3MOCA

Investigation of global and local effects of radiation damage on porcine pancreatic elastase. eighth stage of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mocA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mocA01
1F7ZA 3AW1A 5ABWA 1CU1A 1PQAA 2WPMS 1C1OA 2BX3A 2G5NA 2OXSA 2XW9A 5LH8A 7ESTE 2VIPA 1GGDB 1QA0A 2OBOA 1HNEE 2LPRA 1GHVH 1KXFA 4UONA 1EAWA 1QL8A 1L1NA 1TNLA 2FOHA 3RXGA 1DS2E 2NWNA 1PPFE 1SLUB 1SHHB 2Q6FA 3NPSA 3V13A 3MI4A 4INKA 1MTVA 1BHXB 1QL7A 1CGHA 2FOGA 3CENA 4IN2A 5GCHF 1MH0A 1K22H 2B7DH 3GY8A 4LZ1H 4D9QA 1O3EA 3RC4A 2SGDE 5LPRA 1LVMA 3U8OH 1FV9A 1SGYE 3O8DA 1S6HA 5EGMA 3LJOA 2AEIH 1E37B 4YZUA 2GD4B 1EJMA 1YCPK 3A7XA 1N8OB 1KSNA 1KXAA 3SGQE 4NFFA 3FP8E 1ELDE 1Y3WA 3I29A 4VGCC 3G01A 2WYGA 3ELAH 1DICA 1CA0B 1SGEE 3URDA 3RXTA 4A1VA 8ESTE 3QN7A 1C5PA 1FLEE 4Y7BA 3RU4T 3SUGA 2O8WA 3O8CA 1QR3E 1QRWA 3SQEE 1MKWK 1ANCA 3BTQE 1BITA 1HAIH 1O35A 1LMWB 2THFB 4NG9H 3SOSA 4AB9A 5ESTE 2BYAX 1SLWB 1BRBE 3SO3A 2QF0A 1EP6A 1NRRH 2VGCC 3SUDA 3UOUA 3PWBA 1XKBC 1ZR0A 3V0XA 5LPEA 1G36A 1P2KA 2ZFPH 2KAIB 1AD8H 3UQVA 2SGPE 1E38B 4IN1A 2ZDMA 1HAZB 1P8VC 1NO9H 1DM4B 2H9TH 5EU8A 1QTFA 4MPVA 2ZI2H 4K1SA 1GI3A 2WPLS 1MD7A 3P70B 1AUTC 1BTZA 3MO6A 4BAQB 3NUMA 1GJCB 2HALA 3LGUA 3VFEA 1YCPH 3RXPA 3SNDA 3PTNA 3QGNB 4LOYH 1T4UH 1P09A 3GY4A 1C2IA 5DGJA 1FPCH 2PKAA 2XXLA 4FUEA 4X6MA 5ESBA 3K65B 1SR5C 1O37A 1U6QA 1DVAH 2QXJA 3H7OA 2HWLB 2PV9B 1A61H 3KQCA 1ETRH 1C4V2 3ATKA 3QWCH 1GBTA 4X8SH 2TGAA 1FMGA 5F8ZA 1GVKB 5DP8A 2H6MA 1L2EA 2H2ZA 2F9OA 5EPYA 1GMHG 1MKWH 3U98H 3BN9A 1WQSA 1P01A 4WXIA 1SOTA 3SV6A 1MKXK 2QV1A 4J1YA 5C3NA 1E34B 1W0YH 4GAWA 2XC5A 3ATIA 1QQ4A 4UD9H 4JZEH 4AGKA 2P3UB 1GDUA 3FAOA 1JXPA 1Z1JA 3M3SA 2B8OH 5GPIB 1PPHE 4F49A 3LH1A 4Y0ZE 3PMBB 3RXAA 1SBWA 4INLA 1GBEA 4LZ4B 1C5XB 5F8TA 4OS1A 1NU7B 1LPGB 2FX6A 2ZGBH 1O2LA 3I77A 3SV8A 2ZG0H 4AN7A 4XFQA 3Q76A 5DJ7A 4BTUB 1Q2WA 1UK4A 1DWDH 2BDAA 2CGAA 3V7TA 1QRZA 1A3EH 1SLVB 2HNTE 4KGAA 3GCTF 3P8FA 2ZIQH 1GBAA 5FBEA 5DKMA 4FU9A 3ZZDA 5A09A 4Y7AA 5HXFA 2WPIS 1O2UA 3SORA 3RXCA 1AZ8A 2ZFRH 3UNQA 1V2PT 1UTPA 2V3HH 3ESTA 1V2UT 1GBKA 2ZO3H 1EZXC 3M7QA 3QUMP 1H9LB 3RLWH 2ZF0H 2TPIZ 1P0SH 3W95A 3LGIA 1O2WA 1MKXH 3KQEA 1GI6A 2STBE 3UNSA 1OXGA 4DCDA 4ABAA 5LGOA 3E1XB 3A7TA 2P59A 1CO7E 2ANKH 3GY7A 2W3IA 1G3BA 4JZ1A 1HLTH 3RXSA 3VB5A 1QJ7B 1Z7KA 2QAAA 1FXYA 2EC9H 4IC6A 4BAKB 2ZDAH 3RMMH 3QTOH 2J92A 1YPKH 4FU7A 3RDZA 4AYVB 4ABHA 1KXDA 1ELCA 1HAVB 1ZMLA 1MUEB 1AUJA 2FTMA 2A4GA 1IQEA 9ESTA 1EUFA 3MU4A 1OYQA 1DOJA 3UFAA 2D8WA 3UR6A 2FI3E 3ZZ8A 1FIZA 3RP2A 2C8WB 1TNJA 1LKAA 3RC6A 1EAXA 4B2CA 1QB6A 4FUIA 2A7HA 1C1PA 1O2OA 3KQBA 1ZTLA 1S81A 1E0FD 1HJAB 1AHTH 4D8NA 1DFPA 4B71A 2G4UA 1DANH 3LOXA 1GBHA 1L0ZA 2FOCA 1MU6B 1NESE 2FESH 3B9FH 3ODFA 3DA9B 3S7HB 1SB1H 2ULLA 1QIXB 4BAHB 1EOLA 1GG6C 1P2NA 3PMHB 3TJUA 3IG6B 4YLQH 5C2ZA 1UVUH 1H9HE 3S9AA 1GCTC 1O3MA 1C5VA 3HGPA 2Y82A 1O2ZA 5BPEA 1KY9A 4I8LA 1AKSB 1FY8E 1NFUA 2J38A 4IMZA 2QN5T 5L30H 1EAIA 1UHBA 3KNXA 2PKSC 1C2GA 3GY5A 5IYTA 3P6ZB 2CMYA 4X2YA 1F0UA 3S9BA 3MH7A 2GDEH 2OQUA 3H5CB 5A0BA 1PQ8A 4E7RG 2P93A 2QXHA 4MNXA 1C5QA 3SU2A 3GCNA 2BDGA 2WV5A 5HYOA 1ZGVA 1LO6A 1GBJA 2Y5GA 1A0HB 3ZZCA 1SGQE 1GHXH 1BIOA 5E2PA 1A1RA 3VGCC 1PPZA 2Q6DA 1ZMNA 2D1JA 5DK1A 3UPEA 2BLVA 2VIVA 1LVOA 1PYTD 3ZVEA 4FVBA 1BTUA 1LKBA 3PM3A 3ZZAA 2AGGX 1SFQB 1VGCB 5JBTA 2SFAA 1Y3VA 1GPZA 3CS7A 3VB3A 1C5UA 1J9CH 5DP5A 3A8BA 5J4QA 4Q7YA 2GVFA 5AF9H 1UTNA 2GTBA 1C1VH 2WPKS 4UEHH 1FONA 1UO6A 3UY9A 1ZHRA 2XNIA 4DIIH 4TPIZ 2PSYA 1GBBA 1SGDE 3QZQA 3JZ2B 3OYPA 4GHTA 1DXWA 4ZKSU 1T7CA 1AWHB 1HRTH 1XXFA 2Y7ZA 3NKKA 8KME2 2R0LA 1GI0A 4WF8A 3AW0A 1O39A 1O5AB 1GL0E 4CRDA 3STJA 4AZ2B 2BVRH 1ZYOA 2HOBA 1GMCG 3TK9A 2ZQ1A 1GCDA 1L4ZA 4MNYA 5CHAB 2OC0A 5A8ZA 2GP9B 1BOQA 3OU0A 5B6OA 1O3BA 4HTCH 2XTTB 1NTPA 4E06H 3TGKE 3SJOA 1O3NA 4JMYA 5AHGH 1EPTB 2BY9X 1TWXB 1ZSKA 1QJ1B 2ZTZA 1PYTC 3M5LA 5C1XA 1AE5A 1QHRB 4FUFA 4CHAC 1XVMA 2QXIA 3BEFB 3U69H 3T26A 1GJ6A 1RRKA 1XKAC 1O2IA 3PO1C 2BXTH 2BDHA 4J2YB 5HM9A 2AMPA 1O5EH 1AB9C 1RJXB 2Z9LA 1O2SA 2CHAB 3A85A 2GGVB 3RXBA 2H9EH 5A2MH 3RXJA 4IW4E 3NK8A 1QL9A 2BHGA 4DURA 3RU4D 2AYWA 4ABGA 1SGRE 3HKJB 5GXPA 1DY8A 3MU0A 4DW2U 3SZNA 4TPYA 4Y6DA 4ABIA 1THRH 3RXRA 1BJVA 3TGIE 4CBOA 2BVXH 1V6DA 3UWIA 1HAYB 3MNBA 3QO6A 2ANWA 1GMDF 3A89A 3FZDA 1CT4E 2WINI 2QGRA 1OWDA 1TAWA 2ESTE 2GCHG 1GBDA 1J17T 4TY7A 1HAXB 1MZAA 1H9IE 2VWLA 4ISOA 2Z9GA 5FX5A 1S0QA 5E2OA 3HKIB 3SJ9A 2B0FA 1A5IA 3QTVH 3RXDA 3SV7A 3PYHA 3SJ8A 1TONA 3BTME 1P10A 1CT2E 6GCHF 4K69A 1EZQA 1GHAG 3F9HA 5E0GA 1HDTH 1JIMA 1O5FH 1Y3UA 2A5IA 1KIGH 1UVSH 4ZROA 4ZXYH 1V2VT 2VB0A 3LC5A 3MTYA 5E0HA 4ASHA 5CE1A 1LPZB 3JZ1B 1A0LA 1AIXH 1NM6A 3F1SB 4Y79A 3WY8A 1D3PB 3O8BA 1WCZA 5E0JA 1SSXA 1ELAA 2CJIA 4OS4A 1HAGE 3C27B 1Z6JH 2V35A 2A2XH 1GVLA 3AASA 3I78A 4RSPA 3M5MA 4JZDH 2F3CE 2DUCA 3TH4H 1NU9A 3D49H 2XC4A 3TJVA 1GJ5H 1CA0C 1KDQB 1HGTH 1OWIA 1MTNB 1A2CH 4NIVA 1PPEE 3ZZ4A 1H8DH 3M5OA 3M5NA 3UWJH 2BZAA 4YM9A 1EX3A 2SNWA 4XSKU 2FI4E 1P3EA 1BBRE 1YGCH 2O8TA 2PUXB 1UTMA 2C4FH 1LHDH 2IJOB 1FUJA 