3MOCA

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. eighth stage of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mocA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mocA01
1GMDF 2XCNA 1ZTLA 4B1TA 2Z6BD 1ETSH 1HDTH 2ULLA 1C2GA 2GCHG 2O8WA 1O33A 4BANB 4HFPB 1EUFA 4JYUH 2STBE 2I6QA 4TY7A 4YLUA 1O2OA 1SGQE 2QC2A 4I8GA 2WYJA 4ABFA 1O2ZA 3MO9A 2BY5X 3SUDA 3SO3A 1W0ZU 2EI6A 2GP9B 3KIDU 1O3HA 4Y8XA 5HXFA 2RDLA 2VVVA 3UNSA 2ANMH 1AN1E 4H6TA 1TALA 5EXLA 4OS5A 4JZDH 5HMAA 1PPBH 2R2MB 2WUCA 2G55A 3ZVGA 1W7XH 2XBVA 1AFEH 1OWKA 1KDQB 1T31A 4AFSA 1BJVA 4X1QU 1SGCA 3ZVEA 5GDSH 6CHAC 2GCTC 5C67A 5ESBA 1QQ4A 4GCHF 2OTVA 3RXBA 1CT2E 4ZH8A 1UMAH 4Q7ZA 2ZDLA 4OS4A 4TYDA 3VFEA 2UUJB 3A86A 4FUEA 3EGKH 2ZKSA 1AUTC 1FQ3A 5E2OA 4FUDA 1EKBB 1RTKA 2HRVA 1K1JA 2JH6D 3GDUA 4WMFA 3V7TA 3M3VA 3T28A 1MZAA 1SHYA 2AGEX 2Y5GA 2PWXA 5AHGH 1E36B 2W3IA 3QTOH 2B0FA 1OP8A 2ZHWH 4HI3A 1GVLA 1O2RA 3LH3A 1NT1A 3WY8A 3LU9B 2WV5A 1TGCA 1WQVH 3HPTB 2UWPA 2BD5A 1HJ8A 4X1PU 2R3YA 4U30A 1GBMA 4MNYA 1AZZA 1LHDH 2A2QH 1BBRK 3MU0A 2XC5A 2ZG0H 4CHAC 4NA9H 4R8TB 1GI7B 1P01A 4TWWA 5FCRA 4E7NA 2ZQ2A 2BVRH 2ZFSA 1J17T 1N8OB 1QL7A 1C5LH 3HK3B 1C5SA 3SU3A 1F5RA 3NZIA 3FVFB 1C5NH 1CGHA 1FV9A 3RXTA 3T62A 1ZMLA 3FANA 1UVTH 1TA2A 2Z94A 1K22H 1SQAA 1UTLM 3OU0A 4GCHG 3VEQB 1ELFA 5JBCS 3GY4A 1C9PA 3B23B 3GCOA 3TJVA 3TNTA 4XBDA 2FYRA 1C5MD 2AH4X 4B74A 4I32A 3SQHE 4Y8ZA 5FBEA 2F83A 2FIRH 2QCYA 5T3HA 1GBIA 2O8UA 1O5GH 4X1SU 5T6FA 1E0FD 4ZKNU 1C2DA 1P9UA 1XXFA 3TLOA 5A8ZA 2XC0A 1IQGA 1C1PA 3SJKA 2HNTE 2P95A 3BTQE 1GHAF 2P16A 1S5SA 1EXFA 4BAQB 3SI3H 3PMJA 1TNKA 1O3MA 1Z71A 1EJAA 1UJ1A 3BG4B 3ZZ6A 4DOQA 1P03A 3MOCA 1KXBA 2ZCHP 1QRZA 2AGGX 3KCGH 4LZ4B 2AMQA 1LCYA 4F49A 3W95A 1G9IE 2A5AA 3M5NA 3PO1B 5FAHA 1W14U 8GCHG 3E1XB 5LH8A 2VVUA 1TGNA 1H1BA 2Z9LA 1ESBA 3AAVA 1D6RA 1XMNB 1DM4B 1MTWA 2O8LA 2J34A 1LPGB 3ZVCA 2ZFFH 1YLDA 3P8FA 3SJIA 2BLWA 4ZAEA 3Q77A 3A7VA 3ELAH 1MTSA 4GSOA 1RJXB 1DXPA 3DFLA 1O2YA 3BTDE 4X6OA 5L30H 1VGCC 2LPRA 2QAAA 1EPTC 1CA8B 2AERH 1KLIH 1GVKB 1CSOE 3UR6A 4CRAA 3BSQA 1RGQA 1SOTA 4A1XA 1KXDA 2XCFA 4DJZB 4IN2A 1C5YB 2I6SA 2KAIB 4BOHA 2XBWA 5TCAA 1DXWA 1P2IA 1E38B 2CF9H 1MKWH 2GDDA 2FOHA 2FI5E 2FTLE 4Y79A 1NRRH 1BRBE 1OWEA 1TPPA 1V2KT 3LKWA 1BZXE 4AFQA 1XUGA 1L4DA 1ZSLA 2B8OH 3GY5A 3GCTG 4IC6A 4FU9A 2TGAA 4DIHH 1P12E 1HUTH 1IQNA 2FESH 5EG4A 3RU4D 1H9HE 1TBQH 1YPEH 3ODDA 3W94A 4I8LA 1HAHH 3A88A 3RXVA 1O5FH 2CF8H 5CE1A 1YP9A 3GISB 1AFQC 1GMHF 4XE4A 1LQDB 1XVMA 1IQHA 1ZOMA 3MO3A 1BTZA 3ZZ7A 4XFQA 1M9UA 2H2ZA 2FXRA 3HKIB 1GI3A 2F9PA 2G8TA 4JYVH 2DE8A 4KTSA 4Q7YA 1NRPH 1FXYA 2BD8A 1EZSC 1SHHB 2V3HH 3BEFB 1EB2A 5AVDA 1AKSA 1YPKH 2BY7X 1KXEA 5I46H 4CRDA 4DIIH 4LZ1H 1ZGVA 4ABHA 4FUGA 3Q3KA 1F0TA 1ZJDA 5C5OA 2ZGXH 1PQAA 3BTME 3MTYA 1F0RA 2FO9A 1DOJA 3LOXA 3SZNA 1IOEA 1BQYA 2A31A 5DP3A 3ZVFA 1HAZB 2FTMA 2EEKA 4NFEA 4GUXA 4B76A 1J16A 4UONA 3RU4E 1KXCA 1P04A 1EAUA 1GWAA 3ZZ3A 3E0PB 2C8WB 1NO9H 3PMHB 3SU6A 1OSSA 2FI3E 2A4OA 2ZGCA 2ZTXA 4INKA 4I8JA 3GCHC 1P0SH 4TWYA 4PROA 1PPGE 2NU4E 1TMTH 2ZCLP 1KDQA 1LPKB 5EPYA 1AQ7A 2GMTB 1NM6A 3KL6A 2UUYA 1XKAC 2ODYB 4AX9H 1TRNA 1RRKA 3BIUH 5C1UA 3QGNB 1XUHA 1D3QB 2CV3A 3CP7A 1WYKA 2FI4E 4B75A 3M37A 2P59A 5H4IB 1BBRE 4XBBA 3T25A 1QL9A 4MPXA 4ISIH 1L1GA 1V2QT 1OYQA 1SLXB 1ZLRA 4A6LA 4AGKA 1IHTH 5PTPA 2PUQH 1S81A 2ZC9H 2ODQA 1BTPA 4WH6A 2BY9X 1Z8IB 3UOUA 2TGPZ 3ITIA 3KQBA 1BRCE 4X0WU 5DP4A 3UREA 1ZHPA 1RTLA 4YTAA 5CMXH 4DGJA 3B8JA 1MBQA 2VINA 1XUJA 4BTTB 3URDA 3TNSA 2VWOA 1O3IA 4UEHH 2JETC 4CRCA 4VGCC 2Z9KA 3BF6H 1TE0A 1K1OA 1P3EA 1S83A 2ZEBA 4WJG2 3M61U 3RXPA 4OS6A 1W8BH 1Y3XA 1G2MA 4Y10E 5DJ7A 1DITH 4X2YA 1BA8B 1JWTA 4CR9A 1TOMH 4IW4E 4BTIB 3BTKE 3O8RA 4BNRA 1TX8A 2VVCA 3TJUA 7LPRA 2FOAA 1F7ZA 1FIWA 1C2HA 3IG6B 1KLTA 1HAXB 1WQSA 5FBIA 1HV7A 2FLRH 1AI8H 1FAXA 1L0ZA 2ZDVH 1O5CB 5E2PA 1QCPA 1BRAA 1VCPA 1D4PB 3M7UA 2CHAC 1EP6A 1ETTH 3KN2A 1O2UA 2FS8A 3E16B 1CO7E 1PPCE 1S82A 2GDEH 3P17H 1DDJA 1IQLA 3S0NA 1O3LA 4AFZA 4B2CA 3E8LA 3A82A 4X6MA 5IYTA 3RDZA 3RXRA 4B73A 3TH3H 2NWNA 1DT2A 1O2XA 2FWWA 1AD8H 1ESAA 8KME2 2BXTH 3R0FA 3VGCB 2ZFRH 3SNBA 4Y6DA 5G4BA 1T8OA 3S7KB 2Q1JA 1ELCA 1GJAB 1TLDA 4MNWA 1HAGE 3VB5A 1D3TB 1JIRA 1T4VH 2R9PA 1UCYE 1DWEH 2F3CE 3VB4A 3KHVA 1ANBA 2VIQA 3UY9A 2QYIA 1CBWB 1EAWA 1QTFA 3ZV9A 2PR3A 1XM1A 2PUXB 3QDZB 3LPRA 2PGBB 1P06A 4X1RU 1O30A 3HGPA 2RA0A 4KELA 3RMMH 4CRFA 1TNJA 4MVNA 2BHGA 4FUJA 3PLPA 1LVOA 4E05H 1SGFG 1TNIA 2SGFE 1O2VA 4GVUA 1X7AC 1FPHH 4AOQA 2ZHQH 1GBCA 5FX5A 1AIXH 3VB7A 2QXHA 2QV1A 1TGSZ 3M3TA 5JBBS 3MH7A 1MH0A 1A4WH 5EOKA 4X6PA 3BTEE 3T27A 3P8NA 4J2YB 2A1DB 5TCCA 2TPIZ 3O8CA 1ORFA 2ZU1A 4ZROA 2GZ8A 3CS0A 1VCQA 1MKXK 2XBXA 1TFXA 2IOTA 1SMFE 4IMZA 3QTVH 1C5QA 5EXMA 3PROA 1W12U 5LGOA 1G3DA 2GVFA 1O2NA 1V6DA 4U32A 2B5TB 2M5TA 1CT0E 2G00A 4ZHLU 4NSVA 1V2PT 2FLBH 1GL1A 1Z8GA 3F6UH 3HK6B 2Z3EA 1ESTA 1TNLA 1GGDB 2ZU5A 1LVYA 7GCHF 3GY6A 3RXSA 3SV7A 4O3TA 3SNEA 3BTGE 1O2QA 4CH2B 1SFIA 1THRH 1OWJA 1ZPZA 3M5OA 1EOLA 5A8YA 5DK1A 5HM2A 4AFUA 1TQ0B 2EA3A 2GCHF 4Y76A 1CE5A 4JCNA 3FFGA 