4MNYA

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk903
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator chain B
publication title Peptide ligands stabilized by small molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnyA01
1JRTA 1L2EA 1BT7A 1TA6A 1T8NA 1YKTA 1W11U 3PMHB 1O31A 2XBWA 4TWWA 5A0AE 2D1JA 2ZCKP 1SHYA 4B74A 4TWYA 2OUAA 5E0JA 1WYKA 1GJ4H 2QV1A 2A4OA 2OQ5A 3MHWU 1TGBA 1TMUH 1L1NA 3BEIB 1DXPA 1M9UA 4X8VH 5FCKA 2AERH 2AMQA 1SMFE 4K8YA 1V2TT 5FXLA 1LPGB 1LHEH 5DP8A 4IC5A 1AUJA 1EB2A 1TRNA 1A3EH 6GCHG 5A0BA 2DE9A 1W7GH 1PPFE 3MTYA 4I8JA 1K28D 1PPEE 5DP6A 1AWFH 1E0FD 4GHTA 1QL7A 3SV6A 2NU4E 4XSKU 3BG4B 2BY8X 5C5NA 4DOQA 2ZHQH 5ABWA 1HPGA 5AHGH 4AFSA 1MQ5A 4Y11E 3I29A 3SU2A 3AASA 2ULLA 1O5CB 3UY9A 1ZSKA 3FAOA 2ZC9H 3BTME 4HFPB 3SV9A 2ZFRH 1SGIB 2WPKS 3MH4A 5CMXH 1TNHA 3SGQE 3AW1A 3ODFA 1E35B 1FY4A 1DWBH 5GWZA 1AZ8A 4ZXXH 3SI3H 2BOKA 1LHDH 3M3SA 1SGFG 5DP9A 3LH3A 1C4Y2 4MPVA 1FAXA 2GGVB 1CT2E 2ESTE 2F9VA 3S9AA 2Y82A 1NU9A 2ZCHP 2A4QA 2A4GA 2ZGJA 3LJJA 1PFXC 2G00A 1C2EA 3SV2H 1GBBA 4CR5A 2Y5GA 1SFQB 3ZZCA 1E37B 1HFDA 2FM2A 4YTAA 1TOCB 3FVFB 1C2MA 1P2QA 5EG4A 3RXTA 2ZTZA 2A2XH 3RXHA 2H1UA 4I33A 3ZVFA 1HAVB 1FI8A 1C1UH 1NY22 2FS9A 4ZHMU 1FUJA 1ARCA 1TNLA 4GVUA 4YOIA 4Y7BA 2GTBA 1LQEA 2JETC 5JBBS 3QTVH 4DG4A 2BY5X 1TGSZ 5HM9A 4TY7A 3CS7A 1P2JA 1O30A 1J9CH 1OPHB 3LC5A 1HUTH 1FPHH 2ZPQA 4Y7AA 3CP7A 3VB6A 4IC6A 1W14U 3VGCC 1Y8TA 2A7CA 2W3IA 1AFEH 4UFDH 3STIA 4E7NA 4JZFH 3HK3B 1RTLA 1QQUA 4FUDA 5HYOA 1ELTA 1O2OA 3LC3A 3RM0H 4AN7A 3IITA 1TABE 1W13U 4YO9A 1TIOA 2TIOA 1ZYOA 5GPIB 1FQ3A 1MH0A 1GL0E 1RXPA 2BQ7B 2JH0D 1BCUH 2FI3E 2CV3A 4BXSA 4UFFH 3QUMP 2VIQA 3UQVA 2NU1E 3EA8A 2H6MA 1BRAA 2ZEBA 1XXFA 5AVDA 4I31A 3KGPA 3PWCA 1SFIA 1WV7H 1UTPA 2ANWA 2WPIS 3EA9A 1AO5A 1BTWA 2XXLA 1DUAA 3NZIA 2W5EA 1GHWH 1Z8IB 5ESTE 1IQEA 2PSXA 2Z9LA 4A7IB 1YPEH 1SLVB 1QJ1B 1C5ZB 1GBMA 2A31A 1AB9C 2PLXA 2FOMB 3G01A 1LKBA 1DFPA 2B5TB 1O2WA 4ABBA 2VINA 1SHHB 3VB4A 3U8OH 2FI5E 3RM2H 1HIAB 3ZVCA 2WPHS 1IQFA 2ZHFH 1DSTA 3S7HB 1GI0A 1THRH 1AI8H 3A81A 1ZMJA 2OP9A 1ZJDA 1T4VH 3A8BA 1EAWA 1OS8A 3TK5A 2ZHWH 3SNBA 4GCHG 3V12A 2FMJA 5A8XA 2FX4A 1NTPA 2G5VA 2R2MB 1MZAA 1OSSA 1HCGA 4HI3A 3LGWA 2P3UB 5JBCS 2PW8H 2KAIB 1OOKB 1CE5A 3ZZAA 1PQAA 4Y8ZA 5C20A 2GKVE 1TRMA 2C90B 1F7ZA 5C1UA 1HAZB 1GBLA 1HDTH 5FPSA 2O8LA 1O2XA 4H6TA 3M5NA 2BX3A 1G30B 1V2KT 1Z7KA 1ZHMA 1VITG 4A5TS 2ILNA 5EQSA 2VU8E 2FODA 4AX9H 1SBWA 1CBWB 1JRSA 1NFYA 4KP0A 1J15A 1EATA 1MKXH 1CHOF 1Z8GA 1HAPH 1F2SE 2STBE 1LKAA 2R2WU 4Y10E 5DJ7A 4BAMB 2SGAA 1XUKA 1P2IA 1MUEB 1MD8A 1ELVA 4INLA 4BTIB 2OBQA 1O3AA 1CGJE 2D26C 3A8CA 5K7RA 1MBMA 1P01A 1VITH 4AFUA 1GHBF 1A0LA 1C5TA 1W0ZU 4HGCA 3MNXA 1O3PB 1VZQH 3C1KA 2BVRH 3F6UH 5C1XA 3MU8A 4KKDA 2VIDA 1P05A 1DICA 1O2KA 3QWCH 1EX3A 2ANMH 1V2PT 4AZ2B 1EOLA 2C4FH 3A88A 3MU1A 1GDQA 2YOLA 1K1IA 3S9CA 1GVZA 1YPJH 2GCTC 5DO4H 3RXKA 1SGTA 1MKXK 1O2RA 3M7UA 4RKJB 2EA3A 1F5LA 2BDCA 1GBJA 5C1YA 2CMYA 2ZFPH 1LTOA 3QK1A 4FUFA 4ABFA 3PROA 2G52A 2F9BH 1O3EA 4LOYH 1HAYB 2G81E 1TGTA 2ZDVH 3LONA 4INKA 4DVAU 2WPJS 3QDZB 3PMAB 3I77A 1F0RA 3BTQE 4MQAA 1FAKH 1GCTB 1O3IA 1BRCE 3ENSB 3RLWH 2FO9A 2CHAB 1O3JA 2VIOA 1SG8B 2PKAB 1BBRE 4KTUA 2ZFTA 5EODA 1D3QB 4ABAA 1ZTLA 2AGEX 2Z9IA 1H4WA 3BTEE 3KCGH 1W7XH 3RLYH 4MNXA 1KIGH 3TGJE 1RD3B 1FMGA 2G4TA 3A89A 2AS9A 3PO1C 1C5MD 1O2MA 2GT8A 1NRNH 3P17H 4IMZA 5F8TA 1GJCB 3RMNH 1BTPA 3BF6H 1G3BA 3P8OA 4OS4A 4NIVA 3QO6A 2FOBA 3BN9A 4ZUHA 2PTNA 1LHCH 4DCDA 3MFJA 2DUCA 1GBTA 2XTTB 1HJ8A 2Z9JA 1ZMNA 2GDDA 2BZ6H 2BD4A 4B2BA 4K60A 1F5RA 1UHBA 2B9LA 2SGDE 1JXPA 2Z3CA 3M7QA 4B73A 1ELBA 3PMBB 4MPXA 3BSQA 3VB3A 4K1SA 3NK8A 2JETB 5E2PA 1C2LA 1Z8RA 1AE8H 1O2LA 1AVWA 2IJOB 4JCNA 2GV6A 5A8YA 4GLYA 1O3CA 2BQ6B 1EP5A 4FUEA 4ABEA 5DP3A 3GYMA 1GJ9B 4JZIA 3RXQA 3GDVA 1PPZA 4DIIH 2XRCA 6GCHF 3R0FA 4B76A 4ZROA 3K65B 3KEEA 4Q7ZA 3VGCB 1DLEA 2WPLS 1DT2A 2ANYA 1P0SH 5CE1A 2ZU2A 2ZWLH 1BMMH 1TPPA 3C27B 3GDSA 1S82A 2ZQ2A 2NWNA 1A2CH 2LNCA 3UR9A 1EPTA 1O2YA 1UTLM 3GCNA 3A82A 2XC0A 3K9XB 2FOGA 1BA8B 3GY6A 2P59A 1TNJA 3M5MA 1SGEE 3H7OA 3K6YA 3PYHA 2HRVA 2HVXA 1WBGB 3LT3A 1GMHG 4NA8A 1SSXA 1MMJN 3M7TA 5GJ4B 5HMAA 3SUFA 2WYGA 2ZP0H 3SGBE 3UQOA 1S6HA 1OX1A 3M61U 3MH6A 3A87A 2HGTH 2QIQA 3UFAA 2AH4X 1HRTH 5FAHA 2V35A 4U30A 3SNAA 1SGPE 3NXPA 1IQGA 4ABIA 1P2NA 4O9VA 2A4RA 1GJDB 3RXIA 1F0UA 1IHTH 4NIXA 1UVUH 4FUIA 2P94A 1ZSJA 3OYPA 4A1VA 2FESH 1O3GA 1SPJA 1AB9B 1UMAH 1NM6A 2LPRA 3W94A 1V2LT 1D3PB 1XMNB 3ODDA 1C5NH 1GJ5H 1L1JA 3ESTA 2ZFSA 1W12U 2Q1JA 1ZZZA 1GVKB 4D9QA 3ZVGA 1DXWA 1KSNA 3SW2B 1BJVA 2STAE 3ZVBA 5FX5A 1EJMA 3BTDE 3ZZ5A 1K1MA 1Y3VA 2FOFA 3A84A 2QN5T 1GI8B 4BTUB 5F03A 1MBQA 1HJAC 1P10A 1J8AA 3MMGA 2O9QA 3E91A 5HXFA 1A0HB 1P2KA 1AZZA 2B8OH 3SJIA 5LPEA 4MDSA 1DSUA 1NFWA 1IQIA 2FOCA 3L3TA 3PB1E 1F0SA 3D23A 4WXIA 5FPYA 1ZGVA 5FPTA 1P2OA 3SGAE 1B0FA 2WPMS 5LH8A 2QXGA 2F3CE 3T5FH 1BBRH 4X2YA 1YPKH 3TJOA 3U8RH 1SGRE 1V2ST 1CHGA 1MTNC 1V2RT 1C2DA 1LCYA 4MNYA 1SI5H 5T6DA 4BAKB 1P57B 1AMHA 2C3SA 3SJKA 1Z71A 4ISLA 2A32A 1QBOA 1RIWC 5EXNA 3T25A 