3RXLA 1T8OA 1VJ9U 4X2WA 5EXLA 3GYLB 2G00A 1K1IA 2FX4A 1QQUA 1S83A 4B74A 1FN6A 8GCHF 3TJNA 3MOCA 3UNRA 1IQHA 1OWJA 5GIBA 4U01A 1BHXF 4MVNA 5FCRA 4GVUA 4MPWA 1FNIA 1SI5H 3SW2B 2C8YB 3EA9A 1W2KH 2GV6A 1F5RA 1VITH 3U8RH 1EATA 1BUIA 1TRYA 3ZVCA 5A8YA 3GCHC 1Z8JB 3K6ZA 6CHAB 2UWLA 2EA3A 4O3UA 3LGTA 1BMAA 1O5GH 1BJUA 2F9PA 4AFUA 2OD3B 2PFEA 2H5DA 1XUIA 3SHAH 3GOVB 1V3XA 4Z0KA 7KMEH 1ZZZA 4GCHF 2JETB 3OY6U 1TOMH 2ANMH 1ID5H 2HPPH 3M7UA 3P92A 3KIDU 1Y5AT 1IQLA 1O2NA 3RXMA 1O2JA 2NU3E 4O3TA 4AOQA 2P95A 1KLTA 1QBVH 3LIWA 4B2AA 2ZHEH 3E16B 4X1QU 1JMOH 3PMJA 2CV3A 5DP4A 9LPRA 4H6TA 1F5KU 3TJOA 1MCTA 3VB4A 1GBLA 1CHOF 1GBMA 2EI8A 2SGAA 2Y5FA 2SNVA 1ZGIA 1YM0A 1QJ6B 3KL6A 4DVAU 1EKBB 3RXEA 1ZTJA 3Q3XA 2FLRH 5C5OA 3A7WA 2ZTXA 4A6LA 3SJIA 3MMGA 4NIYA 2VNTA 2R9PA 4WMEA 3SNAA 1LHFH 1DUEA 5JB9S 1O5CB 2VIQA 4ABJA 4TY6A 2XBVA 2YNBA 1ANEA 3SU5A 3BTKE 2QA9E 3ZZBA 1T8MA 1D4PB 5JPMH 1O3LA 3M3VA 1DPOA 1YPJH 1CGJE 1KDQA 4NFEA 4AFSA 1O3FA 2VIWA 1YP9A 1B0EA 2FTLE 3KHVA 2BD5A 3BG8A 1TNKA 1G30B 1CGIE 1MU8B 3FVFB 1IQMA 5FBIA 1HUTH 1TMTH 1TQ7B 1YPMH 1KXEA 3LDXH 1O2RA 2BD8A 1RGQA 1K1NA 1KTTB 1SL3A 2CF9H 1EASA 1D3QB 1O2PA 1TYNA 1Y59T 3M7TA 4OGYA 3A8AA 1NRPH 4BXSA 3ZZ9A 4Y71A 1AVGH 2JH6D 3BTWE 3W94A 1NRNH 1K9OE 1TIOA 2G8TA 1ZRBA 3TVJB 1JBUH 2XBXA 1D6RA 4QT8C 2G4TA 1C2LA 1UCYK 3SV2H 1NFYA 4XBBA 1P02A 3ZV9A 1ESBA 1O5DH 2ODQA 2FLBH 3KQDA 4NSYA 1DXPA 1O3OA 5F6MA 1AGJA 1EAUA 5EXNA 1PQ7A 5JYIA 5EW2H 1MQ6A 1GMHF 1S84A 2J34A 1W13U 1C9PA 1S82A 3EGKH 3M36A 4MNWA 3SU4A 3SNEA 3MYWA 1MCVA 1THPB 2J95A 4H6SB 4NA9H 4WMDA 4K8YA 1FPHH 2J9NA 1C5MD 3SHCH 4E7NA 1LTOA 3L3TA 2P94A 3P8GA 4FUHA 2DE9A 3LH3A 5EW1H 3KCGH 1UTJA 1ACBE 2XCNA 2H5CA 3HK3B 4O97A 5C20A 1ARBA 4KTSA 1C1TA 3R0FA 4Y0YE 3RLYH 1OP8A 1HJ8A 3MNXA 2DE8A 2Z94A 5SGAE 2ALVA 3GY2A 1P9UA 2QYIA 2XWAA 1CBWC 2I6QA 3M37A 4CH8B 1C5YB 1C2JA 1RIWC 2BY7X 3F9FA 4FUCA 2ZHFH 1P12E 1W3CA 4YESB 4R0IA 3QZRA 1Z8RA 1ZOMA 4IMQA 3MFJA 1IHTH 1J8AA 1WV7H 4NWLA 4RKOB 2D2DA 1F0TA 1V2OT 1UCYH 3S7KB 4BNRA 1TPPA 2A0QB 1EOJA 2Z3DA 2ZU3A 3BG4C 1GI7B 4PROA 5I46H 1NROH 3URCA 4YOIA 2GCTB 1SMFE 1CQQA 3VPKA 2UUKB 1O2QA 2WPHS 2QCYA 4JYVH 3UOPA 1SGFG 3RXKA 2HLCA 1LHGH 1HXEH 1ZSLA 4VGCB 4ZHAA 3RXIA 1OKXA 5EQQA 1X7AC 3TK5A 4HI3A 1GI2A 1SHYA 1NY22 2R3YA 3F9GA 3SU6A 1IQKA 3GCTG 4Y10E 3L33A 1EQ9A 1VGCC 1DUAA 3MH6A 1F5LA 1V2KT 3TK6A 1G32B 4KKDA 5FX6A 1B5GH 1C1MA 3GDSA 4DOQA 1W14U 3GCOA 3TLOA 2ZA5A 1A46H 2SGEE 2FPZA 1CVWH 2KAIA 2VGCB 4B1TA 1QFKH 3MNCA 2YNAA 1C1WH 1FQ3A 3TNSA 4CRBA 1BTYA 1O38A 1TRNA 2TRMA 4IC5A 1SC8U 1LVYA 2FIRH 3RUOA 4Y11E 2FXRA 1GI9B 1C5TA 1O3HA 3MHWU 1V2TT 2RCEA 4XDEA 4ZKNU 4X6OA 1BMNH 5CHAC 2PTCE 1TB6H 3TGJE 2B5TB 1SQAA 2RDLA 2UUYA 2WYJA 1UK3A 4HGCA 2ZFQH 3PROA 2NU0E 1XUJA 3A7VA 4X1NU 2F9VA 3IITA 1YLCA 3SN8A 1W12U 2VVUA 4WH8A 5AVDA 1H1BA 2WPJS 2ASUB 1H4WA 2PUQH 2RA3A 1GJ8B 1GI4A 1P05A 1TGNA 3A82A 3RC5A 4ZKOU 1YPEH 4JK5A 1IQGA 1RTFB 3H7TA 2FI5E 2B9LA 1SFIA 2M5TA 4MQAA 1BTPA 1SGCA 2WUBA 2CXVA 1YLDA 5C5NA 2ANYA 3LGWA 1FY1A 2FS8A 5CMXH 1BRAA 3RXVA 3A81A 3RXUA 3MO3A 1BDAA 2ZGHA 3UUZA 3U9AH 1UVTH 2O9QA 1G2MA 1T32A 1ANBA 4BAOB 1UK2A 2PSXA 2ZHDA 4AG1A 2TIOA 1ZSJA 3MU8A 2FMJA 3LGVA 1HAHH 4DGJA 2HGTH 3RM2H 4X8VH 1H8IH 2ZGXH 2OBQA 2QXGA 4SGAE 2BY6X 3V12A 3GDVA 3ATMA 1C2MA 3EQ0H 1TBQH 1BRCE 1GDNA 2VINA 7LPRA 2PHBA 1O33A 3K9XB 1YF4A 3BTTE 1GHBG 3PMAB 4Q2KA 2VIOA 2ODPA 1HB0B 1GJAB 3ZYEA 1DWBH 1TX7A 3RU4E 1Z6EA 4I8JA 1KYNA 1J15A 1C5WB 2ZGJA 3M61U 5JBBS 2TBSA 3PLBA 2A5KA 1HBTH 2P8OC 3A87A 4UFFH 1SGPE 4D76A 1XUFA 2XC0A 2ZECA 2OC8A 4YLUA 1AVWA 1WOFA 4X2VA 4MG3A 1ZPCA 1XVOA 2ZNKH 3RXFA 1PPBH 2ZPSA 2BVSH 3TH3H 1N1LA 2F9BH 3ODDA 2EI7A 1GMCF 2XRCA 2BY5X 3A80A 1GBIA 1GI5A 1MBQA 2W7SA 5FAHA 4OS5A 1HAVA 1G37A 1PJPA 4CRAA 2AFQB 1TPOA 1DSUA 1MAXA 1QA7A 2V3OH 1NFXA 1C2DA 1MTNC 1SVPA 5L2YH 2C3SA 3E90B 4M7GA 5DO4H 1O3PB 1W8BH 2UUJB 4ABEA 1S0RA 2QY0B 3ZVDA 3T62A 5JB8S 1C1QA 1CSOE 1K21H 3A88A 1RS0A 4KTCA 3SNBA 2A2QH 1OS8A 1TGCA 1ZRKA 1ELEE 2QC2A 1AO5A 2ZC9H 3A8DA 1ESTA 1O34A 3C1KA 2YOLA 4BXWA 1WBGB 5A8XA 3A8CA 1CE5A 4AFZA 3U8TH 2K1QA 1XM1A 3B8JA 3SV9A 2D26C 1GG6B 4XBCA 1DDJA 1AKSA 1DT2A 1GCTB 1L1JA 2OINA 2Y5HA 3PV4A 4WJG2 1QNJA 3BTDE 1IAUA 1VCQA 1W11U 2ZGCA 1ETTH 3ZVFA 4YO9A 2PKSB 4ESTE 2BLOA 1ZJDA 1FAXA 2VU8E 1XUKA 1P2MA 2AGIX 1S6FA 1AFQB 3AAUA 1BA8B 3TH2H 2ZEBA 2BLQA 1IQFA 4K1EA 4UFGH 1V2WT 2LNCA 3P8NA 1OOKB 1GJDB 1TQ0B 4NZLA 1T4VH 1SQOA 1GGDC 1ZMJA 2JETC 2Y6TA 2XWBI 1UTKA 3GICB 1V2MT 3ZVBA 1O2TA 4LK4A 3VGCB 1MMJN 1GMDG 3RXOA 1F2SE 2ALPA 2Z6BD 1Z1IA 1OPHB 1UTLM 1LDTT 3BIVH 1Y8TA 2C93B 4F4OC 3QX5H 3LPRA 3AVZA 2Z9KA 3E0PB 5L2ZH 3DT0H 1VZQH 1YPHC 1VITF 5FPYA 1V2QT 5C1YA 1AVXA 1AZZA 4I32A 1O36A 1EZSC 1O2GH 3HGNA 1QGFA 1LCYA 1N8OC 4YOJA 4FVDA 2HRVA 5H4IB 1P04A 3SBKA 4MLFB 4RKJB 2FP7B 1TGBA 1FY5A 1IQJA 2I6SA 4MPXA 8LPRA 3Q3KA 4I33A 1J14A 1WSSH 1BMMH 4HFPB 3VXEH 4JZFH 3BEUA 4FUDA 2J4IA 2PTNA 1W7XH 3DHKH 1ZPZA 1DE7H 1P2QA 4CBNA 1HXFH 3E6PH 1OWEA 5F03A 5T3HA 1ZLRA 1ESAA 4ISNA 5DP7A 4KELA 3ZZ5A 2AGEX 4GHQA 2OUAA 3F9EA 3A84A 1TE0A 4JYTA 1EPTA 4GSOA 2AERH 