4MNYA

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk903
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator chain B
publication title Peptide ligands stabilized by small molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 245
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnyA01
3K6YA 1CHOG 2Y5FA 2HALA 2P93A 4Y7BA 1SBWA 2P8OB 3B9FH 1OWHA 4TPYA 1J8AA 1O31A 4AB9A 4Y71A 2J94A 3GDSA 4ISLA 5GWZA 1IQEA 1K1OA 4RSPA 4K8BA 5LPRA 2BLQA 1W2KH 3OX7U 3R0FA 5AVDA 1LHFH 2J95A 3AW1A 4X6OA 3V12A 2QF3A 4FUHA 5C5NA 4MPXA 1MAXA 4XE4A 4UEHH 1QJ6B 1Z1IA 2UUFB 4ZH8A 2ESTE 5LPFA 3E16B 2QXIA 1VCQA 2FO9A 1OP0A 2ZGJA 1GG6B 2AMDA 1VCPA 1NU7B 1BRAA 3RMLH 1K1JA 2ZCKP 5EW2H 4X2XA 1HIAA 3GISB 3A7WA 5EGMA 1A2CH 2CF9H 2FDAA 1L2EA 2PTCE 4Y79A 4NA8A 1TPAE 1GBJA 1GJ7B 1O2XA 1L0ZA 3E90B 4BTUB 1LQEA 3QWCH 4ASHA 1SOTA 5L2YH 2ASUB 4NA9H 2GT7A 3GCHC 1O2YA 5DP3A 2BDGA 3HK3B 2BQ7B 3MH6A 1JRSA 1KXEA 1TMBH 2ZIQH 4ZXYH 2XXLA 3LGUA 2OQ5A 3TNSA 2RA3A 1NPMA 1UTLM 2ZCLP 4I33A 2V6NA 2WPHS 3P8FA 1GMCF 1TOCB 4K3JA 1YPHE 3GY8A 3SUEA 2XC5A 2SFAA 5EPYA 1V2VT 1V2PT 5E0GA 2BVXH 1OP8A 5HM9A 1TNJA 2C8YB 2ZP0H 2FLRH 8ESTE 4NA7A 4WF8A 1HDTH 1GHBF 2K1QA 2OLGA 1PQ7A 1HLTH 5F8TA 3PTBA 3O8RA 4YLQH 1A3EH 4JZEH 5B6OA 2FXRA 3BTEE 2C90B 4U01A 5GDSH 4K1TA 4MG3A 1P0SH 1P2OA 2BLOA 2BDIA 1C4V2 1Y3YA 2VWMA 1P05A 3ZYEA 4CHAB 5F8ZA 3RXFA 2ZGCA 3E0NB 1A61H 2O8MA 4ESTE 4FUGA 3PROA 2IPHA 1WUNH 3ZZDA 2A32A 2ZPRA 2G00A 1WSSH 1UO6A 1EX3A 1FLEE 2RA0A 2BX4A 3W94A 2C3SA 1TFXA 3E0PB 3A82A 2FOCA 3LH3A 4NFFA 1HAVA 4K1SA 1GGDB 1W7XH 3BG8A 2AFQB 1GJ8B 1SC8U 3UREA 3LGVA 1MTVA 2ZECA 3TJNA 5EXLA 2AERH 1K2I1 1RTKA 2O9QA 3Q3KA 4BTIB 4FUBA 4SGBE 1DX5M 1O2JA 1CBWB 1HAGE 1ZPZA 3M3VA 2OTVA 3P92A 4Y8YA 3D49H 1A3BH 1XVMA 1AFQC 1UTPA 4X6PA 1TE0A 3MU5A 5DG6A 3RU4E 5A8YA 2AMQA 5C5OA 2VU8E 2M5TA 9LPRA 1HBTH 1SOZA 2V3HH 3RXHA 1YPKH 3QN7A 2Y7ZA 6GCHG 3LOXA 4O97A 3D65E 5CHAC 1SQOA 1Y5UT 2PR3A 3SQEE 3TK9A 4GHTA 2BD5A 1XUKA 1E38B 6ESTA 4O9VA 1VJ9U 4A92A 1SFQB 2ZQ1A 2QCYA 3Q3YA 3AW0A 1JXPA 1NRPH 4JYVH 1ANBA 1P12E 1KYNA 1EPTA 2DE8A 1FIZA 1UTQA 3RXBA 3MU1A 4DIIH 1L4ZA 3A89A 4GLYA 2BD2A 3KF2A 3GDUA 1TWXB 3UQVA 1XUHA 2B8OH 3LJOA 1ELGA 5HXFA 4NIWA 1YCPH 3PMAB 2Z9LA 1AFEH 2AIPA 4LOYH 1FAXA 3E1XB 1N8OB 1GJ5H 2NU1E 1GBMA 1NN6A 3LGTA 1A0HB 4UFGH 3SV7A 2QXGA 1O2WA 2OINA 4D7FA 1C5MD 1BJUA 1GBCA 1V2QT 2GKVE 5EW1H 4ISIH 4GHQA 2WINI 3H5CB 3UOPA 4HGCA 3RXVA 2LPRA 8GCHG 1SSXA 4WJG2 2PKSB 5E2OA 8KME2 1ZGIA 1W13U 1GWAA 3A8DA 1LPGB 5T3HA 3WY8A 3EA8A 3RLWH 2ZWLH 4INKA 1MKXH 2ZDAH 2G8TA 5FBEA 4ABGA 2FI4E 3DD2H 1G3BA 1RS0A 3RMMH 1DWCH 1DPOA 3GYMA 3KIDU 1FV9A 2H2ZA 3ITIA 2R2WU 3JZ2B 2ANYA 1LCYA 4NIVA 2PUQH 4YLUA 1S6HA 1W12U 1KTSB 2ANMH 1SGQE 1F5KU 4ISOA 1FPCH 4RKJB 1EKBB 1AMHA 2PLXA 2XTTB 1NS3A 1BITA 2FODA 3A80A 1C5TA 1LHGH 1PPBH 2CGAA 3P8NA 2ZO3H 1DY9A 1UK3A 2FEQH 4H6SB 2A5AA 1YBWA 2ALVA 1S6FA 2PFEA 3AAUA 4CRGA 1O38A 4KTCA 1NRNH 1ESTA 5FPSA 2TPIZ 4KTSA 1C1MA 1G3CA 1WQVH 4NFEA 4XFQA 5IYTA 1GVLA 1KXBA 2ZA5A 1PPCE 3IITA 4CRFA 1EUFA 2GMTB 3M5OA 1CT2E 2BLVA 2XBVA 1P3CA 4I7YH 3ZVCA 2SGEE 3GDVA 1CT4E 1EAXA 1T8LA 1GBDA 3EGKH 4YO9A 3SBKA 3L6PA 5GCHF 3Q77A 1GHZA 1ZZZA 1O5GH 3VB6A 3TIUA 3SHAH 4FUIA 2D1JA 1BRCE 5E8EH 1W11U 1GI0A 1BCUH 1AZZA 2CXVA 1DWDH 1SL3A 2A5KA 1P9SA 1BMLA 1ZTJA 3SHCH 3MYWA 4WH6A 3UOUA 4A7IB 2A4OA 1H8IH 1O2NA 3TVJB 2ZEBA 2VGCB 1C5RA 1TX8A 1TMTH 5LPEA 1PJPA 1OYQA 3MU0A 3UR6A 1OWKA 1EASA 1SGFG 2D2DA 2D26C 2XBYA 4M7GA 1G32B 1S85A 4E06H 4E7NA 2OC8A 1NU9A 4F49A 5C3NA 1SGFA 1O3DA 3TPIZ 1C1RA 1A0LA 1CA8B 4BAQB 2OC1A 2FS8A 1DDJA 6CHAC 1KLTA 3ATLA 1F5LA 5JDUB 3LC3A 4D7GA 3SNCA 2FYRA 5A0CA 3BF6H 1SMFE 1IHTH 1FIWA 1BHXB 1Z7KA 3SORA 3KNXA 3ZZ8A 1UCYK 4UFDH 4I8JA 3O8CA 5AF9H 2FOMB 3QX5H 3UY9A 1CQQA 1NFXA 4MPVA 1FONA 4IGDA 5DP6A 3U8OH 5EODA 1RD3B 5JBTA 4XBBA 1BB0B 3S7HB 2FP7B 1G3EA 3KCGH 1C5UA 1AZ8A 1KIGH 1ABIH 4NSVA 1BTYA 2BHGA 1OXGA 2B5TB 3RDZA 1NRRH 2XBWA 2EI7A 1CU1A 4CREA 1FN6A 4OS5A 1PPGE 3SU6A 4FU8A 3PV4A 1GJAB 3LJJA 2XC4A 4B73A 1IOEA 2ZDKA 1DLKB 1MTNB 1OP2A 4D76A 3ESTA 1TNKA 1Q2WA 4ZHMU 1EXFA 1SI5H 1VITG 1RIWC 3EQ0H 5GIBA 2OXSA 1H9HE 5FPTA 3RXPA 4A1TA 4DIHH 1QJ7B 1ZSJA 2V35A 1K28D 1NFYA 1C9TA 4MNVA 3I78A 2W7UA 1C2GA 2VINA 1SHHB 1ZPCA 4HZHA 1SFIA 3M35A 1TQ7B 1NRSH 1QHRB 5E2PA 3E91A 4Q7YA 1C2EA 3F9FA 3GOVB 1LHDH 1V3XA 1K22H 1GMDG 2VWOA 3SU4A 2UWPA 1QY6A 1QTFA 3MOCA 1AHTH 1QA7A 1MZDA 1O34A 1SGTA 1CGHA 3UFAA 3P17H 4MVNA 1MD7A 1MD8A 1T7CA 3PM3A 1HNEE 1O5BB 1CVWH 2BDCA 2FM2A 2AH4X 1GDUA 1GBIA 4MPUA 1O3FA 2TGDA 3URCA 3ZV8A 1QL8A 1P8VC 3RM0H 3ZZ3A 1G9IE 2ZHEH 3ZVAA 2P3FH 4NIYA 3UQOA 3SJIA 1THSH 1V2LT 4JZDH 1MTUA 2F9UA 1HXFH 1FI8A 5JBAS 1BTUA 1NROH 3M36A 1BBRH 1BMAA 4D9RA 1DANH 1GCDA 1C2LA 1TQ0B 2VH6A 4BNRA 4FUDA 1TGTA 2Z3CA 1ESAA 3ZYDA 1LQDB 3F9GA 2Q6GA 1ZHRA 3RXRA 5C1YA 3OU0A 3FP7E 2GCHG 1Y3XA 1LHEH 5ETXA 3U1IB 3BSQA 3URDA 1GI7B 4ZROA 3ZZ7A 4CBNA 1TALA 4B74A 2O8UA 2A4QA 1KXCA 2FOEA 3SU2A 4AB8A 2HVXA 1C5XB 3F1SB 1C5YB 1EZQA 1P09A 1TRYA 2Z3EA 3DFLA 1V2MT 3U98H 2ZHFH 1Z8IB 1TGCA 2ILNA 1HJAB 1LPKB 2Y5HA 5SGAE 5T6FA 