2O8UA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q/s195a) in complex with inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
245
structure length
238
Chain Sequence
IIGGEFTTIENQPWFAAIYRRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDAGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase plasminogen activator
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
total genus 53
structure length 238
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8uA01
2WPKS 3CS0A 3S9BA 1HAHH 2FEQH 4NWKA 4I8JA 1ELCA 1GBLA 2UWLA 3ZVDA 3RXUA 3LOXA 3A7YA 4UFDH 2C8YB 2VGCB 4CH8B 1HJ8A 1F2SE 3HGPA 1DX5M 1O3BA 2PTCE 1C2FA 4KP0A 1ARBA 1PYTC 3F9GA 1N8OC 5ABWA 7GCHG 1BDAA 2ZU5A 3H7OA 2ZC9H 4B73A 2ZFFH 3KN2A 1GHAF 1O35A 4XDEA 2VWMA 4FUGA 2FPZA 1HAOH 2J38A 3BV9B 1BA8B 1CO7E 1ZGVA 1O2YA 1W10U 3F9FA 3LGTA 1MZAA 5DP5A 2FWWA 4NIWA 4JK6A 2CXVA 1CBWB 4OS7A 1GBKA 3EYDA 3A7VA 1LPZB 2A31A 4I31A 3O8DA 1Y5AT 1SGTA 1C5SA 1GG6C 2RA0A 2F9PA 2K1QA 2R0KA 5C5OA 2G5VA 1YM0A 1ELAA 5JBTA 3FFGA 1WBGB 1XKAC 1BHXF 3SU2A 1QY6A 3E3TA 1B7XB 2FX6A 2XC4A 1ZSJA 3GYLB 2BD7A 3TJVA 4FVDA 1T8OA 5JB9S 2GTBA 1TOMH 1ELVA 4X1RU 3M5LA 4Y10E 2F9UA 5DO4H 1C5ZB 1NU9A 3FVFB 3LPRA 1EZQA 1BTWA 2TGPZ 3ZZ8A 5F8XA 2IOTA 1MD8A 1VITF 1J16A 1BTXA 2BLQA 2CF9H 4YESB 1TALA 3ATIA 1DOJA 4J1YA 1IQNA 1AD8H 4B75A 3M5MA 2Z6BD 2G5NA 4DT7B 2IPHA 3OU0A 3PB1E 1AFQC 2ZGHA 1PPEE 1SR5C 2FZZA 5DP7A 3ZV9A 3UREA 4X8TH 4FUBA 4CBNA 3MNBA 1BRCE 2HOBA 3OYPA 1K21H 2ZHDA 2BX4A 5LPRA 2G55A 2GT7A 4A92A 1W11U 7KMEH 3L3TA 3MMGA 4GHTA 1T4VH 4I8KA 1VJ9U 2FYQA 3V12A 5JYIA 3K9XB 1YKTA 1EJMA 4A1TA 2BDIA 4AFQA 3OY5U 3TITA 1C1TA 4A6LA 1GCDA 3HPTB 3RXQA 3TJNA 1AE8H 1CHOF 2NU4E 1TMUH 2BTCE 3U8RH 2EI8A 2JKHA 1YPMH 4U32A 1NROH 1NN6A 1LVBA 1EZUC 5F8TA 3TK9A 4OS6A 4XBDA 2WINI 5FX5A 1DWEH 4TY7A 2NU3E 3SUEA 2R3YA 3U8OH 3GYMA 3LDXH 1AO5A 5C2ZA 4UONA 3VB6A 3RLWH 2G00A 2OQUA 1TNKA 3JZ2B 4X0WU 2GMTB 1BBRK 1A1RA 4HTCH 3STJA 5FAHA 1V3XA 4BAOB 6CHAB 2PSXA 1AVXA 1A2CH 2VVCA 2Y80A 1XUHA 4Y76A 1S81A 3AASA 1W7XH 3SHCH 1MZDA 2P95A 1T7CA 1EP6A 1YLDA 2QXGA 1MKWH 2FOMB 4CHAC 8GCHF 1O5CB 1SLUB 1TNGA 5T6FA 1C5QA 1CA0C 1O5BB 1WV7H 1RXPA 4LXBH 4NIYA 2FIRH 1CT4E 2DE8A 5H4IB 3PROA 2M5TA 3PO1C 1X7AC 1O2RA 3MU1A 3RM2H 3SU5A 1Z7KA 1KXBA 3QGNB 1O34A 3TIUA 1KIGH 2A5AA 4B2CA 2GCHF 1ZHPA 1FZZA 1VITG 1LTOA 5GCHG 2FTMA 3BG4B 3LC3A 9LPRA 3V13A 1HLTH 3A8AA 1NRRH 2ANMH 3SGBE 1GHBG 1QQ4A 3UWIA 1TBZH 1TQ0B 1F5LA 4X6NA 3P8OA 2CJIA 4WJG2 1KXFA 1DXWA 3S69A 1SMFE 2JH0D 4K69A 1P2JA 1DSTA 1GJ6A 1IHTH 1ZHMA 1LVYA 1KYNA 1C5LH 2GZ8A 1UMAH 1INCA 2O8MA 4JZDH 1Y59T 1QNJA 1S83A 1GMCF 4CH2B 2Z9LA 1XUGA 1RD3B 1F5KU 1LHGH 3BIVH 3M36A 2HWLB 1ARCA 2WUCA 4O03A 2TGDA 4K3JA 4B71A 1QJ1B 3GY8A 2NU0E 2VU8E 3H7TA 1QA7A 1CHOG 1NTPA 1PQAA 3I78A 4ZKNU 1ZMLA 3TGJE 1GJ4H 1BB0B 1JIRA 1Y3WA 4MQAA 5C67A 1C2EA 2AGIX 4X1NU 4ABHA 4OS5A 1AU8A 4IC6A 3LONA 1KLTA 1C9TA 1K1MA 1JWTA 4FUJA 3ZZ7A 1KY9A 4K1SA 3A7ZA 1TNIA 4CRBA 3RU4E 4ISHH 2ASUB 2IN2A 1EAIA 2B7DH 2YNBA 1C5YB 1ELBA 1NFYA 2ZDKA 2XBVA 1AE5A 1THRH 1UCYE 5T6GA 4IW4E 1P9SA 3STIA 1TRNA 4TPIZ 3B23B 2YOLA 4NIXA 1NESE 4KTUA 2PKSC 1EPTC 1DWBH 3RMMH 8GCHG 5E8EH 1GMHF 1VGCB 4MTBA 2ZQ1A 3AVZA 1O5AB 2IJOB 2ZFSA 4X2YA 5EQQA 2QC2A 3RMOH 5BRRE 2B9LA 2GV7A 3ZZDA 4F49A 5L2YH 1YPHC 4MPWA 2QA9E 3SJ8A 1W2KH 4Q7YA 4NGAH 1P3CA 2UUFB 4CREA 4E7NA 3S7HB 1PQ5A 2R2MB 3SJ9A 2VVVA 2GCHG 2JETC 1QRWA 3MNSA 3K2UA 3VGCC 4YO9A 1O2OA 1TX8A 3RU4D 3P8GA 1FIWA 3UY9A 3PLBA 2I6QA 2ZPRA 4UE7H 2O8LA 2TPIZ 1TPAE 1Z8RA 4I8HA 1TB6H 1W14U 2J92A 4K60A 5L2ZH 2Z3EA 1GL0E 1QJ7B 3BIUH 5IYTA 1QTFA 1KDQA 1P04A 1YC0A 2BDGA 5FCRA 3NZIA 1EJAA 1YCPM 2F83A 1C5VA 1HAGE 2PKAA 4AB8A 2GDEH 2H6MA 4BXSA 2G4TA 2A4OA 1WSSH 3B9FH 1UVTH 3EA8A 1GI7B 3ITIA 3T26A 3LJOA 4NFEA 2GDDA 4CRFA 3HK6B 2ODQA 1ETRH 1RS0A 2P8OB 3S7KB 2XWAA 5HGGA 2BY5X 1W0ZU 3I77A 2WPLS 4BAQB 1KSNA 1TA2A 4Y7BA 4O97A 4KELA 1LMWB 3P6ZB 2UUKB 1V2NT 4AFZA 2OQ5A 2CGAA 3F6UH 1EAXA 3GCOA 1DY8A 4OS1A 4JZIA 2CHAC 3M7TA 3KQDA 3BG8A 1B0EA 4TYDA 1JRTA 2BD3A 1J9CH 3ODDA 4XE4A 1TQ7B 1VCWA 1LVMA 4B1TA 3D23A 1DITH 1TX6A 1P9UA 1SGCA 1D3QB 1VR1H 2J9NA 4JZFH 2O8WA 3BEFB 1SGFG 1OWIA 4HZHA 4WMFA 1NRSH 5DP3A 4Y6DA 2A2QH 1LHDH 2WUBA 1QB9A 1U6QA 3Q3YA 2A45B 2PFEA 1OWJA 1W3CA 3ZYEA 5BPEA 1BTPA 3RU4T 3MH7A 1HFDA 3RP2A 1BUIA 4YT7H 3PTBA 1B5GH 4H6SB 1GMHG 2VIVA 1MD7A 2P94A 4Y11E 3SV8A 1GI3A 1O2HA 4D9RA 2A1DB 2Z9IA 2BDAA 2SGDE 2AGEX 1LO6A 1YPGH 2ZU1A 1O37A 1RTFB 4IMZA 2THFB 1MAYA 2XTTB 2HPPH 3LGYA 3KCGH 4BAKB 2QAAA 4BTIB 2BB4A 2XNIA 1K28D 2ZGBH 1N6YA 1C1MA 1GGDC 3U1JB 3SUFA 3UNQA 3Q77A 1FPCH 2ZF0H 3A8CA 4KGAA 3SNCA 2W7UA 2BLOA 1GBEA 3CP7A 3SO3A 3R3GB 4E05H 2JH5D 2ZCKP 1GMDF 3AAVA 3P17H 3SNBA 1NFWA 1G3CA 2FXRA 2HRVA 3RXJA 1ELTA 3UFAA 3UIRA 1G36A 3SBKA 3UUZA 1ANCA 2BY9X 4OS2A 1HB0B 2FI4E 2R0LA 2FX4A 2ILNA 3C1KA 3EDXB 1ZRBA 2C8WB 3IWMA 1KDQB 3SZNA 3EQ0H 3MO9A 2PKAB 3RXCA 1ZTKA 3FP8E 4ZH8A 2AMPA 2BMGB 1TPPA 4DIIH 2OXSA 1F0UA 4FUHA 1FV9A 1DUEA 1ABJH 4X8UH 4Q80A 3R0FA 2BXTH 1L1JA 2BXUH 2EC9H 1V2PT 2F9OA 4DCDA 1TRYA 5DP8A 1FN8A 4OS4A 3A88A 3URCA 2BD4A 1ORFA 4RKOB 3KGPA 