1UTPA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSINOGEN
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utpA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utpA02
5JYIA 1OWEA 1PFXC 2BVXH 1FQ3A 4XBBA 1RJXB 1O3MA 1W14U 1GVLA 1BRUP 1O5AB 4YOJA 3SJ8A 1FV9A 4X6MA 2FS8A 1WV7H 1A0HB 2WPHS 1O3PB 1Y3VA 3FVFB 3TJNA 4H6SB 3AVZA 4Y7BA 1U6QA 1IHTH 2ZGXH 5FBEA 1LPZB 3P8NA 1SB1H 3GDSA 3M35A 4YM9A 2ZO3H 1D3PB 1C2IA 4ZKOU 1BBRK 3MU5A 2W7UA 3ATIA 1LTOA 3A8CA 2C4FH 4YZUA 2WINI 1IQIA 2ZCLP 2WPJS 4AN7A 1GGDB 1QL7A 1YBWA 1XXDA 3M36A 2O9QA 2J95A 4YOIA 3CP7A 1NRNH 3P8FA 1QL8A 3E0NB 1QJ7B 2F9OA 4MDSA 1QCPA 1JIMA 2V35A 1CA0B 4HI3A 2O8TA 1O30A 1J15A 1DVAH 2XYAA 2CV3A 3RXOA 1QNJA 1G3EA 1RTKA 4GAWA 3VGCC 1YPMH 1C1QA 2AEIH 1LPKB 4Y11E 1O2QA 1LKAA 3LGWA 1MZAA 1LHGH 4U32A 3A87A 1BOQA 3E91A 2ZDNA 1GBBA 3RMLH 5A0CA 1RXPA 1QL9A 3M3TA 1Y5AT 3NCLA 1GBMA 1RS0A 3RXGA 1CU1A 4O03A 1RIWB 1O2OA 3B8JA 3PM3A 1DWEH 1JMOH 4DW2U 3LH3A 2W7SA 6GCHF 1O2IA 1LDTT 3M5LA 8KME2 3CS0A 5I46H 4B2CA 2P3FH 3BTWE 3PMBB 1EB1H 3SGAE 1NS3A 3KQDA 1KLJH 3U1JB 4YESB 5FPSA 2LNCA 1P3EA 4GHTA 2ZQ1A 2VJ1A 1GI1A 4J1YA 4THNH 2WUCA 1HAVB 4Q7YA 1NROH 4GSOA 3BTDE 5LPRA 2F9BH 3ATMA 3B23B 3BF6H 4X8TH 2PSYA 3SJIA 3V3MA 3MU8A 3QZRA 5J4SA 1A5HA 1ETTH 2BM2A 2YNBA 1TGCA 3LGVA 3QUMP 1GJ6A 2FI4E 1GHWH 2C90B 1D6RA 2FXRA 2XWAA 2FZZA 3GDUA 2J4IA 1O2WA 1ELVA 4NZQA 1J17T 2BQ7B 1A3EH 4MNYA 1G32B 2FESH 1O5EH 1SGTA 1QR3E 3RXAA 1MAYA 4LK4A 5F8XA 5FPTA 5J4QA 2XNIA 1HCGA 2FO9A 6CHAB 5FCRA 2BLQA 4JZIA 1P10A 1VGCB 2Y5FA 3RXSA 1TGNA 3MI4A 1IQGA 3TH4H 2F9VA 2Z6BD 3QN7A 1PPGE 1ARCA 1HAZB 2ZIQH 1FN6A 4O3TA 2A4GA 1TONA 3VXFH 3JZ2B 2DE8A 1VZQH 1C2MA 3SV7A 2ULLA 2AFQB 1ZMNA 1VR1H 1E36B 3QZQA 1O0DH 3AASA 4TPIZ 2ZU1A 2FLRH 1AUTC 2OINA 3EA9A 2G55A 3A7YA 1GMHG 2VIDA 3SHAH 2JETB 1C2JA 1BTYA 3SUGA 4MNWA 1O2VA 3F1SB 1TWXB 2BY7X 1MBMA 3O8RA 2ZPRA 1EZXC 1LVOA 5FHTA 5B6OA 1FAKH 1S85A 4AFSA 4IN2A 1TAWA 3S9CA 2NU1E 1MAXA 4AG1A 2G5NA 1DICA 3TGJE 1AIXH 4B2AA 3GY8A 1S81A 1D3TB 5JPMH 1YPKH 2ZG0H 3LC3A 5EXMA 2AH4X 2R9PA 1PPHE 4CBOA 1GL1A 4X8UH 1UK4A 4TY6A 4RKOB 1C1WH 1LQEA 3A7XA 3HATH 2ANMH 1K1IA 1TMTH 1OWJA 2TGTA 1OWHA 1TRNA 1P2MA 2HPQH 3C1KA 1HBTH 5C1YA 2IPHA 3LJJA 1C5LH 2JH0D 4ISIH 2QXGA 2GP9B 2PGQB 2A0QB 4E06H 1JOUB 2FOHA 3M3SA 1TABE 1UVUH 3HGPA 4M7GA 1GHAF 1EPTC 1ESTA 4XBCA 3SW2B 1BRBE 1K21H 1C1SA 3I29A 2H9HA 3ZVFA 1ANCA 1TPOA 5DP7A 1SGCA 1P2KA 1AQ7A 3KQBA 1T8LA 2VGCC 1NT1A 4U30A 1GBIA 3SGQE 1P03A 1Z6EA 3SNBA 4GCHF 1BTPA 2BLVA 1YCPK 4Y6DA 4MG3A 1BIOA 2P16A 2Q6DA 4JZFH 1FDPA 2UWOA 2ZKSA 4ZXXH 1CHOG 1VCPA 2UUKB 4CH2B 1ZHMA 4KP0A 1WBGB 1C4V2 5F03A 1QJ6B 3DD2H 3PTBA 3QX5H 1HAIH 2I6QA 1UTKA 4BNRA 3A8AA 1BTUA 2AGGX 1C2KA 3F9EA 1GVKB 2FDAA 4IN1A 1DXWA 3PO1B 1EP5A 1B0EA 1YGCH 5A0AE 1OWKA 1WU1A 3K6YA 1QBNA 4HGCA 2ZHWH 5GWZA 5LPEA 3D65E 1BDAA 2W5EA 4YLQH 4I32A 4B2BA 2ZDAH 3BTEE 2EI7A 1NRPH 1B7XB 1ETRH 1AO5A 4ZKSU 5E0JA 8GCHG 4YT6H 4X1RU 1J9CH 5EW2H 1YYY1 1ZTJA 2AS9A 2V6NA 1GBHA 3HK3B 4GPGA 5AFZH 1O2RA 1BHXF 1V2MT 1MQ5A 1GJBB 1GMHF 3S7HB 2QAAA 2JKHA 1W12U 3SV6A 2ALPA 4ZHMU 1C5ZB 2H9EH 3LGTA 1AWFH 2LPRA 2Q1JA 4JZ1A 1C5SA 3UR6A 4KTCA 3RMMH 5F8ZA 3A7WA 3W94A 1K2I1 4K1TA 1ZHRA 1GHZA 1UVSH 3Q3YA 1K9OE 1WCZA 4DVAU 3BTKE 2Z9KA 4K3JA 5E2PA 2F83A 2UUJB 1TPSA 2QXHA 2FIRH 2VIOA 1O3BA 4RSPA 2QXIA 3GCHC 1AHTH 2FI5E 1O5GH 2UWPA 2QF0A 2O8WA 4CRDA 5I25A 1O2KA 1A61H 1IQNA 4A7IB 2PGBB 1H8IH 3FANA 3V0XA 1BMNH 4YOGA 3F68H 1DY8A 4D7FA 1Z8IB 3U1IB 2C8XB 1N8OC 2GCHG 2PV9B 3LONA 1K28D 1Q31A 3BEFB 5LGOA 2OXSA 1ANBA 3ZZ6A 3RXHA 3LH1A 1TOCB 4CRCA 1H9HE 4H4FA 3UPEA 1G3BA 1W11U 4LXBH 1O2NA 3GY4A 3RU4T 1IQMA 3JZ1B 2QGRA 3HGNA 3T29A 2BOKA 3O8DA 4NIWA 2ZEBA 1T4UH 1ZTLA 1P01A 2R2WU 4B76A 3MNBA 5A2MH 2WPKS 5IDKA 3A85A 1LQDB 4XDEA 1Z1JA 1Y5UT 2VU8E 4AOQA 3OU0A 1NU7B 1Z1IA 5HM2A 2H6MA 1ZSKA 4CREA 1GI9B 5A8XA 2HVXA 4X6OA 1SLWB 4BTIB 1NFUA 1KXEA 1K22H 2G52A 1LPGB 1O3NA 2Z9GA 2Y7XA 2CHAC 4FVDA 4K5ZA 4XBDA 1WYKA 3RU4E 2BDYA 1HIAB 2V0BA 1HAVA 1FN8A 3RMNH 1MTNC 1C1RA 2GMTB 1AE8H 1GJCB 5AHGH 4AB8A 2AGEX 2SNWA 1IQLA 1GMDG 3BG4C 2Q6GA 3KIDU 3RMOH 1FY4A 4Q7XA 5FAHA 1FONA 4X0WU 1O2UA 1WTGH 5C3NA 1FIZA 3SI4H 3M7TA 3LGYA 1ZZZA 2PW8H 5EPNA 5CHAC 1O3IA 3MNXA 3TJVA 1VJ9U 2AIQA 3ODFA 2OQ5A 2A4QA 4A1XA 4NFEA 2BDCA 1ACBE 1BBRE 2FOMB 1GG6B 1JBUH 3V7TA 3TGIE 1GBJA 1DLKB 4PROA 1AUJA 1GBTA 4RKJB 3PMAB 1F7ZA 1GI6A 2VIVA 1SGFG 3D62A 4WMFA 4DIHH 1FY3A 1HXEH 2ZDLA 1GJ7B 3AAVA 4WWYA 3BTHE 3STIA 3UQOA 1SG8B 3URDA 1DDJA 2DE9A 1PYTD 3WY8A 1GI8B 1D4PB 4UFFH 2FLBH 3GY3A 2G4UA 2O8MA 2P8OB 5H4IB 3RXUA 2BY6X 2NWNA 2FP7B 4U01A 3SN8A 2GT7A 3ENSB 2VB0A 3TGKE 1AE5A 4OS1A 3SJKA 1S6HA 3P8GA 4CHAB 2ODYB 1GDQA 3MNSA 3E16B 1SGIB 3OSYA 2Y5HA 3QTVH 1P09A 3FAOA 1TPPA 3SU6A 3ZYEA 1KY9A 5LH8A 3T28A 2R0LA 1BZXE 1O2ZA 1TIOA 2HWLB 4NIYA 2VH0A 2ZC9H 3OY6U 1A5GH 1C4Y2 1DOJA 2C8YB 1PPBH 4A1VA 1WAYB 1Z8JB 1ZRBA 1UHBB 1TOMH 3DFLA 1ZSJA 2WYJA 3UNQA 1JRTA 1GHVH 5C5OA 1CO7E 2ZECA 3PLBA 3ZZAA 3GYLB 1V2QT 3TH2H 4I8JA 1SGNE 1MTVA 2FOCA 3V13A 3LOXA 1AFEH 1YPGH 3LGUA 4E7RG 6GCHG 1BJVA 2BD4A 4UONA 