2IJOB 4CRDA 1P06A 1TABE 2ZFFH 2HPPH 2F3CE 1A1RA 2ODYB 1ZHMA 2O8WA 3P95A 1VCWA 1DFPA 1XMNB 1AUTC 1L1NA 2FLBH 3BIVH 1GMHF 1JBUH 1OWJA 1QBVH 4AZ2B 3A87A 3PO1C 1IQIA 3OSYA 2JH0D 1WOFA 4I8LA 2BQWB 5BRRE 2OBOA 1O3CA 1NRQH 2KAIA 2P3TB 3KQDA 1E34B 1AWFH 2A5IA 1HRTH 3EDXB 1C1OA 1S83A 1AD8H 5T6DA 1WU1A 3QTOH 1C2MA 1MBQA 2GX4A 2Y5GA 1AKSA 3ZVEA 1IQGA 4BOHA 3RXGA 3VB3A 1ELCA 5FPYA 3U8RH 4INHA 1JIMA 3SGAE 1ZOMA 4WWYA 5AHGH 1DITH 1F5RA 2YNAA 4Q7XA 4ABDA 1XUJA 4OS2A 3HGNA 3HPTB 1EOJA 2C4FH 4KP0A 1UJ1A 1MQ5A 1LPZB 5F6MA 1GHAF 1GI5A 2DE9A 4FUCA 2OQUA 4IS5A 4TWYA 5K0HA 1K1LA 4BXSA 1INCA 1SVPA 2ZDLA 2ZDMA 4HFPB 1H9LB 1WAYB 4WY3A 4FU9A 5DP5A 2I6SA 1GJCB 1GI8B 1FZZA 5I25A 2P94A 5A2MH 1Z1JA 4DT7B 1QFKH 3QDZB 4ZMAH 2EI8A 2FI5E 2Q6FA 1HGTH 1O33A 3UIRA 1O3EA 1GCTC 1HAOH 3RP2A 1D6WA 1WYKA 3PTNA 1YLCA 4K69A 4X1RU 3MHWU 1WTGH 1CSOE 2FX6A 2RCEA 1DXPA 1EZSC 1Z6JH 3MWIU 3TGKE 3QZRA 1GI9B 3BEIB 1Z8RA 2R2MB 2JH6D 4Q2KA 3QK1A 4ZAEA 1HJ8A 1ABJH 1GBAA 3RXDA 2Y7XA 1LHCH 1MU8B 3O8BA 1P57B 1VGCB 2GP9B 1O2QA 3RUOA 3A7ZA 3LKWA 5EXMA 1BUIA 1C9PA 3UWIA 5A8XA 1GL0E 4JK5A 1NC6A 2ZFRH 1O36A 3VPKA 3AAVA 4ABAA 1GMCG 2XW9A 1ETTH 1A46H 5E0JA 1C2DA 2JETC 3OY5U 4FU7A 5EXNA 2Z7FE 3GCNA 3G01A 1GHBG 2GZ7A 3ZVBA 1EZXC 1V2RT 1EPTC 1Z8JB 2GT8A 3M7UA 1E0FD 4MPWA 1ZMLA 1ACBE 4Y7AA 4FVBA 4JK6A 3UTUH 7ESTE 3GCTF 1N6YA 1XKAC 1XUGA 1Q31A 1AB9C 1BMNH 1P2NA 2R3UA 1EJAA 5A09A 1ZSKA 3SQHE 1S82A 4UFFH 1JMOH 2IOTA 5DGJA 1MZAA 3L3TA 4TWWA 2NU3E 1TNGA 2Z9IA 1OWDA 4IC5A 1EATA 3A84A 1H4WA 1SGYE 1T32A 4H6TA 2H6MA 1A5HA 3FP8E 1QRWA 1J14A 1IAUA 1F0TA 2SGDE 1OOKB 2OBQA 1ZGVA 3ATIA 1ANEA 3SU0A 3RXSA 2TBSA 1B0FA 2PKAB 5HMAA 1P04A 1UTOA 1JOUB 1TLDA 2ZQ2A 1MH0A 1MTWA 5DKMA 1N6XA 5HGGA 3JZ1B 2QIQA 5AFYH 3NZIA 2SGQE 3PLPA 1BTZA 3BTGE 2A31A 2W26A 3UNQA 7GCHG 3GCHB 5BPEA 2PKSC 1BRUP 1J9CH 1TONA 4F4OC 1YC0A 1ARBA 3MU4A 3PWBA 2BDHA 2F83A 2GV7A 1F0SA 3T62A 1IQHA 1UK2A 1IQKA 3H7TA 2SGAA 3RXAA 1YM0A 2QAAA 7GCHF 1AVXA 4WMEA 1ETSH 1C1QA 3AVZA 3M61U 1DLEA 2FZZA 3BG4C 1DUAA 3GICB 1A4WH 4GSOA 2ZFTA 1K1PA 3M7QA 5F03A 2F91A 1T8OA 1E36B 1QL9A 2BD8A 2ZTZA 3H7OA 4U30A 2VIOA 2Z94A 3A7TA 5JB9S 4YT7H 1XX9A 1W14U 1NFUA 1QQUA 2UUKB 1UTNA 4I8GA 1QURH 1H9IE 1AGJA 2GCTC 4YT6H 1EAIA 1KLJH 1YPMH 1QB1A 1TA6A 5DP9A 1TMUH 4UE7H 2AYWA 3C1KA 3NXPA 3A7YA 1YPJH 3RLYH 3SNDA 1D3DB 3SV9A 1TX6A 2WYJA 1QRZA 3A7VA 3SJ9A 1FY8E 2GMTC 4Y0ZE 1HYLA 3GY7A 3B8JA 4MDSA 1QA0A 1HAPH 3R3GB 1SPJA 1UTMA 1XKBC 3Q00A 4DURA 2HGTH 1O2ZA 4ABEA 2J2UA 1WBGB 2B0FA 2SGPE 4IMZA 3A7XA 3NUMA 3E6PH 1YCPK 3MMGA 1ARCA 1P2IA 1T8NA 3TJUA 3V7TA 1AFQB 3M37A 1BQYA 1O2LA 2G4UA 5A8ZA 2VH0A 4O3TA 1C1SA 4AX9H 1THRH 2ZU5A 2R0KA 1W3CA 2PUXB 1G30B 1QGFA 2BZ6H 5CHAB 2GDEH 2WV5A 4DG4A 2SNVA 1NM6A 1BA8B 1EZUC 2B9LA 1LDTT 4FUJA 2STAE 2P59A 2YOLA 2ZFQH 2BY5X 2XWBI 1NZQH 3T25A 1DT2A 2TGTA 1IQJA 1SGEE 1MKXK 2W3IA 2ZTXA 1O2VA 1O3JA 1B5GH 5ABWA 3T2NA 3SV8A 2WPKS 1YLDA 3ODFA 5GCHG 1GBKA 1T4VH 1UVSH 1O3OA 5JB8S 4AG1A 2FMJA 1GI4A 1V2ST 4GAWA 1C1VH 1XM1A 1O5CB 1CO7E 1LMWB 1Y5BT 2ALPA 4FVDA 1SQTA 2G4TA 4R8TB 1LVYA 5DPAA 5TJXA 1Y8TA 3SU5A 3SJKA 2BDYA 1UMAH 1O3HA 1O3IA 1LTOA 1P03A 2F9NA 1GI3A 1K21H 2Y81A 1AVGH 2H5DA 1EAUA 3I77A 2ZNKH 3QTVH 3SV6A 1CE5A 3T29A 1O2MA 3RM2H 2G5VA 3EYDA 3SJ8A 2GVFA 1DICA 2J34A 2ZFSA 1CGIE 3FZZA 1MUEB 2BD3A 4KKDA 4ISHH 3TH4H 1BJVA 1C5PA 3AASA 2BY6X 1J15A 2VIQA 4X8VH 3TH2H 1EP6A 1SLUB 1PPEE 1AWHB 3LIWA 3LH1A 1YGCH 2A7HA 1QIXB 4ZKOU 2Z9KA 1PQ8A 1WTHD 1HAZB 4Z0KA 2JH5D 4GCHF 3VGCC 4XSKU 4A1XA 1AI8H 1RXPA 2J4IA 5L6NH 3HATH 3OTJE 1AVWA 3MNBA 3SV2H 2PGQB 1P10A 1V2JT 1HB0B 3A8AA 1AY6H 4HI3A 3RXCA 3ZVGA 1AUJA 1DSTA 3EA9A 5AFZH 2PSYA 1BTWA 4Y76A 4K1EA 1HPGA 3RXTA 2VJ1A 4AOQA 1NT1A 1SLWB 1C1NA 1XUFA 2OC7A 4OS7A 4AFQA 1AE5A 1SLVB 3NKKA 3K65B 1MKWH 2J92A 3SU1A 1ORFA 1FY1A 4FXGH 5HYOA 1HFDA 2FOFA 3I29A 3QO6A 3VB4A 1SGIB 5TCCA 3KGPA 2WPMS 3SJOA 2CV3A 1C1UH 4X1SU 1LO6A 2NU0E 4Y8XA 1S0QA 3BEFB 2CHAC 2XRCA 5DP8A 2P3UB 2BOKA 1KXDA 5DO4H 4IC6A 1BZXE 2GD4B 3A86A 2F9VA 2Y82A 4DY7B 4WXIA 4DVAU 1F2SE 1XVOA 2GDDA 3ZVFA 1UVOA 1JWTA 2OCVB 4R0IA 2BM2A 2BLWA 3S9AA 2TRMA 1RTLA 3FVFB 1HV7A 4X2VA 1UHBB 2QN5T 1FMGA 1KLIH 3KN2A 1CA0C 3MH4A 1ELFA 2JKHA 4YESB 6CHAB 3FZDA 1VJAU 2ODQA 1QBOA 3MI4A 1TBQH 3RXLA 1FUJA 4B2AA 1FXYA 1PPHE 2OP9A 1GVKB 2PTNA 1GJDB 2PSXA 3A8BA 3MNSA 1C5ZB 3TJVA 1AIXH 3GCOA 2C8ZB 1RRKA 1S0RA 3EAJA 4FUEA 4CH8B 1ZHPA 4ABFA 1YKTA 9ESTA 1TYNA 3LGYA 1ZYOA 7LPRA 1P3EA 5ESBA 3D62A 4Y8ZA 2UUYA 4IW4E 2WV4A 3BTKE 3SI3H 1HAYB 4UONA 3RXMA 1L1GA 3SNEA 3KEEA 1BMMH 4VGCC 1ANDA 1BBRE 1ELBA 2ZU1A 2QC2A 3LC5A 2ZPQA 1DOJA 3MO6A 3P70B 2VIPA 3SO3A 1WQSA 1Z71A 1FAKH 4JMYA 2R3YA 1RIWB 1OPHB 1T31A 4X6MA 4PROA 2G52A 3A81A 1FPHH 2FI3E 1QB9A 2FYQA 2XWAA 2VIVA 2J9NA 1GJ4H 3A88A 1GMHG 3LDXH 2UWOA 1ANCA 1ELTA 2ULLA 2YNBA 1GBBA 1C1TA 1XXDA 4SGAE 3B23B 1BBRK 1EB1H 2P8OC 2BD9A 3KQBA 3K6ZA 2A1DB 4B2CA 1X7AC 4Y10E 1ZTLA 3SUGA 3F6UH 2HOBA 4AFZA 4IMQA 3GY4A 4B76A 1VZQH 3ZZBA 2ANKH 2ZGHA 3SGQE 1FN8A 3TGIE 4JZ1A 4D9QA 1P11E 8LPRA 3RU4D 2WYGA 1C5WB 2D8WA 5JYIA 1J16A 4X8TH 4AYVB 3NK8A 5G4BA 2A4GA 3BEUA 1HXEH 