2TRMA 2Y80A 1XUFA 1ELEE 3RC5A 5A8ZA 4I8HA 1NFUA 4U2WA 2GZ8A 2H9TH 1YC0A 1XKAC 4I8KA 1VJAU 2FOAA 1P2MA 2HLCA 3MWIU 3HATH 4K1TA 3ATIA 2IOTA 1DDJA 1TMTH 2FWWA 3CS0A 5EPYA 3ZYDA 1BBRK 2P8OC 2VB0A 2GCTB 1Y5AT 1VCPA 3RU4E 4XDEA 2BDYA 2BDHA 2OC1A 3RXUA 2BYAX 2YNBA 1LHFH 2OQUA 3NPSA 4GCHF 1C2GA 2BD8A 3URCA 1AU8A 3WY8A 3E6PH 5DP7A 3LGUA 1LHGH 2EEKA 2ODPA 3A8AA 2TPIZ 3QZRA 1C4V2 1P9SA 4RSPA 4MPUA 3S69A 3SUGA 5GXPA 4UFGH 1QURH 1EZUC 1WSSH 2FTMA 1WTGH 2ANKH 1AUTC 1QHRB 1Y3YA 1KXCA 1LVBA 2YNAA 3BTKE 3IWMA 2HOBA 2Y5FA 1VITF 2O8UA 1HAIH 3MI4A 4ABHA 2XNIA 3O8BA 3Q76A 4B71A 2WUBA 2CN0H 4I32A 1TX6A 3PO1B 2UWOA 1C1WH 1CT4E 2FOHA 1UTJA 1KLIH 1YLDA 4CRAA 4CRGA 1GBHA 1YM0A 1SQTA 1KLJH 1TBZH 5J4QA 4E06H 1BHXB 4TPYA 4CH2B 1TBQH 2BDAA 3VB5A 1HAHH 1HXFH 2QA9E 1SGNE 4NZQA 1O2UA 5G4BA 1GBDA 1RGQA 1TFXA 5L6NH 1K1LA 2J34A 2QC2A 5A0CA 1AGJA 3I78A 3ZZ6A 1W3CA 1WUNH 2V3HH 2VNTA 3ATMA 2F9PA 2VJ1A 1DITH 2QXIA 3SORA 3MU5A 5CHAC 1D6RA 3BV9B 3RMOH 1MTVA 1SQOA 1SLUB 1L0ZA 3P8NA 4CRDA 3UOUA 1GHAG 1QNJA 3RXBA 1YPHE 3EA7A 3VXFH 1Z8JB 4THNH 2A1DB 4FUJA 2NU2E 1OWKA 2SGPE 2Z9KA 2BY9X 2FDAA 2GP9B 1ZRKA 2FXRA 3Q3KA 3TLOA 4K3JA 1L1GA 1Q3XA 3TH3H 4ISIH 1EPTC 1S5SA 4IGDA 4ABDA 3RXMA 2AGIX 1N8OC 1D4PB 2CF8H 1K2I1 4OS5A 3ZV8A 4D9RA 3MNBA 3SNDA 1EAUA 2BQWB 1QQ4A 2EI8A 2H2ZA 1ANBA 1TPOA 4IBLH 2H5CA 2H5DA 1Z6JH 1P11E 4NSYA 2XBXA 4XFQA 2B0FA 6ESTA 5BPEA 1HJ9A 3A8DA 2XWAA 1UK4A 1T7CA 1UO6A 4X8SH 2ZFFH 7GCHG 1SGFA 3A7WA 3A7YA 5ESBA 2BB4A 1XX9A 1EKBB 4J1YA 4NWLA 3GY5A 3KN2A 4ABGA 4MTBA 2SGFE 1TGCA 4ISNA 1V6DA 2ZHEH 3SBKA 3RMLH 4FU8A 4H4FA 1HGTH 3GISB 1IQNA 4BAQB 1HYLA 2W26A 1DLKB 1NT1A 1V2JT 2EI6A 1TALA 3N7OA 3O8CA 1AIXH 1DWEH 3UOPA 2J95A 3GCHC 1TMBH 2W7UA 1E36B 2ZECA 3FANA 3ITIA 2ZU5A 1QB6A 3LGIA 1ZTKA 1TX8A 4K5ZA 1H1BA 1TBRH 1ACBE 5FCRA 2FP7B 1XM1A 3LH1A 3KQDA 1KXAA 1SOTA 2CGAA 2FZZA 8GCHF 2BDBA 1O2QA 4WWYA 1P12E 4NIWA 5T3HA 5E0HA 4ASHA 1CA0C 3LGYA 2BVXH 1UTNA 1BITA 1GMDG 1H9LB 1GI1A 4FUCA 1GHXH 1BB0B 1JWTA 1QIXB 5AF9H 4ZKNU 3KNXA 2BDGA 1D6WA 2R9PA 1YLCA 1IQMA 1F5KU 2WUCA 1MTNB 1HXEH 7KMEH 1QJ6B 4E05H 1SC8U 4OGXA 1SVPA 3RXLA 1ESBA 5C5OA 1TA2A 1TQ7B 3LKWA 2D2DA 3ATLA 3Q00A 1O3BA 1O2NA 4A1XA 1GMHF 5DGJA 1T8LA 1PPHE 3PLPA 2PKSB 1O35A 3FZZA 3LOXA 1RIWB 1ZHPA 4IW4E 3ELAH 1C5YB 3GY4A 1HLTH 1O2PA 3B23B 1AVGH 1AVXA 1FDPA 1S83A 4YOGA 2F83A 3TK9A 5DP5A 1TNGA 4AG2A 1P02A 5JB9S 1IQKA 2J2UA 2ZDAH 4KELA 2VIPA 1C5RA 2G5NA 1ORFA 2PUQH 2ZDMA 2ZGHA 1A46H 1INCA 1RS0A 4ZXYH 1C1OA 3RXGA 1UK3A 2XBVA 4NZLA 4O97A 2O8TA 1V3XA 1HNEE 4NFEA 8ESTE 1DWDH 2PGBB 5F8XA 3UNRA 2BD2A 1T8MA 2ALPA 3HKIB 2XW9A 1MCTA 2WINI 4AOQA 1WQSA 2EC9H 4YT7H 2AFQB 3RXRA 3MU4A 2PR3A 2XC5A 5FHTA 1SGQE 4CREA 2TGAA 2QXHA 2PUXB 3V13A 2R0KA 4AYVB 1ARBA 3MO6A 1THPB 3PLBA 4M7GA 1C5VA 1ELCA 1V2OT 5L30H 1AFQC 3U8TH 2FIRH 3T28A 4LZ4B 1C9PA 1TGNA 1ELDE 3TU7H 1Z1JA 1LVMA 1SOZA 5JYIA 5T6FA 1HV7A 1UTOA 5EW2H 1ETRH 3ZZDA 2OLGA 4DW2U 1QA0A 1IQLA 1FN8A 1UJ1A 1YCPM 3PTBA 1JIMA 5I46H 5HGGA 2WYJA 1MD7A 5T6GA 4QT8C 1NZQH 1K1PA 3MNCA 1P09A 2J9NA 5FX6A 4UEHH 4FUHA 5DKMA 1NC6A 4BXWA 1B0EA 1LPZB 2ZKSA 2ZGBH 4UONA 2A0QB 1CT0E 2VVVA 2ZPSA 4Y0ZE 3STJA 1Y3XA 4IN1A 1A5HA 2JH5D 1GBAA 3TJUA 1KXFA 2AIPA 3UPEA 2OXSA 1ZR0A 4XBCA 1RRKA 1GBIA 1O2IA 1UHBB 1C5SA 2Q6GA 1RTKA 4B2CA 2ZU1A 1YYY1 9LPRA 2AMPA 4YZUA 2R3YA 1VCWA 4X2WA 2BD5A 4NA7A 1C5OH 1GBKA 5J4SA 5CHAB 3K6ZA 4JK6A 3GICB 1NRQH 3T62A 2BTCE 3ZVEA 1YPLH 4PROA 3ZZ4A 1UTKA 3UNQA 3U1IB 3A7TA 1S0QA 1L4ZA 3GY8A 2VVUA 1GJBB 3EE0B 3AW0A 1GJ6A 2BLQA 3BTWE 2PTCE 3GYLB 5EQRA 5EGMA 5H4IB 2A5IA 1P9UA 4UDWH 4DGJA 1JOUB 1DOJA 1EPTB 1O5EH 4DJZB 3H7TA 8LPRA 1BTYA 3HKJB 4UFEH 2FLBH 1KXDA 1N8OB 3AAUA 1ETSH 5HM2A 4ZKRU 3M3VA 3A80A 3TPIZ 1Y5UT 1DUEA 5L2ZH 1C1RA 1QTFA 3R3GB 4XBBA 3OU0A 1W2KH 2A45B 1FONA 2FYRA 1ZGIA 4ESTE 4JZDH 4ZKOU 3BG4C 1C2KA 1T31A 1BRUP 1XUJA 2ZO3H 7ESTE 1PQ7A 4NA9H 4X2VA 8GCHG 1C1PA 1ELFA 3VB7A 4NCYA 4A92A 1Y3UA 3ZV9A 2OC7A 1LVOA 5EU8A 4AGJA 1D3DB 2UUKB 1GJAB 4NWKA 4HZHA 1O5AB 3PWBA 1NESE 1T32A 4O3UA 3RXJA 4B1TA 4SGAE 1GWAA 4VGCC 2G8TA 2ZHDA 3FP6E 2BMGB 3B9FH 1J16A 1GL1A 4FUGA 7LPRA 1BQYA 1KXBA 2CXVA 3GCHB 1C1MA 2CF9H 1QRZA 1V2UT 2V0BA 1A5GH 4LZ1H 1DM4B 2Z3DA 2GMTC 2VGCC 4X6PA 5EXMA 1TB6H 1NU7B 3TGIE 5EW1H 1CA0B 1EZSC 1GHAF 2FI4E 4ZHLU 3P70B 4JMYA 4CH8B 1H8IH 1HAGE 4X0WU 1MTWA 4R0IA 4NGAH 3SUEA 1DANH 1AD8H 3RUOA 1DX5M 1YPMH 3RXDA 1S6FA 3VXEH 1MTSA 4A6LA 5DK1A 1ESTA 3UREA 1NRPH 1FN6A 1V2NT 3RU4D 1LO6A 2CJIA 2TGTA 2QXJA 1ZTJA 1A3BH 4H42U 1P03A 2F9OA 1C5WB 2A7JA 3MU0A 1BIOA 2A5KA 2OBOA 3L6PA 1O32A 4TPIZ 1D9IA 1GI9B 2OC8A 1TQ0B 1XUHA 1T8OA 1FY1A 1MQ6A 1V2MT 1BUIA 3TVJB 4OS7A 1C1SA 3K2UA 1OP2A 3OY6U 4Q2KA 2WV4A 5I25A 1GJ7B 1NFXA 2SGEE 3ATWA 4MNWA 2F91A 4YM9A 3F9FA 3MO3A 1EJAA 1QCPA 3BTTE 5TJXA 2SGQE 3MNSA 1Q31A 1PQ8A 1H9HE 1AQ7A 4AFZA 1QJ7B 7GCHF 3UWIA 1NRSH 3KIDU 3SNEA 3EQ0H 1H9IE 1NN6A 4AORA 4CRBA 2ZQ1A 2VWOA 1SL3A 1FNIA 2IN2A 4J2YB 1IQHA 1CGHA 1S0RA 1IHSH 2FPZA 2BD3A 3JZ2B 1MZDA 1OYQA 1ZPCA 1TLDA 2FEQH 1OP0A 2GD4B 1EOJA 2GDEH 1XXDA 1XVMA 3QTOH 1LDTT 4KTCA 3SU3A 1O39A 3QLPH 1AFQB 1Y3WA 