3UY9A 5C2ZA 1TMUH 5ABWA 1AD8H 1O31A 2NU2E 3TVJB 1J8AA 2HLCA 1F0RA 2FMJA 4Y8ZA 1W3CA 4NZLA 2BVSH 3MU1A 2ZP0H 1KTSB 1ZPBA 1O36A 4FUHA 3RXTA 1CGJE 4ZKNU 1FPHH 2A5AA 3SGBE 1O2HA 2OC8A 1P11E 4Z0KA 4X6NA 4VGCC 1AWHB 4MLFB 3Q00A 7LPRA 2G4TA 3EGKH 1T8OA 3DUXH 4MNXA 3SV8A 4IBLH 4IS5A 1O2JA 1ZLRA 3NUMA 3OTJE 3M5MA 1XUJA 3A84A 3KEEA 2BTCE 3TIUA 2BLOA 2J34A 4OS4A 1O34A 2XBWA 3GISB 4ZROA 3RM2H 1DPOA 1GCTB 2P94A 2OD3B 4FUFA 4OS2A 1OKXA 3TLOA 3PMJA 4K2YA 4F49A 2RA3A 1S83A 2A31A 3H7TA 4Y0YE 3V12A 1D9IA 3QO6A 2IN2A 1BT7A 5JBTA 3FZZA 1NC6A 1C2EA 2BVRH 4X6PA 5JBCS 1UVOA 4DGJA 3I77A 4INKA 1C5QA 1GMCF 1N6YA 2IOTA 5GCHF 2STBE 1ABJH 1MCTA 5E2OA 4KGAA 1HAXB 1OP2A 3ZZ4A 1A5IA 2C8ZB 4I31A 3RXCA 1SLXB 4ISNA 2TIOA 4GLYA 3SV2H 1V2UT 4X2XA 3MU4A 1T4VH 2ZA5A 2TBSA 1XUKA 1SVPA 1GGDC 2BB4A 1VJAU 3SJOA 2A7CA 4ABGA 1UK2A 2AERH 3SU3A 3FP7E 1X7AC 1C5UA 1SQAA 1WQVH 1OP8A 3RU4D 3KF2A 2W26A 1ID5H 1YP9A 4WVPE 3STJA 1PQAA 4CR5A 1MQ6A 3UOPA 2SGPE 4WJG2 1K1LA 1ELEE 3VGCB 4CR9A 1CA0C 4BTUB 3LPRA 1KTTB 2FYRA 3A8BA 3RXIA 1V2WT 1HAPH 1SQTA 1KYNA 2QN5T 3L6PA 1HAGE 4U2WA 4LOYH 2H5CA 2ZWLH 3LC5A 1IQJA 4DT7B 1NU9A 1S5SA 3U9AH 2F91A 2R2MB 3ZZDA 1Y3XA 3UFAA 1SQOA 2BDIA 3SORA 1EZQA 2BLWA 3RP2A 2ZTYA 4BOHA 1TLDA 4CH8B 1A46H 2ZQ2A 1G2LA 1QQ4A 1UTPA 3SOSA 1O32A 5CE1A 3QTOH 2B0FA 1GHAG 2OLGA 1JXPA 4OS5A 1AY6H 1HJAC 1C5WB 4ASHA 1SGPE 1Z7KA 3HK6B 2QYIA 2W3IA 4R0IA 1Z6JH 5DG6A 1AB9C 1A2CH 1F0TA 1IHSH 1AKSB 4GCHG 2VVCA 2ZTXA 1PQ8A 3RXVA 1TGTA 1QY6A 1SR5C 2Z3DA 2ZHFH 9ESTA 1G3DA 2WV4A 1CGHA 1MKWH 3ZZ7A 1T31A 4FXGH 1GDUA 1G37A 2QIQA 2I6SA 1SHYA 1BMMH 1Y8TA 1D3DB 1HFDA 2XBXA 3OY5U 3SUEA 1NTPA 3GDVA 1YPEH 5AFYH 1DUAA 1HIAA 1S84A 2GGVB 1FXYA 2OCVB 4D8NA 1ELFA 1BQYA 1ELAA 4Y71A 5TJXA 4WMDA 1P9UA 3SV9A 1GJ8B 1P12E 4Y7AA 2EA3A 2XBVA 4MPUA 3SI3H 1GJ9B 5EOKA 4WMEA 6CHAC 3SQHE 1Q3XA 5LPFA 3M3VA 3LDXH 1EJNA 5A09A 2ZZUH 1EKBB 2F9PA 1TNLA 1O35A 1F0SA 1TPAE 1V2PT 2FTLE 1SBWA 1UVPA 1V2LT 3SU0A 2O8UA 4ABAA 1TNGA 2SGFE 3EE0B 2C8WB 2THFB 2VWNA 2FM2A 4LZ4B 3UTUH 3PMHB 1UTNA 4MQAA 4DIIH 1AZZA 1V2KT 3SU1A 1H4WA 2EI8A 2YOLA 4FUEA 3P95A 1DWDH 4UFGH 1K1OA 2PSXA 1T7CA 2H9TH 2JETC 2TRMA 4YO9A 4IW4E 1D6WA 3RXPA 1MTSA 3GY6A 3DFJA 2OTVA 5ETXA 1O5BB 1FUJA 4Q2KA 1ZGIA 2G00A 2BDBA 3U98H 1C5PA 1THPB 2OC0A 1W0ZU 3T5FH 2OBQA 2A1DB 1HJ8A 5HXFA 2BD7A 2ZNKH 2XW9A 3PROA 2TPIZ 2OC7A 2GT8A 1MTUA 1ZPZA 3D23A 1PQ5A 1O3FA 4AORA 1UTQA 5FXLA 1INCA 1W7XH 1F0UA 2XBYA 4ZKRU 1EP6A 1NRRH 5FX5A 2J9NA 2Z3EA 1QB9A 1MH0A 1QBOA 5A8ZA 2WPLS 1RRKA 2J38A 2VWOA 2BZAA 3E1XB 3E90B 4Y79A 5GIBA 3SU2A 3VB3A 5HM9A 1OWIA 4UEHH 7GCHF 1BJUA 3C27B 1P02A 4HZHA 1UHBA 1VITH 2Y6TA 2Y80A 2ZFPH 3RXEA 2PTCE 1TMBH 3SNEA 2FI3E 4NSYA 4CBNA 3NXPA 3NWUA 5T6DA 2Z94A 4D7GA 3TJUA 4ABJA 3MH7A 1RD3B 2VIPA 1QRZA 1BHXB 1OX1A 3OX7U 3GCOA 4ABIA 5FPYA 5T6FA 1O3LA 1HAHH 5ESBA 1SHHB 1EZSC 4ISOA 4YTAA 3A81A 1C5XB 3KNXA 3O8BA 1S0QA 1Y3UA 4A6LA 1SOZA 2QXJA 3MO3A 1HDTH 2XCFA 1GJ5H 1KLIH 3NPSA 3E8LA 2FS9A 3FP8E 1EB2A 1EATA 4FU9A 1TNIA 3TNSA 2BX4A 4ZHAA 1LHFH 1MMJN 1TE0A 1NFYA 1BITA 2OUAA 3ZZBA 3ZVBA 1Z8RA 4I7YH 2ZCHP 4Q80A 3PO1C 3ZZ9A 3P70B 2ZFTA 1V2RT 2FODA 1T8MA 2QCYA 1BMAA 1MBQA 1A0LA 2AGIX 4Z6AH 2PKSB 5ESTE 1HUTH 3F9GA 2A7JA 3MOCA 1BA8B 1HJ9A 3M7UA 2PR3A 1UCYE 1KXBA 1VCWA 1K1NA 5HMAA 1SL3A 2XC0A 4R8TB 3MMGA 1F5KU 1MCVA 2GCTB 4UFDH 1TNJA 2UUYA 1OS8A 3MO6A 1GJAB 3A7TA 5HYOA 1O5FH 4CRBA 2ODQA 2GV7A 1L1NA 1PPFE 3QWCH 4X2VA 2HNTE 1EQ9A 2PLXA 1F92A 3GCHB 3MYWA 1NY22 3PLKA 2CF9H 1CBWB 1OXGA 3NKKA 2WPIS 1TB6H 2BY9X 5K0HA 3FZDA 1AFQB 2A5IA 4BXSA 1GI4A 1SFIA 1AU8A 2RG3A 4NIXA 2D1JA 1Y5BT 2BHGA 3S9AA 4DURA 1DSTA 4BAMB 1N8OB 3K2UA 2TGAA 1C2FA 1C5NH 1SLVB 1W8BH 1DLEA 2ZFFH 4IC5A 1O3EA 3SQEE 3A82A 4UE7H 1PPZA 5E0HA 2VNTA 1NFXA 2J94A 3A88A 1VITG 1MKXH 3PTNA 4J2YB 5DKMA 1NPMA 1QA0A 5GXPA 1QQUA 2FOBA 4AX9H 3F9HA 3U8OH 2XWBI 2ZHDA 1ZOMA 5DJ7A 4IGDA 1H9IE 3UR9A 1BB0B 3EA7A 1P57B 1ANDA 3UNSA 4DOQA 4NWLA 4ZH8A 2J92A 1C2DA 2CN0H 3PV4A 1UTLM 5C20A 3UQVA 1P05A 2ZGJA 4K1EA 5JDUB 3A86A 1H1BA 2EEKA 2GVFA 4YT7H 2OC1A 1WQSA 1KSNA 4A1TA 1YKTA 1TBQH 2AYWA 1MTNB 2ZU5A 2H2ZA 1AKSA 3LGIA 1Y59T 1N1LA 5PTPA 3ZYDA 5K7RA 3ZZ8A 5DP6A 2ZU2A 1ZRKA 4GVUA 1MTWA 2GMTC 3KGPA 1HGTH 3KCGH 2P59A 2WPMS 3TK6A 4AYYB 1M9UA 1AN1E 2ESTE 1CHGA 1ESBA 2A2QH 5C1UA 1TQ7B 1UCYH 1ELCA 2PFEA 3VPKA 3DA9B 2M5TA 3SU4A 2ZTZA 1DANH 2VH6A 2ZCKP 1C5YB 3UNRA 1UTMA 1O39A 5TCCA 1S0RA 1ZR0A 1KLTA 3N7OA 3TU7H 3QGNB 5EW1H 2FTMA 3RXBA 1LHCH 1HAYB 1H9LB 2QF3A 1V2ST 2ZFSA 4AFQA 1TX8A 4F4OC 3ZVAA 2ZPQA 4K60A 2HPPH 1AVWA 1GMCG 5GCHG 3S0NA 2QY0B 4I8LA 1QB1A 1LKBA 1GHYH 3RXQA 1W13U 1G3CA 1A1RA 1CT2E 5DP4A 1NM6A 1O2SA 5GPIB 4QT8C 2AIPA 2P8OC 3G01A 3ELAH 5F6MA 1VITF 2STAE 4ABBA 3SJ9A 1UTOA 1DS2E 1RFNA 3BTQE 1P2IA 1SGDE 3E3TA 3BIVH 1C2GA 2CXVA 5DP9A 5EODA 4SGBE 3MH6A 4O97A 1NFWA 3PWCA 4ABHA 5DO4H 4SGAE 1GI7B 1WTHD 4B1TA 4NIVA 3M7QA 2AMDA 1S82A 2ODPA 1E38B 1MU8B 2A4RA 1GBAA 2O8LA 5G4BA 2SNVA 1O5CB 5JBAS 1SC8U 1GCDA 2XXLA 2P93A 4NCYA 1YPLH 4D76A 1O3OA 2SGDE 3R0FA 2HGTH 3Q76A 4B75A 5C1XA 3PLPA 4ESTE 1G30B 1GDNA 5DGJA 1ELBA 1FJSA 