2BVRH 4X1NU 1Z8GA 3VXFH 2QGRA 3BTFE 5GXPA 2W7SA 4BAHB 4MTBA 2H9TH 2ZHQH 1FQ3A 1P2KA 1QNJA 1SGNE 1D4PB 3SNBA 3ZV9A 2HNTC 4BAMB 1GG6C 2AGGX 3QGJA 2V3OH 4XDEA 3P8GA 1GHAG 4NZQA 3V13A 1G2MA 5LH8A 3ZZAA 4BXWA 5EU8A 2J38A 2NWNA 1HCGA 1NFWA 2FIRH 2A2XH 2ZG0H 3LONA 4OS1A 4XBDA 2BD4A 4GUXA 1BOQA 1TX7A 2FPZA 4BAOB 3FP6E 3E3TA 1W0ZU 2F9PA 1YP9A 1ZLRA 1ZSLA 3OYPA 2F9OA 4OS6A 5CMXH 5FCRA 3GY6A 1F92A 1RJXB 1YPLH 1LVMA 4Z6AH 1GHXH 1BTPA 1T4UH 1LVOA 1A5IA 2BVSH 4CR9A 1OKXA 2CF8H 1AQ7A 1YYY1 3M7TA 4JZFH 1JRTA 1K1MA 2AS9A 1MMJN 1SR5C 3SUFA 1FY5A 1AN1E 3GY3A 1TOMH 1ZTKA 4ZHAA 2A45B 2BOHB 2VVUA 4E7RG 2F9BH 3D23A 4KELA 1HJ9A 4NWLA 1LVBA 4A5TS 3KQEA 5A0AE 3QLPH 1DVAH 2EEKA 1ZJDA 1HAIH 3PO1B 4I8HA 2XCNA 2P16A 1GJBB 1CHOF 1HIAB 3M3TA 3LGIA 3UNSA 2BZAA 3RC5A 2WUBA 3ODDA 1K9OE 3CS0A 1KY9A 1O5EH 3A83A 5EG4A 4CHAC 3ATKA 3FANA 5FX6A 5GPIB 3MNCA 5C1UA 3RC6A 1C5VA 2LNCA 3QZQA 5TCAA 5C1XA 3VB7A 4BANB 4WMFA 4X1PU 2VB0A 3BTHE 1H1BA 4TY7A 4CH2B 1MCTA 1GGDC 1NESE 1J17T 3SU3A 1W8BH 4NGAH 2C8WB 3NWUA 1GPZA 1V2KT 3TLOA 1D6RA 2BB4A 2ZI2H 1THPB 1GI6A 1EB2A 1FJSA 3ZZ9A 1CBWC 3K2UA 1UVTH 1GBFA 4U32A 2VVVA 3GCTG 1KSNA 1TBRH 1TBZH 4UDWH 1O0DH 3U8TH 1CGJE 1C2KA 1O5AB 4B71A 4TY6A 3PMHB 5ESTE 2H9EH 2W5EA 4Y11E 3T5FH 2FESH 1L1JA 3NPSA 3U9AH 1C5OH 4JCNA 1C4Y2 2HNTF 2GZ9A 3BTDE 1O2IA 3M5MA 2NU2E 2CJIA 5EQSA 5L2ZH 2GGVB 2PW8H 1IQNA 1E35B 3ATMA 3MFJA 4MLFB 1C5NH 4WXVA 4AGJA 4QT8C 3E8LA 1V2OT 1V6DA 3PWCA 3MH5A 1GHYH 1V2WT 2BD7A 2AEIH 2EA3A 1GCTB 2DUCA 4MNWA 1BDAA 1E37B 4WH8A 4OS4A 2GV6A 1GBTA 5E0HA 3TK5A 1O37A 1O3PB 2R0LA 3BTTE 4WMDA 4JYUH 1HAVB 1C1PA 1N8OC 2ZGBH 1ZR0A 4FUFA 2CMYA 4BTTB 2FOGA 2NU4E 3LU9B 1YPHC 2PWXA 4IN1A 4ABJA 1O2GH 2PV9B 1PQAA 3PB1E 4NSYA 1QB6A 1MQ6A 1UVPA 1C5SA 2G5NA 4NIXA 2BY8X 5A0BA 2Y6TA 4KGAA 4ZKRU 2GTBA 1K1NA 5EQQA 5K7RA 1GI2A 2FTLE 3DT0H 2RG3A 3M5NA 2PKAA 3TGJE 2A7CA 1KDQB 2JETB 3HKJB 2ZU3A 3STIA 1KTTB 3RU4T 2XCFA 4ZKSU 1C1WH 1O3BA 1ZPBA 1C5LH 1DY8A 1DS2E 4DCDA 1TNIA 2GZ8A 1EPTB 2QXJA 2TGPZ 2EC9H 7KMEH 1C2IA 1PYTD 1ID5H 5FCKA 2Q6DA 1BT7A 3FAOA 5JBBS 3EE0B 1BIOA 2VVCA 4D8NA 2R9PA 1RGQA 1KDQA 1AB9B 5T6GA 1SGCA 1EJMA 4CRAA 2QV1A 3SN8A 3S9CA 2BX3A 3BTWE 5C20A 5F8XA 2XNIA 5PTPA 1TRMA 2QA9E 3ENSB 6GCHF 3SI4H 1QJ1B 1Z6EA 4HTCH 1VR1H 4XOJA 1Y59T 1YF4A 4A6LA 4IN2A 4YOIA 3MU8A 1XUIA 1O3NA 3HK6B 3PMJA 5C2ZA 4I31A 2Q1JA 1DWBH 3EA7A 1YPEH 3IG6B 3BTQE 4YZUA 2O8LA 5J4SA 1SHYA 3DFJA 2I6QA 5EPNA 1Y3VA 2W3KA 4K60A 3SGBE 3SW2B 2PHBA 3ELAH 4K5ZA 4GPGA 1O32A 1TIOA 3ZZ5A 3RXUA 4AGKA 3ZZ6A 1HUTH 1SGPE 3T27A 3Q76A 4ISNA 1UK4A 1WCZA 1NTPA 3DHKH 1DWEH 1A0JA 1M9UA 1EQ9A 2O8TA 3MTYA 3SOSA 1N1LA 3F9EA 5FX5A 2ZTYA 4U2WA 3C27B 2G81E 2ZC9H 3STJA 2VGCC 5FBIA 8GCHF 1GI1A 1SLXB 1SB1H 1EAWA 3LPRA 1G36A 2ZCHP 3M5LA 4B75A 3BG4B 4X2WA 2ZKSA 1MAYA 2H9HA 1O39A 2CN0H 5DK1A 1Y3UA 1OS8A 3PYHA 3P6ZB 1VITH 1DXWA 2BXUH 1Y5AT 1FY3A 1S5SA 3QUMP 2BDBA 2TIOA 4UFEH 1D3PB 5HM2A 1TB6H 1DUEA 3KL6A 1F7ZA 3UWJH 1EOLA 2BXTH 1O2UA 4ABIA 2GCTB 1EJNA 5L30H 1T8MA 3MH7A 3UR9A 3S0NA 2A4RA 1FDPA 3N7OA 1GBHA 1DSUA 2BYAX 2ODPA 4K2YA 1SGRE 1TGBA 1ZJKA 2VNTA 1IQMA 1AO5A 3GY2A 3MO9A 1B7XB 4B2BA 3T26A 1O2KA 2A2QH 1WV7H 2HLCA 4XBCA 1TNHA 1OSSA 1G37A 1C2JA 1GHWH 1TA2A 4X0WU 1ELDE 1TPOA 4AFSA 4GCHG 4I32A 2Z9GA 4WVPE 1GL1A 1O2PA 1K1IA 1MTNC 1F0RA 4H42U 4CR5A 1F0UA 1UCYH 4DJZB 2QF0A 4BAKB 1GJ9B 1V2NT 1DM4B 3HKIB 2RDLA 3GY5A 1O30A 4NZLA 1P9UA 1YPGH 2QY0B 3BV9B 1ETRH 1UCYE 1XXFA 3UUZA 3ZVDA 1KXFA 1LKAA 3KQCA 2PGBB 4TPIZ 4YOGA 5LGOA 1NO9H 2FTMA 3RC4A 4E05H 1O2TA 3L33A 3ZZCA 1GBLA 1TRNA 1ZRKA 2AGEX 2XBXA 4AORA 3UNRA 4LZ1H 1IQFA 3MNXA 1O3KA 2ANWA 2BDAA 3PLKA 4THNH 4AFUA 1QR3E 3S69A 3MO3A 1D3TB 3V3MA 1O2OA 2ZGXH 4INLA 3TH3H 3VEQB 3RMNH 4X6NA 2ZZUH 1UTKA 2IN2A 2AIQA 5FXLA 3TU7H 1P01A 1V2UT 3A8CA 1HAXB 4ZUHA 1MU6B 5I46H 2OD3B 3VFEA 1O3AA 3Q3XA 3CS7A 5H4IB 1Y3WA 3S7KB 2VWNA 2Z6BD 1BRBE 1O5DH 1W10U 1G2LA 2SGFE 4J1YA 3HGPA 1KXAA 3RXKA 4OGXA 5EOKA 2SNWA 3M3SA 1OWIA 2HWLB 2G51A 2STBE 1NY22 4X1QU 1PQ5A 1SGDE 1G3DA 4AYYB 1PPFE 1RFNA 4NWKA 3CENA 1AU8A 1BHXF 1D3QB 1JIRA 4OGYA 2Z3DA 1FNIA 5FHTA 4X8SH 3W95A 4A1VA 2BY7X 1H8DH 1MKWK 1FY4A 1ZMJA 1PFXC 4JZIA 3PMBB 1BTHH 5CE1A 2QYIA 3BTME 1O3MA 3VGCB 2Z9JA 3QGNB 4IBLH 1D9IA 1ELEE 1PYTC 3OY6U 1O35A 2FS9A 1RTFB 5IDKA 4ZXXH 4O03A 1S81A 1HJAC 3P8OA 4JYTA 1MCVA 1VITF 1ESBA 3T28A 4K8YA 2FOAA 1TPPA 3RXQA 2ZPSA 1QBNA 2Y80A 2ZFPH 5JBCS 4LZ4B 1ELAA 1OYTH 2FOBA 2XC0A 4YOJA 1O2RA 1CT0E 1UHBA 2XYAA 3KHVA 4B1TA 1L4DA 2V0BA 2B7DH 4DOQA 2ZU2A 1GJ6A 5FAHA 5JPMH 4RN6A 3RXEA 2WUCA 4YM9A 1GMDF 3FFGA 2BQ6B 4DW2U 1O3GA 1S84A 1MBMA 4ABBA 2UWLA 3BN9A 2FX4A 1B0EA 4I8KA 3GYLB 2ZF0H 3V0XA 1IQLA 1UTJA 3LT3A 2ZHWH 5DJ7A 1A7SA 1W0YH 1W7GH 3VB5A 1AE8H 4RKOB 2CHAB 5GJ4B 1TGNA 1MTSA 2BTCE 1ZMNA 2THFB 4ZHLU 4MQAA 1O2HA 1TPSA 4UD9H 1TNLA 1DE7H 4KTUA 1GDQA 2AGIX 4DGJA 4Q7ZA 2FWWA 1Q3XA 4CRBA 1U6QA 1OWEA 1HAHH 4ABHA 2TGAA 4H4FA 3F9HA 4MNXA 4NCYA 2HNTE 2ZHDA 2HRVA 1QL7A 1C2HA 2OUAA 1O5FH 4LK4A 3TJOA 3CP7A 2VIDA 1P2JA 3U1JB 1CA0B 4YTAA 1SQAA 2WPLS 2GCHF 1V2TT 4AG2A 3PLBA 4CRCA 2H5CA 1C4U2 3RXIA 1PPZA 1GDNA 2KAIB 4J2YB 3F68H 3DA9B 6LPRA 5EQRA 1O3LA 1QRXA 2ZU4A 3VXEH 4Q80A 3O8DA 1TAWA 2G55A 2C8XB 4LXBH 1IHSH 3BIUH 2ZDNA 3A85A 1O2SA 3SNAA 3K9XB 4TYDA 1GBEA 2WPJS 4X8UH 1AKSB 1A5GH 1P02A 1P2QA 1YCPM 2QXHA 4NG9H 5C67A 1C2FA 1QCPA 1LKBA 4CBOA 2A0QB 2H1UA 3U69H 2A7JA 3SZNA 2OC0A 2P95A 3ATWA 3IWMA 3LGWA 1SG8B 1CHGA 2AMPA 1ZRBA 2BMGB 2C93B 1C5QA 1BTXA 1VGCC 2VWLA 4MNYA 5DP4A 3TITA 4VGCB 3NCLA 3UPEA 5J4QA 2UUJB 1TGSZ 1ELVA 1OX1A 2WPIS 1GHVH 3RMOH 3SUDA 1EP5A 4AN7A 3ZZ4A 2BY9X 3S9BA 3TK6A 4ZKNU 1P2MA 3RXOA 4O3UA 3TNTA 2FOHA 1GVZA 3RXJA 4X2YA 3DUXH 4Y0YE 1QQ4A 2EI6A 5DP7A 4Y6DA 4GVUA 2ZDVH 2VIWA 1UVUH 2HPQH