5F8TA 2OBOA 1BMMH 4RKJB 3A89A 1Z8RA 1LMWB 2OCVB 3QZQA 4ISLA 1FLEE 4X2VA 2BDAA 3U8OH 3S9BA 1J8AA 4K60A 1BMAA 1C2IA 3RLYH 2ZWLH 1ID5H 3PB1E 1K1NA 3BN9A 4KTUA 5JB9S 4B2AA 3U8RH 1KXAA 1C2KA 3F1SB 2R3UA 1DY8A 1SGIB 3TGKE 1ZPCA 2GV6A 2RA3A 2WUBA 1EX3A 3PTBA 3E0NB 1XUFA 2VWMA 5EU8A 4TPIZ 3RMOH 1CA0C 4B71A 1GL0E 4SGBE 1O3EA 2WINI 2CJIA 3QN7A 3PYHA 1Y5BT 3D65E 2XRCA 1GJ4H 1OOKB 2Z3DA 2BY8X 1RIWB 3RXOA 4Y8YA 1OS8A 3MFJA 1MBMA 4K2YA 4ABDA 2C3SA 1SSXA 2GT8A 2H9TH 4DG4A 4H42U 2AEIH 1GCTC 3ZVDA 7KMEH 1CGIE 1GVZA 1ARBA 4FUBA 2PLXA 2OC1A 4F4OC 1BDAA 3P70B 1UTQA 2BTCE 1G3BA 1IQIA 3M3SA 4NIXA 1TBZH 1GBAA 3TVJB 1T32A 1CHGA 3FP8E 3ZVBA 1O2JA 1FY1A 2ZPRA 3RC6A 3E6PH 1C5WB 2P8OB 1FY5A 1T8NA 3GY8A 3LT3A 2BD3A 3TITA 1JIMA 2W3KA 2G51A 4AGJA 2R0LA 1JOUB 3LIWA 5JPMH 4MPUA 3T5FH 1VJAU 2C90B 3AW1A 1Z6EA 2A45B 2FX6A 2Y7XA 2OINA 3V12A 1O2LA 4HZHA 1QR3E 2YOLA 1FI8A 1ANCA 2ILNA 3SNDA 3ENSB 1PQ7A 2QF3A 2W7UA 1Q2WA 4IN1A 2CXVA 3PM3A 2STAE 2ZU4A 3T26A 1TPOA 1S0RA 1UK3A 1QIXB 2TIOA 3ZYEA 4CRBA 4D76A 1MD8A 1T8MA 2V0BA 1K2I1 1FJSA 2SGEE 3UFAA 3MU1A 4D8NA 1GDUA 3HKJB 3A8DA 1LHGH 4FUFA 3OTJE 1A0JA 1AGJA 4YO9A 4UD9H 1ABJH 2A5KA 3SUEA 3D23A 3TK6A 2BY6X 5T6GA 2F9OA 3M36A 1AZ8A 1P2OA 1BBRH 1YCPM 3IITA 4ZHMU 1Z6JH 2GGVB 3CENA 3MH4A 3ATWA 2GCTB 1MCVA 1A3BH 8GCHF 1O3AA 1SI5H 3PLBA 2VU8E 1DSTA 2ALVA 1EOJA 4AG2A 4IBLH 2OQUA 4ZUHA 1TGTA 1RTFB 2HPQH 5BPEA 5DG6A 1E37B 5A0AE 2CGAA 2A2XH 1E34B 1K1LA 4A1TA 5GWZA 1ELAA 4XDEA 2ZFTA 1TGBA 1O37A 1GBLA 2G52A 2QY0B 3BG4C 3RXHA 4BAOB 1AUJA 4ABGA 3SI4H 2TGDA 3LONA 5K0HA 2YNAA 3LGTA 1IAUA 5EXNA 4CR5A 2PKSC 1DX5M 1GCDA 1PQ8A 3A8CA 3SU0A 1MAYA 1THPB 1UHBB 1D3DB 1P2QA 2BOKA 4ABEA 4CHAB 2BZAA 3RC5A 2R2WU 5DO4H 2VIWA 1C4U2 1ELTA 4ZXYH 1HLTH 2WPLS 3P8OA 1BIOA 4E7RG 1WU1A 2UWLA 3K6ZA 1WV7H 1TONA 3PMAB 2WV4A 3GCTF 4DCDA 3S9CA 2SNWA 4UFDH 1SB1H 2F9BH 3TGIE 1Z1IA 1EP5A 1NROH 2AMPA 2ZHDA 1KYNA 1QQUA 2ZQ1A 3C27B 3ZYDA 1O34A 1BRUP 1O3FA 1UTJA 2A7JA 4I7YH 3A84A 4Y0ZE 5FCKA 1XUIA 1FDPA 1JXPA 1W0YH 1K1IA 4MG3A 1HXFH 4RN6A 2GKVE 1HJAC 1SGDE 1PYTC 3A7YA 2P3TB 1FY3A 1NRSH 1P10A 2FMJA 2VWNA 1SGYE 1E35B 5FX6A 1C5UA 1GJ6A 2THFB 4X1NU 1UVSH 1THSH 4YOJA 1UCYK 1MTVA 4YLQH 2Z7FE 3EQ0H 1Z7KA 1V2OT 3RXGA 1A5GH 3E3TA 1TYNA 1Q3XA 4H6SB 1EAIA 3UR9A 1JBUH 2D8WA 2ZU2A 2ZTZA 5C20A 1UTKA 1DPOA 1S85A 1QJ7B 4MQAA 4M7GA 3EYDA 1GBEA 1GDNA 3QX5H 4OS7A 1FNIA 1YLCA 1LHEH 3M7QA 1O2PA 3SHCH 1LVBA 4ISHH 1QL8A 1HFDA 1GJ7B 5CHAC 2OXSA 3SV2H 3UQVA 1YC0A 3SBKA 3BTFE 3P92A 1UTMA 1V2LT 2ZZUH 2P3UB 4FVDA 1VITH 3TU7H 3VPKA 1VGCB 2ZHEH 1EPTB 2XNIA 3G01A 3NUMA 1UVOA 2D2DA 2WPJS 1MQ5A 1C1OA 4BAMB 1O3OA 3ZZAA 3ZZBA 3BTHE 1OWDA 5GCHF 2ANKH 4WXIA 2D26C 3KGPA 4JZIA 3GY3A 7ESTE 2EI7A 5AFYH 3S7HB 3RMLH 2QGRA 3A8BA 1IQJA 2O8TA 2ZDMA 2TBSA 4BXSA 1FY8E 5E8EH 4WVPE 4AORA 5JBAS 2C93B 1V2TT 2AIQA 1C5OH 5JBTA 1SGEE 1C5VA 2ZPQA 1O2HA 1V2ST 2WYGA 3NWUA 2JH5D 1BTYA 2ZGBH 2V6NA 5SGAE 3LC3A 1NS3A 1HAYB 1O2MA 4O3UA 5I25A 3GDSA 1HRTH 3RXQA 1P9SA 3BEUA 3KQEA 1MD7A 2H9HA 2QIQA 2FOMB 3RP2A 3V0XA 1DWDH 1N6XA 4JZFH 2ZU3A 5E0HA 5A2MH 1P3CA 2GMTC 2BDGA 3RXMA 3I78A 1YCPK 2UUFB 3UNRA 4FU8A 3OYPA 2Z9JA 2ASUB 2JKHA 2F9VA 3QO6A 2XXLA 3OSYA 1O3DA 1ELBA 1XVOA 3STJA 4HTCH 1FMGA 1CQQA 1TX6A 2VNTA 2PSXA 1ANEA 1LTOA 5GCHG 3SHAH 1J14A 1UK4A 1W11U 4KGAA 1QRXA 1NN6A 4KTCA 3RM0H 1BTXA 1NFWA 3SORA 4RSPA 5E0GA 3ATIA 3RXCA 2ZO3H 4JK6A 2V35A 1A5HA 3NCLA 4I33A 1YF4A 2R0KA 3NK8A 2QA9E 3ODFA 2A5IA 1O31A 1PPFE 1ZPBA 3MU4A 3PMBB 2BYAX 2VH6A 5AFZH 2GZ9A 4AB9A 3KQCA 3O8DA 1HXEH 1DS2E 2A7HA 2J95A 2C8XB 3GDVA 2ZI2H 2NU2E 3GCHB 2P94A 1C1WH 1G36A 2BD2A 4Y7AA 2EI8A 1DLEA 3DHKH 2F9UA 3SQEE 5EGMA 3MMGA 1TOCB 1TNGA 1GJBB 4AN7A 2QXJA 1BTHH 4IS5A 4K1EA 4NA8A 1FY4A 1LDTT 2HGTH 4X8TH 2SGAA 1VITF 1SGFA 1Y3UA 1ZGIA 1OXGA 1O2GH 1QBNA 4K5ZA 3ZZ9A 3V3MA 1XKBC 1Z8JB 3VGCC 4LK4A 4X2XA 3RXUA 3KQDA 1MAXA 1BOQA 1LKBA 1A1RA 1O3GA 1KTTB 2W5EA 3MNXA 1IQFA 1BJUA 1Y59T 2J2UA 1A0HB 3M35A 2Y5HA 4ASHA 2G4UA 2GZ7A 1XUKA 1TNHA 3K2UA 3BEIB 3TIUA 5C3NA 2ESTE 2VIDA 3FP6E 2JETB 2HLCA 4VGCB 1CBWC 3M5MA 4K1SA 5FPTA 5LPFA 2JH0D 1UHBA 1TABE 2XWAA 2C4FH 4FUHA 2BD4A 1LVMA 3U69H 1CT4E 2VIOA 1GHZA 4MDSA 4XOJA 2Y7ZA 1P57B 2BMGB 2G4TA 2Y81A 1VJ9U 1WUNH 2J38A 5J4QA 2Y5FA 1DSUA 4AYVB 1G30B 1C5RA 1B0FA 1GHWH 3QWCH 1MZDA 1SR5C 2B9LA 3GYMA 4UFFH 4AZ2B 3SNAA 3GY7A 1JRTA 2BQWB 2WPHS 2BD9A 1VITG 1UO6A 1BB0B 2CHAB 1PJPA 4D7GA 1L1JA 1S84A 1NRNH 1HIAB 1P11E 1LQEA 2ODPA 1BITA 5AF9H 1O2WA 1WCZA 3F9HA 1H9IE 1MTNC 3BTTE 2H9EH 1DY9A 1FZZA 3MU5A 2J92A 2XC4A 3GY2A 3BG8A 4CREA 5DGJA 2VGCC 2BX3A 1TAWA 4ZHAA 1VZQH 2VH0A 5A0CA 1P09A 1GPZA 1TBRH 4Q2KA 1QBOA 2PV9B 1GGDC 2KAIA 1MU6B 1MKXH 2J9NA 2ZTYA 2F9NA 1K21H 1GBHA 1OX1A 1NFUA 1FUJA 1W13U 2GD4B 4JZ1A 3ZZDA 1O2TA 2HALA 1GMCG 2QF0A 3SUFA 4THNH 1HBTH 1SLWB 1CHOG 1QY6A 3LGWA 3VXEH 1QB9A 1RFNA 1MUEB 2BDBA 2C8YB 5JYIA 2RCEA 2Y6TA 3A7XA 3SJ9A 4FXGH 1YPHC 2GX4A 5FPSA 2FS9A 3F9EA 2BX4A 5B6OA 1EPTA 2H6MA 1DWCH 1K28D 4B2BA 5BRRE 1GI8B 2BLQA 1AB9B 1F2SE 1G32B 1A46H 1ZMJA 2ZDAH 1A5IA 4GPGA 2BQ6B 1K9OE 1GG6C 2Z9IA 3LJOA 2EC9H 2BOHB 1ZSKA 4MNXA 