1ELFA 3GCNA 1N8OB 1IQMA 1JXPA 1D6RA 1GWAA 4YT6H 2XWBI 3M37A 1O2GH 1GBMA 1S0RA 2AMDA 1QIXB 2ZDMA 1HXEH 1O3EA 4NWLA 1C1QA 1NRPH 1WYKA 3F1SB 2PV9B 1HAIH 1QRXA 3ZZ6A 2VWOA 2F9VA 3A7WA 4ISIH 1C2IA 1OP2A 3LU9B 1Y5BT 3NKKA 1LHEH 1GI8B 3BSQA 2ALPA 3ZZ9A 3S9CA 1P2IA 4ABAA 1J14A 1FLEE 1J15A 1TE0A 1D4PB 3O8RA 1K1PA 1BBRH 1S85A 1Y3XA 1H4WA 2VIPA 3EGKH 1GG6B 3DFJA 1TGCA 1VJAU 1OWHA 1P09A 1ZPBA 3RXGA 2AYWA 1JRSA 4X1PU 3SNEA 1F7ZA 1MMJN 2QV1A 1TPOA 1UTMA 2H1UA 1T32A 4NCYA 4YM9A 3O8CA 1BRBE 4D76A 5C1UA 1TAWA 1UK2A 2ANYA 5GXPA 2RCEA 3D62A 2BDCA 1YYY1 1ESBA 2B0FA 2A7HA 2A4GA 3RXKA 1SGIB 1C2GA 3TU7H 3E91A 4Y0ZE 1SOZA 8KME2 3EAJA 3GCTF 1IQHA 2BY7X 1PPZA 1OWKA 2C93B 1GHZA 1HYLA 1JBUH 3HGNA 2ZFQH 4UD9H 3UNSA 1LPGB 3TH2H 4CRDA 1AFQB 1O2XA 3IG6B 3VPKA 1O3IA 3P8FA 4ZKOU 2LNCA 1K2I1 2V0BA 1QL9A 1O2UA 4FU9A 4ZXYH 1L2EA 4DG4A 3E6PH 2Z3CA 1WTGH 1GDQA 2PHBA 4VGCB 1LHCH 2BDBA 2FOFA 1GBCA 3RLYH 3F9HA 1DM4B 1YPJH 1TBQH 1OP8A 4HGCA 2BD9A 1ZZZA 2P16A 3MNXA 3QTVH 1YPEH 1FN6A 1K1NA 1O2PA 1GHYH 3GISB 5AHGH 2UWOA 1FAXA 2PLXA 3QUMP 4UFEH 1QGFA 3H5CB 4MVNA 1QFKH 1AHTH 1HUTH 4UFFH 3SV6A 1E37B 2BDHA 1NRNH 3A8BA 1FMGA 3A80A 1MTVA 2Q6DA 1A0HB 2ZWLH 5EU8A 1YPHE 1SGPE 1HNEE 4DY7B 2BLVA 1SL3A 1VZQH 3ZYDA 1O3CA 2WYGA 2H9EH 1AGJA 4GAWA 2Z9GA 1HAXB 2ZGCA 1IQKA 3TVJB 3EA7A 3NWUA 3L33A 1C1SA 1MTNC 4K8BA 1OSSA 3DA9B 1EPTA 1ZSLA 4SGBE 3PMBB 1T8NA 2STBE 2G8TA 4JYTA 2WPJS 1EXFA 4NA9H 1A61H 4BTUB 5C3NA 1TLDA 1O2MA 5GJ4B 1IQLA 2ZEBA 1CU1A 3MWIU 2XYAA 1LKAA 1ELEE 2FLRH 1SGFA 3ZVGA 2FOGA 1PFXC 2OINA 3SJOA 4X6OA 1OP0A 3ATMA 1F0SA 1MKXH 1KXDA 4DVAU 3A8DA 3M61U 4Y0YE 5JBCS 2PWXA 1IQFA 4F4OC 1CBWC 3A83A 2D1JA 4GCHF 2FS9A 3LJJA 4AGKA 1KLIH 2RA3A 1HAVA 3SI4H 2GZ9A 4JYUH 1V2ST 5DKMA 1MBMA 1YP9A 3ZZ4A 1ANDA 5LH8A 1GHAG 3SN8A 1M9UA 3LT3A 1IQJA 1O3AA 4ZKRU 1RIWB 2BDYA 1ESTA 3QK1A 1TPSA 3PV4A 4BAHB 3VXEH 1SOTA 2AIQA 4MPUA 4UFGH 3FAOA 1CT0E 1WAYB 1AUTC 1H1BA 2XW9A 3PWBA 1S5SA 4LZ1H 1SC8U 2O8UA 1BMMH 3M3SA 4YLQH 1SBWA 2FOEA 3BTME 5HYOA 1ZJDA 2ZPSA 2R9PA 2TGAA 1BMAA 4K1TA 5EPNA 2QIQA 2FOAA 1G37A 1C1NA 1Z1IA 2FM2A 3W94A 4K8YA 3SU3A 2Y5FA 4WMDA 1GJCB 3NK8A 3QZRA 1XMNB 4Y7AA 1GJAB 1GBBA 5PTPA 2ZPQA 2ZO3H 4NA8A 1VCPA 2ZGXH 1A4WH 1NS3A 4ZHLU 1A5HA 3CENA 4AX9H 1A5GH 4Y8YA 2Y81A 3M3TA 2P3UB 3TH3H 2W5EA 3TJUA 1OKXA 3D65E 1S84A 2W7SA 4X8VH 1VITH 2WPMS 3M5OA 2FO9A 2AERH 3HK3B 3NUMA 1SGRE 1C5OH 2Y7ZA 2FP7B 3AW0A 9ESTA 3KQBA 3GICB 1DPOA 1FQ3A 2FI5E 1DSUA 3RC4A 3PLKA 3LIWA 5FBIA 4ZUHA 3E0NB 3QTOH 4D8NA 2QGRA 2AH4X 2FLBH 2VH0A 1UK3A 1MTWA 1QB6A 1JMOH 5DGJA 1QR3E 1OYTH 2ODPA 5F8ZA 1ZSKA 5EXNA 4BAMB 3MU5A 1HV7A 1SPJA 1ZR0A 3K6YA 3T28A 4GHQA 3A7XA 5EGMA 1HJAC 1SLXB 2OP9A 3UR6A 4KKDA 1EPTB 4O9VA 1AWHB 1TMTH 1BOQA 4NSVA 3VEQB 1GJ8B 1ZLRA 2QYIA 1IQIA 1JOUB 5A0CA 5FCKA 3MYWA 1A46H 2UWPA 1DDJA 3C27B 4BTTB 1UCYK 4BNRA 1Z8JB 4ISOA 2ZHWH 2BM2A 2H2ZA 1WTHD 1SGQE 2FOCA 2Z7FE 1HAPH 1MBQA 3RM0H 1G2MA 1MH0A 2GMTC 2J95A 3BF6H 3LGUA 4GCHG 5AF9H 2JETB 1FJSA 1D9IA 1MQ6A 3VGCB 5GIBA 3TK6A 1SI5H 4FUIA 1O2ZA 3TNSA 1O2LA 2Q6FA 1QQUA 3M7QA 2QY0B 1H9HE 2OBQA 5FPSA 1O5FH 1A7SA 1EJNA 1TGNA 4FUEA 5EXMA 3ATLA 1DWCH 5ETXA 1HAVB 1HRTH 3KIDU 5LPFA 3NPSA 5TJXA 1IQGA 5EXLA 7LPRA 1O2IA 1HBTH 3Q3XA 3SUDA 2WYJA 2ZU2A 3MO3A 1ZPZA 4A1VA 4LZ4B 5E2OA 3SORA 1AI8H 4FUFA 3DT0H 1ZOMA 5DP6A 1C4U2 2ZU4A 1BTHH 1C2MA 1ZHRA 5FXLA 2A5KA 4YTAA 1IHSH 1SB1H 1NFXA 2XCFA 3E8LA 1EOLA 4OGYA 3PTNA 3EE0B 1UTKA 5EW2H 4YOGA 3SGAE 3G01A 1D6WA 3S0NA 1FPHH 1EAWA 3SU0A 1GVLA 1CVWH 4THNH 4WY3A 1O30A 2BVRH 4UEHH 4ABDA 1AZ8A 3QLPH 3GDVA 3T27A 1AB9C 3WY8A 2P93A 4WXIA 1GCTC 2FMJA 1E35B 2ZA5A 1HDTH 1ZTLA 1MQ5A 1ESAA 1N6XA 2CHAB 3RXPA 2O8TA 1O2TA 4MNWA 1D3DB 3TNTA 5DK1A 3KEEA 1ZRKA 2SGQE 4ABIA 2Y5HA 1EB2A 1TGBA 5F6MA 5JPMH 3VFEA 3DD2H 4I7YH 2JH6D 3P8NA 1RTKA 1TOCB 1Z8GA 1GBIA 2GP9B 1CE5A 3AAUA 2ZP0H 1MCTA 3BTTE 1TGSZ 1EATA 4R8TB 1K1LA 2ZU3A 1O3OA 2FESH 2VB0A 3LGIA 5F03A 3ENSB 5E0JA 1EOJA 2ALVA 4X8SH 1E0FD 4WF8A 1V2VT 1KXAA 3RXLA 4R0IA 1SGDE 1E34B 2HALA 5IDKA 4Q7ZA 3VB7A 1GMCG 4GLYA 1WQVH 2ZCHP 2GCTC 3PMJA 5GPIB 5TCCA 2BY6X 1TX7A 1HJ9A 5EQSA 1LQDB 1O3MA 1C5TA 3RXDA 3FZZA 5ESBA 1O3GA 1GI1A 1N1LA 1O3LA 2GX4A 4FUCA 3SV2H 2QN5T 2P3TB 1UVPA 1TGTA 1OX1A 3EA9A 1C2JA 1O2QA 2GZ7A 2BQ6B 1C2DA 3RXAA 1DT2A 4I32A 1W0YH 5A8XA 1O31A 4HI3A 4CRCA 4AB9A 2F3CE 1T31A 5DJ7A 2NU1E 2QXJA 1IAUA 1VGCC 3GY5A 5DP9A 5A0AE 2XCNA 5GDSH 1O2KA 4IN1A 1UTOA 2ZG0H 1AMHA 1KLJH 1EQ9A 5K7RA 3ATWA 3M3VA 2TGTA 1GJDB 3E16B 1S6FA 1O33A 1V2LT 2XC0A 2WPIS 4WWYA 4X2WA 3RDZA 3A89A 3CS7A 1BT7A 2A4RA 1TNJA 2VVUA 3DUXH 2F9BH 2VNTA 1CQQA 3KQEA 4X2VA 3ZZCA 5CHAC 3D49H 1O2VA 3MH4A 4MG3A 1P2KA 3T62A 4BXWA 1Y3YA 4A1XA 2A0QB 1G32B 4FU8A 2OUAA 1ANEA 1BRUP 2I6SA 3RXRA 3KNXA 3A7TA 4XFQA 2VH6A 1V2OT 2CN0H 3UR9A 3RXOA 1S0QA 2ZFRH 4LOYH 1WU1A 4AORA 1MU6B 2H5CA 5C20A 1F5RA 1UHBA 4Y71A 3MU8A 1C5MD 4WXVA 1AFEH 1SGYE 4O3UA 1P2MA 1W13U 3JZ1B 3KL6A 1SQTA 2P3FH 2QXHA 1Z8IB 3M5NA 2D8WA 4NA7A 3KQCA 1W7GH 1YLCA 2ZFTA 1DLKB 3ZZBA 1FY8E 5K0HA 1D3PB 1UTLM 3GCHC 2G51A 1C4Y2 2PUXB 3A81A 3SNDA 4IGDA 4KTSA 1Y8TA 1BMLA 1P01A 2A7CA 2WV4A 3BN9A 2BHGA 3Q3KA 1A3EH 