1FV9A

Crystal structure of human microurokinase in complex with 2-amino-5-hydroxy-benzimidazole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE
publication title Identification of novel inhibitors of urokinase via NMR-based screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 50
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fv9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fv9A01
3V3MA 3SGQE 3T27A 4XOJA 3LJOA 3GDVA 1AGJA 5EQRA 6CHAC 3RUOA 1WAYB 1F5RA 4CBOA 4NSYA 4UEHH 2WV5A 3FZDA 1LHGH 3ZZCA 4IN2A 4B2BA 1TB6H 2FMJA 2G5NA 2UWOA 2WPLS 2SGAA 4AFQA 1JRTA 3MOCA 3P70B 1QNJA 4GCHG 4FUHA 1QA7A 3BSQA 1IQNA 3RDZA 3IITA 2RDLA 2OLGA 3O8CA 2VVCA 2JETB 2XC5A 1AWFH 5L2ZH 1PPHE 2Y81A 1LMWB 3KQBA 1AMHA 2XWBI 2XBXA 5AFZH 1VCWA 1PYTC 2WYGA 3UPEA 1LQEA 2ZTXA 3V0XA 1C2KA 4GPGA 1Y5UT 2ZTZA 3GDSA 1O2XA 2F9PA 5CHAC 3QZQA 4D7GA 3H5CB 5EW2H 1F5LA 3GCOA 1WUNH 1OX1A 4X8TH 4HFPB 4IBLH 1ZSKA 4TY7A 2UUFB 3RXLA 2BYAX 2BOKA 1XX9A 4AG1A 1GVZA 1V3XA 2HALA 2ZTYA 3A84A 2VIPA 2NU0E 4LOYH 2Z9GA 4XDEA 3PTNA 3VEQB 1PPFE 1SGFG 5LPRA 1C2LA 4TPYA 5DG6A 4ESTE 1A2CH 4ZUHA 1EB2A 3MU5A 4WXVA 3CS0A 3AW1A 1O2NA 1FAKH 1KXAA 3EAJA 1HAZB 4ABHA 5JDUB 3NCLA 3QTOH 4AFUA 4DCDA 3L3TA 1VCPA 4X0WU 1WCZA 1C5OH 4B2CA 1C5XB 1CO7E 3UOPA 4D7FA 1SGEE 3SU0A 1H8IH 1GI3A 1C5UA 1XUKA 3SN8A 4X2XA 2EA3A 1FZZA 2VH0A 2ZDMA 1QGFA 3LOXA 3M7TA 1K9OE 3UFAA 5LGOA 3R3GB 1AFEH 5FHTA 3FFGA 1DLKB 1C1RA 2A32A 4FVBA 1CHGA 1THRH 1OP8A 1QQ4A 5A2MH 4AYYB 4FUEA 1KTSB 2Y7ZA 4WF8A 4KP0A 2Y80A 2SGQE 2BY9X 1FV9A 4X6MA 3URDA 3EQ0H 4WWYA 2HLCA 4CH2B 1TMBH 1IHSH 1KY9A 1MMJN 1Z1IA 5I25A 3SNCA 4FU8A 3SV9A 1K22H 4UONA 1JBUH 3K9XB 1BB0B 3RXFA 3S0NA 2O8LA 1O3CA 5BPEA 3ESTA 1SGYE 2BVSH 2FP7B 1BUIA 1T7CA 2QGRA 1TGSZ 2A7CA 2ZIQH 1QHRB 3V12A 2AMPA 1LQDB 3BEFB 2J95A 1N8OB 4X2YA 3FANA 1CE5A 1OOKB 1DFPA 3BTHE 1W13U 4I8LA 1V2WT 4LK4A 3AASA 1TNLA 1AUTC 1C2EA 4ISNA 1CT2E 2ZDKA 3TJOA 1QB1A 4BANB 1O31A 3RXQA 1SG8B 1O3BA 1V2OT 4IC6A 2PKAB 1XXFA 1MTNC 5JB8S 1VZQH 4JZ1A 4WMEA 3U1IB 1ZTLA 4JZIA 2C8YB 1C2MA 3SNDA 3SU3A 1P01A 4BTUB 1JRSA 5A0AE 3BTEE 8LPRA 4YT6H 4LZ4B 2VINA 1ELTA 3SUEA 3V13A 4Q7YA 3L33A 1G36A 2XYAA 1SLXB 4H6SB 1QTFA 1K1PA 2BX3A 1C1WH 3MNCA 2Y82A 1FLEE 4KGAA 2ZQ2A 3OYPA 4K2YA 3PWBA 1O2RA 1ZTJA 1ZJKA 5A8YA 4FUDA 1ZRBA 2ZHWH 2GMTC 3MO9A 2FOHA 1DUEA 5F03A 2HVXA 2OC8A 4DY7B 1TNGA 2GCTC 1S6HA 3ZV8A 2PR3A 2YNAA 1DY8A 2AMQA 4JYUH 2J38A 5ABWA 4CR5A 4OGYA 1RRKA 1A5IA 1ZSJA 1C5QA 1J8AA 5I46H 1GL0E 2BB4A 4AX9H 5FXLA 4E7RG 4TYDA 4IC5A 2ZDLA 4GLYA 1EAIA 4Q7ZA 1GBIA 3P95A 2B0FA 1GHAF 5ESBA 1ANDA 1KSNA 5CE1A 1JWTA 3SV2H 1VR1H 3PMJA 1E35B 1RIWC 4D9RA 1HV7A 1MKWK 1CBWB 2A2XH 2W5EA 1UO6A 2BD7A 2XNIA 3PLPA 1KLTA 4AOQA 1P2NA 1ZSLA 2BLOA 2HGTH 2VIDA 3SUDA 3SJIA 3EA9A 1AKSB 3KIDU 1C4U2 3KEEA 2FDAA 1DE7H 2ZPSA 1L2EA 2ZEBA 5AFYH 1P12E 3MH5A 1UTQA 4NSVA 1L1JA 1GBLA 1MCVA 1HUTH 1A0JA 1S85A 3RMLH 1TOMH 4ABBA 1GBFA 1AFQC 2A5IA 4ISLA 4U01A 1H1BA 1BHXF 5EPNA 2GDDA 4J2YB 4JCNA 4CR9A 2CN0H 2I6QA 3LGIA 2BD2A 1B0EA 1C1QA 3BG4C 1EAXA 1UTMA 1UCYE 4ABAA 5ESTE 1LHEH 1O34A 1G3EA 2VNTA 3RC6A 4ISIH 1UMAH 1KIGH 1GBKA 1MTWA 4ZROA 2EC9H 1G30B 4NIXA 1BRUP 1O2PA 4K8BA 1W10U 2FXRA 4OGXA 1BBRK 1FY4A 3FP6E 1G9IE 2R0LA 3SGAE 2ODPA 1PPCE 2BD4A 2BMGB 4X8VH 1F7ZA 1S84A 1XUHA 1TNKA 4MPWA 3GCHC 1GBCA 4BOHA 2CMYA 2VWLA 3LGUA 1JOUB 1TALA 2RA3A 3GY8A 3GY2A 3W94A 1UVOA 1O3LA 2OQ5A 3SV6A 3KF2A 3TNSA 1CHOF 4CHAB 3ZVEA 2FS8A 2WV4A 1A4WH 1L4DA 3A83A 2H9TH 4YOIA 1SGIB 1P04A 1SSXA 3IG6B 4YLQH 3RXRA 2FWWA 2Z9IA 1FIWA 2ZPQA 2ANKH 1ETTH 1DT2A 4NZLA 1T4UH 2Z9KA 2R0KA 1EOJA 1YPHC 3KL6A 1Z6EA 1WSSH 2GDEH 3A81A 4YOGA 5F8TA 1LVOA 3P6ZB 2GZ8A 1SLWB 3DFLA 1IQMA 1GMDG 1TPOA 2ODYB 3AAUA 4YLUA 1GVLA 3NZIA 1TOCB 1MKXH 2FZZA 1BCUH 4X8UH 2G4TA 3E8LA 2CHAC 1GBAA 3BF6H 1AB9B 4BNRA 4AGJA 4X2WA 8GCHG 1FNIA 4JZFH 3BG8A 1GI1A 1GJ4H 1NS3A 2ZO3H 5EOKA 1TABE 3E1XB 2BLQA 1C2JA 3A89A 3PTBA 1L1NA 3SUFA 1GPZA 2AH4X 1AY6H 1H9HE 3URCA 3AW0A 3L6PA 2P16A 3QUMP 1NFYA 2WINI 1Y8TA 4B76A 1T32A 4J1YA 1QQUA 1SHYA 2Z3DA 2ZQ1A 1EX3A 4MPXA 5L2YH 2BD5A 2Y5HA 4ZHMU 1BJVA 3F68H 3NPSA 1GI8B 3VGCB 3VPKA 2B5TB 2V3OH 5E0JA 1DUAA 1O2TA 1INCA 1O2WA 1GJCB 1GCTB 2VIWA 2HNTF 3F9EA 3RU4E 4UFDH 1YBWA 1WBGB 1NT1A 1NFUA 3RMMH 4WY3A 2FLBH 1O5GH 2PTNA 1DDJA 3RLWH 1G3CA 1V2ST 3DUXH 4FUFA 2QN5T 2Z6BD 2XBYA 2F91A 4MQAA 1PQ8A 3GCTG 5FAHA 2FI5E 4AB8A 4ABIA 1V2RT 3E3TA 5FPTA 1WTHD 1C1VH 2Y5GA 2FEQH 2G52A 1F0RA 1J14A 1Y3XA 1FN8A 1G2LA 5G4BA 2F3CE 2ZGCA 1YCPK 4BAHB 6GCHG 2D8WA 2VWNA 3DD2H 1NRRH 3H7TA 1DPOA 1SGPE 3ZYEA 1M9UA 4H6TA 1VITF 1G37A 2W26A 3I29A 3BTGE 4PROA 1UVTH 1P03A 2Z3EA 4UFFH 1UK3A 2ZDVH 1W12U 2QCYA 4Y7AA 2KAIA 3GY4A 1EZSC 1UJ1A 3GICB 1DS2E 1EPTC 6CHAB 2PV9B 1UVSH 1ARBA 5GJ4B 1NY22 1L0ZA 3RXMA 2BVRH 3GYMA 5AHGH 5JBBS 3UR6A 4FXGH 1DOJA 1VITG 1UHBA 3ATIA 1Q3XA 3ZZ3A 1P2IA 3RXVA 3KN2A 3E91A 1SPJA 4JMYA 1HNEE 4IS5A 1W2KH 2FI4E 3FAOA 3TK5A 3D49H 1HBTH 1ANCA 1EJAA 3LC3A 2Q6FA 3FP7E 5FCKA 1GI4A 1B5GH 4XSKU 2F9BH 2ZFSA 1HAGE 1E38B 1H8DH 3OY6U 1AE5A 1WQSA 1O3EA 2OBOA 2O8MA 3RM0H 3RXJA 1CU1A 1EOLA 2ANWA 4DIIH 3LGVA 1LVBA 