2O8UA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q/s195a) in complex with inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
245
structure length
238
Chain Sequence
IIGGEFTTIENQPWFAAIYRRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase plasminogen activator
total genus 53
structure length 238
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8uA01
1PQ8A 4ABJA 3LONA 2EI6A 3MNXA 4B76A 3K6ZA 4K1SA 1A1RA 1MTWA 4ESTE 1TALA 2WPKS 3SHCH 1ELDE 2ZWLH 1EPTA 3EA7A 4YOGA 2F9BH 3SOSA 3FANA 8ESTE 4Q7YA 3NWUA 3PLKA 4BTIB 1GCDA 3QGJA 1TNKA 1GI3A 3MMGA 4OS5A 1ZPCA 1CA0B 5FX6A 2Z3DA 1Y5UT 1SHYA 1T32A 3F9EA 3DT0H 1BA8B 1V2MT 2AIPA 3NKKA 1LMWB 3NCLA 4NWLA 1S81A 1TGCA 2V3HH 2BDGA 2GKVE 2Q6GA 1OS8A 1OXGA 4NIWA 5B6OA 1O2LA 5GXPA 1KXCA 2AERH 2TIOA 1CGHA 5G4BA 3ZZ8A 1AVGH 1HFDA 1A61H 1ZHRA 3ZVDA 3ZZ6A 2BY8X 2JH6D 4WH6A 5TCCA 1ZRBA 1O3BA 1OPHB 2W7SA 4RSPA 2H9TH 1LHDH 1ZYOA 3UQOA 1V2TT 4B71A 1C4Y2 1EJMA 2Y81A 1E37B 1TNGA 1UTJA 2VWLA 2O8LA 2R2WU 1VJAU 1A0HB 3SV9A 2W5EA 2OUAA 2NWNA 1GBMA 3ITIA 2FOHA 2P8OB 1WV7H 1ELVA 3SUGA 1J9CH 1QA7A 2BY6X 4ZXXH 2BX3A 3LC5A 1PFXC 2RA0A 2ODYB 4NIYA 2A5AA 1J17T 3SNCA 2W26A 1HAZB 3DA9B 2PKSC 1H9LB 1BCUH 2NU3E 2I6QA 3RXBA 2FTLE 1UVTH 1TBQH 2BDIA 1HUTH 2FLRH 2GMTB 1C1NA 1O2ZA 1P9UA 1TRMA 3MH6A 1AI8H 3ENSB 1JMOH 1O5DH 1BZXE 5GCHF 5PTPA 2H5CA 1YPMH 4UDWH 1QBOA 2FOFA 2PV9B 1Z6JH 3RM2H 1C5MD 1LHEH 4I31A 3F68H 1LDTT 4INLA 3EYDA 2V3OH 3RU4T 1BRUP 2Z3CA 2HGTH 1TE0A 2P8OC 3ATIA 2F3CE 4SGBE 3O8RA 3MU0A 3UTUH 3TGKE 1KXAA 2A0QB 2V0BA 4Q80A 4X2YA 1SC8U 1OWKA 1BMNH 1LVYA 2OQ5A 1P3CA 3QO6A 2ANWA 1AWFH 3E1XB 1O3HA 1ELAA 1E0FD 1QL9A 3MTYA 5BRRE 1BRAA 1CHGA 1YPGH 3M5NA 4NFEA 1HIAA 2Y5FA 1RRKA 1G32B 4X8UH 3ZVBA 1FPHH 1O2KA 1NC6A 4GUXA 2FI5E 2STAE 4CR5A 1YF4A 2C4FH 1GHBG 5J4SA 3O8CA 2I6SA 4Y8ZA 3ZZAA 1CHOF 4XE4A 1RXPA 1T4VH 1ZHPA 3K9XB 4ABDA 3CS7A 3P70B 3RXFA 1AB9C 4OGYA 2XC5A 1L1NA 1QJ1B 3HGNA 1DUEA 3A80A 1ZTLA 3BTTE 3A83A 1FLEE 3QTOH 1MTNC 6LPRA 5AFYH 2CJIA 3UY9A 6ESTA 1LHCH 4ZAEA 5K0HA 1J15A 3E91A 5L2ZH 1WQSA 1NFWA 1J14A 1MCVA 1CHOG 4H42U 2VIVA 2THFB 3SJ9A 1DOJA 3A7XA 4GLYA 2J92A 3MOCA 1O5AB 1C5LH 5I25A 4RKOB 4WMFA 4CRGA 3SJOA 1MZAA 1YPHE 4ZUHA 2Z9GA 1HRTH 1IQEA 4CREA 3ODDA 1O2IA 2GCHF 1Z8RA 3SNAA 2AH4X 3VXFH 4JYVH 1ZSJA 3OY6U 2A7JA 4X2VA 1O2SA 1B5GH 1BRCE 2C3SA 3FVFB 3BTEE 1EJNA 5CE1A 3PTNA 4Y6DA 1O2RA 1TQ7B 5JBCS 3BV9B 2CHAC 1WBGB 4I8GA 4NIVA 2Y80A 3OU0A 1NY22 1OYQA 2ZHDA 2A2XH 1BHXB 1O2WA 2A5KA 5L6NH 2HALA 3RXGA 1F0TA 2ZPQA 5DP3A 4ABBA 1C1TA 1GBLA 3BTHE 1OP8A 3RU4E 2ZIQH 2PR3A 1O2PA 4AN7A 2F9PA 1HAHH 2ZDMA 4Y76A 1UTOA 5EQQA 4AYVB 1KXFA 5FAHA 1GMHF 3SBKA 1PPZA 3TH4H 6GCHG 1AY6H 1BJUA 5DP5A 1DICA 2P93A 4CRFA 1Y5BT 5T6GA 3TIUA 3TLOA 4IBLH 1ETSH 4E05H 1D6RA 1TNJA 3K6YA 1KLJH 5A09A 4NA9H 2WUCA 3UR6A 1CA8B 1K1LA 1YPHC 3MNSA 2NU0E 2FM2A 1O2NA 1V2NT 3T28A 2FOMB 1SFIA 3S7KB 2XRCA 1HB0B 1GI0A 2GZ7A 4K3JA 1BMAA 3L3TA 1F0UA 1QNJA 1TBZH 2CXVA 1ARCA 2FYRA 2WPIS 1SSXA 3GYLB 5CMXH 3RXSA 1XUHA 2A2QH 3SQHE 3GYMA 1RIWB 1RTFB 2UUKB 6CHAB 3FAOA 1W11U 3L33A 3V13A 2VINA 5LGOA 3CP7A 1ACBE 5I46H 2YNAA 4I7YH 2BM2A 4HGCA 2ZGBH 1GPZA 5DG6A 1FUJA 4JZDH 4AFZA 1UCYK 3TJUA 2H2ZA 1Q31A 3SU2A 4AFQA 3PV4A 1O33A 1EAXA 1MTSA 1QL8A 4K60A 2BZ6H 4NA8A 3PMAB 5JBTA 2SGEE 3RXJA 1ABIH 3PWCA 1L0ZA 2WPHS 1ELBA 1S0RA 5TJXA 1C5UA 3GCTF 2YOLA 3M36A 3OTJE 4I33A 1AKSA 1GDQA 2NU4E 2G4UA 3VB6A 3A84A 3MO3A 1SL3A 2HNTF 1BT7A 2UUFB 5F03A 3T2NA 2A7HA 1ZOMA 5LPFA 1EB1H 3LH3A 1MKXH 1JRSA 5JDUB 1F5LA 1GL1A 2FTMA 4YZUA 4Z0KA 1SGIB 2O8MA 3EA9A 2BY9X 3A7WA 1L2EA 4J1YA 1FPCH 4DVAU 1YBWA 1BBRK 1O2YA 1FY1A 2BQWB 3KNXA 2XBWA 1C5YB 3RXCA 1THSH 2ASUB 4A6LA 1QIXB 1C5PA 2PGBB 2ZCKP 2ZTYA 1TX7A 4B2CA 3A81A 1ANEA 3QN7A 2FOGA 5AF9H 1EPTC 2SGAA 1FY4A 4Y8YA 4AGJA 5FBEA 5GCHG 1NFXA 2XW9A 1P06A 4K1EA 2Z9LA 1XKAC 1OWEA 1SQTA 3P6ZB 4X6OA 1ELFA 1QRXA 1C2MA 2Q6FA 3FZZA 1GBEA 1FZZA 4DJZB 1GVKB 1VITG 5F8TA 3A8DA 1O5FH 2ZFSA 1UHBA 3V0XA 3DD2H 4ABGA 3NZIA 1TNIA 1FIZA 1ZSLA 4MNXA 1FNIA 4ZROA 2PKSB 3KCGH 1QL7A 4AFUA 1D3DB 2UWOA 7GCHG 1DLEA 1OWDA 1O3DA 2OCVB 1Y5AT 1Z8IB 1DSTA 1QQ4A 1TQ0B 5JYIA 1BRBE 1QY6A 1OP2A 3LIWA 3BTME 3ZVEA 1D9IA 3TH2H 2G52A 1C1UH 1C5WB 2ANKH 3C1KA 4GCHF 3SU1A 1SLXB 5A8XA 5C2ZA 4KTSA 2OC8A 1EUFA 2BDAA 2ZTXA 2XC0A 3RC6A 1A7SA 3RP2A 1FJSA 1XMNB 3M5OA 1D3QB 2IN2A 1UCYH 2BB4A 1A4WH 3RXMA 1W0YH 1CT2E 1A3EH 1NTPA 1ZGIA 2SGFE 1SGTA 1E36B 5E0GA 1OWJA 4X1RU 1SG8B 2Y82A 4MVNA 2NU1E 2XYAA 3RMNH 3V12A 1HNEE 3LJOA 1NROH 3QX5H 4TPIZ 3EDXB 1W7XH 3E8LA 1FQ3A 5C1UA 1C5OH 3QDZB 3U1JB 1GBCA 1SPJA 4H6SB 4NCYA 5EXMA 4NZQA 4LZ4B 3LC3A 3OY5U 1V3XA 1C2DA 1SGYE 1Z6EA 2AS9A 1C5RA 2BZAA 5BPEA 1K1IA 4HI3A 3D23A 2AGGX 4BAQB 1AO5A 1SOTA 3VGCB 1O2QA 2RCEA 2ZZUH 4MDSA 4D7GA 1NM6A 2OTVA 3DHKH 2ODQA 4AB9A 2Y5HA 1XXDA 1AWHB 4X1QU 2SFAA 1IHSH 4YLQH 4XSKU 2VIWA 1TPOA 3F9GA 2BQ7B 2ULLA 3SORA 4DG4A 3QGNB 3MU4A 5GDSH 1MZDA 1K1PA 3SI3H 3TNSA 1B0EA 1O2UA 3ZZCA 1T8NA 4ISNA 3KQEA 2ZCLP 2OC1A 3KHVA 1RIWC 1LQDB 3TK6A 4KTCA 2PKAB 1S6FA 2GDDA 5A0CA 3SI4H 2BD9A 3VXEH 4WXVA 1LKBA 2FMJA 2HVXA 3S0NA 2VH0A 1SGRE 1UJ1A 