chains in the Genus database with same CATH superfamily
3K6YA 1CHOG 2Y5FA 3AK5A 2HALA 2P93A 4Y7BA 1SBWA 2P8OB 4ASUD 3B9FH 1OWHA 4TPYA 1J8AA 1O31A 4AB9A 2KCOA 4Y71A 2J94A 3GDSA 4ISLA 5GWZA 1IQEA 1K1OA 4RSPA 4K8BA 5LPRA 2BLQA 1W2KH 3OX7U 3R0FA 5AVDA 1LHFH 2J95A 3AW1A 4X6OA 3V12A 2QF3A 4FUHA 5C5NA 4MPXA 1MAXA 4XE4A 4UEHH 1QJ6B 1Z1IA 2UUFB 4ZH8A 2ESTE 5LPFA 3E16B 2QXIA 1VCQA 2FO9A 1OP0A 2ZGJA 1GG6B 2AMDA 3N99A 1VCPA 1NU7B 1BRAA 3RMLH 1K1JA 2ZCKP 5EW2H 4X2XA 1HIAA 2YMSB 2KCPA 3GISB 3A7WA 5EGMA 1A2CH 2CF9H 2FDAA 1L2EA 2PTCE 4Y79A 5C0UA 4Q63A 4HG6A 1TPAE 4NA8A 1GBJA 1GJ7B 1O2XA 1L0ZA 3E90B 4BTUB 1LQEA 3QWCH 4ASHA 1SOTA 5L2YH 2ASUB 2M2AA 4NA9H 2JDID 2GT7A 3GCHC 1O2YA 5DP3A 2BDGA 2GJGA 2K0QA 3HK3B 2BQ7B 3MH6A 1JRSA 1KXEA 1TMBH 2ZIQH 4ZXYH 2XXLA 3LGUA 2OQ5A 3TNSA 2RA3A 1NPMA 1UTLM 2ZCLP 4I33A 2V6NA 2WPHS 3P8FA 1GMCF 1TOCB 4K3JA 1W0JD 1YPHE 3GY8A 3SUEA 2V7QD 2XC5A 2SFAA 5EPYA 1V2VT 1V2PT 5E0GA 2BVXH 1OP8A 5HM9A 1TNJA 2C8YB 2ZP0H 2FLRH 8ESTE 4NA7A 4WF8A 1HDTH 1GHBF 2K1QA 2OLGA 1PQ7A 1HLTH 5F8TA 3PTBA 3O8RA 4YLQH 1A3EH 4JZEH 5B6OA 2FXRA 3BTEE 2C90B 4U01A 5GDSH 4K1TA 4MG3A 1P0SH 1P2OA 2BLOA 2BDIA 1C4V2 1Y3YA 2VWMA 1P05A 3ZYEA 4CHAB 5F8ZA 3RXFA 2ZGCA 3E0NB 1A61H 2O8MA 4ESTE 4FUGA 3PROA 2EQNA 2IPHA 1WUNH 3ZZDA 2A32A 2ZPRA 2G00A 1WSSH 1UO6A 1EX3A 1FLEE 2RA0A 2BX4A 3W94A 2C3SA 1TFXA 3E0PB 3A82A 2FOCA 3LH3A 4NFFA 1HAVA 4K1SA 2J5UA 1GGDB 1W7XH 3BG8A 2AFQB 1GJ8B 1SC8U 3UREA 3FO8D 3LGVA 1MTVA 2ZECA 3TJNA 4ACAA 2PP6A 1OHHD 5EXLA 2AERH 1K2I1 1RTKA 2O9QA 3Q3KA 4BTIB 4FUBA 4SGBE 1DX5M 1O2JA 1CBWB 1HAGE 1ZPZA 3M3VA 2OTVA 3P92A 4Y8YA 3D49H 1A3BH 1XVMA 1AFQC 1UTPA 2J98A 4X6PA 1TE0A 3GS9A 3MU5A 5DG6A 3RU4E 5A8YA 2AMQA 5C5OA 2VU8E 2M5TA 9LPRA 1HBTH 3N7EA 1SOZA 2V3HH 3RXHA 1YPKH 3QN7A 2Y7ZA 6GCHG 3LOXA 4O97A 3D65E 5CHAC 1SQOA 1Y5UT 2PR3A 3SQEE 3TK9A 4GHTA 2BD5A 1XUKA 1E38B 6ESTA 4O9VA 1VJ9U 4A92A 3FKSD 1SFQB 2ZQ1A 2QCYA 3Q3YA 3AW0A 1JXPA 1NRPH 4JYVH 1ANBA 1P12E 1KYNA 1EPTA 2DE8A 1FIZA 1UTQA 3RXBA 3MU1A 4DIIH 1L4ZA 3A89A 4GLYA 2BD2A 3KF2A 4M9FA 3GDUA 1TWXB 3UQVA 1XUHA 2B8OH 3LJOA 1ELGA 5HXFA 4NIWA 1YCPH 3PMAB 2Z9LA 1AFEH 2AIPA 4LOYH 1FAXA 3E1XB 1N8OB 1GJ5H 2NU1E 2HVYB 1GBMA 1NN6A 3WW7A 3LGTA 1A0HB 4UFGH 3SV7A 2QXGA 1O2WA 2OINA 4D7FA 1C5MD 1BJUA 1GBCA 1V2QT 2GKVE 5EW1H 4ISIH 4GHQA 2WINI 3H5CB 3UOPA 4HGCA 3RXVA 5KEDA 2KCAA 2LPRA 8GCHG 1SSXA 4WJG2 2PKSB 3F3BA 5E2OA 8KME2 2KR7A 1ZGIA 1SQRA 1GWAA 1W13U 1LPGB 3A8DA 5T3HA 3WY8A 3EA8A 3RLWH 2ZWLH 4INKA 1MKXH 2ZDAH 2G8TA 5FBEA 4ABGA 2FI4E 3DD2H 2L6OA 1G3BA 1RS0A 3RMMH 1DWCH 1DPOA 3GYMA 3KIDU 1FV9A 2H2ZA 3ITIA 2R2WU 3JZ2B 2ANYA 1LCYA 4NIVA 2PUQH 4YXWD 4YLUA 1S6HA 1W12U 1KTSB 2ANMH 1SGQE 1F5KU 4ISOA 1FPCH 4RKJB 1EKBB 1AMHA 2PLXA 2XTTB 1NS3A 1BITA 2FODA 3A80A 2HLDD 1C5TA 4P02A 4XRNA 1LHGH 1PPBH 2CGAA 3P8NA 2ZO3H 1DY9A 1UK3A 2FEQH 4H6SB 2A5AA 1YBWA 2ALVA 1S6FA 2PFEA 3AAUA 4CRGA 1O38A 4KTCA 1NRNH 1ESTA 5FPSA 2TPIZ 4KTSA 1C1MA 1KMHB 1G3CA 1WQVH 4NFEA 4XFQA 5IYTA 1GVLA 1KXBA 2ZA5A 3H09A 1PPCE 3IITA 4CRFA 1EUFA 2GMTB 3M5OA 1CT2E 2BLVA 2XBVA 1P3CA 4I7YH 3ZVCA 2SGEE 3GDVA 1CT4E 1EAXA 1T8LA 1GBDA 3EGKH 4YO9A 3SBKA 3L6PA 5GCHF 3Q77A 2LP6A 1FX0B 1GHZA 1ZZZA 1O5GH 3VB6A 3TIUA 3SHAH 4FUIA 2D1JA 1BRCE 5E8EH 1W11U 1GI0A 2AHME 1BCUH 1AZZA 2CXVA 1DWDH 1SL3A 2A5KA 1P9SA 1BMLA 1ZTJA 3SHCH 3MYWA 4WH6A 3UOUA 3SZEA 4A7IB 2A4OA 1H8IH 1O2NA 3TVJB 2ZEBA 2VGCB 1C5RA 1TX8A 1TMTH 5LPEA 1H8ED 1PJPA 1OYQA 3MU0A 3EE7A 3UR6A 1OWKA 1EASA 1SGFG 2D2DA 2D26C 2XBYA 4M7GA 1G32B 1S85A 4E06H 4E7NA 2OC8A 1NU9A 4F49A 5C3NA 1SGFA 1O3DA 3TPIZ 1C1RA 1A0LA 1CA8B 4BAQB 2OC1A 2FS8A 1DDJA 6CHAC 1KLTA 3ATLA 1F5LA 5JDUB 3LC3A 4D7GA 3SNCA 2FYRA 5A0CA 3BF6H 1SMFE 1IHTH 1FIWA 1BHXB 1Z7KA 3SORA 3KNXA 3ZZ8A 1UCYK 4UFDH 4I8JA 3O8CA 5AF9H 2FOMB 3QX5H 3MQKC 3UY9A 1CQQA 1NFXA 4MPVA 1FONA 4IGDA 5DP6A 3U8OH 5EODA 1RD3B 5JBTA 4XBBA 1BB0B 3S7HB 2FP7B 1G3EA 3KCGH 1C5UA 1AZ8A 1KIGH 1ABIH 2VBCA 4NSVA 1BTYA 2BHGA 1OXGA 2B5TB 3RDZA 1NRRH 2XBWA 2EI7A 1CU1A 4CREA 1FN6A 4OS5A 2WSSD 1PPGE 3SU6A 4FU8A 3PV4A 1GJAB 3LJJA 2XC4A 4B73A 1IOEA 2ZDKA 3N7DA 1DLKB 1MTNB 1OP2A 4D76A 3ESTA 1TNKA 1Q2WA 4ZHMU 1EXFA 1SI5H 1VITG 1RIWC 3EQ0H 5GIBA 2OXSA 1H9HE 5FPTA 3RXPA 4A1TA 4DIHH 1QJ7B 1ZSJA 2V35A 1K28D 1NFYA 1C9TA 4MNVA 3I78A 2W7UA 1C2GA 1H8HD 1SHHB 2VINA 1ZPCA 4HZHA 1SFIA 3M35A 1TQ7B 1NRSH 1QHRB 5E2PA 3E91A 4Q7YA 1C2EA 3F9FA 3GOVB 1LHDH 1V3XA 1K22H 1GMDG 1QZ8A 2VWOA 3SU4A 2UWPA 1QY6A 1QTFA 3MOCA 