2OLGA 1ETSH 2BDBA 2NU2E 1HAPH 1MQ5A 1PPCE 5EOKA 1GJ7B 4AYYB 1XUGA 4AFQA 2OTVA 4CHAB 1F0SA 4Y76A 1EXFA 5FHTA 2OCVB 7GCHG 1BTXA 1O3KA 2JH5D 3UIRA 5JBCS 2VIDA 2VH6A 1GHZA 1AB9B 2J94A 2O8UA 2P3TB 4CRCA 1ELFA 1D9IA 4X6NA 3VXFH 5FXLA 5IDKA 2GZ8A 2WV4A 2ZCHP 2ZPRA 2G52A 1BTWA 1W7GH 1ZHMA 3V3MA 3BTEE 1YCPM 2UUFB 4ZHLU 1SGNE 4ABBA 1K1JA 3MU1A 2GMTB 1TNIA 1LPKB 2PKAB 4OS7A 1C5OH 4XOJA 2HVXA 4I8GA 8GCHG 2F9NA 4WXVA 1FDPA 2NU4E 1DX5M 2PWXA 1SPJA 1RD3B 1MD8A 3Q77A 4WH6A 4MDSA 2BM2A 1C5RA 2O8MA 1A0JA 1VCWA 1OSSA 4I31A 4Q80A 1O5BB 1K2I1 4Q7ZA 4FXGH 1L4DA 2W7UA 5PTPA 4NGAH 2Z9JA 5GWZA 1BQYA 1Y5BT 2XCFA 1DITH 1YPGH 5EXMA 2ZDKA 1TBRH 4GCHG 4Y8ZA 3DD2H 2EI6A 5C67A 2ZKSA 4JK6A 2F83A 2ZDLA 3MWIU 4U32A 5DG6A 1NPMA 3BTGE 1TA2A 3NZIA 1AFEH 1D3DB 4U2WA 4YOGA 5GCHG 1QRXA 3LONA 1CHOG 1HV7A 1W10U 1JWTA 1RFNA 1OP2A 5T6GA 2W3KA 2FO9A 2GCTC 1EP5A 1GJBB 4CRFA 3SNCA 2GV7A 3EE0B 2BD2A 1SLXB 4NA7A 4OGXA 1QB9A 1K1PA 4Q7XA 3GY6A 1TBZH 4XE4A 3T28A 3PTBA 2ZFFH 5DP3A 4FUBA 4XBDA 5EQRA 2QF3A 4IS5A 4FUGA 1NFWA 4GUXA 3TITA 1WTGH 1AWFH 1PQ5A 4A92A 3BF6H 3O8RA 3SU1A 2QIQA 3ZV8A 2ZTYA 2UWOA 2R2MB 3L6PA 4B2BA 1W0ZU 4DY7B 4AB8A 2FOFA 1SG8B 1RXPA 1OX1A 1E36B 2W5EA 3R3GB 1S85A 4ZHMU 1K28D 2ZU5A 4TWYA 2A4OA 1AQ7A 5FPTA 3Q00A 1C4U2 4X1RU 3FP6E 5LPFA 3K6YA 2FOAA 1UTOA 3QK1A 3A86A 2ILNA 1HAOH 3SGBE 5JDUB 4NIXA 1DLKB 3MH4A 4AGJA 1HIAB 1O2MA 3U1JB 2HPQH 3ZZ7A 2Z9IA 4K8BA 1HCGA 3MU5A 2VVVA 1AMHA 2PGQB 4BANB 1HJAC 1MTSA 3FP7E 3BIUH 2GZ9A 4X2XA 1OWKA 2IPHA 1GHWH 3BEIB 1Q3XA 2FOMB 1OP0A 1C1RA 4YTAA 3QGJA 1N6YA 3GCHB 4I8KA 5AFYH 1DLEA 1K1LA 5I25A 3SU0A 1P9SA 3GYMA 2Y80A 2A7CA 4OS6A 4K3JA 3UQOA 1CA8B 1NZQH 1FY3A 3UREA 1JRSA 4LXBH 2FS9A 3TIUA 2ZPQA 3T29A 2BZ6H 3RMOH 1ELGA 3OSYA 2UWPA 1WAYB 1FY4A 3PB1E 2BQ7B 1ARCA 3P8OA 1UHBB 1IQIA 1KXCA 3F6UH 4BAMB 2VWOA 3T2NA 1K1OA 4E05H 2VJ1A 1O30A 3EAJA 2BD3A 2ZCLP 2BOKA 1QCPA 1THSH 3LKWA 1MTWA 1EJNA 1NN6A 5G4BA 2VWNA 4MNVA 4D7GA 3SQHE 2AS9A 4FU8A 5AFZH 1P06A 2R2WU 1A5HA 3KF2A 1ELVA 1F92A 2P3FH 1EB1H 1Y3XA 2OP9A 2VWMA 3A83A 1YKTA 1PPGE 2AIPA 5FPSA 5GDSH 2BB4A 5ETXA 1O2HA 1V2ST 2SGFE 3AAVA 1BBRK 1MTUA 1TLDA 3UR9A 3DUXH 1INCA 1O2VA 3D62A 2GKVE 1YC0A 1TOCB 4IBLH 4ABDA 4INHA 1JOUB 3BTFE 1WTHD 1P3CA 2CN0H 5EG4A 4RN6A 5EQSA 3SUFA 2PLXA 1C5NH 5HM2A 1LVBA 3TU7H 1SOZA 3FZZA 3OX7U 1LHEH 2BTCE 3LU9B 1YYY1 3HPTB 1V2RT 4D7FA 2BD7A 2G51A 1O3JA 3ENSB 1V2JT 1BTHH 1BZXE 2A4QA 4UE7H 5TJXA 1O3IA 1C2KA 1C5ZB 1Z71A 2H1UA 4UFDH 3BV9B 1UJ1A 2F9UA 4A1TA 4BTTB 1C1SA 1WQVH 4ZXXH 1G3DA 3S0NA 1HIAA 1EPTC 3GY3A 1G3EA 4NA8A 2EEKA 4K2YA 1TMBH 1CT0E 4TYDA 2PW8H 4CR9A 3N7OA 2TGPZ 4SGBE 1O32A 1C5SA 4GLYA 1AE8H 1Z8GA 1BBRH 4NCYA 4NWKA 2CHAC 1UMAH 3PLKA 1O2KA 1KTSB 1EB2A 1BT7A 4WY3A 2AMDA 4DT7B 5K0HA 1DSTA 1O2YA 1GWAA 1M9UA 3P17H 3D23A 4DJZB 2G81E 3PLPA 5JBAS 4WMFA 1JIRA 1VR1H 1FIWA 1CHGA 1G2LA 1BRUP 1NS3A 2G5VA 2JH0D 4K5ZA 3KGPA 1G9IE 1TMUH 4YT6H 3LJJA 3P95A 2A7JA 1ZJKA 2AH4X 1BMLA 2VVCA 3KN2A 4AG2A 3RMNH 1TNHA 5TCAA 1O3GA 2FOBA 2GZ7A 1IHSH 1SGTA 3UTUH 4WWYA 3Q3YA 1V2NT 1LQEA 1CBWB 2BD4A 4CREA 1P2JA 2FWWA 2BDYA 1RIWB 5HMAA 2AMQA 1GHBF 5E8EH 1AFQC 1HJ9A 1YPLH 2FYQA 4O03A 4B76A 1Y3YA 2BD9A 4B75A 3DFJA 4I8HA 1EJAA 2BOHB 5EPNA 2ZQ2A 1PFXC 3S69A 3VB7A 5BRRE 1ABIH 3RXQA 5F8XA 2WUCA 1C2HA 1EZUC 3BG4B 2PR3A 1O31A 3DFLA 2V6NA 2Z3EA 4U30A 2Y81A 4X0WU 1J16A 1O3AA 1P2IA 5TCCA 1UVPA 1YPHE 1Z8IB 4THNH 4K60A 1QBNA 4AORA 1B0FA 3BSQA 3HK6B 3ZVGA 3CS0A 1TRMA 1D6WA 2HNTC 4ABFA 2ZU2A 4UFEH 3FANA 1DY9A 1XX9A 4FUJA 2ZWLH 1AN1E 2STAE 3K2UA 5HGGA 3E3TA 2ZP0H 4ZKRU 3NCLA 4CH2B 1RTKA 1A7SA 3EA8A 3EYDA 4HZHA 5T6FA 3T25A 1TA6A 1BCUH 2TGTA 3FFGA 1F0RA 1AU8A 1FZZA 1MBMA 1G3CA 1O2XA 4O9VA 2FDAA 3M3TA 5C1UA 1ZHPA 4H42U 4BOHA 1P11E 3SU3A 4ZMAH 1SGFA 1ZPBA 2C8XB 2A31A 4TWWA 4ZUHA 3ZVAA 1C5LH 1VJAU 3OY5U 4NSVA 1FAKH 4WVPE 1QURH 3GDUA 2OQ5A 1MZDA 2FEQH 1QB1A 1TPSA 4X1PU 1WUNH 1HFDA 1DWCH 2O8LA 2FYRA 3A7YA 2PGBB 2ZFSA 2CF8H 6LPRA 1GBFA 2V0BA 2GT8A 2BY8X 1T8LA 1FN8A 3RXHA 3F68H 1O3DA 4KTUA 4ISIH 4BTIB 3VB6A 1ELBA 3HATH 1UTQA 1TFXA 3SJKA 1A5GH 4A7IB 4Z6AH 1C1NA 1RTLA 3OTJE 4KP0A 1KLJH 2G55A 2OC7A 3LC3A 3STIA 3GISB 2BLWA 2HNTF 2BXUH 1C9TA 1TPAE 1BB0B 2ZHQH 1SGIB 1HPGA 2IN2A 1V2LT 2J2UA 1C1UH 3TNTA 1WU1A 2W26A 1TX6A 3LT3A 3S9CA 2A5AA 3LGYA 2FM2A 1TALA 2GCHF 2BDIA 6CHAC 1AY6H 3SUEA 5DPAA 2GMTC 1ANDA 4CR5A 3EDXB 1P03A 4NZQA 1UCYE 1GBCA 4X1SU 1NT1A 2F91A 2Z7FE 1C2FA 1XXDA 1E35B 1GL1A 1NRSH 3RM0H 2ZU1A 1N6XA 2ZDNA 1XMNB 2XYAA 3E91A 1ABJH 1B7XB 3ATWA 1IQNA 3ZZ3A 2ZFTA 1Q31A 1OWHA 2C8ZB 2GX4A 1GHAF 1L1GA 3ITIA 1O3CA 1A3BH 3SI3H 2Q1JA 5K7RA 4ZAEA 2JKHA 2ZU4A 4A1XA 4YT7H 2BX4A 5FCKA 1QY6A 2Q6GA 3A7ZA 3TPIZ 1GVZA 2A45B 4ISHH 3T5FH 5DP6A 2H9HA 3M35A 2C90B 2ODYB 4X6PA 2TGDA 4K1TA 4MPUA 3BTHE 3MH5A 1VCPA 2P8OB 4JYUH 3T27A 1P57B 2Y7XA 2AIQA 3MNSA 4H4FA 1FI8A 2ZZUH 2XBWA 4MTBA 3U1IB 6GCHG 4A5TS 4CRGA 2BDCA 1T31A 1C4Y2 6ESTA 3QDZB 2P16A 1O0DH 1GDQA 2BQWB 1TX8A 2ZHWH 1QBOA 3NXPA 2IOTA 2GT7A 2R0KA 1DWEH 1LQDB 3IWMA 4DG4A 2GDDA 2RA0A 1TABE 4B73A 1LHCH 1GJ4H 1VITG 4OS2A 2XBYA 3CP7A 4GPGA 1MAYA 2R3UA 4I7YH 2OC1A 3QLPH 1KLIH 1GJ9B 1WYKA 3ZZ6A 1T8NA 1NRQH 1YBWA 1A4WH 1AI8H 2FODA 2NU1E 3E8LA 5A0CA 4ZH8A 4UDWH 3ZYDA 2A32A 4NIWA 1ZTKA 4IGDA 1JRTA 7GCHF 5J4SA 3D65E 5DP9A 1NC6A 1P2OA 1HYLA 1GI1A 3NWUA 3EA7A 1TGTA 3PO1B 1C2EA 3RMLH 3SI4H 5A0AE 4Y8XA 3VEQB 2FOEA 1D3TB 1ORFA 1KXBA 1FJSA 3PWCA 5GJ4B 1UVOA 1ELTA 2Z3CA 4JCNA 4ISLA 2ZDVH 4D9RA 1IOEA 1S5SA 1K1MA 2VH0A 4JZIA 3ATLA 5T6DA 4DIHH 1SQTA 1TGSZ 4X8TH 4Y8YA 2FZZA 1GI8B 1XUHA 2ZCKP 4R8TB 2A4RA 4X8UH 3KEEA 1GHYH 5L6NH 3MO9A 2A1DB 2RG3A 3SGAE 4AX9H 1OYTH 1TNGA 1Y5UT 3B23B 3E0NB 2SGQE 2BQ6B 5EODA 2BMGB