4JMYA 1WQVH 1QTFA 4FVDA 2TGPZ 2Z9KA 1QQUA 1T7CA 4GCHG 5H4IB 1MMJN 1UVSH 2P59A 4K8YA 2BVSH 4B2AA 1G3BA 2J95A 3VFEA 1HDTH 1HAGE 3IWMA 4NA7A 3ZV8A 2WPLS 4O9VA 4CHAB 3ZVFA 3ZZ5A 3L6PA 1C1MA 2D1JA 4JZ1A 1W0ZU 2CV3A 3UUZA 1O3NA 1O3IA 5TCAA 1CQQA 1P05A 1QRZA 2CF9H 5DO4H 1EP6A 1G36A 1AFEH 3RXOA 4GVUA 1EPTB 3RMOH 3I29A 1P2IA 1W12U 1P9SA 1X7AC 2CHAB 1CT4E 2VIDA 1TB6H 5A8YA 3RC4A 3SGBE 1ESBA 1S83A 3BSQA 2ZU1A 4NG9H 1O32A 4CBOA 4BTUB 2P3UB 3MO9A 1N8OB 4BOHA 3E0NB 3D65E 1THRH 2BX4A 2GDEH 2BDYA 1XUKA 1MAXA 2CF8H 4CH2B 3JZ2B 5C5OA 1A5IA 1LHGH 1EX3A 4NWKA 1UVOA 1E34B 5EQRA 4I8KA 2BD5A 1O3CA 3RXRA 2G4TA 1W2KH 1MTVA 1MU8B 1FI8A 1HCGA 3BG4C 1FY8E 4NSVA 5JB9S 3GICB 5C5NA 3RXKA 1SMFE 2ZFTA 2ZHFH 3A88A 1EXFA 3TJNA 1ZSKA 1TGNA 3TPIZ 4X8VH 3ATLA 3KQCA 1V2WT 1GI7B 1DS2E 2A31A 4RKJB 4QT8C 1YPKH 1GHZA 1AFQB 4YT6H 1V2ST 3DFJA 4NZLA 3MH7A 2VIOA 1EASA 3S9BA 5EW2H 5SGAE 2AFQB 1AB9B 5LH8A 4LK4A 4X2WA 2AIQA 3M35A 3AAVA 1DSUA 1CVWH 1XKBC 8GCHG 3TNTA 4IC6A 1YPEH 1ETRH 1LVBA 3GCHB 2C93B 3S9AA 2SNWA 1TLDA 2A32A 4XBDA 2J4IA 2G5VA 2GT8A 3P8GA 5DKMA 3SN8A 1DT2A 1LHFH 1YLCA 2ZDVH 3BG4B 1CO7E 5E2OA 2DE8A 1SQAA 2QN5T 3SV8A 1O5BB 1AGJA 3RLYH 5DP7A 4Y0ZE 1FV9A 2Y5GA 3Q76A 4OS6A 1O2JA 1UTKA 3GY4A 1HYLA 1C1SA 2FZZA 2TGTA 3ELAH 1P2OA 1O38A 1IQGA 5HGGA 1O3EA 1KLIH 4UFEH 1TOMH 6CHAC 1DVAH 3EAJA 1MD7A 3I77A 2A1DB 5AHGH 2A4QA 2AGEX 3LGTA 1RTLA 2R0KA 2A4GA 1GJ9B 3RXQA 3R3GB 1Z8GA 4LZ1H 4UFGH 1LVMA 2TPIZ 1MU6B 1W3CA 1CA0C 3LGIA 1P12E 4DURA 1SHHB 4DCDA 1VCQA 1BMLA 1GMCF 2VGCC 1K21H 2CMYA 1O31A 4JZIA 2J34A 5DP9A 4UFFH 4B74A 3LJJA 2G8TA 3PMBB 3HK6B 2ZO3H 3P95A 1S0QA 3S69A 1ZPZA 2Y7XA 1K2I1 3CENA 5HM9A 1K1OA 3BTFE 3BTWE 1KTTB 1BQYA 1A46H 4U32A 3TH3H 2NU2E 1AZZA 1TRYA 3A7YA 3A8AA 4M7GA 1SB1H 2ALVA 1FMGA 4FUJA 1GDNA 4CR9A 1GI1A 1LPKB 2UUJB 4WF8A 3B23B 3PO1C 1IQFA 4WVPE 3ZZ3A 2HRVA 2IOTA 3U1IB 1P2QA 4A5TS 4XBCA 4ISHH 3LGWA 3T26A 3VB5A 1KIGH 1S84A 1PQ5A 2Q1JA 2QXIA 4INHA 1NRPH 2FESH 1G3EA 3PYHA 4NGAH 5EOKA 1O37A 1Q3XA 4FUGA 1ZMJA 1GDUA 5A0AE 4OS2A 1O3GA 1OWHA 2Z6BD 3D49H 1HAYB 2H1UA 3ATWA 1VITF 3FP7E 4D8NA 3KQDA 1AE5A 2BYAX 1E35B 3GCTG 3T27A 3RUOA 1NU7B 1NS3A 1EAIA 1GHBF 2G81E 3QTVH 1ELEE 2GMTC 2QGRA 2TGAA 1A5GH 3ODFA 2GV6A 1G2MA 2Y7ZA 4AOQA 3T62A 3MU1A 4MNWA 2KAIA 2UWLA 3H7OA 1IQKA 4YOIA 2ALPA 2BDBA 3ZZ7A 1DM4B 2A4RA 1W14U 1EATA 3IITA 4I8HA 5F6MA 3PTBA 2XBVA 5FXLA 4J2YB 1LVOA 4BAHB 3UWIA 4U2WA 1PQAA 1A0LA 2BHGA 1WOFA 2PKAA 1C1OA 1RD3B 3OSYA 2ZFFH 2ZI2H 1SBWA 2ANYA 1QJ7B 2SGQE 1FAKH 2VU8E 1P2JA 1ZTJA 3NXPA 1KDQA 2FP7B 5DP8A 1GL0E 4TWYA 2B9LA 2WV4A 2BTCE 3UQVA 7KMEH 5EODA 2J9NA 1TA2A 1ZRKA 4D76A 1GCTB 3PROA 1O39A 1BUIA 4Y7AA 1K28D 3P17H 2Z9JA 2TGDA 1BDAA 4WWYA 1C2EA 1C1RA 4ZXYH 1V6DA 1H8DH 2QXHA 3PLPA 5C20A 1AUTC 1YGCH 1A0JA 2QF0A 1L1GA 1MBMA 3E90B 1YCPK 2D8WA 3KEEA 5FBIA 4D7FA 3GY6A 4D9RA 2FI3E 4WH8A 1DY8A 1W10U 1ORFA 1HV7A 1VZQH 1SQOA 1MBQA 2C8ZB 3RMMH 1XVOA 2ZECA 1OOKB 3BTDE 1ID5H 1HJ9A 2VJ1A 3A89A 3BG8A 4H6TA 3SJIA 1KYNA 3URCA 1QURH 1JIRA 1GHYH 4UE7H 5A2MH 4SGAE 4Y11E 2QC2A 1QJ6B 1CE5A 2XCFA 1UVUH 5EPNA 3A85A 2K1QA 1NRSH 1F5RA 1NESE 1C5ZB 1AKSB 1LO6A 2FS9A 1C4V2 1UTMA 3EE0B 1GMCG 3UR9A 3MHWU 1SLWB 3S7HB 4E7RG 3STIA 5JBBS 4B73A 2QYIA 4GAWA 2VGCB 2V35A 3A87A 1C5XB 4ABEA 4TY7A 1G2LA 4XDEA 5E0HA 2BD8A 1PPCE 3T5FH 4Q2KA 4ZHLU 1HJAC 1G3DA 5ESTE 1O36A 6GCHF 1BMMH 1KXDA 2OC7A 4X8SH 4WXIA 1ESAA 4IMZA 3SGAE 3SUFA 4ABFA 2ZQ2A 4YESB 1CBWC 2JETB 9ESTA 1DFPA 2UWPA 1PPHE 1D3TB 2FEQH 3SU3A 2AEIH 1V2PT 1UCYE 2W3IA 1Z7KA 1WYKA 4X0WU 2ZU4A 5K7RA 3AASA 4VGCC 4DIHH 1AN1E 1U6QA 4A7IB 4NSYA 1QR3E 3MWIU 1A2CH 3C27B 4ISIH 1WTGH 1YPJH 4IW4E 3UIRA 1P3EA 3TK5A 1P09A 4THNH 1GG6C 2JKHA 1SGDE 4PROA 3M5MA 1TPSA 3S9CA 3GY5A 2WV5A 3EQ0H 1Y3UA 1T8MA 4AGKA 1GVLA 3SUDA 1O30A 1TFXA 1HLTH 1VR1H 1HJAB 3B9FH 1Q2WA 1KY9A 4UONA 3M3VA 1M9UA 5DP4A 3A7TA 2XTTB 4AYYB 1B0FA 3GDSA 4ISOA 3KL6A 4K2YA 1IHTH 1TMTH 4MQAA 1TOCB 4MPXA 1V2QT 3SNEA 1SGCA 4Q7ZA 1P02A 4IS5A 4NFFA 1EOLA 1AVWA 1F2SE 1HJ8A 3PB1E 3RXPA 3T25A 2FX6A 1A3BH 5C67A 1Y3WA 2ZNKH 1EZSC 1EZXC 3LH1A 5AFZH 1ZTKA 1ANDA 2GCTC 3W94A 3RM0H 1INCA 5L30H 3M7QA 3A8CA 2RDLA 1WU1A 1PPGE 2ZQ1A 2XC4A 2FDAA 1KXEA 4KGAA 1ZHMA 2HNTC 1F0SA 2P94A 2WUBA 3Q77A 4OS4A 4BTTB 5EW1H 2VH6A 1VGCC 1YP9A 1SGFG 4MPUA 1UK3A 1H1BA 1PYTD 1TNHA 3GCNA 4MPWA 3P8OA 1BBRE 1BTHH 1PQ7A 1VITH 3AW0A 1GWAA 2EA3A 1XX9A 3EGKH 2QCYA 1YLDA 1ELTA 4YLUA 3BEIB 4JCNA 2F9VA 2ODPA 1PPBH 3BN9A 4MG3A 3U9AH 1C5QA 1V2LT 4MNVA 4X1PU 4JZFH 4NIXA 8LPRA 4Z6AH 1WUNH 1BTPA 1EZUC 3UPEA 3SV7A 1AQ7A 1IQJA 2J38A 4FUFA 4U30A 1NPMA 5DPAA 5HM2A 3OYPA 3SV2H 2PTCE 1HAOH 3SV6A 1Z1IA 2ZGJA 4WJG2 1GI8B 1YCPH 3PM3A 1VGCB 2OBOA 1GJ7B 5IYTA 3BIVH 1WCZA 1EP5A 3GOVB 2IPHA 1T31A 1SFQB 3LT3A 1O35A 4OS7A 3ZYDA 2AMDA 3P8NA 4AFSA 2QIQA 1O3KA 1G37A 2BD3A 3HGPA 2H9EH 2Z94A 3BEFB 1KDQB 1BTWA 1E38B 4XOJA 1DXWA 1GJ6A 4A1VA 3G01A 1GBBA 2Y6TA 1TGSZ 1ZLRA 3OX7U 1IOEA 1CGJE 4XFQA 1OWIA 1Y8TA 1TPPA 1TBRH 2STBE 4OS1A 1XUGA 4MLFB 1AZ8A 1V2UT 1G9IE 1V2VT 2ILNA 4CRAA 3N7OA 2PUQH 3KF2A 1P03A 2BLWA 4UD9H 1A5HA 3IG6B 2BD2A 5L2YH 4Y0YE 1OKXA 1V2RT 2ZPRA 2F83A 