2J94A 1FIZA 4WJG2 2ODYB 2UUFB 3QN7A 4Y76A 1P3CA 4X1NU 1O2TA 2ZNKH 3RXCA 1VGCC 2OC0A 4KTSA 3SU4A 2I6SA 1GMDF 1ABJH 4I8GA 2FOEA 1OYTH 2Q6FA 4X8TH 1QY6A 1AE5A 1WOFA 2VWMA 2PGQB 3ZZBA 4F49A 3RC6A 3NCLA 3P95A 1GI4A 4CBNA 4A1TA 4Y6DA 3U9AH 2XCFA 4X1RU 1K9OE 4O03A 4ABJA 2C93B 3E3TA 1X7AC 2RDLA 3Q3YA 1UTQA 1YPHC 2FS8A 1UVSH 2ZDNA 3SOSA 5IDKA 1BTXA 1U6QA 4ISOA 5JDUB 1LPKB 3GCTG 2VWNA 3UR6A 4BTTB 2UWLA 3SU1A 2FTLE 2RCEA 4FUBA 1VJ9U 1O3FA 2QF0A 1TPAE 2O8WA 1EAIA 4D7GA 1XKBC 2NU0E 1P3EA 1S85A 1SGYE 3EYDA 4ISHH 4RN6A 1HBTH 2ZGXH 4Y8XA 3ZZ7A 1VR1H 3SUDA 4GUXA 2C8YB 1F0TA 1OKXA 1BMNH 4TYDA 3RXPA 2P16A 2BD9A 3QGJA 3SN8A 4YOJA 4U01A 2JH6D 1KTTB 1LMWB 2ZFQH 1GBCA 4AFQA 3VFEA 4DT7B 4DURA 1ANDA 1Q2WA 3F68H 1KDQA 1OWJA 2BXTH 1ID5H 1QR3E 3SQHE 2NU3E 1CO7E 1MU6B 1O3LA 2QY0B 2C8ZB 3CENA 2HNTE 4CRCA 1YP9A 2HPQH 5L2YH 3BTHE 1A61H 1DY9A 3F9HA 4YLUA 1TOMH 3DUXH 4JYTA 2OINA 1QRXA 3FP7E 2FYQA 4WF8A 1MAYA 2W7SA 2Y5HA 1O3NA 4NFFA 4TY6A 3SJ8A 3W95A 3UUZA 1PJPA 2BLWA 5K0HA 3SV8A 1WCZA 3KQEA 1IQJA 5DG6A 4D7FA 1NPMA 2ZDLA 2O8MA 1PPCE 4ZH8A 1V2WT 1FY8E 3TNTA 1EP6A 1GHYH 3KQBA 3ZZ8A 1CQQA 3DD2H 1GCTC 1CU1A 2A2QH 2EI7A 3M37A 1UCYE 1B7XB 4UE7H 2W3KA 5EOKA 2CHAC 5TCCA 4Q7YA 3GY2A 3GCOA 3SU5A 4GSOA 3PTNA 4K69A 4X6NA 1E38B 4VGCB 4MLFB 4CR9A 3KHVA 3HGNA 1Z6EA 1J14A 4O3TA 2BM2A 4BNRA 2VIWA 5GIBA 3TITA 2BVSH 3LPRA 1GI6A 3BEUA 1QB1A 3DA9B 1C5XB 1AY6H 2GZ7A 5JBTA 2XYAA 2GMTB 2C8WB 5DP4A 1BJUA 1J17T 1BRBE 2VGCB 2ZDKA 2HPPH 4X1PU 4BAOB 1N1LA 4ZHAA 2QGRA 3Q77A 2WV5A 1O5GH 1C9TA 3TH2H 1TPSA 1G3EA 1H8DH 4CRFA 4D76A 1MKWH 3M35A 2ZCLP 3LIWA 5C2ZA 1FY3A 5B6OA 1ELAA 1G2LA 1KYNA 2Q6DA 5FBEA 1OWHA 1Z1IA 3RXAA 1ANCA 1QA7A 5SGAE 5GCHG 2BY6X 1OWEA 2SFAA 3HK6B 1G3CA 1BMLA 1O34A 6LPRA 1ZSLA 2Z94A 1ZMLA 4FVBA 3D62A 1KXEA 3IG6B 4FVDA 2BHGA 1XUIA 1GBFA 1TAWA 3KQCA 5E8EH 1MTUA 3EGKH 3SQEE 4NG9H 1EQ9A 1GHZA 4AYYB 1BTUA 1HJAB 1GJ8B 1DE7H 2IPHA 3QGNB 4DIHH 1O2HA 4K2YA 3ZVAA 2P3TB 3LGTA 1IAUA 2BDIA 2P3FH 1AN1E 2H9EH 3QX5H 3A85A 4FU7A 1MKWK 1NRRH 2PWXA 1PPGE 1ABIH 1E34B 5LGOA 1HAVA 4BOHA 2G51A 3T27A 2SNVA 3MH7A 4KGAA 3GDUA 3TK6A 1S81A 4AG1A 2BOHB 1OWIA 1O0DH 3D65E 2BY7X 5TCAA 4K8BA 3SU6A 4Y8YA 2R0LA 1WQVH 1BDAA 5DPAA 3LJOA 4UD9H 2ZTYA 1A0JA 2VIVA 1BZXE 4E7RG 3EAJA 4U32A 2ZIQH 1GPZA 1GG6C 2XWBI 2C8XB 4AB9A 4NIYA 1DPOA 1VGCB 4BANB 3T26A 3U69H 1EJNA 2ZG0H 4B75A 3E8LA 1OP8A 1WTHD 1QBNA 1W10U 3M36A 2PSYA 4YT6H 1QRWA 2FX6A 1UVOA 2RA3A 3FP8E 2P8OB 1GDUA 2OCVB 4I8LA 3O8RA 2ASUB 1GMCG 5IYTA 4CHAC 3OTJE 1FV9A 5JPMH 1QGFA 3QZQA 1RFNA 2TBSA 1B5GH 1K1OA 3RXVA 1XVOA 1O2JA 1JBUH 3NUMA 4IMQA 2AGGX 1EAXA 4WVPE 3V3MA 3BIVH 3S0NA 1Y5BT 3FZDA 1C5LH 1A7SA 3F1SB 4B2AA 2BXUH 1PQ5A 1UCYH 2AEIH 1HIAA 1BTHH 1PPBH 2RG3A 3B8JA 4XOJA 2BLVA 1DS2E 1ETTH 3ZYEA 3KF2A 3RP2A 4I7YH 3SJOA 1D3TB 3E0NB 1EXFA 5C3NA 3UTUH 4GPGA 3L33A 3V7TA 2ZU3A 3D49H 2KAIA 1GHVH 1KLTA 3SHCH 1DVAH 2GCHF 1K1JA 1QBVH 3SNCA 1O33A 1ZOMA 4GHQA 1C2JA 1MU8B 4INHA 3S9BA 1O5BB 3VEQB 1SGCA 1C1NA 3SJ9A 3MO9A 1GBEA 3GY7A 3P6ZB 2VVCA 1PYTD 1PYTC 1UCYK 2Y7ZA 3PM3A 2M5TA 5PTPA 3E0PB 3P8GA 6CHAC 1GGDC 4K1EA 4JYVH 4OS1A 3FFGA 4XBDA 3F9GA 1ZLRA 1WU1A 2UUJB 3V0XA 4NSVA 3SV7A 1C2IA 3ZVDA 1HAOH 1SR5C 4LK4A 4YESB 1O37A 2ALVA 2A5AA 1BOQA 1RTFB 4D8NA 2GZ9A 5EXLA 2HALA 1DWCH 4IN2A 1A5IA 2V3OH 4OS2A 3F9EA 3S7KB 1XUGA 1G3DA 1FY5A 3SO3A 3SHAH 5A2MH 3TGKE 1O2ZA 3GCTF 1A4WH 4MG3A 1C2HA 2OD3B 4F4OC 4R8TB 1HAXB 4FU9A 3BIUH 1L4DA 2PV9B 4WH6A 4WMFA 1G9IE 3DT0H 1RJXB 1C5PA 1EUFA 1GCDA 1VCQA 2F9NA 1C5UA 3A7XA 3OY5U 4X8UH 4MVNA 2AYWA 4SGBE 3T29A 1O2GH 2DE8A 1TWXB 2PHBA 3A83A 3JZ1B 3E1XB 3PLKA 2UUYA 5JBAS 1GI2A 1C5QA 1FJSA 2R3UA 2J38A 1K1NA 1WAYB 2BLOA 2PKAA 1LVYA 3BEFB 1ESAA 5AFZH 1HB0B 2ZGCA 1TYNA 2I6QA 2OTVA 1JMOH 4WMEA 1EB1H 4Y0YE 3LU9B 2VWLA 1N6YA 5E0GA 1EASA 2A7HA 2THFB 2Y81A 4LXBH 3MH5A 1BHXF 4JK5A 4RKOB 2BX4A 1T4UH 1NO9H 3E90B 1ZRBA 1KY9A 4JZ1A 3SI4H 2ZZUH 1S84A 2XC4A 5LPRA 3U98H 1THSH 1UVTH 2H9HA 3M3TA 3P92A 3O8DA 5F8ZA 1QL8A 2GVFA 1G37A 2PFEA 1UVPA 2UWPA 2G4UA 1FXYA 1GI7B 5C67A 2P93A 3RDZA 4JZEH 1O2SA 3P8FA 1GI3A 5BRRE 1V2VT 2SNWA 2QYIA 4FXGH 3RXEA 1MAXA 1TX7A 4ZAEA 1V2QT 4JYUH 1SB1H 2JKHA 1A1RA 2GV7A 2BD7A 4WXVA 1ZPZA 3ZZ9A 4OGYA 3AAVA 3PMJA 3T2NA 1GI5A 2FLRH 1YBWA 2Z7FE 1BTZA 1Y59T 4WY3A 3TJVA 4BAHB 3NKKA 1CSOE 2G55A 1QL9A 1N6XA 3AVZA 4MPWA 1OWDA 5GDSH 1DY8A 1W8BH 2ODQA 1GG6B 1P06A 1P8VC 3Q3XA 3BTFE 3ZZ3A 5A09A 4ZKSU 2ZU4A 2ZI2H 1CA8B 1G2MA 1O36A 4WMDA 4DY7B 5FBIA 1QFKH 3RXFA 5EQQA 1FPCH 2HWLB 2QAAA 3BTGE 3RU4T 2K1QA 1ANEA 1CVWH 1CHOG 2Y6TA 1UK2A 1MCVA 3PV4A 3RXOA 1IOEA 1JIRA 3TIUA 1O5FH 3TNSA 1G36A 2QCYA 4X6OA 5GCHF 4CHAB 3TH4H 1OXGA 1F92A 1C2FA 2XBYA 3LGVA 1K21H 1K22H 1AKSB 1TRYA 2GCHG 1SQAA 3H5CB 2TGDA 1GHBG 2AIQA 3GY3A 3RXSA 2VH6A 3BG8A 2XCNA 4OS6A 1O2VA 3RC4A 1TONA 1EZXC 4H6SB 1YF4A 3HPTB 1YPGH 1TE0A 3RMMH 1ZJKA 4Y79A 5LPFA 3GOVB 3UIRA 4HTCH 2QF3A 1P04A 4X6MA 2HNTC 1KTSB 4YLQH 1O3DA 4Y71A 4Z0KA 4Q80A 3ATKA 3LDXH 3M5LA 2GT7A 1LQDB 1FIWA 2J92A 8KME2 2V6NA 1FZZA 2D8WA 1NROH 1SLWB 1EZQA 3DFJA 4Z6AH 3VPKA 3HGPA 2VH0A 2PKSC 2Y7XA 1FLEE 1TNIA 3DFLA 1C1VH 1YCPH 2RA0A 1TNKA 3SU0A 1AKSA 2ZF0H 1G32B 3DHKH 4X1QU 4GAWA 1BMAA 1C4U2 2HNTF 2B7DH 2GX4A 2P95A 1AHTH 1C1QA 3UNSA 2J4IA 1SGDE 3OX7U 1ELGA 4CBOA 1UTMA 1O3KA 2ZA5A 5ETXA 1GDNA 4AB8A 5F6MA 2F9UA 3A7ZA 4Q7XA 1KDQB 2Z9GA 3U1JB 1SLXB 2Z3EA 1O3MA 3UWJH 3A7VA 4WH8A 3M5OA 3MOCA 3SZNA 1GVLA 2Z6BD 1NS3A 2BZAA 1O38A 2AMDA 1YGCH 3NWUA 3MYWA 6CHAB 5EPNA 1GGDB 1ZHRA 3A86A 4IS5A 1AWHB 3URDA 3EDXB 1QB9A 1CBWC 5E2OA 1C1TA 1ZPBA 1W0YH 4X1SU 2ZTXA 3KL6A 5AFYH 5JB8S 2ZPRA 1CGIE 4MNVA 3TJNA 3OSYA 1O3HA 2TGPZ 4XE4A 4AGKA 3E16B 9ESTA 1O3OA 4ZMAH 1GMCF 4X2XA 1YCPK 1O5DH