3A80A 1XX9A 1RTFB 3PWBA 1FY8E 2PUQH 1E35B 1AMHA 4X2YA 1FIWA 1O3KA 3U8RH 4HFPB 3RC5A 1ELDE 3RLWH 4KTSA 4JYTA 3UOUA 4JZEH 4NFFA 2BD3A 1QJ1B 3QK1A 1YLCA 1IOEA 1KXFA 3ZVDA 5BPEA 2C3SA 1YLDA 2UWLA 4UDWH 4X1PU 1DSUA 3GY7A 1TX7A 3P92A 1O2LA 1EXFA 5EPYA 1QFKH 3GYMA 1F2SE 2VVUA 1FPCH 2Z7FE 2ZFRH 3KQEA 1IAUA 2P3TB 2D2DA 1QHRB 3HKJB 4GUXA 2R3UA 1DT2A 1YF4A 1C5OH 3M5NA 1ZJKA 1GI3A 2GZ7A 1BBRH 1EAXA 4E05H 1C9PA 3IWMA 1XUGA 1FLEE 1NN6A 1EX3A 1XKAC 1ELGA 3BN9A 1YC0A 3MTYA 2ZU4A 2ZDMA 4ABFA 1IQHA 1JRSA 3BSQA 4FUDA 1ZSLA 2CJIA 1EOJA 1T32A 2SFAA 3ATLA 1GCTC 1GI0A 3RXJA 1C5RA 2FYQA 2ZGCA 3T27A 3ZVEA 1L4ZA 1SI5H 5EGMA 3QLPH 5AF9H 2UUFB 4IMQA 1WOFA 4RN6A 3W95A 1O3CA 1LVMA 1IQKA 3ATWA 2W3KA 1FY5A 1GBKA 1F5LA 1P2JA 5DP8A 2GDEH 1C2LA 1P9SA 3GCTF 3IG6B 3LKWA 2BY5X 1HRTH 4HTCH 1GBDA 3RUOA 1KXCA 2SGEE 2B7DH 4ZMAH 1TRMA 2BD9A 1TBRH 1NRQH 5T6GA 2A5KA 2ZGHA 2FOEA 4X8SH 1CQQA 5GDSH 1TRYA 2R3YA 2XC4A 5E8EH 1IQEA 1LMWB 2BD8A 1V2VT 4TY7A 3U69H 3U8TH 3NZIA 3A83A 2TGDA 5C67A 5DK1A 1GI5A 3SZNA 1RGQA 1O38A 2ANWA 2GDDA 1O37A 3RC6A 5GJ4B 4JZDH 1L4DA 3A89A 1CT0E 3L33A 2ZHQH 2HNTC 2ILNA 3ESTA 1HPGA 3EYDA 4FUBA 3RM0H 1SGEE 2A7HA 1EJAA 2P95A 1BCUH 4JK6A 3RXDA 2JH6D 1RIWC 3Q3KA 2ALVA 5EG4A 2G5VA 1ETSH 1W0YH 4CRFA 2BD2A 1F5RA 1YCPM 1P8VC 1ELTA 1ORFA 2G81E 1P3CA 2FOGA 5EQQA 1TNHA 3BIUH 3M5OA 3H7OA 4Y0ZE 2B5TB 4A92A 1K1MA 4FUCA 2A32A 3H5CB 1Y3YA 1ZPCA 1THRH 3ZVCA 1HJAB 5AVDA 1A7SA 7GCHG 1WSSH 1XVOA 1GJDB 4H6TA 1UO6A 1AB9B 4NGAH 3SO3A 4AGKA 1D3QB 1NRSH 6LPRA 4XOJA 1V6DA 3VB4A 3RXKA 2XC5A 1MD8A 1WUNH 2A4OA 1G9IE 2ZGBH 4XSKU 2HNTF 1NZQH 7ESTE 2F3CE 1DY9A 2TGPZ 3F9FA 2F9NA 2CMYA 2K1QA 2GD4B 2PWXA 2FX6A 1O2GH 1ARBA 4MPVA 3MWIU 1YPHC 4FVBA 2Y82A 3Q3XA 5A0BA 4JCNA 1BTXA 5L6NH 3ODDA 1GJ4H 1TNKA 2PKAB 3KL6A 4Y8XA 2ZI2H 4B71A 1E34B 4MVNA 2QA9E 1GHBG 2GKVE 1VGCC 5L2YH 2EI6A 1LHDH 3AW0A 3LIWA 2ZPSA 5DPAA 3URCA 2D26C 1V2NT 1PPEE 3GOVB 4DJZB 1MKWK 1EUFA 2VWLA 3HKIB 5DP3A 1ZMLA 3FP6E 3RXLA 1NO9H 5TCAA 1AI8H 3QDZB 2CF8H 3CS7A 4NSVA 1UTJA 2WUBA 3TK5A 3PB1E 1BUIA 1J16A 3TITA 1C1NA 3ZV9A 1BRAA 1O3AA 3PYHA 4BAQB 1ZTKA 3VB5A 4ABEA 3E0PB 4Q7ZA 2PHBA 2FPZA 4ISLA 2GZ9A 1ABIH 1EJMA 1TALA 2BZ6H 1V2TT 4AFZA 1P06A 1CT4E 2A45B 2D8WA 4JYUH 4KTUA 1P2NA 1N6XA 4FU7A 1FZZA 1SFQB 4LZ1H 1C1UH 1O3JA 2BD5A 2V3HH 3MH5A 4O9VA 1IQFA 1YCPH 1TA2A 1C5MD 1OYQA 1EPTB 2BYAX 1C2HA 4TWWA 2Y7ZA 1C5VA 1O2MA 2DUCA 1AGJA 1TGBA 1XM1A 2YNAA 4I8KA 5A8YA 2VGCB 1CA8B 1V2JT 1XKBC 2RCEA 4UFEH 1ZGVA 3P17H 1DFPA 1JWTA 5FX6A 3S9BA 2VWMA 3RDZA 1SSXA 5BRRE 4K69A 3TJOA 1BMLA 3VB6A 1TQ0B 4INLA 4BAKB 4I8HA 1BTHH 1XUIA 3ITIA 3ZZ5A 4AB9A 3GY2A 2OQUA 3UWJH 1V2OT 2KAIB 3MHWU 3K6ZA 3I78A 5EU8A 1SGFA 1Q2WA 1KDQB 5EXNA 1BTWA 1KXDA 5C5NA 1L2EA 3T25A 4JYVH 1GL0E 8ESTE 3GCNA 1K1PA 1L0ZA 2ZF0H 1E37B 1DX5M 2G8TA 1DWCH 1O2XA 4AFUA 1GHBF 2Q6FA 4ZAEA 1PPCE 1T8NA 2ZFQH 2ANYA 3A7VA 1TGSZ 1LHEH 1QRWA 2GZ8A 4WH8A 3BTME 3RXRA 5JB9S 2AMQA 1ZHPA 2PUXB 1ZMJA 3AW1A 2XRCA 3MU0A 2NU4E 3BV9B 3E6PH 1UJ1A 3M37A 3RXMA 4BANB 5FBIA 1OPHB 4MPWA 1GPZA 1P0SH 1EZUC 1FI8A 1KXAA 1EAWA 1C1PA 1O5DH 1C9TA 1CVWH 2BXUH 2BX3A 2FX4A 4FUJA 1OSSA 4NA7A 4NWKA 2PKSC 4OGYA 1B5GH 4AGJA 2FOAA 1C4U2 1A3BH 2Z9IA 1XUFA 1C1VH 1TBZH 1ZYOA 2AMPA 2HOBA 4XFQA 1Z71A 2H5DA 1GVZA 3SNAA 2GCTC 4I8GA 3ZZCA 1W2KH 4GHQA 1L1GA 4AYVB 3QGJA 1YM0A 3CENA 5EQRA 2NU0E 4OGXA 5EXLA 4TWYA 1PJPA 4ZHLU 3K9XB 2QV1A 1VCQA 2J2UA 2ASUB 1XVMA 2EC9H 3UUZA 1CBWC 1YPJH 3SBKA 2HALA 2OP9A 3VXEH 4FUGA 3TK9A 3A8DA 1AFQC 4O3UA 1O3DA 1JIRA 3IITA 1QB6A 9LPRA 1UMAH 1DM4B 1G2MA 5L30H 3NK8A 2ZDKA 3SUFA 2ZHEH 1GBFA 1GBLA 2Z9LA 1A0JA 5JBBS 3GICB 1W10U 2ZU3A 1XUHA 1TA6A 5CMXH 1SMFE 4FU8A 3T62A 1XXFA 3FFGA 7KMEH 1EAUA 4BXWA 1YPHE 1GHXH 2C93B 1W7GH 1SGYE 2RDLA 2Z9JA 1MZDA 1RTLA 3TNTA 3UREA 1CSOE 1HB0B 3M61U 1O2TA 3Q77A 3MO9A 3D49H 1MU6B 3AAUA 1BRCE 4D9RA 3P6ZB 2GX4A 4D9QA 1LO6A 1C1MA 1CHOF 2XTTB 2ANKH 4AG2A 1MKXK 3VB7A 1TYNA 2CHAB 1MUEB 1K1JA 1P2QA 2Z3CA 1KIGH 1AVXA 3F6UH 2VIWA 2GTBA 2BDAA 4ISHH 5EQSA 1Z8GA 1SLUB 3TPIZ 3S69A 1ESAA 1XMNB 1LVYA 1O33A 2BQWB 3LT3A 5HGGA 5DP5A 1P2OA 3A7ZA 2FEQH 4H42U 4Y76A 1C5TA 3BG4B 3ZZ3A 2IJOB 1NESE 6ESTA 1GI2A 2P3UB 1DUEA 2R0KA 8LPRA 4K1SA 1B0FA 1QIXB 2BOHB 2FWWA 2XCNA 3UIRA 8GCHF 1SOTA 1G36A 2F9UA 4Y10E 1GBCA 1A4WH 1OYTH 1OP0A 2ZDVH 2SGQE 4X1QU 5F8TA 3UWIA 1EASA 5JB8S 1TFXA 4IMZA 1O3GA 5CHAB 2WYGA 1ANEA 2WV5A 3KQCA 2BMGB 4K8YA 2NU3E 3ZVGA 1LVBA 3BTFE 3BTGE 3RC4A 3RLYH 1AVGH 4WY3A 2G51A 3L3TA 4X8VH 1DE7H 2PKAA 4BAHB 3BG8A 3KHVA 3VFEA 1GG6C 4NG9H 1BTZA 1PQ7A 3RXFA 1FAXA 2V3OH 4OS7A 5E0GA 2H1UA 3T26A 1TX6A 1Y3WA 4INHA 4ZUHA 2JH5D 4KKDA 1CGIE 3BTTE 2HRVA 1QA7A 2GV6A 4NA8A 1QBVH 3EAJA 3MFJA 1UCYK 3BEIB 4A5TS 3EA8A 3GCTG 4Y8YA 3KN2A 1QGFA 4CHAC 5FCKA 4X1NU 3P8OA 1CE5A 3T2NA 1EAIA 2GCHF 4DY7B 1DITH 3K65B 4OS6A 2SGAA 4WH6A 1SPJA 1V3XA 4JMYA 1P04A 4BTTB 1QURH 4CRAA 4B73A 4X1SU 1HXFH 2Y5GA 4CRGA 3B9FH 3ATKA 4KELA 3LJOA 1FNIA 4DCDA 3SNDA 4WF8A 1OWDA 3MNCA 3OYPA 2B9LA 4WXVA 4I33A 1H8DH 1UVTH 3GY5A 2VINA 4DG4A 3O8CA 2A2XH 4XE4A 1S6FA 3R3GB 3TH3H 1O3HA 1HNEE 2BDGA 1SGRE 2RA0A 1HAOH 5L2ZH 1GWAA 4MPXA 4MTBA 3EQ0H 1HV7A 1UK3A 1L1JA 3DT0H 1EPTA 1EOLA 1J14A 4E7NA 2FOFA 3BEUA 2CGAA 1FMGA 1O2PA 2BXTH 1GBEA 3S7KB 3SNCA 2OBOA 4NA9H 4TYDA 4MNVA 4B74A 1ZJDA 3SUDA 4IC6A 4WXIA 3SU5A 1QTFA 1QRXA 2BQ6B 4ZXYH 1O2YA 2BY8X 4VGCB 3HPTB 1OOKB 3DHKH 3EDXB 1SGQE 2BDHA 2KAIA 4FUIA 1GMDF 1HLTH 3VEQB 1C1OA 4YLUA 1KDQA 3ZV8A 1FY1A 1THSH 2PTNA 3LU9B 4TPYA 2VVVA 2VIQA 4AZ2B 5SGAE 1LCYA 5T3HA 5IYTA 3SHCH 1E0FD 2B8OH 1PYTC 1C1TA 3MH4A 4UD9H 1DXPA 4K8BA 1DWBH 4ABDA 4JK5A 1HYLA 4X2WA 1MD7A 2Y81A 1AZ8A 4BAOB 2QC2A