5CHAB 4RKJB 1CVWH 2CV3A 2AFQB 3EE0B 2OC7A 2ILNA 1E37B 1GHZA 1O2OA 5GWZA 4B74A 1BHXB 4YM9A 1HYLA 3M5MA 1SVPA 1UTNA 1VJ9U 1O2UA 2GCHF 3SNEA 1BRCE 2OINA 2H9HA 1LVMA 2J4IA 2A45B 1W11U 1H9LB 2GZ7A 3U9AH 1FPHH 3LDXH 1XUGA 1O5AB 3UNQA 2PKSB 5T3HA 1NC6A 1C2IA 5DK1A 8KME2 1YPGH 4Y6DA 2P95A 1BTPA 1D9IA 2A4GA 2A5KA 3E0NB 4VGCB 2C8WB 3P8OA 4GCHF 1KLJH 2SNWA 1ELGA 1E0FD 5JYIA 2GGVB 3E90B 4X6NA 5E0GA 1C4V2 1O0DH 1O5BB 1GCDA 1PPBH 2Z3CA 1IQLA 2HNTE 1ZTKA 1SFIA 1WTGH 2OUAA 1SQOA 5JBCS 2A4QA 2RA0A 3NXPA 1BMAA 2O8WA 1GMCG 1C2FA 1EJNA 4NGAH 3PLKA 4KELA 1TNJA 5DP9A 4ISOA 6ESTA 1TIOA 1OP0A 1K1MA 4Y71A 2C8XB 5E2OA 1TX7A 3ATKA 2GVFA 2HRVA 2ZFPH 5CMXH 1C1UH 1ELCA 3FVFB 3FZZA 4IMZA 5FPYA 3D62A 5DP8A 1Y3YA 3GCNA 4INLA 2QAAA 5A09A 3ZZ5A 2F83A 4DURA 1YYY1 3NWUA 2IN2A 3PB1E 4I8KA 5DO4H 3ELAH 3A8DA 1TBRH 1YCPM 1GG6B 1LPGB 1VCQA 1VGCC 1PQAA 3TJVA 1Y3UA 3A88A 3ENSB 4ASHA 1BRAA 1GDNA 3E16B 3V7TA 3A82A 1ZLRA 2P8OB 1SGRE 1O2SA 4OS4A 1HAYB 3C27B 2STAE 2UWPA 1MTNB 4ABJA 1CA0C 4UDWH 2FOAA 5GIBA 1LVYA 1KDQB 1QA0A 3ZZ8A 5PTPA 1HIAA 3NK8A 4YOJA 3B9FH 1A7SA 5C2ZA 5DP3A 4O9VA 4MPVA 3QTVH 1ZR0A 1MH0A 2J94A 2V3HH 4DOQA 2HPQH 2IOTA 4M7GA 1LKAA 4X6PA 1HXFH 1KYNA 2AEIH 1ZYOA 1O5DH 3IWMA 1PPZA 1IQEA 3RXDA 1T8MA 4Y0YE 2H6MA 4I31A 1A46H 4XBCA 2BY8X 1ELAA 2TGPZ 2NU1E 1K1OA 3SZNA 3UR9A 4KTCA 1QRWA 1QY6A 2VH6A 4YZUA 1GJ8B 1C5VA 1C2DA 1D6WA 1GI2A 3RXOA 1D4PB 3SORA 3K65B 1AWHB 4ABFA 1HAXB 2BXUH 2FYRA 3TK9A 1GHYH 1SGDE 1O2HA 1MZAA 1SR5C 2ZKSA 1O2MA 1SQTA 3KCGH 4OS7A 2BQ7B 4OS1A 2C90B 3CS7A 1GI0A 4DVAU 1YKTA 4D76A 2STBE 3EA8A 3EGKH 1HPGA 2D26C 1MD7A 2OC0A 2QXHA 4NCYA 2ESTE 1F0UA 1F0SA 2QXGA 1ETRH 2JETC 1BJUA 1NFXA 1HAOH 2BD8A 2WPKS 1BTHH 3RU4D 2BLWA 1EASA 2OQUA 4WJG2 5C1UA 2TBSA 1O3AA 1K1JA 1N1LA 1O2KA 2BVXH 3A8CA 4NWLA 4IN1A 3A85A 3ZVFA 4FU7A 2A4RA 4K1EA 3TVJB 3ZZAA 1O33A 2FLRH 1CQQA 3MU1A 4ZH8A 1O2VA 2VU8E 2ZDNA 1C1NA 1EP6A 4HZHA 2ZCKP 1ZZZA 4Z0KA 4MLFB 1NU7B 4WVPE 1SLVB 3QDZB 2P94A 5T6FA 2C3SA 4X8SH 1MD8A 1HAHH 1GJ5H 1AFQB 2M5TA 3LPRA 4ABDA 1T31A 2ZECA 2A4OA 2QXIA 1QBOA 2ZGBH 4HGCA 1Z8IB 1V6DA 1L1GA 1RFNA 3LKWA 1DXPA 2Z94A 1QRZA 1CGIE 2K1QA 2FYQA 3KQEA 1GJBB 2ZDAH 4E05H 5ETXA 1JMOH 4NWKA 5DP7A 1ABJH 4FUCA 1FY8E 2F9UA 3Q77A 1BOQA 3STIA 3MFJA 1D3DB 1ELEE 2QF0A 1ACBE 2P3TB 4IGDA 2ZWLH 1ZMLA 1GGDC 3RXSA 1O3KA 4UFGH 5J4QA 3TJUA 2XC0A 1LO6A 1RS0A 3RXUA 5A8ZA 1ESAA 1YLDA 1QRXA 1CGJE 3P17H 2H1UA 4NA9H 2FO9A 1OYQA 4OS6A 3W95A 1YCPH 1C1PA 1C9PA 3UWJH 2H2ZA 1C2GA 1SFQB 2BTCE 4NZQA 1QURH 5EQQA 3P92A 2J34A 2B8OH 4H4FA 1TNIA 2BQ6B 1NRNH 1J15A 1P2KA 2XBWA 2UUYA 3HK3B 1TMUH 2AGGX 1SI5H 2CHAB 3MNSA 1C5SA 1KXDA 3KGPA 1VITH 1PJPA 4X1RU 3BV9B 2PKAA 1SGCA 1V2QT 4MVNA 1AQ7A 3BTKE 2W7SA 1S0QA 5GPIB 1O5CB 3MH7A 1PQ5A 1IQGA 1GI5A 3GY5A 2W3KA 3HK6B 4B71A 4X1PU 3PMHB 2A2QH 1O36A 1FXYA 3PM3A 2Q6DA 1N6YA 1NN6A 1C1SA 2JKHA 1Q2WA 5IDKA 2ODQA 2Q6GA 3SI4H 1EKBB 1U6QA 1LHCH 2QY0B 3CP7A 3SBKA 4MG3A 1YPMH 4TWWA 3S9BA 2B9LA 3RXHA 2PGQB 3T29A 1C5ZB 4O03A 2ZGHA 3MI4A 1KXEA 4K3JA 1Q31A 2CGAA 2SGPE 3S7HB 3MO6A 2EI8A 5H4IB 1CSOE 1IQFA 2R3UA 3QGJA 1FY5A 1NRQH 3A8AA 1OYTH 3LGWA 2QC2A 3RXTA 2C8ZB 4NA7A 4I33A 4YESB 7GCHG 1V2JT 3U8TH 4ZAEA 3TH2H 2B7DH 4O97A 1HJ9A 2PGBB 1AVXA 3SV7A 3JZ1B 2G81E 4I7YH 3SHCH 4B1TA 1RTLA 4K60A 1GMDF 1ZRKA 4DW2U 1CGHA 3F6UH 2HWLB 3RXKA 3SQEE 4AYVB 3RC4A 3I77A 4X1SU 4CRAA 1EZXC 2BXTH 3P8FA 4ZKNU 3ZZ6A 1QCPA 5JPMH 1O3MA 2JH5D 1J16A 1P9UA 3QLPH 2QIQA 2Z9JA 2JH0D 1BQYA 1WV7H 8GCHF 1P0SH 3A7TA 2EI7A 1YM0A 4ZHAA 2BD9A 3BTFE 1TAWA 4F49A 2H9EH 3PWCA 4NIYA 3M5LA 1EPTB 2SFAA 2WUBA 5FBIA 1AIXH 1AKSA 4ZXYH 1FPCH 1BMMH 3AAVA 4K1SA 4GHQA 3LC5A 1DANH 2FOMB 3TH4H 1ORFA 1DWBH 1UTPA 1ZOMA 2VVUA 5EODA 3RMNH 3ZZ4A 2O8TA 1ELVA 1K1LA 1G2MA 4Y76A 2ZZUH 1V2MT 2BZ6H 2FOCA 3VXFH 1BDAA 4ABGA 3QWCH 4Y8XA 1P2QA 4A1XA 1HLTH 2WPIS 3U1JB 3PMBB 1DY9A 3T2NA 3PYHA 3QN7A 3B8JA 1XUFA 2A7JA 1EAWA 2AIPA 4NIWA 4CRGA 3A8BA 1QFKH 2FM2A 1XMNB 1GVKB 4CRBA 1MZDA 2LPRA 5HM2A 2XC4A 2V6NA 2BDYA 4AORA 3F1SB 3GCTF 5EGMA 1TLDA 3TGIE 2A0QB 2IPHA 1TGBA 5FX6A 2AERH 1W7GH 3BTTE 3TGKE 1ZGIA 2ZU1A 3GY6A 2ZU2A 3T62A 2J9NA 4GAWA 4ZHLU 6GCHF 1GHXH 3BTWE 2H5CA 2I6SA 1GHWH 1P05A 1MAYA 1AZ8A 1NM6A 4FVDA 3OU0A 1NO9H 1P3CA 3M3TA 2H5DA 3HGPA 4ZKRU 4RN6A 1D3TB 3O8DA 1BTUA 1TX8A 4XBBA 3MH4A 2D2DA 3PO1B 3LGTA 3DT0H 1V2KT 2GKVE 2P93A 2TRMA 1O3FA 3A7YA 3HPTB 3ZVAA 3B23B 1FI8A 3UOUA 3RU4T 1UTJA 3TIUA 3KQDA 1G3DA 1S5SA 1S6FA 3T26A 1HJAB 3M5OA 1G32B 1NPMA 4BAOB 3ZVGA 1MBQA 1K1IA 2SGFE 4K69A 2OTVA 1HAVB 1Y3VA 4FUIA 1UTKA 2OBQA 1GBTA 2ALPA 2J2UA 1V2TT 1BBRE 5A0CA 4B73A 1DWEH 4B2AA 4I32A 1BZXE 3LT3A 1QB6A 3SU1A 1OWHA 5JBTA 3UNSA 1C9TA 1PFXC 1TA2A 2QXJA 1KTTB 4ZKSU 2ZP0H 1BRBE 5GCHG 1F0TA 2R9PA 3A7WA 1GJ6A 1EAUA 2VIQA 1FMGA 5IYTA 4A5TS 2G8TA 2A1DB 3A7ZA 2V35A 3BIUH 2BM2A 5TCCA 4X1NU 5HYOA 2A31A 2JH6D 2BHGA 5A0BA 4THNH 4MNYA 2ZHQH 4K5ZA 1YPEH 1GBBA 1DVAH 1DWDH 4Y10E 2W7UA 1HCGA 1AVWA 2PSYA 4TY6A 2FX4A 1YLCA 4UD9H 1JXPA 3I78A 3TU7H 2ZC9H 3BIVH 1GJ9B 1OWJA 4Y79A 4E7NA 1FY1A 5J4SA 2ZPRA 1FJSA 1HRTH 4O3TA 1NRSH 3QGNB 4RKOB 3SJKA 2TGTA 2Z7FE 1IAUA 1RTFB 2FODA 1HXEH 