chains in the Genus database with same CATH superfamily
1JRTA 1L2EA 1BT7A 1TA6A 1S6LA 1T8NA 1YKTA 1W11U 3PMHB 1O31A 2XBWA 4TWWA 5A0AE 2D1JA 2ZCKP 4ACBA 1SHYA 4B74A 4TWYA 2OUAA 5E0JA 1WYKA 1GJ4H 2JDID 2QV1A 2A4OA 2OQ5A 3MHWU 1TGBA 2RDEA 1TMUH 1L1NA 3BEIB 1DXPA 1M9UA 4X8VH 5FCKA 2AERH 2AMQA 1SMFE 4K8YA 1V2TT 5FXLA 1LPGB 1LHEH 5DP8A 4IC5A 1AUJA 1EB2A 1TRNA 1A3EH 6GCHG 5A0BA 2DE9A 1E79D 1W7GH 1PPFE 3MTYA 4I8JA 1K28D 1PPEE 5DP6A 1AWFH 1E0FD 4GHTA 1QL7A 3SV6A 2NU4E 4XSKU 3BG4B 2BY8X 5C5NA 4DOQA 2ZHQH 5ABWA 1HPGA 5AHGH 1FX0B 1MQ5A 4Y11E 4AFSA 3I29A 3SU2A 3AASA 2ULLA 1O5CB 3UY9A 1ZSKA 3FAOA 2ZC9H 3BTME 4HFPB 3SV9A 2ZFRH 1SGIB 2WPKS 3MH4A 5CMXH 1TNHA 3SGQE 5EJZA 3AW1A 3ODFA 1E35B 1FY4A 3FN8A 1DWBH 5GWZA 1AZ8A 4ZXXH 3SI3H 2BOKA 1LHDH 3M3SA 1SGFG 5DP9A 3LH3A 1C4Y2 4MPVA 1FAXA 2GGVB 1CT2E 2ESTE 2F9VA 1K0HA 3S9AA 2Y82A 1NU9A 2ZCHP 2W6ID 2A4QA 2A4GA 2ZGJA 2JIZD 3LJJA 3OAAD 1PFXC 2G00A 1C2EA 3SV2H 1GBBA 4CR5A 2Y5GA 1SFQB 3ZZCA 1E37B 1HFDA 2FM2A 3PRDA 4YTAA 1TOCB 3FVFB 1C2MA 1P2QA 5EG4A 3RXTA 3OFND 2ZTZA 2A2XH 3RXHA 2H1UA 4I33A 3ZVFA 1HAVB 1FI8A 1OHHD 1C1UH 1NY22 2FS9A 4ZHMU 1FUJA 1ARCA 1TNLA 4GVUA 4YOIA 4Y7BA 2GTBA 1LQEA 2JETC 5JBBS 3CNRA 3QTVH 4DG4A 2BY5X 1TGSZ 5HM9A 4TY7A 3PRBA 3CS7A 1P2JA 4Q4LA 1O30A 1J9CH 1OPHB 3LC5A 1HUTH 1FPHH 2ZPQA 4Y7AA 3CP7A 3VB6A 5KEDA 4IC6A 1W14U 3VGCC 1Y8TA 2A7CA 2W3IA 1AFEH 4UFDH 3ZIAD 3STIA 4E7NA 4JZFH 3HK3B 1RTLA 1QQUA 4FUDA 5HYOA 1KMHB 1ELTA 1O2OA 3LC3A 3RM0H 3NRLA 3IITA 1TABE 1W13U 4YO9A 1TIOA 4AN7A 2TIOA 1ZYOA 5GPIB 1FQ3A 1MH0A 1GL0E 1RXPA 2BQ7B 2JH0D 1BCUH 2FI3E 2CV3A 4BXSA 4UFFH 3QUMP 2VIQA 3UQVA 2NU1E 3EA8A 2H6MA 1BRAA 2ZEBA 1XXFA 5AVDA 4I31A 3KGPA 3PWCA 1SFIA 1WV7H 1UTPA 3OEED 2ANWA 2WPIS 3EA9A 1AO5A 1BTWA 2XXLA 1DUAA 3NZIA 2W5EA 1GHWH 1Z8IB 5ESTE 1IQEA 2K8IA 2PSXA 2Z9LA 4A7IB 1YPEH 1SLVB 2WPDD 1QJ1B 4B6FA 1C5ZB 1GBMA 2A31A 1AB9C 2PLXA 2FOMB 3G01A 1LKBA 1DFPA 2B5TB 1O2WA 4ABBA 2VINA 1SHHB 3VB4A 3U8OH 2FI5E 3RM2H 1HIAB 3ZVCA 2WPHS 1IQFA 2ZHFH 1DSTA 3S7HB 1GI0A 1THRH 1AI8H 3A81A 1ZMJA 2OP9A 1ZJDA 1T4VH 3A8BA 2QE7D 1EAWA 5KECA 1OS8A 3TK5A 3SZEA 2ZHWH 3SNBA 4GCHG 3V12A 2FMJA 5A8XA 2FX4A 1NTPA 2G5VA 2R2MB 1MZAA 1OSSA 1HCGA 4HI3A 3LGWA 2P3UB 5JBCS 3UAIC 2PW8H 2KAIB 1OOKB 1CE5A 3ZZAA 2KCPA 1PQAA 4Y8ZA 5C20A 2GKVE 1TRMA 2C90B 1F7ZA 5C1UA 1HAZB 3SYJA 1GBLA 1HDTH 5FPSA 2O8LA 1O2XA 4H6TA 3M5NA 2BX3A 1G30B 1V2KT 4FOUC 1Z7KA 1ZHMA 1VITG 4A5TS 2ILNA 5EQSA 2VU8E 2FODA 4AX9H 1SBWA 1CBWB 1JRSA 1NFYA 4KP0A 1J15A 1EATA 1MKXH 1CHOF 1Z8GA 4Q63A 1F2SE 1HAPH 2STBE 1LKAA 2R2WU 4Y10E 5DJ7A 4BAMB 2SGAA 1XUKA 1P2IA 1MUEB 1MD8A 1ELVA 4INLA 4BTIB 2OBQA 1O3AA 1CGJE 2D26C 3A8CA 5K7RA 1MBMA 1P01A 1VITH 4AFUA 1GHBF 1A0LA 3PV2A 1C5TA 1W0ZU 4HGCA 3MNXA 1O3PB 1VZQH 3C1KA 2BVRH 3F6UH 5C1XA 3MU8A 4KKDA 2VIDA 1P05A 1DICA 2M2AA 1O2KA 5C94A 3QWCH 1EX3A 2ANMH 1V2PT 4AZ2B 1EOLA 2C4FH 3A88A 3MU1A 1GDQA 2YOLA 1K1IA 3S9CA 1GVZA 1YPJH 2GCTC 5DO4H 3RXKA 1SGTA 1MKXK 1O2RA 3F0OA 3M7UA 4RKJB 2EA3A 1F5LA 2BDCA 1GBJA 5C1YA 2CMYA 2ZFPH 1LTOA 3QK1A 4FUFA 4ABFA 3PROA 2G52A 2F9BH 1O3EA 4LOYH 5B6LA 1HAYB 2G81E 1TGTA 2ZDVH 2IJD1 3LONA 4INKA 4DVAU 2WPJS 3QDZB 3PMAB 2IPQX 3I77A 1F0RA 3BTQE 4MQAA 1FAKH 1GCTB 1O3IA 1BRCE 3ENSB 3RLWH 2FO9A 2CHAB 1O3JA 2VIOA 1SG8B 2PKAB 1BBRE 4KTUA 2ZFTA 5EODA 1D3QB 4ABAA 1ZTLA 2AGEX 2Z9IA 1H4WA 3BTEE 3KCGH 1W7XH 3RLYH 4MNXA 1KIGH 3TGJE 2CK3D 1RD3B 1FMGA 2G4TA 3A89A 4ACAA 2AS9A 3PO1C 1C5MD 1O2MA 2GT8A 3U28C 1NRNH 3P17H 4IMZA 5F8TA 1GJCB 3RMNH 1BTPA 3BF6H 1G3BA 3P8OA 4OS4A 4NIVA 3QO6A 2FOBA 3BN9A 4ZUHA 2PTNA 1LHCH 4DCDA 3MFJA 2DUCA 1GBTA 2XTTB 1HJ8A 2Z9JA 1ZMNA 5C17A 2GDDA 2BZ6H 2BD4A 4B2BA 4K60A 1F5RA 1UHBA 2B9LA 2SGDE 1JXPA 2Z3CA 3M7QA 4B73A 1ELBA 3PMBB 4MPXA 3GS9A 3BSQA 3VB3A 4K1SA 3NK8A 2JETB 5E2PA 1C2LA 1Z8RA 1AE8H 1O2LA 1AVWA 2IJOB 4JCNA 2GV6A 5A8YA 4GLYA 1O3CA 2BQ6B 1EP5A 4FUEA 4ABEA 5DP3A 3GYMA 1GJ9B 4JZIA 3RXQA 3GDVA 1PPZA 4DIIH 2XRCA 6GCHF 3R0FA 4B76A 4ZROA 3K65B 3KEEA 4Q7ZA 3VGCB 1DLEA 2WPLS 1DT2A 2ANYA 1P0SH 5CE1A 2ZU2A 2ZWLH 1BMMH 1TPPA 3C27B 3GDSA 1S82A 2ZQ2A 2NWNA 1A2CH 2LNCA 3UR9A 1EPTA 1O2YA 1UTLM 3GCNA 3A82A 2XC0A 3K9XB 2FOGA 1BA8B 3GY6A 2P59A 1TNJA 2L74A 3M5MA 1SGEE 3H7OA 3K6YA 3PYHA 2HRVA 2HVXA 1WBGB 3WWBA 3LT3A 1GMHG 4NA8A 1SSXA 1MMJN 3M7TA 5GJ4B 5HMAA 3SUFA 2WYGA 2ZP0H 3SGBE 3UQOA 1S6HA 1OX1A 3M61U 3MH6A 3AK5A 3A87A 2HGTH 2QIQA 3UFAA 2AH4X 1HRTH 5FAHA 2V35A 4U30A 2J98B 3SNAA 1SGPE 3NXPA 1IQGA 4ABIA 1P2NA 2WZQA 1E1RD 2A4RA 4O9VA 1GJDB 