMLA 3FVFB 1MAYA 1W10U 2Q1JA 2IJOB 4GVUA 3M7TA 1BMNH 1CGJE 1AY6H 2GDEH 1KSNA 2GGVB 3UNQA 1Q2WA 4X1SU 4ZAEA 1C1NA 3M5LA 1C5TA 2WINI 4MPVA 4A1TA 1TNJA 2ZO3H 1GWAA 3RXEA 2H5DA 1TABE 1FI8A 2FX4A 5IYTA 1F0SA 2A5IA 4FU9A 3EA8A 3H5CB 4GHQA 2FI3E 1IAUA 2O8WA 1ANBA 1S6FA 3Q3KA 3BTWE 3GY4A 2G8TA 3ZZBA 1C1OA 3UPEA 1TLDA 3M7UA 1WTGH 2FM2A 4WH6A 1B7XB 1O31A 3UOPA 4DGJA 1EX3A 1K1PA 3RC6A 2A5KA 2V35A 3KNXA 2J2UA 1PYTD 3E0PB 3QTOH 4DOQA 1MTSA 1YBWA 4FVBA 1AVWA 1GCDA 2G81E 2SGPE 1HAXB 3ZZAA 1CSOE 1GDNA 1JMOH 2B9LA 5DP5A 3S7KB 2XNIA 2PW8H 2ZTXA 2JH5D 1A5HA 2ALVA 3C27B 3SW2B 2ZEBA 5FPTA 1ESAA 2XBYA 1Y5AT 4FUJA 2FYRA 2J9NA 3DA9B 5FAHA 1P06A 5E0HA 4X0WU 3RXOA 1EXFA 3RMMH 1NM6A 2FO9A 3EA9A 1E34B 1O3EA 1EOLA 5E0JA 1DWBH 2CGAA 3ATIA 5JBBS 3SHCH 1GBHA 2BD5A 1DSTA 2FOAA 2Y5FA 3N7OA 1W12U 1AMHA 2AIQA 1DX5M 3OTJE 4RN6A 4R0IA 4X1QU 1WQSA 1P2IA 1CQQA 2CJIA 3CS7A 3FZDA 2BDCA 2H2ZA 1Y5BT 2CF8H 3IWMA 1ZSJA 1C5XB 2O8TA 4FUCA 2VVCA 1GI4A 1TRMA 3TLOA 4IN1A 3TK6A 4ASHA 1GBEA 3LPRA 2XC4A 1ID5H 2Y7XA 1FDPA 1P2NA 2ANWA 2FX6A 2FP7B 2VU8E 4D9QA 3ELAH 1W8BH 1G9IE 2W7UA 3HK6B 2FODA 3G01A 4NFFA 2XC0A 3U8RH 1L1JA 2XCFA 1GVLA 2BOHB 1NY22 1EPTA 2AMDA 3MH7A 3R3GB 3D49H 1YPLH 2FESH 1FLEE 1AIXH 1MD8A 3F6UH 4ZXYH 1ZZZA 4KTSA 2BY7X 1HJ9A 2BX4A 3BIUH 1DWEH 4MNXA 1E37B 3V0XA 2AEIH 1KY9A 2ZGXH 3RC4A 3STIA 2NU4E 1BBRE 1AFQC 1EASA 1OYQA 1SOZA 1RRKA 2CF9H 1GBKA 1C5WB 3KCGH 4AB8A 2B0FA 3ZVBA 1THSH 2FPZA 2JETB 1P11E 5FX6A 1VITH 1O2XA 1V2MT 5EG4A 4DCDA 1O2VA 2OUAA 2RG3A 3BTGE 1N6XA 1XM1A 1SGNE 4AYYB 1OYTH 3SGAE 1SGRE 1T4UH 2AGIX 2THFB 5DG6A 1TNLA 2HLCA 3A7TA 1S85A 1CE5A 3LT3A 3LONA 5BPEA 3KQDA 1GVKB 1P2MA 1LQDB 2BXUH 4XOJA 1B0EA 3UR9A 3EQ0H 2EI7A 2CHAC 3S9BA 3S7HB 6CHAB 2O8MA 3LKWA 1T8OA 1ZTKA 5DO4H 1ANDA 1ARCA 1QIXB 4NFEA 