chains in the Genus database with same CATH superfamily
1F7ZA 1WXRA 3AW1A 5ABWA 1CU1A 1PQAA 2WPMS 1C1OA 2BX3A 5DSFA 2G5NA 2OXSA 2XW9A 5LH8A 7ESTE 2VIPA 1GGDB 1QA0A 2OBOA 1HNEE 2LPRA 1GHVH 1KXFA 4UONA 1EAWA 1QL8A 1L1NA 1TNLA 4P02A 2FOHA 3RXGA 1DS2E 2NWNA 2J98B 1PPFE 1SLUB 1SHHB 2Q6FA 3NPSA 3V13A 3MI4A 2F43B 4INKA 1MTVA 1BHXB 1QL7A 1CGHA 1QZ8A 2FOGA 3CENA 4IN2A 5GCHF 5KECA 1MH0A 1K22H 2B7DH 3GY8A 4LZ1H 4D9QA 1O3EA 3RC4A 2SGDE 5LPRA 1LVMA 3U8OH 1FV9A 1SGYE 3O8DA 1S6HA 5EGMA 3LJOA 2AEIH 1E37B 2WPDD 4YZUA 2GD4B 1EJMA 1YCPK 3A7XA 1N8OB 1KSNA 1KXAA 3SGQE 4NFFA 3FP8E 1ELDE 1Y3WA 3I29A 2F4LA 4VGCC 3N99A 3G01A 2WYGA 3ELAH 1DICA 1CA0B 1SGEE 3URDA 3RXTA 4A1VA 8ESTE 3QN7A 1C5PA 1FLEE 4Y7BA 3RU4T 3SUGA 2O8WA 3O8CA 1QR3E 1QRWA 3SQEE 1MKWK 1ANCA 3BTQE 1BITA 1HAIH 1O35A 1LMWB 2THFB 4NG9H 3SOSA 4AB9A 5ESTE 2BYAX 1SLWB 1BRBE 3SO3A 2QF0A 1EP6A 1NRRH 2VGCC 3SUDA 3UOUA 2JJ1D 3PWBA 4F55A 1XKBC 1ZR0A 3V0XA 5LPEA 1G36A 1P2KA 2ZFPH 2KAIB 1AD8H 3UQVA 2SGPE 1E38B 4IN1A 2ZDMA 1HAZB 1P8VC 1NO9H 1DM4B 2H9TH 5EU8A 1QTFA 4MPVA 3DCLA 2ZI2H 4K1SA 1GI3A 2WPLS 1MD7A 3P70B 1AUTC 1BTZA 3MO6A 4BAQB 3NUMA 1GJCB 2HALA 3LGUA 3VFEA 1YCPH 3RXPA 3SNDA 3PTNA 3QGNB 4LOYH 1T4UH 1P09A 3GY4A 1C2IA 5DGJA 1FPCH 2PKAA 2XXLA 4FUEA 4X6MA 5ESBA 3K65B 3PV2A 1SR5C 1O37A 1U6QA 1DVAH 2QXJA 3H7OA 2HWLB 2PV9B 1A61H 3KQCA 1ETRH 1C4V2 3ATKA 3QWCH 1GBTA 4X8SH 2TGAA 1FMGA 5F8ZA 2W6JD 1GVKB 5DP8A 2H6MA 1L2EA 2H2ZA 2F9OA 5EPYA 1GMHG 1MKWH 3U98H 3BN9A 1WQSA 1P01A 3FN8A 1SOTA 4WXIA 3SV6A 2KCYA 1MKXK 2QV1A 4J1YA 5C3NA 1E34B 1W0YH 4GAWA 2XC5A 3ATIA 1QQ4A 4UD9H 4JZEH 4AGKA 2P3UB 1GDUA 3FAOA 5B6LA 1JXPA 1Z1JA 3M3SA 2B8OH 5GPIB 1PPHE 4F49A 3LH1A 4Y0ZE 3PMBB 5EIYA 3RXAA 1SBWA 5F53A 4INLA 1GBEA 4LZ4B 1C5XB 5F8TA 4OS1A 1NU7B 1LPGB 2FX6A 2ZGBH 1O2LA 3I77A 3SV8A 2ZG0H 4AN7A 4XFQA 3Q76A 5DJ7A 4BTUB 1Q2WA 1UK4A 1DWDH 2BDAA 2CGAA 3V7TA 1QRZA 1A3EH 1SLVB 2HNTE 4KGAA 3GCTF 3P8FA 2ZIQH 1GBAA 5FBEA 5DKMA 4FU9A 3ZZDA 5A09A 4Y7AA 5HXFA 2WPIS 1O2UA 3SORA 3PV5A 3RXCA 1AZ8A 2ZFRH 3UNQA 1V2PT 1UTPA 2V3HH 3ESTA 1V2UT 1GBKA 2ZO3H 1EZXC 3M7QA 3QUMP 1H9LB 3RLWH 2ZF0H 2TPIZ 1P0SH 3W95A 3LGIA 1O2WA 1MKXH 3KQEA 1GI6A 2STBE 3UNSA 1OXGA 4DCDA 4ABAA 5LGOA 3E1XB 3A7TA 2QF5A 1SKYE 2P59A 1CO7E 2QE7D 2ANKH 3GY7A 2W3IA 1G3BA 4JZ1A 1HLTH 3RXSA 3VB5A 1QJ7B 1Z7KA 2QAAA 1FXYA 2EC9H 4IC6A 4BAKB 2ZDAH 3RMMH 3QTOH 2J92A 1YPKH 4FU7A 3RDZA 4AYVB 4ABHA 1KXDA 1ELCA 1HAVB 1ZMLA 1MUEB 2XNDD 1AUJA 2FTMA 2A4GA 1IQEA 9ESTA 2EY4C 1EUFA 3MU4A 1OYQA 1DOJA 3UFAA 2WV9A 2D8WA 3UR6A 2FI3E 3ZZ8A 1FIZA 3RP2A 2C8WB 1TNJA 1LKAA 3RC6A 1EAXA 4B2CA 1QB6A 4FUIA 2A7HA 1C1PA 1O2OA 3KQBA 1ZTLA 1S81A 1E0FD 1HJAB 1AHTH 4D8NA 1DFPA 4B71A 2G4UA 1DANH 3LOXA 1GBHA 1L0ZA 2FOCA 1MU6B 1NESE 2FESH 3B9FH 3ODFA 3DA9B 3S7HB 1SB1H 2ULLA 1QIXB 4BAHB 1EOLA 1GG6C 1P2NA 3PMHB 3TJUA 3IG6B 4YLQH 5C2ZA 1UVUH 1H9HE 3S9AA 1GCTC 1O3MA 1C5VA 3HGPA 2Y82A 5KGOA 1O2ZA 5BPEA 1KY9A 4I8LA 1AKSB 1FY8E 1NFUA 2J38A 4IMZA 2QN5T 5L30H 2LP6A 1VKYA 1EAIA 1UHBA 3KNXA 2PKSC 1C2GA 3GY5A 5IYTA 3P6ZB 3CNRA 2CMYA 4X2YA 1F0UA 3S9BA 3MH7A 2GDEH 2OQUA 3H5CB 5A0BA 3WWFA 1PQ8A 4E7RG 2P93A 2QXHA 4MNXA 1C5QA 3SU2A 3GCNA 2BDGA 2WV5A 5HYOA 1ZGVA 1LO6A 1GBJA 2Y5GA 1A0HB 3ZZCA 1SGQE 1GHXH 1BIOA 5E2PA 2RFKC 1A1RA 3VGCC 1PPZA 2Q6DA 1ZMNA 2D1JA 5DK1A 3UPEA 2BLVA 2VIVA 1LVOA 1PYTD 2JDID 3ZVEA 4FVBA 1BTUA 1LKBA 3PM3A 3ZZAA 2AGGX 4FETA 1SFQB 1VGCB 5JBTA 2SFAA 1Y3VA 1GPZA 3CS7A 3VB3A 1C5UA 1J9CH 5DP5A 3A8BA 5J4QA 4Q7YA 2GVFA 5AF9H 1UTNA 2GTBA 1C1VH 2WPKS 4UEHH 1FONA 3EE7A 1UO6A 4TSFD 3UY9A 1ZHRA 2XNIA 4DIIH 4TPIZ 2PSYA 1GBBA 1SGDE 3QZQA 3JZ2B 3F3BA 3OYPA 4GHTA 1DXWA 4ZKSU 1T7CA 1AWHB 1HRTH 1XXFA 2Y7ZA 3NKKA 8KME2 2R0LA 1GI0A 4WF8A 3AW0A 1O39A 1O5AB 1GL0E 4CRDA 3STJA 4AZ2B 2BVRH 1ZYOA 2HOBA 1GMCG 3TK9A 1NBME 2ZQ1A 1GCDA 1L4ZA 4MNYA 5CHAB 2OC0A 5A8ZA 2GP9B 1BOQA 3OU0A 5B6OA 1O3BA 4HTCH 2XTTB 1NTPA 4E06H 1K0HA 3TGKE 3SJOA 1O3NA 4JMYA 5AHGH 1EPTB 2BY9X 1TWXB 1ZSKA 1QJ1B 2ZTZA 1PYTC 3M5LA 5C1XA 1AE5A 1QHRB 4FUFA 3H09A 1XVMA 2QXIA 4CHAC 3BEFB 3U69H 3T26A 1GJ6A 1RRKA 1XKAC 1O2IA 3PO1C 2BXTH 2BDHA 4J2YB 5HM9A 2AMPA 3UAIC 1O5EH 1AB9C 1RJXB 2Z9LA 1O2SA 2CHAB 3A85A 2GGVB 3RXBA 2H9EH 5A2MH 3RXJA 4IW4E 3NK8A 1QL9A 2BHGA 3OTPA 4DURA 3RU4D 2AYWA 4ABGA 1SGRE 3HKJB 5GXPA 1DY8A 3MU0A 4DW2U 3SZNA 4TPYA 5HIYA 4Y6DA 4ABIA 1THRH 3RXRA 1BJVA 3TGIE 4CBOA 2BVXH 3OE7D 1V6DA 3UWIA 1HAYB 3MNBA 2PP6A 3QO6A 2ANWA 1GMDF 3A89A 3FZDA 1CT4E 2WINI 2QGRA 1OWDA 1TAWA 2ESTE 2GCHG 1GBDA 1J17T 4TY7A 1HAXB 