chains in the Genus database with same CATH superfamily
5JYIA 1OWEA 1PFXC 2BVXH 1FQ3A 4XBBA 4Q63A 1RJXB 2GJGA 1O3MA 1W14U 1GVLA 1BRUP 1O5AB 4YOJA 3SJ8A 1FV9A 4X6MA 2KM0A 2FS8A 1WV7H 1A0HB 2WPHS 1O3PB 1Y3VA 3FVFB 3TJNA 4H6SB 3AVZA 4Y7BA 1U6QA 1IHTH 2ZGXH 5FBEA 1LPZB 3P8NA 1SB1H 3GDSA 3M35A 4YM9A 2ZO3H 3NRLA 1D3PB 2WSSD 1C2IA 2LELA 4ZKOU 1BBRK 3MU5A 2W7UA 3ATIA 1LTOA 2K8IA 2C4FH 3A8CA 4YZUA 2WINI 1IQIA 2ZCLP 2WPJS 4AN7A 1GGDB 1QL7A 2V7QD 1YBWA 1XXDA 3M36A 2O9QA 2QF4A 2J95A 4YOIA 3CP7A 1NRNH 3P8FA 1QL8A 3E0NB 1QJ7B 2L6OA 2F9OA 4MDSA 1QCPA 1JIMA 2V35A 1CA0B 4HI3A 2O8TA 1O30A 1J15A 1DVAH 2XYAA 2CV3A 2WPDD 1K0HA 3OE7D 3RXOA 1QNJA 1G3EA 1RTKA 4GAWA 3VGCC 1YPMH 1C1QA 2AEIH 1LPKB 4Y11E 1O2QA 1LKAA 3LGWA 5IK2D 1MZAA 1LHGH 4U32A 3A87A 1BOQA 3E91A 2ZDNA 1GBBA 3OAAD 3RMLH 5A0CA 1RXPA 1QL9A 3M3TA 1Y5AT 3NCLA 1GBMA 1RS0A 4TT3D 3RXGA 1CU1A 4O03A 1RIWB 1O2OA 3B8JA 3PM3A 1DWEH 1JMOH 4DW2U 3LH3A 2W7SA 6GCHF 1O2IA 1LDTT 3M5LA 3DSOA 1BMFD 8KME2 3CS0A 5I46H 4B2CA 2P3FH 3BTWE 3PMBB 1EB1H 2K0QA 3SGAE 1NS3A 3KQDA 1KLJH 3U1JB 4YESB 5FPSA 2LNCA 1P3EA 4GHTA 2ZQ1A 2VJ1A 1GI1A 1WXRA 4J1YA 4THNH 2WUCA 1HAVB 4Q7YA 3FOAA 1NROH 4GSOA 3BTDE 5LPRA 2F9BH 1S6LA 3ATMA 3B23B 3BF6H 4X8TH 2PSYA 3SJIA 3V3MA 3MU8A 3QZRA 5J4SA 1A5HA 1ETTH 2BM2A 3PV5A 2YNBA 1TGCA 3LGVA 3QUMP 1GJ6A 2FI4E 1GHWH 2C90B 1D6RA 2FXRA 2XWAA 2FZZA 3GDUA 2J4IA 1O2WA 1ELVA 4NZQA 1J17T 2BQ7B 1A3EH 4MNYA 1G32B 2FESH 1O5EH 3KQ5A 1SGTA 2JIZD 1QR3E 3DSGA 3RXAA 1MAYA 4LK4A 1SKYE 5F8XA 5FPTA 5J4QA 2XNIA 1HCGA 2FO9A 6CHAB 5FCRA 2BLQA 2IJD1 4JZIA 1P10A 1VGCB 2Y5FA 3RXSA 1TGNA 3MI4A 1IQGA 3TH4H 2F9VA 2Z6BD 3QN7A 1PPGE 1ARCA 1HAZB 2ZIQH 1FN6A 4O3TA 2A4GA 1TONA 3VXFH 3JZ2B 2DE8A 1VZQH 1C2MA 3SV7A 2ULLA 2AFQB 1ZMNA 1VR1H 1E36B 3QZQA 2AHME 1O0DH 3AASA 4TPIZ 2ZU1A 2FLRH 1AUTC 2OINA 3EA9A 2G55A 3A7YA 1GMHG 2VIDA 3SHAH 2JETB 1C2JA 1BTYA 3SUGA 4MNWA 1O2VA 3F1SB 1TWXB 2BY7X 1MBMA 3O8RA 2ZPRA 1EZXC 1LVOA 5FHTA 5B6OA 1FAKH 1S85A 4AFSA 4IN2A 1TAWA 3S9CA 2NU1E 1MAXA 4AG1A 2G5NA 1DICA 3TGJE 1AIXH 4B2AA 3GY8A 1S81A 1D3TB 5JPMH 1YPKH 2ZG0H 3LC3A 5EXMA 2AH4X 3CNRA 2R9PA 1PPHE 4CBOA 3FN8A 1GL1A 4X8UH 1UK4A 4TY6A 4RKOB 1C1WH 1LQEA 3A7XA 3HATH 2ANMH 1K1IA 1TMTH 1OWJA 2TGTA 1OWHA 1TRNA 1P2MA 2HPQH 3C1KA 1HBTH 5C1YA 2IPHA 3LJJA 1C5LH 2JH0D 4ISIH 2QXGA 3VG8A 2GP9B 2PGQB 2A0QB 4E06H 1JOUB 2FOHA 3M3SA 1TABE 1UVUH 3HGPA 4M7GA 1GHAF 1EPTC 1ESTA 4XBCA 3SW2B 1BRBE 1K21H 1C1SA 3I29A 2H9HA 3ZVFA 1ANCA 1TPOA 5DP7A 1SGCA 1P2KA 1AQ7A 3KQBA 2F4LA 1T8LA 2VGCC 1NT1A 5C17A 4U30A 1GBIA 3SGQE 1P03A 1Z6EA 3SNBA 4GCHF 1BTPA 4B6EA 2BLVA 1YCPK 4Y6DA 4MG3A 1BIOA 2P16A 2Q6DA 4JZFH 1FDPA 2UWOA 2ZKSA 3WW7A 4ZXXH 1H8HD 1CHOG 1VCPA 2RDEA 2UUKB 4CH2B 1ZHMA 4KP0A 1WBGB 1C4V2 5F03A 1QJ6B 3DD2H 3PTBA 3QX5H 1HAIH 2I6QA 1UTKA 4BNRA 3A8AA 1BTUA 2AGGX 1C2KA 3F9EA 1QZ8A 1GVKB 2FDAA 4IN1A 1DXWA 3PO1B 1EP5A 1B0EA 1YGCH 5A0AE 1OWKA 1WU1A 3K6YA 1QBNA 4HGCA 2ZHWH 5GWZA 5LPEA 3D65E 1BDAA 2W5EA 4YLQH 4I32A 4B2BA 2ZDAH 3BTEE 2EI7A 1NRPH 1B7XB 1ETRH 1AO5A 4ZKSU 5E0JA 8GCHG 4YT6H 4X1RU 1J9CH 5EW2H 1YYY1 1ZTJA 2AS9A 2V6NA 1GBHA 3HK3B 4GPGA 5AFZH 1O2RA 1BHXF 1V2MT 1MQ5A 1GJBB 1GMHF 3S7HB 2QAAA 2JKHA 1W12U 3SV6A 2ALPA 4ZHMU 1C5ZB 2H9EH 3LGTA 1AWFH 2LPRA 2Q1JA 4JZ1A 2L74A 1C5SA 3UR6A 4KTCA 3RMMH 5F8ZA 3A7WA 3W94A 1K2I1 4K1TA 1ZHRA 1GHZA 1UVSH 3Q3YA 1K9OE 1WCZA 4DVAU 3BTKE 2Z9KA 4K3JA 5E2PA 2F83A 2UUJB 1TPSA 2QXHA 2FIRH 2VIOA 1O3BA 4RSPA 5B6LA 2QXIA 3GCHC 1AHTH 2FI5E 1O5GH 2UWPA 2QF0A 3WWFA 2O8WA 4CRDA 5I25A 1O2KA 1A61H 1IQNA 4A7IB 2PGBB 1H8IH 3FANA 3V0XA 1BMNH 4YOGA 3F68H 1DY8A 4D7FA 1Z8IB 3U1IB 2C8XB 1N8OC 2GCHG 2PV9B 3LONA 1K28D 1Q31A 3BEFB 5LGOA 2OXSA 1ANBA 3ZZ6A 3RXHA 3LH1A 1TOCB 2VBCA 4CRCA 3H09A 1H9HE 4H4FA 2CK3D 3UPEA 1G3BA 1W11U 4LXBH 1O2NA 3GY4A 3RU4T 1IQMA 3JZ1B 2QGRA 3HGNA 3T29A 2BOKA 3O8DA 4NIWA 2ZEBA 5C0TA 1T4UH 1ZTLA 1P01A 2R2WU 4B76A 3MNBA 5A2MH 2WPKS 5IDKA 3A85A 1LQDB 4XDEA 1Z1JA 1Y5UT 2VU8E 4AOQA 3OU0A 1NU7B 1Z1IA 5HM2A 2H6MA 1ZSKA 4CREA 1GI9B 5A8XA 2HVXA 4X6OA 1SLWB 4BTIB 1NFUA 1KXEA 1K22H 2G52A 1LPGB 1O3NA 2Z9GA 2Y7XA 2CHAC 4FVDA 4K5ZA 4XBDA 1WYKA 3RU4E 4ZCNA 2BDYA 1HIAB 2V0BA 1HAVA 1FN8A 3RMNH 1MTNC 1C1RA 2GMTB 1AE8H 1GJCB 5AHGH 3OTPA 4AB8A 2AGEX 2SNWA 1IQLA 1GMDG 3BG4C 2Q6GA 1YY3A 3KIDU 3RMOH 1FY4A 4Q7XA 5FAHA 1FONA 4X0WU 1O2UA 1WTGH 5C3NA 1FIZA 3SI4H 3M7TA 3LGYA 1ZZZA 2PW8H 5EPNA 5CHAC 1O3IA 3MNXA 2JDID 3OEHD 3TJVA 1VJ9U 2AIQA 3ODFA 2OQ5A 2A4QA 4A1XA 4NFEA 2BDCA 1ACBE 1BBRE 2FOMB 1GG6B 1JBUH 3V7TA 3TGIE 1E1QD 1GBJA 4RI0A 1DLKB 