3LPRA 2BLOA 2FPZA 4LXBH 2XWAA 1DANH 1ANBA 2GZ9A 3W95A 3Q00A 1PYTC 2ZPSA 3BTGE 2A5IA 1O2VA 1RTKA 4A92A 1HBTH 1KXBA 4DIIH 3PMJA 3RXTA 1FDPA 2JETC 3E3TA 1P2KA 3MI4A 1O3MA 1UTPA 1DWDH 5JB8S 3ATMA 4FU8A 2PSYA 1G30B 1HAVB 3UNRA 1DITH 3H5CB 3LGYA 1VJ9U 1UHBB 3ZZ9A 3TVJB 1AFQC 1C2GA 2LNCA 3HKIB 4CBNA 2ZHEH 1ZMLA 2PSXA 2WYJA 1GBTA 1C2KA 4K5ZA 1Z71A 5FX5A 1C5TA 4ZH8A 3GDVA 2OC0A 1TONA 1W8BH 4E06H 2FX4A 1O3LA 2F9NA 2C8WB 5JPMH 2QA9E 3F6UH 4IN1A 2GP9B 1LKAA 1P2NA 1SI5H 2O8WA 2W7UA 1MQ6A 1N6YA 1THPB 2ZFQH 3RXEA 4BAOB 2GCHG 4JZEH 2LPRA 3SO3A 4Y79A 1P57B 1O34A 1UVPA 5GPIB 1D3PB 1BTYA 3H7TA 2G5NA 1GBKA 1C2JA 3F9FA 1NZQH 1TABE 3UOUA 1FY3A 4X6PA 2CN0H 2UUYA 1KTSB 5A8ZA 1C1QA 1SGFA 5DP6A 5F8XA 2QXJA 1N8OC 5AVDA 2FO9A 4FUBA 3U8TH 1CU1A 2C8YB 1DE7H 1P11E 1GI4A 3A86A 2Z3EA 3MH5A 1HPGA 1QCPA 2F9OA 2PHBA 2G55A 4FXGH 4JK6A 1S82A 2GV7A 3UNQA 2BOHB 4YT7H 4F49A 4AX9H 1QB9A 1JRTA 5C1XA 2VIQA 3SZNA 1N6XA 1AMHA 1SLUB 1EJAA 2QV1A 1Z1JA 1JBUH 1BBRH 1GJCB 1SGEE 1EB2A 1XXFA 1O5CB 2FIRH 3F1SB 1GMDG 4BNRA 1G3CA 1VCWA 1GBHA 3KN2A 4B1TA 1NRRH 3GCOA 1B7XB 3Q3YA 1RGQA 3QWCH 5GWZA 1GJDB 3ZZ4A 2FOBA 3E16B 1UMAH 2J94A 5FHTA 4KP0A 3DUXH 2BQ6B 1TYNA 2HPPH 1D6WA 1O3JA 4K1TA 1QFKH 3SNBA 3SU6A 3Q3KA 1DX5M 2PUXB 1BTXA 1FIWA 2W3KA 1VCPA 2ZDLA 4IGDA 1F5KU 1C2IA 1DLKB 1ZZZA 5DK1A 3F9HA 4CRDA 5EXNA 2R3UA 2ANMH 1BTUA 1YKTA 3E6PH 2YNBA 2XBYA 7ESTE 2ZU3A 1MH0A 1GCTC 4YTAA 3ATKA 2VWMA 3SHAH 3U8OH 2GT7A 4ISLA 4B75A 1GJBB 4RN6A 5CHAB 5JBAS 1IQLA 3HKJB 1LPGB 3I78A 3FFGA 4UEHH 4KELA 1K1NA 2GD4B 2SGPE 3UOPA 1P01A 3KQBA 5LPRA 1CT0E 1HAPH 2TBSA 3M5LA 3TGIE 1GBFA 2RG3A 2AGIX 4INKA 3RXLA 4ABAA 1QB1A 2DUCA 1GBAA 3GY2A 4IC5A 3ESTA 4TY6A 2BOKA 4GSOA 2H9HA 1DWEH 1HXFH 1NO9H 7LPRA 3TJOA 5EQSA 1W7GH 3GY8A 1GBDA 2QF3A 4CRBA 2TRMA 4MTBA 3SGQE 3AAUA 1EKBB 2GTBA 3PWBA 4MNYA 4BAKB 1SR5C 4U01A 1GJ8B 4XBBA 1O2MA 3GISB 4ZKNU 3HK3B 1V2OT 1XM1A 1GBJA 2FS8A 2ZGCA 1KSNA 1BITA 2GCTB 3ZYEA 3LOXA 1Y59T 1C1VH 4A1XA 1RS0A 5DGJA 5T3HA 2BY7X 1Y3YA 1AUJA 5GJ4B 3QLPH 1XUIA 1P10A 2ZHWH 1HGTH 2O8UA 2G00A 3PO1B 1MTNB 1ANCA 2P3TB 4JYTA 4F4OC 1HAXB 1AHTH 4IN2A 4HFPB 1O2TA 1TNLA 4B2BA 5DJ7A 1H9IE 1QB6A 2SNVA 1EQ9A 1ZGVA 7GCHF 1H8IH 3TU7H 4CRCA 2R0LA 1CBWB 1WSSH 5CHAC 1ZJKA 4ZKRU 2HPQH 3MYWA 2HLCA 2ZFPH 1GI5A 1GI2A 1OSSA 1S5SA 2ZTZA 3LGUA 2Z9IA 2F9UA 3BIUH 1QA0A 1C2LA 2DE9A 2O8TA 1FXYA 4LOYH 3AVZA 1IQMA 1ZMNA 4DOQA 1TA6A 5EG4A 2IJOB 4YO9A 3MNBA 1S6HA 3M7TA 2PTNA 3GDUA 4DW2U 3VPKA 4GHQA 2Q6DA 3VB4A 1QHRB 5HXFA 1RFNA 1NRQH 5FCRA 1GJAB 1SGPE 4O3UA 1GGDC 4GHTA 2ZDKA 2A4OA 4DY7B 2OINA 1UTNA 2OD3B 4X1SU 2ZC9H 1J16A 4YM9A 4ZHAA 1BTZA 1C9PA 2C8XB 4ASHA 4GPGA 1TRNA 3SJ8A 4X6NA 1YPLH 1AVXA 2OBQA 2BD7A 3O8BA 1JIMA 3VEQB 3O8DA 5IDKA 1BIOA 4HZHA 1ARBA 1AD8H 3M7UA 1JOUB 1GMDF 3KIDU 1D4PB 4DGJA 2OLGA 1S85A 1V2JT 1TGTA 1SOZA 1TX8A 2OXSA 1K9OE 4FUDA 2RA3A 4Y71A 1HXEH 3GY3A 5FCKA 2HNTE 4WMDA 1EZQA 2QAAA 3M3SA 1JWTA 1LCYA 3RU4D 5LPEA 1XUFA 1GHXH 4R0IA 4MPVA 3QZQA 2CGAA 1Y3VA 2ZU5A 4BXSA 2ZG0H 1EOJA 2AMQA 2ZGXH 4H4FA 3VGCC 1MUEB 9LPRA 3KGPA 1SLVB 3RXAA 2FOEA 3BTKE 1P2MA 3MFJA 5EPYA 3K2UA 1IAUA 2PWXA 1BJVA 2V6NA 3RXVA 5A0BA 1QGFA 3ZVGA 1RJXB 1MD8A 1H9HE 3GCHC 4R8TB 1C1WH 2FI4E 3MU8A 2FOCA 1TIOA 1SVPA 1O2XA 2PGQB 2ZGHA 1N1LA 3SW2B 1C5VA 1SGQE 3JZ1B 2VWOA 1C5NH 1GI9B 1GI6A 1O2HA 3NK8A 3RXHA 1FN8A 2FXRA 3B8JA 4ZKSU 1FY5A 1NT1A 1QBVH 1P0SH 1F92A 1MKWK 3A7VA 2F91A 1J8AA 1NU9A 4YOJA 3TJVA 1C2HA 1O0DH 1DUAA 1H4WA 1C1PA 4K69A 2VVUA 3VB3A 3UNSA 3M3TA 3ZZBA 2XCNA 4Y8XA 2FLBH 2VVCA 2ZHQH 5F8ZA 1Y3XA 1K1MA 1TX6A 1AE8H 2AMPA 2BLQA 3LDXH 2KAIB 2FYQA 1QBNA 5FPYA 1UO6A 4VGCB 2WYGA 1EAWA 2XWBI 4FUIA 1TWXB 3U69H 5ABWA 1P8VC 3HPTB 5E8EH 3CS0A 2ZP0H 4E7NA 2C90B 3LGVA 4I8LA 1F7ZA 2EI8A 1KLTA 4HTCH 5FPTA 3SU4A 1EAUA 3PMHB 3ZVCA 4ABIA 4FUHA 2XXLA 2P3FH 2M5TA 4AG1A 1IQNA 5E0JA 1GBIA 2EC9H 1NN6A 1MQ5A 1T8LA 3ZVAA 2R9PA 1GHVH 4FUEA 8KME2 4O97A 1ELCA 2ZDNA 1TMUH 3RXDA 3ZV9A 1DY9A 4Y7BA 4AZ2B 2PW8H 3U8RH 2B8OH 1FN6A 2WPJS 1SGNE 2VNTA 5HYOA 1L4ZA 1O2OA 4I8JA 2XBXA 4KKDA 1JXPA 2B5TB 3AW1A 3NUMA 3SU5A 4AB8A 1ESTA 2D26C 5T6FA 2BVRH 3R0FA 3RLWH 4Y10E 3BEUA 3QK1A 4FVBA 4OGXA 1TAWA 2SGDE 4FU7A 2WPMS 3SQEE 2ZDAH 1TMBH 3GY7A 1DWCH 5HMAA 4DT7B 1CSOE 4TWWA 1ETTH 1HIAB 1L1JA 1T4UH 4FU9A 2HOBA 4TYDA 2EI7A 2FWWA 4BXWA 2BXUH 1YM0A 1NFUA 4TPYA 5E2PA 4O3TA 3E0PB 1C9TA 3A82A 4X1NU 3NPSA 5EU8A 3VB7A 1AIXH 2BY5X 3MH4A 1UK2A 3P8FA 4Q7XA 2BLVA 3T29A 2QXGA 1O3OA 1GJ4H 1C5SA 1HAIH 3MU5A 1UK4A 1TGBA 3ZZDA 3UFAA 3SU0A 1YYY1 4I32A 2JH5D 2BDCA 2BXTH 3RXIA 2BVXH 1O2GH 1AU8A 3FP6E 2A45B 4JYUH 3STJA 4ZKOU 1L4DA 4CH8B 2ZFRH 3RXUA 1XUJA 4JK5A 3TGJE 3BTQE 1O5GH 2R2MB 4WY3A 4D9QA 2VIPA 5GIBA 3FZDA 4K8BA 1P04A 1LTOA 3Q3XA 1F0RA 1GVZA 1OYTH 3DFLA 3RC5A 1O5EH 2EEKA 1PPEE 1CGIE 1GG6B 1MTUA 1ABJH 3TK9A 3LKWA 5FPSA 4IMQA 1YCPM 4AORA 2BDHA 1MAYA 4ZMAH 1UTQA 1MCTA 4BANB 2G51A 1DWBH 2GGVB 3P92A 4ZHMU 3SNDA 3RDZA 1GHAF 4UFDH 1BHXF 2FOAA 3WY8A 3PLBA 1K22H 2JH0D 1K1JA 3SJKA 1GHAG 2D2DA 3URDA 2R3YA 1HAVA 2BMGB 5C3NA 3HATH 1XVMA 1DDJA 4BAMB 3U98H 5J4QA 2HWLB 1Z8JB 1PJPA 1OP0A 4WMEA 2PFEA 2H6MA 2J2UA 1WAYB 1LQEA 1YC0A 1ZPBA 2VB0A 1GGDB 2A7CA 3A8BA 2PLXA 1IQIA 1TPAE 1DPOA 2QY0B 1GHWH 2B7DH 1MKWH 1O3FA 5C1YA 1NFYA 1UTLM 2B0FA 2GX4A 4X8TH 3V7TA 2ZF0H 2H5DA 1PPFE 4AG2A 2ZU2A 4FUCA 3UWJH 3TITA 2OQUA 3LU9B 5ETXA 2ZEBA 3V3MA 2FODA 1GJ5H 1WTHD 2VWNA 3M37A 2VVVA 5ESBA 3FP8E 1FAXA 1LPZB 2ZKSA 1NRNH 1C4U2 1MKXK 3D62A 1ZJDA 2GZ8A 2BD4A 2OP9A 3BF6H 3EA8A 1V2KT 4X6MA 1GMHG 1QRWA 3MO6A 3K65B 1OX1A 1W13U 1ELGA 2ZCHP 1BOQA 3QUMP 5EGMA 4O03A 2ESTE 2P95A 4KTUA 3A7ZA 5T6DA 1O3AA 2ZA5A 1O3PB 1ZR0A 2GVFA 1FONA 2AYWA 1C2FA 1BB0B 2P16A 1IQHA 1DXPA 4A1TA 3RMLH 3QZRA 5EXLA 4ABHA 3UREA 3M61U 2XNIA 2Z7FE 3SUEA 2WINI 4X2XA 2O9QA 4CHAC 3MNCA 8GCHF 1T8OA