1AHTH 1QA7A 5C94A 1MZDA 1O34A 1SGTA 1CGHA 3UFAA 3P17H 4MVNA 1MD7A 1MD8A 1T7CA 3PM3A 1HNEE 1O5BB 1CVWH 2BDCA 2FM2A 2AH4X 1GDUA 1GBIA 4MPUA 1O3FA 2TGDA 3URCA 3ZV8A 1QL8A 1P8VC 3RM0H 3ZZ3A 1G9IE 2ZHEH 3ZVAA 2P3FH 4NIYA 3UQOA 3SJIA 1THSH 1V2LT 4JZDH 1MTUA 2F9UA 1HXFH 1FI8A 5JBAS 1BTUA 1NROH 3M36A 1BBRH 1BMAA 4D9RA 1DANH 1GCDA 1C2LA 2W6JD 1TQ0B 2VH6A 4BNRA 2XNDD 4FUDA 1TGTA 2Z3CA 1ESAA 3ZYDA 4Q4LA 1LQDB 3F9GA 2Q6GA 1ZHRA 3RXRA 5C1YA 3OU0A 5B6LA 3FP7E 2GCHG 1Y3XA 1LHEH 5ETXA 3U1IB 3BSQA 3URDA 1GI7B 4ZROA 3ZZ7A 4CBNA 1TALA 4B74A 1NBME 2O8UA 2A4QA 1KXCA 2FOEA 3SU2A 4AB8A 2HVXA 5CHBA 1C5XB 3F1SB 5DN6D 1C5YB 1EZQA 5EIYA 1P09A 1TRYA 2Z3EA 3DFLA 1V2MT 3U98H 2ZHFH 1Z8IB 1TGCA 2ILNA 1HJAB 1LPKB 2Y5HA 5SGAE 5T6FA 2IJOB 4CRDA 1P06A 1TABE 2ZFFH 3PRBA 2HPPH 2F3CE 1A1RA 2ODYB 1ZHMA 2O8WA 3P95A 4RT1A 5IK2D 1VCWA 1DFPA 1XMNB 1AUTC 1L1NA 2KZ4A 2FLBH 3BIVH 1GMHF 1JBUH 1OWJA 1QBVH 4AZ2B 4OM9A 3A87A 3PO1C 1IQIA 3OSYA 2JH0D 1WOFA 3UAIC 4I8LA 2BQWB 5BRRE 2OBOA 1O3CA 1NRQH 2KAIA 2P3TB 3KQDA 1E34B 1W0KD 1AWFH 2A5IA 1HRTH 3EDXB 1C1OA 1S83A 3CNRA 2W6ID 3F2GA 1AD8H 5T6DA 1WU1A 3QTOH 1C2MA 1MBQA 2GX4A 2Y5GA 5EJLA 1AKSA 3ZVEA 1IQGA 4BOHA 4F55A 3RXGA 3VB3A 1ELCA 5FPYA 3U8RH 4INHA 1JIMA 3SGAE 1ZOMA 4WWYA 5AHGH 1DITH 1F5RA 2YNAA 4Q7XA 4ABDA 1XUJA 4OS2A 3HGNA 3HPTB 1EOJA 2C4FH 4KP0A 1UJ1A 1MQ5A 1LPZB 5F6MA 1GHAF 1GI5A 2DE9A 4FUCA 2OQUA 4IS5A 4TWYA 5K0HA 1K1LA 4BXSA 1MABB 1INCA 1SVPA 2ZDLA 2ZDMA 4HFPB 1H9LB 1WAYB 4WY3A 4FU9A 5DP5A 2I6SA 1GJCB 1GI8B 1FZZA 5I25A 2P94A 5A2MH 1Z1JA 4DT7B 1QFKH 3QDZB 4ZMAH 2EI8A 2FI5E 2Q6FA 1HGTH 1O33A 3UIRA 2IPQX 1O3EA 1GCTC 1HAOH 3RP2A 1D6WA 1WYKA 3PTNA 1YLCA 1VKYA 4K69A 4X1RU 3MHWU 1WTGH 1CSOE 2FX6A 2RCEA 1DXPA 1EZSC 1Z6JH 3MWIU 3TGKE 3QZRA 1GI9B 3BEIB 1Z8RA 2R2MB 2JH6D 2QF4A 4Q2KA 3QK1A 4ZAEA 1HJ8A 1ABJH 1GBAA 3RXDA 2Y7XA 1LHCH 1MU8B 3O8BA 1P57B 1VGCB 2GP9B 1O2QA 3RUOA 3A7ZA 4Z1MD 3LKWA 5EXMA 1BUIA 1C9PA 3UWIA 5A8XA 1GL0E 4JK5A 1NC6A 2ZFRH 1O36A 3VPKA 3OEED 3AAVA 4ABAA 1GMCG 2XW9A 1ETTH 4FETA 1A46H 5E0JA 1C2DA 2JETC 3OY5U 4FU7A 5EXNA 2Z7FE 1E1QD 3GCNA 3G01A 1YWUA 1GHBG 2GZ7A 3ZVBA 1K0HA 1EZXC 1V2RT 1EPTC 1Z8JB 5EJZA 2GT8A 3M7UA 1E0FD 4MPWA 1ZMLA 1ACBE 4Y7AA 4FVBA 4JK6A 3UTUH 7ESTE 3GCTF 1N6YA 1XKAC 1XUGA 1Q31A 1AB9C 1BMNH 1P2NA 2R3UA 1EJAA 5A09A 1ZSKA 3SQHE 1S82A 4UFFH 1JMOH 2IOTA 5DGJA 1MZAA 3L3TA 4TWWA 2NU3E 1TNGA 2Z9IA 1OWDA 4IC5A 1EATA 3A84A 1H4WA 1SGYE 1T32A 4H6TA 2H6MA 1A5HA 3FP8E 1QRWA 1J14A 1IAUA 1F0TA 2SGDE 1OOKB 2OBQA 1ZGVA 3ATIA 2QE7D 1ANEA 3SU0A 3RXSA 2TBSA 1B0FA 2PKAB 5HMAA 1P04A 1UTOA 1JOUB 1TLDA 2ZQ2A 1MH0A 1MTWA 5DKMA 1N6XA 5HGGA 3JZ1B 2QIQA 5AFYH 3NZIA 2SGQE 3PLPA 1BTZA 3BTGE 2A31A 2W26A 3UNQA 7GCHG 3GCHB 5BPEA 2PKSC 1BRUP 1J9CH 1TONA 4F4OC 1YC0A 1ARBA 2WZQA 3MU4A 3PWBA 2BDHA 2F83A 2GV7A 1F0SA 3T62A 2KFWA 1IQHA 1UK2A 1IQKA 3H7TA 2SGAA 3RXAA 1YM0A 2QAAA 7GCHF 1AVXA 4WMEA 2KM0A 1ETSH 1C1QA 3AVZA 3M61U 1DLEA 2FZZA 3BG4C 1DUAA 3GICB 3KYGA 1A4WH 4XD7D 4GSOA 2ZFTA 4P00A 2QF5A 2RFKC 1K1PA 3M7QA 5F03A 2F91A 1T8OA 1E36B 5EJ1A 1QL9A 2BD8A 2ZTZA 3H7OA 4U30A 2VIOA 2Z94A 3A7TA 5JB9S 4YT7H 1XX9A 1W14U 1NFUA 1QQUA 2UUKB 1UTNA 2F43B 4I8GA 1QURH 1H9IE 1AGJA 2GCTC 4YT6H 1EAIA 1KLJH 1YPMH 1QB1A 1TA6A 5DP9A 1TMUH 4UE7H 2AYWA 3C1KA 3NXPA 3A7YA 1YPJH 3RLYH 3SNDA 1D3DB 3F0OA 3SV9A 1TX6A 2WYJA 1QRZA 3A7VA 3SJ9A 1FY8E 2GMTC 4Y0ZE 1HYLA 3KYFA 3GY7A 3B8JA 4MDSA 1QA0A 1HAPH 3R3GB 1SPJA 1UTMA 1XKBC 3Q00A 4DURA 2HGTH 1O2ZA 4ABEA 2J2UA 1WBGB 2B0FA 2SGPE 4IMZA 3A7XA 3NUMA 3E6PH 1YCPK 3MMGA 1ARCA 1P2IA 1T8NA 3TJUA 3V7TA 1AFQB 3M37A 1BQYA 1O2LA 2G4UA 5A8ZA 2VH0A 4O3TA 1C1SA 5CDFE 4AX9H 1THRH 2ZU5A 2R0KA 1W3CA 2PUXB 2XOKD 3F2FA 1G30B 1QGFA 2BZ6H 5CHAB 2GDEH 2WV5A 2OK5A 4DG4A 2SNVA 1NM6A 1BA8B 1EZUC 2B9LA 1LDTT 4FUJA 2STAE 2P59A 2YOLA 2ZFQH 2BY5X 2XWBI 1NZQH 3T25A 1DT2A 2TGTA 1IQJA 1SGEE 1MKXK 3OAAD 2W3IA 2ZTXA 1O2VA 1O3JA 1B5GH 5ABWA 3T2NA 3SV8A 2WPKS 1YLDA 3ODFA 5GCHG 1GBKA 1T4VH 1UVSH 1O3OA 5JB8S 4AG1A 2FMJA 1GI4A 1V2ST 4GAWA 1C1VH 1XM1A 1O5CB 1CO7E 1LMWB 1Y5BT 2ALPA 4FVDA 1SQTA 2G4TA 4R8TB 1LVYA 5DPAA 5TJXA 3SYJA 1Y8TA 3SU5A 3SJKA 2CK3D 2BDYA 1UMAH 1O3HA 2YMSD 1O3IA 1LTOA 1P03A 2F9NA 1GI3A 1K21H 2Y81A 1AVGH 2H5DA 1EAUA 3I77A 2ZNKH 3QTVH 3SV6A 1CE5A 3T29A 1O2MA 3RM2H 2G5VA 3EYDA 3SJ8A 2GVFA 1DICA 1WDIA 2J34A 2ZFSA 1CGIE 3FZZA 1MUEB 2BD3A 4KKDA 4ISHH 3TH4H 1BJVA 1C5PA 3AASA 2BY6X 1J15A 2VIQA 3DSPA 4X8VH 3TH2H 1EP6A 1SLUB 1PPEE 1AWHB 3LIWA 3LH1A 1YGCH 2A7HA 1QIXB 4ZKOU 2Z9KA 5KECA 1PQ8A 1WTHD 1HAZB 4Z0KA 2JH5D 4GCHF 3VGCC 4XSKU 4A1XA 1AI8H 1RXPA 2J4IA 5L6NH 3HATH 3OTJE 1AVWA 3MNBA 3SV2H 2PGQB 1P10A 3WWFA 1V2JT 1HB0B 1SKYE 3A8AA 1AY6H 4HI3A 3RXCA 3ZVGA 1AUJA 1DSTA 3EA9A 5AFZH 2PSYA 1BTWA 4Y76A 4K1EA 1HPGA 3RXTA 2VJ1A 4AOQA 1NT1A 1SLWB 1C1NA 1XUFA 2OC7A 4OS7A 4AFQA 1AE5A 1SLVB 3NKKA 3K65B 1MKWH 2J92A 2JJ2D 3SU1A 1ORFA 1FY1A 4FXGH 4TT3D 5HYOA 1HFDA 2FOFA 3I29A 3QO6A 3VB4A 1SGIB 5C0TA 5TCCA 3KGPA 2WPMS 3SJOA 2CV3A 1C1UH 4X1SU 5KGOA 1LO6A 2NU0E 4Y8XA 1S0QA 3BEFB 2CHAC 2XRCA 5DP8A 2P3UB 2BOKA 1KXDA 5DO4H 4IC6A 1BZXE 2GD4B 3A86A 