4MNYA

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk903
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide ligands stabilized by small molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator chain B
total genus 54
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnyA01
6CHAC 2G4TA 1V2QT 5A8YA 1QR3E 1ZTJA 2AERH 5EODA 2ZPRA 1ZGIA 3SQEE 1HJAC 1BBRE 1BJVA 5TJXA 1MTSA 2ZA5A 3PMAB 3M5NA 1GJDB 1MUEB 1YKTA 3P70B 5C5OA 1C5MD 2NU2E 4NZQA 1LVYA 1OWJA 4Z0KA 3U98H 1A4WH 2FXRA 3E16B 1Z6JH 4NG9H 1B5GH 1BHXB 3SUGA 5LPFA 1TGCA 3PWBA 3UTUH 2BDYA 3UY9A 1FJSA 1O2UA 3RU4D 1DE7H 3E91A 4FUFA 3VEQB 2G55A 3RLYH 1NS3A 2EA3A 4I32A 4FU8A 2G4UA 1EQ9A 1A3EH 3BTWE 7KMEH 1EOJA 1DWDH 1CA8B 3TIUA 2QA9E 2GGVB 1AGJA 3RXRA 4LZ4B 4YOJA 2NU3E 1CHOG 5DP3A 4VGCC 1P3CA 1S81A 3RP2A 1IQHA 1KDQA 5I25A 1WTGH 2KAIB 4YOIA 1NRNH 1V2VT 4H4FA 4OS5A 3RM0H 2FDAA 1SVPA 4YT6H 1EKBB 1EP5A 5K7RA 2O8WA 1SMFE 2A1DB 1TRYA 1DLKB 4VGCB 2B9LA 1CO7E 5BRRE 1JRSA 1TWXB 1H4WA 4ZHLU 1NFWA 3U8OH 3ZVAA 2A4RA 4ZH8A 1NU9A 2ZFTA 1G36A 2QCYA 3BEFB 3SGAE 1QFKH 3LGTA 3EA7A 3JZ1B 1ZMLA 1QB6A 3SO3A 1EJAA 2C8ZB 4I8GA 3LJJA 4MNWA 4AYVB 4B71A 3UWJH 3CENA 2YOLA 5AVDA 3SHCH 1MH0A 1ZHPA 1VJAU 1CT0E 2Z6BD 1HAPH 1IOEA 1XM1A 3QGJA 3NZIA 2V6NA 1GMCF 2ZU2A 2PUXB 1E36B 1MBMA 3A8AA 4KP0A 1ANEA 4F4OC 3QGNB 1LQDB 5FPTA 7GCHG 1V6DA 1B7XB 1UTMA 1O3JA 1UCYE 4R8TB 3LONA 1C2HA 3D49H 1VJ9U 1GG6C 1FZZA 4GHQA 4D76A 1GJ9B 1HAVB 3MNXA 2P95A 3UOPA 2JH0D 4INHA 3EE0B 4ASHA 1AZZA 4A1XA 1AVXA 5J4SA 2GX4A 3RXGA 1ANCA 1C1QA 1GMCG 1TNHA 5A8XA 1O38A 1YC0A 1O2ZA 4LOYH 1AB9C 4NIVA 3STJA 1K1LA 1EAWA 1HXEH 1K1MA 2W3IA 1O3PB 3TU7H 3A83A 3ZZ4A 4JMYA 1TNKA 2ZZUH 1IQIA 1S0RA 2ZIQH 3DFLA 3STIA 4JYUH 1C5OH 2GCTB 1TOMH 3PWCA 4X1NU 4MVNA 1W7GH 3QUMP 2Z3CA 3HKIB 3UIRA 1ZJDA 4Q7ZA 1XMNB 3ODFA 1OSSA 4Y0YE 1BMMH 4TYDA 4IS5A 2K1QA 4ESTE 1Z8RA 1LMWB 4Q7YA 2IOTA 1LDTT 1O32A 2BYAX 1W3CA 1ORFA 3PLPA 1LVMA 1MAYA 3ZZ9A 2BY7X 1B0EA 4ZKSU 1GBIA 4B73A 3FVFB 2GDDA 1BJUA 4BAMB 1GI1A 2F9BH 4K1TA 2BOHB 1PFXC 4ZXXH 3NKKA 4FVDA 1XUHA 4E7RG 1ZGVA 4ABDA 2ZFSA 2WUCA 1DY8A 1H8DH 1TA6A 4JYTA 1C1WH 2FEQH 4ZHMU 1OX1A 1XUIA 4TWWA 1KXFA 1Z8GA 1DVAH 3SJ9A 1Z8IB 1O5EH 1IQLA 4BNRA 3TK6A 3SNCA 2J34A 3GY6A 1FPHH 1GVLA 1K1JA 1F0RA 1C5NH 1ESBA 1A46H 3DA9B 3GCOA 3UREA 1LPZB 4MPXA 1GL0E 2Z3EA 2FS9A 2A0QB 1TNJA 3TPIZ 2A2QH 3V7TA 1PQAA 4Y8XA 4MNXA 1O3EA 1PPGE 2A5IA 2BZ6H 5T3HA 1CA0C 1EUFA 1QTFA 3UPEA 1TOCB 5A0AE 1ZTKA 1MTUA 5F03A 1LPKB 2GDEH 1YP9A 8GCHG 4Y7BA 1SOZA 3EA8A 2ZECA 4AGKA 2QIQA 1C1UH 1QRXA 4U30A 1SLVB 2HGTH 3PV4A 4I33A 1LQEA 4HI3A 3RXOA 1GL1A 4ISLA 1GJ6A 3TNTA 3H7OA 4UEHH 1HYLA 1HAHH 3A7VA 1OPHB 1FDPA 3SNDA 2AFQB 2P94A 1JOUB 1L2EA 5C1YA 3SU3A 1SGQE 2PWXA 4OS2A 1TYNA 3MNBA 5IDKA 1MTVA 2F9OA 2W5EA 2BVXH 4MTBA 3BTEE 4RKJB 1Z6EA 1A61H 1SLUB 2PUQH 3UUZA 1VCQA 1UK3A 5T6FA 1J8AA 2PKAB 4F49A 5TCCA 2AIQA 3KQEA 5AHGH 1UHBA 3LGWA 1KYNA 1NTPA 2ZDNA 1C4V2 2O9QA 3M3TA 2GZ9A 1OS8A 1RXPA 4GAWA 1O5CB 4A5TS 3TH3H 3ZZ6A 3PMBB 3HK6B 3HK3B 2CGAA 2ZHFH 3M7UA 1W10U 1P8VC 1SLWB 2Y6TA 1HAVA 1WBGB 1UJ1A 1AU8A 3QWCH 2ZQ1A 2GT7A 4BXWA 3D65E 2ZO3H 1SQAA 2C8YB 2Z94A 4X2VA 3QLPH 5F6MA 2UUKB 4LXBH 1ZSJA 2OP9A 1NN6A 1BMAA 1OWEA 2R3UA 1QA7A 3TITA 3DFJA 2Q1JA 2Z9LA 4CBNA 4ISOA 1G3EA 2B8OH 1CBWC 1GI5A 2ODYB 2W7UA 1AVGH 1MCVA 1DICA 1SG8B 3F9GA 1GMDG 2JKHA 3SZNA 2FPZA 3BG4C 3LGIA 1GMHG 2Z9GA 3CS7A 1L0ZA 1T7CA 2XWBI 2ZFFH 4XE4A 1GCTC 5LGOA 2A7HA 2FM2A 4X2WA 3DT0H 2GZ7A 1ETRH 2GTBA 1C5ZB 1YF4A 5E0JA 2GD4B 2CXVA 4KTSA 5DKMA 1O5DH 3QDZB 1LTOA 4Y10E 4BAOB 1SGRE 1O0DH 1DSTA 1SGFG 3KQDA 2VWNA 5GXPA 4UFGH 1L1JA 1JIRA 1LKBA 1W11U 3T5FH 4INKA 4U01A 2P8OC 4CRDA 1ELDE 2WPLS 5JBCS 2VWLA 1P12E 1C9PA 3UFAA 2XWAA 4NWKA 1YCPM 2ZDVH 1C5QA 2O8TA 5JB8S 2HNTE 3U69H 1ANDA 4ISHH 5DG6A 3ZZ7A 1EAUA 4CR9A 1Y5BT 2FOHA 1THSH 2VIOA 4FUCA 3A88A 1W14U 2ZHWH 1P9UA 1ESTA 3NXPA 2ZQ2A 1FNIA 2UWLA 4Y11E 1QHRB 3RMNH 2SGPE 3BIVH 3ZYDA 1XKAC 1SB1H 1W13U 2OD3B 2H9HA 1T31A 5HMAA 1GI2A 4D7GA 4FU9A 1V2PT 1TRNA 8LPRA 1EPTA 3MYWA 1MU6B 5JBTA 3PO1C 1BTUA 3W95A 2H5CA 1ZR0A 4ZKRU 4E06H 3CS0A 1CT4E 5LH8A 2ZEBA 2ESTE 4HTCH 2PKSB 2Z3DA 2SGQE 1OP0A 1PPZA 1T8NA 1NESE 3M3VA 2OCVB 4B2AA 3TLOA 1O2QA 3P17H 1K1IA 4FUEA 2BY8X 4ZROA 1TGNA 1BRUP 3HGNA 3UQOA 2PFEA 3MOCA 2ANKH 1C2IA 1GG6B 2ODPA 1O2XA 1JBUH 1AI8H 3V13A 2TBSA 1LO6A 3Q76A 3T25A 1ELEE 5E8EH 4I8JA 1AN1E 5EXLA 2D2DA 1ZHRA 1TLDA 2BD3A 5SGAE 1LCYA 1Y3UA 2ZPSA 3A7WA 2VB0A 3MU1A 2ILNA 1FY5A 1O2WA 5HM2A 3PO1B 2AH4X 1NFXA 3SHAH 2C8XB 3RU4T 4A6LA 1TBRH 1BTHH 3ZVFA 4YM9A 1Y3WA 4B2CA 4XDEA 1FIWA 2OINA 3SU2A 2F91A 4FUJA 1DITH 1C5LH 1G2MA 1ELTA 1O2OA 4WH6A 1GCDA 2CV3A 1KXBA 3P8FA 2M5TA 4O03A 3OTJE 3BTQE 1X7AC 3KQBA 1NO9H 1BT7A 1ZHMA 2XC4A 1D6RA 3DUXH 5FHTA 2FWWA 1CGHA 1VITG 2VIWA 2VGCC 1IAUA 5ETXA 2CHAB 1EB1H 1FV9A 3AASA 1KTSB 1W0ZU 4X6OA 1L1GA 1KLJH 1HJAB 1S6FA 3RMOH 2ALVA 3BEIB 4Y8ZA 2AMPA 3QTVH 4Z6AH 2H9EH 1HB0B 1T4VH 2A4OA 1BDAA 1O2PA 1OXGA 2FTMA 3MH4A 3S69A 2ZNKH 4OGYA 4ZUHA 3RM2H 1ETSH 4K69A 2ZPQA 5DJ7A 1EATA 1Q31A 2TGTA 4AOQA 1G2LA 4O3UA 1K28D 4XBDA 3RXIA 1GGDC 3M35A 