2ODYB 1GI4A 1PPCE 1UTQA 4YOJA 1P06A 3PWCA 1T8MA 1C2KA 1HCGA 1S82A 2Z9KA 3VB4A 1NT1A 1A0JA 4IN2A 4TWYA 1QRZA 3F9EA 1G3BA 2OC0A 4J2YB 5LPEA 3MNCA 1O3FA 2YNAA 4XSKU 1A3BH 3FP6E 1GI0A 3ZVFA 2B5TB 4XBCA 5L6NH 1GDNA 3BEIB 2D26C 4ISNA 1A5IA 1C2LA 1H8DH 2HPQH 3QN7A 1O2WA 5EOKA 2Y82A 3BTKE 3GY4A 4B74A 1NFUA 4MDSA 2ZNKH 2W3KA 3ZV8A 1P03A 1NC6A 1P2NA 2XBYA 1AKSA 2EEKA 3BTHE 2ZDAH 4AFUA 4K2YA 2AS9A 5HM2A 2QF0A 1G9IE 3S9AA 1V6DA 1BTUA 4ABJA 3HKJB 1BCUH 1O5DH 1GHWH 2TBSA 3SUGA 1F0TA 2VIDA 1C1PA 1SHHB 1HAYB 4TPYA 4X2XA 5DPAA 3P92A 1BTYA 4BANB 3TH4H 1GVZA 2G52A 4MNVA 2PTNA 3MH5A 2FTLE 3E1XB 1O2NA 1TMBH 1MAXA 4YLUA 4A5TS 3VXFH 1BJUA 4ZAEA 5EPYA 1GJ7B 4B76A 2C90B 1TONA 1V2TT 4RKJB 1V2QT 1LKBA 2CF8H 1E36B 3TK5A 1GVKB 4A7IB 2HLCA 5A0BA 4AFSA 4E06H 2EI6A 1GHVH 2BX3A 1BMNH 3NCLA 5AFZH 2V3HH 2OLGA 1PPHE 3MI4A 1P11E 4NFFA 3FANA 5E2PA 4X1QU 1BHXB 1GHXH 1GBAA 2SGPE 1MTNB 1GMDG 1V2RT 4GUXA 1UHBB 4DOQA 1TYNA 3URDA 3BTEE 5HXFA 4ZMAH 1DUAA 3RXBA 1AWFH 4D7GA 1C2HA 3U9AH 2BLWA 1BJVA 1WUNH 2Q6GA 1NU7B 5FBEA 2QF3A 1O3KA 1RTLA 1EP5A 4H42U 1G3EA 2C4FH 1V2JT 3GDUA 3SU6A 2WV5A 3SQEE 5JBBS 1XKBC 1BIOA 1EKBB 5AFYH 2A32A 1UCYH 2BOHB 1CHGA 1ELDE 5E0HA 1SLVB 1UTPA 3TLOA 1SQOA 3ODFA 1FY4A 2RG3A 2Y7XA 3LH3A 1FAKH 1GPZA 3A85A 2XRCA 1GDUA 1G2LA 2ZI2H 1GBFA 1HPGA 4JZEH 3UPEA 1Y3UA 5J4QA 4LK4A 4AZ2B 2A5IA 1SSXA 3RXHA 3ZVAA 2PGBB 2AEIH 4ZXXH 2FOBA 1ZTJA 1TWXB 2P59A 2VGCC 4JMYA 1ZJKA 1AKSB 2H9TH 1SFIA 3T5FH 2HNTF 1QA0A 1ZYOA 2F9NA 3OTJE 3SQHE 1NPMA 6GCHF 4CRAA 5GCHF 3I29A 1FXYA 4Q7XA 1KXEA 5CMXH 1Q31A 3SU4A 5A09A 1GHBF 1MTUA 4X1SU 4CHAB 3BTGE 1O0DH 3SNAA 1MCVA 1CA0B 1EX3A 4MNXA 4WVPE 1GJBB 4PROA 2EI7A 1ZPCA 3RC5A 3DHKH 1WQSA 2BZ6H 1O38A 1QJ6B 1V2KT 3QGJA 4NZQA 1TBRH 1QHRB 2VIWA 3Q76A 2XBWA 2NWNA 4MNYA 3PO1B 2HNTC 3GDSA 3BTQE 5C1XA 3ZVCA 1V2WT 2SFAA 4VGCC 1RFNA 1ACBE 1KTTB 2Z94A 3TGIE 1H9LB 1AVWA 3MTYA 3GCTG 3NXPA 1C5NH 1YBWA 4FUDA 2ANKH 1DLEA 3BEUA 1C1OA 1G3DA 4CR5A 5I46H 3ZVBA 2OC7A 4H4FA 1MTSA 2ZTYA 1SLWB 2SGEE 5AVDA 2VIQA 3V3MA 3UWJH 4B2AA 1XX9A 2C8ZB 1HJAB 3RXEA 1C9PA 1H8IH 1O3HA 1OOKB 1ABIH 1NY22 1FI8A 1OXGA 1XVOA 4ABEA 1SVPA 3A86A 1KTSB 2GVFA 1TIOA 6LPRA 3F68H 4XOJA 3W95A 4JCNA 1WCZA 4SGAE 1A0LA 1FY1A 1YCPK 2KAIA 2ZECA 1YPKH 1C5PA 1P0SH 1P2OA 1TRMA 4NIVA 6ESTA 4E7RG 5EODA 3SU1A 1S6HA 1Z1JA 4X6PA 2V6NA 2BD8A 2G81E 1FIZA 2DUCA 3MOCA 3HKIB 1TABE 1HIAA 2ZGJA 3SW2B 5GWZA 2DE9A 5C5NA 3UTUH 1UVSH 2BVXH 3PM3A 5EQRA 3V0XA 3RMLH 2SNWA 1GI2A 3AW1A 3LGWA 2AIPA 1XUKA 1QBNA 1C1RA 1P2QA 3T29A 3MO6A 1K22H 4TY6A 1LCYA 3MU4A 4U30A 5A8ZA 1ZMNA 6GCHG 3VB3A 3ZVEA 3ZZAA 2BVSH 4INHA 3P95A 3PMHB 3RXVA 2J4IA 1T8LA 2GKVE 4IS5A 2TIOA 1O3DA 2ZDNA 1GBDA 2PKSB 4Z0KA 1BBRE 3OY6U 2CV3A 1RRKA 4ZROA 1RIWC 3ESTA 3SGQE 4MPVA 2PW8H 2V3OH 2J94A 4NZLA 2PSYA 2OC8A 2AGGX 1AB9B 3U69H 3TGKE 1T4UH 1GCTB 1GBJA 2C8XB 2D2DA 1XUFA 3SJKA 3U1IB 4UDWH 4CRGA 1O32A 6CHAC 1LPKB 3IITA 4ISLA 5HMAA 3T2NA 1DS2E 3V7TA 1UTNA 2ZHEH 4DJZB 4B2BA 1AUJA 1SHYA 1KXCA 3RXSA 2XC5A 3RXFA 4ZHMU 2AMQA 4I33A 1AY6H 1C5RA 2ANWA 1NO9H 2FYRA 1AIXH 4Y8ZA 2FI3E 1THSH 3BTDE 1TNLA 2XBXA 4KTCA 1QB1A 3ATKA 3QO6A 1C5UA 1C1UH 1P3EA 4JYVH 4XBBA 4WH8A 4INKA 3M7UA 1FONA 4X6MA 4DGJA 2FDAA 3PLPA 3SHAH 2LPRA 2W26A 2G4UA 3BG4C 2QXIA 1HXFH 1EZSC 1OWEA 3MH6A 2GCTB 4GSOA 4WH6A 1OWDA 1V2UT 1LQEA 4K1EA 1XXFA 1RGQA 2GT8A 5C1YA 1L4DA 1GBHA 1RJXB 1D3TB 1QL8A 1V2MT 1L1GA 2VINA 2ZHFH 1QBOA 2Y6TA 3QZQA 1QURH 4YOIA 2GD4B 3SV9A 2OTVA 1AN1E 1LVOA 1ANBA 2ESTE 2UUJB 1FY3A 1O5GH 2SGFE 3OSYA 4AYYB 1DWDH 4I8GA 5EG4A 4ASHA 1AVGH 1IQEA 3UOPA 3UOUA 2ZTXA 1MKXK 3MFJA 1C5XB 2ZFPH 4JZ1A 2KAIB 1C4V2 2EA3A 1F92A 1OPHB 4H6TA 1MUEB 2ZDVH 2R2WU 3UQVA 5EW1H 4I8LA 3GY2A 1PJPA 4TWWA 3O8BA 5JBAS 3QX5H 3U8TH 1L1NA 2BD2A 3E0PB 5FPTA 5ESTE 4ABFA 1EB1H 4Z6AH 1HIAB 2H9HA 1FNIA 2SNVA 2F91A 3PMAB 4D7FA 2A7JA 1XXDA 2GGVB 2PGQB 3MHWU 3LGVA 3T25A 2CMYA 1C1WH 1FUJA 8ESTE 2OBOA 5CHAB 2TRMA 4ABGA 4CR9A 1LDTT 1GJ9B 1HGTH 2B8OH 1P57B 2V35A 1FDPA 3BTFE 2ZKSA 4AGJA 1BQYA 1ID5H 3P70B 2W3IA 2OD3B 1MU8B 1O5EH 1ETSH 1TFXA 1Y3VA 3L6PA 1W8BH 4ESTE 1O3JA 2PR3A 1P02A 1BZXE 1TA6A 1EUFA 1GBTA 1QL7A 3K6ZA 3N7OA 5G4BA 1GGDB 2SGAA 1GI6A 2ZDLA 1DFPA 5E0GA 1YPLH 2BQ7B 1MKWK 5B6OA 5J4SA 1BTZA 1NM6A 3B8JA 1SG8B 5I25A 3LH1A 2UUYA 1QCPA 2VWNA 3HATH 3GCHB 3KHVA 3Q00A 7ESTE 2VWLA 1DVAH 1PYTD 3TPIZ 4NG9H 3FZDA 2ZZUH 1EAUA 1Q3XA 1PPFE 3RXIA 1PQ7A 1ETTH 1TNHA 2ZQ2A 3LC5A 3SI3H 4AOQA 3ZZ5A 4OGXA 4O3TA 1DXPA 5DP4A 2Q1JA 4D9QA 1ZGIA 3GOVB 3FP7E 5FPYA 4CBOA 1UK4A 1CA8B 3GY7A 2XXLA 4AG1A 1DANH 2HGTH 4IC5A 1GJ5H 2STAE 3DFLA 2VJ1A 4ZHAA 1AZZA 1IOEA 2Z9JA 2AFQB 3UQOA 1SQAA 2ZHQH 4FVBA 4INLA 4DIHH 1J17T 2Z3DA 4MLFB 2BZAA 4FU7A 1Q2WA 4ZKSU 4K5ZA 1C5WB 2HNTE 1CSOE 4JK5A 3M35A 1K1JA 2QCYA 2FOHA 2P8OC 3E90B 1DY9A 3QDZB 1THPB 4AG2A 1DE7H 1DICA 1CGHA 1GL1A 1UVOA 1Z6EA 1VCQA 1O3NA 1CT2E 2J2UA 1P10A 2GV6A 3OX7U 2BY8X 4RSPA 1Z71A 2O9QA 2NU2E 3U98H 1H9IE 1SFQB 1SGEE 2BYAX 1P05A 1Z6JH 3RXTA 7GCHF 1O36A 1BRAA 5DG6A 1GI5A 3LKWA 1LHFH 5HM9A 2H5DA 2PUQH 3A84A 4DW2U 1XUJA 1PPGE 4U2WA 4RN6A 5JDUB 2ZTZA 4Q2KA 2ZIQH 1L4ZA 1O39A 2WPHS 3A82A 4YZUA 1K1OA 1OS8A 4HFPB 4NSYA 2A4QA 1O3PB 1W12U 1L0ZA 4AYVB 4DURA 1J8AA 5A8YA 3ZZ3A 4BOHA 3K65B 3ELAH 2J34A 1UO6A 3KF2A 2HVXA 3RXMA 8LPRA 3SOSA 3RC6A 4Y79A 1NRQH 1O2SA 1QBVH 1EASA 3SJIA 3SV7A 4WMEA 1E38B 2FODA 3TJOA 4GVUA 1G30B 1ELGA 4M7GA 1XM1A 3VB5A 2RDLA 3RUOA 4IMQA 1NZQH 1AQ7A 4GPGA 3PYHA 1CGJE 3RMNH 1C1VH 1UTJA 4U01A 1PPBH 2A2XH 1XVMA 3MU0A 3GY6A 2BQWB 2C3SA 4AN7A 1XUIA 4IBLH 1HAZB 3A87A 5FHTA 1O2JA 1WOFA 1K1IA 5T6DA 1CGIE 1EZXC 4QT8C 5T3HA 1P8VC 5LGOA 1GI9B 1YF4A 2R3UA 2ZCLP 3GY3A 2Y5GA 1K9OE 2BOKA 4Y8XA 3QWCH 5SGAE 1P12E 2FS8A 1OYQA 4FXGH 1YCPH 5CE1A 1F0RA 1ZMJA 1YGCH 1B0FA 1BITA 1PQ8A 5L30H 3UNRA 2OC1A 5A2MH 1UJ1A 2OCVB 3BTWE 5FX6A 2ULLA 5TCAA 1UVUH 1FY5A 2VIOA 2BD5A 1SGNE 4ABBA 4MPXA 1JIMA 1Y5UT 5JB8S