1DXWA 4A7IB 3VGCC 3ZVDA 4INKA 3TK6A 1TQ0B 1BTZA 3T28A 3CENA 1D3QB 4AZ2B 2WUCA 2THFB 1CA0B 6LPRA 3GY7A 3U98H 1GCTC 1AHTH 2GTBA 2ZA5A 3MH6A 3SI3H 4ABEA 1O2LA 3LIWA 5BRRE 4FUJA 5TCAA 3SU5A 3RXIA 1O3JA 3RMOH 3NKKA 1WU1A 5K0HA 2VIVA 1A0HB 2PW8H 1C5WB 4CH8B 4ZKOU 3KHVA 4R8TB 3O8BA 1F92A 1O2ZA 3Q3YA 5LH8A 1OXGA 2P3FH 1TRMA 1IQKA 1P10A 4K8YA 1O35A 1RJXB 1GMCF 1HAVA 4GSOA 1KXBA 3SU4A 1NROH 2AGEX 4OS2A 1MBMA 2F9OA 5AVDA 3S69A 2FOBA 3Q3XA 2FOEA 1BMNH 4JYVH 1Y59T 2SGEE 4DGJA 2O8UA 3MNBA 1AN1E 5DJ7A 3A7XA 4Y0ZE 1OP2A 2DE9A 3MNXA 7LPRA 1MKXK 1QIXB 2AMDA 4I8JA 2OC1A 4WXIA 2ZCHP 3Q00A 1W3CA 1C1OA 3S9CA 3VB7A 2FPZA 1AO5A 1EJMA 1H9IE 3R0FA 1DX5M 3STJA 3E6PH 2FIRH 1ARCA 1QB9A 1SGNE 3UY9A 1DLEA 1WQVH 1HAIH 2ZNKH 4YO9A 5FX5A 1YC0A 1O30A 2FOFA 4MTBA 1OWIA 3LH3A 4R0IA 4BTTB 3A87A 1Y3WA 1GBHA 1LCYA 3UIRA 1ZMNA 2XWAA 4X1QU 1O2YA 1QJ1B 2TGDA 3RXPA 1C5YB 1MKWH 1C5NH 1N6XA 2ZHFH 3BTQE 4AN7A 1EZUC 1W0ZU 1P2OA 3OSYA 1T8LA 5C67A 1GBMA 1LTOA 3T25A 3M7UA 9ESTA 1W8BH 1DITH 1ETSH 1O3OA 2F9VA 3EYDA 3H7OA 1IOEA 5SGAE 1AVGH 2ZFQH 3KQCA 2FX6A 5B6OA 1SB1H 4AFZA 4WH8A 2TIOA 3ZZ9A 3O8RA 4MDSA 4WMDA 1C5TA 2IJOB 2Y5FA 1GDQA 4RSPA 5C1YA 3ZZBA 1KXFA 1BT7A 3RC5A 3NUMA 1XKBC 2Z9LA 1QL9A 1DWCH 1GI7B 3VB3A 4DJZB 3DHKH 2ALVA 3GISB 4GUXA 2CJIA 1B0FA 1HB0B 3TITA 1F2SE 3ODFA 1ZMJA 1ZHMA 8ESTE 3D65E 4UFEH 2G00A 2C93B 1P11E 2ZHEH 1SQAA 5GXPA 1CT4E 1TWXB 2PLXA 2GMTB 2GZ9A 3RLYH 1O2JA 2ULLA 2PKSC 2VGCC 1BBRH 1FQ3A 2GCTB 1EXFA 3PV4A 1GGDB 1OWEA 3SO3A 3M36A 1TA6A 2PUQH 4VGCC 1SBWA 1QJ7B 1H4WA 3F9FA 3N7OA 2XXLA 1Z8RA 5AF9H 3M7QA 1ELBA 1HDTH 1WYKA 4F4OC 2AIQA 2GD4B 2WPHS 1SHHB 4ISHH 3SJOA 4KTSA 1C4Y2 3RXBA 2OP9A 3BEUA 4CREA 1ID5H 4JK6A 1V2NT 2V0BA 1W14U 1FDPA 5DKMA 1RIWB 1ELFA 1RXPA 1KLIH 1QBVH 2VIOA 3U69H 2C4FH 3MHWU 1UK2A 1RGQA 4DG4A 1OS8A 1NRPH 3MU4A 1P06A 3F9GA 1P9SA 1XKAC 1UCYK 3HKIB 1TRNA 3FP8E 4BTIB 3OTJE 4IMQA 3ATWA 3MMGA 4MNVA 1K1NA 4ZMAH 3M61U 1P2MA 2ZCLP 1AI8H 2FTMA 1MTVA 1YPLH 1NTPA 1PYTD 1GHBF 1TFXA 1KDQA 1YPHE 1RD3B 1TGTA 5C3NA 1C5MD 1GG6C 3SU2A 1HFDA 4AFSA 4XE4A 3VFEA 4A1VA 3WY8A 2BY7X 1SL3A 3M3VA 2GT7A 2ZGJA 3BG4B 2CXVA 2P8OC 2VB0A 4HI3A 3UQVA 4K1TA 1P2JA 1GJ7B 3RXCA 2ZG0H 1GHBG 3BTME 3QZRA 1FIZA 4Y8ZA 1ESBA 1BA8B 4D9QA 2BDHA 3RXEA 2BX4A 1FY3A 2BY6X 1SMFE 3PROA 4U32A 1MU8B 3BN9A 1CT0E 1AD8H 2ZHDA 4U30A 1PQ7A 1S81A 2HNTC 3TLOA 9LPRA 1AUJA 2XRCA 2OD3B 4U2WA 3ZZDA 3AVZA 4NA8A 4INHA 4CBNA 3GCHB 1T8OA 5FCRA 2WYJA 1O2QA 1V2UT 4X2VA 4AGKA 2Q1JA 1K21H 1NESE 1UTLM 1A1RA 4BAKB 1A5GH 1O32A 2YOLA 2VJ1A 5HMAA 4A6LA 1ANEA 3DA9B 3BTDE 4JK5A 2XCNA 1XUIA 1V2LT 3ZV9A 3SNBA 2NWNA 1QBNA 3TNTA 3Q3KA 3UQOA 3T5FH 3Q76A 4A1TA 5C5NA 1YPJH 1ZHRA 1C5LH 4JYTA 3LU9B 2J92A 4E06H 1A5HA 3SV8A 3A7VA 3C1KA 2XTTB 1GI9B 3SNAA 1XUJA 5DGJA 3ODDA 4BXWA 1BTWA 1L4ZA 2XBVA 1A61H 1S82A 1QL8A 1THSH 2ZI2H 1D3PB 1AZZA 2XCFA 3A80A 1C5RA 1K28D 1LPKB 5DP5A 3QX5H 1O3NA 1T8NA 2RCEA 3SHAH 1UVPA 3MU8A 3F9HA 1P09A 3M35A 3GDUA 1EATA 1QL7A 2VWOA 1ESTA 1SOZA 1N8OC 3UWIA 2D1JA 1TRYA 2OXSA 4MNXA 1GDUA 1TQ7B 2Y7XA 1LPZB 2O9QA 1GHAG 3MTYA 1BITA 4H42U 3SOSA 4YT7H 3SUGA 2FTLE 3HGNA 3VB5A 1OWKA 3OX7U 4QT8C 1VJAU 1BTYA 7KMEH 1BIOA 1FN6A 2LNCA 2XW9A 1TGNA 2BOHB 2VWMA 1NU9A 4SGBE 5E2PA 3MWIU 5C5OA 1TPAE 3BEIB 4GVUA 1P3EA 1Z71A 7GCHF 2BD3A 1OKXA 1O3HA 1GBJA 1TNHA 3K6ZA 2TPIZ 2QA9E 2HPPH 2CF9H 2QF3A 1NZQH 5F8XA 1ZPZA 3K2UA 2FOGA 2PHBA 1TMTH 4BAMB 4AB9A 3VB6A 1GJDB 2ZF0H 3OY5U 1SC8U 3TPIZ 5GDSH 5HM9A 4CRFA 4XFQA 1ANBA 1E34B 4AG2A 2ANYA 2SGDE 3DFJA 1MAXA 4MNWA 5FBEA 2EEKA 1IQHA 5L6NH 3EDXB 4HTCH 2P59A 1FUJA 1TBQH 4WMFA 1X7AC 2A7HA 2ZGXH 1IQIA 1YPKH 1TONA 1HGTH 1OWDA 1G3BA 1DICA 3LONA 1TYNA 4XBDA 2W3IA 1Y5BT 1W7XH 2GT8A 1ZPBA 2GX4A 3ATMA 2UUKB 5EG4A 4Q7XA 1FAXA 1RTKA 2DE8A 1JIMA 2BDBA 1Z1JA 1C5PA 1TPPA 2FESH 2ANMH 3UUZA 4CRCA 5F8ZA 1LHDH 2PWXA 2ZFTA 3LH1A 1ZPCA 1O5FH 4SGAE 1THPB 3JZ2B 4FU9A 1O3PB 4B75A 4I8HA 3ZVBA 1Y5AT 1C2HA 3MYWA 1E36B 3ATLA 1S83A 4Y8YA 4TWYA 3KNXA 1CBWC 2G4UA 2VVVA 4UE7H 1CHOG 1O3IA 5L30H 3RXAA 2ASUB 2DUCA 2KAIB 1AE8H 4DT7B 2BDAA 4JZDH 5DP4A 2ZU4A 4ZXXH 1GJAB 1YP9A 2ZFRH 2CF8H 1MQ5A 1SGFA 3VXEH 2BDGA 3S9AA 1UHBB 2R3YA 1EP5A 1XVOA 3K6YA 2G5VA 1MQ6A 1C1MA 1DSTA 1A3EH 3P8NA 5E0HA 1V2VT 1XM1A 4MPUA 2ZFFH 3M3SA 2G55A 3GYLB 3SJ8A 2F9NA 1P57B 3E0PB 1BTXA 3GOVB 1GMHF 1ZGVA 5A8XA 2OCVB 3TJNA 2TGAA 2PUXB 1UK4A 4Y11E 1UVUH 1SGQE 2BY5X 5JBAS 1MU6B 2NU4E 2Y6TA 3LGYA 5DPAA 1T4VH 3HKJB 3SGBE 1P02A 1SGTA 4OS5A 3M37A 3PMAB 1C1TA 2R2WU 1GMHG 3U8OH 1EZQA 4FUGA 1GBEA 1GHVH 1K2I1 2P3UB 3EA7A 4X6OA 2UWLA 3MU0A 4NFFA 1LDTT 1J9CH 3QO6A 3RP2A 2FS9A 1S0RA 1ABIH 2ZU3A 4KKDA 4Y7BA 2QYIA 5C20A 1W0YH 5GCHF 1UTOA 1TPSA 3ZZ7A 4CHAC 1SOTA 3RM2H 3TH3H 1V2PT 1AU8A 1O38A 2A5AA 2YNBA 1Z6JH 1EPTA 4CRDA 3RXGA 5EXMA 5EXLA 2BQWB 5HGGA 1CA8B 2PSXA 5T6GA 1Z8JB 3TGJE 5T6DA 5EXNA 3P8GA 4LZ1H 1OSSA 1A0LA 4NIVA 2GP9B 1O3GA 4FUBA 5EQSA 1Z7KA 4BXSA 2GV7A 2RG3A 3G01A 7ESTE 1YF4A 2WPJS 5C1XA 1TBZH 4KTUA 3SJ9A 3QK1A 4BAQB 1WOFA 1GBDA 2ZU5A 1DSUA 1ELDE 3ZVCA 3UNRA 2AYWA 4IW4E 2BDCA 1EUFA 2SNVA 4YTAA 3U8RH 4O3UA 2NU2E 1AB9C 4D8NA 2AS9A 2R2MB 1JIRA 1FONA 1SLUB 2G51A 3M5NA 4NFEA 2NU3E 1F5KU 1GWAA 2WPMS 4I8GA 1J17T 2EI6A 1DM4B 3UREA 5HXFA 4NG9H 2UUJB 1HJ8A 1PPEE 1OPHB 3HATH 4DIHH 4WH6A 1ZHPA 1VGCB 4JZEH 2AGIX 3MO3A 5LPFA 1MTUA 4TPIZ 5DP6A 4Z6AH 5EPYA 5JB9S 3SQHE 1QJ6B 2PFEA 1XXDA 1UCYH 1O37A 1GI6A 1TGCA 4A92A 5F6MA 4Q2KA 3VB4A 1IHTH 1GL1A 1O2GH 1IQJA 1Z8GA 5LPEA 3ITIA 1MUEB 5EU8A 1LKBA 1ZJDA 1MTSA 2FI3E 3SW2B 5FPSA 1BMLA 5EW1H 2BDIA 5E8EH 2QV1A 1QR3E 2BLVA 1O39A 1HIAB 3D23A 3GY3A 3PO1C 1O5EH 1TX6A 1YGCH 1HAPH 4LXBH 1LHFH 1NFWA 3S7KB 1MCTA 2VGCB 2HOBA 1XVMA 3ZYDA 1EQ9A 1B7XB 4Q80A 3A86A 1TE0A 2GCHG 1A3BH 1EB1H 1HJAC 2GV6A 4GHTA 2BZAA 5K7RA 1O2IA 5TJXA 1O3DA 3SU6A 1D6RA 2PTCE 3LJJA 1P8VC 1PPGE 3UTUH 3PLBA 1KXCA
