1UTPA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utpA02
1P0SH 2FS8A 2IJOB 3RXBA 2FEQH 4ISIH 1UTNA 3IITA 3SGQE 1GBIA 2P95A 6CHAC 2FOEA 4O3UA 5I25A 1S82A 5CMXH 4ABEA 5C20A 2GMTC 1F5KU 4WJG2 1AFQB 1HAZB 4U01A 1C2JA 3SNBA 1TRYA 2XC0A 3SU5A 1HFDA 1ELDE 1K9OE 3A7XA 1O2SA 4FUGA 1ZYOA 2YOLA 4CRDA 4ABFA 1L0ZA 3DFLA 3UTUH 4B2AA 3AAVA 1ZSKA 2BYAX 4FUFA 1IQNA 5ABWA 3U9AH 3A83A 1LHDH 1NFXA 1AE8H 1C9PA 1ZR0A 3ZZ6A 4MNVA 1HCGA 1ZTLA 3SUEA 2ZEBA 2BDGA 3GDSA 5EODA 1S6HA 1TQ7B 3W94A 2ZTXA 1WAYB 3HKIB 3UR6A 1GDNA 1Y5AT 3F9GA 3TH2H 1GI2A 1GBJA 1QRZA 2XBYA 1CA8B 5E0HA 1CHGA 2TGPZ 5FCKA 1ANCA 3TK5A 1Q3XA 1QRXA 1K1NA 4H42U 3RMOH 1A5HA 1VZQH 1SGYE 1U6QA 1O2RA 2QV1A 2FXRA 1TE0A 1ZHRA 1WTGH 2R3YA 1PPEE 1H8DH 1AWHB 1N6YA 1F2SE 1N8OC 5DO4H 1GJ6A 3ZV8A 3RXKA 3RXSA 2AGGX 2HVXA 1Y3WA 1GI8B 1HAVB 2QXHA 1P3CA 2ZCKP 3BSQA 1C1UH 1C2DA 4D8NA 1GJCB 2Y81A 2O8TA 1FIWA 2V3OH 2Z3DA 1NFYA 5JB8S 1AHTH 1BRAA 3RMNH 4O3TA 1CQQA 1LO6A 2XWAA 2AMDA 2Y7XA 4MPUA 2ZTZA 4K1EA 4ABJA 2G81E 2ZFQH 1HAHH 2ZQ1A 2O9QA 1TOMH 5J4QA 1V2QT 3U1IB 1FN6A 2WYGA 1AFEH 2FTLE 3ZZ3A 5GWZA 2ZHWH 2XWBI 1TX8A 4ZHAA 4BTTB 5A0AE 1ZSJA 1XUFA 5DP6A 1HAYB 2QAAA 1GL0E 3O8DA 1BTXA 1NROH 2ZFFH 3HPTB 8GCHG 4LZ4B 1SGNE 1XXDA 1W0YH 3GY6A 1KTSB 3I29A 1Y3VA 1PQ5A 2OD3B 4JK5A 4ABDA 1ESAA 1J14A 1HXFH 4MPWA 1V2JT 4NZQA 5L6NH 4IMQA 4FUBA 1KYNA 1QQUA 3OY6U 1T7CA 1FPHH 3BTGE 1C5XB 2H2ZA 3Q77A 2P16A 2SGQE 1ZHMA 4ABAA 4BAQB 3PTBA 4UE7H 2ZPQA 1YBWA 1S5SA 3MOCA 2PHBA 4Y71A 2ZP0H 3BEIB 2XBVA 1LVYA 2A32A 3BTME 2WV4A 2J2UA 1B0FA 2GVFA 3RXLA 4BXWA 3ZVGA 1SGEE 1P57B 3FZDA 5FPYA 3RXCA 5GCHF 2BD3A 1KXAA 1G32B 1KXEA 1QY6A 3ZZAA 4D9QA 4KELA 1PQ7A 5TCAA 2ZIQH 2ZGXH 3P8OA 3ZYDA 2FESH 3LGWA 4LXBH 4DIIH 1CBWC 1C5UA 1CT0E 1OWKA 3BTQE 1OXGA 4LK4A 1SPJA 4MVNA 1NFWA 1ZRBA 5EW2H 1HJAB 1A61H 2P59A 3B23B 3U8RH 2HNTC 1EJAA 3A87A 1QGFA 4H6SB 1SQOA 1MZDA 3RMMH 3MNCA 4JZFH 1TMBH 1O2MA 2ZDMA 3A85A 1MUEB 2BOKA 4K69A 5JPMH 4RKOB 4IN1A 1O35A 1L2EA 1BBRK 2HRVA 2SFAA 1FPCH 3SZNA 1AI8H 2V35A 1MU8B 1NY22 1M9UA 3MNSA 1O3EA 3QWCH 3LT3A 3CS0A 1QBNA 4AFSA 3FP7E 1O3NA 4UD9H 2W5EA 1SVPA 2XTTB 2ODPA 1S81A 4I31A 4CBNA 1CHOG 3ZVAA 1HJAC 2J95A 4CRAA 4UEHH 5ESTE 5HM9A 2O8MA 3M5MA 1XKAC 3PMHB 1TFXA 2VWMA 5FBEA 5E0GA 1EOJA 1P2OA 2OQUA 4BTUB 2F9PA 3GYMA 2F3CE 1DANH 1E38B 1EZXC 4WMDA 4RN6A 1DY8A 1KTTB 1IQEA 3GY2A 1UTOA 1QA0A 3A8DA 3A88A 5GDSH 4X1PU 1YLDA 2BOHB 3PO1C 2FOHA 1HAXB 4ZXXH 3S7HB 2UUJB 4BAKB 1O2LA 1K21H 2XBXA 5EOKA 1W0ZU 3E0PB 2ZU4A 4AG1A 4WH8A 2A4QA 2FI5E 3MH5A 4ABIA 1OOKB 4I32A 1KDQA 2A31A 2ZGBH 1K2I1 3RC6A 1NRRH 4YT7H 3SJ9A 1GHAF 1W8BH 1T4UH 1GMDG 3PROA 2ZDVH 3AAUA 1MD7A 3P70B 4AFUA 5EPYA 1J8AA 2D1JA 1CGJE 5DKMA 2ZFRH 1C5PA 1CSOE 1S83A 4CRBA 2A7JA 1VR1H 1XVMA 1J17T 3QTVH 4GHQA 1MBMA 4HTCH 3CP7A 2EC9H 4ZHLU 1GHBF 2NU2E 1GMHG 2C3SA 4ZUHA 4K8BA 3RXTA 3N7OA 1JMOH 2BM2A 1YGCH 5T6FA 3QN7A 1C2EA 1OP0A 1ZTJA 2EA3A 2JH5D 1B0EA 1P9UA 2CF8H 4CRFA 1TBRH 2FO9A 1C2HA 3H5CB 4E7RG 1O5EH 3KIDU 1SGFA 2VNTA 1DT2A 1Y3UA 1DDJA 3LJOA 3BTHE 1SMFE 3SNEA 5JDUB 4B73A 1CGIE 2YNBA 3MTYA 4O03A 6GCHG 1HIAB 4XBDA 1C5ZB 1SGPE 1SL3A 2G8TA 3EQ0H 1C2LA 1P2NA 2QGRA 3EE0B 1NS3A 1N1LA 3E1XB 5EU8A 3D49H 5E2PA 2ZI2H 2H5DA 4NCYA 4WH6A 2AIQA 1C5RA 3SUFA 1FV9A 3LJJA 1EP5A 1BQYA 2HALA 3GICB 3E8LA 1AUJA 1O37A 2ZGCA 5F6MA 2WINI 5FAHA 2AERH 2PSYA 3A86A 1KLIH 4NA7A 1G3CA 3SUGA 4R0IA 3PWBA 4FUHA 1O33A 3QK1A 1TNLA 2ZHEH 5JB9S 2GZ8A 8LPRA 1EPTB 1JIMA 2C8ZB 1D3QB 4I8GA 3DT0H 1GBHA 4NIVA 1ETTH 1O36A 1K1IA 2JH0D 1P09A 1OYTH 3LGIA 4QT8C 2Z7FE 2HPQH 3EA7A 2WPMS 2H5CA 4Y6DA 2UWLA 4LZ1H 2AYWA 3FFGA 2A7CA 2A2XH 2OUAA 4U2WA 3TLOA 4IMZA 1YLCA 3A7YA 1K1JA 1QCPA 2BD7A 1MKXH 1V3XA 3RXHA 1P3EA 1O34A 1QL9A 3SJ8A 3UWIA 1NTPA 1SGRE 1ZMNA 3A89A 1AY6H 2PKSC 1D3DB 3U8OH 1DICA 4GUXA 2Y80A 1UTLM 1EPTC 2V6NA 3JZ1B 1VCWA 3TJOA 5BPEA 3OYPA 1D6RA 1NFUA 2FDAA 2ODQA 4GVUA 2HNTE 2VH6A 3Q76A 4DIHH 1ZPZA 3OSYA 3RXQA 4CRCA 3T26A 4HI3A 3CENA 3V13A 3ATLA 2BDHA 2VVCA 1O2QA 1WCZA 4WXVA 4AOQA 2HWLB 3K2UA 2GCTC 1H8IH 1BIOA 3ODDA 3BIUH 1YM0A 1TPPA 5A0BA 2WPHS 1P02A 2VINA 1UCYK 3TH3H 1PPCE 2Y5GA 1TQ0B 1C5LH 1DWEH 3SI4H 4Y8YA 1VITH 2P3UB 1P8VC 1SGQE 1VITF 4CH8B 2O8LA 1C4U2 4KKDA 1V2OT 1ACBE 2R3UA 4GHTA 4WMEA 1SGIB 2IPHA 3PB1E 1DLEA 1V2KT 1O5AB 1T31A 3SNAA 3MU4A 3MU5A 3ATIA 3ZZ4A 4OGXA 3M37A 3UOPA 1TBQH 1GG6B 1Z1IA 5AFYH 4MLFB 2QF0A 3RLYH 4INLA 3A8BA 2G51A 3ZZBA 3GCHB 2PW8H 1C2MA 3MH7A 3ZVBA 1OSSA 1OWDA 1TONA 1IQIA 3HGPA 1Y3XA 4NSYA 4JZDH 1FMGA 1ELEE 2H9EH 1QA7A 2Y5HA 2BY9X 4ZAEA 4BXSA 2ZCHP 2OC7A 1C2GA 1OWJA 3M7QA 4GAWA 2VIDA 4NFFA 3AW1A 2BLVA 2PSXA 1YYY1 5DK1A 2W7SA 3SNDA 3AW0A 2A4RA 7GCHF 5TCCA 2G00A 2G52A 1GDUA 4X6NA 4ABGA 4B1TA 1ZPCA 1HBTH 1JBUH 1FDPA 1GHWH 2GKVE 1TGCA 1GG6C 1ABIH 1EQ9A 3RXGA 3BF6H 2J38A 1V2NT 1QB6A 3F9FA 1NRPH 2FX6A 1F92A 1HAIH 2GP9B 4DT7B 4X6MA 2UUFB 3M35A 1K1PA 1TA6A 3MHWU 2QF3A 3BG4B 1VGCB 3D62A 1A4WH 5EW1H 1W2KH 2F91A 1O5DH 1SFQB 4I7YH 4JZEH 2VIQA 1QB9A 4Z6AH 3UUZA 2AS9A 4ZKRU 1ELBA 4AGJA 5FPTA 4H6TA 3A80A 1P9SA 1OP8A 1AQ7A 2QY0B 2OTVA 1BTWA 5GJ4B 2BTCE 2P93A 