chains in the Genus database with same CATH superfamily
2WPKS 3CS0A 3S9BA 1HAHH 2FEQH 4NWKA 4I8JA 1ELCA 1GBLA 2UWLA 3ZVDA 3RXUA 3LOXA 3A7YA 4Q63A 4UFDH 2C8YB 2VGCB 4CH8B 1HJ8A 1F2SE 3HGPA 1DX5M 1O3BA 2PTCE 1C2FA 4KP0A 1ARBA 1PYTC 3F9GA 1N8OC 5ABWA 7GCHG 1BDAA 2ZU5A 3H7OA 2ZC9H 2KFWA 4B73A 2ZFFH 3KN2A 1GHAF 1O35A 4XDEA 2VWMA 4FUGA 2FPZA 1HAOH 2J38A 3BV9B 1BA8B 1CO7E 1ZGVA 1O2YA 1W10U 2YMSD 3F9FA 3LGTA 1MZAA 5DP5A 2FWWA 4NIWA 4JK6A 2CXVA 1CBWB 4OS7A 1GBKA 3EYDA 3A7VA 1LPZB 2A31A 4I31A 3O8DA 1Y5AT 5KEDA 1SGTA 1C5SA 1GG6C 2RA0A 4XD7D 2F9PA 2K1QA 2R0KA 5C5OA 2G5VA 1YM0A 1ELAA 5JBTA 3FFGA 1WBGB 1XKAC 1BHXF 3SU2A 1QY6A 3E3TA 1B7XB 2FX6A 2XC4A 1ZSJA 3GYLB 2BD7A 3TJVA 4FVDA 3F2GA 1T8OA 5JB9S 2GTBA 1TOMH 1ELVA 4X1RU 1S6LA 3M5LA 4Y10E 2F9UA 5DO4H 1C5ZB 1NU9A 3FVFB 3LPRA 1EZQA 1BTWA 2TGPZ 3ZZ8A 5F8XA 2IOTA 1MD8A 1VITF 1J16A 1BTXA 2BLQA 2CF9H 4YESB 1TALA 3ATIA 1DOJA 4J1YA 1IQNA 1AD8H 4B75A 3M5MA 2Z6BD 2G5NA 4DT7B 2IPHA 3OU0A 3PB1E 2JJ1D 1AFQC 2ZGHA 1PPEE 1SR5C 2FZZA 5DP7A 3ZV9A 3UREA 4X8TH 4FUBA 4CBNA 3MNBA 1BRCE 2HOBA 3OYPA 1K21H 2ZHDA 2BX4A 5C17A 5LPRA 5C94A 2G55A 2GT7A 4A92A 1W11U 7KMEH 3L3TA 3MMGA 4GHTA 1T4VH 4I8KA 1VJ9U 2FYQA 3V12A 5JYIA 3K9XB 1YKTA 1EJMA 4A1TA 2BDIA 4AFQA 3OY5U 3TITA 1C1TA 4A6LA 1GCDA 3HPTB 3RXQA 3TJNA 1AE8H 1CHOF 2NU4E 3N99A 1TMUH 2BTCE 3U8RH 2EI8A 2JKHA 1YPMH 4U32A 1NROH 1NN6A 1LVBA 1EZUC 5F8TA 5F53A 3TK9A 4OS6A 4XBDA 2WINI 5FX5A 1DWEH 4P02A 4TY7A 2NU3E 3SUEA 2R3YA 3U8OH 3GYMA 3LDXH 1AO5A 5C2ZA 4UONA 3KYFA 3VB6A 3RLWH 2G00A 2OQUA 1TNKA 3JZ2B 4X0WU 2GMTB 1BBRK 3UB0A 1A1RA 4HTCH 3STJA 5FAHA 1V3XA 4BAOB 6CHAB 2PSXA 1AVXA 1A2CH 2VVCA 2Y80A 1XUHA 4Y76A 1S81A 3AASA 1W7XH 3SHCH 1MZDA 2P95A 1T7CA 1EP6A 1SQRA 1YLDA 1MKWH 2FOMB 2QXGA 3WW7A 4CHAC 8GCHF 1O5CB 1SLUB 1TNGA 5T6FA 1C5QA 1CA0C 1O5BB 1WV7H 1RXPA 4LXBH 4NIYA 2FIRH 1CT4E 2DE8A 5H4IB 3PROA 2M5TA 3PO1C 1X7AC 1O2RA 3DSOA 3MU1A 3RM2H 3SU5A 1Z7KA 1KXBA 3QGNB 1O34A 3TIUA 1W0JD 4YXWD 1KIGH 2A5AA 4B2CA 2GCHF 1ZHPA 1FZZA 1VITG 1LTOA 5GCHG 2FTMA 3BG4B 3LC3A 9LPRA 3V13A 1HLTH 3A8AA 1NRRH 2ANMH 3SGBE 1GHBG 1QQ4A 3UWIA 3WWFA 1TBZH 1TQ0B 1F5LA 4X6NA 3P8OA 2CJIA 4WJG2 1W0KD 1KXFA 1DXWA 3S69A 1SMFE 2JH0D 4K69A 1P2JA 1DSTA 1GJ6A 2YMSC 1IHTH 1ZHMA 1LVYA 1KYNA 1C5LH 2GZ8A 1UMAH 1INCA 2O8MA 4JZDH 1Y59T 1QNJA 1S83A 1GMCF 4CH2B 2Z9LA 1XUGA 1RD3B 3N7EA 3KQ5A 1F5KU 1LHGH 3BIVH 3M36A 2HWLB 1ARCA 2WUCA 4O03A 2TGDA 4K3JA 4B71A 1QJ1B 3GY8A 2NU0E 2VU8E 3H7TA 1QA7A 1CHOG 1NTPA 1PQAA 3I78A 4ZKNU 1ZMLA 3TGJE 1GJ4H 1BB0B 1JIRA 1Y3WA 4MQAA 2V3MA 5C67A 1C2EA 4OM9A 2AGIX 4X1NU 4ABHA 4OS5A 1AU8A 1QZ8A 4IC6A 3LONA 1KLTA 1C9TA 1K1MA 1JWTA 4FUJA 3ZZ7A 1KY9A 4K1SA 3A7ZA 1TNIA 4CRBA 2KX4A 3RU4E 4ISHH 2W6ID 2ASUB 2IN2A 1EAIA 2B7DH 2YNBA 1C5YB 1ELBA 1NFYA 2ZDKA 2XBVA 1AE5A 1THRH 1UCYE 5T6GA 4IW4E 1P9SA 3STIA 1TRNA 4TPIZ 2IPQX 3B23B 2YOLA 4NIXA 1NESE 2WSSD 4KTUA 2PKSC 1EPTC 1DWBH 3RMMH 8GCHG 5E8EH 1GMHF 1VGCB 4MTBA 2ZQ1A 3AVZA 1O5AB 2IJOB 2ZFSA 4X2YA 5EQQA 2QC2A 3RMOH 5BRRE 2B9LA 2GV7A 3ZZDA 4F49A 5L2YH 1YPHC 4MPWA 2QA9E 3SJ8A 1W2KH 4Q7YA 4NGAH 1P3CA 2UUFB 4CREA 4E7NA 3S7HB 1PQ5A 5C0TA 2R2MB 3SJ9A 2VVVA 2GCHG 2JETC 1QRWA 3MNSA 3K2UA 3VGCC 4YO9A 1O2OA 1TX8A 3RU4D 3PV2A 3P8GA 1FIWA 3UY9A 3PLBA 2I6QA 2ZPRA 2QF4A 4UE7H 2F4LA 2O8LA 2TPIZ 1TPAE 1Z8RA 4I8HA 1TB6H 1W14U 2J92A 4K60A 5L2ZH 2Z3EA 1GL0E 1FX0B 1QJ7B 3BIUH 5IYTA 1QTFA 1KDQA 1P04A 1YC0A 2BDGA 5FCRA 3NZIA 1EJAA 1YCPM 2F83A 1C5VA 1HAGE 2PKAA 4AB8A 2GDEH 2H6MA 4BXSA 2G4TA 2A4OA 1WSSH 3B9FH 1UVTH 3EA8A 1GI7B 3ITIA 3T26A 3LJOA 4NFEA 2GDDA 4CRFA 3HK6B 2ODQA 1ETRH 1RS0A 2P8OB 3S7KB 2XWAA 5HGGA 2BY5X 1W0ZU 3I77A 2WPLS 4BAQB 1KSNA 1TA2A 5DN6D 4Y7BA 4O97A 4KELA 1LMWB 3P6ZB 2UUKB 1V2NT 4AFZA 3VG8A 2OQ5A 1UW7A 2CGAA 3F6UH 1EAXA 3GCOA 1DY8A 4OS1A 2JJ2D 4JZIA 2CHAC 3M7TA 3KQDA 3BG8A 1B0EA 4TYDA 1JRTA 2BD3A 1J9CH 3ODDA 4XE4A 1TQ7B 1VCWA 1LVMA 4B1TA 3D23A 1DITH 1TX6A 1P9UA 1SGCA 1D3QB 1VR1H 2J9NA 4JZFH 2O8WA 3BEFB 1SGFG 1OWIA 4HZHA 4WMFA 1NRSH 5DP3A 4Y6DA 2A2QH 1LHDH 2WUBA 1QB9A 1E1QD 1U6QA 3Q3YA 2A45B 2PFEA 1OWJA 1W3CA 3ZYEA 5BPEA 4TSFD 1BTPA 3RU4T 3MH7A 4B6EA 1HFDA 3EE7A 3RP2A 1BUIA 4YT7H 3PTBA 1B5GH 4H6SB 1GMHG 2VIVA 1MD7A 2P94A 4Y11E 3SV8A 1GI3A 1O2HA 2XNDD 4D9RA 2A1DB 2Z9IA 2BDAA 2SGDE 2AGEX 1LO6A 1YPGH 2ZU1A 1O37A 1RTFB 4IMZA 1EFRD 2THFB 1MAYA 2XTTB 2HPPH 3LGYA 3KCGH 4BAKB 2QAAA 4BTIB 