2XC0A 2R9PA 6GCHG 2WPHS 2UUYA 3EA9A 3LC3A 4NZLA 1DOJA 3F9HA 3A80A 1EX3A 3W94A 5E0HA 4B74A 3SU4A 5EQQA 1GDUA 2PTCE 3IWMA 4R0IA 3URCA 1HJ9A 2HNTF 1DWEH 2CJIA 1BMNH 4NFEA 3GYMA 1UMAH 1MKWK 4JCNA 3GY5A 2ULLA 3SJIA 1P03A 3TGIE 5C20A 5E2OA 2HWLB 1BZXE 3RC5A 3U1JB 1FI8A 2FI3E 1C1PA 4ABHA 4YLUA 2WPIS 4FVBA 4BXSA 2FX6A 1YM0A 2HRVA 3QK1A 1WSSH 2ASUB 4YLQH 3KQCA 1GHZA 1C1OA 2Z9JA 1HIAB 2IPHA 2FZZA 1C1RA 1YPHC 1AIXH 1OP8A 4JYVH 1P0SH 1EPTB 1O2HA 2FOGA 1K22H 5EQRA 1Y3XA 1XVOA 1SHHB 1C2MA 1HGTH 3SV8A 3M5LA 1C4Y2 4ABJA 4CR5A 2STBE 3PROA 4O97A 4GHTA 3MI4A 3RDZA 3A82A 3SNEA 3V3MA 1ZPZA 4IGDA 1ZRBA 2H6MA 1N8OC 2BY6X 1EZXC 2ZHDA 3MU5A 3Q00A 1C5VA 1EP6A 3EYDA 2VJ1A 1VR1H 1VGCC 4OS7A 2F9PA 1GBTA 2PGQB 1SOTA 5T6GA 1HPGA 1TPAE 1DANH 3U1IB 1UVPA 1AVWA 1SGCA 1J17T 3U8RH 1Z8JB 1OKXA 1TX6A 1FPCH 2OC1A 4AFZA 1UTLM 4OS6A 2FTLE 1TQ0B 5F8TA 3RXFA 2Y82A 1O30A 1ZMNA 3ODDA 4D8NA 3I29A 4X1QU 2QAAA 1SR5C 1OWIA 5AFYH 3AW0A 5DP8A 4CH8B 2BQWB 1K2I1 2RCEA 3MFJA 1Z7KA 4FUDA 2OBQA 3GCHB 4K1EA 3RUOA 2ANWA 1P10A 1AWHB 3SI4H 5EGMA 1QBVH 3GCHC 1MKXH 1AQ7A 3ZVBA 2A5KA 4NGAH 1MZAA 2DE9A 1HAOH 4LZ1H 2EC9H 3AAVA 1CBWB 1HXFH 2FIRH 3U9AH 2FO9A 4IC6A 1F5LA 1C1SA 2ZGCA 4YTAA 3MH7A 1ZSKA 1V2MT 1GI9B 3GISB 1F0SA 3KL6A 2CMYA 2NU0E 5EQSA 1GVKB 2V0BA 5C3NA 1C1NA 3ESTA 3MNCA 3JZ2B 3TH4H 5FBIA 3GCTF 5EXMA 1PQ7A 1ID5H 2SNWA 1O5FH 2UWPA 4DJZB 2I6QA 1BRBE 3KN2A 2AEIH 1F2SE 3H7TA 1UVUH 2A31A 2QF3A 3HPTB 2F9NA 1RRKA 3FZDA 2FI5E 1CU1A 1GBLA 3FP7E 3A7YA 2NU1E 2QN5T 1TRMA 2BXUH 1KLTA 3RXCA 2XYAA 3ZZBA 2C90B 4X8VH 1UVSH 2F3CE 2OQ5A 3LIWA 4BAHB 3BTDE 4Y8YA 3BTFE 1BTZA 1RIWC 2CF8H 1EPTC 1Y8TA 2AS9A 2FP7B 3CP7A 1H9HE 1YLDA 1YPMH 3ZZ5A 4Y6DA 5FX6A 1K1OA 2QXHA 4DY7B 3SUDA 5GCHF 2EI6A 1BTXA 4AORA 3FZZA 3VGCB 1TPPA 2BX3A 4NA9H 1ZOMA 1SGTA 3ATWA 1G37A 2WPMS 1IQJA 1KLIH 3V0XA 2F83A 3UOUA 4H42U 4Q2KA 1NRPH 1H8IH 1K1PA 1SLXB 3TJNA 3A81A 4X1PU 1GHAG 1S5SA 1V3XA 1G32B 4ABIA 2BX4A 3S9CA 4SGBE 5DO4H 1NY22 3RXEA 1AZ8A 1C5WB 2YNBA 1A5GH 1UK2A 3EAJA 2BOKA 1PYTC 1ELGA 1N1LA 1MBQA 1NRRH 3NPSA 1GHWH 3SJ8A 1HAXB 5EPNA 1T8OA 2GCTC 5GJ4B 2ZP0H 1ZZZA 3WY8A 3KNXA 2XBXA 3UR6A 2AMDA 1O3LA 3OYPA 4X1RU 1P2JA 1UK4A 2G00A 2SGFE 4X6MA 4KKDA 2SFAA 1E35B 1GBKA 3PLKA 4IMZA 1KXDA 3T62A 3QO6A 4GSOA 3PTBA 2ZHQH 4RN6A 1LVBA 8GCHF 1ANBA 3RXLA 2ANYA 1BBRH 1O5GH 3VB4A 1KDQB 1GJ7B 1AUTC 2SGDE 1Z71A 4ZMAH 4NCYA 3SV6A 3ZV8A 3TJOA 5E2PA 2BMGB 3S0NA 2GVFA 4WXVA 1FONA 1P2KA 1YPLH 2BLWA 1C5SA 3GY3A 1GBEA 1P3EA 3PTNA 3O8CA 3VB7A 2CHAC 3N7OA 3E90B 4D9RA 1SGFA 3IITA 1CVWH 1TPSA 5A09A 4CBOA 6LPRA 4E05H 1YYY1 2NWNA 1GHBF 1ELFA 2A32A 5EPYA 3RMLH 4AB8A 3ZVGA 1AKSA 4YOGA 1Q2WA 2J95A 1SGYE 2VH6A 1WCZA 3M7QA 1V2KT 1Y5UT 1MD8A 1B0FA 4XFQA 3TJVA 5JBBS 3K6ZA 1S6HA 4ABBA 1AHTH 1EOLA 1XUJA 2J92A 2JETC 1ELAA 1GGDB 1JIMA 4ZHAA 2ZFQH 5DP5A 1O33A 1EAXA 1S82A 2ZKSA 1W0YH 1DDJA 4A1TA 2XRCA 1GI7B 1O2IA 2BTCE 1SL3A 4FXGH 1UCYH 1XUGA 5CHAC 1T8MA 4B1TA 1UTPA 4J2YB 2W7SA 4RSPA 1MCTA 3K65B 5G4BA 1EZSC 1FN6A 2P3TB 5T6DA 4I8HA 3MMGA 1WQVH 5DP4A 1HIAA 4NIYA 1DSUA 3A8DA 3GY8A 4Y79A 5L2ZH 1PPEE 4MQAA 7LPRA 2WYJA 2EI7A 6CHAB 5LPEA 5FCRA 3BTKE 1UTNA 1C2LA 3I78A 5JDUB 1VITH 3BTME 1TAWA 2Y7ZA 5DP6A 1DUAA 3D23A 3GY2A 3G01A 3S9AA 1A1RA 1W7XH 2TGAA 2QC2A 5HXFA 1WQSA 3ENSB 1UVTH 1TBQH 5JBAS 1BRCE 4K3JA 3R0FA 1VITF 1O3NA 1F0TA 1ZLRA 3LH3A 3MO3A 4AYYB 4WMEA 1K9OE 2AGGX 5HGGA 1O3KA 1YPEH 1RGQA 5EXNA 5FPYA 3BF6H 2ZGBH 9ESTA 1SC8U 1UO6A 2ZDAH 4O9VA 1RS0A 2EI8A 1GI4A 2FODA 2HVXA 1C4U2 3K2UA 1C5XB 3EDXB 4AFSA 1HAIH 2R2MB 1G30B 1Y3YA 3SUFA 1UTQA 4MPUA 4WF8A 5ABWA 1INCA 1O3DA 2BD8A 3LGVA 3SI3H 4TPYA 1FN8A 2G8TA 1QY6A 4AG1A 3QX5H 3PM3A 3VB5A 1ABIH 2GV6A 2P3FH 1GMDF 4CRCA 2OLGA 2VIVA 2A5AA 4DCDA 1ELBA 1DS2E 1MTWA 2VU8E 1KXEA 1O2SA 3TK5A 4MPWA 2VNTA 2A4GA 3ZZ8A 1ABJH 1T8LA 2XNIA 1KTTB 3FFGA 3GCTG 2BDAA 3UQVA 1VZQH 1W2KH 2BQ6B 2A7CA 3LGUA 3UWIA 5C2ZA 3T2NA 1IHTH 1O35A 4E7NA 3HKJB 1SGDE 4A1VA 2PR3A 4ABGA 4DG4A 4Q7XA 1OWDA 2ZG0H 2P93A 2VVCA 4MNYA 1O37A 1C2JA 3MH6A 1BUIA 2ZU4A 3TJUA 4DW2U 2ALPA 1D3DB 1YCPH 2ZI2H 3QN7A 1HFDA 1FIZA 2VH0A 1SGPE 1BBRK 1DXWA 1C5TA 1IQNA 1MMJN 2OTVA 3LKWA 3E6PH 5IYTA 2ZFPH 1V2RT 1L4DA 2BXTH 3P8OA 3Q77A 4B76A 1ZMJA 2BDIA 2QXIA 2OC8A 4TY6A 2FESH 3SOSA 4MLFB 1AMHA 1HAYB 2PKSC 3GCNA 3Q3XA 2A7JA 2ZGJA 2BVRH 2XCFA 3VFEA 4Y76A 2G5VA 4ABFA 1XX9A 2JETB 4WH8A 4CRFA 2PHBA 1QCPA 4K5ZA 1L4ZA 1GHAF 1FUJA 1RTKA 4AGJA 1C2DA 5EW1H 2ANMH 1D3QB 2Y5HA 1MZDA 4OGXA 2ZU1A 3MU0A 2SNVA 1P02A 1PQ8A 3F9EA 1BTYA 3ATKA 4O3TA 1SPJA 1AE5A 2ZTZA 1RIWB 1TBZH 2C3SA 3MNSA 5F8ZA 3ZV9A 3SW2B 1FLEE 2QGRA 4GPGA 1OWKA 2GKVE 1O2MA 4DIHH 6ESTA 1QA0A 4JZEH 1O2KA 4HFPB 1GVZA 1XXDA 1O3GA 1P04A 1F7ZA 2H1UA 2P8OB 4M7GA 2D1JA 2I6SA 1TNGA 1QJ7B 1SQTA 3E3TA 5L30H 4BOHA 5HM9A 3F9FA 2FLRH 3NK8A 1OYQA 5J4QA 2DUCA 1LHDH 3GY4A 3BEUA 2WYGA 1SGNE 3LGYA 4AN7A 4IN2A 1V2UT 4PROA 3RXKA 2QXGA 3TGKE 2C4FH 1FXYA 2VWOA 2Y5FA 5EG4A 3LJOA 5DGJA 5GCHG 1GJCB 1NRSH 3L33A 3RMMH 3RU4E 2JH6D 3ZZ3A 2VVUA 1XVMA 3OY6U 5H4IB 2BDCA 3LDXH 1GCTB 1MKWH 3NCLA 1KIGH 2EEKA 4IMQA 4HZHA 4GCHF 2QF0A 1IQEA 8ESTE 2WV5A 3GDSA 1BMLA 