4PROA 1AUJA 1GBTA 4RKJB 3N7DA 3PMAB 1F7ZA 1GI6A 2VIVA 1SGFG 3D62A 4WMFA 4DIHH 1FY3A 1HXEH 2ZDLA 1GJ7B 3AAVA 4WWYA 3BTHE 3STIA 3UQOA 1SG8B 3URDA 1DDJA 2DE9A 1PYTD 3WY8A 1GI8B 1D4PB 4UFFH 2FLBH 3GY3A 2G4UA 2O8MA 2P8OB 5H4IB 3RXUA 2BY6X 2NWNA 2FP7B 4U01A 3SN8A 2GT7A 3ENSB 2VB0A 3TGKE 1AE5A 4OS1A 3SJKA 1S6HA 3P8GA 4CHAB 2ODYB 1GDQA 3MNSA 3E16B 1SGIB 3OSYA 2Y5HA 3QTVH 1P09A 3FAOA 1TPPA 3SU6A 3ZYEA 1KY9A 5LH8A 3T28A 2R0LA 2F43B 1BZXE 1O2ZA 1TIOA 2HWLB 4NIYA 2VH0A 2ZC9H 3OY6U 1A5GH 1C4Y2 1DOJA 2C8YB 1PPBH 4A1VA 1WAYB 1Z8JB 1ZRBA 1UHBB 1TOMH 2V3MA 3DFLA 1ZSJA 2WYJA 3UNQA 1JRTA 1GHVH 5C5OA 4P02A 1CO7E 2ZECA 3PLBA 3ZZAA 3GYLB 1V2QT 3TH2H 4I8JA 1SGNE 1MTVA 1SQRA 2FOCA 3V13A 3LOXA 1AFEH 1YPGH 3LGUA 4E7RG 6GCHG 1BJVA 2BD4A 4UONA 3UY9A 5C2ZA 1TMUH 4XRNA 5ABWA 1AD8H 2YMSB 1O31A 2NU2E 3TVJB 1J8AA 2HLCA 1F0RA 2FMJA 4Y8ZA 1W3CA 4NZLA 2BVSH 3MU1A 2ZP0H 1KTSB 1ZPBA 1O36A 4FUHA 3RXTA 1CGJE 4ZKNU 1FPHH 2A5AA 3SGBE 1O2HA 2OC8A 1P11E 5C94A 4Z0KA 4X6NA 4VGCC 1AWHB 4MLFB 3Q00A 4FOUC 7LPRA 2G4TA 3EGKH 1T8OA 3DUXH 4MNXA 3SV8A 4IBLH 4IS5A 1O2JA 1ZLRA 3NUMA 3OTJE 3GS9A 3M5MA 1XUJA 3A84A 3KEEA 2BTCE 3TIUA 2BLOA 2J34A 4OS4A 1O34A 2XBWA 3GISB 4ZROA 3RM2H 1DPOA 1GCTB 3SYJA 2P94A 2OD3B 4FUFA 4OS2A 1NBMD 1OKXA 3TLOA 3PMJA 4K2YA 4F49A 2RA3A 1S83A 2A31A 3H7TA 4Y0YE 3V12A 1D9IA 3QO6A 2IN2A 1BT7A 5JBTA 3FZZA 1NC6A 1C2EA 2BVRH 4X6PA 5JBCS 1UVOA 4DGJA 3I77A 4INKA 1C5QA 1GMCF 1N6YA 2IOTA 5GCHF 2STBE 1ABJH 1MCTA 2PP6A 5E2OA 4KGAA 1HAXB 1MABB 1OP2A 3ZZ4A 1A5IA 4ACBA 2C8ZB 2W6JD 4I31A 3RXCA 1SLXB 3F0OA 4ISNA 2TIOA 4GLYA 3SV2H 1V2UT 4X2XA 1YWUA 1T4VH 3MU4A 2ZA5A 2TBSA 1XUKA 1SVPA 1GGDC 2BB4A 1VJAU 5EJZA 2A7CA 3SJOA 4ABGA 1UK2A 2AERH 3SU3A 3FP7E 1X7AC 1C5UA 1SQAA 1WQVH 1OP8A 3RU4D 3KF2A 2W26A 1ID5H 1YP9A 4WVPE 3STJA 1PQAA 4CR5A 1MQ6A 3PRBA 3UOPA 2SGPE 4WJG2 1K1LA 1ELEE 3VGCB 4CR9A 1CA0C 4BTUB 3LPRA 2WV9A 1KTTB 2FYRA 3A8BA 3RXIA 1V2WT 1VKYA 1HAPH 1SQTA 1KYNA 2QN5T 3L6PA 1HAGE 4U2WA 4LOYH 2H5CA 2ZWLH 3LC5A 1IQJA 4DT7B 3FKSD 2EQNA 1NU9A 1S5SA 3U9AH 2F91A 2R2MB 3AK5A 3ZZDA 1Y3XA 3UFAA 3F2FA 1SQOA 2BDIA 3SORA 1EZQA 2BLWA 3RP2A 2ZTYA 4BOHA 2HVYB 1TLDA 4CH8B 1A46H 2ZQ2A 1G2LA 1QQ4A 1UTPA 3SOSA 1O32A 5CE1A 3QTOH 2B0FA 1GHAG 2HLDD 2OLGA 1JXPA 4OS5A 1AY6H 1HJAC 1C5WB 4ASHA 1SGPE 4OM9A 1Z7KA 3HK6B 2QYIA 2W3IA 4R0IA 1Z6JH 5DG6A 1AB9C 1A2CH 1F0TA 1IHSH 1AKSB 4GCHG 2VVCA 2ZTXA 1PQ8A 5HIZA 3RXVA 1TGTA 1QY6A 1SR5C 2Z3DA 2ZHFH 9ESTA 1G3DA 2WV4A 1CGHA 1MKWH 3SZEA 1T31A 3ZZ7A 4FXGH 1GDUA 1G37A 2QIQA 2I6SA 2XOKD 1SHYA 1BMMH 1Y8TA 1D3DB 1HFDA 2XBXA 3OY5U 3SUEA 1NTPA 3GDVA 1YPEH 5AFYH 1DUAA 1HIAA 1S84A 2GGVB 1FXYA 1COWD 2OCVB 4D8NA 1ELFA 1BQYA 4XD7D 1ELAA 4Y71A 5TJXA 4WMDA 1P9UA 3SV9A 1GJ8B 1P12E 4Y7AA 2EA3A 2XBVA 4MPUA 3SI3H 1GJ9B 5EOKA 4WMEA 6CHAC 3SQHE 1Q3XA 5LPFA 3M3VA 3F3BA 3LDXH 1EJNA 5A09A 2ZZUH 1EKBB 2F9PA 3OFND 1TNLA 1O35A 1F0SA 1TPAE 1V2PT 2FTLE 1SBWA 1UVPA 1V2LT 3SU0A 2O8UA 4ABAA 1TNGA 2SGFE 3EE0B 2C8WB 2THFB 2VWNA 2FM2A 4LZ4B 3UTUH 3PMHB 1UTNA 4MQAA 4DIIH 1AZZA 1V2KT 3SU1A 1H4WA 2EI8A 2YOLA 4FUEA 3P95A 1DWDH 4UFGH 1K1OA 2PSXA 1T7CA 2H9TH 2JETC 2TRMA 4YO9A 4IW4E 1D6WA 3RXPA 1MTSA 3GY6A 3DFJA 2OTVA 5ETXA 1O5BB 1FUJA 4Q2KA 1ZGIA 2G00A 2BDBA 3U98H 1C5PA 1THPB 2OC0A 1W0ZU 3T5FH 2OBQA 2A1DB 1HJ8A 5HXFA 2BD7A 2ZNKH 2XW9A 3PROA 2TPIZ 2OC7A 2GT8A 1MTUA 1ZPZA 3D23A 1PQ5A 1O3FA 4AORA 1UTQA 5FXLA 1INCA 1W7XH 1F0UA 2XBYA 4ZKRU 1EP6A 1NRRH 2RFKC 5FX5A 2J9NA 2Z3EA 1QB9A 1MH0A 1QBOA 5A8ZA 2WPLS 3ZIAD 1RRKA 2J38A 2VWOA 2BZAA 3E1XB 3E90B 4Y79A 5GIBA 3SU2A 3VB3A 5HM9A 1OWIA 4UEHH 7GCHF 1BJUA 3C27B 1P02A 4HZHA 5KECA 1UHBA 1VITH 2Y6TA 2Y80A 2KCOA 2ZFPH 3RXEA 2PTCE 1TMBH 3SNEA 2FI3E 4NSYA 4CBNA 3NXPA 3NWUA 5T6DA 2Z94A 4D7GA 3TJUA 4ABJA 3MH7A 1RD3B 2VIPA 1QRZA 1BHXB 1OX1A 3OX7U 3GCOA 4ABIA 5FPYA 5T6FA 1O3LA 1E1RD 1HAHH 5ESBA 1SHHB 1EZSC 4ISOA 4YTAA 3A81A 5HIYA 1C5XB 3KNXA 3O8BA 2OK5A 1S0QA 1Y3UA 4A6LA 1SOZA 2QXJA 3MO3A 1HDTH 2XCFA 3WWBA 1GJ5H 1KLIH 3NPSA 3E8LA 2FS9A 3FP8E 1EB2A 1EATA 4FU9A 1TNIA 3TNSA 2BX4A 4ZHAA 1LHFH 1MMJN 1TE0A 1NFYA 1BITA 2OUAA 1EFRD 3ZZBA 3ZVBA 1YLNA 1Z8RA 4I7YH 2J98B 2ZCHP 4Q80A 3PO1C 3ZZ9A 3P70B 2ZFTA 1V2RT 2FODA 1T8MA 2QCYA 1BMAA 1MBQA 1A0LA 2AGIX 4ACAA 4Z6AH 2PKSB 5ESTE 1HUTH 3F9GA 2A7JA 3MOCA 1BA8B 1HJ9A 3M7UA 2PR3A 1UCYE 1KXBA 1VCWA 1K1NA 5HMAA 1SL3A 2XC0A 4R8TB 3MMGA 1F5KU 1MCVA 2GCTB 4UFDH 1TNJA 2UUYA 1OS8A 3MO6A 1GJAB 3A7TA 5HYOA 1O5FH 4CRBA 2ODQA 2GV7A 1L1NA 1PPFE 3QWCH 4X2VA 2HNTE 1EQ9A 2PLXA 1F92A 3GCHB 3MYWA 1OHHD 1NY22 3PLKA 2CF9H 1CBWB 1OXGA 2WHXA 2WPIS 3NKKA 1TB6H 2BY9X 5K0HA 3FZDA 1AFQB 2A5IA 4BXSA 1GI4A 3MQKC 1SFIA 1AU8A 2RG3A 4NIXA 2D1JA 1Y5BT 3PRDA 2BHGA 3S9AA 4DURA 1DSTA 2IPQX 5C0UA 4BAMB 1N8OB 3K2UA 2TGAA 1C2FA 1C5NH 1SLVB 1W8BH 1DLEA 2ZFFH 4IC5A 1O3EA 3SQEE 3A82A 4UE7H 1PPZA 5E0HA 2VNTA 1NFXA 2J94A 3A88A 1VITG 1MKXH 3PTNA 4J2YB 5DKMA 1NPMA 1QA0A 5GXPA 1QQUA 2FOBA 4AX9H 3F9HA 3U8OH 2XWBI 2ZHDA 1ZOMA 5DJ7A 4IGDA 1H9IE 3UR9A 1BB0B 3EA7A 5FL7D 1P57B 1ANDA 3N99A 3UNSA 4DOQA 4NWLA 3N7EA 4ZH8A 2J92A 1C2DA 2CN0H 3PV4A 1UTLM 5C20A 