2BB4A 2XNIA 1K28D 2ZGBH 1N6YA 1C1MA 1GGDC 3U1JB 2LELA 3SUFA 3UNQA 3Q77A 1FPCH 2ZF0H 3A8CA 4KGAA 3SNCA 2W7UA 2BLOA 1GBEA 3CP7A 3SO3A 3R3GB 4E05H 2JH5D 2ZCKP 1GMDF 3AAVA 3P17H 3SNBA 1NFWA 1G3CA 2FXRA 2HRVA 3RXJA 1ELTA 3UFAA 3UIRA 1G36A 3SBKA 3UUZA 1OHHD 1ANCA 2BY9X 4OS2A 3OFND 1HB0B 2FI4E 2R0LA 2FX4A 2RFKC 2ILNA 3C1KA 3EDXB 1ZRBA 2C8WB 3IWMA 1KDQB 3SZNA 3EQ0H 3MO9A 5GNDA 2PKAB 3RXCA 1ZTKA 3FP8E 4ZH8A 2AMPA 2BMGB 1TPPA 4DIIH 1F0UA 2OXSA 4FUHA 1FV9A 1DUEA 1ABJH 4X8UH 4Q80A 3R0FA 2BXTH 1L1JA 2BXUH 2EC9H 1V2PT 2F9OA 4DCDA 1TRYA 5DP8A 1FN8A 4OS4A 3A88A 3URCA 2BD4A 1ORFA 4RKOB 3KGPA 1ELFA 3GCNA 1N8OB 1IQMA 1JXPA 1D6RA 1GWAA 4YT6H 3UAIC 2XWBI 3M37A 1O2GH 5EJLA 1GBMA 1S0RA 2AMDA 1QIXB 2ZDMA 1HXEH 1O3EA 4NWLA 1C1QA 1NRPH 1WYKA 3F1SB 2PV9B 1HAIH 1QRXA 3ZZ6A 2VWOA 2F9VA 5HKKD 3A7WA 4ISIH 1C2IA 1OP2A 3LU9B 1Y5BT 4I86A 3NKKA 5CHBA 1LHEH 1GI8B 3BSQA 2ALPA 3ZZ9A 3S9CA 1P2IA 4ABAA 1J14A 3FKSD 1FLEE 1J15A 1BMFD 1TE0A 1D4PB 3O8RA 1K1PA 1MABB 1BBRH 1S85A 1Y3XA 1H4WA 2VIPA 3EGKH 1GG6B 3DFJA 1TGCA 1VJAU 1OWHA 1P09A 1ZPBA 1NBMD 3RXGA 2AYWA 1JRSA 4X1PU 3SNEA 1F7ZA 1MMJN 2QV1A 1TPOA 1UTMA 2H1UA 1T32A 4NCYA 2OK5A 4YM9A 3O8CA 1BRBE 4D76A 5C1UA 1TAWA 5B6LA 1UK2A 2GJGA 2ANYA 5GXPA 2RCEA 3D62A 2BDCA 1YYY1 1ESBA 2B0FA 2A7HA 2A4GA 3RXKA 1SGIB 1C2GA 3TU7H 3E91A 4Y0ZE 1SOZA 8KME2 3EAJA 3GCTF 4DT4A 1IQHA 2BY7X 1PPZA 1OWKA 2C93B 1GHZA 1HYLA 1JBUH 3HGNA 2ZFQH 4UD9H 3UNSA 1LPGB 3TH2H 4CRDA 1AFQB 1O2XA 3IG6B 3VPKA 1O3IA 3P8FA 4ZKOU 2LNCA 1K2I1 2WHXA 2V0BA 1QL9A 1O2UA 4FU9A 4ZXYH 1L2EA 4DG4A 2V7QD 3E6PH 2Z3CA 1WTGH 1GDQA 2PHBA 4VGCB 1LHCH 2BDBA 2FOFA 1GBCA 3RLYH 3F9HA 1DM4B 1YPJH 1TBQH 1OP8A 4HGCA 2BD9A 1ZZZA 2P16A 3MNXA 3QTVH 1YPEH 1FN6A 1K1NA 1O2PA 1GHYH 3GISB 5AHGH 2UWOA 1FAXA 2PLXA 3QUMP 4UFEH 3CNRA 1QGFA 3H5CB 4MVNA 1WDIA 1QFKH 1AHTH 1HUTH 4UFFH 3SV6A 1E37B 2BDHA 1NRNH 3A8BA 1FMGA 3A80A 1MTVA 2Q6DA 1A0HB 2ZWLH 2KCPA 1YPHE 1SGPE 5EU8A 1HNEE 4DY7B 2BLVA 2K8IA 1SL3A 1VZQH 3ZYDA 1O3CA 2WYGA 4B6FA 2H9EH 1AGJA 4GAWA 2Z9GA 1HAXB 2ZGCA 1IQKA 3OAAD 3TVJB 3EA7A 3OTPA 3NWUA 3L33A 1C1SA 1MTNC 4K8BA 4ACAA 1OSSA 3DA9B 1EPTA 1ZSLA 4SGBE 3PMBB 1T8NA 2STBE 2G8TA 4JYTA 2WPJS 1EXFA 4NA9H 1A61H 4BTUB 5C3NA 1TLDA 1O2MA 5GJ4B 1IQLA 2ZEBA 1CU1A 3MWIU 2XYAA 1LKAA 5FL7D 1ELEE 2FLRH 1SGFA 3ZVGA 2FOGA 1PFXC 2KCYA 2OINA 3SJOA 4X6OA 1OP0A 3ATMA 1F0SA 1MKXH 1KXDA 4DVAU 3A8DA 4ZCNA 3M61U 4Y0YE 5JBCS 2PWXA 4XRNA 1IQFA 4F4OC 1CBWC 3OEED 3A83A 2D1JA 4GCHF 2FS9A 3LJJA 4AGKA 1KLIH 2RA3A 1HAVA 3SI4H 2GZ9A 4JYUH 1V2ST 5DKMA 1MBMA 1YP9A 3ZZ4A 1ANDA 5LH8A 1GHAG 3SN8A 4TT3D 1M9UA 3LT3A 1IQJA 1O3AA 4ZKRU 1RIWB 2BDYA 1ESTA 3QK1A 1TPSA 3PV4A 4BAHB 3VXEH 1SOTA 2AIQA 4MPUA 4UFGH 2YMSB 3FAOA 1CT0E 1WAYB 1AUTC 1H1BA 2XW9A 3PWBA 1S5SA 4LZ1H 1SC8U 2O8UA 1BMMH 3M3SA 4YLQH 1SBWA 2FOEA 3BTME 5HYOA 1ZJDA 2ZPSA 5KECA 2R9PA 2TGAA 1BMAA 4K1TA 5EPNA 2QIQA 2FOAA 1G37A 1C1NA 1Z1IA 2FM2A 3W94A 4F55A 4K8YA 3SU3A 2Y5FA 4WMDA 1GJCB 5EJZA 3NK8A 3QZRA 1XMNB 4Y7AA 1GJAB 1GBBA 5PTPA 2ZPQA 2ZO3H 4NA8A 1VCPA 2ZGXH 1A4WH 1NS3A 4ZHLU 1A5HA 3CENA 4AX9H 1A5GH 4Y8YA 2Y81A 3M3TA 3PV5A 2L74A 3N7DA 2P3UB 3TH3H 2W5EA 3TJUA 1OKXA 3D65E 2JIZD 1S84A 2W7SA 3F3BA 1VITH 4X8VH 2WPMS 3M5OA 2FO9A 2AERH 3HK3B 3NUMA 1SGRE 1C5OH 2Y7ZA 2FP7B 3AW0A 9ESTA 3KQBA 3GICB 1DPOA 1FQ3A 2FI5E 1DSUA 3RC4A 3PLKA 3LIWA 5FBIA 4ZUHA 3E0NB 3QTOH 4D8NA 2QGRA 2AH4X 2FLBH 2VH0A 1UK3A 1MTWA 1QB6A 1JMOH 5DGJA 1QR3E 1OYTH 2ODPA 5F8ZA 1ZSKA 5EXNA 4BAMB 3MU5A 1HV7A 1SPJA 1ZR0A 3K6YA 3T28A 4GHQA 3A7XA 5EGMA 1HJAC 1SLXB 1H8HD 2OP9A 3KYGA 3UR6A 4KKDA 1EPTB 4O9VA 1AWHB 1TMTH 1BOQA 4NSVA 3VEQB 1GJ8B 1ZLRA 2QYIA 1IQIA 1JOUB 5A0CA 5FCKA 3MYWA 1A46H 2UWPA 1DDJA 3C27B 4BTTB 1UCYK 4BNRA 1Z8JB 4ISOA 2ZHWH 2LP6A 2BM2A 2H2ZA 1WTHD 1SGQE 2FOCA 2Z7FE 1HAPH 1MBQA 3RM0H 1G2MA 1MH0A 2GMTC 2J95A 3BF6H 3LGUA 4GCHG 4F48B 5AF9H 2JETB 1FJSA 1D9IA 1MQ6A 3VGCB 5GIBA 3TK6A 1SI5H 4FUIA 1O2ZA 3TNSA 1O2LA 2Q6FA 1QQUA 3M7QA 2QY0B 1H9HE 2OBQA 5FPSA 1O5FH 1A7SA 1EJNA 1TGNA 4FUEA 3DCLA 3ATLA 1DWCH 5EXMA 5ETXA 1HAVB 1HRTH 3KIDU 5LPFA 3NPSA 5TJXA 1IQGA 5EXLA 7LPRA 3F0OA 1O2IA 1HBTH 3Q3XA 3SUDA 2WYJA 2ZU2A 3MO3A 1ZPZA 4A1VA 4LZ4B 5E2OA 3SORA 1AI8H 3H09A 4FUFA 3DT0H 1ZOMA 5DP6A 1C4U2 2ZU4A 1BTHH 1C2MA 1ZHRA 5FXLA 2A5KA 4YTAA 4RT1A 1IHSH 1SB1H 1NFXA 2XCFA 3E8LA 1EOLA 4OGYA 3PTNA 3EE0B 1UTKA 5EW2H 4YOGA 3SGAE 3G01A 1D6WA 3S0NA 1FPHH 1EAWA 4AC9A 3SU0A 1GVLA 1CVWH 4THNH 3OEHD 4WY3A 1O30A 2BVRH 4UEHH 4P00A 1AZ8A 4ABDA 3GDVA 3T27A 3QLPH 1AB9C 3WY8A 2P93A 4WXIA 1GCTC 2FMJA 1E35B 2ZA5A 1HDTH 1ZTLA 1MQ5A 1ESAA 1N6XA 2CHAB 3RXPA 2O8TA 1O2TA 4MNWA 1D3DB 3TNTA 5DK1A 3KEEA 1ZRKA 2SGQE 4ABIA 2Y5HA 2F43B 5KGOA 1EB2A 1TGBA 5F6MA 5JPMH 3VFEA 3DD2H 4I7YH 2JH6D 3AK5A 3P8NA 1RTKA 1TOCB 1Z8GA 1GBIA 2GP9B 1CE5A 3AAUA 2ZP0H 1MCTA 3BTTE 1TGSZ 3W1EA 1EATA 4R8TB 1K1LA 2ZU3A 1O3OA 2FESH 2VB0A 3LGIA 5F03A 3ENSB 5E0JA 1EOJA 2ALVA 4X8SH 1E0FD 4WF8A 1V2VT 1KXAA 3RXLA 4R0IA 1SGDE 1E34B 2HALA 5IDKA 4Q7ZA 3VB7A 1GMCG 4GLYA 1WQVH 2ZCHP 3U28C 2GCTC 3PMJA 5GPIB 5TCCA 2BY6X 1TX7A 1HJ9A 5EQSA 1LQDB 1O3MA 1C5TA 3RXDA 3FZZA 5ESBA 1O3GA 1GI1A 1N1LA 1O3LA 