3U28C 2F9VA 2Y82A 4DY7B 4WXIA 4DVAU 1F2SE 1XVOA 2GDDA 3ZVFA 1UVOA 1JWTA 2IJD1 2OCVB 4R0IA 2BM2A 2BLWA 3S9AA 2TRMA 1RTLA 3FVFB 1HV7A 4X2VA 1UHBB 2QN5T 1FMGA 1KLIH 3KN2A 1CA0C 3MH4A 1ELFA 2JKHA 4YESB 6CHAB 3FZDA 1VJAU 2ODQA 1QBOA 3MI4A 1TBQH 3RXLA 1FUJA 4B2AA 1FXYA 1PPHE 2OP9A 1GVKB 2PTNA 1GJDB 2PSXA 3A8BA 3MNSA 1C5ZB 3TJVA 5HKKD 1AIXH 3OTPA 3GCOA 2C8ZB 4ZCNA 1RRKA 1S0RA 3EAJA 4FUEA 4CH8B 1ZHPA 4ABFA 4RI0A 1YKTA 9ESTA 1TYNA 3LGYA 1ZYOA 7LPRA 1P3EA 5ESBA 1BMFD 3D62A 4Y8ZA 2UUYA 4IW4E 2WV4A 3BTKE 3SI3H 1HAYB 4UONA 3RXMA 1L1GA 3SNEA 3KEEA 1BMMH 4VGCC 1ANDA 1BBRE 1ELBA 2ZU1A 2QC2A 3LC5A 2ZPQA 1DOJA 3MO6A 3P70B 2VIPA 3SO3A 1WQSA 1Z71A 3OFND 1FAKH 4JMYA 2R3YA 1RIWB 1OPHB 1T31A 4X6MA 4PROA 2G52A 3A81A 1FPHH 2FI3E 1QB9A 2FYQA 2XWAA 2VIVA 2J9NA 1GJ4H 3A88A 1GMHG 3LDXH 2UWOA 1ANCA 1ELTA 2ULLA 2YNBA 1GBBA 1C1TA 1XXDA 4SGAE 3B23B 1BBRK 1EB1H 2P8OC 2BD9A 3KQBA 3K6ZA 2A1DB 4B2CA 1X7AC 4Y10E 1ZTLA 3SUGA 3F6UH 2HOBA 4AFZA 4IMQA 3GY4A 4B76A 1VZQH 3ZZBA 2ANKH 2ZGHA 3SGQE 1FN8A 3TGIE 4JZ1A 3PRDA 5C17A 4D9QA 1P11E 8LPRA 2F4LA 2WYGA 3RU4D 1C5WB 2D8WA 5JYIA 1J16A 4X8TH 4AYVB 3NK8A 5G4BA 2A4GA 3BEUA 1HXEH 2BVRH 4X1NU 1Z8GA 3VXFH 2QGRA 3BTFE 5FL7D 5GXPA 2W7SA 4BAHB 4MTBA 2H9TH 2ZHQH 1FQ3A 1P2KA 1QNJA 1SGNE 1D4PB 3SNBA 2EY4C 3ZV9A 2HNTC 4BAMB 1GG6C 2AGGX 3QGJA 2V3OH 4XDEA 3P8GA 2YMSC 1GHAG 4NZQA 4RT0A 3V13A 1G2MA 5LH8A 3ZZAA 4BXWA 5EU8A 2J38A 2NWNA 1HCGA 1NFWA 2FIRH 2A2XH 2ZG0H 3LONA 4OS1A 4XBDA 2BD4A 4GUXA 1BOQA 2WPDD 1TX7A 2FPZA 4BAOB 3FP6E 3E3TA 1W0ZU 2F9PA 1YP9A 1ZLRA 1ZSLA 3OYPA 2F9OA 4OS6A 5CMXH 5FCRA 3GY6A 1F92A 1RJXB 1YPLH 1LVMA 4Z6AH 1GHXH 1BTPA 1T4UH 1LVOA 1A5IA 2BVSH 4CR9A 1OKXA 2CF8H 1AQ7A 1YYY1 3M7TA 4JZFH 1JRTA 2V3MA 1K1MA 2AS9A 1MMJN 1SR5C 3SUFA 2L74A 1FY5A 1AN1E 3GY3A 1TOMH 2KCYA 1ZTKA 4ZHAA 2A45B 2BOHB 2VVUA 4E7RG 3VG8A 2F9BH 3D23A 4KELA 1HJ9A 2J97A 4NWLA 1LVBA 4A5TS 3DCLA 3KQEA 5A0AE 3QLPH 1DVAH 2EEKA 1ZJDA 1HAIH 3PO1B 4I8HA 2XCNA 2P16A 1GJBB 1CHOF 1HIAB 3M3TA 3LGIA 1E79D 3UNSA 2BZAA 3RC5A 2WUBA 3ODDA 1K9OE 3CS0A 1KY9A 1O5EH 3A83A 5EG4A 4CHAC 3ATKA 3FANA 5FX6A 5GPIB 3MNCA 5C1UA 3RC6A 1C5VA 2LNCA 3QZQA 5TCAA 5C1XA 3VB7A 4BANB 4WMFA 4X1PU 2VB0A 3BTHE 1H1BA 2WHXA 4TY7A 4CH2B 1MCTA 1GGDC 1NESE 1J17T 3SU3A 1W8BH 4NGAH 2C8WB 3NWUA 1GPZA 1V2KT 3TLOA 1D6RA 2BB4A 2ZI2H 1THPB 1GI6A 1EB2A 1FJSA 3ZZ9A 1CBWC 3K2UA 1UVTH 1GBFA 4U32A 2VVVA 3GCTG 1KSNA 1TBRH 1TBZH 4UDWH 1O0DH 3U8TH 3UB0A 1CGJE 1C2KA 1O5AB 4B71A 4TY6A 3PMHB 5ESTE 2H9EH 2W5EA 4Y11E 3T5FH 2FESH 1L1JA 3NPSA 3U9AH 1C5OH 4JCNA 1C4Y2 2HNTF 2GZ9A 3BTDE 1O2IA 3M5MA 2NU2E 2CJIA 5EQSA 5L2ZH 2GGVB 2PW8H 1IQNA 1E35B 3ATMA 3KQ5A 3MFJA 4MLFB 1C5NH 4WXVA 4AGJA 4QT8C 3E8LA 1V2OT 1V6DA 3PWCA 3MH5A 1GHYH 1V2WT 2BD7A 2AEIH 3WWBA 4DT4A 2EA3A 1GCTB 2DUCA 4MNWA 1BDAA 1E37B 4WH8A 5GNDA 4OS4A 2GV6A 1GBTA 5E0HA 3TK5A 1O37A 1O3PB 2R0LA 3BTTE 4WMDA 4JYUH 1HAVB 1C1PA 1N8OC 2ZGBH 1ZR0A 4FUFA 2CMYA 1WXRA 4BTTB 2FOGA 2NU4E 2KX4A 3LU9B 1YPHC 2PWXA 4IN1A 4ABJA 1O2GH 2PV9B 1PQAA 3PB1E 3W1EA 4NSYA 1QB6A 2J98B 1MQ6A 1UVPA 1C5SA 2G5NA 4NIXA 2BY8X 5A0BA 2Y6TA 4KGAA 4ZKRU 2GTBA 1K1NA 5EQQA 5K7RA 1GI2A 2FTLE 3DT0H 2RG3A 3M5NA 2PKAA 3TGJE 2A7CA 1KDQB 2JETB 3HKJB 2ZU3A 3STIA 1KTTB 3RU4T 2XCFA 4ZKSU 1C1WH 1O3BA 1ZPBA 1C5LH 1DY8A 1DS2E 4DCDA 1TNIA 2GZ8A 1EPTB 2QXJA 2TGPZ 2EC9H 7KMEH 1C2IA 1PYTD 1ID5H 5FCKA 2Q6DA 1BT7A 3FAOA 5JBBS 3EE0B 1BIOA 4B6EA 2VVCA 4D8NA 2R9PA 1RGQA 1KDQA 1AB9B 5T6GA 1SGCA 1EJMA 4CRAA 2QV1A 3SN8A 3S9CA 2BX3A 3BTWE 5C20A 5F8XA 2XNIA 5PTPA 1TRMA 2QA9E 3ENSB 6GCHF 3SI4H 1QJ1B 1Z6EA 4HTCH 1VR1H 4XOJA 1Y59T 1YF4A 4A6LA 4IN2A 4YOIA 3MU8A 1XUIA 1O3NA 3HK6B 3PMJA 5C2ZA 5F53A 4I31A 2Q1JA 1DWBH 3EA7A 1YPEH 4AC9A 3IG6B 3BTQE 4YZUA 2O8LA 5J4SA 1SHYA 3DFJA 2I6QA 5EPNA 1Y3VA 2W3KA 4K60A 3SGBE 3SW2B 2PHBA 3ELAH 4K5ZA 4GPGA 1O32A 1TIOA 3ZZ5A 3RXUA 4AGKA 1UW7A 3ZZ6A 1HUTH 1SGPE 3T27A 3Q76A 4ISNA 1UK4A 1WCZA 1NTPA 3DHKH 1DWEH 1A0JA 1M9UA 1EQ9A 2O8TA 3MTYA 3SOSA 1N1LA 3F9EA 5FX5A 2ZTYA 4U2WA 3C27B 2G81E 2ZC9H 3STJA 2VGCC 5FBIA 8GCHF 1GI1A 1SLXB 1SB1H 1EAWA 3LPRA 1G36A 2ZCHP 3M5LA 4B75A 3BG4B 4X2WA 2ZKSA 1MAYA 2H9HA 1O39A 2CN0H 5DK1A 1Y3UA 1OS8A 3PYHA 3P6ZB 1VITH 1DXWA 5T1VA 3DSGA 2BXUH 1Y5AT 1FY3A 1S5SA 3QUMP 2BDBA 2TIOA 4UFEH 1D3PB 5HM2A 1TB6H 1DUEA 3KL6A 1F7ZA 3UWJH 1EOLA 2BXTH 1O2UA 4ABIA 1NBMD 2GCTB 4I86A 1EJNA 5L30H 1T8MA 3MH7A 3UR9A 3S0NA 2A4RA 1FDPA 3N7OA 1GBHA 1DSUA 2BYAX 2ODPA 4K2YA 1SGRE 1TGBA 1ZJKA 2JJ1D 2VNTA 1IQMA 1AO5A 2LELA 3GY2A 3MO9A 5HIZA 1B7XB 4B2BA 3T26A 1O2KA 2A2QH 1WV7H 2HLCA 4XBCA 1TNHA 1OSSA 1G37A 1C2JA 1GHWH 1TA2A 4X0WU 1ELDE 1TPOA 4AFSA 5HIYA 4GCHG 4I32A 2Z9GA 4WVPE 1GL1A 1O2PA 1K1IA 1MTNC 1F0RA 4H42U 4CR5A 1F0UA 1UCYH 4DJZB 2QF0A 4BAKB 1GJ9B 1V2NT 1DM4B 3HKIB 2RDLA 3GY5A 1O30A 4NZLA 1P9UA 1YPGH 2QY0B 3BV9B 1ETRH 1UCYE 1XXFA 3UUZA 3ZVDA 1KXFA 1LKAA 3KQCA 2PGBB 4TPIZ 4YOGA 5LGOA 1NO9H 1COWD 2FTMA 3RC4A 4E05H 1O2TA 3L33A 3ZZCA 1GBLA 1TRNA 1ZRKA 2AGEX 2XBXA 4AORA 3UNRA 4LZ1H 1IQFA 3MNXA 1O3KA 2ANWA 2BDAA 3PLKA 4THNH 4AFUA 1QR3E 3S69A 3MO3A 1D3TB 3V3MA 1O2OA 2ZGXH 4INLA 3TH3H 