2C93B 1TNHA 2WPJS 1TNJA 2ALPA 1C1NA 1LKAA 4HGCA 1NESE 4O97A 5EXNA 1ELAA 2A2QH 1F7ZA 3LGUA 1ESBA 3BG4C 2THFB 1VGCC 4CRGA 1QQ4A 1CE5A 1F5LA 3SJIA 1DPOA 1RGQA 3HATH 2OINA 5C2ZA 1Z6JH 1WU1A 1KLTA 1ABJH 1G30B 5TJXA 3A7VA 3GYLB 1SGTA 3BG8A 1KXCA 1MBQA 3PMBB 1O3DA 1P06A 3RU4E 2OC0A 4MNWA 1DWDH 1Z8IB 2HOBA 3QO6A 4CREA 2HLCA 2SGFE 3LKWA 3QDZB 3LGVA 3URDA 4GSOA 2ILNA 3L6PA 4FU8A 1O2WA 4MNYA 1N8OB 1T4VH 1Z7KA 2ZA5A 2ZU2A 3M61U 1EB1H 3QGNB 3T25A 1C5QA 1AKSB 1LMWB 3PLKA 2VWLA 1MTNC 1EUFA 1NU7B 3VXFH 1GBAA 1EAXA 3PMJA 1Z1JA 4AX9H 2AH4X 1ESTA 4HZHA 1W11U 3M36A 2Y82A 5CHAB 2R0KA 1B5GH 3D65E 1LCYA 4YOGA 1G37A 1O2YA 1WUNH 5HXFA 1BJUA 3HK3B 1CA0B 1AZZA 3RXOA 1TA2A 2ZWLH 1A3BH 4IGDA 2BDBA 3ZVFA 1LVOA 1RJXB 1L1JA 9LPRA 1PYTD 4FUIA 4B75A 3RXMA 5EXLA 3PM3A 4TPIZ 2GDDA 1UVTH 1T8NA 5C1YA 1J9CH 3PWCA 4THNH 2BDCA 3RMLH 8GCHF 1SFIA 2FZZA 4B76A 1ID5H 1SOTA 2SNVA 1HAPH 4X8VH 1BMNH 1BTYA 5F8ZA 2ZDAH 4BNRA 4Q80A 5CHAC 1V6DA 1AD8H 1GBCA 1GI4A 1YCPK 1THRH 1BA8B 3LH1A 4GCHF 2BVSH 2BQWB 2A5IA 2O8UA 2Y5FA 3MU1A 1CA0C 1H9HE 1GI1A 1BRCE 3SU6A 1EATA 1PPHE 4IW4E 8ESTE 5GPIB 3BTTE 1UMAH 1GMCG 1S0RA 4VGCB 1C5NH 1DM4B 3VPKA 1EXFA 2OCVB 4NGAH 1E0FD 1MH0A 2ZU5A 1W12U 2QYIA 4MNXA 1RTLA 3KNXA 1LPZB 1TALA 2ZHFH 4OS1A 1EAUA 2BLOA 4E7NA 4A1TA 1O31A 1C5WB 1G3EA 1CBWB 1GJ7B 3KCGH 1QURH 4CR5A 2TPIZ 2KAIB 1EAIA 1GI0A 1MZAA 3VB3A 1O3PB 1LHGH 1ANEA 4Y0YE 3VEQB 1Y5BT 3UQOA 4E05H 4WXIA 3E6PH 4AORA 2D26C 3RXVA 4MQAA 1FY8E 3RXPA 5G4BA 1O39A 5A8XA 3UPEA 3TGKE 1DSTA 2QXIA 3UQVA 1V2RT 4JMYA 4VGCC 2B8OH 3S9AA 3RXEA 4YOJA 1TNKA 2LPRA 2ZU1A 1V2LT 2FOFA 1KXFA 3UNQA 4U30A 2DUCA 3Q00A 2TBSA 2SGEE 3UR9A 5HM2A 1O3JA 1W7GH 1VCPA 1IQFA 1BTUA 4AZ2B 1ANBA 3UY9A 2PTCE 1RTKA 9ESTA 1MKWK 4XE4A 1ZGIA 1GJDB 2Y7ZA 1NC6A 4MDSA 4YESB 7KMEH 3SI3H 4UFEH 2C90B 1OWIA 1RS0A 4JCNA 2NU4E 4X1SU 2GV7A 3F9EA 3RXJA 1CHOF 1TABE 2FYRA 3HKJB 4OS2A 4ABHA 1T8LA 1C1RA 1LHFH 3A8CA 1AVWA 2I6SA 2R0LA 1TX7A 3H7TA 1NN6A 3FANA 1AVXA 5ETXA 3S7KB 1O2OA 5GCHG 3K6ZA 3ZVCA 2BXUH 1DITH 3C1KA 3MWIU 2Z3CA 1PYTC 3EDXB 2ANYA 1A0JA 1D3PB 1TGSZ 5E8EH 1O2JA 3SQHE 3GY3A 2ZC9H 2ZKSA 2ZZUH 3RU4D 3PO1B 2F9NA 3RXDA 2BD9A 2SGDE 4OS7A 2OC1A 1BOQA 4Q7ZA 3LIWA 1O0DH 5C1XA 3OX7U 1FLEE 1A1RA 2QXGA 1GHVH 3RXIA 1XKBC 2XC5A 5AF9H 1GBKA 2G4UA 2VH0A 5EXMA 1HV7A 3NWUA 1Y8TA 3VXEH 3KGPA 2BX3A 1O3MA 1KSNA 1UK2A 4YM9A 1ELGA 2J94A 3ZZDA 3KQBA 4GPGA 5AFZH 1IQGA 1GHYH 2GT7A 1DSUA 1GI3A 1WYKA 4GLYA 4KTSA 4FUDA 3QLPH 1GMDF 4CBOA 1ZSLA 3BV9B 2HGTH 3QX5H 3QTOH 4UFGH 2FOCA 4DVAU 4FU7A 2QXJA 1UK4A 2BDIA 4INKA 4FVDA 3PYHA 1MQ5A 5H4IB 4TPYA 4B2BA 1BTZA 2BY6X 2Q6DA 5JBTA 1GMHF 3KF2A 3GY5A 1BT7A 1GDQA 1ORFA 1TGBA 1BBRH 1BRUP 2FOGA 4K3JA 4X6OA 3RC5A 4DG4A 1PFXC 1CGHA 1E35B 2OLGA 3ENSB 4XFQA 1O2NA 2AMQA 1UHBA 1AO5A 2CN0H 5GXPA 3SU3A 1PPGE 4DGJA 2STBE 1RIWC 4UDWH 1O2TA 1INCA 2QA9E 3RXFA 2VIVA 2ZO3H 3EGKH 4A7IB 1SQTA 1QHRB 5B6OA 6GCHF 1EOLA 2D2DA 3DA9B 1L1NA 1MU6B 1HPGA 1GCTB 3NKKA 5A0CA 1HJ9A 1NRSH 2P8OC 1O3KA 4D7FA 4UFDH 4NZLA 3UOUA 2FM2A 2PV9B 3TITA 3SBKA 1C1VH 1UVUH 4K8YA 2BVRH 2XYAA 4JZ1A 4NA9H 1P2JA 2BY5X 1FUJA 4F49A 1ZZZA 1HJ8A 1O2ZA 4U32A 2A5AA 1VJAU 4Y11E 4TYDA 4ZKOU 1EAWA 4XSKU 2GCHG 1MAYA 1TPOA 3LGTA 1HIAA 2ANMH 2P94A 2DE8A 3A7WA 4PROA 1P2IA 1Z8RA 5IDKA 1MCTA 1A2CH 1WQVH 3F9HA 5BRRE 2BD5A 4NWLA 1C5TA 3LDXH 1THPB 1EKBB 2F9UA 4FXGH 2P3TB 1GCTC 3E16B 2QN5T 1CT4E 3SU0A 1QBOA 3M3SA 3NXPA 1AWFH 3MH4A 5IYTA 4BAOB 1GPZA 4I8JA 2CV3A 5EG4A 4WF8A 5DP4A 3AVZA 3TNTA 1DX5M 1PJPA 2QC2A 1O2VA 1BHXF 4Y8ZA 2ZFSA 5FX6A 4FVBA 2BD8A 2PKSB 1GVZA 1B7XB 2PKAA 3V0XA 2R2WU 1QJ6B 1OP2A 2B7DH 4D9RA 1IQLA 2JH6D 3S69A 3MU0A 2I6QA 1LVMA 2ANKH 4X6PA 4I8HA 2AMPA 4H4FA 1BDAA 5T6GA 1ZMLA 1K1OA 2SNWA 3PLBA 4I33A 2BXTH 1H1BA 3SJKA 1DS2E 3ZZ8A 3ATWA 1JWTA 2C4FH 1QJ1B 2BQ6B 1A46H 3G01A 1MAXA 5DPAA 4X1QU 1SC8U 4K1TA 1O2GH 1YKTA 3GCOA 4Y0ZE 5F8XA 2GCTB 2WUCA 3SORA 3T27A 5DGJA 5EPNA 4ZHMU 2NU0E 1W14U 3NPSA 4XBBA 1XUJA 1GHZA 3L33A 2H9HA 2EI7A 2BD2A 1UTKA 1ZTKA 4NFEA 5K0HA 1HDTH 3ELAH 4FU9A 1D9IA 2AIPA 2FLRH 2WPIS 1CT2E 1ZMJA 1N6XA 2CHAB 1SG8B 3RXUA 3GCNA 1QNJA 2ZDLA 1LQDB 3F1SB 1UO6A 4WMFA 4IC5A 1LPKB 3STIA 4Y7BA 3FVFB 3EA8A 1OWEA 3SQEE 1C5SA 3QZQA 2RA0A 1GWAA 2WPLS 4DJZB 5SGAE 1FI8A 2FWWA 1O3GA 2PTNA 3RC4A 1SLVB 1GBBA 3OY5U 1BUIA 3KN2A 1Z8GA 1IQKA 4O9VA 3MNBA 3STJA 5GIBA 2J4IA 1WOFA 3HGNA 3M5NA 2ZU3A 1G36A 1C4V2 3VFEA 2ODYB 2Z3EA 1C2IA 3A7TA 5A8ZA 3UIRA 4RKJB 5AHGH 5JBCS 2V3HH 1D6WA 1O2HA 2CHAC 2XXLA 1W13U 1XUHA 2R2MB 4NIWA 6ESTA 5LPRA 1QL7A 3R0FA 1MQ6A 1XUKA 5FXLA 2Z9KA 3P92A 1ANDA 2BB4A 2XCFA 1SHHB 2ASUB 1W7XH 4BANB 3T5FH 2CXVA 2FI3E 3SV7A 1F0TA 1P03A 1QBVH 3MI4A 1PPBH 2Z94A 3RP2A 1LDTT 1BITA 5EGMA 3M5OA 1DXPA 1BMMH 4LOYH 3GY8A 5JYIA 1AE5A 1Z8JB 4F4OC 1OX1A 2XRCA 4X8TH 2STAE 1Q2WA 4R8TB 1UVOA 1IAUA 1EP6A 1GI9B 1UJ1A 1ELTA 1C2FA 3R3GB 1P10A 4NA8A 1YPKH 2PFEA 2BMGB 1P12E 1UCYH 4YTAA 3LC5A 1O3BA 1BTHH 5HYOA 4JZIA 1Y3YA 1O3HA 1EZSC 4ZKSU 1TGTA 1YC0A 2ZGJA 2C8XB 3GISB 3ODFA 4INHA 1PPFE 1V2VT 1BTPA 3BTFE 3LC3A 1C1SA 1MCVA 3SGAE 4AB8A 3P8GA 4J1YA 4ESTE 1GBFA 1C5YB 