1AD8H 1YPKH 2ZTXA 1P2OA 3MU4A 3A7XA 1EASA 2J38A 3R3GB 1TA2A 2V3HH 3B8JA 3BN9A 5GIBA 2GMTB 2BVSH 2HPPH 1W12U 1C5RA 1C2EA 4A92A 1P2QA 1V2TT 1SI5H 2HOBA 5A2MH 1T4UH 1Y59T 1MKXK 1EAIA 3RXDA 1AUJA 5GWZA 1THRH 2ODQA 3FP8E 3A85A 1LKAA 4H6TA 2THFB 2PKAA 1P06A 3M5OA 4X8TH 1ZPCA 3NUMA 4XBCA 1NFYA 2J9NA 1TQ7B 2ZFRH 1CT2E 1LPGB 1NRQH 3B23B 2KAIA 1O2RA 2GT8A 3ZZAA 2QV1A 4IBLH 4WMFA 1DPOA 1UVOA 3UNQA 1S85A 4JK5A 5AF9H 1F92A 3MO6A 3H5CB 5L2YH 2XBWA 2P16A 1SFQB 3FAOA 4UD9H 1MTNB 2Q6GA 3ZVEA 1O3OA 1PPHE 7ESTE 1D3TB 2BLVA 2GCHF 1FY8E 1TMUH 3M5MA 3ZZCA 2H5DA 3TK9A 1DXPA 4Y0ZE 1CGIE 4CHAB 4NIXA 2WUBA 1BHXF 1V2OT 2VIQA 3A84A 1ACBE 1GBHA 4CRBA 3MHWU 1O2GH 1QQ4A 1CA0B 1MAXA 4I8LA 1BA8B 2VINA 1KY9A 4A7IB 1J9CH 2C93B 1HAZB 5BPEA 1PPBH 1H9LB 1LVOA 4I31A 4K8YA 1YLCA 4Q80A 3TNSA 1V2JT 1EZQA 5LPRA 2BDGA 4WWYA 1SQOA 1GJAB 4I7YH 2B0FA 1HNEE 2FYQA 1NFUA 3E1XB 1TB6H 4JZDH 2F9UA 2HPQH 1TFXA 6GCHF 1BQYA 3SNAA 4KTCA 2FS8A 1LHCH 1ZRKA 3O8DA 3L6PA 1O3BA 1O5AB 1C1VH 4OS4A 4XSKU 3U8TH 3S7HB 3MWIU 4UE7H 1VGCB 3P92A 4DIIH 1CHGA 3SNBA 4YO9A 1FY4A 3LPRA 1ZSLA 1MQ6A 1D3PB 1O3HA 4J1YA 4X6NA 1V2LT 1N6YA 4WXIA 3DD2H 1O2JA 1UTJA 1O2TA 2D8WA 1TABE 2FOAA 4FUHA 5FBEA 1GMHF 3TVJB 2RDLA 1QJ6B 1GI6A 2BY5X 4IW4E 2ZU3A 3GY7A 3SBKA 1E34B 1CGJE 1K21H 2J2UA 1OWHA 3ZVCA 4CRAA 1O3AA 1S84A 1A0HB 1H9IE 1MQ5A 3RXBA 2UUJB 3E0PB 4NWLA 1GBDA 4AG2A 1XUKA 1D9IA 5E0GA 1O39A 4ZKNU 4BAQB 3SV9A 1JWTA 4U2WA 1TGSZ 1DM4B 1YPJH 1HLTH 3C1KA 4JK6A 1BTWA 1FY1A 1M9UA 3ATIA 4X8SH 2IN2A 1GBFA 3EQ0H 3I77A 4THNH 3BTHE 1C5UA 3GDUA 3BTGE 3S9BA 3RXUA 1AY6H 2R2WU 2VVVA 1GBMA 4MPVA 4XBBA 4X6PA 1NT1A 1GJBB 3LH1A 5CMXH 1A5IA 1EB2A 1C2KA 3T29A 3MO9A 4ABAA 1ELVA 1XUFA 3A8CA 1GJ8B 3VXFH 4FUGA 1QURH 1EZUC 1ARBA 1QBOA 3MTYA 1RJXB 1LHGH 1QB1A 1J16A 2UUFB 5K0HA 2BDBA 2BD2A 1ZPBA 5EOKA 4KTUA 1P09A 1WUNH 2BD4A 4WVPE 2QY0B 3VB6A 1BCUH 4DVAU 2A2XH 1CQQA 1FMGA 3UR9A 3GOVB 1QRWA 4NSVA 2Q6DA 4IC5A 1U6QA 5FCKA 1V2NT 3F68H 2QYIA 3A89A 1IQKA 3K6YA 1G3CA 1DWCH 1E38B 1TE0A 2XBVA 2Y80A 1T32A 2VGCB 3LU9B 1DT2A 2YNAA 1KSNA 1O3CA 1TMTH 1P05A 2ZWLH 1BRAA 2Z9KA 1TALA 4XOJA 1C1MA 8KME2 3AAUA 2FYRA 1AWFH 3SU6A 2ZDKA 4AZ2B 4AFUA 4YZUA 3O8RA 1D4PB 2WINI 4X2YA 1TMBH 3BV9B 3KEEA 4BTTB 1AO5A 1Z1IA 5JB9S 1FAKH 3SV2H 4DURA 3A86A 4UFFH 2AMQA 2O8MA 2GZ8A 3VXEH 2J94A 1GJ4H 4AX9H 5EU8A 1QNJA 4HGCA 2PW8H 1O2VA 1VCPA 2JH5D 1SFIA 1QGFA 1HDTH 2OUAA 1O3IA 2F9VA 4AFQA 5L6NH 1C5PA 3P6ZB 3SV7A 2OBOA 3ZVDA 5CE1A 1A0LA 2ZDMA 5CHAB 4NIWA 3BIUH 1YPHE 5TCAA 2BQ7B 3ATLA 1UTKA 2GCHG 2ZCKP 3SJKA 2H2ZA 2NU4E 5C67A 3QZQA 3ITIA 3RC4A 2HLCA 2PTNA 1EJNA 1QBNA 3TH2H 3AW1A 4FUBA 1NM6A 3Q3YA 1PPFE 1WYKA 2G52A 2PSXA 3BSQA 2G51A 4K1SA 3O8BA 3UNSA 1RTLA 2O8UA 1WU1A 4X2XA 1QIXB 3BTTE 1W8BH 2DE8A 1QB9A 3VB3A 2OQUA 2FOFA 1SSXA 4MG3A 1DY9A 4WY3A 3T28A 1DLEA 4CRGA 1YCPK 5C1UA 3KF2A 1IQGA 2GV7A 2TGDA 3RC6A 1HCGA 2PV9B 9LPRA 5DK1A 1P2NA 2Y81A 2R0KA 2D26C 3BG4B 3E8LA 2HALA 2OC0A 4K8BA 1RFNA 2SGEE 1S0QA 2ZU5A 4DGJA 2BLOA 4BTUB 1WTHD 5A0CA 3T26A 3LOXA 1D6WA 1ETTH 1O31A 4BANB 4JZ1A 2QXJA 2BHGA 3GYLB 2R3YA 3F1SB 1HV7A 3M7TA 1KXAA 1O5BB 4RKOB 3ZYEA 3ZZDA 4SGAE 2FOMB 4B2BA 5DPAA 1NROH 3NWUA 3MU8A 1HUTH 1C2FA 2RG3A 1TIOA 4QT8C 2TIOA 3A8BA 3SGQE 4JZFH 5JPMH 3HGPA 1KXCA 3FANA 3P95A 2VIPA 2BZAA 1TPOA 1TX8A 4MNVA 1ZTLA 1IQMA 1L1NA 1BOQA 3AVZA 5A8ZA 1RD3B 1C9TA 1A5HA 3SU5A 1WAYB 1UTOA 1G3DA 1DWBH 1GDNA 1NU7B 3UNRA 2H9TH 5F8XA 1TONA 4GUXA 4Y7AA 4GCHG 1P2IA 1J14A 4X0WU 2ZDLA 1A0JA 3KHVA 3SJOA 2TGPZ 3B9FH 3KCGH 3D62A 3PYHA 1GWAA 1IQFA 2FOBA 2V35A 2FMJA 4B75A 3RXAA 2SGAA 3VGCC 4LK4A 2WV4A 5GPIB 1BIOA 3S7KB 5FAHA 4JZIA 1ESAA 5FXLA 2FI4E 3C27B 2PGBB 4K60A 2B5TB 1FY3A 1P2MA 1O3MA 7GCHF 5B6OA 1RTFB 1NPMA 3HATH 2BD9A 3EGKH 3LT3A 4X1SU 3SORA 3SGBE 2ZGXH 1ZJKA 2ZHEH 5C1XA 3RLWH 1OP2A 2C8WB 3F6UH 4ZKOU 2GMTC 1QL8A 3QTOH 4UDWH 4D7FA 1BTPA 2GP9B 1F5RA 2LNCA 1MTNC 1C2GA 1P57B 3A7TA 1Y5AT 5ESTE 2RA0A 4D9QA 4CREA 1GBBA 1AFQB 2RA3A 3RXQA 1SGIB 1K1NA 1ZYOA 5ESBA 3RXMA 3FP6E 2HNTC 1GHYH 3VPKA 4WJG2 2XXLA 2Y5GA 3TGJE 3ATMA 2BD7A 1ARCA 2ZCHP 4YT7H 3A87A 3RXPA 1PYTD 3A7ZA 2BD5A 3SQHE 1IHSH 1QL7A 3URDA 1MU8B 1HAGE 1UHBB 2FOEA 2R0LA 1GBCA 4X8UH 1TNLA 3DHKH 2WPJS 1GHXH 4TWYA 4UFEH 1FQ3A 1F0UA 2G5NA 1VCWA 3M36A 1F5KU 1JRTA 4UFDH 4WMDA 2FLBH 4NA8A 4I8KA 3RXSA 1GBAA 1GHBG 1GI0A 1HBTH 2A45B 1N8OB 1H1BA 4CHAC 2Y7XA 4H6SB 4NFFA 1TGTA 1DX5M 1EJMA 1TGBA 5EW2H 1C5YB 2O8LA 4OS1A 1HJ8A 4DOQA 4BAKB 3ELAH 3M37A 2ZCLP 1QL9A 4YESB 3SUEA 1YPGH 2AGIX 1Z1JA 5PTPA 1AKSB 5C5NA 3RXTA 2P59A 5A0BA 1BITA 1PPCE 4MDSA 1ELCA 1DFPA 5DP9A 2IJOB 3OY5U 3RXJA 3M3SA 3T27A 2CF9H 2BY9X 5FPSA 1S83A 4ZAEA 4INLA 4AB9A 4FU7A 1AFEH 1LHFH 4TPIZ 3IG6B 1AB9B 1GJ5H 1TX7A 1WOFA 2ZC9H 3GDVA 2P3UB 3PLBA 1C1TA 2AGEX 2V3OH 1MD7A 2ZTYA 1AFQC 2OXSA 4GLYA 5JYIA 1A7SA 3PMHB 2AYWA 1PJPA 2BDHA 1Y3VA 4DT7B 4TY7A 1O2LA 1E37B 1V2WT 2Q6FA 3OU0A 2ZGHA 1XKBC 2BB4A 5GDSH 3V12A 4ABEA 3E0NB 1QJ1B 1QQUA 2FOCA 1O2NA 4FUIA 3RXHA 4KGAA 1DUEA 2TPIZ 5I46H 3SN8A 4CH2B 2XTTB 4ISIH 1A3BH 1GPZA 1E0FD 3K9XB 3PMJA 3MH5A 1G3BA 1TNIA 3RXVA 2VWMA 1P01A 1JMOH 2STAE 5AFZH 2XW9A 1YGCH 1O36A 3P8NA 1HRTH 1GI3A 1J15A 1CHOF 3L3TA 4NSYA 4KELA 2W26A 3SU1A 1QRZA 2PLXA 3BG8A 1XXFA 1NZQH 1CSOE 3GICB 1OOKB 2W3KA 2UWOA 1FAXA 3OX7U 2WPKS 1SBWA 2BLQA 1G9IE 4U32A 1GBJA 4NA7A 2LPRA 1A2CH 1P11E 5DP7A 2ZF0H 2G81E 1P9SA 2A4QA 1CE5A 1WV7H 1UCYK 3Q3KA 3QZRA 5HYOA 1GHVH 1THPB 2VIDA 4UONA 2AIPA 3M61U 1EXFA 1GI8B 4IN1A 4GVUA 2BM2A 4BTIB 1O3FA 3LC5A 1GDQA 1SHYA 2B7DH 1PQ5A 1V2ST 1YBWA 2XC5A 4ISNA 3KIDU 2TRMA 1O2YA 2PSYA 2Z9IA 3P8GA 4K2YA 1LHEH 1O34A 2OC7A 4Y71A 3SU0A 1BB0B 2Z7FE 4ZXYH 3PB1E 2J4IA 1NC6A 1SGEE 1OYTH 2FX4A 1N6XA 1Q3XA 2XCNA 1JXPA 1AE8H 3OSYA 3KGPA 2CN0H 5FX5A 2XBYA