3RXIA 1F0UA 1IHTH 3KYFA 1UVUH 4FUIA 2P94A 4NIXA 1ZSJA 3OYPA 4A1VA 2FESH 1O3GA 1SPJA 1AB9B 1UMAH 1NM6A 2LPRA 3W94A 2WHXA 1V2LT 1D3PB 1XMNB 3ODDA 1C5NH 4OM9A 1GJ5H 1L1JA 1MABB 3ESTA 2ZFSA 1W12U 2Q1JA 1ZZZA 1GVKB 4D9QA 5FL7D 3ZVGA 1DXWA 2GJGA 1KSNA 3SW2B 1BJVA 2STAE 3ZVBA 5FX5A 1EJMA 3BTDE 3ZZ5A 1K1MA 1H8ED 1Y3VA 2FOFA 3A84A 2QN5T 3F0PA 1GI8B 4BTUB 5F03A 1MBQA 1HJAC 1P10A 1J8AA 3MMGA 2O9QA 3E91A 5HXFA 1A0HB 1P2KA 1AZZA 2B8OH 3N99A 3SJIA 5LPEA 4MDSA 1DSUA 1NFWA 1IQIA 2FOCA 3L3TA 3PB1E 1F0SA 3D23A 4WXIA 5FPYA 1ZGVA 5FPTA 1P2OA 3SGAE 1B0FA 2WPMS 5LH8A 2QXGA 4P00A 2F3CE 3T5FH 1BBRH 2EY4C 4X2YA 1YPKH 3TJOA 3U8RH 1SGRE 4XD7D 1V2ST 1CHGA 1MTNC 1V2RT 1C2DA 1LCYA 4MNYA 1NBME 3DSGA 1SI5H 5T6DA 4BAKB 1P57B 1AMHA 2C3SA 3SJKA 1Z71A 4ISLA 2A32A 1QBOA 1RIWC 5EXNA 3T25A 2TRMA 2Y80A 1XUFA 1ELEE 3RC5A 1E1QD 5A8ZA 4I8HA 1NFUA 4U2WA 2GZ8A 2H9TH 1YC0A 1XKAC 4I8KA 1VJAU 2FOAA 2LP6A 1P2MA 2HLCA 3MWIU 3HATH 4K1TA 3ATIA 2IOTA 1DDJA 3F2HA 1TMTH 2FWWA 3CS0A 5EPYA 3ZYDA 1BBRK 2P8OC 2VB0A 2GCTB 1Y5AT 1VCPA 3RU4E 4XDEA 2BDYA 2BDHA 2OC1A 3RXUA 2BYAX 2YNBA 1LHFH 2OQUA 3NPSA 4GCHF 1C2GA 2BD8A 3URCA 1AU8A 3WY8A 3E6PH 5DP7A 3LGUA 1LHGH 2EEKA 2ODPA 3A8AA 2TPIZ 3QZRA 1C4V2 1P9SA 4RSPA 4MPUA 3S69A 3SUGA 5GXPA 4UFGH 1QURH 5HKKD 1EZUC 1WSSH 2FTMA 1WTGH 2ANKH 1AUTC 1QHRB 1Y3YA 1KXCA 1LVBA 2YNAA 3BTKE 3IWMA 2HOBA 2Y5FA 1VITF 2O8UA 1HAIH 3MI4A 4ABHA 2XNIA 3O8BA 3Q76A 4B71A 1UW7A 2WUBA 2CN0H 4I32A 1TX6A 3PO1B 2UWOA 3UB0A 1C1WH 1CT4E 2FOHA 1UTJA 3EE7A 1KLIH 1YLDA 4CRAA 4CRGA 1GBHA 1YM0A 1SQTA 1KLJH 1TBZH 5J4QA 4E06H 1BHXB 4TPYA 4CH2B 4ASUD 1TBQH 2XOKD 2BDAA 3VB5A 1HAHH 1HXFH 2QA9E 1SGNE 4NZQA 1O2UA 5G4BA 1GBDA 1RGQA 1TFXA 5L6NH 1K1LA 2J34A 2QC2A 5A0CA 1AGJA 3I78A 3ZZ6A 1W3CA 1WUNH 2V3HH 4I86A 2VNTA 3ATMA 2F9PA 2VJ1A 1DITH 2QXIA 3SORA 3MU5A 5CHAC 1D6RA 3BV9B 3RMOH 1MTVA 1SQOA 1SLUB 1L0ZA 3P8NA 4CRDA 3UOUA 1GHAG 1QNJA 3RXBA 1YPHE 3EA7A 3VXFH 1Z8JB 4THNH 2JJ2D 2A1DB 4FUJA 2NU2E 1OWKA 2SGPE 2Z9KA 2BY9X 2FDAA 2GP9B 1ZRKA 2FXRA 3Q3KA 3TLOA 4K3JA 1L1GA 1Q3XA 3TH3H 4ISIH 1EPTC 1S5SA 4IGDA 4ABDA 3RXMA 2AGIX 1N8OC 1D4PB 2CF8H 1K2I1 4OS5A 3ZV8A 4D9RA 3MNBA 3SNDA 1EAUA 2BQWB 1QQ4A 1VKYA 2EI8A 2H2ZA 1ANBA 1TPOA 4IBLH 2H5CA 2H5DA 1Z6JH 1P11E 4NSYA 2XBXA 4XFQA 2B0FA 6ESTA 3OTPA 5BPEA 1HJ9A 3A8DA 2XWAA 1UK4A 1T7CA 1UO6A 4X8SH 2ZFFH 7GCHG 1SGFA 3A7WA 3A7YA 5EIYA 1YWUA 2BB4A 5ESBA 1XX9A 1EKBB 4J1YA 4NWLA 2V7QD 2RFKC 3GY5A 3KN2A 4ABGA 4MTBA 2SGFE 1TGCA 4ISNA 1V6DA 2ZHEH 3SBKA 3RMLH 4FU8A 4H4FA 1HGTH 3GISB 1IQNA 1SQRA 4BAQB 1HYLA 2W26A 1DLKB 1NT1A 1V2JT 2EI6A 1TALA 3N7OA 3O8CA 4TT3D 1AIXH 1DWEH 3UOPA 2J95A 3GCHC 1TMBH 2W7UA 1E36B 2ZECA 3FANA 3ITIA 2ZU5A 1QB6A 1YY3A 3LGIA 1ZTKA 1TX8A 4K5ZA 1H1BA 1TBRH 1ACBE 5FCRA 2FP7B 1XM1A 3LH1A 3KQDA 1KXAA 1SOTA 2CGAA 2FZZA 8GCHF 2BDBA 5HIZA 1O2QA 4WWYA 1P12E 4NIWA 5T3HA 5E0HA 4ASHA 1CA0C 3LGYA 2BVXH 1UTNA 1BITA 1GMDG 1H9LB 1GI1A 4FUCA 1GHXH 1BB0B 1JWTA 1QIXB 5AF9H 1QZ8A 4ZKNU 3KNXA 2BDGA 1D6WA 2R9PA 1YLCA 1IQMA 1EFRD 1F5KU 2WUCA 1MTNB 1HXEH 7KMEH 1QJ6B 4E05H 1SC8U 4OGXA 1SVPA 3RXLA 1ESBA 5C5OA 1TA2A 1TQ7B 1W0KD 3LKWA 2D2DA 4FETA 3ATLA 3Q00A 1O3BA 1O2NA 4A1XA 1GMHF 5DGJA 1T8LA 1PPHE 3PLPA 2PKSB 1O35A 3FZZA 4DT4A 3LOXA 1RIWB 1ZHPA 4IW4E 3ELAH 1C5YB 3GY4A 1HLTH 1O2PA 3B23B 1AVGH 1AVXA 1FDPA 1S83A 4YOGA 2F83A 3TK9A 5DP5A 1TNGA 4AG2A 1P02A 5JB9S 1IQKA 2J2UA 2ZDAH 4KELA 2VIPA 3H09A 1C5RA 2G5NA 1ORFA 2PUQH 2ZDMA 2ZGHA 1A46H 1INCA 1RS0A 4ZXYH 1C1OA 3RXGA 1UK3A 2XBVA 4NZLA 4O97A 2O8TA 1V3XA 1HNEE 4NFEA 8ESTE 2OK5A 1DWDH 2PGBB 5F8XA 3KQ5A 3UNRA 2BD2A 1T8MA 2ALPA 3HKIB 2XW9A 1MCTA 2WINI 4AOQA 1WQSA 2EC9H 3W1EA 4YT7H 2AFQB 3RXRA 3MU4A 2PR3A 2XC5A 5FHTA 1SGQE 4CREA 2TGAA 2QXHA 2PUXB 3F2FA 3V13A 2R0KA 4AYVB 1ARBA 3MO6A 1THPB 3PLBA 4M7GA 1C5VA 1ELCA 1V2OT 5L30H 1AFQC 3U8TH 2FIRH 3T28A 4LZ4B 1C9PA 1TGNA 1ELDE 3DCLA 3TU7H 1Z1JA 1LVMA 1SOZA 5JYIA 5T6FA 1HV7A 1UTOA 5EW2H 1ETRH 3ZZDA 2OLGA 4DW2U 1QA0A 1IQLA 1FN8A 1UJ1A 1YCPM 3PTBA 1JIMA 5I46H 5HGGA 2WYJA 1MD7A 5T6GA 4QT8C 1NZQH 1K1PA 3MNCA 1P09A 2J9NA 5FX6A 4UEHH 4FUHA 5DKMA 1NC6A 4HG6A 4BXWA 1B0EA 3FKSD 1LPZB 2ZKSA 2ZGBH 4UONA 2A0QB 1CT0E 2VVVA 2ZPSA 2F4LA 3N7EA 1Y3XA 4Y0ZE 3STJA 4IN1A 1A5HA 2JH5D 1GBAA 2J97A 3TJUA 1KXFA 2AIPA 3UPEA 2OXSA 1ZR0A 4XBCA 4TSFD 1RRKA 1GBIA 1O2IA 1UHBB 1C5SA 2Q6GA 1RTKA 4B2CA 2ZU1A 1YYY1 9LPRA 2AMPA 4YZUA 2R3YA 1VCWA 4X2WA 2BD5A 4NA7A 1C5OH 1GBKA 5HIYA 1COWD 5J4SA 5CHAB 3K6ZA 4JK6A 3GICB 1NRQH 3T62A 2BTCE 3ZVEA 1YPLH 4PROA 3ZZ4A 1UTKA 3UNQA 3U1IB 3A7TA 1S0QA 1L4ZA 3GY8A 2VVUA 2PP6A 1GJBB 3EE0B 3AW0A 1GJ6A 2BLQA 3BTWE 2PTCE 3GYLB 5EQRA 5EGMA 5H4IB 2A5IA 1P9UA 4UDWH 2V3MA 4DGJA 1JOUB 1DOJA 1EPTB 1O5EH 4DJZB 3H7TA 8LPRA 1BTYA 3HKJB 4UFEH 2FLBH 1KXDA 1N8OB 3AAUA 5C0TA 5C0UA 1ETSH 5HM2A 4ZKRU 3M3VA 5DSFA 3A80A 3TPIZ 1Y5UT 1DUEA 5L2ZH 1C1RA 1QTFA 3R3GB 4XBBA 3OU0A 1W2KH 2A45B 3WW7A 1FONA 2FYRA 1ZGIA 4ESTE 4JZDH 4ZKOU 3BG4C 1C2KA 1T31A 1BRUP 1XUJA 2ZO3H 7ESTE 2KM0A 1PQ7A 4NA9H 4X2VA 8GCHG 1C1PA 1ELFA 3VB7A 4NCYA 4A92A 1Y3UA 3ZV9A 2OC7A 1LVOA 5EU8A 4AGJA 1D3DB 2UUKB 1GJAB 