4YT6H 1GL0E 2GKVE 4Y8ZA 7GCHG 1INCA 1NPMA 3OY6U 4ZROA 4BNRA 4BTUB 1FY3A 1S81A 1VGCB 5LPEA 1GJ4H 1QA7A 2ESTE 1GI7B 4ISNA 1QGFA 4YLQH 5DP8A 1GJDB 1NN6A 1PQ8A 3TJOA 1ZGIA 2BD3A 5C20A 4NSYA 1IHTH 1GHAF 2YNBA 1P2JA 2FS9A 4Y76A 1NROH 4K69A 1EJMA 3RXJA 3RXSA 3ZZ5A 1Z6EA 4IGDA 1EOJA 1GGDC 1OKXA 3SGQE 2PTCE 3DUXH 2P3TB 1LPGB 1BMLA 3LGIA 1C9PA 1DDJA 3SORA 1GJ8B 4AG1A 1QRWA 2VIOA 4JCNA 3SNBA 2QY0B 2PUQH 3M3TA 1TPPA 2PGBB 1SGCA 2G5NA 4K60A 1ZPBA 1GL1A 4DY7B 1C1UH 3BTFE 1PPEE 4UE7H 2XYAA 3UREA 2R3YA 1O5FH 1O3BA 2TGTA 2AMPA 2P16A 1C5RA 1F2SE 1GBDA 2FTLE 3VB6A 4ISIH 1BTWA 1LHEH 1PPBH 1P3CA 4NIXA 9ESTA 3NUMA 1MTNC 3U8TH 5DGJA 1RJXB 1ESTA 3I78A 4DJZB 4XE4A 4X8VH 1AO5A 3I29A 4XBDA 5L6NH 1D3DB 1LO6A 1T7CA 1ZMJA 4THNH 3BTHE 2AFQB 1O3FA 5CHAC 5L2ZH 4A1XA 1PPCE 4A7IB 5HM9A 3JZ1B 1GJBB 5EPYA 3KQCA 3QK1A 2ZDLA 1QBNA 2ODYB 1Q31A 2PFEA 4AORA 1GCTC 1J16A 2BVSH 1RXPA 1QCPA 1S84A 1NU9A 1G2MA 2ZP0H 1P02A 2R2WU 4GAWA 4ABAA 4CRGA 4CBNA 2XRCA 1P2OA 1QJ6B 2A2XH 4X1NU 2HNTC 3ZZCA 2NWNA 1L1GA 1XX9A 2STBE 1JRSA 4F4OC 4VGCB 1V2QT 1ZTJA 4FU7A 1SHHB 1EAXA 1BT7A 2J38A 5EGMA 3QX5H 3NKKA 1O2MA 2H6MA 2GCHF 4CREA 1GI0A 1A4WH 1BTXA 3GCHB 4K1SA 1LHCH 1QB1A 1WOFA 2ODPA 2PV9B 1XMNB 3GDSA 1YCPH 3KN2A 4ZUHA 3MH5A 5AHGH 3IG6B 2FI5E 1J14A 2R9PA 1AVXA 2BYAX 3NXPA 2ZKSA 4X6PA 3M37A 2HALA 1GBTA 5C5NA 1TBRH 4H4FA 2Z9IA 4HGCA 1C5ZB 4KELA 3DFJA 2ZIQH 1MKXH 2QXGA 5DK1A 1VJ9U 1O2PA 4AFZA 1FPHH 1RS0A 3M61U 3RXBA 1E38B 2G00A 1ZOMA 3WY8A 3TGKE 3BV9B 1IQKA 5JB9S 1TGSZ 5EXMA 1PPGE 1HXFH 2A2QH 4SGBE 3NPSA 3QZRA 4ABGA 2UWPA 1HRTH 2ZPRA 3SV6A 1MQ6A 2ZNKH 4OS2A 4Q2KA 4YT7H 5FBEA 4JZEH 1A7SA 1LHFH 4BOHA 3SUEA 1O2UA 3GCTG 1BTUA 1C5VA 1NC6A 2P59A 5FCKA 4X8TH 4MNWA 1LKAA 4B76A 1ARBA 4X6OA 2DE9A 3FANA 2F9OA 1RTFB 2F83A 2FYQA 3MNCA 