2GX4A 4FUCA 3SV2H 2QN5T 2P3TB 1UVPA 1TGTA 1OX1A 3EA9A 1C2JA 1O2QA 2GZ7A 2BQ6B 1C2DA 3RXAA 1DT2A 4I32A 1W0YH 5A8XA 1O31A 4HI3A 4CRCA 4AB9A 2F3CE 4FOUC 1T31A 5DJ7A 2NU1E 2QXJA 1IAUA 1VGCC 3GY5A 5DP9A 5A0AE 2XCNA 5GDSH 1O2KA 4IN1A 1UTOA 2ZG0H 1AMHA 1KLJH 1EQ9A 5K7RA 3ATWA 3M3VA 2TGTA 1GJDB 3E16B 1YWUA 1S6FA 1O33A 1V2LT 2XC0A 2WPIS 4WWYA 4X2WA 3RDZA 3A89A 3CS7A 1BT7A 3SZEA 1COWD 1TNJA 2A4RA 2VVUA 3DUXH 2F9BH 2VNTA 1CQQA 3KQEA 4X2VA 3ZZCA 5CHAC 3D49H 1O2VA 3MH4A 4MG3A 1P2KA 3T62A 4BXWA 1Y3YA 5IK2D 4A1XA 2A0QB 1G32B 4FU8A 2OUAA 1ANEA 1BRUP 2I6SA 3RXRA 3KNXA 3ZIAD 3A7TA 4XFQA 2VH6A 1V2OT 2CN0H 3UR9A 3RXOA 1S0QA 2ZFRH 4LOYH 1WU1A 4AORA 1MU6B 2H5CA 5C20A 5DSFA 1F5RA 1UHBA 4Y71A 3MU8A 1C5MD 4WXVA 1AFEH 1SGYE 4O3UA 1P2MA 1W13U 3JZ1B 3KL6A 1SQTA 2P3FH 2QXHA 1Z8IB 3M5NA 2D8WA 4NA7A 3KQCA 1W7GH 1YLCA 2ZFTA 1DLKB 3ZZBA 1FY8E 5K0HA 1D3PB 1UTLM 3GCHC 2G51A 1C4Y2 2PUXB 3A81A 3SNDA 4IGDA 4KTSA 1Y8TA 1BMLA 1P01A 2A7CA 3MQKC 2WV4A 3BN9A 2BHGA 3Q3KA 1A3EH 2ODYB 4HG6A 1GI4A 1PPCE 1UTQA 4YOJA 1P06A 3PWCA 1T8MA 1C2KA 1HCGA 1S82A 2Z9KA 3VB4A 1NT1A 1A0JA 4IN2A 4TWYA 5HIYA 1QRZA 2W6JD 3F9EA 1G3BA 2OC0A 4J2YB 5LPEA 3MNCA 1O3FA 2VBCA 2YNAA 4XSKU 1A3BH 3FP6E 1GI0A 3ZVFA 2B5TB 4XBCA 5L6NH 1GDNA 3BEIB 1NBME 2D26C 4ISNA 1A5IA 1C2LA 1H8DH 2HPQH 3QN7A 1O2WA 5EOKA 2Y82A 3BTKE 3GY4A 4B74A 1NFUA 4MDSA 2ZNKH 2W3KA 3ZV8A 1P03A 1NC6A 1P2NA 2XBYA 1AKSA 2EEKA 3BTHE 2ZDAH 4AFUA 4K2YA 2AS9A 5HM2A 2QF0A 1G9IE 3GS9A 3S9AA 1V6DA 1BTUA 4ABJA 3HKJB 1BCUH 1O5DH 1GHWH 2TBSA 3SUGA 1F0TA 2VIDA 1C1PA 1SHHB 1HAYB 4TPYA 4X2XA 5DPAA 3P92A 4Z1MD 1BTYA 3NRLA 4BANB 3TH4H 1GVZA 2G52A 4MNVA 2PTNA 3MH5A 2FTLE 3E1XB 1O2NA 1TMBH 1MAXA 4YLUA 4A5TS 3VXFH 1BJUA 4ZAEA 5EPYA 1GJ7B 4B76A 3F2HA 2C90B 1TONA 1V2TT 4RKJB 1V2QT 1LKBA 2CF8H 1E36B 3TK5A 1GVKB 4A7IB 2HLCA 5A0BA 4AFSA 4E06H 2EI6A 1GHVH 2BX3A 1BMNH 3NCLA 5AFZH 2V3HH 2OLGA 1PPHE 3MI4A 2QF5A 1P11E 4NFFA 3FANA 5E2PA 4X1QU 1BHXB 1GHXH 5T1VA 1GBAA 2SGPE 1MTNB 1GMDG 1V2RT 4GUXA 1UHBB 4DOQA 1TYNA 3URDA 2EQNA 3BTEE 5HXFA 4ZMAH 1DUAA 3RXBA 1AWFH 4D7GA 1C2HA 3U9AH 2BLWA 1BJVA 1WUNH 2Q6GA 3FOAA 1NU7B 3SYJA 5FBEA 2QF3A 1O3KA 1RTLA 1EP5A 4H42U 1G3EA 2C4FH 1V2JT 3GDUA 3SU6A 2WV5A 3SQEE 5JBBS 1XKBC 1BIOA 1EKBB 5AFYH 2A32A 1SKYE 1UCYH 2BOHB 1CHGA 1ELDE 5E0HA 1SLVB 1UTPA 3TLOA 1SQOA 3ODFA 1FY4A 2RG3A 2Y7XA 3LH3A 1FAKH 1GPZA 3A85A 2XRCA 1GDUA 1G2LA 2ZI2H 1GBFA 1HPGA 4JZEH 3UPEA 1Y3UA 5J4QA 4LK4A 4AZ2B 2A5IA 1SSXA 3RXHA 3ZVAA 2PGBB 2AEIH 4ZXXH 1E1RD 1ZTJA 2FOBA 1TWXB 2P59A 2VGCC 4JMYA 1ZJKA 2IJD1 1AKSB 2H9TH 1SFIA 3T5FH 2HNTF 3DSGA 1QA0A 1ZYOA 2F9NA 3OTJE 3SQHE 1NPMA 6GCHF 4CRAA 5GCHF 3I29A 1FXYA 4Q7XA 1KXEA 5CMXH 1Q31A 4ASUD 3SU4A 5A09A 1GHBF 1MTUA 4X1SU 1WXRA 4CHAB 3BTGE 1O0DH 3SNAA 2HLDD 1MCVA 1CA0B 1EX3A 4MNXA 4WVPE 1GJBB 4PROA 2EI7A 1ZPCA 3RC5A 3DHKH 2RDEA 1WQSA 2BZ6H 1O38A 1QJ6B 1V2KT 3QGJA 1YLNA 4NZQA 1TBRH 1QHRB 2VIWA 3Q76A 2XBWA 1KMHB 2NWNA 4MNYA 3PO1B 2HNTC 3GDSA 3BTQE 5C1XA 3ZVCA 1V2WT 2SFAA 4VGCC 1RFNA 1ACBE 1KTTB 2Z94A 3TGIE 1H9LB 1AVWA 3MTYA 3GCTG 3NXPA 1C5NH 1YBWA 3FO8D 4FUDA 2ANKH 1DLEA 3BEUA 1C1OA 1G3DA 4CR5A 5I46H 3ZVBA 2OC7A 4H4FA 1MTSA 2ZTYA 1SLWB 2SGEE 5AVDA 2VIQA 3V3MA 3UWJH 4B2AA 1XX9A 2C8ZB 1HJAB 3RXEA 1C9PA 1H8IH 1O3HA 1OOKB 1ABIH 1NY22 1FI8A 1OXGA 1XVOA 4ABEA 1SVPA 3A86A 1KTSB 2GVFA 1TIOA 6LPRA 3F68H 4XOJA 5HIZA 3W95A 4JCNA 1WCZA 4ACBA 4SGAE 1A0LA 1FY1A 1YCPK 2KAIA 2ZECA 1YPKH 1C5PA 1P0SH 1P2OA 1TRMA 2PP6A 4NIVA 6ESTA 4E7RG 5EODA 3SU1A 1S6HA 1Z1JA 4X6PA 4Q4LA 2J98A 2V6NA 2BD8A 2G81E 1FIZA 2DUCA 3MOCA 3HKIB 1TABE 1HIAA 2ZGJA 3SW2B 5GWZA 2DE9A 5C5NA 3UTUH 1YY3A 1UVSH 2BVXH 3PM3A 5EQRA 3V0XA 3RMLH 2SNWA 1GI2A 3AW1A 3LGWA 2AIPA 1XUKA 1QBNA 1C1RA 1P2QA 3T29A 3MO6A 1K22H 4TY6A 3PRBA 1LCYA 2KR7A 3MU4A 4U30A 5A8ZA 1ZMNA 6GCHG 3VB3A 3ZVEA 3ZZAA 2BVSH 4INHA 3P95A 3PMHB 3RXVA 2J4IA 1T8LA 2WPDD 2GKVE 4M9FA 4IS5A 2TIOA 1O3DA 2ZDNA 1GBDA 2PKSB 4Z0KA 1BBRE 3OY6U 2CV3A 1RRKA 4ZROA 1RIWC 3ESTA 3SGQE 2QE7D 4MPVA 2PW8H 2V3OH 2J94A 4NZLA 2PSYA 2OC8A 2AGGX 2J5UA 1AB9B 3U69H 3TGKE 1T4UH 1GCTB 1GBJA 2C8XB 2D2DA 1XUFA 3SJKA 3U1IB 4UDWH 4CRGA 1O32A 6CHAC 1LPKB 3IITA 4ISLA 5HMAA 3T2NA 1DS2E 3V7TA 1UTNA 2ZHEH 4DJZB 4B2BA 1AUJA 1SHYA 1KXCA 3RXSA 1VKYA 2XC5A 3RXFA 4ZHMU 2AMQA 4I33A 1AY6H 1C5RA 2ANWA 1NO9H 2FYRA 1AIXH 4Y8ZA 2FI3E 1THSH 3BTDE 1TNLA 2XBXA 4KTCA 1QB1A 3ATKA 3QO6A 1C5UA 1C1UH 1P3EA 4JYVH 1K0HA 4XBBA 4WH8A 4INKA 3M7UA 1FONA 4X6MA 4DGJA 2FDAA 3PLPA 3SHAH 2WV9A 2LPRA 2W26A 2JDID 2G4UA 3BG4C 5EJ1A 2QXIA 1HXFH 1EZSC 1OWEA 3MH6A 2GCTB 4GSOA 4WH6A 1OWDA 1V2UT 1LQEA 4K1EA 1XXFA 1RGQA 2GT8A 5C1YA 1L4DA 1GBHA 1RJXB 1D3TB 1QL8A 1V2MT 1L1GA 2VINA 2ZHFH 1QBOA 2Y6TA 2KCAA 3QZQA 1QURH 4YOIA 2GD4B 3SV9A 2OTVA 5EIYA 1AN1E 1LVOA 1ANBA 2ESTE 2UUJB 1FY3A 1O5GH 2SGFE 3OSYA 4AYYB 1DWDH 4I8GA 5EG4A 4ASHA 1AVGH 1IQEA 3UOPA 3UOUA 2ZTXA 1MKXK 3MFJA 1C5XB 2ZFPH 4JZ1A 2KAIB 1C4V2 2EA3A 1F92A 1OPHB 4H6TA 1MUEB 2ZDVH 2R2WU 3UQVA 5EW1H 4I8LA 3GY2A 3F2FA 1PJPA 4TWWA 3O8BA 5JBAS 2L6OA 3QX5H 2J98B 3U8TH 1L1NA 2BD2A 2K0QA 3E0PB 5FPTA 5ESTE 4ABFA 1EB1H 4Z6AH 1HIAB 2H9HA 1FNIA 2SNVA 