chains in the Genus database with same CATH superfamily
3V3MA 3SGQE 3T27A 4XOJA 3LJOA 3GDVA 1AGJA 5EQRA 6CHAC 3RUOA 1WAYB 1F5RA 4CBOA 4NSYA 4UEHH 2WV5A 3FZDA 1LHGH 3ZZCA 4IN2A 4B2BA 1TB6H 2FMJA 2G5NA 2UWOA 2WPLS 3U28C 2SGAA 4AFQA 1JRTA 3MOCA 3P70B 1QNJA 4GCHG 4FUHA 1QA7A 3BSQA 1IQNA 3RDZA 3IITA 2RDLA 2OLGA 4ACAA 3O8CA 2VVCA 2JETB 3DSPA 2XC5A 1AWFH 5L2ZH 1PPHE 2Y81A 1LMWB 3KQBA 1AMHA 2XWBI 2XBXA 5AFZH 1VCWA 1PYTC 2WYGA 3UPEA 1LQEA 2ZTXA 3V0XA 1C2KA 4GPGA 1Y5UT 2ZTZA 3GDSA 1O2XA 2F9PA 5CHAC 3QZQA 4D7GA 3H5CB 5EW2H 1F5LA 3GCOA 1WUNH 1OX1A 4X8TH 4HFPB 4IBLH 1ZSKA 4TY7A 2UUFB 3RXLA 2BYAX 2BOKA 1XX9A 4AG1A 1GVZA 1V3XA 2HALA 2ZTYA 3A84A 2VIPA 3PV5A 2NU0E 4LOYH 2Z9GA 4XDEA 3PTNA 3VEQB 1PPFE 1SGFG 5LPRA 1C2LA 4TPYA 5DG6A 5T1VA 4ESTE 1A2CH 2WHXA 4ZUHA 1EB2A 3MU5A 4WXVA 3CS0A 3AW1A 1O2NA 1FAKH 1KXAA 3EAJA 1HAZB 4ABHA 5JDUB 3NCLA 3QTOH 4DT4A 4AFUA 4DCDA 3L3TA 1VCPA 4X0WU 1WCZA 1C5OH 4B2CA 1C5XB 1CO7E 3FOAA 3UOPA 4D7FA 1SGEE 3SU0A 1H8IH 1GI3A 1C5UA 1XUKA 3SN8A 4X2XA 2EA3A 1FZZA 2VH0A 2ZDMA 1QGFA 3LOXA 3M7TA 1K9OE 2W6JD 3UFAA 5LGOA 3KYGA 3R3GB 2JJ2D 1AFEH 1VKYA 5FHTA 3FFGA 1DLKB 1C1RA 2A32A 4FVBA 4Z1MD 1CHGA 1THRH 1OP8A 1QQ4A 5FL7D 5A2MH 4AYYB 4FUEA 1KTSB 2Y7ZA 4WF8A 4KP0A 2Y80A 2SGQE 2BY9X 1FV9A 4X6MA 3URDA 3EQ0H 4WWYA 2HLCA 4CH2B 1TMBH 1IHSH 1KY9A 1MMJN 3VG8A 2EY4C 1Z1IA 5I25A 3SNCA 4FU8A 2AHME 3SV9A 1K22H 4UONA 3UB0A 1JBUH 3K9XB 1BB0B 3RXFA 3S0NA 2O8LA 1O3CA 5BPEA 3ESTA 1SGYE 2BVSH 2FP7B 1BUIA 1T7CA 2QGRA 1TGSZ 2A7CA 2ZIQH 1QHRB 3V12A 2KCYA 2AMPA 1LQDB 3BEFB 2J95A 1N8OB 4X2YA 3FANA 1CE5A 1OOKB 1DFPA 3BTHE 1W13U 4I8LA 1V2WT 4LK4A 3AASA 1TNLA 1AUTC 1C2EA 4ISNA 1CT2E 2ZDKA 5HIYA 3TJOA 1QB1A 4BANB 3UAIC 1O31A 3RXQA 1SG8B 1O3BA 1V2OT 4IC6A 2PKAB 1XXFA 1MTNC 5JB8S 1VZQH 4JZ1A 4WMEA 3U1IB 1ZTLA 4JZIA 2C8YB 1C2MA 3SNDA 3SU3A 1P01A 4BTUB 3PRDA 1JRSA 5A0AE 3BTEE 8LPRA 4YT6H 4LZ4B 2VINA 1ELTA 3SUEA 3V13A 4Q7YA 3L33A 1G36A 2XYAA 1SLXB 4H6SB 1QTFA 1K1PA 2BX3A 1C1WH 3MNCA 2Y82A 1FLEE 4KGAA 2ZQ2A 3OYPA 4K2YA 3PWBA 1O2RA 1ZTJA 1ZJKA 5A8YA 4FUDA 1ZRBA 2ZHWH 2GMTC 3MO9A 2FOHA 5CDFE 1DUEA 5F03A 2HVXA 2OC8A 4DY7B 1TNGA 2GCTC 1S6HA 3ZV8A 2PR3A 3KQ5A 2YNAA 1DY8A 2AMQA 4JYUH 2J38A 5ABWA 4CR5A 4OGYA 1RRKA 1A5IA 1ZSJA 1C5QA 1J8AA 5I46H 1GL0E 2BB4A 4AX9H 5FXLA 4E7RG 4TYDA 2WPDD 2ZDLA 4GLYA 4IC5A 1EAIA 4Q7ZA 1GBIA 2W6ID 2B0FA 3P95A 1GHAF 5ESBA 1ANDA 1KSNA 5CE1A 1JWTA 3SV2H 1VR1H 3PMJA 1E35B 1RIWC 4D9RA 1HV7A 1MKWK 1CBWB 2A2XH 2W5EA 1UO6A 2BD7A 2XNIA 3PLPA 1KLTA 4AOQA 1P2NA 1ZSLA 2BLOA 2HGTH 2VIDA 5EJZA 3SUDA 3SJIA 3EA9A 1AKSB 3KIDU 1C4U2 3KEEA 2FDAA 1DE7H 2ZPSA 1L2EA 2ZEBA 1W0JD 5AFYH 1P12E 3MH5A 1UTQA 2PP6A 4NSVA 1L1JA 1GBLA 1MCVA 1HUTH 1A0JA 1S85A 3RMLH 1TOMH 4ABBA 1GBFA 1AFQC 2A5IA 4ISLA 4U01A 1H1BA 1BHXF 5EPNA 2GDDA 4J2YB 4JCNA 4CR9A 2CN0H 2I6QA 3LGIA 2BD2A 1B0EA 1C1QA 3BG4C 1EAXA 4HG6A 1UTMA 1UCYE 4ABAA 5ESTE 1LHEH 1O34A 1G3EA 2VNTA 3RC6A 4ISIH 1UMAH 1KIGH 1GBKA 1MTWA 4ZROA 2EC9H 1G30B 4NIXA 1BRUP 1O2PA 4K8BA 1W10U 2FXRA 4OGXA 1BBRK 1FY4A 3FP6E 1G9IE 2R0LA 3SGAE 2ODPA 1PPCE 2BD4A 2BMGB 2YMSB 4X8VH 1F7ZA 1S84A 1XUHA 1TNKA 4MPWA 3GCHC 1GBCA 4BOHA 2CMYA 2VWLA 3DSGA 1JOUB 3LGUA 1TALA 2RA3A 3GY8A 3GY2A 3W94A 1UVOA 1O3LA 2OQ5A 2KR7A 3SV6A 3KF2A 2KZ4A 3TNSA 1CHOF 4CHAB 3ZVEA 2FS8A 2WV4A 1A4WH 1L4DA 3A83A 2H9TH 2OK5A 4YOIA 1SGIB 1P04A 1SSXA 2XNDD 3IG6B 4YLQH 3RXRA 2FWWA 2Z9IA 1FIWA 2ZPQA 2ANKH 1ETTH 1DT2A 4NZLA 1T4UH 2Z9KA 2QF5A 2R0KA 1EOJA 1YPHC 3KL6A 5IK2D 2GJGA 1Z6EA 1WSSH 2GDEH 3A81A 4YOGA 5F8TA 1LVOA 3P6ZB 2GZ8A 1SLWB 3DFLA 1IQMA 1GMDG 1TPOA 2ODYB 3AAUA 4YLUA 1GVLA 3NZIA 1TOCB 1MKXH 2FZZA 1BCUH 4X8UH 2G4TA 3E8LA 2CHAC 1GBAA 5CHBA 3BF6H 1AB9B 4BNRA 4AGJA 4X2WA 8GCHG 1FNIA 4JZFH 3BG8A 1GI1A 1GJ4H 1NS3A 2ZO3H 5EOKA 1TABE 3E1XB 2BLQA 1C2JA 3A89A 3PTBA 1L1NA 3SUFA 1GPZA 2AH4X 1AY6H 1H9HE 3URCA 3AW0A 3L6PA 2P16A 3QUMP 1NFYA 2WINI 1Y8TA 4B76A 1T32A 4J1YA 1QQUA 1SHYA 2Z3DA 2ZQ1A 1EX3A 4MPXA 5L2YH 2BD5A 2Y5HA 4ZHMU 1BJVA 3F68H 3NPSA 1GI8B 3VGCB 3VPKA 2B5TB 2V3OH 5E0JA 1DUAA 1O2TA 1INCA 1O2WA 1GJCB 1GCTB 2VIWA 2HNTF 3F9EA 3RU4E 4UFDH 1YBWA 5EIYA 1WBGB 1NT1A 1NFUA 3RMMH 4WY3A 2FLBH 1O5GH 2PTNA 1DDJA 3RLWH 1G3CA 1V2ST 3DUXH 4FUFA 2QN5T 2Z6BD 2KFWA 2XBYA 2F91A 4MQAA 1PQ8A 3GCTG 5FAHA 2FI5E 4AB8A 4ABIA 1V2RT 3E3TA 5FPTA 1WTHD 1C1VH 2Y5GA 2FEQH 2G52A 1F0RA 1J14A 1Y3XA 1FN8A 1G2LA 5G4BA 2F3CE 2ZGCA 1YCPK 4BAHB 6GCHG 2D8WA 2VWNA 