chains in the Genus database with same CATH superfamily
6CHAC 2G4TA 1V2QT 5A8YA 1QR3E 1ZTJA 2AERH 5EODA 2ZPRA 1ZGIA 3SQEE 1HJAC 1BBRE 1BJVA 5TJXA 1MTSA 2ZA5A 3PMAB 3M5NA 1GJDB 1MUEB 1YKTA 3P70B 5C5OA 1C5MD 2NU2E 4NZQA 1LVYA 1OWJA 4Z0KA 3U98H 1A4WH 2FXRA 3E16B 1Z6JH 4NG9H 1B5GH 1BHXB 3SUGA 5LPFA 1TGCA 3PWBA 3UTUH 2BDYA 3UY9A 1FJSA 4I86A 1O2UA 3RU4D 1DE7H 3E91A 4FUFA 3VEQB 2G55A 3RLYH 1NS3A 2EA3A 4I32A 4FU8A 2G4UA 1EQ9A 1A3EH 3BTWE 7KMEH 1EOJA 1DWDH 1CA8B 3TIUA 2QA9E 2GGVB 1AGJA 5IK2D 3RXRA 4LZ4B 4YOJA 2NU3E 1CHOG 5DP3A 2RFKC 4VGCC 1P3CA 1S81A 3RP2A 1IQHA 1KDQA 5I25A 1WTGH 2KAIB 4YOIA 1NRNH 2L6OA 1V2VT 4H4FA 4OS5A 3RM0H 5HIYA 2FDAA 1SVPA 4YT6H 1EKBB 1EP5A 5K7RA 2O8WA 1SMFE 1W0JD 5B6LA 2A1DB 1TRYA 2YMSB 1DLKB 1COWD 4VGCB 2B9LA 2JIZD 1CO7E 5BRRE 1JRSA 1TWXB 4RT0A 1H4WA 4ZHLU 1NFWA 3U8OH 3ZVAA 4Z1MD 2A4RA 4ZH8A 1NU9A 2ZFTA 1G36A 2QCYA 3BEFB 3SGAE 1QFKH 3LGTA 3EA7A 3JZ1B 1ZMLA 1QB6A 3SO3A 1EJAA 2C8ZB 4I8GA 3LJJA 4MNWA 4AYVB 4B71A 3UWJH 3CENA 2YOLA 5AVDA 3SHCH 1MH0A 1ZHPA 1VJAU 1CT0E 2Z6BD 1HAPH 1IOEA 1XM1A 3QGJA 2RDEA 3NZIA 2V6NA 1GMCF 2ZU2A 2PUXB 1E36B 1MBMA 3A8AA 4KP0A 1S6LA 1ANEA 4F4OC 3QGNB 1LQDB 5FPTA 7GCHG 1V6DA 1B7XB 1UTMA 1O3JA 1UCYE 4R8TB 3LONA 1C2HA 3D49H 1VJ9U 1GG6C 1FZZA 4GHQA 4D76A 1GJ9B 1HAVB 3MNXA 4Q63A 2P95A 4M9FA 3UOPA 2JH0D 4INHA 3EE0B 4ASHA 3N7DA 1AZZA 4A1XA 1AVXA 5J4SA 2GX4A 3RXGA 1ANCA 1C1QA 1K0HA 1GMCG 1TNHA 5A8XA 1O38A 1YC0A 1O2ZA 4LOYH 1AB9C 4NIVA 3STJA 1K1LA 1EAWA 1HXEH 1K1MA 2W3IA 1O3PB 3TU7H 3A83A 3ZZ4A 4JMYA 1TNKA 2ZZUH 1IQIA 1S0RA 2ZIQH 3DFLA 3STIA 4JYUH 2KM0A 1C5OH 2GCTB 1TOMH 3PWCA 4X1NU 4MVNA 1W7GH 3QUMP 2Z3CA 3HKIB 3UIRA 1ZJDA 4Q7ZA 1XMNB 3ODFA 1OSSA 4Y0YE 1BMMH 4TYDA 4IS5A 2K1QA 4ESTE 1Z8RA 1LMWB 4Q7YA 2IOTA 1LDTT 1O32A 2BYAX 1W3CA 1ORFA 5C17A 3PLPA 1LVMA 1MAYA 3ZZ9A 2BY7X 1B0EA 4ZKSU 1GBIA 4B73A 3FVFB 2GDDA 1BJUA 4BAMB 1GI1A 2F9BH 4K1TA 2BOHB 1PFXC 4ZXXH 3NKKA 4FVDA 1XUHA 4E7RG 1ZGVA 4ABDA 2ZFSA 2WUCA 1DY8A 1H8DH 1TA6A 4JYTA 1C1WH 2FEQH 4ZHMU 1OX1A 2KR7A 1XUIA 4TWWA 1KXFA 1Z8GA 1DVAH 3SJ9A 1Z8IB 1O5EH 2KCPA 1IQLA 4BNRA 3TK6A 3SNCA 2J34A 3GY6A 1FPHH 1GVLA 1K1JA 1F0RA 1C5NH 1ESBA 1A46H 3DA9B 3GCOA 3UREA 1LPZB 4MPXA 1GL0E 2Z3EA 2FS9A 2XOKD 2A0QB 1TNJA 3TPIZ 2A2QH 3V7TA 1PQAA 4Y8XA 4MNXA 4RI0A 1O3EA 1PPGE 2A5IA 2BZ6H 5T3HA 1CA0C 1EUFA 1QTFA 3UPEA 1TOCB 5A0AE 1ZTKA 1MTUA 5F03A 1LPKB 2GDEH 4ASUD 1YP9A 8GCHG 4Y7BA 1SOZA 4FETA 3EA8A 2ZECA 4AGKA 2QIQA 1C1UH 1QRXA 4U30A 1SLVB 2HGTH 3PV4A 4I33A 1LQEA 4HI3A 3PV2A 3RXOA 3F0PA 1GL1A 3WWBA 4ISLA 1GJ6A 3TNTA 3H7OA 4UEHH 1HYLA 1HAHH 3A7VA 1OPHB 1FDPA 3SNDA 1W0KD 2P94A 2AFQB 2IJD1 1JOUB 1L2EA 5C1YA 3SU3A 1SGQE 2PWXA 4OS2A 1TYNA 3MNBA 5IDKA 1MTVA 2F9OA 2W5EA 2BVXH 4MTBA 3BTEE 4RKJB 1Z6EA 1A61H 1SLUB 2PUQH 3UUZA 1VCQA 1UK3A 5T6FA 1J8AA 2PKAB 4F49A 5TCCA 2AIQA 3KQEA 5AHGH 4ACBA 1UHBA 3LGWA 1KYNA 1NTPA 2ZDNA 1C4V2 2O9QA 3M3TA 2GZ9A 3OFND 1OS8A 1RXPA 4GAWA 1O5CB 4A5TS 3TH3H 3ZZ6A 3PMBB 3HK6B 2CK3D 2CGAA 2ZHFH 3HK3B 3M7UA 1W10U 1P8VC 1SLWB 2Y6TA 1HAVA 1WBGB 5KEDA 1UJ1A 1AU8A 3QWCH 2ZQ1A 2GT7A 4BXWA 3D65E 2ZO3H 1SQAA 2C8YB 2Z94A 3N7EA 4X2VA 3QLPH 5F6MA 2UUKB 4LXBH 1ZSJA 2OP9A 1NN6A 3SYJA 2WHXA 1BMAA 1OWEA 2R3UA 1QA7A 3TITA 3DFJA 2Q1JA 2Z9LA 4CBNA 4ISOA 1G3EA 2B8OH 1CBWC 1GI5A 2ODYB 2W7UA 1AVGH 3UB0A 1MCVA 1DICA 1SG8B 3F9GA 1GMDG 2JKHA 3SZNA 2FPZA 3BG4C 3LGIA 1GMHG 2Z9GA 3CS7A 1L0ZA 1T7CA 2XWBI 2ZFFH 4XE4A 1GCTC 5LGOA 2A7HA 2FM2A 1OHHD 4X2WA 3DT0H 2GZ7A 1ETRH 2GTBA 1C5ZB 1YF4A 5E0JA 4F48B 2GD4B 2CXVA 4KTSA 3NRLA 5DKMA 1O5DH 3QDZB 1LTOA 4Y10E 4BAOB 1SGRE 1O0DH 1DSTA 1SGFG 3KQDA 2VWNA 5GXPA 4UFGH 1L1JA 1JIRA 1LKBA 1W11U 3T5FH 4INKA 4U01A 2P8OC 4CRDA 1ELDE 2WPLS 5JBCS 2VWLA 1P12E 1C9PA 3UFAA 2XWAA 4NWKA 1YCPM 2ZDVH 1C5QA 2O8TA 5JB8S 2HNTE 3U69H 1ANDA 4ISHH 5DG6A 3ZZ7A 1EAUA 4CR9A 1Y5BT 2FOHA 1THSH 2VIOA 4FUCA 3A88A 1W14U 2ZHWH 1P9UA 1ESTA 3NXPA 2ZQ2A 1FNIA 2UWLA 4Y11E 4F55A 1QHRB 3RMNH 2SGPE 3BIVH 3ZYDA 1XKAC 1SB1H 1W13U 2OD3B 2H9HA 1T31A 5HMAA 1GI2A 3FOAA 4FU9A 4D7GA 1V2PT 1TRNA 8LPRA 1EPTA 3MYWA 1MU6B 5JBTA 3PO1C 1BTUA 3W95A 2H5CA 1ZR0A 4ZKRU 4E06H 3CS0A 1CT4E 5LH8A 2ZEBA 2ESTE 4HTCH 2PKSB 2Z3DA 2SGQE 1OP0A 1PPZA 1T8NA 3FN8A 1NESE 3M3VA 2OCVB 4B2AA 3TLOA 1O2QA 1E79D 1K1IA 3P17H 4FUEA 2BY8X 4ZROA 5CHBA 1TGNA 3UAIC 1BRUP 3HGNA 3UQOA 2PFEA 3MOCA 2ANKH 1C2IA 1GG6B 2ODPA 1O2XA 1JBUH 3OE7D 1AI8H 3V13A 2TBSA 1LO6A 3OTPA 3Q76A 3T25A 1ELEE 5E8EH 4I8JA 1AN1E 5EXLA 2D2DA 1ZHRA 1TLDA 