1QB1A 2GV6A 2A0QB 2FLBH 3S9BA 1KXBA 1RTFB 3U98H 1T8OA 4Q7YA 2RCEA 2PLXA 3SN8A 1OKXA 1GJBB 5C3NA 3UFAA 1JRSA 2GDEH 5E2OA 3TK6A 3MU8A 1UVSH 1O2PA 4CR9A 1MTSA 4Z0KA 2LNCA 1E36B 3FP6E 2AGEX 1SSXA 1NT1A 4ZKNU 1GBMA 1XUIA 4WY3A 1C9TA 1AGJA 3PV4A 1AU8A 1MTNB 1ZOMA 1HGTH 4TY7A 3GCTG 1UTPA 2PGBB 1RD3B 3TU7H 3CS7A 2B9LA 2JETB 2GX4A 1TGNA 2XBWA 4KGAA 3ZZCA 2BLQA 5JBAS 1MMJN 4CHAB 3LPRA 2A7HA 3M3VA 4KTCA 4AYVB 2C8WB 2F83A 2C8YB 1TRNA 2UWOA 3KEEA 1TBZH 1HNEE 4HFPB 2YNAA 2BDAA 3VGCC 1FXYA 1YPEH 4AYYB 2ZPRA 3V7TA 1SBWA 2Z6BD 3PMAB 4A5TS 1ELFA 2BY7X 3O8RA 1TLDA 5DG6A 1HXEH 1LVBA 4ISNA 2W7UA 1BBRE 3E3TA 3MFJA 1O30A 2H1UA 2NU1E 2FS9A 2M5TA 1AKSA 2PR3A 1C1QA 1C1MA 2SGPE 4OS4A 3UWJH 5LPFA 2ZPSA 1KXDA 1IQJA 2JETC 3BTWE 1JIRA 4X1RU 1C1PA 1AMHA 4KP0A 3GDVA 3FAOA 4AFZA 2FOAA 4CHAC 1NU9A 1ETRH 2Z9IA 2P3FH 1S0QA 3FZZA 1GI5A 3O8BA 1TX6A 4JYVH 4Y10E 3A82A 1FONA 1TAWA 1HB0B 3H7OA 1TPSA 1C5VA 4D76A 1P2KA 4ISLA 1AFQC 1WBGB 2WUBA 2XNIA 4CH2B 1UTQA 1HAVA 4M7GA 3LH3A 1BB0B 1DY9A 3S9CA 2W3IA 1K22H 2BY8X 1X7AC 3BTDE 4DURA 2ZCLP 5F8TA 1V2ST 1C4Y2 1GMCF 1RRKA 2ZF0H 4J2YB 1TNGA 3P95A 3ZVDA 3MO3A 2XC4A 4DCDA 1J16A 1SGCA 2ZDKA 1BRBE 2GGVB 3LU9B 2FI4E 1C1WH 1DLKB 1V2PT 1P2QA 2TRMA 1TB6H 1H9LB 4ZMAH 2VWOA 1QR3E 1AB9B 2IOTA 1AVGH 1GJ4H 2Z9JA 1L4DA 4E06H 1ZJKA 3NCLA 3BTEE 3FP8E 1O2UA 4X2VA 2HNTF 1VCQA 2RG3A 1D4PB 5C67A 2Q6FA 1PPZA 1QFKH 3E91A 4SGAE 1O3IA 2ANWA 3BIVH 4K60A 1G2LA 2ULLA 4ZXYH 3ZZ7A 2BQ7B 3NK8A 4DY7B 4X0WU 5C1UA 1HUTH 3Q3KA 3ZZ9A 3SNCA 4NWKA 1L1GA 4X1NU 1IQHA 4BTIB 1ELVA 4AG2A 4DOQA 1FNIA 3L3TA 3A8AA 1UK3A 4YLUA 3V3MA 3Q3XA 1ZRKA 2KAIA 2ZNKH 2FTMA 2VIWA 3P8FA 1AB9C 2VWNA 3JZ2B 2Z9LA 1GGDB 3MO6A 3K9XB 2G4TA 3F6UH 1O38A 1UTMA 3KQCA 1OS8A 4KTUA 4Y8XA 4GCHG 2J34A 1ZLRA 2BDYA 1GBLA 3A84A 3NZIA 1O3CA 1O5FH 1GI7B 2ZDNA 3RDZA 4AN7A 2BD4A 2PUXB 4IBLH 4TWWA 2VB0A 5EQQA 4Y7AA 2F9VA 1FAXA 1TIOA 2BVXH 3RM0H 1DUEA 1YCPH 3RXRA 1UVPA 4JK6A 3MO9A 1AUTC 3SV2H 1BJVA 1GBDA 1O5CB 3QGJA 1TNIA 5LPEA 4MPXA 1XXFA 1NM6A 2G55A 1DWBH 1T8MA 1SQAA 1WQSA 3HK6B 3SV8A 2FOBA 1GGDC 1P01A 2WYJA 1SLXB 2GD4B 5EQSA 3OU0A 2FP7B 2OQ5A 3C27B 3OTJE 1EZQA 1BMLA 3A7ZA 5C5NA 1DUAA 3E90B 5L30H 1HYLA 2QIQA 1Q31A 1NPMA 3S0NA 4UONA 4IS5A 1PQAA 1QTFA 2A1DB 3IG6B 4X2XA 4SGBE 1CO7E 5A8YA 1OYQA 4MPVA 4FUCA 4AFQA 3M5LA 2TGAA 3MMGA 2GZ7A 1O3LA 1ETSH 3F68H 1YPGH 2A4GA 4A1XA 2FX4A 1THSH 3EAJA 1QJ7B 2PWXA 3K6YA 1EJNA 5JBBS 7LPRA 1WTHD 3RU4T 3SV9A 3T28A 2G5VA 2QCYA 5L2ZH 3GOVB 3ITIA 1KY9A 1SB1H 4IN2A 1O2IA 5C5OA 5LH8A 1T32A 5ESBA 3E0NB 1SLUB 1TWXB 1ZHPA 2F9OA 1MKWH 5K7RA 1V2MT 1XX9A 1WV7H 2VU8E 2AFQB 1RIWB 3M7UA 4JYUH 4BOHA 2NWNA 2SGAA 2OC8A 1PQ8A 4NIYA 3GY7A 3VB6A 1ARBA 1GBTA 2Z9GA 4OGYA 2CF9H 2WV5A 1BCUH 3MYWA 1K1LA 1XVOA 1BMAA 3DUXH 2H6MA 2R9PA 1GBEA 1NRQH 2P8OB 1FY4A 3TGIE 5T3HA 1OPHB 1UCYE 5A2MH 4XBCA 4B71A 4MTBA 4K1SA 1GJAB 1SLWB 1GL1A 1A3EH 1MTUA 1A0HB 3BEFB 1KDQB 3U1JB 3GDUA 1ARCA 1TOCB 2ZQ2A 2EI6A 1J15A 3I77A 3ZVEA 1A5GH 2GCHF 4Q2KA 1Y5UT 3BTKE 3KQEA 1UHBB 4A92A 3U69H 3VB5A 4UFFH 2J92A 1SR5C 1XMNB 2A45B 3TVJB 1KLJH 3B8JA 2FOMB 3SGBE 4ZROA 5CE1A 1P05A 1YCPM 2OBQA 1EJMA 5DP7A 2W26A 3T62A 1KIGH 3AASA 3LONA 3SHCH 3ZV9A 1GHAG 1DWCH 1SGFG 3URCA 2TGTA 2OP9A 2UWPA 2ZFTA 1RFNA 4FUJA 1IHTH 2ZFPH 1O2XA 5F03A 7ESTE 3TK9A 1MTWA 1V2WT 5LGOA 5T6DA 1MTVA 1YPHC 1S85A 2ESTE 1GHBG 1GJ5H 3SUDA 2B5TB 2CMYA 1H9IE 1MKXK 2Y6TA 1D3TB 1EASA 1OWHA 2VVVA 4X8SH 1QIXB 4NSVA 4D7GA 1GVKB 3BN9A 1GJ8B 1C5MD 3P17H 1SHYA 1LHCH 5DP5A 1IOEA 3ATMA 4ISHH 5I46H 2PGQB 1TMUH 2H9TH 2CJIA 3SO3A 3MNXA 2F9BH 1DFPA 3ATKA 2UUKB 1GHXH 3DD2H 1EPTA 4YT6H 4NIXA 1G3BA 1P2MA 2W3KA 1ZGVA 4X2YA 1TYNA 1LPGB 3SW2B 1W10U 4NG9H 2O8WA 1FIZA 5HMAA 4Y76A 1YF4A 2UUYA 2PKAB 4I8LA 2J9NA 2D8WA 1S6FA 4B2CA 1EX3A 1Y59T 3LGYA 1EB2A 3TIUA 3TNSA 1RXPA 5FCRA 1G2MA 1O32A 4RSPA 4XOJA 3T29A 1ELCA 3UNSA 3ZZ5A 1GVLA 3TJUA 1AIXH 3ESTA 3DHKH 3VB7A 5FX5A 2XCNA 3VB4A 1FY5A 5PTPA 1LQEA 2FPZA 3TH4H 3ZYEA 1CU1A 1H4WA 1NO9H 2NU3E 3BEUA 1FY3A 1P11E 1YP9A 3NUMA 3RLWH 3PTNA 2ALVA 1C1TA 1Z71A 1GI6A 3SJOA 4ABBA 1TRMA 2RA3A 1YPLH 3SOSA 3M3TA 1BHXB 4MG3A 1VJ9U 1AZ8A 3KQDA 3Q3YA 2ZGHA 3P6ZB 3QUMP 2BZ6H 4X2WA 1O5BB 1LHEH 1A5IA 4WVPE 4ZH8A 1ZJDA 1O5GH 1QL8A 1AN1E 1XUGA 2TIOA 3KHVA 2HPPH 1UTJA 3K65B 1O3AA 1FQ3A 3SV6A 3I78A 5AVDA 3SU1A 4A1VA 4YZUA 2AEIH 2AGIX 4OS6A 4K2YA 3W95A 1G3DA 3KL6A 3SU4A 1E37B 2G5NA 5DJ7A 4AB9A 2EEKA 2Q6GA 4AGKA 1C5OH 1LTOA 3SHAH 5FPSA 3T2NA 2ZHDA 3EYDA 2FMJA 2IN2A 5A09A 2VIPA 1HAGE 1O2KA 1QRWA 3P8NA 4TY6A 4IC6A 3D23A 1FN8A 1SGDE 2VJ1A 2VIOA 2ZG0H 3GY4A 2FIRH 4YO9A 3UREA 4WWYA 4A6LA 4Y79A 3RXAA 2ZECA 2BLWA 1MD8A 4BAMB 2Q1JA 3DFJA 1IHSH 3U8TH 1K28D 2ZTYA 1JRTA 1A0LA 1GJ9B 1NZQH 1FJSA 4TWYA 4B74A 1DXWA 1FY1A 1JOUB 2TGDA 3TJVA 2GTBA 2K1QA 1C1OA 4ISOA 2XW9A 5EQRA 2PUQH 1HAOH 1SI5H 4OS5A 1O3FA 1O3OA 1FZZA 2OXSA 3EA9A 3M7TA 6LPRA 1VITG 1ZPBA 3MH6A 3RUOA 1DVAH 4YOIA 1V2UT 2GT8A 5DP3A 5DP8A 4YLQH 1W3CA 2VGCB 1TPAE 3B9FH 1F0UA 3IWMA 3TJNA 4FUEA 2JKHA 1SOZA 8KME2 1YPMH 2BHGA 1YPJH 4JYTA 1F5RA 4ASHA 2OBOA 2A4OA 5FHTA 4K5ZA 4BAHB 3QZRA 5DP9A 3O8CA 1XM1A 3GCHC 1BZXE 1P04A 2WPKS 5J4SA 3TGJE 2V0BA 5HGGA 3UNRA 3TPIZ 2B0FA 5L2YH 1IQMA 1HLTH 1HRTH 4XDEA 1K1MA 1JXPA 3GCTF 2CGAA 1V2TT 2RDLA 7GCHG 5FBIA 1F0RA 1CVWH 3RM2H 2FODA 4DW2U 1EZUC 1F0SA 3V12A 6CHAB 1A7SA 1E34B 2VGCC 2DE9A 4Q7XA 3VGCB 1LKBA 3WY8A 2FYQA 1C2KA 1DE7H 1WSSH 1Z6EA 2GMTB 3LOXA 4I8KA 1GCDA 3PLPA 1L4ZA 2A5KA 2BZAA 2BX4A 2EI8A 1NRNH 1TMTH 1DOJA 2GZ9A 1G9IE 1FAKH 4X8UH 2VVUA 3A81A 1YPHE 5E0JA 3SU2A 2ZHQH 1S84A