3DD2H 1NRRH 3H7TA 1DPOA 1SGPE 4F55A 3ZYEA 1M9UA 4H6TA 1VITF 1G37A 2W26A 3I29A 3BTGE 4PROA 1UVTH 1P03A 2Z3EA 4UFFH 1UK3A 2ZDVH 1W12U 2QCYA 4Y7AA 2KAIA 3GY4A 2HVYB 1EZSC 1UJ1A 3GICB 1DS2E 1EPTC 5KECA 6CHAB 2PV9B 1UVSH 1ARBA 5GJ4B 1NY22 1L0ZA 3RXMA 2BVRH 3GYMA 5AHGH 3NRLA 5JBBS 3UR6A 4FXGH 1DOJA 1VITG 1UHBA 3ATIA 1Q3XA 3ZZ3A 1P2IA 3RXVA 3KN2A 3E91A 1SPJA 3N99A 1HNEE 4JMYA 4IS5A 1W2KH 2FI4E 3FAOA 3TK5A 3D49H 1HBTH 1ANCA 1EJAA 3LC3A 2Q6FA 3FP7E 5FCKA 1GI4A 1B5GH 4XSKU 2F9BH 2ZFSA 1HAGE 1E38B 1H8DH 3OY6U 1AE5A 3PRBA 1WQSA 1O3EA 2OBOA 2O8MA 3RM0H 3RXJA 1CU1A 1EOLA 2ANWA 4DIIH 3LGVA 1LVBA 5CHAB 4RKJB 1CVWH 2CV3A 2AFQB 3EE0B 2OC7A 2ILNA 1E37B 1GHZA 1O2OA 5B6LA 5GWZA 1WDIA 4B74A 1BHXB 4YM9A 3OFND 1HYLA 3M5MA 1SVPA 1K0HA 3AK5A 1UTNA 1VJ9U 1O2UA 2GCHF 3SNEA 1BRCE 2OINA 2H9HA 2KCOA 1LVMA 2J4IA 2A45B 1W11U 1H9LB 2GZ7A 3U9AH 1FPHH 3LDXH 1XUGA 1O5AB 3UNQA 2PKSB 2V3MA 1NC6A 5T3HA 1C2IA 5DK1A 8KME2 1YPGH 4Y6DA 2P95A 1BTPA 1D9IA 2A4GA 1E1QD 2A5KA 3E0NB 3OAAD 4VGCB 2C8WB 3P8OA 4GCHF 1KLJH 2SNWA 5C0TA 1ELGA 1E0FD 5JYIA 2GGVB 3E90B 4X6NA 5E0GA 1C4V2 1O0DH 1O5BB 1GCDA 1PPBH 2Z3CA 1IQLA 2HNTE 1ZTKA 1SFIA 1WTGH 2OUAA 1SQOA 5JBCS 2A4QA 2RA0A 3NXPA 1BMAA 2O8WA 1GMCG 1C2FA 1EJNA 4NGAH 3PLKA 4KELA 1TNJA 5KEDA 5DP9A 4ISOA 6ESTA 1TIOA 1OP0A 1K1MA 4Y71A 2C8XB 5E2OA 1TX7A 3ATKA 2GVFA 2HRVA 3PV2A 2ZFPH 5CMXH 1C1UH 1ELCA 4FETA 3FVFB 3FZZA 4IMZA 5FPYA 3D62A 5DP8A 1Y3YA 3GCNA 4YXWD 4INLA 2QAAA 5A09A 3ZZ5A 2F83A 4DURA 1YYY1 3NWUA 2IN2A 3PB1E 4I8KA 5DO4H 3ELAH 3A8DA 1TBRH 1YCPM 1GG6B 1LPGB 1VCQA 1VGCC 1PQAA 3TJVA 1Y3UA 3A88A 3ENSB 4ASHA 1BRAA 1GDNA 3E16B 3V7TA 3A82A 1ZLRA 2P8OB 1SGRE 1O2SA 4OS4A 1HAYB 3C27B 2STAE 2UWPA 1MTNB 4ABJA 4ZCNA 1CA0C 4UDWH 2FOAA 2KCPA 5GIBA 1LVYA 1KDQB 1QA0A 3ZZ8A 5PTPA 1HIAA 3NK8A 2CK3D 4YOJA 2V7QD 3B9FH 4ASUD 1A7SA 5C2ZA 5DP3A 4O9VA 4MPVA 3QTVH 1ZR0A 1MH0A 2J94A 2V3HH 4DOQA 2HPQH 2IOTA 4M7GA 1LKAA 4X6PA 3SZEA 1HXFH 1KYNA 2AEIH 1ZYOA 1O5DH 2JDID 3IWMA 1PPZA 1IQEA 3RXDA 1T8MA 3FN8A 2H6MA 4Y0YE 3DCLA 4I31A 1COWD 1A46H 4XBCA 2BY8X 1ELAA 2TGPZ 2NU1E 1K1OA 3SZNA 3UR9A 4KTCA 1QRWA 1QY6A 2VH6A 1YLNA 4YZUA 3F3BA 1GJ8B 1C5VA 1C2DA 1D6WA 1GI2A 3RXOA 1D4PB 3SORA 3K65B 1AWHB 4ABFA 5DSFA 1HAXB 2BXUH 2FYRA 3TK9A 1GHYH 1SGDE 1O2HA 1MZAA 1SR5C 2ZKSA 3SYJA 1O2MA 1SQTA 3KCGH 4OS7A 2BQ7B 4OS1A 2C90B 3CS7A 2HLDD 1GI0A 4DVAU 1YKTA 4D76A 2STBE 3EA8A 3EGKH 1HPGA 2D26C 1MD7A 2OC0A 2QXHA 4NCYA 2ESTE 1F0UA 1F0SA 2QXGA 1ETRH 3ZIAD 2JETC 1BJUA 1NFXA 1HAOH 2BD8A 2WPKS 1BTHH 3RU4D 2BLWA 1EASA 2OQUA 4WJG2 5C1UA 2TBSA 1O3AA 1K1JA 1N1LA 1O2KA 2BVXH 3A8CA 4NWLA 4IN1A 3A85A 3ZVFA 4FU7A 2A4RA 4K1EA 3TVJB 3ZZAA 1O33A 2FLRH 1CQQA 3MU1A 4ZH8A 1O2VA 2VU8E 2ZDNA 1C1NA 1EP6A 4HZHA 2ZCKP 1ZZZA 4Z0KA 4MLFB 1NU7B 4WVPE 1SLVB 3QDZB 2P94A 5T6FA 2C3SA 4X8SH 1MD8A 1HAHH 1GJ5H 1AFQB 2M5TA 3LPRA 4ABDA 1T31A 2ZECA 2A4OA 2QXIA 1QBOA 2ZGBH 4HGCA 1Z8IB 1V6DA 1L1GA 1RFNA 3LKWA 1DXPA 3OEHD 2Z94A 5DN6D 1QRZA 1CGIE 2K1QA 2FYQA 3KQEA 1GJBB 2ZDAH 4E05H 5ETXA 1JMOH 4NWKA 5DP7A 1ABJH 4FUCA 1FY8E 2F9UA 3Q77A 1BOQA 3STIA 2IJD1 3MFJA 1D3DB 4FOUC 1ELEE 2QF0A 1ACBE 2P3TB 4IGDA 2ZWLH 1ZMLA 1GGDC 2J5UA 3RXSA 2J98B 1O3KA 5GNDA 4UFGH 5J4QA 3TJUA 2XC0A 1LO6A 1RS0A 3WWFA 3RXUA 5A8ZA 1ESAA 1YLDA 1QRXA 1CGJE 3P17H 2H1UA 4NA9H 2FO9A 1OYQA 4OS6A 3W95A 1YCPH 1C1PA 1C9PA 3UWJH 2H2ZA 1C2GA 4XRNA 1SFQB 2BTCE 2WV9A 4NZQA 1QURH 5EQQA 3P92A 2J34A 2B8OH 4H4FA 1TNIA 2BQ6B 1NRNH 1J15A 1P2KA 2VBCA 2UUYA 2XBWA 3HK3B 1TMUH 2AGGX 1SI5H 2CHAB 3MNSA 1C5SA 1KXDA 3KGPA 1VITH 1PJPA 1BMFD 4X1RU 3BV9B 2PKAA 1SGCA 1V2QT 4MVNA 1AQ7A 2K8IA 3BTKE 2W7SA 1S0QA 5GPIB 1O5CB 3MH7A 1PQ5A 5EJ1A 1IQGA 1GI5A 3GY5A 2W3KA 3HK6B 4B71A 4X1PU 3PMHB 2A2QH 1O36A 1FXYA 3PM3A 2Q6DA 1N6YA 1NN6A 1C1SA 2JKHA 1Q2WA 5IDKA 2ODQA 2Q6GA 4TSFD 3SI4H 1EKBB 2K0QA 1U6QA 1LHCH 2QY0B 3CP7A 3SBKA 4MG3A 1YPMH 4TWWA 3S9BA 2B9LA 3RXHA 2PGQB 3T29A 1C5ZB 4O03A 2ZGHA 3MI4A 1KXEA 4K3JA 1Q31A 2CGAA 2SGPE 3S7HB 3MO6A 2EI8A 5H4IB 4RT1A 1CSOE 1IQFA 2R3UA 3QGJA 1FY5A 1NRQH 3A8AA 1OYTH 3LGWA 2QC2A 3RXTA 2C8ZB 4NA7A 4I33A 4YESB 7GCHG 1V2JT 3U8TH 4ZAEA 3TH2H 2B7DH 4O97A 1HJ9A 2PGBB 1AVXA 3SV7A 3JZ1B 2G81E 4I7YH 3SHCH 4B1TA 1RTLA 4K60A 1GMDF 1ZRKA 4DW2U 1CGHA 3F6UH 2HWLB 3RXKA 3SQEE 4AYVB 3RC4A 3I77A 4X1SU 4CRAA 1EZXC 2BXTH 3P8FA 4ZKNU 3ZZ6A 1QCPA 5JPMH 1O3MA 2JH5D 1J16A 1P9UA 3QLPH 2QIQA 2Z9JA 2JH0D 1BQYA 1WV7H 8GCHF 1P0SH 3A7TA 2EI7A 1YM0A 4ZHAA 2BD9A 3F2HA 3BTFE 1TAWA 2LELA 4F49A 1SQRA 2H9EH 3PWCA 4NIYA 3M5LA 1EPTB 2SFAA 2WUBA 5FBIA 1AIXH 1AKSA 4ZXYH 1FPCH 1BMMH 3AAVA 4K1SA 4GHQA 3LC5A 1DANH 3DSOA 2FOMB 3TH4H 1ORFA 1DWBH 1UTPA 1ZOMA 2VVUA 5EODA 3RMNH 3ZZ4A 2O8TA 1ELVA 1K1LA 1G2MA 4Y76A 2ZZUH 1V2MT 2BZ6H 2FOCA 3VXFH 1BDAA 4ABGA 3QWCH 4Y8XA 1P2QA 2JJ1D 4A1XA 1HLTH 2WPIS 3U1JB 3PMBB 1DY9A 3T2NA 3PYHA 3QN7A 3B8JA 1XUFA 2A7JA 1EAWA 2AIPA 4NIWA 4CRGA 3A8BA 1QFKH 2FM2A 1XMNB 1GVKB 4CRBA 1MZDA 2LPRA 5HM2A 2XC4A 2V6NA 2BDYA 4AORA 3F1SB 3GCTF 5EGMA 1TLDA 3TGIE 2A0QB 2IPHA 1TGBA 5FX6A 2AERH 1W7GH 3BTTE 3TGKE 1ZGIA 2ZU1A 3GY6A 2ZU2A 3T62A 2J9NA 3FKSD 4GAWA 4ZHLU 6GCHF 1GHXH 3BTWE 