4NWKA 4HZHA 1O5AB 3PWBA 1NESE 1T32A 4O3UA 3RXJA 4B1TA 4SGAE 1GWAA 4VGCC 2G8TA 2ZHDA 3FP6E 1NBMD 4AC9A 2BMGB 3B9FH 1J16A 1GL1A 4FUGA 7LPRA 1BQYA 1KXBA 2CXVA 3GCHB 1C1MA 2CF9H 1QRZA 1V2UT 2V0BA 1A5GH 5KGOA 4LZ1H 1DM4B 2Z3DA 3OE7D 2GMTC 2VGCC 4X6PA 5EXMA 1TB6H 1NU7B 3TGIE 3F2GA 5EW1H 1CA0B 1EZSC 1GHAF 2FI4E 4ZHLU 3P70B 4JMYA 4CH8B 1H8IH 1HAGE 4X0WU 1MTWA 4R0IA 4NGAH 3SUEA 1DANH 1AD8H 3RUOA 1DX5M 1YPMH 3RXDA 1S6FA 3VXEH 1MTSA 4A6LA 5DK1A 1ESTA 3UREA 1NRPH 1BMFD 1FN6A 1V2NT 3RU4D 1LO6A 2CJIA 2TGTA 2QXJA 5GNDA 1ZTJA 1A3BH 4H42U 1P03A 2F9OA 1C5WB 2A7JA 3MU0A 1BIOA 2A5KA 2OBOA 3L6PA 1O32A 4TPIZ 3DSOA 1D9IA 1WDIA 1GI9B 2OC8A 1TQ0B 1XUHA 1T8OA 1FY1A 1MQ6A 1V2MT 1BUIA 3TVJB 4OS7A 1C1SA 3K2UA 1OP2A 3OY6U 4Q2KA 2WV4A 5I25A 1GJ7B 3N7DA 1NFXA 2SGEE 3ATWA 4MNWA 2F91A 1WXRA 4YM9A 3F9FA 3MO3A 1EJAA 1QCPA 3BTTE 5TJXA 2SGQE 3MNSA 1Q31A 1PQ8A 1H9HE 1AQ7A 4AFZA 1QJ7B 7GCHF 3UWIA 1NRSH 3KIDU 3SNEA 3EQ0H 1H9IE 2KR7A 1NN6A 4AORA 4CRBA 2ZQ1A 3MQKC 2VWOA 1SL3A 5CDFE 1FNIA 2IN2A 4J2YB 1IQHA 1CGHA 1S0RA 1IHSH 2FPZA 2BD3A 3JZ2B 1MZDA 1OYQA 1ZPCA 1TLDA 2FEQH 1OP0A 2GD4B 1EOJA 2GDEH 1XXDA 1XVMA 3QTOH 1LDTT 4KTCA 3SU3A 3FOAA 1O39A 3QLPH 1AFQB 1Y3WA 2J94A 1FIZA 4WJG2 2ODYB 2UUFB 3QN7A 4Y76A 1P3CA 4X1NU 1O2TA 2ZNKH 3RXCA 1VGCC 2OC0A 4KTSA 2HLDD 4RT0A 3SU4A 2I6SA 1GMDF 1ABJH 4I8GA 2FOEA 1OYTH 2Q6FA 4X8TH 1QY6A 1AE5A 1WOFA 2VWMA 2PGQB 3ZZBA 4F49A 3RC6A 3NCLA 2QF5A 3P95A 1GI4A 4CBNA 4A1TA 4Y6DA 3U9AH 2XCFA 4X1RU 1K9OE 4O03A 4ABJA 2C93B 3E3TA 1X7AC 2RDLA 3Q3YA 1UTQA 1YPHC 2FS8A 1UVSH 2ZDNA 3SOSA 5IDKA 1BTXA 1U6QA 4ISOA 5JDUB 1LPKB 3GCTG 2VWNA 3UR6A 4BTTB 2UWLA 3SU1A 2W6JD 2FTLE 2RCEA 4FUBA 1VJ9U 1O3FA 2QF0A 1TPAE 2O8WA 1EAIA 4D7GA 2WSSD 1XKBC 2NU0E 1P3EA 1S85A 1SGYE 2EQNA 3EYDA 4ISHH 4RN6A 1HBTH 2ZGXH 4Y8XA 3ZZ7A 1VR1H 3SUDA 4GUXA 2C8YB 1F0TA 1OKXA 1BMNH 4TYDA 3RXPA 2P16A 2BD9A 3QGJA 3SN8A 4YOJA 4U01A 2JH6D 1KTTB 3FO8D 1LMWB 2ZFQH 1GBCA 4AFQA 3VFEA 4DT7B 4DURA 1ANDA 1Q2WA 3F68H 1KDQA 1OWJA 2BXTH 1ID5H 1QR3E 3SQHE 2NU3E 2KX4A 2YMSD 1CO7E 1MU6B 1O3LA 2QY0B 2C8ZB 2YMSC 3CENA 2HNTE 4CRCA 1SKYE 1YP9A 2HPQH 5L2YH 3BTHE 1A61H 1DY9A 3F9HA 4YLUA 1TOMH 3DUXH 4JYTA 4XRNA 2OINA 1QRXA 3FP7E 2FYQA 4WF8A 1MAYA 2W7SA 2Y5HA 1O3NA 4NFFA 4TY6A 3SJ8A 3W95A 3UUZA 1PJPA 2BLWA 5K0HA 3SV8A 1WCZA 3KQEA 1IQJA 5DG6A 4D7FA 1NPMA 2ZDLA 2O8MA 1PPCE 4ZH8A 1V2WT 1FY8E 3TNTA 1EP6A 1GHYH 3KQBA 3ZZ8A 1CQQA 3DD2H 1GCTC 1CU1A 2A2QH 2EI7A 2VBCA 3M37A 1UCYE 1B7XB 4UE7H 2W3KA 5EOKA 2CHAC 5TCCA 4Q7YA 3GY2A 3GCOA 3SU5A 4B6EA 4GSOA 2KZ4A 3PTNA 4K69A 4X6NA 1E38B 4VGCB 4MLFB 4CR9A 3KHVA 3HGNA 1Z6EA 1J14A 4O3TA 2BM2A 4BNRA 2VIWA 5GIBA 3TITA 5EJ1A 2BVSH 3LPRA 1GI6A 3BEUA 4RT1A 1QB1A 3DA9B 1C5XB 1AY6H 2GZ7A 5JBTA 2XYAA 2GMTB 2C8WB 5DP4A 2WV9A 1BJUA 1J17T 1BRBE 2VGCB 2ZDKA 2HPPH 4X1PU 4BAOB 1N1LA 4ZHAA 2QGRA 3Q77A 2WV5A 1O5GH 1C9TA 4Z1MD 3TH2H 1TPSA 1G3EA 1H8DH 4CRFA 4D76A 1MKWH 3M35A 2ZCLP 3LIWA 5C2ZA 1FY3A 2KCYA 5B6OA 1ELAA 1G2LA 1KYNA 2Q6DA 5FBEA 1OWHA 1Z1IA 3RXAA 1ANCA 1QA7A 5SGAE 5GCHG 2BY6X 1OWEA 2SFAA 3HK6B 1G3CA 1BMLA 1O34A 6LPRA 1ZSLA 2Z94A 1ZMLA 4FVBA 3D62A 1KXEA 3IG6B 4FVDA 2BHGA 1XUIA 1GBFA 1TAWA 3KQCA 5E8EH 1MTUA 3EGKH 3SQEE 4NG9H 1EQ9A 1GHZA 4AYYB 1BTUA 1HJAB 1GJ8B 1DE7H 2IPHA 3QGNB 4DIHH 1O2HA 4K2YA 3ZVAA 2P3TB 3LGTA 1IAUA 2BDIA 2P3FH 1AN1E 2L6OA 2H9EH 3QX5H 3A85A 4FU7A 1MKWK 1NRRH 2PWXA 1PPGE 1ABIH 1E34B 5LGOA 1HAVA 4BOHA 2G51A 3T27A 2SNVA 3MH7A 4KGAA 3GDUA 3TK6A 5IK2D 1S81A 4AG1A 2BOHB 1OWIA 1O0DH 3D65E 2BY7X 5TCAA 4K8BA 3SU6A 4Y8YA 2R0LA 2XNDD 1WQVH 1BDAA 5DPAA 3LJOA 4UD9H 2ZTYA 1A0JA 2VIVA 1BZXE 4E7RG 3EAJA 4U32A 2ZIQH 1GPZA 1GG6C 5T1VA 2XWBI 2C8XB 4AB9A 4NIYA 1DPOA 1VGCB 4BANB 3T26A 3U69H 1EJNA 2ZG0H 4B75A 3E8LA 1OP8A 1WTHD 1QBNA 1W10U 3M36A 2PSYA 4YT6H 1QRWA 2KFWA 2FX6A 1UVOA 2RA3A 3FP8E 2P8OB 1GDUA 2OCVB 4I8LA 3O8RA 2ASUB 2KCOA 1GMCG 5IYTA 4CHAC 3OTJE 3VG8A 1FV9A 5JPMH 1QGFA 3QZQA 1RFNA 2TBSA 1B5GH 1K1OA 3RXVA 1XVOA 1O2JA 2K0QA 1JBUH 3NUMA 4IMQA 2AGGX 1EAXA 4WVPE 3V3MA 3BIVH 3S0NA 1Y5BT 3FZDA 1C5LH 1A7SA 3F1SB 4B2AA 2BXUH 1PQ5A 1UCYH 2AEIH 1HIAA 1BTHH 1PPBH 2RG3A 3B8JA 4XOJA 2BLVA 1DS2E 3OEHD 1ETTH 3ZYEA 3KF2A 3RP2A 4I7YH 3SJOA 1D3TB 3E0NB 1EXFA 5C3NA 3UTUH 4GPGA 5EJLA 3L33A 3V7TA 2ZU3A 3D49H 2KAIA 1GHVH 1KLTA 3SHCH 1DVAH 2GCHF 1K1JA 1QBVH 3SNCA 1O33A 1ZOMA 4GHQA 1C2JA 1MU8B 4INHA 3S9BA 1O5BB 3VEQB 1SGCA 1C1NA 3SJ9A 3MO9A 1GBEA 3GY7A 3P6ZB 2YMSB 2VVCA 1PYTD 1PYTC 1UCYK 2Y7ZA 3PM3A 2M5TA 5PTPA 2HVYB 3E0PB 3P8GA 6CHAC 1GGDC 4K1EA 2F43B 4JYVH 4OS1A 3FFGA 4XBDA 3F9GA 1ZLRA 1WU1A 2UUJB 3V0XA 4NSVA 3SV7A 1C2IA 4P02A 3ZVDA 1HAOH 1SR5C 4LK4A 4YESB 1O37A 2ALVA 2A5AA 1BOQA 5DN6D 3KYGA 1RTFB 4D8NA 2GZ9A 5EXLA 2HALA 1DWCH 4IN2A 1A5IA 2V3OH 4OS2A 3F9EA 3S7KB 1XUGA 1G3DA 1FY5A 3SO3A 3SHAH 5A2MH 3TGKE 2QF4A 1O2ZA 3GCTF 1A4WH 4MG3A 1C2HA 2OD3B 4F4OC 4R8TB 1HAXB 4FU9A 3BIUH 1H8HD 1L4DA 2PV9B 4WH6A 4WMFA 1G9IE 3DT0H 1RJXB 1C5PA 1EUFA 1GCDA 1VCQA 2F9NA 1C5UA 3A7XA 4ZCNA 3OY5U 4X8UH 4MVNA 2KCAA 2AYWA 4SGBE 3T29A 1O2GH 2DE8A 1TWXB 2PHBA 3A83A 3JZ1B 3E1XB 3PLKA 2UUYA 5JBAS 1GI2A 