chains in the Genus database with same CATH superfamily
1P0SH 2FS8A 3EE7A 2IJOB 3RXBA 2FEQH 4ISIH 1UTNA 3IITA 3SGQE 1GBIA 2J97A 2P95A 6CHAC 2FOEA 2KZ4A 4O3UA 5I25A 1S82A 5CMXH 4ABEA 5C20A 2GMTC 1F5KU 4WJG2 1AFQB 1HAZB 4U01A 1C2JA 3SNBA 1TRYA 2XC0A 3SU5A 1HFDA 1ELDE 1K9OE 3A7XA 1O2SA 4FUGA 2WPDD 1ZYOA 2YOLA 4CRDA 4ABFA 1VKYA 1L0ZA 3DFLA 3UTUH 4B2AA 3AAVA 1ZSKA 2BYAX 4FUFA 1IQNA 5ABWA 3U9AH 3A83A 1LHDH 5EJ1A 1SQRA 1NFXA 1AE8H 1C9PA 1ZR0A 3ZZ6A 4MNVA 1HCGA 1ZTLA 3SUEA 2ZEBA 4HG6A 2BDGA 3GDSA 5EODA 1S6HA 1TQ7B 3W94A 2ZTXA 1WAYB 3HKIB 3UR6A 1GDNA 1Y5AT 3F9GA 3TH2H 1GI2A 1GBJA 1QRZA 2XBYA 1CA8B 5E0HA 1CHGA 2TGPZ 5FCKA 1ANCA 3TK5A 2V7QD 1Q3XA 1QRXA 1K1NA 4H42U 3RMOH 3KQ5A 1A5HA 1VZQH 1SGYE 1U6QA 1O2RA 2QV1A 5C0UA 2FXRA 1TE0A 1ZHRA 1WTGH 2R3YA 1PPEE 1H8DH 1AWHB 1N6YA 1F2SE 2GJGA 1N8OC 5DO4H 1GJ6A 3ZV8A 3RXKA 3RXSA 2AGGX 2HVXA 2QF5A 1Y3WA 1GI8B 1HAVB 2QXHA 1P3CA 2ZCKP 3BSQA 1C1UH 2W6ID 1C2DA 4D8NA 1GJCB 2Y81A 2O8TA 3VG8A 1FIWA 2V3OH 2Z3DA 1NFYA 5JB8S 1AHTH 1BRAA 3RMNH 4O3TA 1CQQA 1LO6A 2XWAA 2AMDA 2Y7XA 4MPUA 2ZTZA 4K1EA 4ABJA 2G81E 2ZFQH 1HAHH 2ZQ1A 2O9QA 1TOMH 5J4QA 1V2QT 3U1IB 1FN6A 2WYGA 1AFEH 2FTLE 3ZZ3A 5GWZA 2ZHWH 2XWBI 1TX8A 4ZHAA 4BTTB 5A0AE 1ZSJA 1XUFA 5DP6A 1HAYB 2QAAA 1GL0E 3O8DA 1BTXA 1NROH 2ZFFH 3HPTB 8GCHG 4LZ4B 1SGNE 1XXDA 1W0YH 3GY6A 1KTSB 3I29A 1Y3VA 1PQ5A 2OD3B 4JK5A 4ABDA 1ESAA 1J14A 1HXFH 4MPWA 1V2JT 4NZQA 5L6NH 4IMQA 4FUBA 1KYNA 1QQUA 3OY6U 1T7CA 1FPHH 4RT0A 3BTGE 1C5XB 2H2ZA 3Q77A 2KM0A 2P16A 2SGQE 1ZHMA 4ABAA 4BAQB 3PTBA 4UE7H 2ZPQA 1YBWA 1S5SA 3MOCA 2PHBA 4Y71A 3F2FA 2ZP0H 3BEIB 2XBVA 1LVYA 2A32A 1YY3A 3BTME 2WV4A 2J2UA 1B0FA 2GVFA 3RXLA 4BXWA 5KECA 3ZVGA 1E1QD 1SGEE 1P57B 3FZDA 5FPYA 3RXCA 5GCHF 2BD3A 1KXAA 1G32B 1KXEA 1QY6A 3ZZAA 4D9QA 4KELA 1PQ7A 5TCAA 2ZIQH 4FOUC 2ZGXH 3P8OA 3ZYDA 2FESH 3LGWA 4LXBH 4DIIH 1CBWC 1C5UA 1CT0E 1OWKA 3BTQE 1OXGA 4B6FA 4LK4A 1SPJA 4MVNA 1NFWA 1ZRBA 5EW2H 1HJAB 1A61H 2P59A 3B23B 3U8RH 2HNTC 1EJAA 3A87A 1QGFA 4H6SB 1SQOA 1MZDA 3RMMH 3MNCA 4JZFH 1TMBH 1O2MA 2ZDMA 3A85A 1MUEB 2BOKA 4K69A 5JPMH 4RKOB 4IN1A 1O35A 1L2EA 4M9FA 1BBRK 2HRVA 2SFAA 1FPCH 3SZNA 1AI8H 2V35A 1MU8B 1NY22 1M9UA 3MNSA 1O3EA 3QWCH 3LT3A 3CS0A 1QBNA 4AFSA 3FP7E 1O3NA 4UD9H 2W5EA 1SVPA 2XTTB 2ODPA 1S81A 4I31A 4CBNA 1CHOG 3ZVAA 1HJAC 2J95A 4CRAA 4UEHH 5ESTE 5HM9A 2O8MA 3M5MA 1XKAC 3OEHD 3PMHB 1TFXA 2VWMA 5FBEA 5E0GA 1EOJA 1P2OA 2OQUA 4BTUB 2F9PA 3GYMA 2F3CE 1DANH 5GNDA 1E38B 1EZXC 4WMDA 4RN6A 1DY8A 1KTTB 1IQEA 3GY2A 1FX0B 1UTOA 1QA0A 3A8DA 3A88A 5GDSH 4X1PU 1YLDA 2BOHB 3PO1C 2FOHA 1HAXB 4ZXXH 3S7HB 2UUJB 4BAKB 1O2LA 1K21H 2XBXA 5EOKA 1W0ZU 3E0PB 2ZU4A 4AG1A 4WH8A 2A4QA 2FI5E 3MH5A 4ABIA 1OOKB 4I32A 1KDQA 2A31A 2ZGBH 1K2I1 3RC6A 1NRRH 4YT7H 3SJ9A 1GHAF 1W8BH 1T4UH 1GMDG 3PROA 2ZDVH 3AAUA 1MD7A 3P70B 4AFUA 5EPYA 1J8AA 2D1JA 2L6OA 1CGJE 5DKMA 2ZFRH 1C5PA 1CSOE 1S83A 4CRBA 2A7JA 1VR1H 1XVMA 1J17T 3QTVH 4GHQA 1MBMA 4HTCH 3CP7A 2EC9H 4ZHLU 1GHBF 2NU2E 1GMHG 2C3SA 4ZUHA 4K8BA 3RXTA 3N7OA 1JMOH 2KFWA 2BM2A 1YGCH 5T6FA 3QN7A 1C2EA 5HKKD 1OP0A 1ZTJA 2EA3A 2JH5D 2KCPA 1B0EA 1P9UA 2OK5A 2CF8H 4CRFA 1TBRH 2FO9A 1C2HA 3H5CB 4E7RG 1O5EH 3KIDU 1SGFA 2VNTA 1DT2A 1Y3UA 1DDJA 3LJOA 3BTHE 1SMFE 3SNEA 5JDUB 4B73A 1CGIE 2YNBA 3MQKC 3MTYA 4O03A 6GCHG 1HIAB 4XBDA 1C5ZB 1SGPE 1SL3A 2G8TA 3EQ0H 1C2LA 1P2NA 2QGRA 3EE0B 1NS3A 1N1LA 3E1XB 5EU8A 3D49H 5E2PA 2ZI2H 4I86A 2H5DA 4NCYA 4WH6A 2AIQA 1C5RA 3SUFA 1FV9A 3LJJA 1EP5A 1BQYA 2HALA 3GICB 3E8LA 1AUJA 1O37A 2ZGCA 5F6MA 2WINI 5FAHA 2AERH 2PSYA 3A86A 1KLIH 4NA7A 1G3CA 3SUGA 4R0IA 3PWBA 4FUHA 1O33A 3QK1A 1TNLA 2ZHEH 5JB9S 2GZ8A 8LPRA 1EPTB 1JIMA 2C8ZB 1D3QB 4I8GA 3DT0H 1GBHA 4NIVA 1ETTH 1O36A 1K1IA 2JH0D 1P09A 1OYTH 3LGIA 4QT8C 2Z7FE 2HPQH 3EA7A 2WPMS 2H5CA 4Y6DA 2UWLA 4LZ1H 2AYWA 3FFGA 2A7CA 2A2XH 2OUAA 4U2WA 3TLOA 4IMZA 5KEDA 1YLCA 3A7YA 1K1JA 1QCPA 2BD7A 1MKXH 1V3XA 3RXHA 1P3EA 3FN8A 1O34A 1QL9A 3SJ8A 3UWIA 1NTPA 1SGRE 1ZMNA 3A89A 3NRLA 1AY6H 2PKSC 1D3DB 3U8OH 1DICA 4GUXA 2Y80A 1UTLM 1EPTC 2V6NA 3JZ1B 1VCWA 3TJOA 5BPEA 3OYPA 1D6RA 1NFUA 2FDAA 2ODQA 4GVUA 2J5UA 2HNTE 2VH6A 3Q76A 4DIHH 1ZPZA 3OSYA 3RXQA 4CRCA 3T26A 4HI3A 3CENA 3V13A 3ATLA 2BDHA 2VVCA 1O2QA 1WCZA 4WXVA 4AOQA 2HWLB 3K2UA 2GCTC 1H8IH 1BIOA 3ODDA 3BIUH 1YM0A 1TPPA 5A0BA 2WPHS 1P02A 2VINA 1UCYK 3TH3H 1PPCE 2Y5GA 1TQ0B 1C5LH 1DWEH 3SI4H 4Y8YA 1VITH 2P3UB 1S6LA 1P8VC 1SGQE 1VITF 4CH8B 2O8LA 1C4U2 4KKDA 1V2OT 1ACBE 2R3UA 4GHTA 4WMEA 1SGIB 2IPHA 3PB1E 1DLEA 1V2KT 1O5AB 1T31A 3SNAA 3MU4A 3MU5A 3ATIA 3ZZ4A 4OGXA 3M37A 3UOPA 1TBQH 1GG6B 1Z1IA 5AFYH 3OEED 4MLFB 2QF0A 3RLYH 