chains in the Genus database with same CATH superfamily
1PQ8A 4ABJA 3LONA 2EI6A 3MNXA 4B76A 3K6ZA 4K1SA 1A1RA 1MTWA 4ESTE 1TALA 2WPKS 3SHCH 1ELDE 2ZWLH 1EPTA 3EA7A 4YOGA 2F9BH 3SOSA 3FANA 3MQKC 8ESTE 4Q7YA 3NWUA 2J98B 3PLKA 4BTIB 1GCDA 3QGJA 1TNKA 1GI3A 3N99A 3MMGA 4OS5A 1ZPCA 1CA0B 5FX6A 2JIZD 2Z3DA 1Y5UT 1SHYA 1T32A 3F9EA 2XNDD 3DT0H 1BA8B 1V2MT 2AIPA 3NKKA 1LMWB 3NCLA 4NWLA 1S81A 1TGCA 2V3HH 2BDGA 2GKVE 2Q6GA 1SQRA 1OS8A 1OXGA 4NIWA 5B6OA 1O2LA 5GXPA 1KXCA 2AERH 2TIOA 1CGHA 5G4BA 3ZZ8A 1AVGH 1HFDA 5IK2D 2WZQA 1A61H 1ZHRA 3ZVDA 3ZZ6A 2BY8X 2JH6D 4WH6A 5TCCA 1ZRBA 2XOKD 1O3BA 4HG6A 1OPHB 2W7SA 4RSPA 2H9TH 1LHDH 1ZYOA 3UQOA 1V2TT 4B71A 1C4Y2 1EJMA 2Y81A 1E37B 1TNGA 1UTJA 4F55A 2VWLA 2O8LA 2R2WU 1VJAU 1A0HB 2EY4C 3SV9A 2W5EA 2OUAA 2NWNA 1GBMA 3ITIA 2FOHA 2P8OB 1WV7H 1ELVA 3SUGA 1J9CH 1QA7A 2BY6X 4ZXXH 2BX3A 3LC5A 1PFXC 2RA0A 2ODYB 4NIYA 2A5AA 1J17T 3SNCA 2W26A 1HAZB 3DA9B 3PRBA 2PKSC 1H9LB 1BCUH 2NU3E 2I6QA 3RXBA 3OE7D 2FTLE 1UVTH 1TBQH 2BDIA 1HUTH 2FLRH 3SZEA 2GMTB 1C1NA 1O2ZA 1P9UA 1TRMA 3MH6A 1AI8H 3ENSB 1JMOH 1O5DH 1BZXE 5GCHF 5PTPA 2H5CA 1YPMH 4UDWH 1QBOA 2FOFA 2PV9B 1Z6JH 3RM2H 1C5MD 1LHEH 4I31A 3F68H 1LDTT 4INLA 3EYDA 3F0PA 2V3OH 3RU4T 1BRUP 2Z3CA 2HGTH 1TE0A 2P8OC 3DSPA 3ATIA 2F3CE 4SGBE 3O8RA 3MU0A 3UTUH 3TGKE 1KXAA 2A0QB 2V0BA 4Q80A 4X2YA 1SC8U 1OWKA 1BMNH 1LVYA 2OQ5A 1P3CA 3QO6A 2ANWA 1AWFH 3E1XB 1O3HA 1ELAA 1E0FD 1QL9A 3MTYA 5BRRE 3KYGA 1BRAA 1CHGA 1QZ8A 1YPGH 3M5NA 4NFEA 1HIAA 2Y5FA 1RRKA 1G32B 4X8UH 3ZVBA 1FPHH 1O2KA 1NC6A 4GUXA 2FI5E 2STAE 4CR5A 1YF4A 2C4FH 1GHBG 5J4SA 3O8CA 2I6SA 4Y8ZA 3ZZAA 1CHOF 3WW7A 4XE4A 4P00A 1RXPA 1T4VH 2V3MA 1ZHPA 3K9XB 4ABDA 3CS7A 3P70B 3RXFA 1AB9C 4OGYA 2XC5A 1L1NA 1QJ1B 3HGNA 1DUEA 3A80A 1ZTLA 3BTTE 3A83A 1FLEE 3QTOH 1MTNC 6LPRA 5AFYH 2CJIA 3UY9A 6ESTA 1LHCH 4ZAEA 5K0HA 1J15A 3E91A 5L2ZH 1WQSA 1NFWA 1J14A 1MCVA 1CHOG 4H42U 2VIVA 2THFB 3SJ9A 1DOJA 3A7XA 4GLYA 5KEDA 2J92A 3MOCA 1O5AB 1C5LH 5I25A 4RKOB 4WMFA 4CRGA 4ZCNA 3SJOA 1MZAA 1YPHE 4ZUHA 2Z9GA 1HRTH 1IQEA 4CREA 3ODDA 1O2IA 2GCHF 1Z8RA 3SNAA 2AH4X 3VXFH 4JYVH 1ZSJA 3OY6U 2A7JA 4X2VA 1O2SA 1B5GH 1BRCE 2C3SA 2RDEA 3FVFB 3BTEE 1EJNA 5CE1A 3PTNA 4Y6DA 1O2RA 1TQ7B 5JBCS 3BV9B 2CHAC 1WBGB 4I8GA 4NIVA 2Y80A 3OU0A 1NY22 1OYQA 2ZHDA 2A2XH 1BHXB 1O2WA 2A5KA 3N7DA 5L6NH 2HALA 4M9FA 3RXGA 1F0TA 2ZPQA 5DP3A 4ABBA 1C1TA 1GBLA 3BTHE 1OP8A 3RU4E 2ZIQH 2PR3A 1O2PA 4AN7A 2F9PA 1WDIA 4RT0A 1HAHH 2ZDMA 4Y76A 1UTOA 5EQQA 4AYVB 1KXFA 3OEHD 5FAHA 1GMHF 3SBKA 1PPZA 3TH4H 6GCHG 1AY6H 1BJUA 5DP5A 1DICA 2P93A 4CRFA 1Y5BT 5T6GA 2W6JD 3TIUA 3TLOA 4IBLH 1ETSH 4E05H 1D6RA 1TNJA 3K6YA 1KLJH 5A09A 4NA9H 2WUCA 3UR6A 1CA8B 1K1LA 1YPHC 3MNSA 2NU0E 2FM2A 1O2NA 1V2NT 3T28A 2FOMB 1SFIA 3S7KB 2XRCA 3ZIAD 1HB0B 1GI0A 2GZ7A 1NBMD 4K3JA 1BMAA 3L3TA 1F0UA 1QNJA 1TBZH 2CXVA 1ARCA 2FYRA 2WPIS 4B6EA 3OAAD 1SSXA 3GYLB 5CMXH 3RXSA 1XUHA 2A2QH 3SQHE 1W0JD 3GYMA 1RIWB 2CK3D 1RTFB 2UUKB 6CHAB 3FAOA 1W11U 3L33A 3V13A 2VINA 5LGOA 3CP7A 1ACBE 5I46H 2YNAA 4I7YH 2BM2A 4HGCA 2ZGBH 1GPZA 5DG6A 1FUJA 4JZDH 4AFZA 1UCYK 3TJUA 2H2ZA 1Q31A 3SU2A 4AFQA 3PV4A 1O33A 1EAXA 1MTSA 1QL8A 4K60A 2BZ6H 4NA8A 3PMAB 5JBTA 2SGEE 3RXJA 1ABIH 3PWCA 1L0ZA 1K0HA 2WPHS 1ELBA 1S0RA 5TJXA 1C5UA 3GCTF 2YOLA 3M36A 3OTJE 4I33A 5DN6D 1AKSA 1GDQA 2NU4E 2G4UA 3VB6A 3A84A 3MO3A 1SL3A 3UAIC 2HNTF 1BT7A 2UUFB 5F03A 3T2NA 2A7HA 1ZOMA 5LPFA 1EB1H 3LH3A 1MKXH 1JRSA 5JDUB 1F5LA 1GL1A 2FTMA 4YZUA 4Z0KA 1SGIB 2O8MA 3EA9A 2BY9X 3A7WA 1L2EA 5C0UA 4J1YA 1FPCH 4DVAU 1YBWA 1BBRK 1O2YA 1FY1A 2BQWB 3KNXA 2XBWA 1C5YB 3RXCA 1THSH 2ASUB 4A6LA 1QIXB 1C5PA 2PGBB 2ZCKP 2ZTYA 1TX7A 4B2CA 3A81A 1ANEA 5EJ1A 3QN7A 2FOGA 5AF9H 1EPTC 2SGAA 1FY4A 4Y8YA 4AGJA 5FBEA 5GCHG 1NFXA 2XW9A 1P06A 4K1EA 2Z9LA 1XKAC 1OWEA 1SQTA 3P6ZB 4X6OA 1ELFA 1QRXA 3NRLA 1C2MA 2Q6FA 3FZZA 1GBEA 1FZZA 4DJZB 1GVKB 1VITG 5F8TA 3A8DA 1O5FH 2ZFSA 1UHBA 3V0XA 3DD2H 4ABGA 3NZIA 1TNIA 1FIZA 1ZSLA 4MNXA 1FNIA 4ZROA 2PKSB 3KCGH 1QL7A 4AFUA 2UWOA 1D3DB 7GCHG 1DLEA 1OWDA 1O3DA 2OCVB 1Y5AT 1Z8IB 1DSTA 1QQ4A 1TQ0B 5JYIA 1BRBE 1EFRD 1OP2A 1QY6A 3LIWA 3BTME 3ZVEA 1D9IA 3TH2H 2G52A 1C1UH 1C5WB 2ANKH 3C1KA 4GCHF 3SU1A 1SLXB 5A8XA 5C2ZA 2AHME 4KTSA 2OC8A 1EUFA 2BDAA 2ZTXA 2XC0A 3RC6A 1A7SA 3RP2A 1FJSA 1XMNB 3M5OA 2VBCA 1D3QB 2IN2A 1UCYH 2BB4A 1A4WH 3RXMA 1W0YH 1CT2E 1A3EH 1NTPA 1ZGIA 2SGFE 1SGTA 1E36B 5E0GA 1OWJA 4X1RU 1SG8B 2Y82A 4MVNA 2NU1E 2XYAA 3RMNH 3V12A 1HNEE 