1C5QA 1FJSA 2R3UA 2J38A 1K1NA 1WAYB 2BLOA 2PKAA 1LVYA 3BEFB 2J5UA 1ESAA 5AFZH 1HB0B 2ZGCA 1TYNA 2I6QA 2OTVA 1JMOH 4WMEA 1EB1H 4Y0YE 3LU9B 2VWLA 1N6YA 5E0GA 1EASA 2A7HA 2THFB 2Y81A 4F55A 4LXBH 3MH5A 1BHXF 4JK5A 4RKOB 2BX4A 1T4UH 1NO9H 3E90B 1ZRBA 1KY9A 4JZ1A 3SI4H 2ZZUH 1S84A 2XC4A 5LPRA 3U98H 1THSH 1UVTH 2H9HA 3M3TA 3P92A 3O8DA 1YLNA 2AHME 5F8ZA 1QL8A 2GVFA 1G37A 2PFEA 1UVPA 2UWPA 2G4UA 1FXYA 1GI7B 5C67A 2P93A 3RDZA 4JZEH 1O2SA 3P8FA 1GI3A 3PV5A 5BRRE 1V2VT 2SNWA 2QYIA 4FXGH 3RXEA 1MAXA 1TX7A 4ZAEA 1V2QT 4JYUH 4M9FA 1SB1H 2JKHA 1A1RA 2GV7A 2BD7A 4WXVA 1ZPZA 3ZZ9A 4OGYA 3AAVA 3PMJA 4RI0A 3T2NA 1GI5A 2FLRH 1YBWA 2Z7FE 1BTZA 1Y59T 4WY3A 3TJVA 4BAHB 3NKKA 1CSOE 2G55A 1QL9A 1N6XA 3AVZA 4MPWA 1OWDA 5GDSH 1DY8A 1W8BH 2ODQA 1GG6B 1P06A 1P8VC 3F3BA 3Q3XA 3BTFE 3ZZ3A 5A09A 4ZKSU 2ZU4A 2ZI2H 1CA8B 1G2MA 1O36A 4WMDA 4DY7B 5FBIA 1QFKH 3RXFA 5EQQA 1FPCH 2HWLB 2QAAA 3BTGE 3WWFA 3RU4T 5CHBA 2K1QA 1ANEA 1CVWH 1CHOG 2Y6TA 1UK2A 1MCVA 3PV4A 3RXOA 1IOEA 1JIRA 3TIUA 1O5FH 3TNSA 1G36A 2QCYA 4X6OA 5GCHF 4CHAB 3TH4H 1OXGA 1F92A 1C2FA 2XBYA 2J98A 3LGVA 1K21H 1K22H 1AKSB 1TRYA 2GCHG 1SQAA 3H5CB 2TGDA 1GHBG 2AIQA 3GY3A 3RXSA 2VH6A 3BG8A 2XCNA 4OS6A 1O2VA 3RC4A 1TONA 1EZXC 4H6SB 1YF4A 3HPTB 1YPGH 1TE0A 3RMMH 1ZJKA 4Y79A 5LPFA 3GOVB 3UIRA 4HTCH 2QF3A 1P04A 2JJ1D 4X6MA 2HNTC 1KTSB 4YLQH 1O3DA 4Y71A 1W0JD 4Z0KA 4Q80A 3ATKA 3LDXH 3M5LA 2LELA 2GT7A 1LQDB 1FIWA 2J92A 8KME2 2V6NA 1FZZA 2D8WA 1NROH 1SLWB 1EZQA 3DFJA 4Z6AH 3VPKA 3HGPA 2VH0A 2PKSC 2Y7XA 1FLEE 1TNIA 3DFLA 1C1VH 4F48B 1YCPH 2RA0A 1TNKA 3SU0A 1AKSA 2ZF0H 1G32B 3DHKH 4X1QU 4GAWA 1BMAA 1C4U2 2HNTF 2B7DH 2GX4A 2P95A 1AHTH 1C1QA 3UNSA 2J4IA 1SGDE 3OX7U 1ELGA 4CBOA 1UTMA 1O3KA 2ZA5A 5ETXA 1GDNA 5F53A 4AB8A 5F6MA 2F9UA 3A7ZA 4Q7XA 4YXWD 1KDQB 2Z9GA 3U1JB 1SLXB 2Z3EA 1O3MA 3UWJH 3A7VA 4WH8A 3M5OA 3MOCA 3SZNA 1GVLA 2Z6BD 1NS3A 2BZAA 1O38A 3DSPA 2AMDA 1YGCH 3NWUA 3MYWA 6CHAB 5EPNA 1GGDB 1ZHRA 3A86A 4IS5A 1AWHB 3URDA 3EDXB 1QB9A 1CBWC 5E2OA 1C1TA 1ZPBA 1W0YH 4X1SU 2ZTXA 3KL6A 5AFYH 5JB8S 2ZPRA 1CGIE 4MNVA 3TJNA 3OSYA 1O3HA 2TGPZ 4XE4A 4AGKA 3E16B 9ESTA 1O3OA 4ZMAH 1GMCF 4X2XA 1YCPK 1O5DH
chains in the Genus database with same CATH topology
1JRTA 1L2EA 1BT7A 1TA6A 1T8NA 1YKTA 1W11U 3PMHB 1O31A 2XBWA 4TWWA 5A0AE 2D1JA 2ZCKP 1SHYA 4B74A 4TWYA 2OUAA 5E0JA 1WYKA 1GJ4H 2QV1A 2A4OA 2OQ5A 3MHWU 1TGBA 1TMUH 1L1NA 3BEIB 1DXPA 1M9UA 4X8VH 5FCKA 2AERH 2AMQA 1SMFE 4K8YA 1V2TT 5FXLA 1LPGB 1LHEH 5DP8A 4IC5A 1AUJA 1EB2A 1TRNA 1A3EH 6GCHG 5A0BA 2DE9A 1W7GH 1PPFE 3MTYA 4I8JA 1K28D 1PPEE 5DP6A 1AWFH 1E0FD 4GHTA 1QL7A 3SV6A 2NU4E 4XSKU 3BG4B 2BY8X 5C5NA 4DOQA 2ZHQH 5ABWA 1HPGA 5AHGH 4AFSA 1MQ5A 4Y11E 3I29A 3SU2A 3AASA 2ULLA 1O5CB 3UY9A 1ZSKA 3FAOA 2ZC9H 3BTME 4HFPB 3SV9A 2ZFRH 1SGIB 2WPKS 3MH4A 5CMXH 1TNHA 3SGQE 3AW1A 3ODFA 1E35B 1FY4A 1DWBH 5GWZA 1AZ8A 4ZXXH 3SI3H 2BOKA 1LHDH 3M3SA 1SGFG 5DP9A 3LH3A 1C4Y2 4MPVA 1FAXA 2GGVB 1CT2E 2ESTE 2F9VA 3S9AA 2Y82A 1NU9A 2ZCHP 2A4QA 2A4GA 2ZGJA 3LJJA 1PFXC 2G00A 1C2EA 3SV2H 1GBBA 4CR5A 2Y5GA 1SFQB 3ZZCA 1E37B 1HFDA 2FM2A 4YTAA 1TOCB 3FVFB 1C2MA 1P2QA 5EG4A 3RXTA 2ZTZA 2A2XH 3RXHA 2H1UA 4I33A 3ZVFA 1HAVB 1FI8A 1C1UH 1NY22 2FS9A 4ZHMU 1FUJA 1ARCA 1TNLA 4GVUA 4YOIA 4Y7BA 2GTBA 1LQEA 2JETC 5JBBS 3QTVH 4DG4A 2BY5X 1TGSZ 5HM9A 4TY7A 3CS7A 1P2JA 1O30A 1J9CH 1OPHB 3LC5A 1HUTH 1FPHH 2ZPQA 4Y7AA 3CP7A 3VB6A 4IC6A 1W14U 3VGCC 1Y8TA 2A7CA 2W3IA 1AFEH 4UFDH 3STIA 4E7NA 4JZFH 3HK3B 1RTLA 1QQUA 4FUDA 5HYOA 1ELTA 1O2OA 3LC3A 3RM0H 4AN7A 3IITA 1TABE 1W13U 4YO9A 1TIOA 2TIOA 1ZYOA 5GPIB 1FQ3A 1MH0A 1GL0E 1RXPA 2BQ7B 2JH0D 1BCUH 2FI3E 2CV3A 4BXSA 4UFFH 3QUMP 2VIQA 3UQVA 2NU1E 3EA8A 2H6MA 1BRAA 2ZEBA 1XXFA 5AVDA 4I31A 3KGPA 3PWCA 1SFIA 1WV7H 1UTPA 2ANWA 2WPIS 3EA9A 1AO5A 1BTWA 2XXLA 1DUAA 3NZIA 2W5EA 1GHWH 1Z8IB 5ESTE 1IQEA 2PSXA 2Z9LA 4A7IB 1YPEH 1SLVB 1QJ1B 1C5ZB 1GBMA 2A31A 1AB9C 2PLXA 2FOMB 3G01A 1LKBA 1DFPA 2B5TB 1O2WA 4ABBA 2VINA 1SHHB 3VB4A 3U8OH 2FI5E 3RM2H 1HIAB 3ZVCA 2WPHS 1IQFA 2ZHFH 1DSTA 3S7HB 1GI0A 1THRH 1AI8H 3A81A 1ZMJA 2OP9A 1ZJDA 1T4VH 3A8BA 1EAWA 1OS8A 3TK5A 2ZHWH 3SNBA 4GCHG 3V12A 2FMJA 5A8XA 2FX4A 1NTPA 2G5VA 2R2MB 1MZAA 1OSSA 1HCGA 4HI3A 3LGWA 2P3UB 5JBCS 2PW8H 2KAIB 1OOKB 1CE5A 3ZZAA 1PQAA 4Y8ZA 5C20A 2GKVE 1TRMA 2C90B 1F7ZA 5C1UA 1HAZB 1GBLA 1HDTH 5FPSA 2O8LA 1O2XA 4H6TA 3M5NA 2BX3A 1G30B 1V2KT 1Z7KA 1ZHMA 1VITG 4A5TS 2ILNA 5EQSA 2VU8E 2FODA 4AX9H 1SBWA 1CBWB 1JRSA 1NFYA 4KP0A 1J15A 1EATA 1MKXH 1CHOF 1Z8GA 1HAPH 1F2SE 2STBE 1LKAA 2R2WU 4Y10E 5DJ7A 4BAMB 2SGAA 1XUKA 1P2IA 1MUEB 1MD8A 1ELVA 4INLA 4BTIB 2OBQA 1O3AA 1CGJE 2D26C 3A8CA 5K7RA 1MBMA 1P01A 1VITH 4AFUA 1GHBF 1A0LA 1C5TA 1W0ZU 4HGCA 3MNXA 1O3PB 1VZQH 3C1KA 2BVRH 3F6UH 5C1XA 3MU8A 4KKDA 2VIDA 1P05A 1DICA 1O2KA 3QWCH 1EX3A 2ANMH 1V2PT 4AZ2B 1EOLA 2C4FH 3A88A 3MU1A 1GDQA 2YOLA 1K1IA 3S9CA 1GVZA 1YPJH 2GCTC 5DO4H 3RXKA 1SGTA 1MKXK 1O2RA 3M7UA 4RKJB 2EA3A 1F5LA 2BDCA 1GBJA 5C1YA 2CMYA 2ZFPH 1LTOA 3QK1A 4FUFA 4ABFA 3PROA 2G52A 2F9BH 1O3EA 4LOYH 1HAYB 2G81E 1TGTA 2ZDVH 3LONA 4INKA 4DVAU 2WPJS 3QDZB 3PMAB 