4INLA 3A8BA 2G51A 3ZZBA 4F48B 3GCHB 2PW8H 1C2MA 3MH7A 3ZVBA 1OSSA 1OWDA 1TONA 1IQIA 3HGPA 1Y3XA 4NSYA 4JZDH 1FMGA 2V3MA 1ELEE 2H9EH 1QA7A 2Y5HA 2BY9X 4ZAEA 4BXSA 2ZCHP 2OC7A 1C2GA 1OWJA 2LELA 3M7QA 2WHXA 4GAWA 2VIDA 4NFFA 2K8IA 2QE7D 2BLVA 2PSXA 3AW1A 1YYY1 4ACAA 2WZQA 5DK1A 2W7SA 3SNDA 3AW0A 2A4RA 7GCHF 5TCCA 2G00A 2G52A 1GDUA 4X6NA 4ABGA 4B1TA 1ZPCA 1HBTH 4FETA 1JBUH 1FDPA 1GHWH 2GKVE 1NBME 1TGCA 1GG6C 1ABIH 1EQ9A 3RXGA 1MABB 3BF6H 2J38A 1V2NT 1QB6A 3F9FA 1NRPH 2FX6A 1F92A 1HAIH 2GP9B 4DT7B 4Q4LA 4X6MA 2UUFB 3M35A 1K1PA 1TA6A 3MHWU 1K0HA 2QF3A 3BG4B 1VGCB 3D62A 1A4WH 5EW1H 1W2KH 2F91A 4RI0A 1O5DH 1SFQB 4I7YH 4JZEH 2VIQA 1QB9A 4Z6AH 3UUZA 2AS9A 4ZKRU 1ELBA 4AGJA 5FPTA 4H6TA 3A80A 1P9SA 1OP8A 1AQ7A 2QY0B 2OTVA 1BTWA 5GJ4B 3OE7D 2BTCE 2P93A 2C93B 1TNHA 2WPJS 1TNJA 2ALPA 1C1NA 1LKAA 4HGCA 1NESE 4O97A 5EXNA 1ELAA 2A2QH 2EY4C 1F7ZA 3LGUA 1ESBA 3BG4C 2THFB 1VGCC 4CRGA 1QQ4A 1BMFD 1CE5A 1F5LA 2QF4A 3FOAA 5EJLA 3SJIA 1DPOA 1RGQA 1W0KD 3HATH 2OINA 5C2ZA 1Z6JH 1WU1A 1KLTA 1ABJH 1G30B 5TJXA 3A7VA 3GYLB 1SGTA 3BG8A 1KXCA 1MBQA 3PMBB 1O3DA 1P06A 3F2GA 3RU4E 5C0TA 2OC0A 4MNWA 1DWDH 1Z8IB 2HOBA 3QO6A 4CREA 2HLCA 2SGFE 3LKWA 3QDZB 3LGVA 3URDA 4GSOA 2ILNA 3L6PA 4FU8A 1O2WA 4MNYA 4XD7D 1N8OB 4ASUD 1T4VH 1Z7KA 2ZA5A 2ZU2A 3M61U 1EB1H 3QGNB 3T25A 1C5QA 1AKSB 1LMWB 3PLKA 2VWLA 1MTNC 1EUFA 1NU7B 3VXFH 1GBAA 1EAXA 1COWD 3DSPA 3PMJA 1Z1JA 3SYJA 2AH4X 4AX9H 1ESTA 4HZHA 1W11U 3M36A 2Y82A 5CHAB 2R0KA 1B5GH 3D65E 1LCYA 4YOGA 1G37A 1O2YA 1WUNH 5HXFA 1BJUA 3HK3B 1CA0B 1AZZA 3RXOA 1TA2A 2ZWLH 1A3BH 4IGDA 2BDBA 3ZVFA 1LVOA 1RJXB 1L1JA 9LPRA 1PYTD 4FUIA 4B75A 3RXMA 5EXLA 3PM3A 4TPIZ 2GDDA 1UVTH 1T8NA 5C1YA 1J9CH 3PWCA 4THNH 2BDCA 3RMLH 4B6EA 8GCHF 1SFIA 2FZZA 4B76A 1ID5H 1SOTA 2SNVA 1HAPH 4X8VH 1BMNH 1BTYA 5F8ZA 2ZDAH 4BNRA 4Q80A 5CHAC 1V6DA 1AD8H 1GBCA 1GI4A 1YCPK 1THRH 1BA8B 3LH1A 4GCHF 2BVSH 2BQWB 2A5IA 2O8UA 2Y5FA 3MU1A 1CA0C 1H9HE 4P02A 1GI1A 1BRCE 3SU6A 1EATA 1PPHE 4IW4E 8ESTE 5GPIB 3BTTE 1UMAH 1GMCG 1S0RA 4VGCB 1C5NH 1DM4B 3VPKA 1EXFA 2OCVB 4NGAH 1E0FD 1MH0A 2ZU5A 1W12U 2QYIA 4MNXA 1RTLA 3KNXA 1LPZB 1TALA 2ZHFH 4OS1A 1EAUA 2BLOA 4E7NA 4A1TA 5CHBA 1O31A 1C5WB 2M2AA 1G3EA 1CBWB 1GJ7B 3KCGH 1QURH 4CR5A 2TPIZ 2KAIB 1EAIA 1GI0A 1MZAA 3VB3A 1O3PB 1LHGH 1ANEA 4Y0YE 3VEQB 1Y5BT 3UQOA 1NBMD 3FKSD 4E05H 4WXIA 3E6PH 4AORA 5F53A 1H8ED 2D26C 3RXVA 4MQAA 1FY8E 3RXPA 5G4BA 1O39A 5A8XA 3UPEA 3TGKE 1DSTA 2QXIA 3UQVA 1V2RT 4JMYA 4VGCC 2B8OH 3S9AA 3RXEA 4YOJA 1TNKA 2LPRA 2ZU1A 1V2LT 2FOFA 3F2HA 1KXFA 3UNQA 4U30A 2DUCA 3Q00A 2TBSA 2SGEE 3UR9A 5HM2A 1O3JA 1W7GH 1VCPA 1IQFA 1BTUA 4AZ2B 1ANBA 3UY9A 2PTCE 1RTKA 9ESTA 1MKWK 4XE4A 1ZGIA 1GJDB 2Y7ZA 1NC6A 4MDSA 4YESB 7KMEH 3SI3H 4UFEH 2C90B 1OWIA 1RS0A 4JCNA 5EJZA 2NU4E 4X1SU 2GV7A 3F3BA 3F9EA 3RXJA 1CHOF 1TABE 2FYRA 3HKJB 4OS2A 4ABHA 1T8LA 1C1RA 1LHFH 3A8CA 1AVWA 2I6SA 2R0LA 1TX7A 3H7TA 1NN6A 3FANA 1AVXA 5ETXA 3S7KB 1O2OA 5GCHG 3K6ZA 3ZVCA 2BXUH 1DITH 3C1KA 5HIZA 3MWIU 2Z3CA 1PYTC 3EDXB 2ANYA 4P00A 1A0JA 1D3PB 1TGSZ 5E8EH 1O2JA 3SQHE 3GY3A 2ZC9H 2ZKSA 2ZZUH 3RU4D 3PO1B 2F9NA 3RXDA 2BD9A 2SGDE 4OS7A 2OC1A 1BOQA 4Q7ZA 3LIWA 1O0DH 5C1XA 2JJ2D 2W6JD 3OX7U 1FLEE 1A1RA 2QXGA 1GHVH 3RXIA 4Z1MD 2J98A 1XKBC 2XC5A 5AF9H 1GBKA 2G4UA 2VH0A 5EXMA 1HV7A 3NWUA 1Y8TA 3VXEH 3KGPA 2BX3A 1O3MA 1KSNA 1UK2A 4YM9A 1ELGA 2J94A 3ZZDA 3KQBA 4GPGA 5AFZH 1IQGA 1GHYH 2GT7A 1DSUA 1GI3A 1WYKA 4GLYA 4KTSA 4FUDA 3QLPH 3WW7A 1GMDF 4CBOA 1ZSLA 3BV9B 2HGTH 3QX5H 3UAIC 3QTOH 4UFGH 2FOCA 2XNDD 4DVAU 4FU7A 2QXJA 1UK4A 2BDIA 4INKA 4FVDA 3PYHA 1MQ5A 5H4IB 4TPYA 4B2BA 1BTZA 2BY6X 2Q6DA 2LP6A 5JBTA 1GMHF 3KF2A 3GY5A 1BT7A 1GDQA 1ORFA 1TGBA 1BBRH 1BRUP 2FOGA 4K3JA 4X6OA 3RC5A 4DG4A 1PFXC 1CGHA 1E35B 2OLGA 3ENSB 4XFQA 1O2NA 2AMQA 1UHBA 1AO5A 2CN0H 5GXPA 3SU3A 1PPGE 4DGJA 2STBE 1RIWC 4UDWH 1O2TA 1INCA 2QA9E 3RXFA 2VIVA 2F43B 2ZO3H 3EGKH 4A7IB 1SQTA 1QHRB 5B6OA 6GCHF 3N7DA 1EOLA 2D2DA 3OTPA 3DA9B 1L1NA 1MU6B 1HPGA 1GCTB 3NKKA 5A0CA 1HJ9A 1NRSH 2P8OC 1O3KA 4D7FA 4UFDH 4NZLA 3UOUA 2FM2A 2PV9B 3TITA 3SBKA 1C1VH 1UVUH 4K8YA 2BVRH 2XYAA 4JZ1A 4NA9H 1P2JA 2BY5X 1FUJA 4F49A 1ZZZA 1HJ8A 1O2ZA 4U32A 2A5AA 5B6LA 1VJAU 4Y11E 4TYDA 4ZKOU 1EAWA 4XSKU 2GCHG 1MAYA 1TPOA 2JIZD 3LGTA 1HIAA 2ANMH 4AC9A 2P94A 2DE8A 3A7WA 4PROA 1P2IA 1Z8RA 2CK3D 5IDKA 1MCTA 1A2CH 1WQVH 3F9HA 5BRRE 2BD5A 4NWLA 1C5TA 2KCYA 3LDXH 1THPB 1EKBB 2F9UA 4FXGH 2P3TB 1GCTC 3E16B 2QN5T 1CT4E 3SU0A 1QBOA 3M3SA 3NXPA 1AWFH 3MH4A 5IYTA 4BAOB 1GPZA 4I8JA 2CV3A 5EG4A 5T1VA 4WF8A 5DP4A 3AVZA 3TNTA 1DX5M 1EFRD 1PJPA 2QC2A 2XOKD 1O2VA 4TT3D 1BHXF 4Y8ZA 2ZFSA 5FX6A 4FVBA 2BD8A 1GVZA 2PKSB 1B7XB 2PKAA 3V0XA 2R2WU 1QJ6B 1OP2A 2B7DH 4D9RA 1IQLA 2JH6D 3S69A 3MU0A 2I6QA 1LVMA 2ANKH 4X6PA 4I8HA 2AMPA 4H4FA 1BDAA 5T6GA 1ZMLA 1K1OA 2SNWA 3PLBA 4I33A 2BXTH 1H1BA 3SJKA 1DS2E 3ZZ8A 3ATWA 1JWTA 2C4FH 1QJ1B 2BQ6B 1A46H 3G01A 1MAXA 5DPAA 4X1QU 1SC8U 4K1TA 1O2GH 1YKTA 3GCOA 4Y0ZE 5F8XA 2GCTB 2WUCA 4YXWD 3SORA 3T27A 5DGJA 5EPNA 4ZHMU 2NU0E 1W14U 3NPSA 4XBBA 1XUJA 1GHZA 3L33A 2H9HA 3ZIAD 2EI7A 