1MZAA 2LELA 1H9IE 2VWLA 4ISOA 2Z9GA 5FX5A 1S0QA 5E2OA 3HKIB 3SJ9A 2B0FA 1NBMD 1A5IA 3QTVH 3RXDA 3SV7A 3PYHA 3SJ8A 1TONA 3BTME 1P10A 4XRNA 1CT2E 1BMFD 6GCHF 2J97A 4K69A 1EZQA 1GHAG 3F9HA 5E0GA 1HDTH 1JIMA 1O5FH 1Y3UA 2A5IA 1KIGH 1UVSH 4ZROA 4ZXYH 1V2VT 2VB0A 3LC5A 3MTYA 5E0HA 4ASHA 5CE1A 1LPZB 3JZ1B 1A0LA 1AIXH 1NM6A 3F1SB 4Y79A 3WY8A 1D3PB 3O8BA 1KMHB 1UW7A 1WCZA 4TT3D 5E0JA 1SSXA 1ELAA 2CJIA 4OS4A 1HAGE 3C27B 1Z6JH 2V35A 2A2XH 1GVLA 3AASA 3I78A 4RSPA 3M5MA 4JZDH 2F3CE 2DUCA 1MABB 3TH4H 1NU9A 3D49H 2XC4A 3TJVA 1GJ5H 1CA0C 1KDQB 1HGTH 1OWIA 1MTNB 1A2CH 4NIVA 2KCAA 1PPEE 3ZZ4A 1H8DH 3M5OA 3M5NA 3UWJH 2BZAA 4YM9A 1EX3A 2SNWA 4XSKU 2FI4E 1P3EA 1BBRE 2VBCA 2L6OA 1YGCH 2O8TA 2PUXB 1UTMA 2C4FH 1LHDH 4YXWD 2IJOB 1FUJA 3RXLA 1T8OA 1VJ9U 4X2WA 5EXLA 3GYLB 2G00A 1K1IA 2FX4A 1QQUA 2CK3D 1S83A 4B74A 1FN6A 2XOKD 8GCHF 3TJNA 3MOCA 3UNRA 1IQHA 1OWJA 5GIBA 4U01A 1YY3A 1BHXF 4MVNA 5FCRA 4GVUA 4MPWA 1FNIA 1SI5H 3SW2B 2C8YB 3EA9A 1W2KH 2GV6A 3KQ5A 1F5RA 1VITH 3U8RH 1EATA 1BUIA 1TRYA 3ZVCA 5A8YA 3GCHC 1Z8JB 3K6ZA 6CHAB 2UWLA 2EA3A 2JIZD 4O3UA 3LGTA 1BMAA 1O5GH 2EQNA 1BJUA 2F9PA 4AFUA 2OD3B 2PFEA 2H5DA 1XUIA 3SHAH 3N7EA 3GOVB 1V3XA 4Z0KA 7KMEH 1ZZZA 4GCHF 2JETB 3OY6U 1TOMH 2ANMH 1ID5H 2HPPH 3M7UA 3P92A 3KIDU 1Y5AT 1IQLA 1O2NA 3RXMA 1O2JA 2NU3E 4O3TA 4AOQA 2P95A 1KLTA 1QBVH 3LIWA 4B2AA 2ZHEH 4ACAA 3E16B 4X1QU 1JMOH 3PMJA 2CV3A 5DP4A 9LPRA 4H6TA 1F5KU 3TJOA 1MCTA 3VB4A 1GBLA 1CHOF 1GBMA 2EI8A 2SGAA 2Y5FA 2SNVA 1ZGIA 1YM0A 1QJ6B 3KL6A 4DVAU 1EKBB 3RXEA 1ZTJA 3Q3XA 2FLRH 5C5OA 3A7WA 2ZTXA 4A6LA 3SJIA 3MMGA 4NIYA 2VNTA 3DSPA 2R9PA 4WMEA 3SNAA 1LHFH 1DUEA 5JB9S 3OEHD 3FOAA 1O5CB 2VIQA 3F2GA 4ABJA 4TY6A 2XBVA 2YNBA 2YMSD 1ANEA 3SU5A 3BTKE 2QA9E 4P00A 3ZZBA 1T8MA 1D4PB 5JPMH 1O3LA 3M3VA 1DPOA 1YPJH 1CGJE 1KDQA 4NFEA 4AFSA 1O3FA 2VIWA 1YP9A 1B0EA 1EFRD 2FTLE 3KHVA 2M2AA 2BD5A 3BG8A 1TNKA 1G30B 1CGIE 1MU8B 3FVFB 1IQMA 5FBIA 1HUTH 1TMTH 1TQ7B 1YPMH 1KXEA 3LDXH 1O2RA 2BD8A 1RGQA 1K1NA 1KTTB 1SL3A 2CF9H 1EASA 1D3QB 4F48B 1O2PA 1TYNA 1Y59T 3M7TA 4OGYA 3A8AA 1NRPH 4BXSA 3ZZ9A 4Y71A 1AVGH 2KM0A 2JH6D 3BTWE 3W94A 1NRNH 1K9OE 1TIOA 2G8TA 1ZRBA 3TVJB 1JBUH 2XBXA 1D6RA 4QT8C 2G4TA 1C2LA 1UCYK 3SV2H 1NFYA 4XBBA 1P02A 2YMSC 3ZV9A 1ESBA 1O5DH 2ODQA 2FLBH 3KQDA 4NSYA 1DXPA 1O3OA 5F6MA 1AGJA 1EAUA 5EXNA 1PQ7A 5JYIA 5EW2H 1MQ6A 1GMHF 1S84A 2J34A 1W13U 1C9PA 1S82A 3EGKH 3FO8D 3M36A 4MNWA 5EJLA 3SNEA 3SU4A 3MYWA 1MCVA 1THPB 2J95A 4H6SB 4NA9H 4WMDA 5FL7D 4K8YA 1FPHH 2J9NA 1C5MD 3SHCH 4E7NA 1LTOA 3L3TA 2P94A 3P8GA 4FUHA 2DE9A 3LH3A 5EW1H 3KCGH 1UTJA 1ACBE 2XCNA 2H5CA 3HK3B 4O97A 5C20A 1ARBA 4KTSA 1C1TA 3R0FA 4Y0YE 3RLYH 1OP8A 1HJ8A 3MNXA 2DE8A 2Z94A 5SGAE 2ALVA 3GY2A 1P9UA 2J98A 2QYIA 2XWAA 1CBWC 2I6QA 3M37A 4CH8B 1C5YB 1C2JA 1RIWC 2BY7X 3F9FA 4FUCA 2ZHFH 1P12E 1W3CA 4YESB 4R0IA 3QZRA 1Z8RA 1ZOMA 4IMQA 3MFJA 1IHTH 1J8AA 1WV7H 4NWLA 4RKOB 2D2DA 1F0TA 1V2OT 1UCYH 2V3MA 2IJD1 3S7KB 4BNRA 1TPPA 2A0QB 1EOJA 2Z3DA 2ZU3A 3BG4C 1GI7B 3SYJA 4PROA 5I46H 1NROH 3URCA 4YOIA 2GCTB 1SMFE 1CQQA 3VPKA 2UUKB 1O2QA 2WPHS 2QCYA 4JYVH 3UOPA 1SGFG 3RXKA 2HLCA 1LHGH 1HXEH 1ZSLA 4VGCB 4ZHAA 3RXIA 1OKXA 4I86A 5EQQA 1X7AC 3TK5A 4HI3A 1GI2A 1SHYA 1NY22 2R3YA 3F9GA 3OFND 1IQKA 3SU6A 3GCTG 4Y10E 3L33A 1EQ9A 1VGCC 1DUAA 3W1EA 3NRLA 3MH6A 1F5LA 1V2KT 3TK6A 1G32B 4KKDA 5FX6A 1B5GH 1C1MA 3GDSA 4DOQA 4DT4A 1W14U 3GCOA 3TLOA 2ZA5A 1A46H 2SGEE 2FPZA 1CVWH 2KAIA 2VGCB 4B1TA 1QFKH 3MNCA 2YNAA 1C1WH 1FQ3A 3TNSA 4CRBA 1BTYA 5C94A 1O38A 3KYFA 1TRNA 2TRMA 4IC5A 1SC8U 1LVYA 2FIRH 3RUOA 4Y11E 2FXRA 1GI9B 1C5TA 1O3HA 3MHWU 1V2TT 2RCEA 1FX0B 4XDEA 4ZKNU 4X6OA 1BMNH 5CHAC 2PTCE 1TB6H 3TGJE 2B5TB 1SQAA 2RDLA 2UUYA 2WYJA 5KEDA 1UK3A 4HGCA 2ZFQH 3PROA 2NU0E 1XUJA 3A7VA 4X1NU 2F9VA 3IITA 1YLCA 2RDEA 3SN8A 1H8ED 1W12U 2VVUA 4WH8A 5AVDA 3MQKC 1H1BA 2WPJS 2ASUB 1H4WA 2PUQH 2RA3A 1GJ8B 1GI4A 1P05A 1TGNA 3A82A 3RC5A 4ZKOU 1YPEH 4JK5A 1IQGA 1RTFB 3H7TA 2FI5E 4ZCNA 2B9LA 3UB0A 1SFIA 2KR7A 5C0TA 2M5TA 4MQAA 1BTPA 1SGCA 2WUBA 2CXVA 1YLDA 5C5NA 2ANYA 3LGWA 1FY1A 2FS8A 5CMXH 1BRAA 3RXVA 3A81A 3RXUA 3MO3A 1BDAA 1E79D 4FOUC 2ZGHA 3UUZA 3U9AH 1UVTH 2O9QA 1G2MA 1T32A 1ANBA 4BAOB 1UK2A 2PSXA 2ZHDA 4AG1A 2TIOA 1ZSJA 3MU8A 2FMJA 3LGVA 1HAHH 4DGJA 2HGTH 3RM2H 4X8VH 1H8IH 2WHXA 2ZGXH 2GJGA 2OBQA 2QXGA 4SGAE 2BY6X 3V12A 3GDVA 3ATMA 1C2MA 3EQ0H 1TBQH 1BRCE 1GDNA 2VINA 2HVYB 7LPRA 2PHBA 1O33A 3K9XB 1YF4A 3BTTE 1GHBG 3PMAB 4Q2KA 2VIOA 2ODPA 1W0KD 1HB0B 1GJAB 3ZYEA 1DWBH 1TX7A 3RU4E 1Z6EA 4I8JA 1KYNA 1J15A 1C5WB 2ZGJA 3M61U 5JBBS 2TBSA 3PLBA 5DN6D 2A5KA 1HBTH 3DSGA 2P8OC 3A87A 4UFFH 5HKKD 1SGPE 4D76A 1XUFA 2XC0A 2ZECA 2OC8A 4YLUA 1AVWA 1WOFA 4X2VA 3OEED 4MG3A 1ZPCA 1XVOA 2ZNKH 3RXFA 1PPBH 2ZPSA 2BVSH 3TH3H 1N1LA 2F9BH 3ODDA 2EI7A 1GMCF 2XRCA 2BY5X 3A80A 1GBIA 1GI5A 1MBQA 2W7SA 5FAHA 4OS5A 1HAVA 1G37A 1PJPA 4CRAA 2AFQB 1TPOA 1DSUA 1MAXA 1QA7A 2V3OH 1NFXA 1C2DA 1MTNC 1SVPA 5L2YH 2C3SA 3E90B 4M7GA 5DO4H 1O3PB 3F2FA 1W8BH 2UUJB 4ABEA 1S0RA 2QY0B 3ZVDA 3T62A 5JB8S 1C1QA 1CSOE 1K21H 3A88A 1RS0A 4KTCA 3SNBA 2A2QH 1OS8A 1TGCA 1ZRKA 