3LJOA 1NROH 3QX5H 4TPIZ 3EDXB 1W7XH 3E8LA 1FQ3A 5C1UA 1C5OH 3QDZB 3U1JB 1GBCA 1SPJA 4H6SB 4NCYA 5EXMA 4NZQA 4LZ4B 2KFWA 3LC3A 3OY5U 1V3XA 1C2DA 1SGYE 1Z6EA 2AS9A 1C5RA 2BZAA 5BPEA 1K1IA 4HI3A 3D23A 2AGGX 4BAQB 1AO5A 1SOTA 2WSSD 3VGCB 1O2QA 2RCEA 2ZZUH 4MDSA 4D7GA 2LELA 5HIYA 1NM6A 2F4LA 2OTVA 3DHKH 2ODQA 4AB9A 2Y5HA 1XXDA 1AWHB 4X1QU 2SFAA 1IHSH 4YLQH 4XSKU 2VIWA 1VKYA 1TPOA 3F9GA 2BQ7B 2ULLA 3SORA 4DG4A 3QGNB 3MU4A 5GDSH 1MZDA 1K1PA 3SI3H 1E1QD 1B0EA 1O2UA 3TNSA 3ZZCA 1T8NA 4ISNA 3KQEA 2ZCLP 2OC1A 4Q4LA 3KHVA 1RIWC 1LQDB 3TK6A 4KTCA 2PKAB 1S6FA 2GDDA 5A0CA 3SI4H 2BD9A 3VXEH 4WXVA 1LKBA 2FMJA 2HVXA 3S0NA 2VH0A 1SGRE 1UJ1A 4JMYA 1WQVH 1QTFA 4FVDA 2TGPZ 2Z9KA 1QQUA 1T7CA 4GCHG 5H4IB 1MMJN 1UVSH 2P59A 4K8YA 2BVSH 4B2AA 1G3BA 2J95A 3VFEA 1HDTH 1HAGE 3IWMA 4NA7A 3ZV8A 2WPLS 4O9VA 4CHAB 3ZVFA 3ZZ5A 3L6PA 1C1MA 2D1JA 4JZ1A 1W0ZU 2CV3A 4ACAA 3UUZA 1O3NA 3OTPA 1O3IA 5TCAA 1CQQA 1P05A 1QRZA 2CF9H 5DO4H 1EP6A 1G36A 1AFEH 3RXOA 4GVUA 1EPTB 3RMOH 3I29A 1P2IA 1W12U 1P9SA 1X7AC 3KYFA 2CHAB 1CT4E 2VIDA 1TB6H 5A8YA 3RC4A 3SGBE 1ESBA 1S83A 3BSQA 2WV9A 2ZU1A 4NG9H 1O32A 4CBOA 4BTUB 2P3UB 3MO9A 1N8OB 4BOHA 3E0NB 3D65E 1THRH 2BX4A 2GDEH 2BDYA 1XUKA 1MAXA 2CF8H 4CH2B 3JZ2B 5C5OA 1A5IA 1LHGH 1EX3A 4NWKA 1UVOA 1E34B 5EQRA 4I8KA 5C0TA 2BD5A 1O3CA 3RXRA 2G4TA 1W2KH 1MTVA 1MU8B 1FI8A 1HCGA 3BG4C 1FY8E 4NSVA 5JB9S 3GICB 5C5NA 3RXKA 1SMFE 2ZFTA 2ZHFH 3A88A 1EXFA 3TJNA 1ZSKA 1TGNA 3TPIZ 3F2FA 4X8VH 3ATLA 3KQCA 1V2WT 1GI7B 1DS2E 2A31A 4RKJB 4QT8C 1YPKH 1GHZA 1AFQB 4YT6H 1V2ST 3DFJA 2KR7A 4NZLA 3MH7A 2VIOA 1EASA 3S9BA 5EW2H 2YMSC 5SGAE 2AFQB 1AB9B 5LH8A 4LK4A 4X2WA 2AIQA 3M35A 3AAVA 1DSUA 1CVWH 1XKBC 8GCHG 3TNTA 4IC6A 1YPEH 1ETRH 1LVBA 3GCHB 2C93B 3S9AA 2SNWA 3SYJA 1TLDA 2A32A 4XBDA 2J4IA 1W0KD 2G5VA 2GT8A 3P8GA 4I86A 5DKMA 1DT2A 1LHFH 1YLCA 3FOAA 2ZDVH 3SN8A 3BG4B 1CO7E 2HLDD 5E2OA 2DE8A 1SQAA 2QN5T 3SV8A 1O5BB 1AGJA 3RLYH 5DP7A 4Y0ZE 1FV9A 2Y5GA 3Q76A 5CDFE 4OS6A 1O2JA 1UTKA 3GY4A 1HYLA 1C1SA 2FZZA 2TGTA 2IJD1 3ELAH 1P2OA 1O38A 1IQGA 5HGGA 1O3EA 1KLIH 4UFEH 1TOMH 6CHAC 1DVAH 3EAJA 1MD7A 3I77A 2A1DB 5AHGH 2A4QA 2AGEX 3LGTA 1RTLA 2R0KA 2A4GA 1GJ9B 3RXQA 2KM0A 3R3GB 1Z8GA 4LZ1H 4UFGH 3U28C 1YLNA 1LVMA 2TPIZ 1MU6B 1W3CA 1CA0C 3LGIA 1P12E 4DURA 1SHHB 4DCDA 1VCQA 1BMLA 1GMCF 4RT1A 1K21H 2VGCC 2CMYA 1O31A 4JZIA 1FX0B 2J34A 5DP9A 4UFFH 4B74A 3LJJA 2G8TA 3PMBB 3HK6B 2ZO3H 3P95A 1S0QA 3S69A 1ZPZA 2Y7XA 1K2I1 3CENA 5HM9A 1K1OA 3BTFE 3BTWE 3W1EA 1KTTB 1BQYA 1A46H 4XD7D 4U32A 3TH3H 2NU2E 1AZZA 1TRYA 3A7YA 3A8AA 4M7GA 1SB1H 2ALVA 1FMGA 4FUJA 1GDNA 4CR9A 1GI1A 1LPKB 2UUJB 4WF8A 3B23B 3PO1C 1IQFA 4WVPE 3ZZ3A 2HRVA 2IOTA 3U1IB 3PV2A 1P2QA 4A5TS 4XBCA 4ISHH 3LGWA 3T26A 3VB5A 1E1RD 1KIGH 1S84A 1PQ5A 2Q1JA 1KMHB 2QXIA 4INHA 1NRPH 2FESH 1G3EA 3PYHA 4NGAH 5EOKA 1O37A 1Q3XA 4FUGA 1ZMJA 1GDUA 5A0AE 4OS2A 1O3GA 1OWHA 2Z6BD 3D49H 1HAYB 2H1UA 3ATWA 5HKKD 1VITF 3FP7E 4D8NA 3KQDA 1AE5A 2BYAX 1E35B 3GCTG 3T27A 3RUOA 1NU7B 1NS3A 1EAIA 1GHBF 2G81E 3QTVH 1ELEE 2GMTC 2QGRA 2TGAA 4XRNA 1A5GH 3ODFA 2GV6A 1G2MA 2Y7ZA 4AOQA 3T62A 3MU1A 4MNWA 2KAIA 2UWLA 3H7OA 1IQKA 4YOIA 2ALPA 2BDBA 3ZZ7A 1DM4B 2A4RA 1W14U 1EATA 3IITA 4I8HA 5F6MA 3PTBA 2XBVA 5FXLA 4J2YB 1LVOA 4BAHB 3UWIA 4U2WA 1PQAA 1A0LA 2BHGA 1WOFA 2PKAA 1C1OA 1RD3B 3OSYA 2ZFFH 2ZI2H 1SBWA 2ANYA 1QJ7B 2SGQE 1FAKH 2VU8E 1P2JA 1ZTJA 3NXPA 1KDQA 2FP7B 5DP8A 1GL0E 4TWYA 5C94A 2B9LA 2WV4A 2BTCE 3UQVA 3CNRA 7KMEH 5EODA 2J9NA 1TA2A 1ZRKA 4D76A 5EJZA 1GCTB 3PROA 1O39A 1BUIA 2L74A 4Y7AA 1K28D 2PP6A 2Z9JA 2TGDA 3P17H 1BDAA 4WWYA 1C2EA 1C1RA 4ZXYH 1V6DA 1H8DH 2K8IA 2QXHA 3PLPA 5C20A 1AUTC 1YGCH 1A0JA 2QF0A 1L1GA 1MBMA 3E90B 1YCPK 2D8WA 3KEEA 5FBIA 5HIZA 4D7FA 3GY6A 4D9RA 2FI3E 4WH8A 2QF4A 1DY8A 1W10U 1ORFA 1S6LA 1HV7A 1VZQH 1SQOA 1MBQA 2C8ZB 3RMMH 1XVOA 2ZECA 1OOKB 3BTDE 1ID5H 1HJ9A 2VJ1A 3A89A 3BG8A 4H6TA 3SJIA 1KYNA 4TT3D 3URCA 1QURH 1JIRA 1GHYH 4UE7H 5A2MH 4SGAE 4Y11E 2QC2A 1QJ6B 1CE5A 2XCFA 1UVUH 5EPNA 3A85A 1WXRA 2K1QA 1NRSH 1F5RA 1NESE 1C5ZB 2V7QD 1AKSB 1LO6A 2FS9A 1C4V2 1UTMA 3EE0B 1GMCG 3UR9A 3MHWU 1SLWB 3S7HB 4E7RG 3STIA 5JBBS 4B73A 2QYIA 4GAWA 2VGCB 2V35A 3A87A 1C5XB 2KX4A 4ABEA 4TY7A 1G2LA 4XDEA 5E0HA 2BD8A 1PPCE 3T5FH 4Q2KA 4ZHLU 1HJAC 1G3DA 5ESTE 1O36A 6GCHF 1BMMH 1KXDA 2OC7A 4X8SH 4WXIA 1ESAA 4IMZA 3SGAE 3SUFA 4ABFA 2ZQ2A 4YESB 1CBWC 2JETB 9ESTA 1DFPA 2UWPA 5B6LA 1PPHE 1D3TB 2FEQH 3SU3A 2AEIH 1V2PT 1UCYE 2W3IA 1Z7KA 5GNDA 1WYKA 4X0WU 2ZU4A 5K7RA 3AASA 4VGCC 4DIHH 1AN1E 1U6QA 4A7IB 4NSYA 3PV5A 1QR3E 3MWIU 1A2CH 3C27B 4ISIH 3WWFA 1WTGH 1YPJH 4IW4E 3UIRA 1P3EA 3TK5A 1P09A 4THNH 1GG6C 2JKHA 1SGDE 4PROA 3M5MA 1TPSA 2KZ4A 5F53A 4ASUD 3S9CA 3GY5A 2WV5A 3EQ0H 3UB0A 1Y3UA 1T8MA 4AGKA 1GVLA 3SUDA 1O30A 1TFXA 1HLTH 1VR1H 1HJAB 3B9FH 3AK5A 1Q2WA 1KY9A 4UONA 3M3VA 1M9UA 5DP4A 3A7TA 2XTTB 4AYYB 1B0FA 3GDSA 4ISOA 3KL6A 4K2YA 1IHTH 1TMTH 4MQAA 1TOCB 4MPXA 1V2QT 5EJLA 3SNEA 1SGCA 1OHHD 4Q7ZA 1P02A 4IS5A 4NFFA 1EOLA 1AVWA 2YMSD 1F2SE 1HJ8A 3PB1E 3RXPA 3T25A 2FX6A 1A3BH 5C67A 1Y3WA 2ZNKH 1EZSC 1EZXC 3LH1A 5AFZH 1ZTKA 1ANDA 2GCTC 3W94A 3RM0H 