2BD2A 1UTKA 1ZTKA 4NFEA 5K0HA 1HDTH 3ELAH 4FU9A 1D9IA 2AHME 2AIPA 2FLRH 2WPIS 1CT2E 1ZMJA 1N6XA 2CHAB 1SG8B 3RXUA 3GCNA 1QNJA 2ZDLA 1LQDB 3F1SB 1UO6A 4WMFA 4IC5A 1LPKB 3STIA 4Y7BA 3FVFB 3EA8A 1OWEA 3SQEE 1C5SA 3QZQA 2RA0A 1GWAA 2WPLS 4DJZB 5SGAE 1FI8A 2FWWA 1O3GA 2PTNA 3RC4A 1SLVB 1GBBA 3OY5U 1BUIA 3KN2A 1Z8GA 1IQKA 4O9VA 3MNBA 3STJA 5GIBA 2J4IA 1WOFA 3HGNA 3M5NA 2ZU3A 4XRNA 1G36A 1C4V2 3VFEA 2ODYB 2Z3EA 1C2IA 3A7TA 5A8ZA 3UIRA 4RKJB 5AHGH 5JBCS 2V3HH 1D6WA 1O2HA 2CHAC 2XXLA 3N7EA 1W13U 1XUHA 2R2MB 4NIWA 6ESTA 5LPRA 1QL7A 3R0FA 1MQ6A 1XUKA 5FXLA 3UB0A 3AK5A 2Z9KA 3P92A 1ANDA 2BB4A 2XCFA 1SHHB 2ASUB 1W7XH 4BANB 3T5FH 2CXVA 2FI3E 3SV7A 1F0TA 1P03A 1QBVH 3MI4A 1PPBH 2Z94A 3RP2A 1LDTT 1BITA 5EGMA 3M5OA 1DXPA 1BMMH 4LOYH 3GY8A 5JYIA 2VBCA 3W1EA 1AE5A 1Z8JB 4F4OC 1OX1A 2XRCA 4X8TH 2STAE 1Q2WA 4R8TB 1UVOA 1IAUA 1EP6A 1GI9B 1UJ1A 1ELTA 1C2FA 3R3GB 1P10A 4NA8A 1YPKH 2PFEA 2F4LA 2BMGB 1P12E 1UCYH 4YTAA 3LC5A 1O3BA 1BTHH 5HYOA 4JZIA 1Y3YA 1O3HA 1EZSC 4ZKSU 1TGTA 1YC0A 2ZGJA 2C8XB 3GISB 3ODFA 3PV2A 4INHA 1PPFE 1V2VT 1BTPA 3BTFE 5FL7D 3LC3A 1C1SA 1MCVA 3SGAE 4AB8A 3P8GA 4J1YA 4ESTE 1GBFA 1C5YB 1QB1A 2GV6A 2A0QB 2FLBH 3S9BA 1KXBA 2RFKC 1RTFB 3U98H 1T8OA 4Q7YA 2RCEA 2PLXA 3SN8A 1OKXA 2KCAA 1GJBB 5C3NA 3UFAA 1JRSA 2GDEH 5E2OA 2HVYB 3TK6A 3MU8A 1UVSH 1H8HD 1O2PA 4CR9A 1MTSA 4Z0KA 2LNCA 1E36B 3FP6E 2AGEX 1SSXA 1NT1A 4ZKNU 1GBMA 1XUIA 4WY3A 1C9TA 1AGJA 3PV4A 1AU8A 1MTNB 1ZOMA 1HGTH 4TY7A 3GCTG 1UTPA 5DSFA 2PGBB 1RD3B 3TU7H 3CS7A 2B9LA 2JETB 2GX4A 1QZ8A 1TGNA 2XBWA 4KGAA 3ZZCA 2BLQA 5JBAS 1MMJN 4CHAB 3LPRA 2A7HA 5KGOA 3M3VA 4KTCA 4AYVB 2C8WB 2F83A 2C8YB 3PRDA 1TRNA 2UWOA 3KEEA 1TBZH 1HNEE 4HFPB 2YNAA 2BDAA 3VGCC 1FXYA 1YPEH 4AYYB 3U28C 2ZPRA 3V7TA 1SBWA 2Z6BD 3PMAB 4A5TS 1ELFA 2BY7X 3O8RA 1TLDA 5DG6A 1HXEH 1LVBA 4ISNA 2W7UA 1BBRE 3E3TA 3MFJA 1O30A 2H1UA 2FS9A 2M5TA 2NU1E 1AKSA 2PR3A 1C1QA 1C1MA 2SGPE 4OS4A 1YLNA 3UWJH 5LPFA 2ZPSA 1KXDA 1IQJA 2JETC 3BTWE 1JIRA 4X1RU 1C1PA 1AMHA 4KP0A 3GDVA 3FAOA 4AFZA 2FOAA 4CHAC 1NU9A 1ETRH 2Z9IA 2P3FH 1S0QA 3FZZA 1GI5A 3O8BA 1TX6A 4JYVH 4Y10E 2KX4A 3A82A 2WSSD 1FONA 1TAWA 1HB0B 3H7OA 1TPSA 1C5VA 4D76A 1P2KA 4ISLA 1AFQC 1WBGB 2WUBA 2XNIA 2IPQX 4CH2B 1UTQA 1HAVA 4M7GA 3LH3A 1BB0B 1DY9A 3S9CA 2W3IA 1K22H 2BY8X 3F0PA 1X7AC 3BTDE 4DURA 2ZCLP 5F8TA 1V2ST 3WWBA 1C4Y2 1GMCF 1RRKA 2ZF0H 4J2YB 1TNGA 3P95A 3ZVDA 3MO3A 2XC4A 4DCDA 1J16A 1SGCA 2ZDKA 1BRBE 2GGVB 3LU9B 2FI4E 1C1WH 1DLKB 1V2PT 1P2QA 2TRMA 1TB6H 1H9LB 4ZMAH 2VWOA 1QR3E 2K0QA 1AB9B 2IOTA 1AVGH 1GJ4H 2Z9JA 1L4DA 4E06H 1ZJKA 3NCLA 3BTEE 5CDFE 3FP8E 1O2UA 4X2VA 2HNTF 4RT1A 1VCQA 2RG3A 1D4PB 5C67A 2Q6FA 1PPZA 1QFKH 3E91A 4SGAE 1O3IA 2ANWA 3BIVH 4K60A 1G2LA 2ULLA 4ZXYH 3ZZ7A 2BQ7B 3NK8A 2EQNA 4DY7B 4X0WU 5C1UA 1HUTH 3Q3KA 3ZZ9A 3SNCA 4NWKA 1L1GA 4X1NU 1IQHA 4BTIB 1ELVA 4AG2A 4DOQA 1FNIA 3L3TA 3A8AA 1UK3A 4YLUA 3V3MA 3Q3XA 1ZRKA 2KAIA 2ZNKH 2FTMA 2VIWA 3P8FA 1AB9C 2VWNA 3JZ2B 2Z9LA 1GGDB 3MO6A 3K9XB 2G4TA 3F6UH 1O38A 1UTMA 3KQCA 1OS8A 1E79D 4KTUA 4Y8XA 2YMSD 4GCHG 2J34A 1ZLRA 2BDYA 1GBLA 3A84A 3NZIA 4OM9A 1O3CA 1O5FH 1GI7B 2ZDNA 3RDZA 4AN7A 2BD4A 2PUXB 4IBLH 4TWWA 2VB0A 5EQQA 5C94A 4Y7AA 2F9VA 1FAXA 1TIOA 2BVXH 3RM0H 1DUEA 1YCPH 3RXRA 1UVPA 4JK6A 3MO9A 1AUTC 3SV2H 3H09A 1BJVA 3KYGA 1GBDA 1O5CB 3QGJA 3PRBA 1TNIA 5LPEA 4MPXA 1XXFA 1YWUA 1NM6A 2G55A 1DWBH 1T8MA 3N99A 1SQAA 1WQSA 3HK6B 3SV8A 2FOBA 1GGDC 1P01A 2WYJA 1SLXB 2GD4B 5EQSA 3OU0A 2FP7B 2OQ5A 3C27B 3OTJE 1EZQA 2JJ1D 1BMLA 3A7ZA 5C5NA 1DUAA 3E90B 5L30H 1HYLA 2QIQA 1Q31A 1NPMA 3S0NA 4UONA 4IS5A 1PQAA 1QTFA 2A1DB 3IG6B 4X2XA 4SGBE 1CO7E 5A8YA 1OYQA 4MPVA 4FUCA 4TSFD 4AFQA 3M5LA 2TGAA 3MMGA 2GZ7A 1O3LA 1SKYE 1ETSH 3F68H 1YPGH 2A4GA 4A1XA 2FX4A 1THSH 3EAJA 1QJ7B 2PWXA 3K6YA 3KYFA 1EJNA 5JBBS 7LPRA 1WTHD 3RU4T 3SV9A 3DSOA 3T28A 2G5VA 2QCYA 5L2ZH 3GOVB 3ITIA 1KY9A 1SB1H 4IN2A 1O2IA 5C5OA 5LH8A 1T32A 5ESBA 3E0NB 1SLUB 1TWXB 1ZHPA 2F9OA 1MKWH 5K7RA 2YMSB 1V2MT 1XX9A 1WV7H 3WWFA 2VU8E 2AFQB 1RIWB 3M7UA 2J98B 4JYUH 4BOHA 2NWNA 2SGAA 2OC8A 1PQ8A 4NIYA 3GY7A 3VB6A 1ARBA 1GBTA 2Z9GA 4OGYA 2CF9H 3SZEA 2WV5A 1BCUH 3MYWA 1K1LA 1XVOA 1BMAA 3DUXH 2H6MA 3DCLA 2R9PA 1GBEA 1NRQH 2P8OB 1FY4A 2L74A 3PV5A 3TGIE 5T3HA 1OPHB 1UCYE 5A2MH 4XBCA 4B71A 4Q63A 4MTBA 3OFND 1GJAB 2YMSC 4K1SA 1SLWB 1GL1A 1A3EH 1MTUA 1A0HB 3BEFB 1KDQB 3U1JB 3GDUA 1ARCA 1TOCB 2ZQ2A 2EI6A 1J15A 3I77A 3ZVEA 1A5GH 2GCHF 4Q2KA 1Y5UT 3BTKE 3KQEA 1UHBB 4A92A 3U69H 3VB5A 4UFFH 2J92A 1SR5C 1XMNB 3F0OA 2A45B 3TVJB 1KLJH 3B8JA 2FOMB 3SGBE 4ZROA 5CE1A 1P05A 2PP6A 1YCPM 2OBQA 5DN6D 1EJMA 5DP7A 2W26A 3T62A 1KIGH 3AASA 3LONA 3SHCH 3ZV9A 1GHAG 1DWCH 1SGFG 3URCA 2TGTA 2OP9A 2UWPA 2ZFTA 1RFNA 4FUJA 1IHTH 2ZFPH 1O2XA 5F03A 7ESTE 3TK9A 1MTWA 1V2WT 5LGOA 5T6DA 1MTVA 1YPHC 1S85A 2ESTE 1GHBG 1GJ5H 3SUDA 2B5TB 2CMYA 1H9IE 1MKXK 2IJD1 2Y6TA 1D3TB 1EASA 1OWHA 2VVVA 4X8SH 1QIXB 4NSVA 4D7GA 1GVKB 3BN9A 1GJ8B 1C5MD 3P17H 1SHYA 1LHCH 5DP5A 1IOEA 3ATMA 4ISHH 5I46H 2PGQB 1TMUH 2H9TH 2CJIA 3SO3A 3MNXA 2F9BH 1DFPA 3ATKA 2UUKB 1GHXH 3DD2H 1EPTA 4YT6H 