1SG8B 3U1JB 3RC4A 5DP9A 1DVAH 1H4WA 4FVBA 1PQ5A 1AO5A 1ELDE 3MNSA 1O5EH 2VJ1A 4ABJA 3EAJA 2DUCA 4LXBH 5ETXA 3EE0B 2FOFA 1O5DH 3GCNA 2K1QA 3PTNA 4YT6H 1GHVH 4MPWA 1O35A 1RD3B 5EQRA 2AGIX 1T7CA 4K8BA 1A7SA 3KNXA 2WPIS 3UOPA 1A0LA 4NIWA 5EQQA 1PYTD 4LOYH 3EA7A 1TRYA 3D49H 3RMNH 4CH8B 1GJCB 4WWYA 2IN2A 5A09A 1GI4A 1T8LA 1KXFA 1UVUH 4D9RA 1GJ5H 1W3CA 4Y7BA 1D6WA 4UFEH 1A61H 3E90B 1K1MA 1ZHMA 4ESTE 1K1PA 1Y3WA 1AHTH 4X2WA 4U01A 5EPNA 4NWKA 2PHBA 1C1RA 3A7ZA 2ZP0H 3BV9B 4NIYA 1GI1A 1KLJH 2BDCA 1V2UT 1Y5AT 2FOEA 2PKAB 4NGAH 2CMYA 4K1TA 1GI5A 3HATH 3SUGA 3KF2A 4GAWA 2TRMA 1GI9B 3NXPA 5LPEA 1Y3YA 3CS7A 5ESTE 1D3PB 1WOFA 3L6PA 1DFPA 3UPEA 1GBTA 3UNQA 4Q7XA 2XYAA 1NC6A 4Z6AH 5ABWA 3I29A 5EODA 5K7RA 1DUAA 4MNVA 1SC8U 1ZSJA 1HAVB 3MNBA 8LPRA 5L6NH 3RXLA 2LNCA 1EAXA 2ZNKH 3LGUA 1CA0B 1RXPA 1WTGH 1SGRE 1S6FA 1QB1A 1IQKA 1YGCH 2HNTF 1KY9A 1BTWA 2H1UA 2FX4A 4JYTA 4NZQA 4UE7H 3A83A 4WMEA 2UUKB 5EW1H 3A8AA 1NTPA 1DUEA 3U1IB 1BMLA 1FPCH 3MYWA 9ESTA 3DD2H 1GCTB 3KEEA 1Y5UT 1AVXA 1GJ8B 4SGAE 2FYQA 1GBFA 1N8OC 1O3NA 5J4SA 1GI0A 1ELEE 3Q00A 1C4Y2 1UK2A 3U9AH 3H7OA 1N1LA 1QA0A 5JDUB 4OS2A 3V13A 2A4GA 5JB8S 1NZQH 5GXPA 1AU8A 1DLKB 2PFEA 2XTTB 3P8GA 1EATA 3T2NA 2Q6GA 2H5CA 3TH2H 2OQ5A 4NZLA 1QA7A 3A7WA 1GMDG 4OGYA 3SGAE 1GBBA 3O8BA 3S69A 6CHAB 1BCUH 5GIBA 2ZGJA 5C5NA 2GV7A 3SOSA 1O5AB 1XXDA 2PSYA 3PV4A 3RXJA 4BTUB 1ZR0A 1SPJA 4K69A 5C1YA 1GHYH 2BM2A 1SGTA 3M7TA 1SVPA 1YPLH 1AVWA 3RU4T 2AFQB 2AMDA 3P6ZB 1HAPH 4AB8A 2ZHFH 1C5TA 1B7XB 3FAOA 3EA9A 2V3OH 3H5CB 3STIA 1AY6H 3MH6A 1O2KA 1N6YA 3FZDA 1O5BB 1EB1H 1UTOA 3UQOA 3MH5A 5A8XA 3QZRA 1WBGB 1F5LA 2ZGHA 4ZKSU 1O3KA 1HGTH 2BDYA 3PO1C 1EZXC 1HAIH 2FM2A 3BTWE 3UWJH 1PPHE 4UDWH 3T29A 4MLFB 1QGFA 1P2JA 3LGIA 2A4RA 2DE9A 1HIAA 4RKOB 3HGNA 3K9XB 2Q6DA 5FHTA 1NU9A 3LGYA 3RM2H 1J9CH 1SLUB 2A0QB 2Z3CA 1QHRB 2VB0A 1GJDB 4I8KA 4ISNA 2Y80A 4GLYA 4DVAU 3ATMA 4D9QA 1KSNA 3N7OA 4BAHB 1GHXH 4CBNA 2SGPE 2GTBA 4XSKU 4IGDA 3QK1A 3BIVH 1GHBF 4X6NA 5GJ4B 1IQMA 1BUIA 2XBYA 4ZKOU 1LHFH 1TRMA 1FAKH 1O0DH 4TPYA 2QXGA 1G3CA 1ZRKA 4BAKB 1NU7B 3LGVA 1ZTKA 2RG3A 1J15A 3K65B 1KTSB 1DANH 4X8UH 2IPHA 4ZKRU 2ANYA 3LC5A 3F9GA 1C5XB 1LPZB 2PKSB 1C5PA 3MO6A 4DT7B 2BVXH 1V3XA 1C5ZB 3TK5A 9LPRA 2AYWA 1C2MA 2HWLB 3DUXH 1F5KU 1KIGH 1SL3A 1F0SA 1UCYH 2VIVA 4Q80A 1C1MA 1GDQA 1YPJH 1INCA 1TMBH 3DA9B 1JRSA 1NPMA 1A3EH 1LHCH 4O9VA 3Q3XA 2UWOA 1HCGA 3A81A 1C2FA 1JMOH 1P2MA 4D7FA 1WAYB 2VIPA 4ZXXH 3AW0A 1O32A 2OC0A 1O36A 4DY7B 3SV8A 4O97A 4O03A 3ESTA 4UFGH 1QFKH 5DKMA 1BT7A 4NCYA 5GPIB 1GHAG 4WMDA 1GHBG 1MKWK 1OYTH 1NESE 3ATLA 1HJAB 3K6YA 3TGJE 3ZZ8A 3U98H 2PTCE 3OX7U 4WH8A 1L1NA 1ARCA 1PPZA 5DP8A 2G5NA 4IMQA 2FZZA 4NA7A 2ZFQH 1FN8A 1O3BA 1FN6A 1C1VH 2AIPA 4KKDA 3MHWU 2HVXA 3EDXB 4INHA 5HGGA 1C1NA 1ZHRA 1ELVA 1O2SA 4AYYB 2WPKS 4HGCA 2PTNA 1SQOA 6LPRA 2B7DH 2W26A 4FU7A 2P3FH 3L33A 1CGJE 1XX9A 1C1TA 1V2MT 2O8MA 1GJ9B 1P8VC 1GBDA 4NG9H 4CRGA 5HYOA 1O39A 5CHAB 2PKAA 3JZ1B 1AVGH 2P93A 4JZEH 1H8DH 1TB6H 1AFQB 4FUCA 1U6QA 1YCPH 4ABAA 1TX7A 1HB0B 1F92A 5DP7A 2VWLA 3OY5U 3ZV8A 1BHXB 2OLGA 1L2EA 1NFXA 1OP2A 3SU1A 1HAVA 1BMNH 4DURA 4DW2U 1V2RT 3OY6U 4JK5A 1AMHA 3PWCA 1A2CH 3URCA 1TPAE 1H9LB 3QLPH 4X8SH 2BB4A 2HNTC 3PLKA 1O2IA 3M5LA 4NIVA 2G81E 1GMHG 2BQ7B 1LKAA 3VB6A 3TH4H 2OP9A 2O9QA 3RXKA 1S0QA 4YZUA 4INLA 3EA8A 1QNJA 2ZDNA 3VXFH 1QRWA 3RXAA 4X8VH 2F91A 3DT0H 3SJ8A 3AASA 2BVSH 4IC5A 3R3GB 5EW2H 1SOZA 4A7IB 2WPMS 3F9FA 4I31A 1VCWA 5FPYA 1YPHE 3AAUA 3A87A 1OWIA 2A7CA 4J1YA 1H8IH 4R0IA 5L2YH 5C2ZA 3NKKA 4ISOA 3SN8A 2Z9GA 1SLVB 1ZMNA 1O3JA 3SU5A 1PFXC 3U8TH 1G2LA 2SGQE 3ZZ5A 2YNBA 2OC8A 3MWIU 5DP5A 2A4QA 1P2KA 3A85A 1Y8TA 1ZYOA 1ZTJA 4ZMAH 2OC7A 4NWLA 3ZZ4A 4Z0KA 1Z1JA 1ABIH 3TJOA 1WTHD 4YT7H 4GHQA 3PWBA 1MTUA 2IJOB 3UIRA 1GI2A 3LDXH 1TA6A 8ESTE 1TPSA 2W7SA 1YM0A 1HYLA 2Q6FA 4NSYA 5F8ZA 2FEQH 1QB6A 3GOVB 1GBJA 3A7TA 1C4V2 2NU1E 4BXWA 5F8XA 1C9TA 2XWBI 1EJNA 6GCHF 1HAOH 3TPIZ 1YBWA 5C1XA 1IHSH 3UUZA 3TK9A 4WY3A 1B0EA 1LO6A 1DE7H 1EQ9A 2J4IA 1NY22 2PGQB 2A32A 3QGJA 3TJNA 4A1VA 1EASA 1AWHB 1EZQA 1UVPA 1GMCF 2BXUH 4WF8A 1CVWH 1SGPE 3SV6A 4CBOA 3QUMP 5EQSA 2HPPH 1CHOF 4QT8C 1ACBE 3S9AA 3SU2A 3MU8A 2FOCA 1B5GH 1NFYA 3VB3A 1OKXA 4YM9A 2J94A 1Y3VA 3A80A 1V2WT 3JZ2B 3F68H 1ANDA 1O3PB 5DPAA 4OGXA 1C1QA 3MNCA 1AWFH 3Q3YA 1G37A 1HPGA 3LJJA 4K3JA 1RS0A 4WXVA 4YESB 2OUAA 3NPSA 3H7TA 2XW9A 4MTBA 1P05A 1V2JT 3D62A 2SFAA 4YOGA 4Y71A 2ALPA 2OD3B 1YPMH 5FXLA 2G5VA 5HM9A 1HNEE 1TIOA 2GT7A 2ZFPH 1AE8H 3SNCA 1EJMA 4TY6A 6GCHG 3RXEA 1UTNA 2ZDKA 1SGNE 4A92A 1ZJKA 2OBQA 1W10U 2SGDE 1V2VT 2BLOA 2ZECA 4ABIA 4E06H 1TMUH 5F6MA 2TGTA 2FPZA 1DICA 2Y82A 1AB9C 1FONA 1GBKA 4NFFA 3ZVAA 2BDIA 3MI4A 3Q76A 1P02A 3E91A 4Y11E 3SW2B 2NU0E 2BD7A 1D9IA 1CU1A 3ATKA 1TWXB 3ZZCA 3FZZA 1SQTA 5A0BA 2AS9A 1MTNB 1P2NA 3SU4A 5L2ZH 2FOGA 1FIZA 2FDAA 1GI6A 2SNVA 1W2KH 1MCTA 2ANWA 2VGCB 4XBCA 1O3CA 4KP0A 1AE5A 1UTPA 1QJ1B 1ZZZA 3GYLB 4MPVA 1C2JA 1OPHB 2C8ZB 2FOBA 2ZCKP 4K8YA 4U2WA 1C1UH 2D1JA 1VR1H 2QN5T 5E0JA 2PW8H 3AVZA 3RXIA 1C1SA 1YYY1 1NRQH 6ESTA 3SV9A 2BDHA 1YKTA 1ZRBA 1IQEA 3UTUH 5F03A 2HOBA 1L4ZA 1F0UA 4Y0YE 1C2LA 1T4UH 2ZF0H 5IDKA 3I77A 3RXDA 1QBVH 1ELGA 1RIWC 1G3EA 1MU8B 1Q31A 5TJXA 4H4FA 1S6HA 3P95A 2CN0H 2ZIQH 1MMJN 1TQ7B 3SGBE 3RXFA 3FP7E 4AG1A 1ETRH 3RLWH 1W7GH 1PPEE 3IWMA 2FP7B 1OP0A 1DWBH 1EZUC 1HJ9A 1BTUA 2QXIA 2ZA5A 1MQ6A 4OS1A 1QJ6B 3B9FH 4FUIA 4ABBA 1GG6B 1BHXF 1SFQB 5DP6A 3SGQE 4I8HA 2BLVA 1V2NT 2H5DA 2ZPSA 1SBWA 3SJOA 4YOIA 3UWIA 2NU3E 1C2EA 4GHTA 3L3TA 4A5TS 2P8OC 1AKSB 1WSSH 3LH1A 1OWHA 3DFJA 2BZ6H 7GCHG 3GICB 3C1KA 4JMYA 3RUOA 2FODA 1O38A 1QURH 5T6DA 5LPRA 1YPGH