1ELEE 2QC2A 1AO5A 2ZC9H 3A8DA 1ESTA 1O34A 3C1KA 2YOLA 4BXWA 1WBGB 5A8XA 3A8CA 1CE5A 4AFZA 3U8TH 2K1QA 1XM1A 3B8JA 3SV9A 2D26C 1GG6B 4XBCA 1DDJA 1AKSA 1DT2A 1GCTB 1L1JA 2OINA 2Y5HA 3PV4A 4WJG2 1QNJA 3BTDE 1IAUA 1VCQA 1W11U 2ZGCA 1ETTH 3ZVFA 4YO9A 2PKSB 3KYGA 2BLOA 4ESTE 1ZJDA 1FAXA 2VU8E 1XUKA 1P2MA 2AGIX 1S6FA 1AFQB 3AAUA 2K8IA 1BA8B 3TH2H 2ZEBA 2BLQA 1IQFA 4K1EA 4UFGH 1V2WT 2LNCA 2L74A 3P8NA 1OOKB 1GJDB 1TQ0B 4NZLA 1T4VH 1SQOA 1GGDC 1ZMJA 2JETC 2Y6TA 2XWBI 1UTKA 3GICB 1V2MT 3ZVBA 1O2TA 4LK4A 3VGCB 1MMJN 1GMDG 3RXOA 1F2SE 2ALPA 2Z6BD 1Z1IA 1OPHB 1UTLM 3AK5A 1LDTT 3BIVH 1Y8TA 2C93B 4F4OC 3QX5H 3LPRA 3AVZA 2KZ4A 2Z9KA 3E0PB 3DT0H 1VZQH 5L2ZH 1YPHC 1VITF 5FPYA 1V2QT 5C1YA 1AVXA 1AZZA 4I32A 1O36A 1EZSC 1O2GH 3HGNA 1QGFA 1LCYA 1N8OC 4YOJA 4FVDA 2HRVA 5H4IB 1H8HD 1P04A 3SBKA 4MLFB 4RKJB 2FP7B 1TGBA 1FY5A 1IQJA 2I6SA 4MPXA 8LPRA 3Q3KA 4I33A 1J14A 1WSSH 1BMMH 4HFPB 3VXEH 4JZFH 3BEUA 4FUDA 2J4IA 2PTNA 1W7XH 3DHKH 1ZPZA 1DE7H 1P2QA 4CBNA 1HXFH 5EJZA 3E6PH 1OWEA 5F03A 5T3HA 1ZLRA 1ESAA 4ISNA 5DP7A 4KELA 3ZZ5A 2AGEX 4GHQA 2OUAA 3F9EA 3A84A 1TE0A 4JYTA 1S6LA 2JJ2D 1EPTA 4GSOA 2AERH 1ETSH 2BDBA 2OLGA 2NU2E 1HAPH 1MQ5A 1PPCE 2IPQX 5EOKA 1GJ7B 4AYYB 1XUGA 4AFQA 2OTVA 4CHAB 1F0SA 4Y76A 1EXFA 5FHTA 2OCVB 7GCHG 1BTXA 1O3KA 2JH5D 3UIRA 5JBCS 2VIDA 2VH6A 1GHZA 1AB9B 2J94A 2O8UA 2P3TB 4CRCA 1ELFA 1D9IA 4X6NA 3VXFH 5FXLA 5IDKA 2GZ8A 2WV4A 2ZCHP 2ZPRA 2G52A 1BTWA 1W7GH 1ZHMA 3V3MA 3BTEE 1YCPM 2UUFB 4ZHLU 1SGNE 4ABBA 1K1JA 3MU1A 2GMTB 1TNIA 1LPKB 2PKAB 4OS7A 1C5OH 4XOJA 2HVXA 4I8GA 8GCHG 2F9NA 4WXVA 1FDPA 2NU4E 1DX5M 2PWXA 1SPJA 1RD3B 1MD8A 3Q77A 4WH6A 4MDSA 1WDIA 2BM2A 1C5RA 2O8MA 1A0JA 1VCWA 1OSSA 4I31A 4Q80A 1O5BB 1K2I1 1COWD 4Q7ZA 3DSOA 4FXGH 1L4DA 2W7UA 5PTPA 4NGAH 2Z9JA 5GWZA 1BQYA 1OHHD 1Y5BT 2XCFA 1DITH 1YPGH 5EXMA 2ZDKA 1TBRH 4GCHG 4Y8ZA 3DD2H 2EI6A 5C67A 3F2HA 2ZKSA 4JK6A 2F83A 5GNDA 2ZDLA 3MWIU 4U32A 5DG6A 1NPMA 3BTGE 1TA2A 3NZIA 1AFEH 1D3DB 4U2WA 4YOGA 5GCHG 1QRXA 3LONA 1CHOG 1HV7A 1W10U 1JWTA 1RFNA 1OP2A 5T6GA 2W3KA 2FO9A 2GCTC 1EP5A 1GJBB 4CRFA 3SNCA 2GV7A 1W0JD 3EE0B 3PRBA 2BD2A 1SLXB 4NA7A 4OGXA 1QB9A 1K1PA 4Q7XA 3GY6A 2WSSD 1TBZH 4XE4A 3T28A 3PTBA 4Q63A 2ZFFH 5DP3A 4FUBA 4XBDA 5EQRA 2QF3A 4IS5A 4FUGA 1NFWA 4GUXA 3TITA 1WTGH 1AWFH 1PQ5A 4A92A 3BF6H 3O8RA 3SU1A 2QIQA 3ZV8A 2ZTYA 2UWOA 2R2MB 3L6PA 4B2BA 1W0ZU 4DY7B 4AB8A 2FOFA 1SG8B 1RXPA 1OX1A 1E36B 2W5EA 3R3GB 1S85A 4ZHMU 1K28D 2ZU5A 4TWYA 2A4OA 1AQ7A 5FPTA 3Q00A 1C4U2 4X1RU 3FP6E 5LPFA 3K6YA 2FOAA 1UTOA 3QK1A 3A86A 2ILNA 1HAOH 3SGBE 5JDUB 4NIXA 1DLKB 3MH4A 4AGJA 5C0UA 1HIAB 1O2MA 3U1JB 2HPQH 3ZZ7A 2Z9IA 4K8BA 1HCGA 3MU5A 2VVVA 1AMHA 2PGQB 4BANB 1HJAC 1MTSA 3FP7E 3BIUH 2GZ9A 4X2XA 1OWKA 2IPHA 1GHWH 3BEIB 1Q3XA 2FOMB 1OP0A 2WZQA 1C1RA 4YTAA 3QGJA 1N6YA 3GCHB 4I8KA 5AFYH 1DLEA 1K1LA 5I25A 3SU0A 1P9SA 3GYMA 2Y80A 2A7CA 4OS6A 4K3JA 3UQOA 1CA8B 1NZQH 1FY3A 3UREA 1JRSA 4LXBH 2FS9A 3TIUA 2ZPQA 3T29A 2BZ6H 3RMOH 1ELGA 3OSYA 2UWPA 1WAYB 1FY4A 3PB1E 2BQ7B 1ARCA 3P8OA 1UHBB 1IQIA 1KXCA 1YWUA 3F6UH 4BAMB 2VWOA 3T2NA 1K1OA 4E05H 2VJ1A 1O30A 3EAJA 2BD3A 2ZCLP 2BOKA 1QCPA 1THSH 3LKWA 1MTWA 1EJNA 1NN6A 5G4BA 2VWNA 4MNVA 4D7GA 3SQHE 2AS9A 4FU8A 5HIZA 5AFZH 1P06A 2R2WU 1A5HA 3KF2A 1ELVA 1F92A 2P3FH 1EB1H 1Y3XA 2OP9A 2VWMA 3A83A 1YKTA 1PPGE 2AIPA 5FPSA 5GDSH 2BB4A 5ETXA 1O2HA 1V2ST 2SGFE 3AAVA 1BBRK 1MTUA 1TLDA 3UR9A 3DUXH 5CDFE 1INCA 1O2VA 3D62A 2GKVE 1YC0A 1TOCB 4IBLH 4ABDA 4INHA 1JOUB 3BTFE 1WTHD 1P3CA 2CN0H 5EG4A 4RN6A 5EQSA 3SUFA 2PLXA 1C5NH 5HM2A 1LVBA 3TU7H 1SOZA 3FZZA 3OX7U 1LHEH 2BTCE 3LU9B 1YYY1 3HPTB 1V2RT 4D7FA 2BD7A 2G51A 1O3JA 3ENSB 1V2JT 1BTHH 1E1RD 1BZXE 2A4QA 4UE7H 5TJXA 1O3IA 1C2KA 1C5ZB 1Z71A 2H1UA 4UFDH 3BV9B 1UJ1A 2F9UA 4A1TA 4BTTB 1C1SA 1WQVH 4ZXXH 1G3DA 3S0NA 1HIAA 1EPTC 3GY3A 1G3EA 4NA8A 2YMSB 2EEKA 4K2YA 1TMBH 1CT0E 4TYDA 2PW8H 4CR9A 3N7OA 2TGPZ 4SGBE 1O32A 1C5SA 4GLYA 1AE8H 1Z8GA 1BBRH 4NCYA 4NWKA 4XD7D 2CHAC 1UMAH 3PLKA 5T1VA 1O2KA 1KTSB 1EB2A 1BT7A 4WY3A 2AMDA 4DT7B 5K0HA 1DSTA 1O2YA 1GWAA 1M9UA 3P17H 3D23A 4DJZB 2G81E 3PLPA 5JBAS 4WMFA 1JIRA 1VR1H 1FIWA 1CHGA 1G2LA 1BRUP 1NS3A 2G5VA 2JH0D 4K5ZA 3KGPA 1G9IE 1TMUH 4YT6H 3LJJA 3P95A 2A7JA 1ZJKA 2AH4X 1BMLA 2VVCA 3KN2A 4AG2A 3RMNH 1TNHA 3GS9A 5TCAA 1O3GA 2FOBA 2GZ7A 1IHSH 4RT1A 1SGTA 3F0OA 3UTUH 4WWYA 3Q3YA 1V2NT 1LQEA 1CBWB 2BD4A 3U28C 2OK5A 4CREA 1P2JA 2FWWA 2BDYA 1RIWB 5HMAA 2AMQA 1GHBF 5E8EH 1AFQC 1HJ9A 1YPLH 2FYQA 4O03A 4B76A 1Y3YA 2BD9A 4B75A 3DFJA 4I8HA 1EJAA 2BOHB 5EPNA 2ZQ2A 1PFXC 3S69A 3VB7A 5BRRE 1ABIH 3RXQA 5F8XA 2WUCA 1C2HA 1EZUC 3BG4B 2PR3A 1O31A 3DFLA 2V6NA 2Z3EA 4U30A 2Y81A 4X0WU 5EJ1A 1J16A 1O3AA 1P2IA 5TCCA 1UVPA 1YPHE 3PRDA 1Z8IB 4THNH 4K60A 1QBNA 4AORA 1B0FA 3BSQA 3HK6B 3ZVGA 3CS0A 1TRMA 1D6WA 2HNTC 4ABFA 2ZU2A 4UFEH 3FANA 1DY9A 1XX9A 4FUJA 2ZWLH 1AN1E 2STAE 3K2UA 5HGGA 3E3TA 2ZP0H 4ZKRU 3NCLA 4CH2B 1RTKA 1A7SA 3EA8A 3EYDA 4HZHA 5T6FA 3T25A 1TA6A 1BCUH 2TGTA 3FFGA 1F0RA 1AU8A 1FZZA 1MBMA 1G3CA 1O2XA 4O9VA 2FDAA 3M3TA 5C1UA 1ZHPA 4H42U 4BOHA 1P11E 3SU3A 4ZMAH 1SGFA 1ZPBA 2C8XB 