4NIXA 1G3BA 1P2MA 2W3KA 1ZGVA 4X2YA 1TYNA 4ZCNA 1LPGB 3SW2B 1W10U 1UW7A 4NG9H 2O8WA 1FIZA 5HMAA 4Y76A 1YF4A 2UUYA 2PKAB 4I8LA 2J9NA 2D8WA 1S6FA 4B2CA 1EX3A 1Y59T 3LGYA 1EB2A 3TIUA 3TNSA 1RXPA 5FCRA 1G2MA 1O32A 4RSPA 4XOJA 3T29A 5C17A 1ELCA 3UNSA 3ZZ5A 1GVLA 3TJUA 1AIXH 3ESTA 3DHKH 3VB7A 5FX5A 2XCNA 1E1RD 3VB4A 1FY5A 5PTPA 1LQEA 2FPZA 3TH4H 3ZYEA 1CU1A 1H4WA 1NO9H 2NU3E 3BEUA 1FY3A 1P11E 1YP9A 3NUMA 3RLWH 3PTNA 2ALVA 1C1TA 1Z71A 1GI6A 3SJOA 4ABBA 1TRMA 2RA3A 1YPLH 3SOSA 3M3TA 1BHXB 4MG3A 1VJ9U 1AZ8A 3KQDA 3Q3YA 2ZGHA 3P6ZB 3QUMP 2BZ6H 4X2WA 1O5BB 1LHEH 1A5IA 4WVPE 4ZH8A 1ZJDA 1O5GH 1QL8A 5EIYA 1AN1E 1XUGA 2TIOA 3KHVA 2HPPH 1UTJA 3K65B 1O3AA 1FQ3A 3SV6A 3I78A 5AVDA 4F55A 3SU1A 4A1VA 4YZUA 2AEIH 2RDEA 2AGIX 3GS9A 4K2YA 4OS6A 3FO8D 3W95A 1G3DA 1WDIA 3KL6A 3SU4A 1E37B 2G5NA 5DJ7A 4AB9A 2EEKA 2Q6GA 4AGKA 1C5OH 1LTOA 3SHAH 5FPSA 3T2NA 2KCOA 2ZHDA 3EYDA 2FMJA 2IN2A 5A09A 2VIPA 1HAGE 1O2KA 1QRWA 3P8NA 5IK2D 4TY6A 4IC6A 3D23A 1FN8A 1SGDE 2VJ1A 2VIOA 2ZG0H 3DSGA 2FIRH 3GY4A 4YO9A 3UREA 4WWYA 4A6LA 4Y79A 3RXAA 2ZECA 2BLWA 1MD8A 4BAMB 2Q1JA 3DFJA 1IHSH 3U8TH 1K28D 2ZTYA 1JRTA 1A0LA 1GJ9B 1NZQH 1FJSA 4TWYA 4B74A 1DXWA 1FY1A 1JOUB 2TGDA 3TJVA 1OHHD 2GTBA 1C1OA 2K1QA 4ISOA 2XW9A 5EQRA 2PUQH 1HAOH 2KR7A 1SI5H 4OS5A 1O3FA 1O3OA 1FZZA 2OXSA 3EA9A 3M7TA 1KMHB 6LPRA 1VITG 1ZPBA 2WV9A 3MH6A 3RUOA 1DVAH 4YOIA 1V2UT 2GT8A 5DP3A 5DP8A 4YLQH 1W3CA 2VGCB 1TPAE 3B9FH 1F0UA 3IWMA 3TJNA 4FUEA 5HIYA 2JKHA 1SOZA 8KME2 1YPMH 2BHGA 1YPJH 4JYTA 3CNRA 1F5RA 4ASHA 2OBOA 2A4OA 5FHTA 4K5ZA 4BAHB 3QZRA 5DP9A 3O8CA 1XM1A 3OAAD 3GCHC 1BZXE 1P04A 2WPKS 5J4SA 3TGJE 2V0BA 5HGGA 3UNRA 3TPIZ 2B0FA 5L2YH 1IQMA 1HLTH 1HRTH 4XDEA 1K1MA 1JXPA 3GCTF 2CGAA 2JDID 1V2TT 2RDLA 7GCHG 5FBIA 1F0RA 1CVWH 3RM2H 2FODA 4DW2U 1EZUC 1F0SA 3V12A 6CHAB 1A7SA 1E34B 2VGCC 2DE9A 4Q7XA 3VGCB 1LKBA 3WY8A 2FYQA 1C2KA 1DE7H 1WSSH 1Z6EA 2GMTB 3LOXA 4ACBA 4I8KA 1GCDA 3PLPA 1L4ZA 2A5KA 2BZAA 2BX4A 2EI8A 1NRNH 2HLDD 1TMTH 1DOJA 2GZ9A 1G9IE 1FAKH 4X8UH 2VVUA 3A81A 1YPHE 5E0JA 4DT4A 1WXRA 3SU2A 2ZHQH 1S84A 1W0JD
chains in the Genus database with same CATH topology
1P0SH 2FS8A 2IJOB 3RXBA 2FEQH 4ISIH 1UTNA 3IITA 3SGQE 1GBIA 2P95A 6CHAC 2FOEA 4O3UA 5I25A 1S82A 5CMXH 4ABEA 5C20A 2GMTC 1F5KU 4WJG2 1AFQB 1HAZB 4U01A 1C2JA 3SNBA 1TRYA 2XC0A 3SU5A 1HFDA 1ELDE 1K9OE 3A7XA 1O2SA 4FUGA 1ZYOA 2YOLA 4CRDA 4ABFA 1L0ZA 3DFLA 3UTUH 4B2AA 3AAVA 1ZSKA 2BYAX 4FUFA 1IQNA 5ABWA 3U9AH 3A83A 1LHDH 1NFXA 1AE8H 1C9PA 1ZR0A 3ZZ6A 4MNVA 1HCGA 1ZTLA 3SUEA 2ZEBA 2BDGA 3GDSA 5EODA 1S6HA 1TQ7B 3W94A 2ZTXA 1WAYB 3HKIB 3UR6A 1GDNA 1Y5AT 3F9GA 3TH2H 1GI2A 1GBJA 1QRZA 2XBYA 1CA8B 5E0HA 1CHGA 2TGPZ 5FCKA 1ANCA 3TK5A 1Q3XA 1QRXA 1K1NA 4H42U 3RMOH 1A5HA 1VZQH 1SGYE 1U6QA 1O2RA 2QV1A 2FXRA 1TE0A 1ZHRA 1WTGH 2R3YA 1PPEE 1H8DH 1AWHB 1N6YA 1F2SE 1N8OC 5DO4H 1GJ6A 3ZV8A 3RXKA 3RXSA 2AGGX 2HVXA 1Y3WA 1GI8B 1HAVB 2QXHA 1P3CA 2ZCKP 3BSQA 1C1UH 1C2DA 4D8NA 1GJCB 2Y81A 2O8TA 1FIWA 2V3OH 2Z3DA 1NFYA 5JB8S 1AHTH 1BRAA 3RMNH 4O3TA 1CQQA 1LO6A 2XWAA 2AMDA 2Y7XA 4MPUA 2ZTZA 4K1EA 4ABJA 2G81E 2ZFQH 1HAHH 2ZQ1A 2O9QA 1TOMH 5J4QA 1V2QT 3U1IB 1FN6A 2WYGA 1AFEH 2FTLE 3ZZ3A 5GWZA 2ZHWH 2XWBI 1TX8A 4ZHAA 4BTTB 5A0AE 1ZSJA 1XUFA 5DP6A 1HAYB 2QAAA 1GL0E 3O8DA 1BTXA 1NROH 2ZFFH 3HPTB 8GCHG 4LZ4B 1SGNE 1XXDA 1W0YH 3GY6A 1KTSB 3I29A 1Y3VA 1PQ5A 2OD3B 4JK5A 4ABDA 1ESAA 1J14A 1HXFH 4MPWA 1V2JT 4NZQA 5L6NH 4IMQA 4FUBA 1KYNA 1QQUA 3OY6U 1T7CA 1FPHH 3BTGE 1C5XB 2H2ZA 3Q77A 2P16A 2SGQE 1ZHMA 4ABAA 4BAQB 3PTBA 4UE7H 2ZPQA 1YBWA 1S5SA 3MOCA 2PHBA 4Y71A 2ZP0H 3BEIB 2XBVA 1LVYA 2A32A 3BTME 2WV4A 2J2UA 1B0FA 2GVFA 3RXLA 4BXWA 3ZVGA 1SGEE 1P57B 3FZDA 5FPYA 3RXCA 5GCHF 2BD3A 1KXAA 1G32B 1KXEA 1QY6A 3ZZAA 4D9QA 4KELA 1PQ7A 5TCAA 2ZIQH 2ZGXH 3P8OA 3ZYDA 2FESH 3LGWA 4LXBH 4DIIH 1CBWC 1C5UA 1CT0E 1OWKA 3BTQE 1OXGA 4LK4A 1SPJA 4MVNA 1NFWA 1ZRBA 5EW2H 1HJAB 1A61H 2P59A 3B23B 3U8RH 2HNTC 1EJAA 3A87A 1QGFA 4H6SB 1SQOA 1MZDA 3RMMH 3MNCA 4JZFH 1TMBH 1O2MA 2ZDMA 3A85A 1MUEB 2BOKA 4K69A 5JPMH 4RKOB 4IN1A 1O35A 1L2EA 1BBRK 2HRVA 2SFAA 1FPCH 3SZNA 1AI8H 2V35A 1MU8B 1NY22 1M9UA 3MNSA 1O3EA 3QWCH 3LT3A 3CS0A 1QBNA 4AFSA 3FP7E 1O3NA 4UD9H 2W5EA 1SVPA 2XTTB 2ODPA 1S81A 4I31A 4CBNA 1CHOG 3ZVAA 1HJAC 2J95A 4CRAA 4UEHH 5ESTE 5HM9A 2O8MA 3M5MA 1XKAC 3PMHB 1TFXA 2VWMA 5FBEA 5E0GA 1EOJA 1P2OA 2OQUA 4BTUB 2F9PA 3GYMA 2F3CE 1DANH 1E38B 1EZXC 4WMDA 4RN6A 1DY8A 1KTTB 1IQEA 3GY2A 1UTOA 1QA0A 3A8DA 3A88A 5GDSH 4X1PU 1YLDA 2BOHB 3PO1C 2FOHA 1HAXB 4ZXXH 3S7HB 2UUJB 4BAKB 1O2LA 1K21H 2XBXA 5EOKA 1W0ZU 3E0PB 2ZU4A 4AG1A 4WH8A 2A4QA 2FI5E 3MH5A 4ABIA 1OOKB 4I32A 1KDQA 2A31A 2ZGBH 1K2I1 3RC6A 1NRRH 4YT7H 3SJ9A 1GHAF 1W8BH 1T4UH 1GMDG 3PROA 2ZDVH 3AAUA 1MD7A 3P70B 4AFUA 5EPYA 1J8AA 2D1JA 1CGJE 5DKMA 2ZFRH 1C5PA 1CSOE 1S83A 4CRBA 2A7JA 1VR1H 1XVMA 1J17T 3QTVH 4GHQA 1MBMA 4HTCH 3CP7A 2EC9H 4ZHLU 1GHBF 2NU2E 1GMHG 2C3SA 4ZUHA 4K8BA 3RXTA 3N7OA 1JMOH 2BM2A 1YGCH 5T6FA 3QN7A 1C2EA 1OP0A 1ZTJA 2EA3A 2JH5D 1B0EA 1P9UA 2CF8H 4CRFA 1TBRH 2FO9A 1C2HA 3H5CB 4E7RG 1O5EH 3KIDU 