1INCA 5L30H 3M7QA 3A8CA 2RDLA 1WU1A 1PPGE 3OFND 2WPDD 3WWBA 2ZQ1A 2XC4A 2FDAA 1KXEA 4KGAA 1ZHMA 2HNTC 3F2HA 1F0SA 2P94A 2WUBA 1COWD 3Q77A 4OS4A 4BTTB 5EW1H 2VH6A 1VGCC 1YP9A 1SGFG 4MPUA 1UK3A 1H1BA 1PYTD 1TNHA 3GCNA 4MPWA 3P8OA 1BBRE 1BTHH 1PQ7A 1VITH 3AW0A 1GWAA 2EA3A 1XX9A 3EGKH 2QCYA 1YLDA 1ELTA 4YLUA 3BEIB 4JCNA 2F9VA 2ODPA 1PPBH 3VG8A 3BN9A 4MG3A 3U9AH 1C5QA 1V2LT 4MNVA 4X1PU 4JZFH 3F3BA 4NIXA 8LPRA 4Z6AH 1WUNH 1BTPA 1EZUC 3UPEA 3KQ5A 3SV7A 1AQ7A 1IQJA 2J38A 4FUFA 4U30A 1NPMA 5DPAA 5HM2A 3OYPA 3SV2H 2PTCE 1HAOH 3SV6A 1Z1IA 2ZGJA 4WJG2 1GI8B 1YCPH 3PM3A 1VGCB 2OBOA 2RFKC 1GJ7B 5IYTA 3BIVH 1WCZA 1EP5A 3GOVB 2IPHA 1T31A 1SFQB 3LT3A 1O35A 4OS7A 2QE7D 3ZYDA 2AMDA 3P8NA 4AFSA 2QIQA 1O3KA 1G37A 2BD3A 3HGPA 2LP6A 2H9EH 2Z94A 3BEFB 1KDQB 1BTWA 1E38B 4XOJA 1DXWA 1GJ6A 4A1VA 3G01A 1GBBA 2Y6TA 1TGSZ 1ZLRA 3OX7U 1IOEA 1CGJE 4XFQA 1OWIA 1Y8TA 1TPPA 1TBRH 2STBE 4OS1A 2OK5A 1XUGA 4MLFB 1AZ8A 2KCPA 1V2UT 1G9IE 1V2VT 2ILNA 4CRAA 3N7OA 2PUQH 3KF2A 1P03A 2BLWA 4UD9H 1A5HA 3IG6B 2BD2A 5L2YH 4Y0YE 1OKXA 1V2RT 2ZPRA 2F83A 3LPRA 2BLOA 2FPZA 4LXBH 2XWAA 1DANH 1ANBA 2GZ9A 3W95A 3Q00A 1PYTC 2ZPSA 3BTGE 2A5IA 2F43B 1O2VA 1RTKA 4A92A 1HBTH 1KXBA 4DIIH 3PMJA 3RXTA 1FDPA 2JETC 3E3TA 4F48B 1P2KA 3MI4A 1O3MA 1UTPA 1DWDH 5JB8S 3ATMA 4FU8A 2PSYA 1G30B 1HAVB 3UNRA 1DITH 3H5CB 3LGYA 1VJ9U 1UHBB 3ZZ9A 4YXWD 3TVJB 1AFQC 1C2GA 2LNCA 3HKIB 4CBNA 2ZHEH 1ZMLA 5CHBA 2PSXA 2WYJA 1GBTA 1C2KA 4K5ZA 1Z71A 5FX5A 1C5TA 2HVYB 4ZH8A 3GDVA 2OC0A 1TONA 1W8BH 4E06H 2FX4A 1O3LA 2F9NA 2C8WB 3OEED 5JPMH 2QA9E 3F6UH 4IN1A 2GP9B 1LKAA 1P2NA 1SI5H 2O8WA 2W7UA 4P02A 1MQ6A 1N6YA 1THPB 2ZFQH 3RXEA 4BAOB 2GCHG 5C17A 4JZEH 2LPRA 3SO3A 4Y79A 1P57B 1O34A 1UVPA 5GPIB 1D3PB 1BTYA 3H7TA 2G5NA 1GBKA 1C2JA 3F9FA 1NZQH 1TABE 3UOUA 1FY3A 4X6PA 2CN0H 2UUYA 1KTSB 5A8ZA 1C1QA 1SGFA 5DP6A 5F8XA 2QXJA 1N8OC 5AVDA 2FO9A 4FUBA 4AC9A 3U8TH 1CU1A 2C8YB 1DE7H 1P11E 1GI4A 3A86A 2Z3EA 3MH5A 1HPGA 3F0OA 2M2AA 1QCPA 2F9OA 2PHBA 2G55A 4FXGH 4JK6A 1S82A 2GV7A 3UNQA 2BOHB 4YT7H 4F49A 4AX9H 1QB9A 1JRTA 5C1XA 2VIQA 4Q63A 3SZNA 1N6XA 1AMHA 1SLUB 1EJAA 2QV1A 1Z1JA 1JBUH 1SKYE 2K0QA 4B6FA 1BBRH 1GJCB 1SGEE 1EB2A 1XXFA 1O5CB 2FIRH 3F1SB 1GMDG 4BNRA 1G3CA 1VCWA 1GBHA 3KN2A 4B1TA 1NRRH 3GCOA 1B7XB 3Q3YA 4OM9A 1RGQA 3QWCH 5GWZA 1GJDB 3ZZ4A 3FN8A 2QF5A 2FOBA 3E16B 1UMAH 2J94A 3PRDA 5FHTA 4KP0A 5EIYA 3DSGA 3DUXH 2BQ6B 1TYNA 2HPPH 1D6WA 1O3JA 4K1TA 1MABB 1QFKH 3SNBA 3SU6A 3Q3KA 1DX5M 2PUXB 1BTXA 1FIWA 2W3KA 1VCPA 2ZDLA 3N7EA 4IGDA 1F5KU 1C2IA 1DLKB 1ZZZA 5DK1A 3F9HA 4CRDA 5EXNA 2R3UA 2ANMH 2IPQX 1BTUA 1YKTA 3E6PH 2YNBA 2XBYA 7ESTE 1YWUA 1MH0A 2ZU3A 1GCTC 4YTAA 3ATKA 2VWMA 3SHAH 2KCOA 3U8OH 2GT7A 4ISLA 4B75A 1GJBB 4RN6A 5CHAB 5JBAS 1IQLA 3HKJB 1LPGB 3I78A 3FFGA 4UEHH 4KELA 1K1NA 2GD4B 2SGPE 3UOPA 1P01A 3KQBA 5LPRA 1CT0E 1HAPH 2TBSA 3M5LA 3TGIE 1GBFA 2RG3A 2AGIX 4INKA 3RXLA 4ABAA 1QB1A 2DUCA 2GJGA 1GBAA 3GY2A 4IC5A 3ESTA 4TY6A 2BOKA 4GSOA 2H9HA 1DWEH 1HXFH 1NO9H 7LPRA 3TJOA 5EQSA 1W7GH 3GY8A 1GBDA 2QF3A 4CRBA 4RI0A 2TRMA 4MTBA 3SGQE 3AAUA 1EKBB 2GTBA 3PWBA 4MNYA 4BAKB 1SR5C 4U01A 1GJ8B 4XBBA 1O2MA 3GISB 4ZKNU 3HK3B 1V2OT 1XM1A 1GBJA 2FS8A 2ZGCA 1KSNA 1BITA 2GCTB 3ZYEA 3LOXA 1Y59T 2JJ2D 1C1VH 4A1XA 1RS0A 5DGJA 4DT4A 5T3HA 2BY7X 1Y3YA 1AUJA 5GJ4B 3QLPH 1XUIA 1P10A 2ZHWH 1HGTH 2O8UA 2G00A 3PO1B 1MTNB 1ANCA 2P3TB 4JYTA 4F4OC 1HAXB 1AHTH 4IN2A 4HFPB 1O2TA 1TNLA 4B2BA 5DJ7A 1H9IE 1QB6A 2SNVA 1BMFD 1EQ9A 4FOUC 5KGOA 1ZGVA 7GCHF 1H8IH 3TU7H 4CRCA 1YY3A 2R0LA 1CBWB 1WSSH 5CHAC 1ZJKA 4ZKRU 2HPQH 3MYWA 2HLCA 2ZFPH 1GI5A 1UW7A 1GI2A 1OSSA 1S5SA 2ZTZA 3LGUA 2Z9IA 2F9UA 3BIUH 1QA0A 1C2LA 2DE9A 2O8TA 1FXYA 4LOYH 2JJ1D 3AVZA 1IQMA 1ZMNA 4DOQA 1TA6A 5EG4A 2IJOB 4YO9A 3MNBA 1S6HA 3M7TA 2PTNA 3GDUA 4DW2U 3VPKA 4GHQA 2Q6DA 3VB4A 1QHRB 5HXFA 1RFNA 1NRQH 5FCRA 1GJAB 1SGPE 2L6OA 4O3UA 1GGDC 4GHTA 2JDID 2ZDKA 2A4OA 4DY7B 2OINA 1UTNA 2OD3B 4X1SU 2ZC9H 1J16A 4YM9A 4ZHAA 1BTZA 1C9PA 2C8XB 4ASHA 4GPGA 1TRNA 3SJ8A 4X6NA 1YPLH 1AVXA 2OBQA 2BD7A 3DCLA 3O8BA 1JIMA 3VEQB 2EQNA 3O8DA 5IDKA 1BIOA 4Z1MD 4HZHA 1ARBA 1AD8H 3M7UA 1JOUB 1GMDF 3KIDU 1D4PB 4DGJA 2OLGA 5KECA 1S85A 1V2JT 1TGTA 1SOZA 1TX8A 2OXSA 1K9OE 4FUDA 2RA3A 4Y71A 1HXEH 3GY3A 4FETA 5FCKA 2HNTE 4WMDA 1EZQA 2QAAA 3M3SA 1JWTA 1LCYA 3RU4D 5LPEA 3EE7A 1XUFA 1GHXH 4R0IA 4MPVA 3QZQA 2CGAA 1Y3VA 2ZU5A 4BXSA 2ZG0H 1EOJA 2AMQA 2ZGXH 4H4FA 3VGCC 1MUEB 9LPRA 3KGPA 3F2GA 1SLVB 3RXAA 2FOEA 3BTKE 1P2MA 3MFJA 5EPYA 3K2UA 1IAUA 2PWXA 1BJVA 2V6NA 3RXVA 5A0BA 1QGFA 3ZVGA 1RJXB 1MD8A 1H9HE 3GCHC 4R8TB 1C1WH 2FI4E 3MU8A 2FOCA 1TIOA 1SVPA 1O2XA 5DSFA 2PGQB 2ZGHA 1N1LA 3SW2B 1C5VA 1SGQE 3JZ1B 2VWOA 1C5NH 1GI9B 1GI6A 1O2HA 3NK8A 3RXHA 1FN8A 2FXRA 3B8JA 4ZKSU 1FY5A 1NT1A 1NBME 1QBVH 1P0SH 1F92A 1MKWK 3A7VA 2F91A 1J8AA 1NU9A 4YOJA 3TJVA 1C2HA 1O0DH 1DUAA 1H4WA 1C1PA 4K69A 2VVUA 3VB3A 3UNSA 3M3TA 3ZZBA 2XCNA 4Y8XA 2FLBH 2VVCA 2ZHQH 5F8ZA 1Y3XA 1K1MA 1TX6A 1AE8H 2AMPA 2BLQA 3LDXH 2KAIB 2FYQA 1QBNA 5FPYA 1UO6A 4VGCB 2WYGA 1EAWA 2XWBI 4FUIA 1TWXB 3U69H 5ABWA 1P8VC 3HPTB 5E8EH 3CS0A 2ZP0H 4E7NA 2C90B 3LGVA 4I8LA 1F7ZA 