3OAAD 2A31A 4TWWA 4ZUHA 3ZVAA 1C5LH 1VJAU 3OY5U 4B6FA 4NSVA 1FAKH 4WVPE 1QURH 3GDUA 2OQ5A 1MZDA 2FEQH 1QB1A 1TPSA 4X1PU 1WUNH 1HFDA 1DWCH 2O8LA 2FYRA 3A7YA 3VG8A 2PGBB 2W6ID 2ZFSA 2CF8H 6LPRA 5CHBA 1GBFA 2V0BA 2GT8A 2BY8X 1T8LA 1FN8A 3RXHA 3F68H 4AC9A 1O3DA 4KTUA 4ISIH 4BTIB 3VB6A 1ELBA 3HATH 1UTQA 1TFXA 3SJKA 1A5GH 4A7IB 4Z6AH 1C1NA 1RTLA 3OTJE 4KP0A 1KLJH 2G55A 2OC7A 3LC3A 3STIA 3GISB 2BLWA 2HNTF 2BXUH 1C9TA 1TPAE 1BB0B 2ZHQH 2KCOA 1SGIB 1HPGA 2IN2A 1V2LT 2J2UA 1C1UH 3TNTA 1WU1A 2W26A 1TX6A 3LT3A 3S9CA 2A5AA 3LGYA 2FM2A 1TALA 2KCPA 2GCHF 2BDIA 4OM9A 6CHAC 1AY6H 3SUEA 5DPAA 2HLDD 2GMTC 3WW7A 1ANDA 4CR5A 3EDXB 1P03A 4NZQA 1UCYE 1GBCA 4X1SU 1NT1A 2F91A 2Z7FE 1C2FA 1XXDA 1E35B 1GL1A 1NRSH 4ASUD 3RM0H 2ZU1A 1N6XA 2ZDNA 1XMNB 2XYAA 3E91A 1ABJH 1B7XB 3ATWA 1IQNA 3ZZ3A 2ZFTA 1Q31A 1OWHA 2C8ZB 2GX4A 3N7DA 1GHAF 1L1GA 3ITIA 2KFWA 1O3CA 1A3BH 3SI3H 2Q1JA 5C17A 5K7RA 4ZAEA 2JKHA 2ZU4A 4A1XA 4YT7H 2BX4A 5FCKA 1QY6A 2Q6GA 3A7ZA 3TPIZ 1GVZA 2A45B 4B6EA 4ISHH 3T5FH 5DP6A 2H9HA 3M35A 2C90B 2ODYB 4X6PA 2TGDA 4K1TA 4MPUA 3BTHE 3MH5A 1VCPA 2P8OB 4JYUH 3T27A 1P57B 2Y7XA 2AIQA 3MNSA 4H4FA 1FI8A 2ZZUH 2XBWA 4MTBA 3U1IB 6GCHG 1YLNA 4A5TS 2AHME 2BDCA 1T31A 4CRGA 1C4Y2 6ESTA 3QDZB 2P16A 4HG6A 1O0DH 1GDQA 2BQWB 1TX8A 2ZHWH 1QBOA 3NXPA 2IOTA 2GT7A 2R0KA 1DWEH 1LQDB 3IWMA 4DG4A 1E1QD 2KX4A 2GDDA 3SZEA 2RA0A 1TABE 4B73A 1LHCH 1GJ4H 1VITG 4OS2A 4ACBA 2XBYA 3CP7A 4GPGA 1MAYA 2R3UA 4I7YH 2OC1A 3QLPH 1KLIH 1GJ9B 1WYKA 3ZZ6A 1T8NA 4RT0A 1NRQH 1YBWA 1A4WH 1AI8H 2FODA 2NU1E 3E8LA 4Z1MD 5A0CA 4ZH8A 4M9FA 4UDWH 3ZYDA 2A32A 4NIWA 1ZTKA 4IGDA 1JRTA 7GCHF 5J4SA 3D65E 5DP9A 1NC6A 1P2OA 1HYLA 1GI1A 3NWUA 3EA7A 1TGTA 3PO1B 2J5UA 1C2EA 3RMLH 3SI4H 5A0AE 4Y8XA 3VEQB 2FOEA 1D3TB 1ORFA 1KXBA 1FJSA 3PWCA 5GJ4B 3ZIAD 1UVOA 1SQRA 1ELTA 2Z3CA 4JCNA 4Q4LA 2V7QD 4ISLA 2ZDVH 4D9RA 1IOEA 3FKSD 1S5SA 1K1MA 2VH0A 4JZIA 3ATLA 5T6DA 4DIHH 1SQTA 1TGSZ 4RI0A 4X8TH 4Y8YA 2QF4A 2FZZA 1GI8B 1XUHA 2ZCKP 4R8TB 2A4RA 4X8UH 3KEEA 1GHYH 5L6NH 3MO9A 3WWBA 2A1DB 2RG3A 3SGAE 5IK2D 3F0PA 4AX9H 1OYTH 2K0QA 1TNGA 1Y5UT 3B23B 3E0NB 2SGQE 2BQ6B 5EODA 2BMGB
chains in the Genus database with same CATH topology
1F7ZA 3AW1A 5ABWA 1CU1A 1PQAA 2WPMS 1C1OA 2BX3A 2G5NA 2OXSA 2XW9A 5LH8A 7ESTE 2VIPA 1GGDB 1QA0A 2OBOA 1HNEE 2LPRA 1GHVH 1KXFA 4UONA 1EAWA 1QL8A 1L1NA 1TNLA 2FOHA 3RXGA 1DS2E 2NWNA 1PPFE 1SLUB 1SHHB 2Q6FA 3NPSA 3V13A 3MI4A 4INKA 1MTVA 1BHXB 1QL7A 1CGHA 2FOGA 3CENA 4IN2A 5GCHF 1MH0A 1K22H 2B7DH 3GY8A 4LZ1H 4D9QA 1O3EA 3RC4A 2SGDE 5LPRA 1LVMA 3U8OH 1FV9A 1SGYE 3O8DA 1S6HA 5EGMA 3LJOA 2AEIH 1E37B 4YZUA 2GD4B 1EJMA 1YCPK 3A7XA 1N8OB 1KSNA 1KXAA 3SGQE 4NFFA 3FP8E 1ELDE 1Y3WA 3I29A 4VGCC 3G01A 2WYGA 3ELAH 1DICA 1CA0B 1SGEE 3URDA 3RXTA 4A1VA 8ESTE 3QN7A 1C5PA 1FLEE 4Y7BA 3RU4T 3SUGA 2O8WA 3O8CA 1QR3E 1QRWA 3SQEE 1MKWK 1ANCA 3BTQE 1BITA 1HAIH 1O35A 1LMWB 2THFB 4NG9H 3SOSA 4AB9A 5ESTE 2BYAX 1SLWB 1BRBE 3SO3A 2QF0A 1EP6A 1NRRH 2VGCC 3SUDA 3UOUA 3PWBA 1XKBC 1ZR0A 3V0XA 5LPEA 1G36A 1P2KA 2ZFPH 2KAIB 1AD8H 3UQVA 2SGPE 1E38B 4IN1A 2ZDMA 1HAZB 1P8VC 1NO9H 1DM4B 2H9TH 5EU8A 1QTFA 4MPVA 2ZI2H 4K1SA 1GI3A 2WPLS 1MD7A 3P70B 1AUTC 1BTZA 3MO6A 4BAQB 3NUMA 1GJCB 2HALA 3LGUA 3VFEA 1YCPH 3RXPA 3SNDA 3PTNA 3QGNB 4LOYH 1T4UH 1P09A 3GY4A 1C2IA 5DGJA 1FPCH 2PKAA 2XXLA 4FUEA 4X6MA 5ESBA 3K65B 1SR5C 1O37A 1U6QA 1DVAH 2QXJA 3H7OA 2HWLB 2PV9B 1A61H 3KQCA 1ETRH 1C4V2 3ATKA 3QWCH 1GBTA 4X8SH 2TGAA 1FMGA 5F8ZA 1GVKB 5DP8A 2H6MA 1L2EA 2H2ZA 2F9OA 5EPYA 1GMHG 1MKWH 3U98H 3BN9A 1WQSA 1P01A 4WXIA 1SOTA 3SV6A 1MKXK 2QV1A 4J1YA 5C3NA 1E34B 1W0YH 4GAWA 2XC5A 3ATIA 1QQ4A 4UD9H 4JZEH 4AGKA 2P3UB 1GDUA 3FAOA 1JXPA 1Z1JA 3M3SA 2B8OH 5GPIB 1PPHE 4F49A 3LH1A 4Y0ZE 3PMBB 3RXAA 1SBWA 4INLA 1GBEA 4LZ4B 1C5XB 5F8TA 4OS1A 1NU7B 1LPGB 2FX6A 2ZGBH 1O2LA 3I77A 3SV8A 2ZG0H 4AN7A 4XFQA 3Q76A 5DJ7A 4BTUB 1Q2WA 1UK4A 1DWDH 2BDAA 2CGAA 3V7TA 1QRZA 1A3EH 1SLVB 2HNTE 4KGAA 3GCTF 3P8FA 2ZIQH 1GBAA 5FBEA 5DKMA 4FU9A 3ZZDA 5A09A 4Y7AA 5HXFA 2WPIS 1O2UA 3SORA 3RXCA 1AZ8A 2ZFRH 3UNQA 1V2PT 1UTPA 2V3HH 3ESTA 1V2UT 1GBKA 2ZO3H 1EZXC 3M7QA 3QUMP 1H9LB 3RLWH 2ZF0H 2TPIZ 1P0SH 3W95A 3LGIA 1O2WA 1MKXH 3KQEA 1GI6A 2STBE 3UNSA 1OXGA 4DCDA 4ABAA 5LGOA 3E1XB 3A7TA 2P59A 1CO7E 2ANKH 3GY7A 2W3IA 1G3BA 4JZ1A 1HLTH 3RXSA 3VB5A 1QJ7B 1Z7KA 2QAAA 1FXYA 2EC9H 4IC6A 4BAKB 2ZDAH 3RMMH 3QTOH 2J92A 1YPKH 4FU7A 3RDZA 4AYVB 4ABHA 1KXDA 1ELCA 1HAVB 1ZMLA 1MUEB 1AUJA 2FTMA 2A4GA 1IQEA 9ESTA 1EUFA 3MU4A 1OYQA 1DOJA 3UFAA 2D8WA 3UR6A 2FI3E 3ZZ8A 1FIZA 3RP2A 2C8WB 1TNJA 1LKAA 3RC6A 1EAXA 4B2CA 1QB6A 4FUIA 2A7HA 1C1PA 1O2OA 3KQBA 1ZTLA 1S81A 1E0FD 1HJAB 1AHTH 4D8NA 1DFPA 4B71A 2G4UA 1DANH 3LOXA 1GBHA 1L0ZA 2FOCA 1MU6B 1NESE 2FESH 3B9FH 3ODFA 3DA9B 3S7HB 1SB1H 2ULLA 1QIXB 4BAHB 1EOLA 1GG6C 1P2NA 3PMHB 3TJUA 3IG6B 4YLQH 5C2ZA 1UVUH 1H9HE 3S9AA 1GCTC 1O3MA 1C5VA 3HGPA 2Y82A 1O2ZA 5BPEA 1KY9A 4I8LA 1AKSB 1FY8E 1NFUA 2J38A 4IMZA 2QN5T 5L30H 1EAIA 1UHBA 3KNXA 2PKSC 1C2GA 3GY5A 5IYTA 3P6ZB 2CMYA 4X2YA 1F0UA 3S9BA 3MH7A 2GDEH 2OQUA 3H5CB 5A0BA 1PQ8A 4E7RG 2P93A 2QXHA 4MNXA 