2BD3A 5SGAE 1LCYA 1Y3UA 2ZPSA 3A7WA 2VB0A 3MU1A 2ILNA 1FY5A 1O2WA 5HM2A 3PO1B 2AH4X 1NFXA 3SHAH 2C8XB 3GS9A 3RU4T 4A6LA 1TBRH 2JDID 1BTHH 3ZVFA 4YM9A 1Y3WA 4B2CA 4XDEA 1FIWA 2OINA 3SU2A 2F91A 4FUJA 1DITH 1C5LH 1G2MA 1ELTA 1O2OA 4WH6A 1GCDA 2CV3A 2J97A 1KXBA 3P8FA 2M5TA 4O03A 3OTJE 3BTQE 1X7AC 3KQBA 1NO9H 1BT7A 1ZHMA 2XC4A 1D6RA 3DUXH 5FHTA 2FWWA 2XNDD 1CGHA 1VITG 2VIWA 2VGCC 1IAUA 5ETXA 2CHAB 1EB1H 1FV9A 3AASA 1KTSB 1W0ZU 5FL7D 4X6OA 5T1VA 1L1GA 1KLJH 1HJAB 1S6FA 3RMOH 2ALVA 3BEIB 4Y8ZA 2AMPA 3QTVH 4Z6AH 2H9EH 1HB0B 1T4VH 2A4OA 1BDAA 1O2PA 1OXGA 2FTMA 3MH4A 3S69A 2ZNKH 4OGYA 4ZUHA 3RM2H 3OEHD 1ETSH 4K69A 2ZPQA 5DJ7A 1EATA 1Q31A 2TGTA 4AOQA 1G2LA 4O3UA 1K28D 4XBDA 3RXIA 1BMFD 2K8IA 1GGDC 3M35A 2XC0A 2R9PA 6GCHG 2WPHS 2UUYA 3EA9A 2KFWA 3LC3A 4NZLA 1DOJA 3F9HA 3A80A 1EX3A 3W94A 5E0HA 4B74A 5EJLA 3SU4A 5EQQA 1GDUA 2PTCE 2JJ1D 1E1QD 3IWMA 4R0IA 3URCA 1HJ9A 2L74A 2HNTF 1DWEH 2CJIA 1BMNH 4NFEA 3GYMA 1UMAH 1MKWK 4JCNA 3GY5A 2ULLA 3SJIA 1P03A 3TGIE 5C20A 5E2OA 2HWLB 1BZXE 3RC5A 1NBMD 3U1JB 1FI8A 2FI3E 1C1PA 4ABHA 4YLUA 2WPIS 4FVBA 4BXSA 2FX6A 1YM0A 2HRVA 3QK1A 1WSSH 2ASUB 2V3MA 4YLQH 2WSSD 3KQCA 1GHZA 1C1OA 2Z9JA 1HIAB 2IPHA 2FZZA 1C1RA 1YPHC 1AIXH 1OP8A 4JYVH 3F2HA 1P0SH 1EPTB 1O2HA 2FOGA 1K22H 5EQRA 1Y3XA 1XVOA 4Q4LA 1SHHB 1C2MA 1HGTH 3SV8A 3M5LA 1C4Y2 4ABJA 4CR5A 2STBE 3PROA 4O97A 4GHTA 3MI4A 3RDZA 3A82A 3SNEA 3V3MA 1ZPZA 4IGDA 1ZRBA 2H6MA 1N8OC 2BY6X 1EZXC 2ZHDA 3MU5A 3Q00A 1C5VA 1EP6A 3EYDA 2VJ1A 1VR1H 1VGCC 4OS7A 2F9PA 1GBTA 2PGQB 1SOTA 5T6GA 1HPGA 1TPAE 1DANH 3U1IB 1UVPA 2K0QA 1AVWA 1SGCA 1J17T 3U8RH 1Z8JB 1OKXA 1TX6A 1FPCH 2OC1A 4AFZA 1UTLM 2LP6A 4OS6A 2FTLE 1TQ0B 5F8TA 3RXFA 2Y82A 1O30A 3DSGA 1ZMNA 3ODDA 4D8NA 3I29A 4X1QU 2QAAA 1SR5C 1OWIA 5AFYH 3AW0A 5DP8A 4CH8B 2BQWB 5HKKD 1K2I1 2RCEA 3MFJA 1Z7KA 4FUDA 2OBQA 3GCHB 4K1EA 3RUOA 2ANWA 1P10A 1AWHB 3SI4H 5EGMA 1QBVH 3GCHC 1MKXH 1SQRA 1AQ7A 3ZVBA 2A5KA 4NGAH 1MZAA 2DE9A 1HAOH 4LZ1H 2EC9H 3AAVA 1CBWB 1HXFH 2FIRH 3U9AH 2FO9A 4IC6A 1F5LA 1C1SA 2ZGCA 4YTAA 3MH7A 2F4LA 1ZSKA 1V2MT 1GI9B 3GISB 1F0SA 3KL6A 2CMYA 2NU0E 5EQSA 1GVKB 2V0BA 5C3NA 1C1NA 3ESTA 3MNCA 3JZ2B 3TH4H 5FBIA 3GCTF 5EXMA 1PQ7A 1ID5H 2SNWA 1O5FH 2UWPA 4DJZB 2I6QA 1BRBE 3KN2A 2AEIH 1F2SE 3H7TA 1UVUH 2A31A 2QF3A 3HPTB 2F9NA 1RRKA 3FZDA 2FI5E 1CU1A 1GBLA 3FP7E 3A7YA 2NU1E 2QN5T 1TRMA 2BXUH 1KLTA 3RXCA 2XYAA 3ZZBA 2C90B 4X8VH 1UVSH 2F3CE 2OQ5A 3LIWA 4BAHB 3BTDE 4Y8YA 3BTFE 1BTZA 1RIWC 2CF8H 1EPTC 1Y8TA 2AS9A 2FP7B 3CP7A 1H9HE 1YLDA 1YPMH 3ZZ5A 2HVYB 4Y6DA 5FX6A 1K1OA 2QXHA 4DY7B 3SUDA 5GCHF 2EI6A 1BTXA 4AORA 3FZZA 3VGCB 1TPPA 2BX3A 4NA9H 1ZOMA 1SGTA 3ATWA 4B6FA 1G37A 2WPMS 1IQJA 1KLIH 3V0XA 2F83A 3UOUA 4H42U 4Q2KA 3CNRA 1NRPH 1H8IH 1K1PA 1SLXB 3TJNA 3A81A 4X1PU 1GHAG 1S5SA 1V3XA 1G32B 2WV9A 4ABIA 2BX4A 3S9CA 4SGBE 5DO4H 1NY22 3RXEA 1AZ8A 1C5WB 2YNBA 1A5GH 1UK2A 3EAJA 2BOKA 1PYTC 1ELGA 1N1LA 1MBQA 1NRRH 3NPSA 1GHWH 3SJ8A 1HAXB 4DT4A 5EPNA 1T8OA 2GCTC 5GJ4B 2ZP0H 1ZZZA 4TT3D 2JJ2D 3WY8A 3KNXA 2XBXA 3UR6A 2AMDA 1O3LA 3OYPA 4X1RU 2SGFE 1P2JA 1UK4A 2G00A 4X6MA 4KKDA 2SFAA 1E35B 1GBKA 3PLKA 4IMZA 1KXDA 3T62A 3QO6A 4GSOA 3PTBA 2ZHQH 4RN6A 1LVBA 8GCHF 1ANBA 3RXLA 2ANYA 1BBRH 1O5GH 3VB4A 1KDQB 1GJ7B 1AUTC 2SGDE 1Z71A 4ZMAH 4HG6A 4NCYA 3SV6A 3ZV8A 3TJOA 5E2PA 2BMGB 3S0NA 2GVFA 4WXVA 1FONA 1P2KA 1YPLH 2BLWA 1C5SA 3GY3A 1GBEA 1P3EA 3PTNA 3O8CA 3VB7A 2CHAC 3N7OA 3E90B 4D9RA 1SGFA 3IITA 1CVWH 1TPSA 5A09A 4CBOA 6LPRA 4E05H 1YYY1 2NWNA 1GHBF 1ELFA 2A32A 5EPYA 3RMLH 4AB8A 3ZVGA 1AKSA 4YOGA 1Q2WA 2J95A 1SGYE 2VH6A 1WCZA 2OK5A 3M7QA 1V2KT 1Y5UT 1MD8A 1B0FA 1FX0B 4XFQA 3TJVA 5JBBS 3K6ZA 1S6HA 4ABBA 1AHTH 1EOLA 1XUJA 2J92A 2JETC 1ELAA 1GGDB 1JIMA 4ZHAA 2ZFQH 5DP5A 1O33A 4XRNA 1EAXA 1S82A 2ZKSA 1W0YH 3N99A 1DDJA 4A1TA 2XRCA 1GI7B 1O2IA 2BTCE 1SL3A 4FXGH 1UCYH 1XUGA 5CHAC 1T8MA 4B1TA 1UTPA 4J2YB 2W7SA 4RSPA 1MCTA 3K65B 5G4BA 1EZSC 2QF4A 1FN6A 4RT1A 2P3TB 5T6DA 4I8HA 3MMGA 1WQVH 1E1RD 5DP4A 1HIAA 4NIYA 1DSUA 3A8DA 3GY8A 4Y79A 5L2ZH 1PPEE 4MQAA 7LPRA 2WYJA 2EI7A 6CHAB 5LPEA 5FCRA 3BTKE 1UTNA 1C2LA 3I78A 5JDUB 1VITH 3BTME 1TAWA 2Y7ZA 5DP6A 1DUAA 2KCOA 3D23A 3GY2A 3G01A 3S9AA 1A1RA 1W7XH 2TGAA 2QC2A 5HXFA 1WQSA 3ENSB 1UVTH 2AHME 1TBQH 5JBAS 1BRCE 2WPDD 4K3JA 3R0FA 1VITF 1O3NA 1F0TA 1ZLRA 3LH3A 3MO3A 4AYYB 4WMEA 1K9OE 2AGGX 5HGGA 1O3KA 1YPEH 1RGQA 5EXNA 5FPYA 3BF6H 5DN6D 2ZGBH 9ESTA 1SC8U 1UO6A 2ZDAH 4O9VA 2YMSC 1RS0A 2EI8A 1GI4A 2FODA 2HVXA 1C4U2 3K2UA 1C5XB 3EDXB 4AFSA 1HAIH 2R2MB 1YWUA 1G30B 1Y3YA 3SUFA 1UTQA 4MPUA 4WF8A 5ABWA 2EY4C 1INCA 1O3DA 2BD8A 3LGVA 3SI3H 4TPYA 1FN8A 2G8TA 1QY6A 4AG1A 1WDIA 2GJGA 3QX5H 3PM3A 3VB5A 1ABIH 2GV6A 2P3FH 1GMDF 4CRCA 4P02A 2OLGA 2VIVA 2A5AA 4DCDA 1ELBA 1DS2E 1MTWA 2VU8E 1KXEA 1O2SA 3TK5A 4MPWA 2VNTA 2A4GA 3ZZ8A 1ABJH 1T8LA 2XNIA 1KTTB 3FFGA 3GCTG 2BDAA 3UQVA 1VZQH 1W2KH 2BQ6B 2A7CA 3LGUA 3UWIA 5C2ZA 3T2NA 1IHTH 1O35A 4E7NA 3HKJB 1SGDE 4A1VA 2PR3A 4ABGA 4DG4A 4Q7XA 1OWDA 2ZG0H 2P93A 2VVCA 4MNYA 1O37A 1C2JA 3MH6A 1BUIA 2ZU4A 3TJUA 1UW7A 3KYGA 4DW2U 2ALPA 1D3DB 1YCPH 2EQNA 2ZI2H 3QN7A 1HFDA 