5F53A 2H5CA 2I6SA 1GHWH 1P05A 1MAYA 1AZ8A 1NM6A 4FVDA 3OU0A 1NO9H 1P3CA 3M3TA 2H5DA 3OE7D 1NBME 3HGPA 4ZKRU 4RN6A 1D3TB 3O8DA 1BTUA 1TX8A 4XBBA 3MH4A 2D2DA 3PO1B 3LGTA 3DT0H 1V2KT 2GKVE 2P93A 2TRMA 1O3FA 3A7YA 3HPTB 3ZVAA 3B23B 1FI8A 3UOUA 3RU4T 1UTJA 1E1RD 3TIUA 3KQDA 1G3DA 1S5SA 1S6FA 3T26A 1HJAB 3M5OA 1G32B 2XOKD 1NPMA 4BAOB 3ZVGA 1MBQA 1K1IA 2SGFE 4K69A 2OTVA 2WZQA 1HAVB 1Y3VA 4FUIA 1UTKA 2OBQA 2KX4A 1GBTA 2ALPA 2J2UA 1V2TT 1BBRE 5A0CA 4B73A 1DWEH 4B2AA 4RI0A 4I32A 1BZXE 3LT3A 1QB6A 3SU1A 1OWHA 5JBTA 3UNSA 1C9TA 1PFXC 1TA2A 2QXJA 1KTTB 4ZKSU 2ZP0H 1BRBE 5GCHG 1F0TA 2R9PA 3A7WA 1GJ6A 1EAUA 2VIQA 1FMGA 5IYTA 4AC9A 4A5TS 2G8TA 2A1DB 3A7ZA 2V35A 3BIUH 2BM2A 5TCCA 4X1NU 5HYOA 2A31A 2JH6D 2BHGA 5A0BA 4THNH 4MNYA 2ZHQH 4K5ZA 1YPEH 1GBBA 1DVAH 1WXRA 3F2FA 1DWDH 4Y10E 2W7UA 1HCGA 1AVWA 2PSYA 4TY6A 2FX4A 1YLCA 4UD9H 1JXPA 3I78A 3TU7H 2ZC9H 3BIVH 1GJ9B 1OWJA 4Y79A 4E7NA 1FY1A 5J4SA 3KYFA 2ZPRA 1FJSA 1SKYE 2JIZD 1HRTH 4O3TA 1NRSH 3QGNB 4RKOB 3SJKA 2TGTA 2Z7FE 1IAUA 1RTFB 2FODA 1HXEH 1DXWA 4A7IB 3VGCC 3ZVDA 4INKA 3TK6A 1TQ0B 1BTZA 3CNRA 3CENA 3T28A 1D3QB 4AZ2B 2WUCA 1FX0B 2THFB 1CA0B 6LPRA 3GY7A 3U98H 1GCTC 1AHTH 2GTBA 2ZA5A 5HKKD 3MH6A 3SI3H 4ABEA 1O2LA 3LIWA 5BRRE 4FUJA 5TCAA 3SU5A 3RXIA 1O3JA 2LP6A 3RMOH 3NKKA 1WU1A 2L74A 5K0HA 2VIVA 1A0HB 2PW8H 1C5WB 4CH8B 4ZKOU 3KHVA 2YMSD 3O8BA 4R8TB 1F92A 1O2ZA 3Q3YA 5LH8A 1OXGA 2P3FH 1TRMA 1IQKA 1P10A 4K8YA 1O35A 1RJXB 1GMCF 1HAVA 4GSOA 5HIZA 1KXBA 3SU4A 1NROH 2AGEX 4OS2A 1MBMA 2F4LA 2F9OA 5AVDA 3S69A 2FOBA 3Q3XA 2FOEA 1BMNH 4JYVH 1Y59T 2SGEE 4DGJA 2O8UA 3MNBA 1AN1E 4TT3D 1H8ED 5DJ7A 3GS9A 3A7XA 4Y0ZE 1OP2A 2DE9A 3MNXA 7LPRA 1MKXK 1QIXB 2AMDA 4I8JA 2OC1A 4WXIA 2ZCHP 3Q00A 4F48B 1W3CA 1C1OA 3S9CA 2WSSD 3VB7A 2FPZA 1AO5A 1EJMA 1H9IE 3R0FA 1DX5M 3STJA 3E6PH 2FIRH 1ARCA 1QB9A 1SGNE 3UY9A 1DLEA 1WQVH 1HAIH 2ZNKH 4YO9A 5FX5A 1YC0A 1O30A 2FOFA 4MTBA 1OWIA 3LH3A 4R0IA 4BTTB 3A87A 1Y3WA 1GBHA 1LCYA 3UIRA 1ZMNA 2XWAA 4X1QU 1O2YA 1QJ1B 2TGDA 3RXPA 1C5YB 1MKWH 1C5NH 1N6XA 2ZHFH 3BTQE 4AN7A 1EFRD 1EZUC 1W0ZU 1P2OA 3OSYA 1T8LA 5C67A 1GBMA 1LTOA 3T25A 3M7UA 9ESTA 1W8BH 1DITH 1ETSH 1O3OA 2F9VA 3EYDA 3H7OA 1IOEA 5SGAE 3N7DA 1AVGH 2ZFQH 3KQCA 2FX6A 5B6OA 1SB1H 4OM9A 4AFZA 4WH8A 2TIOA 3ZZ9A 3O8RA 4MDSA 4WMDA 1C5TA 2IJOB 2Y5FA 1GDQA 4RSPA 5C1YA 3ZZBA 1KXFA 1BT7A 3RC5A 3NUMA 1XKBC 2Z9LA 2QF4A 1QL9A 1DWCH 1GI7B 3VB3A 4DJZB 3DHKH 2ALVA 3GISB 4GUXA 2CJIA 1B0FA 3FO8D 1HB0B 3TITA 1F2SE 3ODFA 1ZMJA 1ZHMA 8ESTE 3D65E 4UFEH 3H09A 2G00A 2C93B 1P11E 4B6FA 2ZHEH 1SQAA 5GXPA 2RFKC 1CT4E 1TWXB 2PLXA 2GMTB 2GZ9A 3RLYH 1O2JA 2ULLA 2PKSC 2VGCC 1BBRH 1FQ3A 2GCTB 1EXFA 3PV4A 1GGDB 1OWEA 3SO3A 3M36A 1TA6A 2PUQH 4VGCC 1SBWA 1QJ7B 1H4WA 3F9FA 3N7OA 2XXLA 1Z8RA 5AF9H 3M7QA 1ELBA 1HDTH 1WYKA 4F4OC 2AIQA 2GD4B 2WPHS 1SHHB 4ISHH 3SJOA 4KTSA 1C4Y2 3RXBA 2OP9A 3BEUA 4CREA 1ID5H 4JK6A 1V2NT 2V0BA 1W14U 1FDPA 5DKMA 1RIWB 1ELFA 1RXPA 1KLIH 1QBVH 2VIOA 3U69H 2C4FH 3MHWU 1UK2A 1RGQA 4DG4A 1OS8A 1NRPH 3MU4A 1P06A 3F9GA 1P9SA 1XKAC 1UCYK 3HKIB 1TRNA 3FP8E 4BTIB 3OTJE 4IMQA 3ATWA 3MMGA 4MNVA 1K1NA 4ZMAH 3M61U 1P2MA 2ZCLP 1AI8H 2FTMA 1MTVA 1YPLH 1NTPA 1PYTD 1E79D 1GHBF 1TFXA 1KDQA 1YPHE 1RD3B 1TGTA 5C3NA 2J97A 1C5MD 1NBMD 1GG6C 3SU2A 1HFDA 4AFSA 4XE4A 3VFEA 4A1VA 3WY8A 2BY7X 1SL3A 3M3VA 2GT7A 2ZGJA 3BG4B 2CXVA 2P8OC 2VB0A 4HI3A 3UQVA 4K1TA 1P2JA 1GJ7B 3RXCA 2ZG0H 1GHBG 3BTME 3QZRA 1FIZA 4Y8ZA 1ESBA 1BA8B 4D9QA 2BDHA 3RXEA 2BX4A 1FY3A 2BY6X 1SMFE 3PROA 4U32A 1MU8B 3BN9A 1CT0E 1AD8H 1MABB 2ZHDA 1PQ7A 1S81A 2HNTC 4U30A 3TLOA 1AUJA 1KMHB 2XRCA 9LPRA 2OD3B 4U2WA 3ZZDA 3AVZA 4NA8A 4INHA 4CBNA 3GCHB 1T8OA 5FCRA 2WYJA 1O2QA 1V2UT 4X2VA 4AGKA 2Q1JA 1K21H 1NESE 1UTLM 1A1RA 4BAKB 1A5GH 1O32A 2YOLA 2VJ1A 5HMAA 4A6LA 1ANEA 3DA9B 3BTDE 4JK5A 2XCNA 1XUIA 1V2LT 3ZV9A 3SNBA 4Q63A 3MQKC 2NWNA 1QBNA 3TNTA 3Q3KA 3UQOA 3T5FH 3Q76A 4A1TA 5C5NA 1YPJH 1ZHRA 1C5LH 2IPQX 4JYTA 3LU9B 2J92A 4E06H 1A5HA 3SV8A 1S6LA 3A7VA 2XTTB 3C1KA 1GI9B 3SNAA 1XUJA 5DGJA 3ODDA 3F0OA 4BXWA 1BTWA 1L4ZA 2XBVA 1A61H 1S82A 1QL8A 1THSH 2ZI2H 1D3PB 1AZZA 2XCFA 3A80A 1C5RA 1K28D 1LPKB 5DP5A 3QX5H 1O3NA 1T8NA 2RCEA 3SHAH 1UVPA 3MU8A 3F9HA 4XD7D 1P09A 3M35A 3GDUA 1EATA 1QL7A 2VWOA 1ESTA 1SOZA 1N8OC 4P02A 3EE7A 3UWIA 2D1JA 1TRYA 2OXSA 4MNXA 1GDUA 1TQ7B 2Y7XA 1LPZB 2O9QA 1GHAG 3MTYA 1BITA 4H42U 3SOSA 4YT7H 3SUGA 2FTLE 3HGNA 3VB5A 1OWKA 3OX7U 4QT8C 1VJAU 1BTYA 7KMEH 1BIOA 1FN6A 2LNCA 2XW9A 1TGNA 2BOHB 2VWMA 1NU9A 4SGBE 5E2PA 3MWIU 5C5OA 1TPAE 3BEIB 4GVUA 1P3EA 1Z71A 7GCHF 2BD3A 1OKXA 1O3HA 1GBJA 4P00A 1TNHA 3K6ZA 2TPIZ 3WW7A 2QA9E 2HPPH 2CF9H 1OHHD 2QF3A 1NZQH 5F8XA 1ZPZA 3K2UA 2FOGA 2PHBA 1TMTH 4BAMB 4AB9A 3VB6A 1GJDB 2ZF0H 3OY5U 1SC8U 3TPIZ 5GDSH 5HM9A 4CRFA 2J98A 3OEED 4XFQA 1ANBA 1E34B 4AG2A 2ANYA 2SGDE 3DFJA 1MAXA 4MNWA 5FBEA 2EEKA 1IQHA 5L6NH 3EDXB 4HTCH 2P59A 1FUJA 1TBQH 4WMFA 1X7AC 2QE7D 2A7HA 2ZGXH 1IQIA 1YPKH 1TONA 1HGTH 1OWDA 1G3BA 1DICA 3LONA 3OTPA 1TYNA 4XBDA 2W3IA 1Y5BT 1W7XH 2GT8A 1ZPBA 2GX4A 3ATMA 2UUKB 5EG4A 4Q7XA 1FAXA 1RTKA 2DE8A 1JIMA 2BDBA 1Z1JA 1C5PA 1TPPA 2FESH 2ANMH 3UUZA 