chains in the Genus database with same CATH superfamily
1GMDF 2XCNA 1ZTLA 4B1TA 2Z6BD 1ETSH 1HDTH 2ULLA 1C2GA 2GCHG 2O8WA 1O33A 4BANB 4HFPB 1EUFA 4JYUH 2STBE 2I6QA 4TY7A 4YLUA 1O2OA 1SGQE 2QC2A 4I8GA 2WYJA 4ABFA 1O2ZA 3MO9A 2BY5X 3SUDA 3SO3A 1W0ZU 2EI6A 3UAIC 2GP9B 3FKSD 3KIDU 1O3HA 4Y8XA 5HXFA 2RDLA 4Q4LA 2VVVA 2F4LA 3UNSA 2ANMH 1AN1E 4H6TA 1TALA 5EXLA 4OS5A 4JZDH 5HMAA 1PPBH 5EJLA 2R2MB 2WUCA 2G55A 3ZVGA 1W7XH 2XBVA 1AFEH 1OWKA 1KDQB 1T31A 4AFSA 1BJVA 4X1QU 1SGCA 3ZVEA 5GDSH 6CHAC 2GCTC 5C67A 5ESBA 1QQ4A 4GCHF 2OTVA 3RXBA 1CT2E 4ZH8A 1UMAH 4Q7ZA 2ZDLA 4OS4A 4TYDA 3VFEA 2UUJB 3A86A 4FUEA 3EGKH 2ZKSA 1AUTC 1FQ3A 5E2OA 4ZCNA 3SYJA 4FUDA 1EKBB 1RTKA 2HRVA 1K1JA 2JH6D 3GDUA 4WMFA 3V7TA 3M3VA 3T28A 1MZAA 1SHYA 2AGEX 2Y5GA 2PWXA 5AHGH 1E36B 2W3IA 3QTOH 2B0FA 1OP8A 2ZHWH 4HI3A 1GVLA 1O2RA 3LH3A 1NT1A 3WY8A 3LU9B 2WV5A 1TGCA 1WQVH 3HPTB 2UWPA 2BD5A 1HJ8A 4X1PU 2R3YA 3W1EA 4U30A 1GBMA 4MNYA 1AZZA 1LHDH 2A2QH 1BBRK 3MU0A 2XC5A 2ZG0H 4CHAC 4NA9H 1H8ED 4R8TB 1GI7B 1P01A 4TWWA 5FCRA 4E7NA 2ZQ2A 2BVRH 2ZFSA 1J17T 1N8OB 1QL7A 1C5LH 3HK3B 1C5SA 3SU3A 1FX0B 1F5RA 3NZIA 3FVFB 1C5NH 4AC9A 1CGHA 1FV9A 3RXTA 3NRLA 3T62A 1ZMLA 3F2HA 3FANA 1UVTH 1TA2A 2Z94A 1K22H 1SQAA 1UTLM 3OU0A 4GCHG 3VEQB 1ELFA 5JBCS 3GY4A 1C9PA 3B23B 3GCOA 3TJVA 3TNTA 4XBDA 2FYRA 1C5MD 2AH4X 4B74A 4I32A 3SQHE 4Y8ZA 5FBEA 3CNRA 2F83A 2FIRH 2QCYA 5T3HA 1GBIA 2O8UA 1O5GH 4X1SU 5T6FA 1E0FD 2WPDD 1C2DA 4ZKNU 1P9UA 1XXFA 3TLOA 5A8ZA 2XC0A 1IQGA 1C1PA 3SJKA 2HNTE 2P95A 1W0JD 3BTQE 1GHAF 2P16A 1S5SA 1EXFA 4BAQB 3SI3H 3PMJA 1TNKA 1O3MA 1Z71A 1EJAA 1UJ1A 3BG4B 3ZZ6A 4DOQA 1P03A 3MOCA 1KXBA 2ZCHP 1QRZA 2AGGX 3KCGH 3UB0A 4LZ4B 2AMQA 1LCYA 4F49A 3FO8D 3W95A 1G9IE 2A5AA 3M5NA 3PO1B 5FAHA 1W14U 8GCHG 3E1XB 5LH8A 2VVUA 1TGNA 1H1BA 2Z9LA 1ESBA 3AAVA 3FOAA 1D6RA 1XMNB 1DM4B 1MTWA 2O8LA 2J34A 1LPGB 4HG6A 5EJ1A 1COWD 3ZVCA 2ZFFH 1YLDA 3P8FA 3SJIA 2BLWA 4ZAEA 3Q77A 3A7VA 2W6ID 3ELAH 1MTSA 4GSOA 1RJXB 1DXPA 3DFLA 1O2YA 3BTDE 4X6OA 5L30H 1VGCC 2LPRA 2QAAA 1EPTC 1CA8B 2AERH 1KLIH 1GVKB 1CSOE 3UR6A 4CRAA 3BSQA 1RGQA 1SOTA 4A1XA 2KFWA 1KXDA 2XCFA 4DJZB 4IN2A 1C5YB 2I6SA 2KAIB 4BOHA 2XBWA 5TCAA 1DXWA 1P2IA 1E38B 2CF9H 1MKWH 2GDDA 4P02A 2FOHA 2FI5E 2FTLE 4Y79A 1NRRH 1BRBE 1OWEA 1TPPA 2KM0A 1V2KT 3LKWA 1BZXE 2WV9A 4AFQA 1XUGA 1L4DA 1ZSLA 2B8OH 3GY5A 3GCTG 4IC6A 4FU9A 2TGAA 4DIHH 1P12E 1HUTH 1IQNA 2FESH 5EG4A 3RU4D 1H9HE 1TBQH 1YPEH 3ODDA 3OFND 3W94A 4I8LA 1HAHH 3A88A 3RXVA 1O5FH 2CF8H 5CE1A 1YP9A 3GISB 1AFQC 1GMHF 4XE4A 1LQDB 1XVMA 1IQHA 1ZOMA 3MO3A 1BTZA 3ZZ7A 4XFQA 1M9UA 2H2ZA 2FXRA 3HKIB 1GI3A 2F9PA 2G8TA 4JYVH 2DE8A 4KTSA 4Q7YA 1NRPH 1FXYA 2BD8A 1EZSC 1SHHB 3PV2A 4DT4A 2V3HH 3BEFB 1EB2A 5AVDA 1AKSA 1YPKH 2BY7X 1KXEA 5I46H 2F43B 4CRDA 4DIIH 4LZ1H 1ZGVA 2M2AA 4ABHA 4FUGA 3Q3KA 1F0TA 1ZJDA 5C5OA 2ZGXH 1PQAA 3BTME 3MTYA 1F0RA 2FO9A 1DOJA 3LOXA 3SZNA 1IOEA 1BQYA 2A31A 5DP3A 3ZVFA 1HAZB 2FTMA 2EEKA 4NFEA 4GUXA 4B76A 1J16A 4UONA 3RU4E 1KXCA 1P04A 1EAUA 1GWAA 3ZZ3A 1SKYE 3E0PB 2C8WB 1NO9H 3PMHB 3SU6A 1OSSA 2FI3E 2A4OA 2ZGCA 5CHBA 2ZTXA 4INKA 4I8JA 3GCHC 1P0SH 4TWYA 4ASUD 4PROA 3F3BA 1PPGE 2NU4E 1TMTH 3PRBA 2ZCLP 1KDQA 1LPKB 5EPYA 1AQ7A 1WXRA 2GMTB 1NM6A 3KL6A 2UUYA 1XKAC 2ODYB 4AX9H 1TRNA 1RRKA 3BIUH 2L74A 4RI0A 5C1UA 3QGNB 1XUHA 1D3QB 2CV3A 3CP7A 1WYKA 2FI4E 4B75A 3M37A 2P59A 5H4IB 1BBRE 4XBBA 3T25A 1QL9A 4MPXA 4ISIH 1L1GA 1V2QT 1OYQA 1SLXB 1ZLRA 4A6LA 4AGKA 1IHTH 5PTPA 2PUQH 3AK5A 1S81A 2ZC9H 2ODQA 1BTPA 4WH6A 2BY9X 1Z8IB 3UOUA 2TGPZ 3ITIA 3KQBA 1BRCE 4X0WU 4TSFD 5DP4A 3UREA 1ZHPA 1RTLA 4YTAA 5CMXH 4DGJA 3B8JA 1MBQA 2RDEA 2VINA 1XUJA 4BTTB 3URDA 2KCPA 3TNSA 2VWOA 1O3IA 4UEHH 2JETC 4CRCA 4VGCC 2Z9KA 3BF6H 1TE0A 1K1OA 4Z1MD 1P3EA 1S83A 2ZEBA 4WJG2 3OTPA 3M61U 3RXPA 4OS6A 1W8BH 1Y3XA 1G2MA 4Y10E 5DJ7A 1DITH 4X2YA 1BA8B 1JWTA 4CR9A 1TOMH 2LELA 4IW4E 4BTIB 3BTKE 2XOKD 4BNRA 3O8RA 1TX8A 2VVCA 3TJUA 7LPRA 4Q63A 2FOAA 1F7ZA 1FIWA 1C2HA 3IG6B 1KLTA 1HAXB 1WQSA 5FBIA 1HV7A 2FLRH 1AI8H 1FAXA 1L0ZA 2ZDVH 1O5CB 5E2PA 1QCPA 1BRAA 1VCPA 1D4PB 3M7UA 2CHAC 1EP6A 1ETTH 3KN2A 1O2UA 2FS8A 3E16B 1CO7E 1PPCE 1S82A 1QZ8A 2GDEH 3P17H 1DDJA 1IQLA 3S0NA 1O3LA 4AFZA 4B2CA 3E8LA 3A82A 2WHXA 4X6MA 5IYTA 3RDZA 3RXRA 4B73A 3TH3H 1DT2A 2FWWA 1NBMD 1O2XA 2NWNA 1AD8H 3F2GA 1ESAA 8KME2 2BXTH 3R0FA 3VGCB 2ZFRH 3SNBA 4Y6DA 5G4BA 1T8OA 1EFRD 3S7KB 2Q1JA 1ELCA 1GJAB 1TLDA 4MNWA 1HAGE 3VB5A 1D3TB 3DSOA 1JIRA 1T4VH 2R9PA 1UCYE 1DWEH 2F3CE 3VB4A 3KHVA 1ANBA 2VIQA 3UY9A 2QYIA 1CBWB 1EAWA 1QTFA 3ZV9A 2PR3A 1XM1A 