1FIZA 2VH0A 1SGPE 1BBRK 1DXWA 1C5TA 1IQNA 1MMJN 2OTVA 3LKWA 3E6PH 5IYTA 2ZFPH 1V2RT 1L4DA 2BXTH 2HLDD 3P8OA 3Q77A 4B76A 1ZMJA 1SKYE 2BDIA 2QXIA 2OC8A 4TY6A 2FESH 3SOSA 4MLFB 1AMHA 1HAYB 2PKSC 3GCNA 3Q3XA 1KMHB 2WZQA 2A7JA 2ZGJA 2BVRH 2XCFA 3VFEA 4YXWD 4Y76A 2G5VA 4ABFA 1XX9A 2JETB 4WH8A 4CRFA 2PHBA 1QCPA 4K5ZA 1L4ZA 1GHAF 2LELA 1H8ED 1FUJA 1RTKA 4AGJA 1C2DA 5EW1H 2ANMH 1D3QB 2Y5HA 1MZDA 4OGXA 2ZU1A 3MU0A 2SNVA 1P02A 1PQ8A 3F9EA 1BTYA 3ATKA 2V7QD 4O3TA 1SPJA 1AE5A 2ZTZA 1RIWB 1TBZH 2C3SA 3MNSA 5F8ZA 3ZV9A 3SW2B 1FLEE 2QGRA 4GPGA 1OWKA 2GKVE 1O2MA 4DIHH 6ESTA 1QA0A 4JZEH 1O2KA 4HFPB 1GVZA 1XXDA 1O3GA 1P04A 1F7ZA 2H1UA 2P8OB 4M7GA 2D1JA 2I6SA 1TNGA 1QJ7B 1SQTA 3F2FA 3E3TA 5L30H 4BOHA 5HM9A 3F9FA 2FLRH 3NK8A 1OYQA 5J4QA 2DUCA 1LHDH 3GY4A 3BEUA 2WYGA 1SGNE 3H09A 3LGYA 4AN7A 4IN2A 1V2UT 4PROA 3RXKA 2QXGA 3TGKE 2C4FH 1FXYA 4XD7D 2VWOA 2Y5FA 5EG4A 2PP6A 2KX4A 3LJOA 5DGJA 5GCHG 1GJCB 1NRSH 3L33A 3RMMH 3RU4E 2JH6D 3ZZ3A 2VVUA 1XVMA 3OY6U 4P00A 2BDCA 3LDXH 5H4IB 1GCTB 1MKWH 3NCLA 1KIGH 2EEKA 4IMQA 4HZHA 4GCHF 2QF0A 1IQEA 8ESTE 2WV5A 3GDSA 1BMLA 1AD8H 1YPKH 2ZTXA 1P2OA 3MU4A 3A7XA 1EASA 2J38A 3R3GB 1TA2A 2V3HH 3B8JA 3BN9A 5GIBA 2GMTB 2BVSH 2HPPH 1W12U 1C5RA 1C2EA 4A92A 1P2QA 1V2TT 1SI5H 2HOBA 5A2MH 1T4UH 1Y59T 1MKXK 1EAIA 3RXDA 1AUJA 5GWZA 1THRH 2ODQA 3FP8E 3A85A 1LKAA 4H6TA 2THFB 2PKAA 1P06A 3M5OA 4X8TH 1ZPCA 3NUMA 4XBCA 1NFYA 2J9NA 1TQ7B 2ZFRH 1CT2E 1LPGB 1NRQH 3B23B 2KAIA 1O2RA 2GT8A 3ZZAA 2QV1A 4IBLH 4ACAA 4WMFA 1DPOA 1UVOA 3UNQA 1S85A 4JK5A 5AF9H 1F92A 3MO6A 3H5CB 5L2YH 1VKYA 2XBWA 2P16A 1SFQB 3FAOA 4UD9H 1MTNB 2Q6GA 3ZVEA 1O3OA 1PPHE 7ESTE 1D3TB 2BLVA 2GCHF 1FY8E 1TMUH 3M5MA 3ZZCA 2H5DA 3TK9A 1DXPA 4Y0ZE 1CGIE 4CHAB 4NIXA 2WUBA 1BHXF 3U28C 2J98B 1V2OT 2VIQA 3A84A 1ACBE 1GBHA 4CRBA 3MHWU 1O2GH 1QQ4A 1CA0B 1MAXA 4I8LA 1BA8B 2VINA 1KY9A 4A7IB 1J9CH 2C93B 1HAZB 5BPEA 1PPBH 1H9LB 1LVOA 4I31A 4K8YA 1YLCA 4Q80A 3TNSA 1V2JT 1EZQA 5LPRA 2BDGA 4WWYA 1SQOA 1GJAB 4I7YH 2B0FA 1HNEE 2FYQA 1NFUA 3E1XB 1TB6H 4JZDH 2F9UA 2HPQH 1TFXA 6GCHF 1BQYA 3OEED 3SNAA 4KTCA 2FS8A 1LHCH 1ZRKA 3O8DA 3L6PA 1O3BA 1O5AB 1C1VH 4OS4A 4XSKU 3U8TH 3S7HB 3MWIU 4UE7H 1VGCB 3P92A 4DIIH 1CHGA 3SNBA 4YO9A 1FY4A 3LPRA 1ZSLA 1MQ6A 1D3PB 1O3HA 4J1YA 4X6NA 3F2GA 1V2LT 1N6YA 4WXIA 3DD2H 1O2JA 1UTJA 1O2TA 2D8WA 1TABE 2FOAA 2F43B 4FUHA 5FBEA 2YMSD 1GMHF 3TVJB 2RDLA 1QJ6B 1GI6A 2BY5X 4IW4E 2ZU3A 3GY7A 3SBKA 1E34B 1CGJE 1K21H 2J2UA 1OWHA 3ZVCA 4CRAA 1O3AA 1S84A 1A0HB 1H9IE 1MQ5A 3RXBA 2UUJB 3E0PB 4NWLA 1GBDA 4AG2A 1XUKA 1D9IA 5E0GA 1O39A 4ZKNU 4BAQB 3SV9A 1JWTA 4U2WA 1TGSZ 1DM4B 1YPJH 1HLTH 3C1KA 4JK6A 1BTWA 1FY1A 1M9UA 3ATIA 4X8SH 2IN2A 1GBFA 3EQ0H 3I77A 4THNH 3BTHE 1C5UA 3GDUA 3BTGE 3S9BA 3RXUA 1AY6H 2R2WU 2VVVA 2J5UA 3WWFA 1GBMA 4MPVA 4XBBA 4X6PA 1NT1A 1GJBB 3LH1A 5CMXH 1A5IA 1EB2A 1C2KA 3T29A 3MO9A 4ABAA 1ELVA 1XUFA 3A8CA 1GJ8B 3VXFH 4FUGA 1QURH 1EZUC 1ARBA 1QBOA 3MTYA 1RJXB 1LHGH 1QB1A 1J16A 2UUFB 5K0HA 2BDBA 2BD2A 1ZPBA 5EOKA 4KTUA 1P09A 1WUNH 2BD4A 4WVPE 2QY0B 3VB6A 1BCUH 1YLNA 4DVAU 2A2XH 1CQQA 1FMGA 3UR9A 3GOVB 1QRWA 4NSVA 2Q6DA 4IC5A 1U6QA 5FCKA 1V2NT 3F68H 2QYIA 3A89A 1IQKA 3K6YA 1G3CA 1DWCH 1E38B 1TE0A 2XBVA 2Y80A 1T32A 2VGCB 3LU9B 1DT2A 1H8HD 1KSNA 1O3CA 2YNAA 1TMTH 1P05A 2ZWLH 1BRAA 2Z9KA 1TALA 4XOJA 1C1MA 8KME2 3AAUA 2FYRA 1AWFH 3SU6A 2ZDKA 4AZ2B 4AFUA 4YZUA 3O8RA 1D4PB 2WINI 4X2YA 1TMBH 3BV9B 3DSOA 3KEEA 2M2AA 4BTTB 3KYFA 1AO5A 1Z1IA 5JB9S 1FAKH 3SV2H 4DURA 3A86A 4UFFH 1WXRA 2AMQA 2O8MA 2GZ8A 3VXEH 2J94A 1GJ4H 4AX9H 5EU8A 1QNJA 4HGCA 2PW8H 1O2VA 1VCPA 2JH5D 1SFIA 1QGFA 1HDTH 2OUAA 4ZCNA 1O3IA 2F9VA 4AFQA 5L6NH 1C5PA 3P6ZB 3SV7A 2OBOA 3ZVDA 5CE1A 1A0LA 2ZDMA 5CHAB 4NIWA 3BIUH 1YPHE 5TCAA 2BQ7B 3ATLA 1UTKA 2GCHG 2ZCKP 3SJKA 2H2ZA 2NU4E 5C67A 3QZQA 3ITIA 3RC4A 2HLCA 2PTNA 1EJNA 1QBNA 3TH2H 3AW1A 4FUBA 2W6JD 2KCAA 1NM6A 3Q3YA 1PPFE 1WYKA 3MQKC 2G52A 2PSXA 3BSQA 2G51A 4K1SA 3O8BA 3UNSA 1RTLA 2O8UA 1WU1A 4X2XA 1QIXB 3BTTE 1W8BH 2DE8A 1QB9A 3VB3A 2OQUA 2FOFA 4AC9A 1SSXA 4MG3A 3F3BA 1DY9A 4WY3A 3T28A 1DLEA 4CRGA 1YCPK 5C1UA 3KF2A 1IQGA 2GV7A 2TGDA 3RC6A 1HCGA 2PV9B 9LPRA 5DK1A 1P2NA 2Y81A 2R0KA 2KCYA 2D26C 3BG4B 3E8LA 2HALA 2OC0A 4K8BA 1RFNA 2SGEE 1S0QA 2ZU5A 4DGJA 2BLOA 4BTUB 1WTHD 5A0CA 3T26A 3LOXA 1D6WA 1ETTH 1O31A 4BANB 4JZ1A 2QXJA 2BHGA 3GYLB 3OAAD 2R3YA 3F1SB 1HV7A 3M7TA 1KXAA 1O5BB 4RKOB 3ZYEA 3ZZDA 4SGAE 2FOMB 4B2BA 5DPAA 1NROH 3NWUA 3KQ5A 3DSPA 3MU8A 1HUTH 1C2FA 2RG3A 1TIOA 4QT8C 2TIOA 3A8BA 3PRDA 3SGQE 4JZFH 5JPMH 3HGPA 1KXCA 3FANA 3P95A 2VIPA 2BZAA 1TPOA 1TX8A 4MNVA 1ZTLA 1IQMA 1L1NA 1BOQA 3AVZA 5A8ZA 1RD3B 1C9TA 1A5HA 3FKSD 3SU5A 1WAYB 1UTOA 1G3DA 1DWBH 3VG8A 1GDNA 1NU7B 3UNRA 2H9TH 5F8XA 1TONA 4GUXA 4Y7AA 4GCHG 1P2IA 1J14A 4X0WU 2ZDLA 1A0JA 3KHVA 3SJOA 2TGPZ 3B9FH 3KCGH 5GNDA 3D62A 3PYHA 1GWAA 1IQFA 2FOBA 2V35A 2FMJA 4B75A 3RXAA 2SGAA 3VGCC 4LK4A 2WV4A 5GPIB 1BIOA 3S7KB 5FAHA 4JZIA 1ESAA 5FXLA 2FI4E 3C27B 2PGBB 4K60A 2B5TB 1FY3A 1P2MA 1O3MA 7GCHF 5B6OA 1RTFB 1NPMA 5F53A 3HATH 2BD9A 3EGKH 3LT3A 4X1SU 3SORA 3SGBE 2ZGXH 1ZJKA 2ZHEH 5C1XA 