3UQVA 2J5UA 1P05A 2ZGJA 4K1EA 5JDUB 1FX0B 3A86A 1H1BA 2EEKA 2GVFA 4YT7H 2OC1A 1WQSA 1KSNA 4A1TA 1YKTA 1TBQH 2AYWA 1MTNB 2ZU5A 2H2ZA 1AKSA 3LGIA 1Y59T 1N1LA 5PTPA 3ZYDA 5K7RA 3ZZ8A 5DP6A 2ZU2A 1ZRKA 4GVUA 1MTWA 2GMTC 3KGPA 1HGTH 3KCGH 2P59A 2WPMS 3TK6A 4AYYB 1M9UA 1AN1E 2ESTE 1CHGA 1ESBA 2A2QH 5C1UA 3DCLA 1TQ7B 1UCYH 1ELCA 2PFEA 3VPKA 3DA9B 2M5TA 3SU4A 2ZTZA 1DANH 2VH6A 2ZCKP 1C5YB 3UNRA 1UTMA 1O39A 5TCCA 1S0RA 1ZR0A 1KLTA 3N7OA 3TU7H 3QGNB 5EW1H 2FTMA 3RXBA 1LHCH 1HAYB 1H9LB 2QF3A 1V2ST 2ZFSA 4AFQA 1TX8A 4F4OC 3ZVAA 2ZPQA 4K60A 2HPPH 1AVWA 1GMCG 5GCHG 3S0NA 2QY0B 4I8LA 1QB1A 1LKBA 2KR7A 2KCPA 2JJ1D 1GHYH 3RXQA 1W13U 1G3CA 1A1RA 1CT2E 5DP4A 1NM6A 1O2SA 5GPIB 4QT8C 2AIPA 3DSPA 2P8OC 3G01A 3ELAH 5F6MA 1VITF 2STAE 4ABBA 3SJ9A 1UTOA 1DS2E 1RFNA 3BTQE 1P2IA 1SGDE 3E3TA 3BIVH 1C2GA 2CXVA 5DP9A 5EODA 4SGBE 3MH6A 4O97A 1NFWA 3PWCA 4ABHA 5DO4H 4SGAE 1GI7B 1WTHD 2XNDD 4B1TA 4NIVA 3M7QA 2AMDA 1S82A 2ODPA 1E38B 1MU8B 2A4RA 1GBAA 2O8LA 5G4BA 2SNVA 1O5CB 5JBAS 1SC8U 1GCDA 2XXLA 2P93A 4NCYA 1E79D 1YPLH 4D76A 1O3OA 2SGDE 3R0FA 2HGTH 3Q76A 4B75A 5C1XA 3PLPA 4ESTE 1G30B 1GDNA 5DGJA 1ELBA 1FJSA 3A80A 1XX9A 1RTFB 3PWBA 1FY8E 2PUQH 1E35B 1AMHA 4X2YA 1FIWA 1O3KA 3U8RH 4HFPB 3RC5A 1ELDE 3RLWH 4KTSA 4JYTA 4B6FA 3UOUA 4JZEH 4NFFA 2BD3A 1QJ1B 3QK1A 4F48B 2YMSC 1YLCA 1IOEA 1KXFA 3ZVDA 5BPEA 2C3SA 1YLDA 2UWLA 4UDWH 4X1PU 1DSUA 3GY7A 1TX7A 3P92A 1O2LA 1EXFA 5EPYA 1QFKH 3GYMA 1F2SE 2VVUA 1FPCH 2Z7FE 2ZFRH 3KQEA 1IAUA 2P3TB 2D2DA 1QHRB 3HKJB 4GUXA 2R3UA 1DT2A 1YF4A 1C5OH 3UAIC 3M5NA 1ZJKA 1GI3A 2GZ7A 1BBRH 1EAXA 4E05H 1C9PA 3IWMA 1XUGA 1FLEE 1NN6A 1EX3A 1XKAC 1ELGA 3BN9A 1YC0A 3MTYA 2ZU4A 2ZDMA 4ABFA 1IQHA 1JRSA 3BSQA 4FUDA 2J98A 1ZSLA 2CJIA 1EOJA 1T32A 2SFAA 3ATLA 1GCTC 1GI0A 3RXJA 1C5RA 2FYQA 2ZGCA 3T27A 3ZVEA 1L4ZA 1SI5H 5EGMA 3QLPH 3UB0A 5AF9H 2UUFB 4IMQA 1WOFA 4RN6A 3W95A 1O3CA 1LVMA 1IQKA 3ATWA 2W3KA 1FY5A 1GBKA 1F5LA 1P2JA 5DP8A 2GDEH 1C2LA 1P9SA 3GCTF 3FO8D 2EY4C 3IG6B 3LKWA 2BY5X 1HRTH 4HTCH 1GBDA 4TSFD 1KXCA 3RUOA 2SGEE 2B7DH 4ZMAH 1TRMA 2BD9A 1TBRH 1NRQH 5T6GA 2A5KA 2ZGHA 2FOEA 4X8SH 1CQQA 5GDSH 1TRYA 2R3YA 2XC4A 5E8EH 1IQEA 1LMWB 2BD8A 1V2VT 4TY7A 3U69H 3U8TH 3NZIA 3A83A 2TGDA 5C67A 5DK1A 1GI5A 3SZNA 1RGQA 5F53A 2KCAA 1O38A 2ANWA 2GDDA 1O37A 3RC6A 5GJ4B 4JZDH 1L4DA 3A89A 1CT0E 3L33A 2ZHQH 2HNTC 1UW7A 2ILNA 1HPGA 3ESTA 3EYDA 4FUBA 3RM0H 1SGEE 2A7HA 1EJAA 2P95A 1BCUH 4JK6A 3RXDA 2JH6D 1RIWC 4P00A 3Q3KA 2ALVA 5EG4A 2G5VA 1ETSH 1W0YH 4CRFA 2BD2A 1F5RA 1YCPM 1P8VC 1ELTA 1ORFA 2G81E 1P3CA 2FOGA 5EQQA 1W0JD 1TNHA 3BIUH 3M5OA 3H7OA 4Y0ZE 2B5TB 4A92A 1K1MA 4FUCA 2A32A 3H5CB 1Y3YA 1ZPCA 1THRH 2LP6A 3ZVCA 1HJAB 5AVDA 4RT0A 1A7SA 7GCHG 1WSSH 1XVOA 1GJDB 4H6TA 5CHBA 1UO6A 1AB9B 4NGAH 3SO3A 4AGKA 1D3QB 1NRSH 6LPRA 4XOJA 1V6DA 3VB4A 3RXKA 2XC5A 1MD8A 1WUNH 2A4OA 1G9IE 2ZGBH 4XSKU 2HNTF 1NZQH 7ESTE 2F3CE 1DY9A 2TGPZ 3F9FA 2F9NA 2CMYA 2K1QA 2GD4B 2PWXA 3EE7A 2FX6A 1O2GH 1ARBA 4MPVA 3MWIU 5CDFE 1YPHC 4FVBA 2Y82A 3Q3XA 5A0BA 4JCNA 1BTXA 5L6NH 3ODDA 1GJ4H 1TNKA 2PKAB 3KL6A 4Y8XA 2ZI2H 4B71A 1E34B 4MVNA 2QA9E 1GHBG 2GKVE 1VGCC 5L2YH 2EI6A 1LHDH 3AW0A 3LIWA 2ZPSA 5DPAA 3URCA 2D26C 1V2NT 1PPEE 3GOVB 1H8ED 4DJZB 1MKWK 1EUFA 2VWLA 3HKIB 5DP3A 1ZMLA 2QF5A 4AC9A 3FP6E 3RXLA 1NO9H 1W0KD 5TCAA 1AI8H 3QDZB 2CF8H 3CS7A 4NSVA 1UTJA 2WUBA 3TK5A 3PB1E 4ASUD 1BUIA 1J16A 3TITA 1C1NA 3ZV9A 1BRAA 1O3AA 3PYHA 4BAQB 1ZTKA 3VB5A 1WDIA 4ABEA 3E0PB 4Q7ZA 2PHBA 4F55A 2FPZA 4ISLA 2GZ9A 1ABIH 1EJMA 4YXWD 1TALA 2BZ6H 1V2TT 4AFZA 1P06A 1CT4E 2A45B 2D8WA 4JYUH 4KTUA 1P2NA 4RT1A 1N6XA 4FU7A 1FZZA 1SFQB 4LZ1H 1C1UH 1O3JA 4I86A 2JJ2D 2BD5A 2V3HH 3MH5A 4O9VA 1IQFA 1YCPH 1TA2A 1C5MD 1OYQA 1EPTB 2BYAX 1C2HA 4TWWA 2Y7ZA 1C5VA 1O2MA 2DUCA 1AGJA 1TGBA 1XM1A 2YNAA 4I8KA 5A8YA 2VGCB 1CA8B 1V2JT 1XKBC 4HG6A 4M9FA 2RCEA 4UFEH 1ZGVA 3P17H 1DFPA 1JWTA 5FX6A 3S9BA 2VWMA 3RDZA 1SSXA 5BRRE 4K69A 3TJOA 1BMLA 3VB6A 1TQ0B 4INLA 4BAKB 4I8HA 1BTHH 1XUIA 3ITIA 3ZZ5A 4AB9A 3GY2A 2OQUA 3UWJH 1V2OT 2KAIB 3MHWU 3K6ZA 3I78A 5EU8A 4DT4A 1SGFA 1Q2WA 1KDQB 5EXNA 1BTWA 1KXDA 5C5NA 1L2EA 3T25A 4JYVH 1GL0E 8ESTE 3GCNA 1K1PA 1L0ZA 2ZF0H 1E37B 1DX5M 2G8TA 1DWCH 1O2XA 4AFUA 1GHBF 2Q6FA 4ZAEA 1PPCE 1T8NA 2ZFQH 5HKKD 2ANYA 2M2AA 3A7VA 1TGSZ 1LHEH 1QRWA 2GZ8A 4WH8A 3BTME 3RXRA 5JB9S 2AMQA 1ZHPA 2PUXB 1ZMJA 3AW1A 2XRCA 4Z1MD 3MU0A 2NU4E 5KEDA 3BV9B 3E6PH 1UJ1A 3M37A 3RXMA 4BANB 5FBIA 1OPHB 4MPWA 1GPZA 1P0SH 1EZUC 2KFWA 1FI8A 1KXAA 2KX4A 1EAWA 1C1PA 1O5DH 1C9TA 1CVWH 2BXUH 2BX3A 2FX4A 4FUJA 1OSSA 4NA7A 4NWKA 2PKSC 4OGYA 1B5GH 4AGJA 2FOAA 1C4U2 1A3BH 2Z9IA 1XUFA 1C1VH 1TBZH 1ZYOA 2AMPA 2HOBA 3U28C 4XFQA 1Z71A 2H5DA 1GVZA 3SNAA 2GCTC 4I8GA 3ZZCA 1W2KH 4GHQA 1L1GA 4AYVB 3QGJA 1YM0A 3CENA 5EQRA 2NU0E 4OGXA 5EXLA 4TWYA 1PJPA 4ZHLU 3K9XB 2QV1A 1VCQA 2J2UA 2ASUB 1XVMA 2EC9H 3UUZA 1CBWC 1YPJH 3SBKA 2HALA 2OP9A 3VXEH 4FUGA 3TK9A 3A8DA 1AFQC 4O3UA 1O3DA 1JIRA 3IITA 1QB6A 2KCYA 9LPRA 1UMAH 1DM4B 1G2MA 5L30H 3NK8A 2ZDKA 3SUFA 2ZHEH 1GBFA 1NBME 1GBLA 2QE7D 2Z9LA 1A0JA 5JBBS 4Q4LA 3GICB 1W10U 2ZU3A 1XUHA 1TA6A 5CMXH 