1C5QA 3SU2A 3GCNA 2BDGA 2WV5A 5HYOA 1ZGVA 1LO6A 1GBJA 2Y5GA 1A0HB 3ZZCA 1SGQE 1GHXH 1BIOA 5E2PA 1A1RA 3VGCC 1PPZA 2Q6DA 1ZMNA 2D1JA 5DK1A 3UPEA 2BLVA 2VIVA 1LVOA 1PYTD 3ZVEA 4FVBA 1BTUA 1LKBA 3PM3A 3ZZAA 2AGGX 1SFQB 1VGCB 5JBTA 2SFAA 1Y3VA 1GPZA 3CS7A 3VB3A 1C5UA 1J9CH 5DP5A 3A8BA 5J4QA 4Q7YA 2GVFA 5AF9H 1UTNA 2GTBA 1C1VH 2WPKS 4UEHH 1FONA 1UO6A 3UY9A 1ZHRA 2XNIA 4DIIH 4TPIZ 2PSYA 1GBBA 1SGDE 3QZQA 3JZ2B 3OYPA 4GHTA 1DXWA 4ZKSU 1T7CA 1AWHB 1HRTH 1XXFA 2Y7ZA 3NKKA 8KME2 2R0LA 1GI0A 4WF8A 3AW0A 1O39A 1O5AB 1GL0E 4CRDA 3STJA 4AZ2B 2BVRH 1ZYOA 2HOBA 1GMCG 3TK9A 2ZQ1A 1GCDA 1L4ZA 4MNYA 5CHAB 2OC0A 5A8ZA 2GP9B 1BOQA 3OU0A 5B6OA 1O3BA 4HTCH 2XTTB 1NTPA 4E06H 3TGKE 3SJOA 1O3NA 4JMYA 5AHGH 1EPTB 2BY9X 1TWXB 1ZSKA 1QJ1B 2ZTZA 1PYTC 3M5LA 5C1XA 1AE5A 1QHRB 4FUFA 4CHAC 1XVMA 2QXIA 3BEFB 3U69H 3T26A 1GJ6A 1RRKA 1XKAC 1O2IA 3PO1C 2BXTH 2BDHA 4J2YB 5HM9A 2AMPA 1O5EH 1AB9C 1RJXB 2Z9LA 1O2SA 2CHAB 3A85A 2GGVB 3RXBA 2H9EH 5A2MH 3RXJA 4IW4E 3NK8A 1QL9A 2BHGA 4DURA 3RU4D 2AYWA 4ABGA 1SGRE 3HKJB 5GXPA 1DY8A 3MU0A 4DW2U 3SZNA 4TPYA 4Y6DA 4ABIA 1THRH 3RXRA 1BJVA 3TGIE 4CBOA 2BVXH 1V6DA 3UWIA 1HAYB 3MNBA 3QO6A 2ANWA 1GMDF 3A89A 3FZDA 1CT4E 2WINI 2QGRA 1OWDA 1TAWA 2ESTE 2GCHG 1GBDA 1J17T 4TY7A 1HAXB 1MZAA 1H9IE 2VWLA 4ISOA 2Z9GA 5FX5A 1S0QA 5E2OA 3HKIB 3SJ9A 2B0FA 1A5IA 3QTVH 3RXDA 3SV7A 3PYHA 3SJ8A 1TONA 3BTME 1P10A 1CT2E 6GCHF 4K69A 1EZQA 1GHAG 3F9HA 5E0GA 1HDTH 1JIMA 1O5FH 1Y3UA 2A5IA 1KIGH 1UVSH 4ZROA 4ZXYH 1V2VT 2VB0A 3LC5A 3MTYA 5E0HA 4ASHA 5CE1A 1LPZB 3JZ1B 1A0LA 1AIXH 1NM6A 3F1SB 4Y79A 3WY8A 1D3PB 3O8BA 1WCZA 5E0JA 1SSXA 1ELAA 2CJIA 4OS4A 1HAGE 3C27B 1Z6JH 2V35A 2A2XH 1GVLA 3AASA 3I78A 4RSPA 3M5MA 4JZDH 2F3CE 2DUCA 3TH4H 1NU9A 3D49H 2XC4A 3TJVA 1GJ5H 1CA0C 1KDQB 1HGTH 1OWIA 1MTNB 1A2CH 4NIVA 1PPEE 3ZZ4A 1H8DH 3M5OA 3M5NA 3UWJH 2BZAA 4YM9A 1EX3A 2SNWA 4XSKU 2FI4E 1P3EA 1BBRE 1YGCH 2O8TA 2PUXB 1UTMA 2C4FH 1LHDH 2IJOB 1FUJA 3RXLA 1T8OA 1VJ9U 4X2WA 5EXLA 3GYLB 2G00A 1K1IA 2FX4A 1QQUA 1S83A 4B74A 1FN6A 8GCHF 3TJNA 3MOCA 3UNRA 1IQHA 1OWJA 5GIBA 4U01A 1BHXF 4MVNA 5FCRA 4GVUA 4MPWA 1FNIA 1SI5H 3SW2B 2C8YB 3EA9A 1W2KH 2GV6A 1F5RA 1VITH 3U8RH 1EATA 1BUIA 1TRYA 3ZVCA 5A8YA 3GCHC 1Z8JB 3K6ZA 6CHAB 2UWLA 2EA3A 4O3UA 3LGTA 1BMAA 1O5GH 1BJUA 2F9PA 4AFUA 2OD3B 2PFEA 2H5DA 1XUIA 3SHAH 3GOVB 1V3XA 4Z0KA 7KMEH 1ZZZA 4GCHF 2JETB 3OY6U 1TOMH 2ANMH 1ID5H 2HPPH 3M7UA 3P92A 3KIDU 1Y5AT 1IQLA 1O2NA 3RXMA 1O2JA 2NU3E 4O3TA 4AOQA 2P95A 1KLTA 1QBVH 3LIWA 4B2AA 2ZHEH 3E16B 4X1QU 1JMOH 3PMJA 2CV3A 5DP4A 9LPRA 4H6TA 1F5KU 3TJOA 1MCTA 3VB4A 1GBLA 1CHOF 1GBMA 2EI8A 2SGAA 2Y5FA 2SNVA 1ZGIA 1YM0A 1QJ6B 3KL6A 4DVAU 1EKBB 3RXEA 1ZTJA 3Q3XA 2FLRH 5C5OA 3A7WA 2ZTXA 4A6LA 3SJIA 3MMGA 4NIYA 2VNTA 2R9PA 4WMEA 3SNAA 1LHFH 1DUEA 5JB9S 1O5CB 2VIQA 4ABJA 4TY6A 2XBVA 2YNBA 1ANEA 3SU5A 3BTKE 2QA9E 3ZZBA 1T8MA 1D4PB 5JPMH 1O3LA 3M3VA 1DPOA 1YPJH 1CGJE 1KDQA 4NFEA 4AFSA 1O3FA 2VIWA 1YP9A 1B0EA 2FTLE 3KHVA 2BD5A 3BG8A 1TNKA 1G30B 1CGIE 1MU8B 3FVFB 1IQMA 5FBIA 1HUTH 1TMTH 1TQ7B 1YPMH 1KXEA 3LDXH 1O2RA 2BD8A 1RGQA 1K1NA 1KTTB 1SL3A 2CF9H 1EASA 1D3QB 1O2PA 1TYNA 1Y59T 3M7TA 4OGYA 3A8AA 1NRPH 4BXSA 3ZZ9A 4Y71A 1AVGH 2JH6D 3BTWE 3W94A 1NRNH 1K9OE 1TIOA 2G8TA 1ZRBA 3TVJB 1JBUH 2XBXA 1D6RA 4QT8C 2G4TA 1C2LA 1UCYK 3SV2H 1NFYA 4XBBA 1P02A 3ZV9A 1ESBA 1O5DH 2ODQA 2FLBH 3KQDA 4NSYA 1DXPA 1O3OA 5F6MA 1AGJA 1EAUA 5EXNA 1PQ7A 5JYIA 5EW2H 1MQ6A 1GMHF 1S84A 2J34A 1W13U 1C9PA 1S82A 3EGKH 3M36A 4MNWA 3SU4A 3SNEA 3MYWA 1MCVA 1THPB 2J95A 4H6SB 4NA9H 4WMDA 4K8YA 1FPHH 2J9NA 1C5MD 3SHCH 4E7NA 1LTOA 3L3TA 2P94A 3P8GA 4FUHA 2DE9A 3LH3A 5EW1H 3KCGH 1UTJA 1ACBE 2XCNA 2H5CA 3HK3B 4O97A 5C20A 1ARBA 4KTSA 1C1TA 3R0FA 4Y0YE 3RLYH 1OP8A 1HJ8A 3MNXA 2DE8A 2Z94A 5SGAE 2ALVA 3GY2A 1P9UA 2QYIA 2XWAA 1CBWC 2I6QA 3M37A 4CH8B 1C5YB 1C2JA 1RIWC 2BY7X 3F9FA 4FUCA 2ZHFH 1P12E 1W3CA 4YESB 4R0IA 3QZRA 1Z8RA 1ZOMA 4IMQA 3MFJA 1IHTH 1J8AA 1WV7H 4NWLA 4RKOB 2D2DA 1F0TA 1V2OT 1UCYH 3S7KB 4BNRA 1TPPA 2A0QB 1EOJA 2Z3DA 2ZU3A 3BG4C 1GI7B 4PROA 5I46H 1NROH 3URCA 4YOIA 2GCTB 1SMFE 1CQQA 3VPKA 2UUKB 1O2QA 2WPHS 2QCYA 4JYVH 3UOPA 1SGFG 3RXKA 2HLCA 1LHGH 1HXEH 1ZSLA 4VGCB 4ZHAA 3RXIA 1OKXA 5EQQA 1X7AC 3TK5A 4HI3A 1GI2A 1SHYA 1NY22 2R3YA 3F9GA 3SU6A 1IQKA 3GCTG 4Y10E 3L33A 1EQ9A 1VGCC 1DUAA 3MH6A 1F5LA 1V2KT 3TK6A 1G32B 4KKDA 5FX6A 1B5GH 1C1MA 3GDSA 4DOQA 1W14U 3GCOA 3TLOA 2ZA5A 1A46H 2SGEE 2FPZA 1CVWH 2KAIA 2VGCB 4B1TA 1QFKH 3MNCA 2YNAA 1C1WH 1FQ3A 3TNSA 4CRBA 1BTYA 1O38A 1TRNA 2TRMA 4IC5A 1SC8U 1LVYA 2FIRH 3RUOA 4Y11E 2FXRA 1GI9B 1C5TA 1O3HA 3MHWU 1V2TT 2RCEA 4XDEA 4ZKNU 4X6OA 1BMNH 5CHAC 2PTCE 1TB6H 3TGJE 2B5TB 1SQAA 2RDLA 2UUYA 2WYJA 1UK3A 4HGCA 2ZFQH 3PROA 2NU0E 1XUJA 3A7VA 4X1NU 2F9VA 3IITA 1YLCA 3SN8A 1W12U 2VVUA 4WH8A 5AVDA 1H1BA 2WPJS 2ASUB 1H4WA 2PUQH 2RA3A 1GJ8B 1GI4A 1P05A 1TGNA 3A82A 3RC5A 4ZKOU 1YPEH 4JK5A 1IQGA 1RTFB 3H7TA 2FI5E 2B9LA 1SFIA 2M5TA 4MQAA 1BTPA 1SGCA 2WUBA 2CXVA 1YLDA 5C5NA 2ANYA 3LGWA 1FY1A 2FS8A 5CMXH 1BRAA 3RXVA 3A81A 3RXUA 3MO3A 1BDAA 2ZGHA 3UUZA 3U9AH 1UVTH 2O9QA 1G2MA 1T32A 1ANBA 4