3RLWH 1OP2A 2C8WB 3F6UH 4ZKOU 2GMTC 1QL8A 3QTOH 4UDWH 3ZIAD 4D7FA 1BTPA 2GP9B 1F5RA 2LNCA 1MTNC 3SZEA 1C2GA 1P57B 3A7TA 5DSFA 1Y5AT 5ESTE 5EJZA 2RA0A 4D9QA 5KECA 4CREA 1GBBA 1AFQB 2RA3A 3RXQA 3DCLA 1SGIB 1K1NA 1ZYOA 5ESBA 3RXMA 3FP6E 2HNTC 1GHYH 3PRBA 3VPKA 4B6EA 4WJG2 2XXLA 2Y5GA 2KZ4A 3TGJE 3ATMA 2BD7A 1ARCA 2ZCHP 4YT7H 3A87A 3RXPA 1PYTD 3A7ZA 2BD5A 3SQHE 1IHSH 1QL7A 3URDA 1MU8B 1HAGE 1UHBB 2FOEA 2R0LA 1GBCA 5C94A 4X8UH 1TNLA 3DHKH 2WPJS 1GHXH 4TWYA 4UFEH 1FQ3A 1F0UA 5C0TA 2G5NA 1VCWA 3M36A 1F5KU 1JRTA 4UFDH 4WMDA 2FLBH 4NA8A 4I8KA 3RXSA 1GBAA 1GHBG 1GI0A 1HBTH 3FO8D 2A45B 1N8OB 1H1BA 4CHAC 2Y7XA 4H6SB 4NFFA 4TSFD 1TGTA 1DX5M 1EJMA 1TGBA 5EW2H 1C5YB 2O8LA 4OS1A 1HJ8A 4DOQA 4BAKB 3WW7A 3ELAH 3M37A 4FOUC 2ZCLP 1QL9A 4YESB 3SUEA 1YPGH 2AGIX 5HIZA 1Z1JA 5EJ1A 5PTPA 2W6ID 1AKSB 5C5NA 3RXTA 2P59A 5A0BA 1BITA 1PPCE 4MDSA 1ELCA 1DFPA 5DP9A 2IJOB 3OY5U 3RXJA 3M3SA 3T27A 2CF9H 2BY9X 5FPSA 1S83A 4ZAEA 4INLA 4AB9A 4FU7A 3AK5A 5CDFE 1AFEH 1LHFH 4TPIZ 3IG6B 1AB9B 1GJ5H 1TX7A 1WOFA 2ZC9H 3GDVA 2P3UB 3PLBA 1C1TA 2AGEX 2V3OH 1MD7A 2ZTYA 1AFQC 1MABB 2OXSA 4GLYA 5JYIA 5EIYA 1A7SA 3PMHB 2IPQX 1QZ8A 5KGOA 2AYWA 1PJPA 2BDHA 1Y3VA 4DT7B 4TY7A 1O2LA 1E37B 1V2WT 2Q6FA 3OU0A 2ZGHA 1XKBC 2BB4A 5GDSH 3V12A 4ABEA 3W1EA 3E0NB 1QJ1B 3PV5A 1QQUA 2FOCA 1O2NA 4FUIA 3RXHA 4KGAA 1DUEA 2TPIZ 5I46H 3SN8A 4CH2B 2QF5A 2XTTB 4ISIH 1A3BH 1GPZA 1E0FD 3K9XB 3PMJA 3MH5A 1G3BA 1TNIA 3RXVA 2VWMA 1P01A 1JMOH 2STAE 5AFZH 2XW9A 1YGCH 1O36A 3P8NA 1HRTH 1GI3A 1J15A 1CHOF 3L3TA 4NSYA 4KELA 2W26A 3SU1A 1QRZA 2PLXA 3BG8A 1XXFA 1NZQH 1CSOE 3GICB 1OOKB 2W3KA 3EE7A 2UWOA 1FAXA 3OX7U 2QE7D 2WPKS 1SBWA 2BLQA 1G9IE 4U32A 1GBJA 4NA7A 2LPRA 1A2CH 1P11E 5DP7A 2ZF0H 2G81E 1P9SA 2A4QA 1CE5A 1WV7H 1UCYK 3Q3KA 3QZRA 5HYOA 1GHVH 1THPB 2J98A 2VIDA 1YY3A 4UONA 2AIPA 3M61U 1EXFA 1GI8B 4IN1A 4GVUA 2BM2A 4BTIB 3F0OA 1O3FA 3LC5A 1GDQA 1SHYA 2B7DH 1PQ5A 1V2ST 1YBWA 2XC5A 2VBCA 3KIDU 4ISNA 2TRMA 1O2YA 2PSYA 2Z9IA 3P8GA 4K2YA 1LHEH 1O34A 2OC7A 4Y71A 3SU0A 4OM9A 5C0UA 1NBME 1BB0B 2Z7FE 4ZXYH 3PB1E 2J4IA 1NC6A 1SGEE 1OYTH 1EFRD 2FX4A 1N6XA 1Q3XA 2XCNA 1JXPA 1AE8H 3OSYA 3KGPA 2CN0H 5FX5A 2XBYA
chains in the Genus database with same CATH topology
6CHAC 2G4TA 1V2QT 5A8YA 1QR3E 1ZTJA 2AERH 5EODA 2ZPRA 1ZGIA 3SQEE 1HJAC 1BBRE 1BJVA 5TJXA 1MTSA 2ZA5A 3PMAB 3M5NA 1GJDB 1MUEB 1YKTA 3P70B 5C5OA 1C5MD 2NU2E 4NZQA 1LVYA 1OWJA 4Z0KA 3U98H 1A4WH 2FXRA 3E16B 1Z6JH 4NG9H 1B5GH 1BHXB 3SUGA 5LPFA 1TGCA 3PWBA 3UTUH 2BDYA 3UY9A 1FJSA 1O2UA 3RU4D 1DE7H 3E91A 4FUFA 3VEQB 2G55A 3RLYH 1NS3A 2EA3A 4I32A 4FU8A 2G4UA 1EQ9A 1A3EH 3BTWE 7KMEH 1EOJA 1DWDH 1CA8B 3TIUA 2QA9E 2GGVB 1AGJA 3RXRA 4LZ4B 4YOJA 2NU3E 1CHOG 5DP3A 4VGCC 1P3CA 1S81A 3RP2A 1IQHA 1KDQA 5I25A 1WTGH 2KAIB 4YOIA 1NRNH 1V2VT 4H4FA 4OS5A 3RM0H 2FDAA 1SVPA 4YT6H 1EKBB 1EP5A 5K7RA 2O8WA 1SMFE 2A1DB 1TRYA 1DLKB 4VGCB 2B9LA 1CO7E 5BRRE 1JRSA 1TWXB 1H4WA 4ZHLU 1NFWA 3U8OH 3ZVAA 2A4RA 4ZH8A 1NU9A 2ZFTA 1G36A 2QCYA 3BEFB 3SGAE 1QFKH 3LGTA 3EA7A 3JZ1B 1ZMLA 1QB6A 3SO3A 1EJAA 2C8ZB 4I8GA 3LJJA 4MNWA 4AYVB 4B71A 3UWJH 3CENA 2YOLA 5AVDA 3SHCH 1MH0A 1ZHPA 1VJAU 1CT0E 2Z6BD 1HAPH 1IOEA 1XM1A 3QGJA 3NZIA 2V6NA 1GMCF 2ZU2A 2PUXB 1E36B 1MBMA 3A8AA 4KP0A 1ANEA 4F4OC 3QGNB 1LQDB 5FPTA 7GCHG 1V6DA 1B7XB 1UTMA 1O3JA 1UCYE 4R8TB 3LONA 1C2HA 3D49H 1VJ9U 1GG6C 1FZZA 4GHQA 4D76A 1GJ9B 1HAVB 3MNXA 2P95A 3UOPA 2JH0D 4INHA 3EE0B 4ASHA 1AZZA 4A1XA 1AVXA 5J4SA 2GX4A 3RXGA 1ANCA 1C1QA 1GMCG 1TNHA 5A8XA 1O38A 1YC0A 1O2ZA 4LOYH 1AB9C 4NIVA 3STJA 1K1LA 1EAWA 1HXEH 1K1MA 2W3IA 1O3PB 3TU7H 3A83A 3ZZ4A 4JMYA 1TNKA 2ZZUH 1IQIA 1S0RA 2ZIQH 3DFLA 3STIA 4JYUH 1C5OH 2GCTB 1TOMH 3PWCA 4X1NU 4MVNA 1W7GH 3QUMP 2Z3CA 3HKIB 3UIRA 1ZJDA 4Q7ZA 1XMNB 3ODFA 1OSSA 4Y0YE 1BMMH 4TYDA 4IS5A 2K1QA 4ESTE 1Z8RA 1LMWB 4Q7YA 2IOTA 1LDTT 1O32A 2BYAX 1W3CA 1ORFA 3PLPA 1LVMA 1MAYA 3ZZ9A 2BY7X 1B0EA 4ZKSU 1GBIA 4B73A 3FVFB 2GDDA 1BJUA 4BAMB 1GI1A 2F9BH 4K1TA 2BOHB 1PFXC 4ZXXH 3NKKA 4FVDA 1XUHA 4E7RG 1ZGVA 4ABDA 2ZFSA 2WUCA 1DY8A 1H8DH 1TA6A 4JYTA 1C1WH 2FEQH 4ZHMU 1OX1A 1XUIA 4TWWA 1KXFA 1Z8GA 1DVAH 3SJ9A 1Z8IB 1O5EH 1IQLA 4BNRA 3TK6A 3SNCA 2J34A 3GY6A 1FPHH 1GVLA 1K1JA 1F0RA 1C5NH 1ESBA 1A46H 3DA9B 3GCOA 3UREA 1LPZB 4MPXA 1GL0E 2Z3EA 2FS9A 2A0QB 1TNJA 3TPIZ 2A2QH 3V7TA 1PQAA 4Y8XA 4MNXA 1O3EA 1PPGE 2A5IA 2BZ6H 5T3HA 1CA0C 1EUFA 1QTFA 3UPEA 1TOCB 5A0AE 1ZTKA 1MTUA 5F03A 1LPKB 2GDEH 1YP9A 8GCHG 4Y7BA 1SOZA 3EA8A 2ZECA 4AGKA 2QIQA 1C1UH 1QRXA 4U30A 1SLVB 2HGTH 3PV4A 4I33A 1LQEA 4HI3A 3RXOA 1GL1A 4ISLA 1GJ6A 3TNTA 3H7OA 4UEHH 1HYLA 1HAHH 3A7VA 1OPHB 1FDPA 3SNDA 2AFQB 2P94A 1JOUB 1L2EA 5C1YA 3SU3A 1SGQE 2PWXA 4OS2A 1TYNA 3MNBA 5IDKA 1MTVA 2F9OA 2W5EA 2BVXH 4MTBA 3BTEE 4RKJB 1Z6EA 1A61H 1SLUB 2PUQH 3UUZA 1VCQA 1UK3A 5T6FA 1J8AA 2PKAB 4F49A 5TCCA 2AIQA 3KQEA 5AHGH 1UHBA 3LGWA 1KYNA 1NTPA 2ZDNA 1C4V2 2O9QA 3M3TA 2GZ9A 1OS8A 1RXPA 4GAWA 1O5CB 4A5TS 3TH3H 3ZZ6A 3PMBB 3HK6B 3HK3B 2CGAA 2ZHFH 3M7UA 1W10U 1P8VC 1SLWB 2Y6TA 1HAVA 1WBGB 1UJ1A 1AU8A 3QWCH 2ZQ1A 2GT7A 4BXWA 3D65E 2ZO3H 1SQAA 2C8YB 2Z94A 4X2VA 3QLPH 