1SMFE 4FU8A 3T62A 1XXFA 3FFGA 7KMEH 1EAUA 4BXWA 1YPHE 1GHXH 3KYFA 5T1VA 2C93B 1W7GH 1SGYE 2RDLA 2Z9JA 1MZDA 1RTLA 3TNTA 3UREA 1CSOE 1HB0B 3M61U 1O2TA 3Q77A 3MO9A 3D49H 1MU6B 3AAUA 3F0PA 1BRCE 4D9RA 3P6ZB 2GX4A 5KGOA 4D9QA 1LO6A 1C1MA 1CHOF 2W6ID 2XTTB 2ANKH 4AG2A 1MKXK 3VB7A 1TYNA 2CHAB 1MUEB 1K1JA 1P2QA 2Z3CA 1KIGH 1AVXA 3F6UH 2VIWA 2GTBA 2BDAA 4ISHH 2J97A 5EQSA 1Z8GA 1SLUB 3TPIZ 3S69A 1ESAA 1XMNB 1LVYA 1O33A 2BQWB 3LT3A 5HGGA 5EJLA 5DP5A 1P2OA 3A7ZA 2FEQH 4H42U 4Y76A 3W1EA 1C5TA 3PV2A 3BG4B 3ZZ3A 2IJOB 1NESE 6ESTA 1GI2A 2P3UB 3F2HA 1DUEA 2R0KA 8LPRA 4K1SA 1B0FA 2BOHB 1QIXB 2FWWA 2XCNA 3UIRA 8GCHF 1SOTA 1G36A 2F9UA 4Y10E 1GBCA 1A4WH 1OYTH 1OP0A 2ZDVH 2SGQE 4X1QU 5F8TA 3UWIA 1EASA 5JB8S 1TFXA 4IMZA 1O3GA 5CHAB 2WYGA 1ANEA 2WV5A 3KQCA 2WZQA 2BMGB 4K8YA 2NU3E 3ZVGA 2YMSD 1LVBA 3BTFE 3BTGE 5DN6D 3RC4A 3RLYH 1AVGH 4WY3A 2G51A 3L3TA 4X8VH 1DE7H 2PKAA 4BAHB 3BG8A 3KHVA 3VFEA 1GG6C 4NG9H 1BTZA 1PQ7A 3RXFA 1FAXA 2V3OH 4OS7A 5E0GA 2H1UA 3T26A 1TX6A 1Y3WA 4INHA 4ZUHA 2JH5D 4KKDA 1CGIE 3BTTE 4FETA 2HRVA 1QA7A 2GV6A 4NA8A 1QBVH 3EAJA 3MFJA 1UCYK 3BEIB 3OEED 4A5TS 3EA8A 3GCTG 4Y8YA 3KN2A 1QGFA 4CHAC 5FCKA 4X1NU 3P8OA 1CE5A 3T2NA 1EAIA 2GCHF 4DY7B 1DITH 3K65B 4OS6A 2SGAA 4WH6A 1SPJA 1V3XA 4JMYA 1P04A 4BTTB 1QURH 4CRAA 4B73A 4X1SU 1HXFH 2Y5GA 4CRGA 3B9FH 3ATKA 4KELA 3LJOA 1FNIA 4DCDA 3SNDA 4WF8A 1OWDA 3MNCA 3OYPA 2B9LA 4WXVA 4I33A 1H8DH 1UVTH 3GY5A 2VINA 4DG4A 3O8CA 2A2XH 4XE4A 1S6FA 3R3GB 3TH3H 1O3HA 1HNEE 2BDGA 1SGRE 2RA0A 1HAOH 5L2ZH 1GWAA 4MPXA 4MTBA 3EQ0H 1HV7A 1UK3A 1L1JA 3DT0H 1EPTA 1EOLA 5EIYA 1J14A 4E7NA 2FOFA 3BEUA 2CGAA 1FMGA 1O2PA 3KYGA 2BXTH 1GBEA 3S7KB 3SNCA 2OBOA 4NA9H 4TYDA 4MNVA 4B74A 1ZJDA 3SUDA 4IC6A 4WXIA 3SU5A 1QTFA 1QRXA 3F2GA 2BQ6B 4ZXYH 1O2YA 2BY8X 4VGCB 3HPTB 1OOKB 3DHKH 3EDXB 1SGQE 2BDHA 2KAIA 5EJ1A 4FUIA 1GMDF 1HLTH 5GNDA 3VEQB 1C1OA 4YLUA 1KDQA 3ZV8A 5DSFA 1FY1A 1THSH 2PTNA 3LU9B 4TPYA 2VVVA 2VIQA 4AZ2B 5SGAE 1LCYA 5T3HA 5IYTA 3SHCH 1E0FD 2B8OH 1PYTC 1C1TA 1KMHB 3MH4A 4UD9H 1DXPA 4K8BA 1DWBH 4ABDA 4JK5A 1HYLA 4X2WA 1MD7A 2Y81A 1AZ8A 2KZ4A 4BAOB 2QC2A
chains in the Genus database with same CATH topology
5JYIA 1OWEA 1PFXC 2BVXH 1FQ3A 4XBBA 1RJXB 1O3MA 1W14U 1GVLA 1BRUP 1O5AB 4YOJA 3SJ8A 1FV9A 4X6MA 2FS8A 1WV7H 1A0HB 2WPHS 1O3PB 1Y3VA 3FVFB 3TJNA 4H6SB 3AVZA 4Y7BA 1U6QA 1IHTH 2ZGXH 5FBEA 1LPZB 3P8NA 1SB1H 3GDSA 3M35A 4YM9A 2ZO3H 1D3PB 1C2IA 4ZKOU 1BBRK 3MU5A 2W7UA 3ATIA 1LTOA 3A8CA 2C4FH 4YZUA 2WINI 1IQIA 2ZCLP 2WPJS 4AN7A 1GGDB 1QL7A 1YBWA 1XXDA 3M36A 2O9QA 2J95A 4YOIA 3CP7A 1NRNH 3P8FA 1QL8A 3E0NB 1QJ7B 2F9OA 4MDSA 1QCPA 1JIMA 2V35A 1CA0B 4HI3A 2O8TA 1O30A 1J15A 1DVAH 2XYAA 2CV3A 3RXOA 1QNJA 1G3EA 1RTKA 4GAWA 3VGCC 1YPMH 1C1QA 2AEIH 1LPKB 4Y11E 1O2QA 1LKAA 3LGWA 1MZAA 1LHGH 4U32A 3A87A 1BOQA 3E91A 2ZDNA 1GBBA 3RMLH 5A0CA 1RXPA 1QL9A 3M3TA 1Y5AT 3NCLA 1GBMA 1RS0A 3RXGA 1CU1A 4O03A 1RIWB 1O2OA 3B8JA 3PM3A 1DWEH 1JMOH 4DW2U 3LH3A 2W7SA 6GCHF 1O2IA 1LDTT 3M5LA 8KME2 3CS0A 5I46H 4B2CA 2P3FH 3BTWE 3PMBB 1EB1H 3SGAE 1NS3A 3KQDA 1KLJH 3U1JB 4YESB 5FPSA 2LNCA 1P3EA 4GHTA 2ZQ1A 2VJ1A 1GI1A 4J1YA 4THNH 2WUCA 1HAVB 4Q7YA 1NROH 4GSOA 3BTDE 5LPRA 2F9BH 3ATMA 3B23B 3BF6H 4X8TH 2PSYA 3SJIA 3V3MA 3MU8A 3QZRA 5J4SA 1A5HA 1ETTH 2BM2A 2YNBA 1TGCA 3LGVA 3QUMP 1GJ6A 2FI4E 1GHWH 2C90B 1D6RA 2FXRA 2XWAA 2FZZA 3GDUA 2J4IA 1O2WA 1ELVA 4NZQA 1J17T 2BQ7B 1A3EH 4MNYA 1G32B 2FESH 1O5EH 1SGTA 1QR3E 3RXAA 1MAYA 4LK4A 5F8XA 5FPTA 5J4QA 2XNIA 1HCGA 2FO9A 6CHAB 5FCRA 2BLQA 4JZIA 1P10A 1VGCB 2Y5FA 3RXSA 1TGNA 3MI4A 1IQGA 3TH4H 2F9VA 2Z6BD 3QN7A 1PPGE 1ARCA 1HAZB 2ZIQH 1FN6A 4O3TA 2A4GA 1TONA 3VXFH 3JZ2B 2DE8A 1VZQH 1C2MA 3SV7A 2ULLA 2AFQB 1ZMNA 1VR1H 1E36B 3QZQA 1O0DH 3AASA 4TPIZ 2ZU1A 2FLRH 1AUTC 2OINA 3EA9A 2G55A 3A7YA 1GMHG 2VIDA 3SHAH 2JETB 1C2JA 1BTYA 3SUGA 4MNWA 1O2VA 3F1SB 1TWXB 2BY7X 1MBMA 3O8RA 2ZPRA 1EZXC 1LVOA 5FHTA 5B6OA 1FAKH 1S85A 4AFSA 4IN2A 1TAWA 3S9CA 2NU1E 1MAXA 4AG1A 2G5NA 1DICA 3TGJE 1AIXH 4B2AA 3GY8A 1S81A 1D3TB 5JPMH 1YPKH 2ZG0H 3LC3A 5EXMA 2AH4X 2R9PA 1PPHE 4CBOA 1GL1A 4X8UH 1UK4A 4TY6A 4RKOB 1C1WH 1LQEA 3A7XA 3HATH 2ANMH 1K1IA 1TMTH 1OWJA 2TGTA 1OWHA 1TRNA 1P2MA 2HPQH 3C1KA 1HBTH 5C1YA 2IPHA 3LJJA 1C5LH 2JH0D 4ISIH 2QXGA 2GP9B 2PGQB 2A0QB 4E06H 1JOUB 2FOHA 3M3SA 1TABE 1UVUH 3HGPA 4M7GA 1GHAF 1EPTC 1ESTA 4XBCA 3SW2B 1BRBE 1K21H 1C1SA 3I29A 2H9HA 3ZVFA 1ANCA 1TPOA 5DP7A 1SGCA 1P2KA 1AQ7A 3KQBA 1T8LA 2VGCC 1NT1A 4U30A 1GBIA 3SGQE 1P03A 1Z6EA 3SNBA 4GCHF 1BTPA 2BLVA 1YCPK 4Y6DA 4MG3A 1BIOA 2P16A 2Q6DA 4JZFH 1FDPA 2UWOA 2ZKSA 4ZXXH 1CHOG 1VCPA 2UUKB 4CH2B 1ZHMA 4KP0A 1WBGB 1C4V2 5F03A 1QJ6B 3DD2H 3PTBA 3QX5H 1HAIH 2I6QA 1UTKA 4BNRA 3A8AA 1BTUA 2AGGX 1C2KA 3F9EA 1GVKB 2FDAA 4IN1A 1DXWA 3PO1B 1EP5A 1B0EA 1YGCH 5A0AE 1OWKA 1WU1A 3K6YA 1QBNA 4HGCA 2ZHWH 5GWZA 5LPEA 3D65E 1BDAA 2W5EA 4YLQH 4I32A 4B2BA 2ZDAH 3BTEE 2EI7A 1NRPH 1B7XB 1ETRH 1AO5A 4ZKSU 5E0JA 8GCHG 4YT6H 4X1RU 1J9CH 5EW2H 1YYY1 1ZTJA 2AS9A 2V6NA 1GBHA 3HK3B 4GPGA 5AFZH 1O2RA 1BHXF 1V2MT 1MQ5A 1GJBB 1GMHF 3S7HB 2QAAA 2JKHA 1W12U 3SV6A 