4CRCA 5F8ZA 4M9FA 1LHDH 2PWXA 2ZFTA 3LH1A 1ZPCA 1O5FH 4SGAE 1THPB 3JZ2B 4FU9A 1O3PB 4B75A 4I8HA 3ZVBA 1Y5AT 1C2HA 3MYWA 1E36B 3ATLA 1S83A 4Y8YA 4TWYA 3KNXA 1CBWC 2G4UA 2VVVA 4UE7H 1CHOG 1O3IA 5L30H 3RXAA 2ASUB 2DUCA 2KAIB 1AE8H 4DT7B 2BDAA 5C17A 4JZDH 5DP4A 2ZU4A 4ZXXH 1GJAB 1QZ8A 1YP9A 2ZFRH 2CF8H 1MQ5A 1SGFA 3VXEH 2BDGA 3S9AA 1UHBB 2R3YA 3W1EA 1EP5A 4I86A 1XVOA 1H8HD 3K6YA 2G5VA 1MQ6A 1C1MA 1DSTA 1A3EH 3P8NA 5E0HA 1V2VT 1XM1A 4MPUA 2ZFFH 3M3SA 2G55A 3GYLB 3SJ8A 2F9NA 1P57B 3E0PB 1BTXA 3GOVB 1GMHF 1ZGVA 5A8XA 2OCVB 3TJNA 2TGAA 2PUXB 1UK4A 2KM0A 4Y11E 1UVUH 1SGQE 2BY5X 5JBAS 1MU6B 2KCAA 2NU4E 2Y6TA 3LGYA 5DPAA 1T4VH 3HKJB 3SGBE 1P02A 1SGTA 4OS5A 2RDEA 3M37A 3PMAB 1C1TA 2R2WU 3N7EA 1GMHG 2YMSC 3U8OH 1EZQA 4FUGA 1GBEA 1GHVH 1K2I1 2P3UB 3EA7A 4X6OA 2UWLA 3MU0A 1W0KD 4NFFA 1LDTT 1J9CH 3QO6A 3RP2A 2FS9A 1S0RA 1ABIH 2ZU3A 4KKDA 4Y7BA 2QYIA 5C20A 1W0YH 5GCHF 1UTOA 1TPSA 3ZZ7A 4CHAC 1SOTA 2L6OA 3RM2H 3TH3H 1V2PT 1AU8A 1O38A 2A5AA 2YNBA 1Z6JH 1EPTA 4CRDA 3RXGA 5EXMA 5EXLA 2BQWB 5HGGA 1CA8B 2PSXA 5T6GA 1Z8JB 3TGJE 5T6DA 5EXNA 3P8GA 4LZ1H 1OSSA 1A0LA 1YWUA 4NIVA 2GP9B 1O3GA 4FUBA 5EQSA 1Z7KA 3F0PA 4BXSA 2GV7A 2RG3A 5C0UA 3G01A 7ESTE 1YF4A 2WPJS 5C1XA 1TBZH 4KTUA 3SJ9A 3QK1A 4BAQB 1WOFA 1GBDA 2ZU5A 1DSUA 1ELDE 3ZVCA 4Q4LA 3UNRA 2AYWA 4IW4E 2F43B 2BDCA 1EUFA 2SNVA 4YTAA 3U8RH 4O3UA 2NU2E 1AB9C 1UW7A 4D8NA 2AS9A 2R2MB 1JIRA 1FONA 1SLUB 2G51A 3M5NA 4NFEA 2NU3E 1F5KU 1GWAA 2WPMS 4I8GA 1J17T 2EI6A 1DM4B 5KGOA 3UREA 5HXFA 4NG9H 2UUJB 1HJ8A 1PPEE 1OPHB 3HATH 4DIHH 4WH6A 1ZHPA 1VGCB 4JZEH 2AGIX 3MO3A 5LPFA 1MTUA 4TPIZ 5DP6A 4Z6AH 5EPYA 5JB9S 3SQHE 1QJ6B 2PFEA 1XXDA 1UCYH 1O37A 1GI6A 1TGCA 2M2AA 4A92A 5F6MA 4Q2KA 3VB4A 1IHTH 1GL1A 1O2GH 1IQJA 1Z8GA 3WWBA 5C94A 5LPEA 3ITIA 1MUEB 5EU8A 1LKBA 1ZJDA 1MTSA 2FI3E 5EJLA 3SW2B 5FPSA 1BMLA 5EW1H 2BDIA 5E8EH 2QV1A 1QR3E 2BLVA 1O39A 1HIAB 3D23A 4B6EA 1YY3A 3GY3A 3PO1C 3F2GA 1O5EH 1TX6A 1YGCH 1HAPH 4LXBH 1LHFH 1NFWA 3S7KB 1MCTA 2VGCB 4ACBA 2HOBA 1XVMA 3ZYDA 1EQ9A 1B7XB 4Q80A 3A86A 2EQNA 1TE0A 2GCHG 4RT0A 1A3BH 1EB1H 1HJAC 2GV6A 4GHTA 2BZAA 5K7RA 1O2IA 5TJXA 1O3DA 3SU6A 1D6RA 2PTCE 3LJJA 1P8VC 1PPGE 3UTUH 3PLBA 1KXCA
chains in the Genus database with same CATH topology
3V3MA 3SGQE 3T27A 4XOJA 3LJOA 3GDVA 1AGJA 5EQRA 6CHAC 3RUOA 1WAYB 1F5RA 4CBOA 4NSYA 4UEHH 2WV5A 3FZDA 1LHGH 3ZZCA 4IN2A 4B2BA 1TB6H 2FMJA 2G5NA 2UWOA 2WPLS 2SGAA 4AFQA 1JRTA 3MOCA 3P70B 1QNJA 4GCHG 4FUHA 1QA7A 3BSQA 1IQNA 3RDZA 3IITA 2RDLA 2OLGA 3O8CA 2VVCA 2JETB 2XC5A 1AWFH 5L2ZH 1PPHE 2Y81A 1LMWB 3KQBA 1AMHA 2XWBI 2XBXA 5AFZH 1VCWA 1PYTC 2WYGA 3UPEA 1LQEA 2ZTXA 3V0XA 1C2KA 4GPGA 1Y5UT 2ZTZA 3GDSA 1O2XA 2F9PA 5CHAC 3QZQA 4D7GA 3H5CB 5EW2H 1F5LA 3GCOA 1WUNH 1OX1A 4X8TH 4HFPB 4IBLH 1ZSKA 4TY7A 2UUFB 3RXLA 2BYAX 2BOKA 1XX9A 4AG1A 1GVZA 1V3XA 2HALA 2ZTYA 3A84A 2VIPA 2NU0E 4LOYH 2Z9GA 4XDEA 3PTNA 3VEQB 1PPFE 1SGFG 5LPRA 1C2LA 4TPYA 5DG6A 4ESTE 1A2CH 4ZUHA 1EB2A 3MU5A 4WXVA 3CS0A 3AW1A 1O2NA 1FAKH 1KXAA 3EAJA 1HAZB 4ABHA 5JDUB 3NCLA 3QTOH 4AFUA 4DCDA 3L3TA 1VCPA 4X0WU 1WCZA 1C5OH 4B2CA 1C5XB 1CO7E 3UOPA 4D7FA 1SGEE 3SU0A 1H8IH 1GI3A 1C5UA 1XUKA 3SN8A 4X2XA 2EA3A 1FZZA 2VH0A 2ZDMA 1QGFA 3LOXA 3M7TA 1K9OE 3UFAA 5LGOA 3R3GB 1AFEH 5FHTA 3FFGA 1DLKB 1C1RA 2A32A 4FVBA 1CHGA 1THRH 1OP8A 1QQ4A 5A2MH 4AYYB 4FUEA 1KTSB 2Y7ZA 4WF8A 4KP0A 2Y80A 2SGQE 2BY9X 1FV9A 4X6MA 3URDA 3EQ0H 4WWYA 2HLCA 4CH2B 1TMBH 1IHSH 1KY9A 1MMJN 1Z1IA 5I25A 3SNCA 4FU8A 3SV9A 1K22H 4UONA 1JBUH 3K9XB 1BB0B 3RXFA 3S0NA 2O8LA 1O3CA 5BPEA 3ESTA 1SGYE 2BVSH 2FP7B 1BUIA 1T7CA 2QGRA 1TGSZ 2A7CA 2ZIQH 1QHRB 3V12A 2AMPA 1LQDB 3BEFB 2J95A 1N8OB 4X2YA 3FANA 1CE5A 1OOKB 1DFPA 3BTHE 1W13U 4I8LA 1V2WT 4LK4A 3AASA 1TNLA 1AUTC 1C2EA 4ISNA 1CT2E 2ZDKA 3TJOA 1QB1A 4BANB 1O31A 3RXQA 1SG8B 1O3BA 1V2OT 4IC6A 2PKAB 1XXFA 1MTNC 5JB8S 1VZQH 4JZ1A 4WMEA 3U1IB 1ZTLA 4JZIA 2C8YB 1C2MA 3SNDA 3SU3A 1P01A 4BTUB 1JRSA 5A0AE 3BTEE 8LPRA 4YT6H 4LZ4B 2VINA 1ELTA 3SUEA 3V13A 4Q7YA 3L33A 1G36A 2XYAA 1SLXB 4H6SB 1QTFA 1K1PA 2BX3A 1C1WH 3MNCA 2Y82A 1FLEE 4KGAA 2ZQ2A 3OYPA 4K2YA 3PWBA 1O2RA 1ZTJA 1ZJKA 5A8YA 4FUDA 1ZRBA 2ZHWH 2GMTC 3MO9A 2FOHA 1DUEA 5F03A 2HVXA 2OC8A 4DY7B 1TNGA 2GCTC 1S6HA 3ZV8A 2PR3A 2YNAA 1DY8A 2AMQA 4JYUH 2J38A 5ABWA 4CR5A 4OGYA 1RRKA 1A5IA 1ZSJA 1C5QA 1J8AA 5I46H 1GL0E 2BB4A 4AX9H 5FXLA 4E7RG 4TYDA 4IC5A 2ZDLA 4GLYA 1EAIA 4Q7ZA 1GBIA 3P95A 2B0FA 1GHAF 5ESBA 1ANDA 1KSNA 5CE1A 1JWTA 3SV2H 1VR1H 3PMJA 1E35B 1RIWC 4D9RA 1HV7A 1MKWK 1CBWB 2A2XH 2W5EA 1UO6A 2BD7A 2XNIA 3PLPA 1KLTA 4AOQA 1P2NA 1ZSLA 2BLOA 2HGTH 2VIDA 3SUDA 3SJIA 3EA9A 1AKSB 3KIDU 1C4U2 3KEEA 2FDAA 1DE7H 2ZPSA 1L2EA 2ZEBA 5AFYH 1P12E 3MH5A 1UTQA 4NSVA 1L1JA 1GBLA 1MCVA 1HUTH 1A0JA 1S85A 3RMLH 1TOMH 4ABBA 1GBFA 1AFQC 2A5IA 4ISLA 4U01A 1H1BA 1BHXF 5EPNA 2GDDA 4J2YB 4JCNA 4CR9A 2CN0H 2I6QA 3LGIA 2BD2A 1B0EA 1C1QA 3BG4C 1EAXA 1UTMA 1UCYE 4ABAA 5ESTE 1LHEH 1O34A 1G3EA 2VNTA 3RC6A 4ISIH 1UMAH 1KIGH 1GBKA 1MTWA 4ZROA 2EC9H 1G30B 4NIXA 1BRUP 1O2PA 4K8BA 1W10U 2FXRA 4OGXA 1BBRK 1FY4A 3FP6E 1G9IE 2R0LA 3SGAE 2ODPA 1PPCE 2BD4A 2BMGB 4X8VH 1F7ZA 