5F6MA 2UUKB 4LXBH 1ZSJA 2OP9A 1NN6A 1BMAA 1OWEA 2R3UA 1QA7A 3TITA 3DFJA 2Q1JA 2Z9LA 4CBNA 4ISOA 1G3EA 2B8OH 1CBWC 1GI5A 2ODYB 2W7UA 1AVGH 1MCVA 1DICA 1SG8B 3F9GA 1GMDG 2JKHA 3SZNA 2FPZA 3BG4C 3LGIA 1GMHG 2Z9GA 3CS7A 1L0ZA 1T7CA 2XWBI 2ZFFH 4XE4A 1GCTC 5LGOA 2A7HA 2FM2A 4X2WA 3DT0H 2GZ7A 1ETRH 2GTBA 1C5ZB 1YF4A 5E0JA 2GD4B 2CXVA 4KTSA 5DKMA 1O5DH 3QDZB 1LTOA 4Y10E 4BAOB 1SGRE 1O0DH 1DSTA 1SGFG 3KQDA 2VWNA 5GXPA 4UFGH 1L1JA 1JIRA 1LKBA 1W11U 3T5FH 4INKA 4U01A 2P8OC 4CRDA 1ELDE 2WPLS 5JBCS 2VWLA 1P12E 1C9PA 3UFAA 2XWAA 4NWKA 1YCPM 2ZDVH 1C5QA 2O8TA 5JB8S 2HNTE 3U69H 1ANDA 4ISHH 5DG6A 3ZZ7A 1EAUA 4CR9A 1Y5BT 2FOHA 1THSH 2VIOA 4FUCA 3A88A 1W14U 2ZHWH 1P9UA 1ESTA 3NXPA 2ZQ2A 1FNIA 2UWLA 4Y11E 1QHRB 3RMNH 2SGPE 3BIVH 3ZYDA 1XKAC 1SB1H 1W13U 2OD3B 2H9HA 1T31A 5HMAA 1GI2A 4D7GA 4FU9A 1V2PT 1TRNA 8LPRA 1EPTA 3MYWA 1MU6B 5JBTA 3PO1C 1BTUA 3W95A 2H5CA 1ZR0A 4ZKRU 4E06H 3CS0A 1CT4E 5LH8A 2ZEBA 2ESTE 4HTCH 2PKSB 2Z3DA 2SGQE 1OP0A 1PPZA 1T8NA 1NESE 3M3VA 2OCVB 4B2AA 3TLOA 1O2QA 3P17H 1K1IA 4FUEA 2BY8X 4ZROA 1TGNA 1BRUP 3HGNA 3UQOA 2PFEA 3MOCA 2ANKH 1C2IA 1GG6B 2ODPA 1O2XA 1JBUH 1AI8H 3V13A 2TBSA 1LO6A 3Q76A 3T25A 1ELEE 5E8EH 4I8JA 1AN1E 5EXLA 2D2DA 1ZHRA 1TLDA 2BD3A 5SGAE 1LCYA 1Y3UA 2ZPSA 3A7WA 2VB0A 3MU1A 2ILNA 1FY5A 1O2WA 5HM2A 3PO1B 2AH4X 1NFXA 3SHAH 2C8XB 3RU4T 4A6LA 1TBRH 1BTHH 3ZVFA 4YM9A 1Y3WA 4B2CA 4XDEA 1FIWA 2OINA 3SU2A 2F91A 4FUJA 1DITH 1C5LH 1G2MA 1ELTA 1O2OA 4WH6A 1GCDA 2CV3A 1KXBA 3P8FA 2M5TA 4O03A 3OTJE 3BTQE 1X7AC 3KQBA 1NO9H 1BT7A 1ZHMA 2XC4A 1D6RA 3DUXH 5FHTA 2FWWA 1CGHA 1VITG 2VIWA 2VGCC 1IAUA 5ETXA 2CHAB 1EB1H 1FV9A 3AASA 1KTSB 1W0ZU 4X6OA 1L1GA 1KLJH 1HJAB 1S6FA 3RMOH 2ALVA 3BEIB 4Y8ZA 2AMPA 3QTVH 4Z6AH 2H9EH 1HB0B 1T4VH 2A4OA 1BDAA 1O2PA 1OXGA 2FTMA 3MH4A 3S69A 2ZNKH 4OGYA 4ZUHA 3RM2H 1ETSH 4K69A 2ZPQA 5DJ7A 1EATA 1Q31A 2TGTA 4AOQA 1G2LA 4O3UA 1K28D 4XBDA 3RXIA 1GGDC 3M35A 2XC0A 2R9PA 6GCHG 2WPHS 2UUYA 3EA9A 3LC3A 4NZLA 1DOJA 3F9HA 3A80A 1EX3A 3W94A 5E0HA 4B74A 3SU4A 5EQQA 1GDUA 2PTCE 3IWMA 4R0IA 3URCA 1HJ9A 2HNTF 1DWEH 2CJIA 1BMNH 4NFEA 3GYMA 1UMAH 1MKWK 4JCNA 3GY5A 2ULLA 3SJIA 1P03A 3TGIE 5C20A 5E2OA 2HWLB 1BZXE 3RC5A 3U1JB 1FI8A 2FI3E 1C1PA 4ABHA 4YLUA 2WPIS 4FVBA 4BXSA 2FX6A 1YM0A 2HRVA 3QK1A 1WSSH 2ASUB 4YLQH 3KQCA 1GHZA 1C1OA 2Z9JA 1HIAB 2IPHA 2FZZA 1C1RA 1YPHC 1AIXH 1OP8A 4JYVH 1P0SH 1EPTB 1O2HA 2FOGA 1K22H 5EQRA 1Y3XA 1XVOA 1SHHB 1C2MA 1HGTH 3SV8A 3M5LA 1C4Y2 4ABJA 4CR5A 2STBE 3PROA 4O97A 4GHTA 3MI4A 3RDZA 3A82A 3SNEA 3V3MA 1ZPZA 4IGDA 1ZRBA 2H6MA 1N8OC 2BY6X 1EZXC 2ZHDA 3MU5A 3Q00A 1C5VA 1EP6A 3EYDA 2VJ1A 1VR1H 1VGCC 4OS7A 2F9PA 1GBTA 2PGQB 1SOTA 5T6GA 1HPGA 1TPAE 1DANH 3U1IB 1UVPA 1AVWA 1SGCA 1J17T 3U8RH 1Z8JB 1OKXA 1TX6A 1FPCH 2OC1A 4AFZA 1UTLM 4OS6A 2FTLE 1TQ0B 5F8TA 3RXFA 2Y82A 1O30A 1ZMNA 3ODDA 4D8NA 3I29A 4X1QU 2QAAA 1SR5C 1OWIA 5AFYH 3AW0A 5DP8A 4CH8B 2BQWB 1K2I1 2RCEA 3MFJA 1Z7KA 4FUDA 2OBQA 3GCHB 4K1EA 3RUOA 2ANWA 1P10A 1AWHB 3SI4H 5EGMA 1QBVH 3GCHC 1MKXH 1AQ7A 3ZVBA 2A5KA 4NGAH 1MZAA 2DE9A 1HAOH 4LZ1H 2EC9H 3AAVA 1CBWB 1HXFH 2FIRH 3U9AH 2FO9A 4IC6A 1F5LA 1C1SA 2ZGCA 4YTAA 3MH7A 1ZSKA 1V2MT 1GI9B 3GISB 1F0SA 3KL6A 2CMYA 2NU0E 5EQSA 1GVKB 2V0BA 5C3NA 1C1NA 3ESTA 3MNCA 3JZ2B 3TH4H 5FBIA 3GCTF 5EXMA 1PQ7A 1ID5H 2SNWA 1O5FH 2UWPA 4DJZB 2I6QA 1BRBE 3KN2A 2AEIH 1F2SE 3H7TA 1UVUH 2A31A 2QF3A 3HPTB 2F9NA 1RRKA 3FZDA 2FI5E 1CU1A 1GBLA 3FP7E 3A7YA 2NU1E 2QN5T 1TRMA 2BXUH 1KLTA 3RXCA 2XYAA 3ZZBA 2C90B 4X8VH 1UVSH 2F3CE 2OQ5A 3LIWA 4BAHB 3BTDE 4Y8YA 3BTFE 1BTZA 1RIWC 2CF8H 1EPTC 1Y8TA 2AS9A 2FP7B 3CP7A 1H9HE 1YLDA 1YPMH 3ZZ5A 4Y6DA 5FX6A 1K1OA 2QXHA 4DY7B 3SUDA 5GCHF 2EI6A 1BTXA 4AORA 3FZZA 3VGCB 1TPPA 2BX3A 4NA9H 1ZOMA 1SGTA 3ATWA 1G37A 2WPMS 1IQJA 1KLIH 3V0XA 2F83A 3UOUA 4H42U 4Q2KA 1NRPH 1H8IH 1K1PA 1SLXB 3TJNA 3A81A 4X1PU 1GHAG 1S5SA 1V3XA 1G32B 4ABIA 2BX4A 3S9CA 4SGBE 5DO4H 1NY22 3RXEA 1AZ8A 1C5WB 2YNBA 1A5GH 1UK2A 3EAJA 2BOKA 1PYTC 1ELGA 1N1LA 1MBQA 1NRRH 3NPSA 1GHWH 3SJ8A 1HAXB 5EPNA 1T8OA 2GCTC 5GJ4B 2ZP0H 1ZZZA 3WY8A 3KNXA 2XBXA 3UR6A 2AMDA 1O3LA 3OYPA 4X1RU 1P2JA 1UK4A 2G00A 2SGFE 4X6MA 4KKDA 2SFAA 1E35B 1GBKA 3PLKA 4IMZA 1KXDA 3T62A 3QO6A 4GSOA 3PTBA 2ZHQH 4RN6A 1LVBA 8GCHF 1ANBA 3RXLA 2ANYA 1BBRH 1O5GH 3VB4A 1KDQB 1GJ7B 1AUTC 2SGDE 1Z71A 4ZMAH 4NCYA 3SV6A 3ZV8A 3TJOA 5E2PA 2BMGB 3S0NA 2GVFA 4WXVA 1FONA 1P2KA 1YPLH 2BLWA 1C5SA 3GY3A 1GBEA 1P3EA 3PTNA 3O8CA 3VB7A 2CHAC 3N7OA 3E90B 4D9RA 1SGFA 3IITA 1CVWH 1TPSA 5A09A 4CBOA 6LPRA 4E05H 1YYY1 2NWNA 1GHBF 1ELFA 2A32A 5EPYA 3RMLH 4AB8A 3ZVGA 1AKSA 4YOGA 1Q2WA 2J95A 1SGYE 2VH6A 1WCZA 3M7QA 1V2KT 1Y5UT 1MD8A 1B0FA 4XFQA 3TJVA 5JBBS 3K6ZA 1S6HA 4ABBA 1AHTH 1EOLA 1XUJA 2J92A 2JETC 1ELAA 1GGDB 1JIMA 4ZHAA 2ZFQH 5DP5A 1O33A 1EAXA 1S82A 2ZKSA 1W0YH 1DDJA 4A1TA 2XRCA 1GI7B 1O2IA 2BTCE 1SL3A 4FXGH 1UCYH 1XUGA 5CHAC 1T8MA 4B1TA 1UTPA 4J2YB 2W7SA 4RSPA 1MCTA 3K65B 5G4BA 1EZSC 1FN6A 2P3TB 5T6DA 4I8HA 3MMGA 1WQVH 5DP4A 1HIAA 4NIYA 1DSUA 3A8DA 3GY8A 4Y79A 5L2ZH 1PPEE 4MQAA 7LPRA 2WYJA 2EI7A 6CHAB 5LPEA 5FCRA 3BTKE 1UTNA 1C2LA 3I78A 5JDUB 1VITH