2F91A 3PMAB 4D7FA 2A7JA 2HVYB 1XXDA 2GGVB 2PGQB 4RI0A 1E79D 3MHWU 3LGVA 3T25A 2CMYA 1C1WH 1FUJA 8ESTE 2CK3D 2OBOA 5CHAB 2TRMA 4ABGA 3FN8A 4CR9A 1LDTT 1GJ9B 1HGTH 2B8OH 1P57B 2V35A 1FDPA 3BTFE 2ZKSA 4AGJA 1BQYA 1ID5H 3P70B 2W3IA 2OD3B 1MU8B 1O5EH 1ETSH 1TFXA 1Y3VA 3L6PA 1W8BH 4ESTE 1O3JA 2PR3A 1P02A 1BZXE 1TA6A 1EUFA 1GBTA 1QL7A 3K6ZA 3N7OA 5G4BA 2KCOA 1GGDB 2SGAA 1GI6A 2ZDLA 1DFPA 5E0GA 1YPLH 2BQ7B 1MKWK 5B6OA 5J4SA 1BTZA 1NM6A 3B8JA 1SG8B 5I25A 3LH1A 2UUYA 1QCPA 2VWNA 3HATH 3GCHB 3KHVA 3Q00A 7ESTE 2VWLA 1DVAH 1PYTD 3TPIZ 4NG9H 3FZDA 2ZZUH 1EAUA 1Q3XA 1PPFE 3RXIA 1PQ7A 1ETTH 1TNHA 2ZQ2A 3LC5A 3SI3H 4AOQA 3ZZ5A 4OGXA 4O3TA 1DXPA 5DP4A 2Q1JA 4D9QA 1ZGIA 3GOVB 3FP7E 5FPYA 4CBOA 1UK4A 1CA8B 3GY7A 2XXLA 4AG1A 1DANH 2HGTH 4IC5A 1GJ5H 2STAE 3DFLA 2VJ1A 4ZHAA 1AZZA 1IOEA 5C0UA 2Z9JA 2AFQB 3UQOA 1SQAA 2J97A 2ZHQH 4FVBA 4INLA 4DIHH 1J17T 2Z3DA 4MLFB 2BZAA 2KZ4A 4FU7A 1Q2WA 4ZKSU 2WZQA 4K5ZA 1C5WB 2HNTE 1CSOE 4JK5A 3M35A 1K1JA 2KM0A 2QCYA 2FOHA 2XOKD 2P8OC 3E90B 1DY9A 3QDZB 1THPB 2AHME 4AG2A 1DE7H 1DICA 1CGHA 1GL1A 1UVOA 1Z6EA 1VCQA 1O3NA 1CT2E 2J2UA 1P10A 2GV6A 3OX7U 2BY8X 4RSPA 1Z71A 2O9QA 2NU2E 3U98H 1H9IE 1SFQB 1SGEE 2BYAX 1P05A 1Z6JH 3RXTA 3DSPA 7GCHF 1O36A 1BRAA 5DG6A 1GI5A 3LKWA 1LHFH 5HM9A 2H5DA 2PUQH 3A84A 4DW2U 1XUJA 1PPGE 4U2WA 5CDFE 4RN6A 5JDUB 2ZTZA 4Q2KA 2ZIQH 1L4ZA 1O39A 2WPHS 3A82A 4YZUA 1K1OA 1OS8A 4HFPB 3OE7D 4NSYA 2A4QA 1O3PB 1W12U 1L0ZA 4AYVB 4DURA 1J8AA 3F0PA 5A8YA 3ZZ3A 4BOHA 3K65B 3ELAH 2J34A 1UO6A 3KF2A 2HVXA 3RXMA 8LPRA 3SOSA 3RC6A 4Y79A 1NRQH 2M2AA 1O2SA 1QBVH 1EASA 3SJIA 3SV7A 4WMEA 1E38B 2FODA 4RT0A 4GVUA 1G30B 3TJOA 1ELGA 4M7GA 1XM1A 3VB5A 2RDLA 3RUOA 4IMQA 1NZQH 1AQ7A 4GPGA 3PYHA 1CGJE 3RMNH 1C1VH 1UTJA 4U01A 1PPBH 2A2XH 1XVMA 3MU0A 3GY6A 2BQWB 2C3SA 4AN7A 1XUIA 4IBLH 1HAZB 3A87A 5FHTA 1O2JA 1WOFA 1K1IA 2EY4C 5T6DA 1CGIE 1EZXC 4QT8C 5T3HA 1P8VC 5LGOA 1GI9B 1YF4A 2R3UA 2ZCLP 3GY3A 2Y5GA 1K9OE 2BOKA 4Y8XA 3QWCH 4FETA 5SGAE 1P12E 2FS8A 1OYQA 4FXGH 1YCPH 5CE1A 1F0RA 1ZMJA 1YGCH 1B0FA 1BITA 1PQ8A 5L30H 3UNRA 2OC1A 5A2MH 1UJ1A 2OCVB 3BTWE 5FX6A 2ULLA 1H8ED 5TCAA 1UVUH 1FY5A 2VIOA 2BD5A 1SGNE 4ABBA 4MPXA 1JIMA 1Y5UT 5JB8S 3WWBA 3PRDA
chains in the Genus database with same CATH topology
2WPKS 3CS0A 3S9BA 1HAHH 2FEQH 4NWKA 4I8JA 1ELCA 1GBLA 2UWLA 3ZVDA 3RXUA 3LOXA 3A7YA 4UFDH 2C8YB 2VGCB 4CH8B 1HJ8A 1F2SE 3HGPA 1DX5M 1O3BA 2PTCE 1C2FA 4KP0A 1ARBA 1PYTC 3F9GA 1N8OC 5ABWA 7GCHG 1BDAA 2ZU5A 3H7OA 2ZC9H 4B73A 2ZFFH 3KN2A 1GHAF 1O35A 4XDEA 2VWMA 4FUGA 2FPZA 1HAOH 2J38A 3BV9B 1BA8B 1CO7E 1ZGVA 1O2YA 1W10U 3F9FA 3LGTA 1MZAA 5DP5A 2FWWA 4NIWA 4JK6A 2CXVA 1CBWB 4OS7A 1GBKA 3EYDA 3A7VA 1LPZB 2A31A 4I31A 3O8DA 1Y5AT 1SGTA 1C5SA 1GG6C 2RA0A 2F9PA 2K1QA 2R0KA 5C5OA 2G5VA 1YM0A 1ELAA 5JBTA 3FFGA 1WBGB 1XKAC 1BHXF 3SU2A 1QY6A 3E3TA 1B7XB 2FX6A 2XC4A 1ZSJA 3GYLB 2BD7A 3TJVA 4FVDA 1T8OA 5JB9S 2GTBA 1TOMH 1ELVA 4X1RU 3M5LA 4Y10E 2F9UA 5DO4H 1C5ZB 1NU9A 3FVFB 3LPRA 1EZQA 1BTWA 2TGPZ 3ZZ8A 5F8XA 2IOTA 1MD8A 1VITF 1J16A 1BTXA 2BLQA 2CF9H 4YESB 1TALA 3ATIA 1DOJA 4J1YA 1IQNA 1AD8H 4B75A 3M5MA 2Z6BD 2G5NA 4DT7B 2IPHA 3OU0A 3PB1E 1AFQC 2ZGHA 1PPEE 1SR5C 2FZZA 5DP7A 3ZV9A 3UREA 4X8TH 4FUBA 4CBNA 3MNBA 1BRCE 2HOBA 3OYPA 1K21H 2ZHDA 2BX4A 5LPRA 2G55A 2GT7A 4A92A 1W11U 7KMEH 3L3TA 3MMGA 4GHTA 1T4VH 4I8KA 1VJ9U 2FYQA 3V12A 5JYIA 3K9XB 1YKTA 1EJMA 4A1TA 2BDIA 4AFQA 3OY5U 3TITA 1C1TA 4A6LA 1GCDA 3HPTB 3RXQA 3TJNA 1AE8H 1CHOF 2NU4E 1TMUH 2BTCE 3U8RH 2EI8A 2JKHA 1YPMH 4U32A 1NROH 1NN6A 1LVBA 1EZUC 5F8TA 3TK9A 4OS6A 4XBDA 2WINI 5FX5A 1DWEH 4TY7A 2NU3E 3SUEA 2R3YA 3U8OH 3GYMA 3LDXH 1AO5A 5C2ZA 4UONA 3VB6A 3RLWH 2G00A 2OQUA 1TNKA 3JZ2B 4X0WU 2GMTB 1BBRK 1A1RA 4HTCH 3STJA 5FAHA 1V3XA 4BAOB 6CHAB 2PSXA 1AVXA 1A2CH 2VVCA 2Y80A 1XUHA 4Y76A 1S81A 3AASA 1W7XH 3SHCH 1MZDA 2P95A 1T7CA 1EP6A 1YLDA 2QXGA 1MKWH 2FOMB 4CHAC 8GCHF 1O5CB 1SLUB 1TNGA 5T6FA 1C5QA 1CA0C 1O5BB 1WV7H 1RXPA 4LXBH 4NIYA 2FIRH 1CT4E 2DE8A 5H4IB 3PROA 2M5TA 3PO1C 1X7AC 1O2RA 3MU1A 3RM2H 3SU5A 1Z7KA 1KXBA 3QGNB 1O34A 3TIUA 1KIGH 2A5AA 4B2CA 2GCHF 1ZHPA 1FZZA 1VITG 1LTOA 5GCHG 2FTMA 3BG4B 3LC3A 9LPRA 3V13A 1HLTH 3A8AA 1NRRH 2ANMH 3SGBE 1GHBG 1QQ4A 3UWIA 1TBZH 1TQ0B 1F5LA 4X6NA 3P8OA 2CJIA 4WJG2 1KXFA 1DXWA 3S69A 1SMFE 2JH0D 4K69A 1P2JA 1DSTA 1GJ6A 1IHTH 1ZHMA 1LVYA 1KYNA 1C5LH 2GZ8A 1UMAH 1INCA 2O8MA 4JZDH 1Y59T 1QNJA 1S83A 1GMCF 4CH2B 2Z9LA 1XUGA 1RD3B 1F5KU 1LHGH 3BIVH 3M36A 2HWLB 1ARCA 2WUCA 4O03A 2TGDA 4K3JA 4B71A 1QJ1B 3GY8A 2NU0E 2VU8E 3H7TA 1QA7A 1CHOG 1NTPA 1PQAA 3I78A 4ZKNU 1ZMLA 3TGJE 1GJ4H 1BB0B 1JIRA 1Y3WA 4MQAA 5C67A 1C2EA 2AGIX 4X1NU 4ABHA 4OS5A 1AU8A 4IC6A 3LONA 1KLTA 1C9TA 1K1MA 1JWTA 4FUJA 3ZZ7A 1KY9A 4K1SA 3A7ZA 1TNIA 4CRBA 3RU4E 4ISHH 2ASUB 2IN2A 1EAIA 2B7DH 2YNBA 1C5YB 1ELBA 1NFYA 2ZDKA 2XBVA 1AE5A 1THRH 1UCYE 5T6GA 4IW4E 1P9SA 3STIA 1TRNA 4TPIZ 3B23B 2YOLA 4NIXA 1NESE 4KTUA 2PKSC 1EPTC 1DWBH 3RMMH 8GCHG 5E8EH 1GMHF 1VGCB 4MTBA 2ZQ1A 3AVZA 1O5AB 2IJOB 2ZFSA 4X2YA 5EQQA 2QC2A 3RMOH 5BRRE 2B9LA 2GV7A 3ZZDA 4F49A 5L2YH 1YPHC 4MPWA 2QA9E 3SJ8A 1W2KH 4Q7YA 4NGAH 1P3CA 2UUFB 4CREA 