2PUXB 3QDZB 3LPRA 2PGBB 1P06A 4X1RU 1O30A 3HGPA 2RA0A 4KELA 3RMMH 4CRFA 1TNJA 4MVNA 2BHGA 2WZQA 4FUJA 3PLPA 1LVOA 4E05H 1SGFG 1TNIA 2SGFE 1O2VA 4GVUA 1X7AC 1FPHH 2EY4C 4AOQA 2ZHQH 1GBCA 5FX5A 1AIXH 3VB7A 2QXHA 2QV1A 3PV5A 1TGSZ 2EQNA 3M3TA 5JBBS 3MH7A 5EJZA 1MH0A 1A4WH 1UW7A 5EOKA 4X6PA 3BTEE 3T27A 3P8NA 4J2YB 4ACAA 1NBME 3OE7D 2A1DB 5TCCA 2TPIZ 3O8CA 1ORFA 2ZU1A 4ZROA 2GZ8A 5C0UA 3CS0A 1VCQA 2KCYA 1MKXK 2XBXA 1TFXA 4B6FA 2IOTA 1SMFE 4IMZA 3QTVH 1C5QA 5EXMA 3PROA 1W12U 5LGOA 4F48B 1G3DA 2GVFA 1O2NA 1V6DA 4U32A 2B5TB 2M5TA 1CT0E 2G00A 4ZHLU 4NSVA 1V2PT 2FLBH 4FOUC 1GL1A 1Z8GA 3F6UH 3HK6B 2Z3EA 1ESTA 1TNLA 1GGDB 2ZU5A 1LVYA 7GCHF 3GY6A 3RXSA 3SV7A 4O3TA 3SNEA 3BTGE 1O2QA 4CH2B 1SFIA 1THRH 1OWJA 1ZPZA 3M5OA 1EOLA 5A8YA 5DK1A 5HM2A 4OM9A 4AFUA 1TQ0B 2EA3A 2GCHF 4Y76A 1CE5A 4JCNA 3FFGA 5F8TA 2OBOA 1BMMH 4RKJB 3A89A 1Z8RA 1LMWB 2OCVB 3QZQA 4ISLA 1FLEE 4X2VA 2BDAA 3U8OH 3S9BA 1J8AA 4K60A 1BMAA 1C2IA 3RLYH 2ZWLH 1ID5H 3PB1E 1K1NA 3BN9A 4KTUA 5JB9S 4B2AA 3U8RH 1KXAA 1C2KA 3F1SB 1YY3A 2R3UA 1DY8A 1SGIB 3TGKE 2WSSD 1ZPCA 2GV6A 2RA3A 3H09A 2WUBA 1EX3A 3PTBA 3E0NB 1XUFA 2VWMA 5EU8A 4TPIZ 3RMOH 1CA0C 4B71A 1GL0E 1S6LA 4SGBE 1O3EA 2YMSB 2WINI 2CJIA 3QN7A 3PYHA 1Y5BT 3D65E 2XRCA 1GJ4H 1OOKB 2Z3DA 2BY8X 1RIWB 3RXOA 4Y8YA 1OS8A 3MFJA 1MBMA 4K2YA 4ABDA 2C3SA 1SSXA 2GT8A 2H9TH 4DG4A 4H42U 2AEIH 1GCTC 3ZVDA 7KMEH 1CGIE 1GVZA 1ARBA 4FUBA 2PLXA 2OC1A 4F4OC 1E1RD 1BDAA 3P70B 1E1QD 1MABB 1UTQA 2BTCE 1G3BA 1IQIA 3M3SA 3OAAD 4NIXA 1TBZH 1GBAA 3TVJB 1T32A 1CHGA 3FP8E 3ZVBA 1O2JA 1FY1A 2ZPRA 3RC6A 3E6PH 1C5WB 2P8OB 1FY5A 1T8NA 3GY8A 3LT3A 2HLDD 2BD3A 1KMHB 3TITA 1JIMA 2W3KA 2G51A 4AGJA 2R0LA 1JOUB 3LIWA 5JPMH 4MPUA 3T5FH 5KEDA 1VJAU 2C90B 3AW1A 1Z6EA 2A45B 2FX6A 2Y7XA 2OINA 2AHME 3V12A 1O2LA 4HZHA 1QR3E 2YOLA 1FI8A 1ANCA 2ILNA 3SNDA 3ENSB 1PQ7A 2QF3A 2W7UA 1Q2WA 4IN1A 2CXVA 3PM3A 2STAE 2ZU4A 3T26A 1TPOA 1S0RA 1UK3A 1QIXB 2TIOA 3ZYEA 4CRBA 4D76A 1MD8A 1T8MA 2V0BA 1K2I1 4P00A 1FJSA 2SGEE 3UFAA 3MU1A 4D8NA 1GDUA 3HKJB 3A8DA 1LHGH 4FUFA 3OTJE 1A0JA 1AGJA 3SZEA 4YO9A 4UD9H 1ABJH 2A5KA 3SUEA 3D23A 3TK6A 2BY6X 5T6GA 2F9OA 3M36A 1AZ8A 2OK5A 1P2OA 1BBRH 1YCPM 3IITA 4ZHMU 1Z6JH 2GGVB 2QE7D 3CENA 3MH4A 3ATWA 2GCTB 1MCVA 1A3BH 1VKYA 8GCHF 1O3AA 1SI5H 3PLBA 2VU8E 1DSTA 2ALVA 1EOJA 4AG2A 4IBLH 2OQUA 4ZUHA 1TGTA 1RTFB 5HIZA 2HPQH 5BPEA 5DG6A 1E37B 5A0AE 2CGAA 2A2XH 1E34B 1K1LA 4A1TA 5GWZA 1ELAA 4XDEA 2ZFTA 1TGBA 1O37A 1GBLA 2G52A 2QY0B 3BG4C 3KYFA 3RXHA 4BAOB 1AUJA 4ABGA 3SI4H 2TGDA 3LONA 5K0HA 2YNAA 3LGTA 1IAUA 5EXNA 4CR5A 2PKSC 1DX5M 1GCDA 1PQ8A 3A8CA 3SU0A 1MAYA 1THPB 1UHBB 1D3DB 1P2QA 2BOKA 4ABEA 4CHAB 5C94A 2BZAA 3RC5A 2R2WU 5DO4H 2VIWA 1C4U2 1ELTA 4ZXYH 1HLTH 2WPLS 3P8OA 1BIOA 4E7RG 1WU1A 2UWLA 3K6ZA 1WV7H 1TONA 3PMAB 2J98B 2WV4A 3GCTF 4DCDA 3S9CA 2SNWA 4UFDH 1SB1H 3VG8A 2F9BH 3TGIE 1Z1IA 1EP5A 1NROH 2AMPA 2ZHDA 1KYNA 1QQUA 2ZQ1A 5T1VA 3C27B 3ZYDA 1O34A 1E79D 1BRUP 1O3FA 1UTJA 2A7JA 4I7YH 3A84A 4Y0ZE 5FCKA 1XUIA 1FDPA 1JXPA 2JJ2D 1W0YH 1K1IA 4MG3A 1HXFH 4RN6A 2GKVE 1HJAC 1SGDE 1PYTC 3A7YA 2P3TB 1FY3A 1NRSH 1P10A 2FMJA 2VWNA 1SGYE 1E35B 5FX6A 1C5UA 1GJ6A 2THFB 4X1NU 1UVSH 1THSH 4YOJA 1UCYK 1MTVA 4YLQH 2Z7FE 3EQ0H 1Z7KA 1V2OT 3RXGA 1A5GH 3E3TA 1TYNA 1Q3XA 4H6SB 1EAIA 3UR9A 1JBUH 2D8WA 2ZU2A 2ZTZA 5C20A 1UTKA 2VBCA 1DPOA 1S85A 1YWUA 1QJ7B 4MQAA 4M7GA 3EYDA 1GBEA 1GDNA 3QX5H 4OS7A 1FNIA 1YLCA 1LHEH 3M7QA 1O2PA 3SHCH 1LVBA 4ISHH 1QL8A 1HFDA 1GJ7B 5CHAC 2OXSA 3SV2H 3UQVA 1YC0A 3SBKA 3BTFE 3P92A 1UTMA 1V2LT 2ZZUH 2P3UB 4FVDA 1VITH 3F0PA 3TU7H 3VPKA 1VGCB 2ZHEH 1EPTB 2XNIA 3G01A 3NUMA 1UVOA 2D2DA 2WPJS 1MQ5A 1C1OA 4BAMB 1O3OA 3ZZAA 3ZZBA 3BTHE 1OWDA 5GCHF 2ANKH 4WXIA 2D26C 3KGPA 4JZIA 3GY3A 7ESTE 2EI7A 5AFYH 3S7HB 3RMLH 2QGRA 3A8BA 1IQJA 2O8TA 2ZDMA 2TBSA 4BXSA 1FY8E 5E8EH 4WVPE 4AORA 5JBAS 2C93B 1V2TT 2AIQA 1C5OH 5JBTA 1SGEE 1C5VA 2ZPQA 1O2HA 1V2ST 2WYGA 3NWUA 2JH5D 1BTYA 2ZGBH 2V6NA 5SGAE 3LC3A 1NS3A 1HAYB 1O2MA 4O3UA 5I25A 3GDSA 1HRTH 3RXQA 5KGOA 1P9SA 3BEUA 3KQEA 1MD7A 2H9HA 2QIQA 2FOMB 3RP2A 3V0XA 1WDIA 1DWDH 1N6XA 4JZFH 2ZU3A 5E0HA 5A2MH 1P3CA 2GMTC 2BDGA 3RXMA 3I78A 1K0HA 1YCPK 2UUFB 3UNRA 4FU8A 3OYPA 2Z9JA 2ASUB 2JKHA 2F9VA 3QO6A 2XXLA 3OSYA 1O3DA 1ELBA 2KZ4A 1XVOA 3STJA 4HTCH 3EE7A 1FMGA 1CQQA 1TX6A 2VNTA 2PSXA 1ANEA 1LTOA 5GCHG 3SHAH 1J14A 1UK4A 1W11U 4KGAA 1QRXA 1NN6A 4KTCA 3RM0H 1BTXA 1NFWA 3SORA 4RSPA 5E0GA 3ATIA 3RXCA 2ZO3H 4JK6A 2V35A 1A5HA 3NCLA 4I33A 1YF4A 2R0KA 3NK8A 2QA9E 3ODFA 2A5IA 1O31A 1PPFE 1ZPBA 3MU4A 3PMBB 2BYAX 2VH6A 5AFZH 2GZ9A 4AB9A 3KQCA 3O8DA 1HXEH 1DS2E 2A7HA 2J95A 2C8XB 3GDVA 3DCLA 2ZI2H 2NU2E 3GCHB 2P94A 1C1WH 5DN6D 1G36A 2BD2A 4Y7AA 2EI8A 1DLEA 3DHKH 2F9UA 3SQEE 5EGMA 3MMGA 1TOCB 1TNGA 1GJBB 4AN7A 2QXJA 4M9FA 1BTHH 4IS5A 4K1EA 4NA8A 1FY4A 1LDTT 4XRNA 2HGTH 4X8TH 2SGAA 1VITF 1SGFA 1Y3UA 1ZGIA 1OXGA 1O2GH 1QBNA 4K5ZA 3ZZ9A 3V3MA 1XKBC 1Z8JB 3VGCC 4LK4A 4X2XA 3RXUA 3KQDA 1MAXA 1BOQA 1LKBA 1A1RA 1O3GA 2V7QD 1KTTB 2W5EA 3MNXA 1IQFA 1BJUA 1Y59T 2J2UA 1A0HB 3M35A 2Y5HA 4ASHA 2G4UA 2GZ7A 1XUKA 1TNHA 3K2UA 3BEIB 