2EI8A 1KLTA 4HTCH 5FPTA 3SU4A 1EAUA 3PMHB 3ZVCA 4ABIA 4FUHA 2XXLA 2P3FH 2M5TA 4AG1A 1IQNA 5E0JA 1GBIA 2EC9H 1NN6A 1MQ5A 1T8LA 4ACBA 3ZVAA 2R9PA 3FO8D 1GHVH 4FUEA 8KME2 4O97A 1ELCA 2ZDNA 1TMUH 3RXDA 3ZV9A 1DY9A 4Y7BA 4AZ2B 2PW8H 3U8RH 2B8OH 1FN6A 2WPJS 1SGNE 2VNTA 5HYOA 1L4ZA 1O2OA 4I8JA 2XBXA 4KKDA 1JXPA 2B5TB 3AW1A 3NUMA 2J97A 3SU5A 4AB8A 1ESTA 2D26C 5T6FA 2BVRH 3R0FA 3RLWH 4Y10E 3BEUA 3QK1A 4FVBA 4OGXA 1TAWA 2SGDE 4FU7A 2WPMS 3SQEE 2ZDAH 1TMBH 4TSFD 3GY7A 1DWCH 5HMAA 4DT7B 1CSOE 4TWWA 3DSOA 1ETTH 1HIAB 1L1JA 1T4UH 4FU9A 2HOBA 4TYDA 2EI7A 2FWWA 4BXWA 2BXUH 1YM0A 1H8ED 1NFUA 4TPYA 5E2PA 4O3TA 3E0PB 1C9TA 3A82A 4X1NU 3NPSA 5EU8A 3VB7A 1AIXH 2W6ID 2BY5X 3MH4A 1UK2A 3P8FA 4Q7XA 2BLVA 3T29A 2QXGA 1O3OA 1GJ4H 1C5SA 1HAIH 3MU5A 1UK4A 1TGBA 3ZZDA 3UFAA 3SU0A 2KCYA 1YYY1 4I32A 2JH5D 2BDCA 2BXTH 3RXIA 2BVXH 1O2GH 1AU8A 3FP6E 2A45B 4JYUH 3STJA 4ZKOU 1L4DA 4CH8B 2ZFRH 3RXUA 1XUJA 4JK5A 3TGJE 3BTQE 1O5GH 2R2MB 4WY3A 4D9QA 2VIPA 5GIBA 3FZDA 4K8BA 1P04A 1E79D 1LTOA 3Q3XA 1F0RA 1GVZA 1OYTH 3DFLA 3RC5A 1O5EH 2EEKA 1PPEE 1CGIE 1GG6B 1MTUA 1ABJH 3TK9A 3LKWA 5FPSA 4IMQA 1YCPM 4AORA 2BDHA 1MAYA 4ZMAH 1UTQA 1MCTA 5T1VA 2G51A 4BANB 1DWBH 2GGVB 3P92A 4ZHMU 3SNDA 3RDZA 1GHAF 4UFDH 1BHXF 2FOAA 3WY8A 3GS9A 3PLBA 1K22H 2JH0D 1K1JA 3SJKA 1GHAG 2D2DA 3URDA 2R3YA 1HAVA 2BMGB 2KCAA 5C3NA 3HATH 1XVMA 1DDJA 4BAMB 3U98H 5J4QA 2HWLB 1Z8JB 1PJPA 1OP0A 4WMEA 2PFEA 2H6MA 2J2UA 1WAYB 1LQEA 1YC0A 1ZPBA 2VB0A 1GGDB 2A7CA 3A8BA 2PLXA 1IQIA 1TPAE 1DPOA 2QY0B 1GHWH 2B7DH 1MKWH 1O3FA 5C1YA 1NFYA 1UTLM 2B0FA 2GX4A 3FKSD 4X8TH 3H09A 2WHXA 3V7TA 2ZF0H 2H5DA 1PPFE 4AG2A 2ZU2A 4FUCA 3UWJH 3TITA 2OQUA 3LU9B 5ETXA 2ZEBA 3V3MA 2FODA 1GJ5H 5FL7D 1WTHD 2VWNA 3M37A 2VVVA 5ESBA 3FP8E 1FAXA 1LPZB 2ZKSA 1NRNH 1C4U2 1MKXK 2J98A 3D62A 1ZJDA 2GZ8A 2BD4A 2OP9A 3BF6H 3EA8A 1V2KT 4X6MA 1GMHG 1QRWA 3MO6A 3K65B 1OX1A 1W13U 1ELGA 2ZCHP 1BOQA 2J5UA 3QUMP 5EGMA 4O03A 2ESTE 2P95A 4KTUA 3A7ZA 5T6DA 1O3AA 2ZA5A 1O3PB 1ZR0A 2GVFA 1FONA 2AYWA 1C2FA 1H8HD 2P16A 1BB0B 1IQHA 1DXPA 4A1TA 3RMLH 3QZRA 5EXLA 4ABHA 3UREA 3M61U 2YMSB 2XNIA 2Z7FE 3SUEA 2WINI 4X2XA 2O9QA 4CHAC 3MNCA 8GCHF 1T8OA
chains in the Genus database with same CATH topology
1PQ8A 4ABJA 3LONA 2EI6A 3MNXA 4B76A 3K6ZA 4K1SA 1A1RA 1MTWA 4ESTE 1TALA 2WPKS 3SHCH 1ELDE 2ZWLH 1EPTA 3EA7A 4YOGA 2F9BH 3SOSA 3FANA 8ESTE 4Q7YA 3NWUA 3PLKA 4BTIB 1GCDA 3QGJA 1TNKA 1GI3A 3MMGA 4OS5A 1ZPCA 1CA0B 5FX6A 2Z3DA 1Y5UT 1SHYA 1T32A 3F9EA 3DT0H 1BA8B 1V2MT 2AIPA 3NKKA 1LMWB 3NCLA 4NWLA 1S81A 1TGCA 2V3HH 2BDGA 2GKVE 2Q6GA 1OS8A 1OXGA 4NIWA 5B6OA 1O2LA 5GXPA 1KXCA 2AERH 2TIOA 1CGHA 5G4BA 3ZZ8A 1AVGH 1HFDA 1A61H 1ZHRA 3ZVDA 3ZZ6A 2BY8X 2JH6D 4WH6A 5TCCA 1ZRBA 1O3BA 1OPHB 2W7SA 4RSPA 2H9TH 1LHDH 1ZYOA 3UQOA 1V2TT 4B71A 1C4Y2 1EJMA 2Y81A 1E37B 1TNGA 1UTJA 2VWLA 2O8LA 2R2WU 1VJAU 1A0HB 3SV9A 2W5EA 2OUAA 2NWNA 1GBMA 3ITIA 2FOHA 2P8OB 1WV7H 1ELVA 3SUGA 1J9CH 1QA7A 2BY6X 4ZXXH 2BX3A 3LC5A 1PFXC 2RA0A 2ODYB 4NIYA 2A5AA 1J17T 3SNCA 2W26A 1HAZB 3DA9B 2PKSC 1H9LB 1BCUH 2NU3E 2I6QA 3RXBA 2FTLE 1UVTH 1TBQH 2BDIA 1HUTH 2FLRH 2GMTB 1C1NA 1O2ZA 1P9UA 1TRMA 3MH6A 1AI8H 3ENSB 1JMOH 1O5DH 1BZXE 5GCHF 5PTPA 2H5CA 1YPMH 4UDWH 1QBOA 2FOFA 2PV9B 1Z6JH 3RM2H 1C5MD 1LHEH 4I31A 3F68H 1LDTT 4INLA 3EYDA 2V3OH 3RU4T 1BRUP 2Z3CA 2HGTH 1TE0A 2P8OC 3ATIA 2F3CE 4SGBE 3O8RA 3MU0A 3UTUH 3TGKE 1KXAA 2A0QB 2V0BA 4Q80A 4X2YA 1SC8U 1OWKA 1BMNH 1LVYA 2OQ5A 1P3CA 3QO6A 2ANWA 1AWFH 3E1XB 1O3HA 1ELAA 1E0FD 1QL9A 3MTYA 5BRRE 1BRAA 1CHGA 1YPGH 3M5NA 4NFEA 1HIAA 2Y5FA 1RRKA 1G32B 4X8UH 3ZVBA 1FPHH 1O2KA 1NC6A 4GUXA 2FI5E 2STAE 4CR5A 1YF4A 2C4FH 1GHBG 5J4SA 3O8CA 2I6SA 4Y8ZA 3ZZAA 1CHOF 4XE4A 1RXPA 1T4VH 1ZHPA 3K9XB 4ABDA 3CS7A 3P70B 3RXFA 1AB9C 4OGYA 2XC5A 1L1NA 1QJ1B 3HGNA 1DUEA 3A80A 1ZTLA 3BTTE 3A83A 1FLEE 3QTOH 1MTNC 6LPRA 5AFYH 2CJIA 3UY9A 6ESTA 1LHCH 4ZAEA 5K0HA 1J15A 3E91A 5L2ZH 1WQSA 1NFWA 1J14A 1MCVA 1CHOG 4H42U 2VIVA 2THFB 3SJ9A 1DOJA 3A7XA 4GLYA 2J92A 3MOCA 1O5AB 1C5LH 5I25A 4RKOB 4WMFA 4CRGA 3SJOA 1MZAA 1YPHE 4ZUHA 2Z9GA 1HRTH 1IQEA 4CREA 3ODDA 1O2IA 2GCHF 1Z8RA 3SNAA 2AH4X 3VXFH 4JYVH 1ZSJA 3OY6U 2A7JA 4X2VA 1O2SA 1B5GH 1BRCE 2C3SA 3FVFB 3BTEE 1EJNA 5CE1A 3PTNA 4Y6DA 1O2RA 1TQ7B 5JBCS 3BV9B 2CHAC 1WBGB 4I8GA 4NIVA 2Y80A 3OU0A 1NY22 1OYQA 2ZHDA 2A2XH 1BHXB 1O2WA 2A5KA 5L6NH 2HALA 3RXGA 1F0TA 2ZPQA 5DP3A 4ABBA 1C1TA 1GBLA 3BTHE 1OP8A 3RU4E 2ZIQH 2PR3A 1O2PA 4AN7A 2F9PA 1HAHH 2ZDMA 4Y76A 1UTOA 5EQQA 4AYVB 1KXFA 5FAHA 1GMHF 3SBKA 1PPZA 3TH4H 6GCHG 1AY6H 1BJUA 5DP5A 1DICA 2P93A 4CRFA 1Y5BT 5T6GA 3TIUA 3TLOA 4IBLH 1ETSH 4E05H 1D6RA 1TNJA 3K6YA 1KLJH 5A09A 4NA9H 2WUCA 3UR6A 1CA8B 1K1LA 1YPHC 3MNSA 2NU0E 2FM2A 1O2NA 1V2NT 3T28A 2FOMB 1SFIA 3S7KB 2XRCA 1HB0B 1GI0A 2GZ7A 4K3JA 1BMAA 3L3TA 1F0UA 1QNJA 1TBZH 2CXVA 1ARCA 2FYRA 2WPIS 1SSXA 3GYLB 5CMXH 3RXSA 1XUHA 2A2QH 3SQHE 3GYMA 1RIWB 1RTFB 2UUKB 6CHAB 3FAOA 1W11U 3L33A 3V13A 2VINA 5LGOA 3CP7A 1ACBE 5I46H 2YNAA 4I7YH 2BM2A 4HGCA 2ZGBH 1GPZA 5DG6A 1FUJA 4JZDH 4AFZA 1UCYK 3TJUA 2H2ZA 1Q31A 3SU2A 4AFQA 3PV4A 1O33A 1EAXA 1MTSA 1QL8A 4K60A 2BZ6H 