1SGFA 2VNTA 1DT2A 1Y3UA 1DDJA 3LJOA 3BTHE 1SMFE 3SNEA 5JDUB 4B73A 1CGIE 2YNBA 3MTYA 4O03A 6GCHG 1HIAB 4XBDA 1C5ZB 1SGPE 1SL3A 2G8TA 3EQ0H 1C2LA 1P2NA 2QGRA 3EE0B 1NS3A 1N1LA 3E1XB 5EU8A 3D49H 5E2PA 2ZI2H 2H5DA 4NCYA 4WH6A 2AIQA 1C5RA 3SUFA 1FV9A 3LJJA 1EP5A 1BQYA 2HALA 3GICB 3E8LA 1AUJA 1O37A 2ZGCA 5F6MA 2WINI 5FAHA 2AERH 2PSYA 3A86A 1KLIH 4NA7A 1G3CA 3SUGA 4R0IA 3PWBA 4FUHA 1O33A 3QK1A 1TNLA 2ZHEH 5JB9S 2GZ8A 8LPRA 1EPTB 1JIMA 2C8ZB 1D3QB 4I8GA 3DT0H 1GBHA 4NIVA 1ETTH 1O36A 1K1IA 2JH0D 1P09A 1OYTH 3LGIA 4QT8C 2Z7FE 2HPQH 3EA7A 2WPMS 2H5CA 4Y6DA 2UWLA 4LZ1H 2AYWA 3FFGA 2A7CA 2A2XH 2OUAA 4U2WA 3TLOA 4IMZA 1YLCA 3A7YA 1K1JA 1QCPA 2BD7A 1MKXH 1V3XA 3RXHA 1P3EA 1O34A 1QL9A 3SJ8A 3UWIA 1NTPA 1SGRE 1ZMNA 3A89A 1AY6H 2PKSC 1D3DB 3U8OH 1DICA 4GUXA 2Y80A 1UTLM 1EPTC 2V6NA 3JZ1B 1VCWA 3TJOA 5BPEA 3OYPA 1D6RA 1NFUA 2FDAA 2ODQA 4GVUA 2HNTE 2VH6A 3Q76A 4DIHH 1ZPZA 3OSYA 3RXQA 4CRCA 3T26A 4HI3A 3CENA 3V13A 3ATLA 2BDHA 2VVCA 1O2QA 1WCZA 4WXVA 4AOQA 2HWLB 3K2UA 2GCTC 1H8IH 1BIOA 3ODDA 3BIUH 1YM0A 1TPPA 5A0BA 2WPHS 1P02A 2VINA 1UCYK 3TH3H 1PPCE 2Y5GA 1TQ0B 1C5LH 1DWEH 3SI4H 4Y8YA 1VITH 2P3UB 1P8VC 1SGQE 1VITF 4CH8B 2O8LA 1C4U2 4KKDA 1V2OT 1ACBE 2R3UA 4GHTA 4WMEA 1SGIB 2IPHA 3PB1E 1DLEA 1V2KT 1O5AB 1T31A 3SNAA 3MU4A 3MU5A 3ATIA 3ZZ4A 4OGXA 3M37A 3UOPA 1TBQH 1GG6B 1Z1IA 5AFYH 4MLFB 2QF0A 3RLYH 4INLA 3A8BA 2G51A 3ZZBA 3GCHB 2PW8H 1C2MA 3MH7A 3ZVBA 1OSSA 1OWDA 1TONA 1IQIA 3HGPA 1Y3XA 4NSYA 4JZDH 1FMGA 1ELEE 2H9EH 1QA7A 2Y5HA 2BY9X 4ZAEA 4BXSA 2ZCHP 2OC7A 1C2GA 1OWJA 3M7QA 4GAWA 2VIDA 4NFFA 3AW1A 2BLVA 2PSXA 1YYY1 5DK1A 2W7SA 3SNDA 3AW0A 2A4RA 7GCHF 5TCCA 2G00A 2G52A 1GDUA 4X6NA 4ABGA 4B1TA 1ZPCA 1HBTH 1JBUH 1FDPA 1GHWH 2GKVE 1TGCA 1GG6C 1ABIH 1EQ9A 3RXGA 3BF6H 2J38A 1V2NT 1QB6A 3F9FA 1NRPH 2FX6A 1F92A 1HAIH 2GP9B 4DT7B 4X6MA 2UUFB 3M35A 1K1PA 1TA6A 3MHWU 2QF3A 3BG4B 1VGCB 3D62A 1A4WH 5EW1H 1W2KH 2F91A 1O5DH 1SFQB 4I7YH 4JZEH 2VIQA 1QB9A 4Z6AH 3UUZA 2AS9A 4ZKRU 1ELBA 4AGJA 5FPTA 4H6TA 3A80A 1P9SA 1OP8A 1AQ7A 2QY0B 2OTVA 1BTWA 5GJ4B 2BTCE 2P93A 2C93B 1TNHA 2WPJS 1TNJA 2ALPA 1C1NA 1LKAA 4HGCA 1NESE 4O97A 5EXNA 1ELAA 2A2QH 1F7ZA 3LGUA 1ESBA 3BG4C 2THFB 1VGCC 4CRGA 1QQ4A 1CE5A 1F5LA 3SJIA 1DPOA 1RGQA 3HATH 2OINA 5C2ZA 1Z6JH 1WU1A 1KLTA 1ABJH 1G30B 5TJXA 3A7VA 3GYLB 1SGTA 3BG8A 1KXCA 1MBQA 3PMBB 1O3DA 1P06A 3RU4E 2OC0A 4MNWA 1DWDH 1Z8IB 2HOBA 3QO6A 4CREA 2HLCA 2SGFE 3LKWA 3QDZB 3LGVA 3URDA 4GSOA 2ILNA 3L6PA 4FU8A 1O2WA 4MNYA 1N8OB 1T4VH 1Z7KA 2ZA5A 2ZU2A 3M61U 1EB1H 3QGNB 3T25A 1C5QA 1AKSB 1LMWB 3PLKA 2VWLA 1MTNC 1EUFA 1NU7B 3VXFH 1GBAA 1EAXA 3PMJA 1Z1JA 4AX9H 2AH4X 1ESTA 4HZHA 1W11U 3M36A 2Y82A 5CHAB 2R0KA 1B5GH 3D65E 1LCYA 4YOGA 1G37A 1O2YA 1WUNH 5HXFA 1BJUA 3HK3B 1CA0B 1AZZA 3RXOA 1TA2A 2ZWLH 1A3BH 4IGDA 2BDBA 3ZVFA 1LVOA 1RJXB 1L1JA 9LPRA 1PYTD 4FUIA 4B75A 3RXMA 5EXLA 3PM3A 4TPIZ 2GDDA 1UVTH 1T8NA 5C1YA 1J9CH 3PWCA 4THNH 2BDCA 3RMLH 8GCHF 1SFIA 2FZZA 4B76A 1ID5H 1SOTA 2SNVA 1HAPH 4X8VH 1BMNH 1BTYA 5F8ZA 2ZDAH 4BNRA 4Q80A 5CHAC 1V6DA 1AD8H 1GBCA 1GI4A 1YCPK 1THRH 1BA8B 3LH1A 4GCHF 2BVSH 2BQWB 2A5IA 2O8UA 2Y5FA 3MU1A 1CA0C 1H9HE 1GI1A 1BRCE 3SU6A 1EATA 1PPHE 4IW4E 8ESTE 5GPIB 3BTTE 1UMAH 1GMCG 1S0RA 4VGCB 1C5NH 1DM4B 3VPKA 1EXFA 2OCVB 4NGAH 1E0FD 1MH0A 2ZU5A 1W12U 2QYIA 4MNXA 1RTLA 3KNXA 1LPZB 1TALA 2ZHFH 4OS1A 1EAUA 2BLOA 4E7NA 4A1TA 1O31A 1C5WB 1G3EA 1CBWB 1GJ7B 3KCGH 1QURH 4CR5A 2TPIZ 2KAIB 1EAIA 1GI0A 1MZAA 3VB3A 1O3PB 1LHGH 1ANEA 4Y0YE 3VEQB 1Y5BT 3UQOA 4E05H 4WXIA 3E6PH 4AORA 2D26C 3RXVA 4MQAA 1FY8E 3RXPA 5G4BA 1O39A 5A8XA 3UPEA 3TGKE 1DSTA 2QXIA 3UQVA 1V2RT 4JMYA 4VGCC 2B8OH 3S9AA 3RXEA 4YOJA 1TNKA 2LPRA 2ZU1A 1V2LT 2FOFA 1KXFA 3UNQA 4U30A 2DUCA 3Q00A 2TBSA 2SGEE 3UR9A 5HM2A 1O3JA 1W7GH 1VCPA 1IQFA 1BTUA 4AZ2B 1ANBA 3UY9A 2PTCE 1RTKA 9ESTA 1MKWK 4XE4A 1ZGIA 1GJDB 2Y7ZA 1NC6A 4MDSA 4YESB 7KMEH 3SI3H 4UFEH 2C90B 1OWIA 1RS0A 4JCNA 2NU4E 4X1SU 2GV7A 3F9EA 3RXJA 1CHOF 1TABE 2FYRA 3HKJB 4OS2A 4ABHA 1T8LA 1C1RA 1LHFH 3A8CA 1AVWA 2I6SA 2R0LA 1TX7A 3H7TA 1NN6A 3FANA 1AVXA 5ETXA 3S7KB 1O2OA 5GCHG 3K6ZA 3ZVCA 2BXUH 1DITH 3C1KA 3MWIU 2Z3CA 1PYTC 3EDXB 2ANYA 1A0JA 1D3PB 1TGSZ 5E8EH 1O2JA 3SQHE 3GY3A 2ZC9H 2ZKSA 2ZZUH 3RU4D 3PO1B 2F9NA 3RXDA 2BD9A 2SGDE 4OS7A 2OC1A 1BOQA 4Q7ZA 3LIWA 1O0DH 5C1XA 3OX7U 1FLEE 1A1RA 2QXGA 1GHVH 3RXIA 1XKBC 2XC5A 5AF9H 1GBKA 2G4UA 2VH0A 5EXMA 1HV7A 3NWUA 1Y8TA 3VXEH 3KGPA 2BX3A 1O3MA 1KSNA 1UK2A 4YM9A 1ELGA 2J94A 3ZZDA 3KQBA 4GPGA 5AFZH 1IQGA 1GHYH 2GT7A 1DSUA 1GI3A 1WYKA 4GLYA 4KTSA 4FUDA 3QLPH 1GMDF 4CBOA 1ZSLA 3BV9B 2HGTH 3QX5H 3QTOH 4UFGH 2FOCA 4DVAU 4FU7A 2QXJA 1UK4A 2BDIA 4INKA 4FVDA 3PYHA 1MQ5A 5H4IB 4TPYA 4B2BA 1BTZA 2BY6X 2Q6DA 5JBTA 1GMHF 3KF2A 3GY5A 1BT7A 1GDQA 1ORFA 1TGBA 1BBRH 1BRUP 2FOGA 4K3JA 4X6OA 3RC5A 4DG4A 1PFXC 1CGHA 1E35B 2OLGA 3ENSB 4XFQA 1O2NA 2AMQA 1UHBA 1AO5A 2CN0H 5GXPA 3SU3A 1PPGE 4DGJA 2STBE 1RIWC 4UDWH 1O2TA 1INCA 2QA9E 3RXFA 2VIVA 2ZO3H 3EGKH 4A7IB 1SQTA 1QHRB 5B6OA 6GCHF 1EOLA 2D2DA 3DA9B 1L1NA 1MU6B 1HPGA 1GCTB 3NKKA 5A0CA 1HJ9A 1NRSH 2P8OC 1O3KA