3TIUA 5C3NA 2ESTE 2VIDA 3PRDA 3FP6E 2JETB 2HLCA 4VGCB 1CBWC 3M5MA 4K1SA 5FPTA 5LPFA 2JH0D 1UHBA 1TABE 2XWAA 2C4FH 4FUHA 2BD4A 1LVMA 3U69H 1CT4E 2VIOA 5DSFA 1GHZA 4MDSA 4XOJA 2Y7ZA 1P57B 2BMGB 2G4TA 2Y81A 3DSPA 1VJ9U 1WUNH 1SQRA 2J38A 5J4QA 2Y5FA 1DSUA 4AYVB 1G30B 1C5RA 1B0FA 1GHWH 3QWCH 1MZDA 1SR5C 2B9LA 3GYMA 4UFFH 4AZ2B 3SNAA 3GY7A 1JRTA 2BQWB 2WPHS 2BD9A 1VITG 2GJGA 1UO6A 1BB0B 2CHAB 1PJPA 4D7GA 1L1JA 1S84A 1NRNH 1HIAB 1P11E 3F2FA 1LQEA 2ODPA 1BITA 4FETA 5AF9H 1O2WA 1WCZA 3F9HA 1H9IE 1MTNC 3BTTE 2H9EH 1DY9A 1FZZA 3MU5A 2J92A 2XC4A 3GY2A 3BG8A 4CREA 5DGJA 2VGCC 2BX3A 1TAWA 4ZHAA 1VZQH 2VH0A 5A0CA 1P09A 1GPZA 1TBRH 3ZIAD 4Q2KA 1QBOA 2PV9B 1GGDC 2KAIA 1MU6B 1MKXH 2J9NA 2ZTYA 2F9NA 1K21H 1GBHA 1OX1A 1NFUA 1FUJA 1W13U 2GD4B 4JZ1A 3ZZDA 1O2TA 2HALA 1GMCG 2QF0A 3SUFA 4THNH 1HBTH 1SLWB 1CHOG 4XD7D 1QY6A 3LGWA 3VXEH 1QB9A 1RFNA 1MUEB 2BDBA 2C8YB 5JYIA 2RCEA 2Y6TA 3A7XA 3SJ9A 4FXGH 1YPHC 2GX4A 5FPSA 2FS9A 3F9EA 2BX4A 5B6OA 1EPTA 2H6MA 1DWCH 1K28D 4B2BA 5BRRE 1GI8B 2BLQA 1AB9B 1F2SE 1G32B 1A46H 1ZMJA 2QF5A 2ZDAH 1A5IA 4GPGA 2BQ6B 1K9OE 1GG6C 2Z9IA 3LJOA 2EC9H 2BOHB 1ZSKA 4MNXA 1SG8B 3U1JB 3RC4A 5DP9A 1DVAH 1H4WA 4FVBA 1PQ5A 1AO5A 1ELDE 3MNSA 1O5EH 2VJ1A 4ABJA 3EAJA 2DUCA 4LXBH 5ETXA 5GNDA 3EE0B 2FOFA 1O5DH 3GCNA 2K1QA 3PTNA 4YT6H 1GHVH 4MPWA 1O35A 1RD3B 5EQRA 2AGIX 1T7CA 4K8BA 1A7SA 3KNXA 2WPIS 3UOPA 1A0LA 4NIWA 5EQQA 1PYTD 2JDID 4LOYH 3EA7A 1TRYA 3D49H 3RMNH 3F0OA 4CH8B 1GJCB 4WWYA 2IN2A 5A09A 2KR7A 1GI4A 1T8LA 1KXFA 1UVUH 4D9RA 1GJ5H 1W3CA 4Y7BA 1D6WA 4UFEH 1A61H 3E90B 1K1MA 1ZHMA 4ESTE 1K1PA 1Y3WA 3N7DA 1AHTH 4X2WA 4U01A 5EPNA 4NWKA 2PHBA 1C1RA 3A7ZA 4TT3D 2ZP0H 3BV9B 4NIYA 1GI1A 1KLJH 2BDCA 1V2UT 1Y5AT 2FOEA 2PKAB 4NGAH 3WWFA 2CMYA 4K1TA 1GI5A 3HATH 3SUGA 3KF2A 4GAWA 2V3MA 2TRMA 1GI9B 2IJD1 3NXPA 5LPEA 1Y3YA 3CS7A 2PP6A 5ESTE 1D3PB 1WOFA 3L6PA 1DFPA 3UPEA 1GBTA 3UNQA 4Q7XA 2XYAA 1NC6A 4Z6AH 5ABWA 3I29A 5EODA 5K7RA 1DUAA 4MNVA 1SC8U 1ZSJA 1HAVB 3MNBA 8LPRA 5L6NH 3RXLA 2JIZD 2LNCA 1EAXA 2ZNKH 3LGUA 1CA0B 1RXPA 1WTGH 1SGRE 1S6FA 1QB1A 1IQKA 1YGCH 2HNTF 1KY9A 1BTWA 2H1UA 2FX4A 4JYTA 4NZQA 4UE7H 3A83A 4WMEA 2UUKB 5EW1H 3A8AA 1NTPA 1DUEA 3U1IB 1BMLA 1FPCH 1OHHD 3MYWA 9ESTA 3DD2H 1GCTB 3KEEA 1Y5UT 1AVXA 1GJ8B 4SGAE 5F53A 2FYQA 1GBFA 1N8OC 1O3NA 5J4SA 1GI0A 1ELEE 3Q00A 4B6EA 1C4Y2 1UK2A 3U9AH 3H7OA 1N1LA 1QA0A 5JDUB 4OS2A 3V13A 2A4GA 5JB8S 1NZQH 5GXPA 1AU8A 1DLKB 2PFEA 2XTTB 3P8GA 1EATA 3T2NA 2Q6GA 2H5CA 3TH2H 2OQ5A 4NZLA 1QA7A 3A7WA 1GMDG 4OGYA 3SGAE 1GBBA 3O8BA 3S69A 6CHAB 1BCUH 5GIBA 2ZGJA 5C5NA 2GV7A 3SOSA 1O5AB 1XXDA 1W0KD 2L6OA 2PSYA 3PV4A 3RXJA 4BTUB 1ZR0A 1SPJA 4K69A 5C1YA 1GHYH 2BM2A 5C0TA 1SGTA 3M7TA 1SVPA 1YPLH 1AVWA 3RU4T 2AFQB 2AMDA 3P6ZB 1HAPH 4AB8A 2ZHFH 1C5TA 1B7XB 3FAOA 3EA9A 2V3OH 3H5CB 3STIA 1AY6H 3MH6A 1O2KA 1N6YA 3FZDA 1O5BB 1EB1H 1UTOA 3UQOA 2CK3D 3MH5A 5A8XA 3QZRA 1WBGB 1F5LA 2ZGHA 4ZKSU 1O3KA 1HGTH 2BDYA 3PO1C 1EZXC 1HAIH 2FM2A 3BTWE 3UWJH 1PPHE 4UDWH 3T29A 4MLFB 1QGFA 1P2JA 3LGIA 2A4RA 2DE9A 1HIAA 2JJ1D 4RKOB 3HGNA 3K9XB 2Q6DA 5FHTA 1NU9A 3LGYA 3RM2H 1J9CH 1SLUB 2A0QB 2Z3CA 1QHRB 2VB0A 1GJDB 4I8KA 4ISNA 2Y80A 4GLYA 4DVAU 2KX4A 3ATMA 4D9QA 1KSNA 3N7OA 4BAHB 1GHXH 4CBNA 2SGPE 2GTBA 4XSKU 4IGDA 4RT0A 3QK1A 3BIVH 1GHBF 4X6NA 5B6LA 5GJ4B 1IQMA 1BUIA 2XBYA 4ZKOU 1LHFH 1TRMA 1FAKH 1O0DH 4TPYA 2QXGA 1G3CA 1ZRKA 4BAKB 1NU7B 3MQKC 3LGVA 1ZTKA 2RG3A 1J15A 3K65B 1KTSB 1DANH 4X8UH 2IPHA 4ZKRU 2ANYA 3LC5A 2QF4A 3F9GA 1C5XB 1LPZB 2PKSB 1C5PA 3MO6A 4DT7B 2BVXH 1V3XA 1C5ZB 3TK5A 9LPRA 2AYWA 1C2MA 2HWLB 3DUXH 1F5KU 1KIGH 1SL3A 1F0SA 1UCYH 2VIVA 4Q80A 1C1MA 4ACBA 1GDQA 1YPJH 2K8IA 1INCA 1TMBH 3DA9B 1JRSA 1NPMA 1A3EH 1LHCH 4O9VA 3Q3XA 2UWOA 2W6JD 1HCGA 3A81A 1C2FA 1JMOH 1P2MA 4D7FA 1WAYB 2VIPA 4ZXXH 3AW0A 1O32A 2OC0A 1O36A 4DY7B 3SV8A 4O97A 4O03A 3ESTA 4UFGH 1QFKH 5DKMA 1BT7A 4NCYA 5GPIB 1GHAG 4WMDA 4I86A 1GHBG 1MKWK 1OYTH 1NESE 3ATLA 1HJAB 3K6YA 3TGJE 3ZZ8A 3U98H 2PTCE 3OX7U 4WH8A 3GS9A 1L1NA 1ARCA 1PPZA 1BMFD 3WW7A 5DP8A 2G5NA 4IMQA 2FZZA 4NA7A 2RFKC 2ZFQH 1FN8A 1O3BA 1FN6A 1C1VH 2AIPA 4KKDA 3MHWU 2HVXA 3EDXB 4INHA 5HGGA 1C1NA 1ZHRA 1ELVA 1O2SA 4AYYB 2WPKS 4HGCA 2PTNA 1SQOA 6LPRA 2B7DH 2W26A 4FU7A 2P3FH 3L33A 1CGJE 1XX9A 1C1TA 1V2MT 2O8MA 1GJ9B 1P8VC 5HKKD 1GBDA 4NG9H 4CRGA 5HYOA 1O39A 5CHAB 2PKAA 3JZ1B 1AVGH 2P93A 4JZEH 1H8DH 1TB6H 1AFQB 2XNDD 2J97A 4FUCA 1U6QA 1YCPH 4ABAA 1TX7A 1HB0B 1F92A 5DP7A 2VWLA 3OY5U 3ZV8A 1BHXB 2OLGA 1L2EA 1NFXA 1OP2A 3SU1A 1HAVA 1BMNH 4DURA 4DW2U 1V2RT 3OY6U 4JK5A 1AMHA 3PWCA 1A2CH 3URCA 1TPAE 1H9LB 3QLPH 4X8SH 2BB4A 2HNTC 3PLKA 1O2IA 3M5LA 4NIVA 2G81E 1GMHG 2BQ7B 1LKAA 3VB6A 2YMSD 3TH4H 2OP9A 2O9QA 3RXKA 1S0QA 4YZUA 4INLA 3EA8A 1QNJA 2ZDNA 3VXFH 1QRWA 3RXAA 4X8VH 2F91A 3DT0H 3SJ8A 3AASA 5EIYA 2BVSH 4IC5A 3R3GB 5EW2H 1SOZA 5HIYA 4A7IB 2WPMS 3F9FA 4I31A 1VCWA 5FPYA 1YPHE 3AAUA 3A87A 1OWIA 2A7CA 4J1YA 1H8IH 4R0IA 5L2YH 5C2ZA 3NKKA 4ISOA 3SN8A 3FN8A 2Z9GA 1SLVB 1ZMNA 1O3JA 3SU5A 2HVYB 1PFXC 3U8TH 1G2LA 2SGQE 3ZZ5A 2YNBA 2OC8A 3MWIU 5DP5A 2A4QA 1P2KA 3A85A 1Y8TA 1ZYOA 