4E7NA 3S7HB 1PQ5A 2R2MB 3SJ9A 2VVVA 2GCHG 2JETC 1QRWA 3MNSA 3K2UA 3VGCC 4YO9A 1O2OA 1TX8A 3RU4D 3P8GA 1FIWA 3UY9A 3PLBA 2I6QA 2ZPRA 4UE7H 2O8LA 2TPIZ 1TPAE 1Z8RA 4I8HA 1TB6H 1W14U 2J92A 4K60A 5L2ZH 2Z3EA 1GL0E 1QJ7B 3BIUH 5IYTA 1QTFA 1KDQA 1P04A 1YC0A 2BDGA 5FCRA 3NZIA 1EJAA 1YCPM 2F83A 1C5VA 1HAGE 2PKAA 4AB8A 2GDEH 2H6MA 4BXSA 2G4TA 2A4OA 1WSSH 3B9FH 1UVTH 3EA8A 1GI7B 3ITIA 3T26A 3LJOA 4NFEA 2GDDA 4CRFA 3HK6B 2ODQA 1ETRH 1RS0A 2P8OB 3S7KB 2XWAA 5HGGA 2BY5X 1W0ZU 3I77A 2WPLS 4BAQB 1KSNA 1TA2A 4Y7BA 4O97A 4KELA 1LMWB 3P6ZB 2UUKB 1V2NT 4AFZA 2OQ5A 2CGAA 3F6UH 1EAXA 3GCOA 1DY8A 4OS1A 4JZIA 2CHAC 3M7TA 3KQDA 3BG8A 1B0EA 4TYDA 1JRTA 2BD3A 1J9CH 3ODDA 4XE4A 1TQ7B 1VCWA 1LVMA 4B1TA 3D23A 1DITH 1TX6A 1P9UA 1SGCA 1D3QB 1VR1H 2J9NA 4JZFH 2O8WA 3BEFB 1SGFG 1OWIA 4HZHA 4WMFA 1NRSH 5DP3A 4Y6DA 2A2QH 1LHDH 2WUBA 1QB9A 1U6QA 3Q3YA 2A45B 2PFEA 1OWJA 1W3CA 3ZYEA 5BPEA 1BTPA 3RU4T 3MH7A 1HFDA 3RP2A 1BUIA 4YT7H 3PTBA 1B5GH 4H6SB 1GMHG 2VIVA 1MD7A 2P94A 4Y11E 3SV8A 1GI3A 1O2HA 4D9RA 2A1DB 2Z9IA 2BDAA 2SGDE 2AGEX 1LO6A 1YPGH 2ZU1A 1O37A 1RTFB 4IMZA 2THFB 1MAYA 2XTTB 2HPPH 3LGYA 3KCGH 4BAKB 2QAAA 4BTIB 2BB4A 2XNIA 1K28D 2ZGBH 1N6YA 1C1MA 1GGDC 3U1JB 3SUFA 3UNQA 3Q77A 1FPCH 2ZF0H 3A8CA 4KGAA 3SNCA 2W7UA 2BLOA 1GBEA 3CP7A 3SO3A 3R3GB 4E05H 2JH5D 2ZCKP 1GMDF 3AAVA 3P17H 3SNBA 1NFWA 1G3CA 2FXRA 2HRVA 3RXJA 1ELTA 3UFAA 3UIRA 1G36A 3SBKA 3UUZA 1ANCA 2BY9X 4OS2A 1HB0B 2FI4E 2R0LA 2FX4A 2ILNA 3C1KA 3EDXB 1ZRBA 2C8WB 3IWMA 1KDQB 3SZNA 3EQ0H 3MO9A 2PKAB 3RXCA 1ZTKA 3FP8E 4ZH8A 2AMPA 2BMGB 1TPPA 4DIIH 2OXSA 1F0UA 4FUHA 1FV9A 1DUEA 1ABJH 4X8UH 4Q80A 3R0FA 2BXTH 1L1JA 2BXUH 2EC9H 1V2PT 2F9OA 4DCDA 1TRYA 5DP8A 1FN8A 4OS4A 3A88A 3URCA 2BD4A 1ORFA 4RKOB 3KGPA 1ELFA 3GCNA 1N8OB 1IQMA 1JXPA 1D6RA 1GWAA 4YT6H 2XWBI 3M37A 1O2GH 1GBMA 1S0RA 2AMDA 1QIXB 2ZDMA 1HXEH 1O3EA 4NWLA 1C1QA 1NRPH 1WYKA 3F1SB 2PV9B 1HAIH 1QRXA 3ZZ6A 2VWOA 2F9VA 3A7WA 4ISIH 1C2IA 1OP2A 3LU9B 1Y5BT 3NKKA 1LHEH 1GI8B 3BSQA 2ALPA 3ZZ9A 3S9CA 1P2IA 4ABAA 1J14A 1FLEE 1J15A 1TE0A 1D4PB 3O8RA 1K1PA 1BBRH 1S85A 1Y3XA 1H4WA 2VIPA 3EGKH 1GG6B 3DFJA 1TGCA 1VJAU 1OWHA 1P09A 1ZPBA 3RXGA 2AYWA 1JRSA 4X1PU 3SNEA 1F7ZA 1MMJN 2QV1A 1TPOA 1UTMA 2H1UA 1T32A 4NCYA 4YM9A 3O8CA 1BRBE 4D76A 5C1UA 1TAWA 1UK2A 2ANYA 5GXPA 2RCEA 3D62A 2BDCA 1YYY1 1ESBA 2B0FA 2A7HA 2A4GA 3RXKA 1SGIB 1C2GA 3TU7H 3E91A 4Y0ZE 1SOZA 8KME2 3EAJA 3GCTF 1IQHA 2BY7X 1PPZA 1OWKA 2C93B 1GHZA 1HYLA 1JBUH 3HGNA 2ZFQH 4UD9H 3UNSA 1LPGB 3TH2H 4CRDA 1AFQB 1O2XA 3IG6B 3VPKA 1O3IA 3P8FA 4ZKOU 2LNCA 1K2I1 2V0BA 1QL9A 1O2UA 4FU9A 4ZXYH 1L2EA 4DG4A 3E6PH 2Z3CA 1WTGH 1GDQA 2PHBA 4VGCB 1LHCH 2BDBA 2FOFA 1GBCA 3RLYH 3F9HA 1DM4B 1YPJH 1TBQH 1OP8A 4HGCA 2BD9A 1ZZZA 2P16A 3MNXA 3QTVH 1YPEH 1FN6A 1K1NA 1O2PA 1GHYH 3GISB 5AHGH 2UWOA 1FAXA 2PLXA 3QUMP 4UFEH 1QGFA 3H5CB 4MVNA 1QFKH 1AHTH 1HUTH 4UFFH 3SV6A 1E37B 2BDHA 1NRNH 3A8BA 1FMGA 3A80A 1MTVA 2Q6DA 1A0HB 2ZWLH 5EU8A 1YPHE 1SGPE 1HNEE 4DY7B 2BLVA 1SL3A 1VZQH 3ZYDA 1O3CA 2WYGA 2H9EH 1AGJA 4GAWA 2Z9GA 1HAXB 2ZGCA 1IQKA 3TVJB 3EA7A 3NWUA 3L33A 1C1SA 1MTNC 4K8BA 1OSSA 3DA9B 1EPTA 1ZSLA 4SGBE 3PMBB 1T8NA 2STBE 2G8TA 4JYTA 2WPJS 1EXFA 4NA9H 1A61H 4BTUB 5C3NA 1TLDA 1O2MA 5GJ4B 1IQLA 2ZEBA 1CU1A 3MWIU 2XYAA 1LKAA 1ELEE 2FLRH 1SGFA 3ZVGA 2FOGA 1PFXC 2OINA 3SJOA 4X6OA 1OP0A 3ATMA 1F0SA 1MKXH 1KXDA 4DVAU 3A8DA 3M61U 4Y0YE 5JBCS 2PWXA 1IQFA 4F4OC 1CBWC 3A83A 2D1JA 4GCHF 2FS9A 3LJJA 4AGKA 1KLIH 2RA3A 1HAVA 3SI4H 2GZ9A 4JYUH 1V2ST 5DKMA 1MBMA 1YP9A 3ZZ4A 1ANDA 5LH8A 1GHAG 3SN8A 1M9UA 3LT3A 1IQJA 1O3AA 4ZKRU 1RIWB 2BDYA 1ESTA 3QK1A 1TPSA 3PV4A 4BAHB 3VXEH 1SOTA 2AIQA 4MPUA 4UFGH 3FAOA 1CT0E 1WAYB 1AUTC 1H1BA 2XW9A 3PWBA 1S5SA 4LZ1H 1SC8U 2O8UA 1BMMH 3M3SA 4YLQH 1SBWA 2FOEA 3BTME 5HYOA 1ZJDA 2ZPSA 2R9PA 2TGAA 1BMAA 4K1TA 5EPNA 2QIQA 2FOAA 1G37A 1C1NA 1Z1IA 2FM2A 3W94A 4K8YA 3SU3A 2Y5FA 4WMDA 1GJCB 3NK8A 3QZRA 1XMNB 4Y7AA 1GJAB 1GBBA 5PTPA 2ZPQA 2ZO3H 4NA8A 1VCPA 2ZGXH 1A4WH 1NS3A 4ZHLU 1A5HA 3CENA 4AX9H 1A5GH 4Y8YA 2Y81A 3M3TA 2P3UB 3TH3H 2W5EA 3TJUA 1OKXA 3D65E 1S84A 2W7SA 4X8VH 1VITH 2WPMS 3M5OA 2FO9A 2AERH 3HK3B 3NUMA 1SGRE 1C5OH 2Y7ZA 2FP7B 3AW0A 9ESTA 3KQBA 3GICB 1DPOA 1FQ3A 2FI5E 1DSUA 3RC4A 3PLKA 3LIWA 5FBIA 4ZUHA 3E0NB 3QTOH 4D8NA 2QGRA 2AH4X 2FLBH 2VH0A 1UK3A 1MTWA 1QB6A 1JMOH 5DGJA 1QR3E 1OYTH 2ODPA 5F8ZA 1ZSKA 5EXNA 4BAMB 3MU5A 1HV7A 1SPJA 1ZR0A 3K6YA 3T28A 4GHQA 3A7XA 5EGMA 1HJAC 1SLXB 2OP9A 3UR6A 4KKDA 1EPTB 4O9VA 1AWHB 1TMTH 1BOQA 4NSVA 3VEQB 1GJ8B 1ZLRA 2QYIA 1IQIA 1JOUB 5A0CA 5FCKA 3MYWA 1A46H 2UWPA 1DDJA 3C27B 4BTTB 1UCYK 4BNRA 1Z8JB 4ISOA 2ZHWH 2BM2A 2H2ZA 1WTHD 1SGQE 2FOCA 2Z7FE 1HAPH 1MBQA 3RM0H 1G2MA 1MH0A 2GMTC 2J95A 3BF6H 3LGUA 4GCHG 5AF9H 2JETB 1FJSA 1D9IA 1MQ6A 3VGCB 5GIBA 3TK6A 1SI5H 4FUIA 1O2ZA 3TNSA 1O2LA 2Q6FA 1QQUA 3M7QA 2QY0B 1H9HE 2OBQA 5FPSA 1O5FH 1A7SA 1EJNA 1TGNA 4FUEA 5EXMA 3ATLA 1DWCH 5ETXA 1HAVB 1HRTH 3KIDU 5LPFA 3NPSA 5TJXA 1IQGA 5EXLA 7LPRA 1O2IA 1HBTH 3Q3XA 3SUDA 2WYJA 2ZU2A 3MO3A 1ZPZA 4A1VA 4LZ4B 5E2OA 3SORA 1AI8H 4FUFA 3DT0H 1ZOMA 5DP6A 1C4U2 2ZU4A 1BTHH 1C2MA 1ZHRA 5FXLA 2A5KA 4YTAA 1IHSH