1S84A 1XUHA 1TNKA 4MPWA 3GCHC 1GBCA 4BOHA 2CMYA 2VWLA 3LGUA 1JOUB 1TALA 2RA3A 3GY8A 3GY2A 3W94A 1UVOA 1O3LA 2OQ5A 3SV6A 3KF2A 3TNSA 1CHOF 4CHAB 3ZVEA 2FS8A 2WV4A 1A4WH 1L4DA 3A83A 2H9TH 4YOIA 1SGIB 1P04A 1SSXA 3IG6B 4YLQH 3RXRA 2FWWA 2Z9IA 1FIWA 2ZPQA 2ANKH 1ETTH 1DT2A 4NZLA 1T4UH 2Z9KA 2R0KA 1EOJA 1YPHC 3KL6A 1Z6EA 1WSSH 2GDEH 3A81A 4YOGA 5F8TA 1LVOA 3P6ZB 2GZ8A 1SLWB 3DFLA 1IQMA 1GMDG 1TPOA 2ODYB 3AAUA 4YLUA 1GVLA 3NZIA 1TOCB 1MKXH 2FZZA 1BCUH 4X8UH 2G4TA 3E8LA 2CHAC 1GBAA 3BF6H 1AB9B 4BNRA 4AGJA 4X2WA 8GCHG 1FNIA 4JZFH 3BG8A 1GI1A 1GJ4H 1NS3A 2ZO3H 5EOKA 1TABE 3E1XB 2BLQA 1C2JA 3A89A 3PTBA 1L1NA 3SUFA 1GPZA 2AH4X 1AY6H 1H9HE 3URCA 3AW0A 3L6PA 2P16A 3QUMP 1NFYA 2WINI 1Y8TA 4B76A 1T32A 4J1YA 1QQUA 1SHYA 2Z3DA 2ZQ1A 1EX3A 4MPXA 5L2YH 2BD5A 2Y5HA 4ZHMU 1BJVA 3F68H 3NPSA 1GI8B 3VGCB 3VPKA 2B5TB 2V3OH 5E0JA 1DUAA 1O2TA 1INCA 1O2WA 1GJCB 1GCTB 2VIWA 2HNTF 3F9EA 3RU4E 4UFDH 1YBWA 1WBGB 1NT1A 1NFUA 3RMMH 4WY3A 2FLBH 1O5GH 2PTNA 1DDJA 3RLWH 1G3CA 1V2ST 3DUXH 4FUFA 2QN5T 2Z6BD 2XBYA 2F91A 4MQAA 1PQ8A 3GCTG 5FAHA 2FI5E 4AB8A 4ABIA 1V2RT 3E3TA 5FPTA 1WTHD 1C1VH 2Y5GA 2FEQH 2G52A 1F0RA 1J14A 1Y3XA 1FN8A 1G2LA 5G4BA 2F3CE 2ZGCA 1YCPK 4BAHB 6GCHG 2D8WA 2VWNA 3DD2H 1NRRH 3H7TA 1DPOA 1SGPE 3ZYEA 1M9UA 4H6TA 1VITF 1G37A 2W26A 3I29A 3BTGE 4PROA 1UVTH 1P03A 2Z3EA 4UFFH 1UK3A 2ZDVH 1W12U 2QCYA 4Y7AA 2KAIA 3GY4A 1EZSC 1UJ1A 3GICB 1DS2E 1EPTC 6CHAB 2PV9B 1UVSH 1ARBA 5GJ4B 1NY22 1L0ZA 3RXMA 2BVRH 3GYMA 5AHGH 5JBBS 3UR6A 4FXGH 1DOJA 1VITG 1UHBA 3ATIA 1Q3XA 3ZZ3A 1P2IA 3RXVA 3KN2A 3E91A 1SPJA 4JMYA 1HNEE 4IS5A 1W2KH 2FI4E 3FAOA 3TK5A 3D49H 1HBTH 1ANCA 1EJAA 3LC3A 2Q6FA 3FP7E 5FCKA 1GI4A 1B5GH 4XSKU 2F9BH 2ZFSA 1HAGE 1E38B 1H8DH 3OY6U 1AE5A 1WQSA 1O3EA 2OBOA 2O8MA 3RM0H 3RXJA 1CU1A 1EOLA 2ANWA 4DIIH 3LGVA 1LVBA 5CHAB 4RKJB 1CVWH 2CV3A 2AFQB 3EE0B 2OC7A 2ILNA 1E37B 1GHZA 1O2OA 5GWZA 4B74A 1BHXB 4YM9A 1HYLA 3M5MA 1SVPA 1UTNA 1VJ9U 1O2UA 2GCHF 3SNEA 1BRCE 2OINA 2H9HA 1LVMA 2J4IA 2A45B 1W11U 1H9LB 2GZ7A 3U9AH 1FPHH 3LDXH 1XUGA 1O5AB 3UNQA 2PKSB 5T3HA 1NC6A 1C2IA 5DK1A 8KME2 1YPGH 4Y6DA 2P95A 1BTPA 1D9IA 2A4GA 2A5KA 3E0NB 4VGCB 2C8WB 3P8OA 4GCHF 1KLJH 2SNWA 1ELGA 1E0FD 5JYIA 2GGVB 3E90B 4X6NA 5E0GA 1C4V2 1O0DH 1O5BB 1GCDA 1PPBH 2Z3CA 1IQLA 2HNTE 1ZTKA 1SFIA 1WTGH 2OUAA 1SQOA 5JBCS 2A4QA 2RA0A 3NXPA 1BMAA 2O8WA 1GMCG 1C2FA 1EJNA 4NGAH 3PLKA 4KELA 1TNJA 5DP9A 4ISOA 6ESTA 1TIOA 1OP0A 1K1MA 4Y71A 2C8XB 5E2OA 1TX7A 3ATKA 2GVFA 2HRVA 2ZFPH 5CMXH 1C1UH 1ELCA 3FVFB 3FZZA 4IMZA 5FPYA 3D62A 5DP8A 1Y3YA 3GCNA 4INLA 2QAAA 5A09A 3ZZ5A 2F83A 4DURA 1YYY1 3NWUA 2IN2A 3PB1E 4I8KA 5DO4H 3ELAH 3A8DA 1TBRH 1YCPM 1GG6B 1LPGB 1VCQA 1VGCC 1PQAA 3TJVA 1Y3UA 3A88A 3ENSB 4ASHA 1BRAA 1GDNA 3E16B 3V7TA 3A82A 1ZLRA 2P8OB 1SGRE 1O2SA 4OS4A 1HAYB 3C27B 2STAE 2UWPA 1MTNB 4ABJA 1CA0C 4UDWH 2FOAA 5GIBA 1LVYA 1KDQB 1QA0A 3ZZ8A 5PTPA 1HIAA 3NK8A 4YOJA 3B9FH 1A7SA 5C2ZA 5DP3A 4O9VA 4MPVA 3QTVH 1ZR0A 1MH0A 2J94A 2V3HH 4DOQA 2HPQH 2IOTA 4M7GA 1LKAA 4X6PA 1HXFH 1KYNA 2AEIH 1ZYOA 1O5DH 3IWMA 1PPZA 1IQEA 3RXDA 1T8MA 4Y0YE 2H6MA 4I31A 1A46H 4XBCA 2BY8X 1ELAA 2TGPZ 2NU1E 1K1OA 3SZNA 3UR9A 4KTCA 1QRWA 1QY6A 2VH6A 4YZUA 1GJ8B 1C5VA 1C2DA 1D6WA 1GI2A 3RXOA 1D4PB 3SORA 3K65B 1AWHB 4ABFA 1HAXB 2BXUH 2FYRA 3TK9A 1GHYH 1SGDE 1O2HA 1MZAA 1SR5C 2ZKSA 1O2MA 1SQTA 3KCGH 4OS7A 2BQ7B 4OS1A 2C90B 3CS7A 1GI0A 4DVAU 1YKTA 4D76A 2STBE 3EA8A 3EGKH 1HPGA 2D26C 1MD7A 2OC0A 2QXHA 4NCYA 2ESTE 1F0UA 1F0SA 2QXGA 1ETRH 2JETC 1BJUA 1NFXA 1HAOH 2BD8A 2WPKS 1BTHH 3RU4D 2BLWA 1EASA 2OQUA 4WJG2 5C1UA 2TBSA 1O3AA 1K1JA 1N1LA 1O2KA 2BVXH 3A8CA 4NWLA 4IN1A 3A85A 3ZVFA 4FU7A 2A4RA 4K1EA 3TVJB 3ZZAA 1O33A 2FLRH 1CQQA 3MU1A 4ZH8A 1O2VA 2VU8E 2ZDNA 1C1NA 1EP6A 4HZHA 2ZCKP 1ZZZA 4Z0KA 4MLFB 1NU7B 4WVPE 1SLVB 3QDZB 2P94A 5T6FA 2C3SA 4X8SH 1MD8A 1HAHH 1GJ5H 1AFQB 2M5TA 3LPRA 4ABDA 1T31A 2ZECA 2A4OA 2QXIA 1QBOA 2ZGBH 4HGCA 1Z8IB 1V6DA 1L1GA 1RFNA 3LKWA 1DXPA 2Z94A 1QRZA 1CGIE 2K1QA 2FYQA 3KQEA 1GJBB 2ZDAH 4E05H 5ETXA 1JMOH 4NWKA 5DP7A 1ABJH 4FUCA 1FY8E 2F9UA 3Q77A 1BOQA 3STIA 3MFJA 1D3DB 1ELEE 2QF0A 1ACBE 2P3TB 4IGDA 2ZWLH 1ZMLA 1GGDC 3RXSA 1O3KA 4UFGH 5J4QA 3TJUA 2XC0A 1LO6A 1RS0A 3RXUA 5A8ZA 1ESAA 1YLDA 1QRXA 1CGJE 3P17H 2H1UA 4NA9H 2FO9A 1OYQA 4OS6A 3W95A 1YCPH 1C1PA 1C9PA 3UWJH 2H2ZA 1C2GA 1SFQB 2BTCE 4NZQA 1QURH 5EQQA 3P92A 2J34A 2B8OH 4H4FA 1TNIA 2BQ6B 1NRNH 1J15A 1P2KA 2XBWA 2UUYA 3HK3B 1TMUH 2AGGX 1SI5H 2CHAB 3MNSA 1C5SA 1KXDA 3KGPA 1VITH 1PJPA 4X1RU 3BV9B 2PKAA 1SGCA 1V2QT 4MVNA 1AQ7A 3BTKE 2W7SA 1S0QA 5GPIB 1O5CB 3MH7A 1PQ5A 1IQGA 1GI5A 3GY5A 2W3KA 3HK6B 4B71A 4X1PU 3PMHB 2A2QH 1O36A 1FXYA 3PM3A 2Q6DA 1N6YA 1NN6A 1C1SA 2JKHA 1Q2WA 5IDKA 2ODQA 2Q6GA 3SI4H 1EKBB 1U6QA 1LHCH 2QY0B 3CP7A 3SBKA 4MG3A 1YPMH 4TWWA 3S9BA 2B9LA 3RXHA 2PGQB 3T29A 1C5ZB 4O03A 2ZGHA 3MI4A 1KXEA 4K3JA 1Q31A 2CGAA 2SGPE 3S7HB 3MO6A 2EI8A 5H4IB 1CSOE 1IQFA 2R3UA 3QGJA 1FY5A 1NRQH 3A8AA 1OYTH 3LGWA 2QC2A 3RXTA 2C8ZB 4NA7A 4I33A 4YESB 7GCHG 1V2JT 3U8TH 4ZAEA 3TH2H 2B7DH 4O97A 1HJ9A 2PGBB 1AVXA 3SV7A 3JZ1B 2G81E 4I7YH 3SHCH 4B1TA 1RTLA 4K60A 1GMDF 1ZRKA