2ALPA 4ZHMU 1C5ZB 2H9EH 3LGTA 1AWFH 2LPRA 2Q1JA 4JZ1A 1C5SA 3UR6A 4KTCA 3RMMH 5F8ZA 3A7WA 3W94A 1K2I1 4K1TA 1ZHRA 1GHZA 1UVSH 3Q3YA 1K9OE 1WCZA 4DVAU 3BTKE 2Z9KA 4K3JA 5E2PA 2F83A 2UUJB 1TPSA 2QXHA 2FIRH 2VIOA 1O3BA 4RSPA 2QXIA 3GCHC 1AHTH 2FI5E 1O5GH 2UWPA 2QF0A 2O8WA 4CRDA 5I25A 1O2KA 1A61H 1IQNA 4A7IB 2PGBB 1H8IH 3FANA 3V0XA 1BMNH 4YOGA 3F68H 1DY8A 4D7FA 1Z8IB 3U1IB 2C8XB 1N8OC 2GCHG 2PV9B 3LONA 1K28D 1Q31A 3BEFB 5LGOA 2OXSA 1ANBA 3ZZ6A 3RXHA 3LH1A 1TOCB 4CRCA 1H9HE 4H4FA 3UPEA 1G3BA 1W11U 4LXBH 1O2NA 3GY4A 3RU4T 1IQMA 3JZ1B 2QGRA 3HGNA 3T29A 2BOKA 3O8DA 4NIWA 2ZEBA 1T4UH 1ZTLA 1P01A 2R2WU 4B76A 3MNBA 5A2MH 2WPKS 5IDKA 3A85A 1LQDB 4XDEA 1Z1JA 1Y5UT 2VU8E 4AOQA 3OU0A 1NU7B 1Z1IA 5HM2A 2H6MA 1ZSKA 4CREA 1GI9B 5A8XA 2HVXA 4X6OA 1SLWB 4BTIB 1NFUA 1KXEA 1K22H 2G52A 1LPGB 1O3NA 2Z9GA 2Y7XA 2CHAC 4FVDA 4K5ZA 4XBDA 1WYKA 3RU4E 2BDYA 1HIAB 2V0BA 1HAVA 1FN8A 3RMNH 1MTNC 1C1RA 2GMTB 1AE8H 1GJCB 5AHGH 4AB8A 2AGEX 2SNWA 1IQLA 1GMDG 3BG4C 2Q6GA 3KIDU 3RMOH 1FY4A 4Q7XA 5FAHA 1FONA 4X0WU 1O2UA 1WTGH 5C3NA 1FIZA 3SI4H 3M7TA 3LGYA 1ZZZA 2PW8H 5EPNA 5CHAC 1O3IA 3MNXA 3TJVA 1VJ9U 2AIQA 3ODFA 2OQ5A 2A4QA 4A1XA 4NFEA 2BDCA 1ACBE 1BBRE 2FOMB 1GG6B 1JBUH 3V7TA 3TGIE 1GBJA 1DLKB 4PROA 1AUJA 1GBTA 4RKJB 3PMAB 1F7ZA 1GI6A 2VIVA 1SGFG 3D62A 4WMFA 4DIHH 1FY3A 1HXEH 2ZDLA 1GJ7B 3AAVA 4WWYA 3BTHE 3STIA 3UQOA 1SG8B 3URDA 1DDJA 2DE9A 1PYTD 3WY8A 1GI8B 1D4PB 4UFFH 2FLBH 3GY3A 2G4UA 2O8MA 2P8OB 5H4IB 3RXUA 2BY6X 2NWNA 2FP7B 4U01A 3SN8A 2GT7A 3ENSB 2VB0A 3TGKE 1AE5A 4OS1A 3SJKA 1S6HA 3P8GA 4CHAB 2ODYB 1GDQA 3MNSA 3E16B 1SGIB 3OSYA 2Y5HA 3QTVH 1P09A 3FAOA 1TPPA 3SU6A 3ZYEA 1KY9A 5LH8A 3T28A 2R0LA 1BZXE 1O2ZA 1TIOA 2HWLB 4NIYA 2VH0A 2ZC9H 3OY6U 1A5GH 1C4Y2 1DOJA 2C8YB 1PPBH 4A1VA 1WAYB 1Z8JB 1ZRBA 1UHBB 1TOMH 3DFLA 1ZSJA 2WYJA 3UNQA 1JRTA 1GHVH 5C5OA 1CO7E 2ZECA 3PLBA 3ZZAA 3GYLB 1V2QT 3TH2H 4I8JA 1SGNE 1MTVA 2FOCA 3V13A 3LOXA 1AFEH 1YPGH 3LGUA 4E7RG 6GCHG 1BJVA 2BD4A 4UONA 3UY9A 5C2ZA 1TMUH 5ABWA 1AD8H 1O31A 2NU2E 3TVJB 1J8AA 2HLCA 1F0RA 2FMJA 4Y8ZA 1W3CA 4NZLA 2BVSH 3MU1A 2ZP0H 1KTSB 1ZPBA 1O36A 4FUHA 3RXTA 1CGJE 4ZKNU 1FPHH 2A5AA 3SGBE 1O2HA 2OC8A 1P11E 4Z0KA 4X6NA 4VGCC 1AWHB 4MLFB 3Q00A 7LPRA 2G4TA 3EGKH 1T8OA 3DUXH 4MNXA 3SV8A 4IBLH 4IS5A 1O2JA 1ZLRA 3NUMA 3OTJE 3M5MA 1XUJA 3A84A 3KEEA 2BTCE 3TIUA 2BLOA 2J34A 4OS4A 1O34A 2XBWA 3GISB 4ZROA 3RM2H 1DPOA 1GCTB 2P94A 2OD3B 4FUFA 4OS2A 1OKXA 3TLOA 3PMJA 4K2YA 4F49A 2RA3A 1S83A 2A31A 3H7TA 4Y0YE 3V12A 1D9IA 3QO6A 2IN2A 1BT7A 5JBTA 3FZZA 1NC6A 1C2EA 2BVRH 4X6PA 5JBCS 1UVOA 4DGJA 3I77A 4INKA 1C5QA 1GMCF 1N6YA 2IOTA 5GCHF 2STBE 1ABJH 1MCTA 5E2OA 4KGAA 1HAXB 1OP2A 3ZZ4A 1A5IA 2C8ZB 4I31A 3RXCA 1SLXB 4ISNA 2TIOA 4GLYA 3SV2H 1V2UT 4X2XA 3MU4A 1T4VH 2ZA5A 2TBSA 1XUKA 1SVPA 1GGDC 2BB4A 1VJAU 3SJOA 2A7CA 4ABGA 1UK2A 2AERH 3SU3A 3FP7E 1X7AC 1C5UA 1SQAA 1WQVH 1OP8A 3RU4D 3KF2A 2W26A 1ID5H 1YP9A 4WVPE 3STJA 1PQAA 4CR5A 1MQ6A 3UOPA 2SGPE 4WJG2 1K1LA 1ELEE 3VGCB 4CR9A 1CA0C 4BTUB 3LPRA 1KTTB 2FYRA 3A8BA 3RXIA 1V2WT 1HAPH 1SQTA 1KYNA 2QN5T 3L6PA 1HAGE 4U2WA 4LOYH 2H5CA 2ZWLH 3LC5A 1IQJA 4DT7B 1NU9A 1S5SA 3U9AH 2F91A 2R2MB 3ZZDA 1Y3XA 3UFAA 1SQOA 2BDIA 3SORA 1EZQA 2BLWA 3RP2A 2ZTYA 4BOHA 1TLDA 4CH8B 1A46H 2ZQ2A 1G2LA 1QQ4A 1UTPA 3SOSA 1O32A 5CE1A 3QTOH 2B0FA 1GHAG 2OLGA 1JXPA 4OS5A 1AY6H 1HJAC 1C5WB 4ASHA 1SGPE 1Z7KA 3HK6B 2QYIA 2W3IA 4R0IA 1Z6JH 5DG6A 1AB9C 1A2CH 1F0TA 1IHSH 1AKSB 4GCHG 2VVCA 2ZTXA 1PQ8A 3RXVA 1TGTA 1QY6A 1SR5C 2Z3DA 2ZHFH 9ESTA 1G3DA 2WV4A 1CGHA 1MKWH 3ZZ7A 1T31A 4FXGH 1GDUA 1G37A 2QIQA 2I6SA 1SHYA 1BMMH 1Y8TA 1D3DB 1HFDA 2XBXA 3OY5U 3SUEA 1NTPA 3GDVA 1YPEH 5AFYH 1DUAA 1HIAA 1S84A 2GGVB 1FXYA 2OCVB 4D8NA 1ELFA 1BQYA 1ELAA 4Y71A 5TJXA 4WMDA 1P9UA 3SV9A 1GJ8B 1P12E 4Y7AA 2EA3A 2XBVA 4MPUA 3SI3H 1GJ9B 5EOKA 4WMEA 6CHAC 3SQHE 1Q3XA 5LPFA 3M3VA 3LDXH 1EJNA 5A09A 2ZZUH 1EKBB 2F9PA 1TNLA 1O35A 1F0SA 1TPAE 1V2PT 2FTLE 1SBWA 1UVPA 1V2LT 3SU0A 2O8UA 4ABAA 1TNGA 2SGFE 3EE0B 2C8WB 2THFB 2VWNA 2FM2A 4LZ4B 3UTUH 3PMHB 1UTNA 4MQAA 4DIIH 1AZZA 1V2KT 3SU1A 1H4WA 2EI8A 2YOLA 4FUEA 3P95A 1DWDH 4UFGH 1K1OA 2PSXA 1T7CA 2H9TH 2JETC 2TRMA 4YO9A 4IW4E 1D6WA 3RXPA 1MTSA 3GY6A 3DFJA 2OTVA 5ETXA 1O5BB 1FUJA 4Q2KA 1ZGIA 2G00A 2BDBA 3U98H 1C5PA 1THPB 2OC0A 1W0ZU 3T5FH 2OBQA 2A1DB 1HJ8A 5HXFA 2BD7A 2ZNKH 2XW9A 3PROA 2TPIZ 2OC7A 2GT8A 1MTUA 1ZPZA 3D23A 1PQ5A 1O3FA 4AORA 1UTQA 5FXLA 1INCA 1W7XH 1F0UA 2XBYA 4ZKRU 1EP6A 1NRRH 5FX5A 2J9NA 2Z3EA 1QB9A 1MH0A 1QBOA 5A8ZA 2WPLS 1RRKA 2J38A 2VWOA 2BZAA 3E1XB 3E90B 4Y79A 5GIBA 3SU2A 3VB3A 5HM9A 1OWIA 4UEHH 7GCHF 1BJUA 3C27B 1P02A 4HZHA 1UHBA 1VITH 2Y6TA 2Y80A 2ZFPH 3RXEA 2PTCE 1TMBH 3SNEA 2FI3E 4NSYA 4CBNA 3NXPA 3NWUA 5T6DA 2Z94A 4D7GA 3TJUA 4ABJA 3MH7A 1RD3B 2VIPA 1QRZA 1BHXB 1OX1A 3OX7U 3GCOA 4ABIA 5FPYA 5T6FA 1O3LA 1HAHH 5ESBA 1SHHB 1EZSC 4ISOA 4YTAA 3A81A 1C5XB 3KNXA 3O8BA 1S0QA 1Y3UA 4A6LA 1SOZA 2QXJA 3MO3A 1HDTH 2XCFA 1GJ5H 1KLIH 3NPSA 3E8LA 2FS9A 3FP8E 1EB2A 1EATA 4FU9A 1TNIA 3TNSA 2BX4A 4ZHAA 1LHFH 1MMJN 1TE0A 1NFYA 1BITA 2OUAA 3ZZBA 3ZVBA 1Z8RA 4I7YH 2ZCHP