4NA8A 3PMAB 5JBTA 2SGEE 3RXJA 1ABIH 3PWCA 1L0ZA 2WPHS 1ELBA 1S0RA 5TJXA 1C5UA 3GCTF 2YOLA 3M36A 3OTJE 4I33A 1AKSA 1GDQA 2NU4E 2G4UA 3VB6A 3A84A 3MO3A 1SL3A 2HNTF 1BT7A 2UUFB 5F03A 3T2NA 2A7HA 1ZOMA 5LPFA 1EB1H 3LH3A 1MKXH 1JRSA 5JDUB 1F5LA 1GL1A 2FTMA 4YZUA 4Z0KA 1SGIB 2O8MA 3EA9A 2BY9X 3A7WA 1L2EA 4J1YA 1FPCH 4DVAU 1YBWA 1BBRK 1O2YA 1FY1A 2BQWB 3KNXA 2XBWA 1C5YB 3RXCA 1THSH 2ASUB 4A6LA 1QIXB 1C5PA 2PGBB 2ZCKP 2ZTYA 1TX7A 4B2CA 3A81A 1ANEA 3QN7A 2FOGA 5AF9H 1EPTC 2SGAA 1FY4A 4Y8YA 4AGJA 5FBEA 5GCHG 1NFXA 2XW9A 1P06A 4K1EA 2Z9LA 1XKAC 1OWEA 1SQTA 3P6ZB 4X6OA 1ELFA 1QRXA 1C2MA 2Q6FA 3FZZA 1GBEA 1FZZA 4DJZB 1GVKB 1VITG 5F8TA 3A8DA 1O5FH 2ZFSA 1UHBA 3V0XA 3DD2H 4ABGA 3NZIA 1TNIA 1FIZA 1ZSLA 4MNXA 1FNIA 4ZROA 2PKSB 3KCGH 1QL7A 4AFUA 1D3DB 2UWOA 7GCHG 1DLEA 1OWDA 1O3DA 2OCVB 1Y5AT 1Z8IB 1DSTA 1QQ4A 1TQ0B 5JYIA 1BRBE 1QY6A 1OP2A 3LIWA 3BTME 3ZVEA 1D9IA 3TH2H 2G52A 1C1UH 1C5WB 2ANKH 3C1KA 4GCHF 3SU1A 1SLXB 5A8XA 5C2ZA 4KTSA 2OC8A 1EUFA 2BDAA 2ZTXA 2XC0A 3RC6A 1A7SA 3RP2A 1FJSA 1XMNB 3M5OA 1D3QB 2IN2A 1UCYH 2BB4A 1A4WH 3RXMA 1W0YH 1CT2E 1A3EH 1NTPA 1ZGIA 2SGFE 1SGTA 1E36B 5E0GA 1OWJA 4X1RU 1SG8B 2Y82A 4MVNA 2NU1E 2XYAA 3RMNH 3V12A 1HNEE 3LJOA 1NROH 3QX5H 4TPIZ 3EDXB 1W7XH 3E8LA 1FQ3A 5C1UA 1C5OH 3QDZB 3U1JB 1GBCA 1SPJA 4H6SB 4NCYA 5EXMA 4NZQA 4LZ4B 3LC3A 3OY5U 1V3XA 1C2DA 1SGYE 1Z6EA 2AS9A 1C5RA 2BZAA 5BPEA 1K1IA 4HI3A 3D23A 2AGGX 4BAQB 1AO5A 1SOTA 3VGCB 1O2QA 2RCEA 2ZZUH 4MDSA 4D7GA 1NM6A 2OTVA 3DHKH 2ODQA 4AB9A 2Y5HA 1XXDA 1AWHB 4X1QU 2SFAA 1IHSH 4YLQH 4XSKU 2VIWA 1TPOA 3F9GA 2BQ7B 2ULLA 3SORA 4DG4A 3QGNB 3MU4A 5GDSH 1MZDA 1K1PA 3SI3H 3TNSA 1B0EA 1O2UA 3ZZCA 1T8NA 4ISNA 3KQEA 2ZCLP 2OC1A 3KHVA 1RIWC 1LQDB 3TK6A 4KTCA 2PKAB 1S6FA 2GDDA 5A0CA 3SI4H 2BD9A 3VXEH 4WXVA 1LKBA 2FMJA 2HVXA 3S0NA 2VH0A 1SGRE 1UJ1A 4JMYA 1WQVH 1QTFA 4FVDA 2TGPZ 2Z9KA 1QQUA 1T7CA 4GCHG 5H4IB 1MMJN 1UVSH 2P59A 4K8YA 2BVSH 4B2AA 1G3BA 2J95A 3VFEA 1HDTH 1HAGE 3IWMA 4NA7A 3ZV8A 2WPLS 4O9VA 4CHAB 3ZVFA 3ZZ5A 3L6PA 1C1MA 2D1JA 4JZ1A 1W0ZU 2CV3A 3UUZA 1O3NA 1O3IA 5TCAA 1CQQA 1P05A 1QRZA 2CF9H 5DO4H 1EP6A 1G36A 1AFEH 3RXOA 4GVUA 1EPTB 3RMOH 3I29A 1P2IA 1W12U 1P9SA 1X7AC 2CHAB 1CT4E 2VIDA 1TB6H 5A8YA 3RC4A 3SGBE 1ESBA 1S83A 3BSQA 2ZU1A 4NG9H 1O32A 4CBOA 4BTUB 2P3UB 3MO9A 1N8OB 4BOHA 3E0NB 3D65E 1THRH 2BX4A 2GDEH 2BDYA 1XUKA 1MAXA 2CF8H 4CH2B 3JZ2B 5C5OA 1A5IA 1LHGH 1EX3A 4NWKA 1UVOA 1E34B 5EQRA 4I8KA 2BD5A 1O3CA 3RXRA 2G4TA 1W2KH 1MTVA 1MU8B 1FI8A 1HCGA 3BG4C 1FY8E 4NSVA 5JB9S 3GICB 5C5NA 3RXKA 1SMFE 2ZFTA 2ZHFH 3A88A 1EXFA 3TJNA 1ZSKA 1TGNA 3TPIZ 4X8VH 3ATLA 3KQCA 1V2WT 1GI7B 1DS2E 2A31A 4RKJB 4QT8C 1YPKH 1GHZA 1AFQB 4YT6H 1V2ST 3DFJA 4NZLA 3MH7A 2VIOA 1EASA 3S9BA 5EW2H 5SGAE 2AFQB 1AB9B 5LH8A 4LK4A 4X2WA 2AIQA 3M35A 3AAVA 1DSUA 1CVWH 1XKBC 8GCHG 3TNTA 4IC6A 1YPEH 1ETRH 1LVBA 3GCHB 2C93B 3S9AA 2SNWA 1TLDA 2A32A 4XBDA 2J4IA 2G5VA 2GT8A 3P8GA 5DKMA 3SN8A 1DT2A 1LHFH 1YLCA 2ZDVH 3BG4B 1CO7E 5E2OA 2DE8A 1SQAA 2QN5T 3SV8A 1O5BB 1AGJA 3RLYH 5DP7A 4Y0ZE 1FV9A 2Y5GA 3Q76A 4OS6A 1O2JA 1UTKA 3GY4A 1HYLA 1C1SA 2FZZA 2TGTA 3ELAH 1P2OA 1O38A 1IQGA 5HGGA 1O3EA 1KLIH 4UFEH 1TOMH 6CHAC 1DVAH 3EAJA 1MD7A 3I77A 2A1DB 5AHGH 2A4QA 2AGEX 3LGTA 1RTLA 2R0KA 2A4GA 1GJ9B 3RXQA 3R3GB 1Z8GA 4LZ1H 4UFGH 1LVMA 2TPIZ 1MU6B 1W3CA 1CA0C 3LGIA 1P12E 4DURA 1SHHB 4DCDA 1VCQA 1BMLA 1GMCF 2VGCC 1K21H 2CMYA 1O31A 4JZIA 2J34A 5DP9A 4UFFH 4B74A 3LJJA 2G8TA 3PMBB 3HK6B 2ZO3H 3P95A 1S0QA 3S69A 1ZPZA 2Y7XA 1K2I1 3CENA 5HM9A 1K1OA 3BTFE 3BTWE 1KTTB 1BQYA 1A46H 4U32A 3TH3H 2NU2E 1AZZA 1TRYA 3A7YA 3A8AA 4M7GA 1SB1H 2ALVA 1FMGA 4FUJA 1GDNA 4CR9A 1GI1A 1LPKB 2UUJB 4WF8A 3B23B 3PO1C 1IQFA 4WVPE 3ZZ3A 2HRVA 2IOTA 3U1IB 1P2QA 4A5TS 4XBCA 4ISHH 3LGWA 3T26A 3VB5A 1KIGH 1S84A 1PQ5A 2Q1JA 2QXIA 4INHA 1NRPH 2FESH 1G3EA 3PYHA 4NGAH 5EOKA 1O37A 1Q3XA 4FUGA 1ZMJA 1GDUA 5A0AE 4OS2A 1O3GA 1OWHA 2Z6BD 3D49H 1HAYB 2H1UA 3ATWA 1VITF 3FP7E 4D8NA 3KQDA 1AE5A 2BYAX 1E35B 3GCTG 3T27A 3RUOA 1NU7B 1NS3A 1EAIA 1GHBF 2G81E 3QTVH 1ELEE 2GMTC 2QGRA 2TGAA 1A5GH 3ODFA 2GV6A 1G2MA 2Y7ZA 4AOQA 3T62A 3MU1A 4MNWA 2KAIA 2UWLA 3H7OA 1IQKA 4YOIA 2ALPA 2BDBA 3ZZ7A 1DM4B 2A4RA 1W14U 1EATA 3IITA 4I8HA 5F6MA 3PTBA 2XBVA 5FXLA 4J2YB 1LVOA 4BAHB 3UWIA 4U2WA 1PQAA 1A0LA 2BHGA 1WOFA 2PKAA 1C1OA 1RD3B 3OSYA 2ZFFH 2ZI2H 1SBWA 2ANYA 1QJ7B 2SGQE 1FAKH 2VU8E 1P2JA 1ZTJA 3NXPA 1KDQA 2FP7B 5DP8A 1GL0E 4TWYA 2B9LA 2WV4A 2BTCE 3UQVA 7KMEH 5EODA 2J9NA 1TA2A 1ZRKA 4D76A 1GCTB 3PROA 1O39A 1BUIA 4Y7AA 1K28D 3P17H 2Z9JA 2TGDA 1BDAA 4WWYA 1C2EA 1C1RA 4ZXYH 1V6DA 1H8DH 2QXHA 3PLPA 5C20A 1AUTC 1YGCH 1A0JA 2QF0A 1L1GA 1MBMA 3E90B 1YCPK 2D8WA 3KEEA 5FBIA 4D7FA 3GY6A 4D9RA 2FI3E 4WH8A 1DY8A 1W10U 1ORFA 1HV7A 1VZQH 1SQOA 1MBQA 2C8ZB 3RMMH 1XVOA 2ZECA 1OOKB 3BTDE 1ID5H 1HJ9A 2VJ1A 3A89A 3BG8A 4H6TA 3SJIA 1KYNA 3URCA 1QURH 1JIRA 1GHYH 4UE7H 5A2MH 4SGAE 4Y11E 2QC2A 1QJ6B 1CE5A 2XCFA 1UVUH 5EPNA 3A85A 2K1QA 1NRSH 1F5RA 1NESE 1C5ZB 1AKSB 1LO6A 2FS9A 1C4V2 1UTMA 3EE0B 1GMCG 3UR9A 3MHWU 1SLWB 3S7HB 4E7RG 3STIA 5JBBS 4B73A 2QYIA 4GAWA 2VGCB 2V35A 3A87A 1C5XB 4ABEA 4TY7A 1G2LA