1ZTJA 4ZMAH 2OC7A 4NWLA 3ZZ4A 4Z0KA 1Z1JA 1ABIH 2IPQX 3TJOA 1WTHD 4YT7H 4GHQA 3PWBA 1YLNA 1MTUA 2IJOB 3UIRA 1GI2A 3LDXH 1TA6A 8ESTE 1TPSA 4RT1A 1YM0A 1HYLA 2Q6FA 4NSYA 2W7SA 5F8ZA 2FEQH 1QB6A 5IK2D 3GOVB 1GBJA 3A7TA 5KECA 1C4V2 2NU1E 2KCAA 4BXWA 5F8XA 1C9TA 2XWBI 1EJNA 6GCHF 1HAOH 3TPIZ 1YBWA 5C1XA 1IHSH 3UUZA 5CDFE 3TK9A 4WY3A 1B0EA 1LO6A 1DE7H 1EQ9A 2J4IA 1NY22 2PGQB 2A32A 2J98A 3QGJA 3TJNA 4A1VA 1EASA 1AWHB 1EZQA 1UVPA 1GMCF 2BXUH 4WF8A 1CVWH 1SGPE 3SV6A 4CBOA 3QUMP 5EQSA 2HPPH 1CHOF 4QT8C 1ACBE 3S9AA 3SU2A 3MU8A 2FOCA 1B5GH 1NFYA 3N99A 3VB3A 1OKXA 4YM9A 2J94A 1Y3VA 3A80A 1V2WT 3JZ2B 3F68H 1ANDA 1O3PB 5DPAA 4OGXA 2K0QA 4YXWD 1C1QA 3MNCA 1AWFH 3Q3YA 1G37A 1HPGA 3LJJA 4K3JA 1RS0A 4WXVA 4YESB 2OUAA 3NPSA 3H7TA 2J5UA 2XW9A 4MTBA 1P05A 1V2JT 3D62A 2SFAA 4YOGA 4Y71A 2ALPA 2OD3B 1YPMH 5FXLA 2G5VA 5HM9A 1HNEE 1TIOA 2GT7A 2ZFPH 1AE8H 3SNCA 1EJMA 4TY6A 6GCHG 3RXEA 1UTNA 2ZDKA 1SGNE 4A92A 1ZJKA 2OBQA 1W10U 2SGDE 1V2VT 2BLOA 2ZECA 4ABIA 4E06H 1TMUH 5F6MA 2TGTA 2FPZA 1DICA 2Y82A 1AB9C 1FONA 1GBKA 4NFFA 3ZVAA 2BDIA 3MI4A 3Q76A 1P02A 3E91A 4Y11E 3SW2B 2NU0E 2BD7A 1D9IA 1CU1A 3ATKA 1TWXB 3ZZCA 3FZZA 1SQTA 5A0BA 2AS9A 1MTNB 1P2NA 3SU4A 5L2ZH 2LP6A 2FOGA 5FL7D 1FIZA 2FDAA 3OEED 1GI6A 2SNVA 1W2KH 1MCTA 2ANWA 2VGCB 4XBCA 1O3CA 4KP0A 1AE5A 1UTPA 1QJ1B 4F55A 1ZZZA 3GYLB 4MPVA 1C2JA 1OPHB 2C8ZB 2FOBA 2ZCKP 4K8YA 3DSGA 4U2WA 1C1UH 2D1JA 1VR1H 2QN5T 5E0JA 2PW8H 1H8HD 3AVZA 3RXIA 1C1SA 1YYY1 1NRQH 6ESTA 3SV9A 2YMSC 3KYGA 2BDHA 1YKTA 1ZRBA 1IQEA 3WWBA 3UTUH 5F03A 2HOBA 1L4ZA 1F0UA 4Y0YE 1C2LA 1T4UH 2ZF0H 5IDKA 3I77A 3RXDA 1QBVH 2KCOA 1ELGA 1RIWC 1G3EA 1MU8B 1Q31A 5TJXA 4H4FA 1S6HA 3P95A 2CN0H 2ZIQH 1MMJN 1TQ7B 3SGBE 3RXFA 3FP7E 3KQ5A 4AG1A 1ETRH 3RLWH 1W7GH 1PPEE 3IWMA 2FP7B 1OP0A 3N7EA 1DWBH 1EZUC 1HJ9A 1BTUA 2QXIA 2ZA5A 3U28C 1MQ6A 4OS1A 1QJ6B 3B9FH 4FUIA 4ABBA 1GG6B 1BHXF 1SFQB 5DP6A 3SGQE 4I8HA 2BLVA 1V2NT 2H5DA 2ZPSA 1SBWA 3SJOA 4YOIA 3UWIA 2NU3E 1C2EA 4GHTA 3L3TA 5C17A 4A5TS 2P8OC 3OEHD 1AKSB 1WSSH 3LH1A 1OWHA 3DFJA 2BZ6H 7GCHG 3GICB 3C1KA 4JMYA 3RUOA 2FODA 1O38A 1QURH 5T6DA 5LPRA 1YPGH
chains in the Genus database with same CATH topology
1GMDF 2XCNA 1ZTLA 4B1TA 2Z6BD 1ETSH 1HDTH 2ULLA 1C2GA 2GCHG 2O8WA 1O33A 4BANB 4HFPB 1EUFA 4JYUH 2STBE 2I6QA 4TY7A 4YLUA 1O2OA 1SGQE 2QC2A 4I8GA 2WYJA 4ABFA 1O2ZA 3MO9A 2BY5X 3SUDA 3SO3A 1W0ZU 2EI6A 2GP9B 3KIDU 1O3HA 4Y8XA 5HXFA 2RDLA 2VVVA 3UNSA 2ANMH 1AN1E 4H6TA 1TALA 5EXLA 4OS5A 4JZDH 5HMAA 1PPBH 2R2MB 2WUCA 2G55A 3ZVGA 1W7XH 2XBVA 1AFEH 1OWKA 1KDQB 1T31A 4AFSA 1BJVA 4X1QU 1SGCA 3ZVEA 5GDSH 6CHAC 2GCTC 5C67A 5ESBA 1QQ4A 4GCHF 2OTVA 3RXBA 1CT2E 4ZH8A 1UMAH 4Q7ZA 2ZDLA 4OS4A 4TYDA 3VFEA 2UUJB 3A86A 4FUEA 3EGKH 2ZKSA 1AUTC 1FQ3A 5E2OA 4FUDA 1EKBB 1RTKA 2HRVA 1K1JA 2JH6D 3GDUA 4WMFA 3V7TA 3M3VA 3T28A 1MZAA 1SHYA 2AGEX 2Y5GA 2PWXA 5AHGH 1E36B 2W3IA 3QTOH 2B0FA 1OP8A 2ZHWH 4HI3A 1GVLA 1O2RA 3LH3A 1NT1A 3WY8A 3LU9B 2WV5A 1TGCA 1WQVH 3HPTB 2UWPA 2BD5A 1HJ8A 4X1PU 2R3YA 4U30A 1GBMA 4MNYA 1AZZA 1LHDH 2A2QH 1BBRK 3MU0A 2XC5A 2ZG0H 4CHAC 4NA9H 4R8TB 1GI7B 1P01A 4TWWA 5FCRA 4E7NA 2ZQ2A 2BVRH 2ZFSA 1J17T 1N8OB 1QL7A 1C5LH 3HK3B 1C5SA 3SU3A 1F5RA 3NZIA 3FVFB 1C5NH 1CGHA 1FV9A 3RXTA 3T62A 1ZMLA 3FANA 1UVTH 1TA2A 2Z94A 1K22H 1SQAA 1UTLM 3OU0A 4GCHG 3VEQB 1ELFA 5JBCS 3GY4A 1C9PA 3B23B 3GCOA 3TJVA 3TNTA 4XBDA 2FYRA 1C5MD 2AH4X 4B74A 4I32A 3SQHE 4Y8ZA 5FBEA 2F83A 2FIRH 2QCYA 5T3HA 1GBIA 2O8UA 1O5GH 4X1SU 5T6FA 1E0FD 4ZKNU 1C2DA 1P9UA 1XXFA 3TLOA 5A8ZA 2XC0A 1IQGA 1C1PA 3SJKA 2HNTE 2P95A 3BTQE 1GHAF 2P16A 1S5SA 1EXFA 4BAQB 3SI3H 3PMJA 1TNKA 1O3MA 1Z71A 1EJAA 1UJ1A 3BG4B 3ZZ6A 4DOQA 1P03A 3MOCA 1KXBA 2ZCHP 1QRZA 2AGGX 3KCGH 4LZ4B 2AMQA 1LCYA 4F49A 3W95A 1G9IE 2A5AA 3M5NA 3PO1B 5FAHA 1W14U 8GCHG 3E1XB 5LH8A 2VVUA 1TGNA 1H1BA 2Z9LA 1ESBA 3AAVA 1D6RA 1XMNB 1DM4B 1MTWA 2O8LA 2J34A 1LPGB 3ZVCA 2ZFFH 1YLDA 3P8FA 3SJIA 2BLWA 4ZAEA 3Q77A 3A7VA 3ELAH 1MTSA 4GSOA 1RJXB 1DXPA 3DFLA 1O2YA 3BTDE 4X6OA 5L30H 1VGCC 2LPRA 2QAAA 1EPTC 1CA8B 2AERH 1KLIH 1GVKB 1CSOE 3UR6A 4CRAA 3BSQA 1RGQA 1SOTA 4A1XA 1KXDA 2XCFA 4DJZB 4IN2A 1C5YB 2I6SA 2KAIB 4BOHA 2XBWA 5TCAA 1DXWA 1P2IA 1E38B 2CF9H 1MKWH 2GDDA 2FOHA 2FI5E 2FTLE 4Y79A 1NRRH 1BRBE 1OWEA 1TPPA 1V2KT 3LKWA 1BZXE 4AFQA 1XUGA 1L4DA 1ZSLA 2B8OH 3GY5A 3GCTG 4IC6A 4FU9A 2TGAA 4DIHH 1P12E 1HUTH 1IQNA 2FESH 5EG4A 3RU4D 1H9HE 1TBQH 1YPEH 3ODDA 3W94A 4I8LA 1HAHH 3A88A 3RXVA 1O5FH 2CF8H 5CE1A 1YP9A 3GISB 1AFQC 1GMHF 4XE4A 1LQDB 1XVMA 1IQHA 1ZOMA 3MO3A 1BTZA 3ZZ7A 4XFQA 1M9UA 2H2ZA 2FXRA 3HKIB 1GI3A 2F9PA 2G8TA 4JYVH 2DE8A 4KTSA 4Q7YA 1NRPH 1FXYA 2BD8A 1EZSC 1SHHB 2V3HH 3BEFB 1EB2A 5AVDA 1AKSA 1YPKH 2BY7X 1KXEA 5I46H 4CRDA 4DIIH 4LZ1H 1ZGVA 4ABHA 4FUGA 3Q3KA 1F0TA 1ZJDA 5C5OA 2ZGXH 1PQAA 3BTME 3MTYA 1F0RA 2FO9A 1DOJA 3LOXA 3SZNA 1IOEA 1BQYA 2A31A 5DP3A 3ZVFA 1HAZB 2FTMA 2EEKA 4NFEA 4GUXA 4B76A 1J16A 4UONA 3RU4E 1KXCA 1P04A 1EAUA 1GWAA 3ZZ3A 3E0PB 2C8WB 1NO9H 3PMHB 3SU6A 1OSSA 2FI3E 2A4OA 2ZGCA 2ZTXA 4INKA 4I8JA 3GCHC 1P0SH 4TWYA 4PROA 1PPGE 2NU4E 1TMTH 2ZCLP 1KDQA 1LPKB 5EPYA 