3VEQB 3RMNH 4TSFD 4X6NA 3FOAA 2JIZD 2ZZUH 1YY3A 5DSFA 1UTKA 2IN2A 2AIQA 5FXLA 1YLNA 3TU7H 1P01A 1V2UT 3A8CA 1HAXB 4ZUHA 1MU6B 5I46H 2OD3B 3VFEA 1O3AA 3Q3XA 3CS7A 5H4IB 1Y3WA 3S7KB 1S6LA 2VWNA 2Z6BD 1BRBE 1O5DH 1W10U 1G2LA 2SGFE 4J1YA 3PV5A 3HGPA 1E1RD 1KXAA 3RXKA 4OGXA 5EOKA 2SNWA 3M3SA 1OWIA 2HWLB 2G51A 2STBE 1NY22 4X1QU 1PQ5A 1SGDE 1G3DA 4AYYB 1PPFE 3ZIAD 1RFNA 4NWKA 3CENA 1AU8A 1BHXF 1D3QB 1JIRA 4OGYA 2Z3DA 1FNIA 5FHTA 4X8SH 3W95A 4A1VA 2BY7X 1H8DH 1MKWK 4B6FA 1FY4A 1ZMJA 1PFXC 4JZIA 3PMBB 1BTHH 5CE1A 2QYIA 3BTME 1O3MA 3VGCB 2Z9JA 3QGNB 4IBLH 1D9IA 1ELEE 1PYTC 3OY6U 1O35A 2FS9A 1RTFB 5IDKA 4ZXXH 4O03A 1S81A 1HJAC 3P8OA 4JYTA 1MCVA 1VITF 1ESBA 3T28A 4K8YA 2FOAA 3FN8A 1TPPA 3RXQA 2ZPSA 1QBNA 2Y80A 2ZFPH 5JBCS 4LZ4B 1ELAA 1OYTH 2FOBA 2XC0A 4YOJA 1O2RA 1CT0E 1UHBA 2XYAA 3KHVA 4B1TA 1L4DA 2V0BA 2B7DH 4DOQA 2ZU2A 1GJ6A 5FAHA 5JPMH 4RN6A 3RXEA 2WUCA 4YM9A 1GMDF 3FFGA 2BQ6B 4DW2U 1O3GA 1S84A 1EFRD 3F0PA 1MBMA 4ABBA 3DSOA 2UWLA 3BN9A 2FX4A 1B0EA 4I8KA 3GYLB 2ZF0H 3V0XA 1IQLA 1UTJA 3LT3A 2ZHWH 5DJ7A 1A7SA 1W0YH 1W7GH 3VB5A 4ACBA 4FOUC 1AE8H 4RKOB 2CHAB 5GJ4B 1TGNA 1MTSA 2BTCE 1ZMNA 2THFB 4ZHLU 4MQAA 1O2HA 1TPSA 4UD9H 1TNLA 1DE7H 4KTUA 1GDQA 2AGIX 4DGJA 4Q7ZA 2FWWA 1Q3XA 4CRBA 1U6QA 1OWEA 2K8IA 1HAHH 4ABHA 2TGAA 4H4FA 3F9HA 4MNXA 4NCYA 2HNTE 2ZHDA 2HRVA 1QL7A 1C2HA 2OUAA 3OEHD 1O5FH 4LK4A 3TJOA 4F48B 3CP7A 2VIDA 1P2JA 3U1JB 1CA0B 4YTAA 1SQAA 2WPLS 2WV9A 2GCHF 1V2TT 4AG2A 3PLBA 4CRCA 2RDEA 2H5CA 1C4U2 3RXIA 1PPZA 1GDNA 2KAIB 4J2YB 3F68H 3DA9B 6LPRA 5EQRA 1O3LA 1QRXA 2ZU4A 3VXEH 4Q80A 3O8DA 1TAWA 2G55A 2C8XB 4LXBH 1IHSH 3BIUH 2ZDNA 3A85A 1O2SA 3SNAA 3K9XB 4TYDA 1GBEA 2WPJS 4X8UH 1AKSB 1A5GH 1P02A 1P2QA 1YCPM 2QXHA 4NG9H 5C67A 1C2FA 1QCPA 1LKBA 4CBOA 2A0QB 2H1UA 3U69H 2A7JA 3SZNA 2OC0A 2P95A 3ATWA 3IWMA 3LGWA 1SG8B 1CHGA 2AMPA 1ZRBA 2BMGB 2C93B 1C5QA 1BTXA 1VGCC 2VWLA 3NRLA 4MNYA 5DP4A 3TITA 4VGCB 3NCLA 3UPEA 5J4QA 3OE7D 2UUJB 1TGSZ 1ELVA 1OX1A 2WPIS 1GHVH 3RMOH 3SUDA 3F2HA 1EP5A 4AN7A 3ZZ4A 2BY9X 3S9BA 3TK6A 4ZKNU 1P2MA 3RXOA 4O3UA 3TNTA 2FOHA 1GVZA 3RXJA 4X2YA 3DUXH 4Y0YE 1QQ4A 2EI6A 5DP7A 4Y6DA 3PV2A 4GVUA 2ZDVH 2VIWA 1UVUH 2HPQH
chains in the Genus database with same CATH topology
3K6YA 1CHOG 2Y5FA 2HALA 2P93A 4Y7BA 1SBWA 2P8OB 3B9FH 1OWHA 4TPYA 1J8AA 1O31A 4AB9A 4Y71A 2J94A 3GDSA 4ISLA 5GWZA 1IQEA 1K1OA 4RSPA 4K8BA 5LPRA 2BLQA 1W2KH 3OX7U 3R0FA 5AVDA 1LHFH 2J95A 3AW1A 4X6OA 3V12A 2QF3A 4FUHA 5C5NA 4MPXA 1MAXA 4XE4A 4UEHH 1QJ6B 1Z1IA 2UUFB 4ZH8A 2ESTE 5LPFA 3E16B 2QXIA 1VCQA 2FO9A 1OP0A 2ZGJA 1GG6B 2AMDA 1VCPA 1NU7B 1BRAA 3RMLH 1K1JA 2ZCKP 5EW2H 4X2XA 1HIAA 3GISB 3A7WA 5EGMA 1A2CH 2CF9H 2FDAA 1L2EA 2PTCE 4Y79A 4NA8A 1TPAE 1GBJA 1GJ7B 1O2XA 1L0ZA 3E90B 4BTUB 1LQEA 3QWCH 4ASHA 1SOTA 5L2YH 2ASUB 4NA9H 2GT7A 3GCHC 1O2YA 5DP3A 2BDGA 3HK3B 2BQ7B 3MH6A 1JRSA 1KXEA 1TMBH 2ZIQH 4ZXYH 2XXLA 3LGUA 2OQ5A 3TNSA 2RA3A 1NPMA 1UTLM 2ZCLP 4I33A 2V6NA 2WPHS 3P8FA 1GMCF 1TOCB 4K3JA 1YPHE 3GY8A 3SUEA 2XC5A 2SFAA 5EPYA 1V2VT 1V2PT 5E0GA 2BVXH 1OP8A 5HM9A 1TNJA 2C8YB 2ZP0H 2FLRH 8ESTE 4NA7A 4WF8A 1HDTH 1GHBF 2K1QA 2OLGA 1PQ7A 1HLTH 5F8TA 3PTBA 3O8RA 4YLQH 1A3EH 4JZEH 5B6OA 2FXRA 3BTEE 2C90B 4U01A 5GDSH 4K1TA 4MG3A 1P0SH 1P2OA 2BLOA 2BDIA 1C4V2 1Y3YA 2VWMA 1P05A 3ZYEA 4CHAB 5F8ZA 3RXFA 2ZGCA 3E0NB 1A61H 2O8MA 4ESTE 4FUGA 3PROA 2IPHA 1WUNH 3ZZDA 2A32A 2ZPRA 2G00A 1WSSH 1UO6A 1EX3A 1FLEE 2RA0A 2BX4A 3W94A 2C3SA 1TFXA 3E0PB 3A82A 2FOCA 3LH3A 4NFFA 1HAVA 4K1SA 1GGDB 1W7XH 3BG8A 2AFQB 1GJ8B 1SC8U 3UREA 3LGVA 1MTVA 2ZECA 3TJNA 5EXLA 2AERH 1K2I1 1RTKA 2O9QA 3Q3KA 4BTIB 4FUBA 4SGBE 1DX5M 1O2JA 1CBWB 1HAGE 1ZPZA 3M3VA 2OTVA 3P92A 4Y8YA 3D49H 1A3BH 1XVMA 1AFQC 1UTPA 4X6PA 1TE0A 3MU5A 5DG6A 3RU4E 5A8YA 2AMQA 5C5OA 2VU8E 2M5TA 9LPRA 1HBTH 1SOZA 2V3HH 3RXHA 1YPKH 3QN7A 2Y7ZA 6GCHG 3LOXA 4O97A 3D65E 5CHAC 1SQOA 1Y5UT 2PR3A 3SQEE 3TK9A 4GHTA 2BD5A 1XUKA 1E38B 6ESTA 4O9VA 1VJ9U 4A92A 1SFQB 2ZQ1A 2QCYA 3Q3YA 3AW0A 1JXPA 1NRPH 4JYVH 1ANBA 1P12E 1KYNA 1EPTA 2DE8A 1FIZA 1UTQA 3RXBA 3MU1A 4DIIH 1L4ZA 3A89A 4GLYA 2BD2A 3KF2A 3GDUA 1TWXB 3UQVA 1XUHA 2B8OH 3LJOA 1ELGA 5HXFA 4NIWA 1YCPH 3PMAB 2Z9LA 1AFEH 2AIPA 4LOYH 1FAXA 3E1XB 1N8OB 1GJ5H 2NU1E 1GBMA 1NN6A 3LGTA 1A0HB 4UFGH 3SV7A 2QXGA 1O2WA 2OINA 4D7FA 1C5MD 1BJUA 1GBCA 1V2QT 2GKVE 5EW1H 4ISIH 4GHQA 2WINI 3H5CB 3UOPA 4HGCA 3RXVA 2LPRA 8GCHG 1SSXA 4WJG2 2PKSB 5E2OA 8KME2 1ZGIA 1W13U 1GWAA 3A8DA 1LPGB 5T3HA 3WY8A 3EA8A 3RLWH 2ZWLH 4INKA 1MKXH 2ZDAH 2G8TA 5FBEA 4ABGA 2FI4E 3DD2H 1G3BA 1RS0A 3RMMH 1DWCH 1DPOA 3GYMA 3KIDU 1FV9A 2H2ZA 3ITIA 2R2WU 3JZ2B 2ANYA 1LCYA 4NIVA 2PUQH 4YLUA 1S6HA 1W12U 1KTSB 2ANMH 1SGQE 1F5KU 4ISOA 1FPCH 4RKJB 1EKBB 1AMHA 2PLXA 2XTTB 1NS3A 1BITA 2FODA 3A80A 1C5TA 1LHGH 1PPBH 2CGAA 3P8NA 2ZO3H 1DY9A 1UK3A 2FEQH 4H6SB 2A5AA 1YBWA 2ALVA 1S6FA 2PFEA 3AAUA 4CRGA 1O38A 4KTCA 1NRNH 1ESTA 5FPSA 2TPIZ 4KTSA 1C1MA 1G3CA 1WQVH 4NFEA 4XFQA 5IYTA 1GVLA 1KXBA 2ZA5A 1PPCE 3IITA 4CRFA 1EUFA 2GMTB 3M5OA 1CT2E 2BLVA 2XBVA 1P3CA 4I7YH 3ZVCA 2SGEE 3GDVA 1CT4E 1EAXA 1T8LA 1GBDA 3EGKH 4YO9A 3SBKA 3L6PA 5GCHF 