3I77A 1F0RA 3BTQE 4MQAA 1FAKH 1GCTB 1O3IA 1BRCE 3ENSB 3RLWH 2FO9A 2CHAB 1O3JA 2VIOA 1SG8B 2PKAB 1BBRE 4KTUA 2ZFTA 5EODA 1D3QB 4ABAA 1ZTLA 2AGEX 2Z9IA 1H4WA 3BTEE 3KCGH 1W7XH 3RLYH 4MNXA 1KIGH 3TGJE 1RD3B 1FMGA 2G4TA 3A89A 2AS9A 3PO1C 1C5MD 1O2MA 2GT8A 1NRNH 3P17H 4IMZA 5F8TA 1GJCB 3RMNH 1BTPA 3BF6H 1G3BA 3P8OA 4OS4A 4NIVA 3QO6A 2FOBA 3BN9A 4ZUHA 2PTNA 1LHCH 4DCDA 3MFJA 2DUCA 1GBTA 2XTTB 1HJ8A 2Z9JA 1ZMNA 2GDDA 2BZ6H 2BD4A 4B2BA 4K60A 1F5RA 1UHBA 2B9LA 2SGDE 1JXPA 2Z3CA 3M7QA 4B73A 1ELBA 3PMBB 4MPXA 3BSQA 3VB3A 4K1SA 3NK8A 2JETB 5E2PA 1C2LA 1Z8RA 1AE8H 1O2LA 1AVWA 2IJOB 4JCNA 2GV6A 5A8YA 4GLYA 1O3CA 2BQ6B 1EP5A 4FUEA 4ABEA 5DP3A 3GYMA 1GJ9B 4JZIA 3RXQA 3GDVA 1PPZA 4DIIH 2XRCA 6GCHF 3R0FA 4B76A 4ZROA 3K65B 3KEEA 4Q7ZA 3VGCB 1DLEA 2WPLS 1DT2A 2ANYA 1P0SH 5CE1A 2ZU2A 2ZWLH 1BMMH 1TPPA 3C27B 3GDSA 1S82A 2ZQ2A 2NWNA 1A2CH 2LNCA 3UR9A 1EPTA 1O2YA 1UTLM 3GCNA 3A82A 2XC0A 3K9XB 2FOGA 1BA8B 3GY6A 2P59A 1TNJA 3M5MA 1SGEE 3H7OA 3K6YA 3PYHA 2HRVA 2HVXA 1WBGB 3LT3A 1GMHG 4NA8A 1SSXA 1MMJN 3M7TA 5GJ4B 5HMAA 3SUFA 2WYGA 2ZP0H 3SGBE 3UQOA 1S6HA 1OX1A 3M61U 3MH6A 3A87A 2HGTH 2QIQA 3UFAA 2AH4X 1HRTH 5FAHA 2V35A 4U30A 3SNAA 1SGPE 3NXPA 1IQGA 4ABIA 1P2NA 4O9VA 2A4RA 1GJDB 3RXIA 1F0UA 1IHTH 4NIXA 1UVUH 4FUIA 2P94A 1ZSJA 3OYPA 4A1VA 2FESH 1O3GA 1SPJA 1AB9B 1UMAH 1NM6A 2LPRA 3W94A 1V2LT 1D3PB 1XMNB 3ODDA 1C5NH 1GJ5H 1L1JA 3ESTA 2ZFSA 1W12U 2Q1JA 1ZZZA 1GVKB 4D9QA 3ZVGA 1DXWA 1KSNA 3SW2B 1BJVA 2STAE 3ZVBA 5FX5A 1EJMA 3BTDE 3ZZ5A 1K1MA 1Y3VA 2FOFA 3A84A 2QN5T 1GI8B 4BTUB 5F03A 1MBQA 1HJAC 1P10A 1J8AA 3MMGA 2O9QA 3E91A 5HXFA 1A0HB 1P2KA 1AZZA 2B8OH 3SJIA 5LPEA 4MDSA 1DSUA 1NFWA 1IQIA 2FOCA 3L3TA 3PB1E 1F0SA 3D23A 4WXIA 5FPYA 1ZGVA 5FPTA 1P2OA 3SGAE 1B0FA 2WPMS 5LH8A 2QXGA 2F3CE 3T5FH 1BBRH 4X2YA 1YPKH 3TJOA 3U8RH 1SGRE 1V2ST 1CHGA 1MTNC 1V2RT 1C2DA 1LCYA 4MNYA 1SI5H 5T6DA 4BAKB 1P57B 1AMHA 2C3SA 3SJKA 1Z71A 4ISLA 2A32A 1QBOA 1RIWC 5EXNA 3T25A 2TRMA 2Y80A 1XUFA 1ELEE 3RC5A 5A8ZA 4I8HA 1NFUA 4U2WA 2GZ8A 2H9TH 1YC0A 1XKAC 4I8KA 1VJAU 2FOAA 1P2MA 2HLCA 3MWIU 3HATH 4K1TA 3ATIA 2IOTA 1DDJA 1TMTH 2FWWA 3CS0A 5EPYA 3ZYDA 1BBRK 2P8OC 2VB0A 2GCTB 1Y5AT 1VCPA 3RU4E 4XDEA 2BDYA 2BDHA 2OC1A 3RXUA 2BYAX 2YNBA 1LHFH 2OQUA 3NPSA 4GCHF 1C2GA 2BD8A 3URCA 1AU8A 3WY8A 3E6PH 5DP7A 3LGUA 1LHGH 2EEKA 2ODPA 3A8AA 2TPIZ 3QZRA 1C4V2 1P9SA 4RSPA 4MPUA 3S69A 3SUGA 5GXPA 4UFGH 1QURH 1EZUC 1WSSH 2FTMA 1WTGH 2ANKH 1AUTC 1QHRB 1Y3YA 1KXCA 1LVBA 2YNAA 3BTKE 3IWMA 2HOBA 2Y5FA 1VITF 2O8UA 1HAIH 3MI4A 4ABHA 2XNIA 3O8BA 3Q76A 4B71A 2WUBA 2CN0H 4I32A 1TX6A 3PO1B 2UWOA 1C1WH 1CT4E 2FOHA 1UTJA 1KLIH 1YLDA 4CRAA 4CRGA 1GBHA 1YM0A 1SQTA 1KLJH 1TBZH 5J4QA 4E06H 1BHXB 4TPYA 4CH2B 1TBQH 2BDAA 3VB5A 1HAHH 1HXFH 2QA9E 1SGNE 4NZQA 1O2UA 5G4BA 1GBDA 1RGQA 1TFXA 5L6NH 1K1LA 2J34A 2QC2A 5A0CA 1AGJA 3I78A 3ZZ6A 1W3CA 1WUNH 2V3HH 2VNTA 3ATMA 2F9PA 2VJ1A 1DITH 2QXIA 3SORA 3MU5A 5CHAC 1D6RA 3BV9B 3RMOH 1MTVA 1SQOA 1SLUB 1L0ZA 3P8NA 4CRDA 3UOUA 1GHAG 1QNJA 3RXBA 1YPHE 3EA7A 3VXFH 1Z8JB 4THNH 2A1DB 4FUJA 2NU2E 1OWKA 2SGPE 2Z9KA 2BY9X 2FDAA 2GP9B 1ZRKA 2FXRA 3Q3KA 3TLOA 4K3JA 1L1GA 1Q3XA 3TH3H 4ISIH 1EPTC 1S5SA 4IGDA 4ABDA 3RXMA 2AGIX 1N8OC 1D4PB 2CF8H 1K2I1 4OS5A 3ZV8A 4D9RA 3MNBA 3SNDA 1EAUA 2BQWB 1QQ4A 2EI8A 2H2ZA 1ANBA 1TPOA 4IBLH 2H5CA 2H5DA 1Z6JH 1P11E 4NSYA 2XBXA 4XFQA 2B0FA 6ESTA 5BPEA 1HJ9A 3A8DA 2XWAA 1UK4A 1T7CA 1UO6A 4X8SH 2ZFFH 7GCHG 1SGFA 3A7WA 3A7YA 5ESBA 2BB4A 1XX9A 1EKBB 4J1YA 4NWLA 3GY5A 3KN2A 4ABGA 4MTBA 2SGFE 1TGCA 4ISNA 1V6DA 2ZHEH 3SBKA 3RMLH 4FU8A 4H4FA 1HGTH 3GISB 1IQNA 4BAQB 1HYLA 2W26A 1DLKB 1NT1A 1V2JT 2EI6A 1TALA 3N7OA 3O8CA 1AIXH 1DWEH 3UOPA 2J95A 3GCHC 1TMBH 2W7UA 1E36B 2ZECA 3FANA 3ITIA 2ZU5A 1QB6A 3LGIA 1ZTKA 1TX8A 4K5ZA 1H1BA 1TBRH 1ACBE 5FCRA 2FP7B 1XM1A 3LH1A 3KQDA 1KXAA 1SOTA 2CGAA 2FZZA 8GCHF 2BDBA 1O2QA 4WWYA 1P12E 4NIWA 5T3HA 5E0HA 4ASHA 1CA0C 3LGYA 2BVXH 1UTNA 1BITA 1GMDG 1H9LB 1GI1A 4FUCA 1GHXH 1BB0B 1JWTA 1QIXB 5AF9H 4ZKNU 3KNXA 2BDGA 1D6WA 2R9PA 1YLCA 1IQMA 1F5KU 2WUCA 1MTNB 1HXEH 7KMEH 1QJ6B 4E05H 1SC8U 4OGXA 1SVPA 3RXLA 1ESBA 5C5OA 1TA2A 1TQ7B 3LKWA 2D2DA 3ATLA 3Q00A 1O3BA 1O2NA 4A1XA 1GMHF 5DGJA 1T8LA 1PPHE 3PLPA 2PKSB 1O35A 3FZZA 3LOXA 1RIWB 1ZHPA 4IW4E 3ELAH 1C5YB 3GY4A 1HLTH 1O2PA 3B23B 1AVGH 1AVXA 1FDPA 1S83A 4YOGA 2F83A 3TK9A 5DP5A 1TNGA 4AG2A 1P02A 5JB9S 1IQKA 2J2UA 2ZDAH 4KELA 2VIPA 1C5RA 2G5NA 1ORFA 2PUQH 2ZDMA 2ZGHA 1A46H 1INCA 1RS0A 4ZXYH 1C1OA 3RXGA 1UK3A 2XBVA 4NZLA 4O97A 2O8TA 1V3XA 1HNEE 4NFEA 8ESTE 1DWDH 2PGBB 5F8XA 3UNRA 2BD2A 1T8MA 2ALPA 3HKIB 2XW9A 1MCTA 2WINI 4AOQA 1WQSA 2EC9H 4YT7H 2AFQB 3RXRA 3MU4A 2PR3A 2XC5A 5FHTA 1SGQE 4CREA 2TGAA 2QXHA 2PUXB 3V13A 2R0KA 4AYVB 1ARBA 3MO6A 1THPB 3PLBA 4M7GA 1C5VA 1ELCA 1V2OT 5L30H 1AFQC 3U8TH 2FIRH 3T28A 4LZ4B 1C9PA 1TGNA 1ELDE 3TU7H 1Z1JA 1LVMA 1SOZA 5JYIA 5T6FA 1HV7A 1UTOA 5EW2H 1ETRH 3ZZDA 2OLGA 4DW2U 1QA0A 1IQLA 1FN8A 1UJ1A 1YCPM 3PTBA 1JIMA 5I46H 5HGGA 2WYJA 1MD7A 5T6GA 4QT8C 1NZQH 1K1PA 3MNCA 1P09A 2J9NA 5FX6A 4UEHH 4FUHA 5DKMA 1NC6A 4BXWA 1B0EA 1LPZB 2ZKSA 2ZGBH 4UONA