1WUNH 2ZHEH 1OP2A 4JK5A 1HJ8A 2C8YB 4IC6A 3MWIU 1Z6JH 1O2RA 4IW4E 3FP8E 1WSSH 1XUKA 2B7DH 3KIDU 3FZZA 4YLUA 1HIAB 1H8DH 4D8NA 4MTBA 1HV7A 1YPMH 3RXDA 2TIOA 4DIIH 1C1PA 1G2LA 4FUFA 3RXFA 2CMYA 2VGCC 3TGIE 3RXVA 2A1DB 2GVFA 2H9EH 2ZC9H 1Y59T 4NZQA 1ELAA 5EOKA 5JYIA 1RTKA 1P3EA 3VGCB 1IQGA 2BDGA 1WAYB 3RDZA 1FIWA 1MTVA 2W3IA 4INKA 3UNSA 3E6PH 4TYDA 2P3UB 1AI8H 1DWDH 2QA9E 4X6NA 1UCYE 4A5TS 3SNAA 3V12A 1RD3B 1QQ4A 1VCWA 2Z9GA 2PSYA 1ZRKA 2K1QA 1Z7KA 2ZHWH 2LNCA 1XUHA 2ZFFH 2EA3A 4Y8YA 3SGBE 2V6NA 3OX7U 3SUGA 4K8BA 4TWYA 1HLTH 2C8XB 4ABDA 3DD2H 3TH4H 3BTKE 3GOVB 3T25A 1KTTB 5IDKA 2WPJS 1MD7A 4AZ2B 5JB8S 3O8BA 3BTEE 2AIPA 1K22H 1GJAB 1ZMNA 1A61H 3K2UA 1GI1A 3SUDA 4ZXXH 1QURH 2XXLA 5EW1H 3A87A 3RM0H 5FXLA 1BB0B 2AERH 4OGXA 1V2UT 2Y6TA 3U69H 1C5MD 3SJIA 1C2LA 1ELEE 1BIOA 4X6MA 2SNWA 5CMXH 4YZUA 3U9AH 1UTJA 1OWEA 3ZVAA 4I8GA 3RXGA 5A8ZA 1CA0C 1K28D 2SGQE 1V2RT 2FI4E 2WV4A 3TK9A 3S9CA 3W95A 1EAIA 3LH1A 3P6ZB 2P8OC 2BOKA 1TGNA 2OQ5A 1SQAA 1DY9A 3TNSA 5A09A 5TJXA 1K2I1 1Y3VA 1BTPA 1RGQA 2NU1E 2FOMB 3QWCH 1C2MA 4GSOA 1V2OT 2VWMA 2OCVB 2Y7ZA 3SU4A 1K1IA 1CU1A 4MG3A 1LDTT 1H9IE 4ABBA 2UUKB 5FX5A 1V2KT 1YPHC 1Z8JB 4JYVH 1MCVA 2ZWLH 2ZHDA 1C5YB 1JXPA 2Z9JA 3LGUA 1FY5A 4Y8XA 1MBQA 2CXVA 2ZQ2A 3EYDA 1H4WA 1THPB 4Y71A 1GJ6A 3VB7A 2ZFTA 1W3CA 2ZGJA 1HBTH 1NZQH 3TH2H 1O5EH 3VB4A 3D23A 4B2AA 1Y8TA 1MH0A 1O2OA 2ULLA 4Y0YE 3SV2H 1O5CB 1IQNA 1TGBA 3F9GA 1C2EA 1ZJDA 5FBIA 2P93A 2ASUB 3I77A 1Z8IB 4BXWA 4WF8A 4WWYA 1FN6A 1NRQH 1W7XH 3D65E 2ZU4A 4JZ1A 4INHA 1O3IA 1G3BA 3GY6A 1FN8A 1O33A 3QGNB 3ZYEA 4I8LA 1C1SA 3GCTF 1K1MA 1CGIE 4UDWH 1JIRA 1AFEH 1A5IA 2WPHS 1H1BA 1HIAA 2C4FH 3GDVA 1QL7A 1MKWH 2QN5T 3UY9A 1BBRK 1DSUA 4TY6A 1LVOA 1GI8B 4I32A 1EAWA 4LOYH 1KDQB 2C93B 2RA3A 1QQUA 1U6QA 2BTCE 3F9EA