1AQ7A 2GMTB 1NM6A 3KL6A 2UUYA 1XKAC 2ODYB 4AX9H 1TRNA 1RRKA 3BIUH 5C1UA 3QGNB 1XUHA 1D3QB 2CV3A 3CP7A 1WYKA 2FI4E 4B75A 3M37A 2P59A 5H4IB 1BBRE 4XBBA 3T25A 1QL9A 4MPXA 4ISIH 1L1GA 1V2QT 1OYQA 1SLXB 1ZLRA 4A6LA 4AGKA 1IHTH 5PTPA 2PUQH 1S81A 2ZC9H 2ODQA 1BTPA 4WH6A 2BY9X 1Z8IB 3UOUA 2TGPZ 3ITIA 3KQBA 1BRCE 4X0WU 5DP4A 3UREA 1ZHPA 1RTLA 4YTAA 5CMXH 4DGJA 3B8JA 1MBQA 2VINA 1XUJA 4BTTB 3URDA 3TNSA 2VWOA 1O3IA 4UEHH 2JETC 4CRCA 4VGCC 2Z9KA 3BF6H 1TE0A 1K1OA 1P3EA 1S83A 2ZEBA 4WJG2 3M61U 3RXPA 4OS6A 1W8BH 1Y3XA 1G2MA 4Y10E 5DJ7A 1DITH 4X2YA 1BA8B 1JWTA 4CR9A 1TOMH 4IW4E 4BTIB 3BTKE 3O8RA 4BNRA 1TX8A 2VVCA 3TJUA 7LPRA 2FOAA 1F7ZA 1FIWA 1C2HA 3IG6B 1KLTA 1HAXB 1WQSA 5FBIA 1HV7A 2FLRH 1AI8H 1FAXA 1L0ZA 2ZDVH 1O5CB 5E2PA 1QCPA 1BRAA 1VCPA 1D4PB 3M7UA 2CHAC 1EP6A 1ETTH 3KN2A 1O2UA 2FS8A 3E16B 1CO7E 1PPCE 1S82A 2GDEH 3P17H 1DDJA 1IQLA 3S0NA 1O3LA 4AFZA 4B2CA 3E8LA 3A82A 4X6MA 5IYTA 3RDZA 3RXRA 4B73A 3TH3H 2NWNA 1DT2A 1O2XA 2FWWA 1AD8H 1ESAA 8KME2 2BXTH 3R0FA 3VGCB 2ZFRH 3SNBA 4Y6DA 5G4BA 1T8OA 3S7KB 2Q1JA 1ELCA 1GJAB 1TLDA 4MNWA 1HAGE 3VB5A 1D3TB 1JIRA 1T4VH 2R9PA 1UCYE 1DWEH 2F3CE 3VB4A 3KHVA 1ANBA 2VIQA 3UY9A 2QYIA 1CBWB 1EAWA 1QTFA 3ZV9A 2PR3A 1XM1A 2PUXB 3QDZB 3LPRA 2PGBB 1P06A 4X1RU 1O30A 3HGPA 2RA0A 4KELA 3RMMH 4CRFA 1TNJA 4MVNA 2BHGA 4FUJA 3PLPA 1LVOA 4E05H 1SGFG 1TNIA 2SGFE 1O2VA 4GVUA 1X7AC 1FPHH 4AOQA 2ZHQH 1GBCA 5FX5A 1AIXH 3VB7A 2QXHA 2QV1A 1TGSZ 3M3TA 5JBBS 3MH7A 1MH0A 1A4WH 5EOKA 4X6PA 3BTEE 3T27A 3P8NA 4J2YB 2A1DB 5TCCA 2TPIZ 3O8CA 1ORFA 2ZU1A 4ZROA 2GZ8A 3CS0A 1VCQA 1MKXK 2XBXA 1TFXA 2IOTA 1SMFE 4IMZA 3QTVH 1C5QA 5EXMA 3PROA 1W12U 5LGOA 1G3DA 2GVFA 1O2NA 1V6DA 4U32A 2B5TB 2M5TA 1CT0E 2G00A 4ZHLU 4NSVA 1V2PT 2FLBH 1GL1A 1Z8GA 3F6UH 3HK6B 2Z3EA 1ESTA 1TNLA 1GGDB 2ZU5A 1LVYA 7GCHF 3GY6A 3RXSA 3SV7A 4O3TA 3SNEA 3BTGE 1O2QA 4CH2B 1SFIA 1THRH 1OWJA 1ZPZA 3M5OA 1EOLA 5A8YA 5DK1A 5HM2A 4AFUA 1TQ0B 2EA3A 2GCHF 4Y76A 1CE5A 4JCNA 3FFGA 5F8TA 2OBOA 1BMMH 4RKJB 3A89A 1Z8RA 1LMWB 2OCVB 3QZQA 4ISLA 1FLEE 4X2VA 2BDAA 3U8OH 3S9BA 1J8AA 4K60A 1BMAA 1C2IA 3RLYH 2ZWLH 1ID5H 3PB1E 1K1NA 3BN9A 4KTUA 5JB9S 4B2AA 3U8RH 1KXAA 1C2KA 3F1SB 2R3UA 1DY8A 1SGIB 3TGKE 1ZPCA 2GV6A 2RA3A 2WUBA 1EX3A 3PTBA 3E0NB 1XUFA 2VWMA 5EU8A 4TPIZ 3RMOH 1CA0C 4B71A 1GL0E 4SGBE 1O3EA 2WINI 2CJIA 3QN7A 3PYHA 1Y5BT 3D65E 2XRCA 1GJ4H 1OOKB 2Z3DA 2BY8X 1RIWB 3RXOA 4Y8YA 1OS8A 3MFJA 1MBMA 4K2YA 4ABDA 2C3SA 1SSXA 2GT8A 2H9TH 4DG4A 4H42U 2AEIH 1GCTC 3ZVDA 7KMEH 1CGIE 1GVZA 1ARBA 4FUBA 2PLXA 2OC1A 4F4OC 1BDAA 3P70B 1UTQA 2BTCE 1G3BA 1IQIA 3M3SA 4NIXA 1TBZH 1GBAA 3TVJB 1T32A 1CHGA 3FP8E 3ZVBA 1O2JA 1FY1A 2ZPRA 3RC6A 3E6PH 1C5WB 2P8OB 1FY5A 1T8NA 3GY8A 3LT3A 2BD3A 3TITA 1JIMA 2W3KA 2G51A 4AGJA 2R0LA 1JOUB 3LIWA 5JPMH 4MPUA 3T5FH 1VJAU 2C90B 3AW1A 1Z6EA 2A45B 2FX6A 2Y7XA 2OINA 3V12A 1O2LA 4HZHA 1QR3E 2YOLA 1FI8A 1ANCA 2ILNA 3SNDA 3ENSB 1PQ7A 2QF3A 2W7UA 1Q2WA 4IN1A 2CXVA 3PM3A 2STAE 2ZU4A 3T26A 1TPOA 1S0RA 1UK3A 1QIXB 2TIOA 3ZYEA 4CRBA 4D76A 1MD8A 1T8MA 2V0BA 1K2I1 1FJSA 2SGEE 3UFAA 3MU1A 4D8NA 1GDUA 3HKJB 3A8DA 1LHGH 4FUFA 3OTJE 1A0JA 1AGJA 4YO9A 4UD9H 1ABJH 2A5KA 3SUEA 3D23A 3TK6A 2BY6X 5T6GA 2F9OA 3M36A 1AZ8A 1P2OA 1BBRH 1YCPM 3IITA 4ZHMU 1Z6JH 2GGVB 3CENA 3MH4A 3ATWA 2GCTB 1MCVA 1A3BH 8GCHF 1O3AA 1SI5H 3PLBA 2VU8E 1DSTA 2ALVA 1EOJA 4AG2A 4IBLH 2OQUA 4ZUHA 1TGTA 1RTFB 2HPQH 5BPEA 5DG6A 1E37B 5A0AE 2CGAA 2A2XH 1E34B 1K1LA 4A1TA 5GWZA 1ELAA 4XDEA 2ZFTA 1TGBA 1O37A 1GBLA 2G52A 2QY0B 3BG4C 3RXHA 4BAOB 1AUJA 4ABGA 3SI4H 2TGDA 3LONA 5K0HA 2YNAA 3LGTA 1IAUA 5EXNA 4CR5A 2PKSC 1DX5M 1GCDA 1PQ8A 3A8CA 3SU0A 1MAYA 1THPB 1UHBB 1D3DB 1P2QA 2BOKA 4ABEA 4CHAB 2BZAA 3RC5A 2R2WU 5DO4H 2VIWA 1C4U2 1ELTA 4ZXYH 1HLTH 2WPLS 3P8OA 1BIOA 4E7RG 1WU1A 2UWLA 3K6ZA 1WV7H 1TONA 3PMAB 2WV4A 3GCTF 4DCDA 3S9CA 2SNWA 4UFDH 1SB1H 2F9BH 3TGIE 1Z1IA 1EP5A 1NROH 2AMPA 2ZHDA 1KYNA 1QQUA 2ZQ1A 3C27B 3ZYDA 1O34A 1BRUP 1O3FA 1UTJA 2A7JA 4I7YH 3A84A 4Y0ZE 5FCKA 1XUIA 1FDPA 1JXPA 1W0YH 1K1IA 4MG3A 1HXFH 4RN6A 2GKVE 1HJAC 1SGDE 1PYTC 3A7YA 2P3TB 1FY3A 1NRSH 1P10A 2FMJA 2VWNA 1SGYE 1E35B 5FX6A 1C5UA 1GJ6A 2THFB 4X1NU 1UVSH 1THSH 4YOJA 1UCYK 1MTVA 4YLQH 2Z7FE 3EQ0H 1Z7KA 1V2OT 3RXGA 1A5GH 3E3TA 1TYNA 1Q3XA 4H6SB 1EAIA 3UR9A 1JBUH 2D8WA 2ZU2A 2ZTZA 5C20A 1UTKA 1DPOA 1S85A 1QJ7B 4MQAA 4M7GA 3EYDA 1GBEA 1GDNA 3QX5H 4OS7A 1FNIA 1YLCA 1LHEH 3M7QA 1O2PA 3SHCH 1LVBA 4ISHH 1QL8A 1HFDA 1GJ7B 5CHAC 2OXSA 3SV2H 3UQVA 1YC0A 3SBKA 3BTFE 3P92A 1UTMA 1V2LT 2ZZUH 2P3UB 4FVDA 1VITH 3TU7H 3VPKA 1VGCB 2ZHEH 1EPTB 2XNIA 3G01A 3NUMA 1UVOA 2D2DA 2WPJS 1MQ5A 1C1OA 4BAMB 1O3OA 3ZZAA 3ZZBA 3BTHE 1OWDA 5GCHF 2ANKH 4WXIA 2D26C 3KGPA 4JZIA 3GY3A 7ESTE 2EI7A 5AFYH 3S7HB 3RMLH 2QGRA 3A8BA 1IQJA 2O8TA 2ZDMA 2TBSA 4BXSA 1FY8E 5E8EH 4WVPE 4AORA 5JBAS 2C93B 1V2TT 2AIQA 1C5OH 5JBTA 1SGEE 1C5VA 2ZPQA 1O2HA 1V2ST 2WYGA 3NWUA 2JH5D 1BTYA 2ZGBH 2V6NA 5SGAE 3LC3A 1NS3A 1HAYB 1O2MA 4O3UA 5I25A 3GDSA 1HRTH 3RXQA 1P9SA 3BEUA 3KQEA 1MD7A 2H9HA 2QIQA 2FOMB 3RP2A 3V0XA 1DWDH 1N6XA 4JZFH 2ZU3A 5E0HA 5A2MH 1P3CA 2GMTC 2BDGA 3RXMA 3I78A