3Q77A 1GHZA 1ZZZA 1O5GH 3VB6A 3TIUA 3SHAH 4FUIA 2D1JA 1BRCE 5E8EH 1W11U 1GI0A 1BCUH 1AZZA 2CXVA 1DWDH 1SL3A 2A5KA 1P9SA 1BMLA 1ZTJA 3SHCH 3MYWA 4WH6A 3UOUA 4A7IB 2A4OA 1H8IH 1O2NA 3TVJB 2ZEBA 2VGCB 1C5RA 1TX8A 1TMTH 5LPEA 1PJPA 1OYQA 3MU0A 3UR6A 1OWKA 1EASA 1SGFG 2D2DA 2D26C 2XBYA 4M7GA 1G32B 1S85A 4E06H 4E7NA 2OC8A 1NU9A 4F49A 5C3NA 1SGFA 1O3DA 3TPIZ 1C1RA 1A0LA 1CA8B 4BAQB 2OC1A 2FS8A 1DDJA 6CHAC 1KLTA 3ATLA 1F5LA 5JDUB 3LC3A 4D7GA 3SNCA 2FYRA 5A0CA 3BF6H 1SMFE 1IHTH 1FIWA 1BHXB 1Z7KA 3SORA 3KNXA 3ZZ8A 1UCYK 4UFDH 4I8JA 3O8CA 5AF9H 2FOMB 3QX5H 3UY9A 1CQQA 1NFXA 4MPVA 1FONA 4IGDA 5DP6A 3U8OH 5EODA 1RD3B 5JBTA 4XBBA 1BB0B 3S7HB 2FP7B 1G3EA 3KCGH 1C5UA 1AZ8A 1KIGH 1ABIH 4NSVA 1BTYA 2BHGA 1OXGA 2B5TB 3RDZA 1NRRH 2XBWA 2EI7A 1CU1A 4CREA 1FN6A 4OS5A 1PPGE 3SU6A 4FU8A 3PV4A 1GJAB 3LJJA 2XC4A 4B73A 1IOEA 2ZDKA 1DLKB 1MTNB 1OP2A 4D76A 3ESTA 1TNKA 1Q2WA 4ZHMU 1EXFA 1SI5H 1VITG 1RIWC 3EQ0H 5GIBA 2OXSA 1H9HE 5FPTA 3RXPA 4A1TA 4DIHH 1QJ7B 1ZSJA 2V35A 1K28D 1NFYA 1C9TA 4MNVA 3I78A 2W7UA 1C2GA 2VINA 1SHHB 1ZPCA 4HZHA 1SFIA 3M35A 1TQ7B 1NRSH 1QHRB 5E2PA 3E91A 4Q7YA 1C2EA 3F9FA 3GOVB 1LHDH 1V3XA 1K22H 1GMDG 2VWOA 3SU4A 2UWPA 1QY6A 1QTFA 3MOCA 1AHTH 1QA7A 1MZDA 1O34A 1SGTA 1CGHA 3UFAA 3P17H 4MVNA 1MD7A 1MD8A 1T7CA 3PM3A 1HNEE 1O5BB 1CVWH 2BDCA 2FM2A 2AH4X 1GDUA 1GBIA 4MPUA 1O3FA 2TGDA 3URCA 3ZV8A 1QL8A 1P8VC 3RM0H 3ZZ3A 1G9IE 2ZHEH 3ZVAA 2P3FH 4NIYA 3UQOA 3SJIA 1THSH 1V2LT 4JZDH 1MTUA 2F9UA 1HXFH 1FI8A 5JBAS 1BTUA 1NROH 3M36A 1BBRH 1BMAA 4D9RA 1DANH 1GCDA 1C2LA 1TQ0B 2VH6A 4BNRA 4FUDA 1TGTA 2Z3CA 1ESAA 3ZYDA 1LQDB 3F9GA 2Q6GA 1ZHRA 3RXRA 5C1YA 3OU0A 3FP7E 2GCHG 1Y3XA 1LHEH 5ETXA 3U1IB 3BSQA 3URDA 1GI7B 4ZROA 3ZZ7A 4CBNA 1TALA 4B74A 2O8UA 2A4QA 1KXCA 2FOEA 3SU2A 4AB8A 2HVXA 1C5XB 3F1SB 1C5YB 1EZQA 1P09A 1TRYA 2Z3EA 3DFLA 1V2MT 3U98H 2ZHFH 1Z8IB 1TGCA 2ILNA 1HJAB 1LPKB 2Y5HA 5SGAE 5T6FA 2IJOB 4CRDA 1P06A 1TABE 2ZFFH 2HPPH 2F3CE 1A1RA 2ODYB 1ZHMA 2O8WA 3P95A 1VCWA 1DFPA 1XMNB 1AUTC 1L1NA 2FLBH 3BIVH 1GMHF 1JBUH 1OWJA 1QBVH 4AZ2B 3A87A 3PO1C 1IQIA 3OSYA 2JH0D 1WOFA 4I8LA 2BQWB 5BRRE 2OBOA 1O3CA 1NRQH 2KAIA 2P3TB 3KQDA 1E34B 1AWFH 2A5IA 1HRTH 3EDXB 1C1OA 1S83A 1AD8H 5T6DA 1WU1A 3QTOH 1C2MA 1MBQA 2GX4A 2Y5GA 1AKSA 3ZVEA 1IQGA 4BOHA 3RXGA 3VB3A 1ELCA 5FPYA 3U8RH 4INHA 1JIMA 3SGAE 1ZOMA 4WWYA 5AHGH 1DITH 1F5RA 2YNAA 4Q7XA 4ABDA 1XUJA 4OS2A 3HGNA 3HPTB 1EOJA 2C4FH 4KP0A 1UJ1A 1MQ5A 1LPZB 5F6MA 1GHAF 1GI5A 2DE9A 4FUCA 2OQUA 4IS5A 4TWYA 5K0HA 1K1LA 4BXSA 1INCA 1SVPA 2ZDLA 2ZDMA 4HFPB 1H9LB 1WAYB 4WY3A 4FU9A 5DP5A 2I6SA 1GJCB 1GI8B 1FZZA 5I25A 2P94A 5A2MH 1Z1JA 4DT7B 1QFKH 3QDZB 4ZMAH 2EI8A 2FI5E 2Q6FA 1HGTH 1O33A 3UIRA 1O3EA 1GCTC 1HAOH 3RP2A 1D6WA 1WYKA 3PTNA 1YLCA 4K69A 4X1RU 3MHWU 1WTGH 1CSOE 2FX6A 2RCEA 1DXPA 1EZSC 1Z6JH 3MWIU 3TGKE 3QZRA 1GI9B 3BEIB 1Z8RA 2R2MB 2JH6D 4Q2KA 3QK1A 4ZAEA 1HJ8A 1ABJH 1GBAA 3RXDA 2Y7XA 1LHCH 1MU8B 3O8BA 1P57B 1VGCB 2GP9B 1O2QA 3RUOA 3A7ZA 3LKWA 5EXMA 1BUIA 1C9PA 3UWIA 5A8XA 1GL0E 4JK5A 1NC6A 2ZFRH 1O36A 3VPKA 3AAVA 4ABAA 1GMCG 2XW9A 1ETTH 1A46H 5E0JA 1C2DA 2JETC 3OY5U 4FU7A 5EXNA 2Z7FE 3GCNA 3G01A 1GHBG 2GZ7A 3ZVBA 1EZXC 1V2RT 1EPTC 1Z8JB 2GT8A 3M7UA 1E0FD 4MPWA 1ZMLA 1ACBE 4Y7AA 4FVBA 4JK6A 3UTUH 7ESTE 3GCTF 1N6YA 1XKAC 1XUGA 1Q31A 1AB9C 1BMNH 1P2NA 2R3UA 1EJAA 5A09A 1ZSKA 3SQHE 1S82A 4UFFH 1JMOH 2IOTA 5DGJA 1MZAA 3L3TA 4TWWA 2NU3E 1TNGA 2Z9IA 1OWDA 4IC5A 1EATA 3A84A 1H4WA 1SGYE 1T32A 4H6TA 2H6MA 1A5HA 3FP8E 1QRWA 1J14A 1IAUA 1F0TA 2SGDE 1OOKB 2OBQA 1ZGVA 3ATIA 1ANEA 3SU0A 3RXSA 2TBSA 1B0FA 2PKAB 5HMAA 1P04A 1UTOA 1JOUB 1TLDA 2ZQ2A 1MH0A 1MTWA 5DKMA 1N6XA 5HGGA 3JZ1B 2QIQA 5AFYH 3NZIA 2SGQE 3PLPA 1BTZA 3BTGE 2A31A 2W26A 3UNQA 7GCHG 3GCHB 5BPEA 2PKSC 1BRUP 1J9CH 1TONA 4F4OC 1YC0A 1ARBA 3MU4A 3PWBA 2BDHA 2F83A 2GV7A 1F0SA 3T62A 1IQHA 1UK2A 1IQKA 3H7TA 2SGAA 3RXAA 1YM0A 2QAAA 7GCHF 1AVXA 4WMEA 1ETSH 1C1QA 3AVZA 3M61U 1DLEA 2FZZA 3BG4C 1DUAA 3GICB 1A4WH 4GSOA 2ZFTA 1K1PA 3M7QA 5F03A 2F91A 1T8OA 1E36B 1QL9A 2BD8A 2ZTZA 3H7OA 4U30A 2VIOA 2Z94A 3A7TA 5JB9S 4YT7H 1XX9A 1W14U 1NFUA 1QQUA 2UUKB 1UTNA 4I8GA 1QURH 1H9IE 1AGJA 2GCTC 4YT6H 1EAIA 1KLJH 1YPMH 1QB1A 1TA6A 5DP9A 1TMUH 4UE7H 2AYWA 3C1KA 3NXPA 3A7YA 1YPJH 3RLYH 3SNDA 1D3DB 3SV9A 1TX6A 2WYJA 1QRZA 3A7VA 3SJ9A 1FY8E 2GMTC 4Y0ZE 1HYLA 3GY7A 3B8JA 4MDSA 1QA0A 1HAPH 3R3GB 1SPJA 1UTMA 1XKBC 3Q00A 4DURA 2HGTH 1O2ZA 4ABEA 2J2UA 1WBGB 2B0FA 2SGPE 4IMZA 3A7XA 3NUMA 3E6PH 1YCPK 3MMGA 1ARCA 1P2IA 1T8NA 3TJUA 3V7TA 1AFQB 3M37A 1BQYA 1O2LA 2G4UA 5A8ZA 2VH0A 4O3TA 1C1SA 4AX9H 1THRH 2ZU5A 2R0KA 1W3CA 2PUXB 1G30B 1QGFA 2BZ6H 5CHAB 2GDEH 2WV5A 4DG4A 2SNVA 1NM6A 1BA8B 1EZUC 2B9LA 1LDTT 4FUJA 2STAE 2P59A 2YOLA 2ZFQH 2BY5X 2XWBI 1NZQH 3T25A 1DT2A 2TGTA 1IQJA 1SGEE 1MKXK 2W3IA 2ZTXA 1O2VA 1O3JA 1B5GH 5ABWA 3T2NA 3SV8A 2WPKS 1YLDA 3ODFA 5GCHG 1GBKA 1T4VH 1UVSH 1O3OA 5JB8S 4AG1A 2FMJA 1GI4A 1V2ST 4GAWA 1C1VH 1XM1A 1O5CB 1CO7E 1LMWB 1Y5BT 2ALPA 4FVDA 1SQTA 2G4TA 4R8TB 1LVYA 5DPAA 5TJXA 1Y8TA 3SU5A 3SJKA 2BDYA 1UMAH 1O3HA 1O3IA 1LTOA 1P03A 2F9NA 1GI3A 1K21H 2Y81A 1AVGH