1FV9A

Crystal structure of human microurokinase in complex with 2-amino-5-hydroxy-benzimidazole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE
publication title Identification of novel inhibitors of urokinase via NMR-based screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 50
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fv9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fv9A01
4DOQA 1EB2A 2GX4A 3SUDA 1NPMA 1EUFA 3A80A 4X2WA 2NWNA 1G3EA 2PSXA 4GAWA 1G3BA 2PKAA 3MH6A 3P17H 1V2NT 1ELGA 2YNAA 1XUGA 3A8AA 1UCYE 1EJNA 3AW1A 3U9AH 3ZVFA 1V2LT 3BEFB 2RCEA 2HPQH 1TA6A 2GKVE 1BHXF 3S7KB 1RTKA 1GHZA 4JK5A 1Z8IB 1HFDA 2XBYA 7LPRA 2FIRH 1GI3A 1ORFA 1HAVB 2B5TB 1IQHA 3GISB 1QJ1B 5EPNA 1SGRE 1GJCB 3H5CB 4KTUA 2CN0H 1GJDB 4ABJA 1ZMLA 4ZKNU 1LPKB 1EZUC 1GJ8B 1U6QA 2PUXB 4H6TA 4DCDA 4MPUA 1MUEB 3ATIA 1PQ7A 1Y3UA 1A5HA 3TJNA 1QB6A 1BITA 1ZSKA 2FP7B 2W7UA 3ZVDA 3SJIA 1ABJH 2P3UB 2WPIS 3A87A 4Q2KA 1KIGH 1HAHH 3UNSA 2C8WB 1Z1JA 4NIXA 1LO6A 1OWJA 3SV2H 3RMOH 3SI3H 2VIQA 3SV6A 5EXNA 1Q31A 1AUJA 3N7OA 4ZHLU 1A0HB 1ETSH 4JZIA 1DWDH 3FP6E 3T26A 2QF0A 2JKHA 3A7VA 1ELEE 7GCHG 1HNEE 4JCNA 1O3JA 1A5GH 1LPZB 2BY6X 4F4OC 1KY9A 2IPHA 3LIWA 2ZGBH 2PWXA 3RXGA 2ZA5A 1PQAA 1OPHB 1GL1A 2QXHA 2STBE 1PYTC 1GBMA 2EI8A 1KXEA 1J9CH 1GJ5H 1MCTA 4KKDA 5DK1A 1YF4A 1C5SA 5F03A 1CT4E 2FZZA 3UOPA 2AH4X 1JWTA 3ZVAA 1FLEE 1V2PT 4I8LA 2PGBB 1C1MA 2G4TA 1L2EA 1C1UH 1ZMNA 5C3NA 1T7CA 1QFKH 3PLBA 1TFXA 2XBVA 1O3BA 2Y82A 3O8CA 4CREA 1DY9A 1GBKA 2BOKA 2GMTB 2A4GA 1BUIA 2ANMH 2F91A 3NZIA 3PTNA 2Z9IA 2BVRH 2GCTC 2PTNA 3K65B 1WTHD 1XUFA 1ZTKA 3RC6A 4DIHH 4ZMAH 1OP2A 4K1EA 1GI9B 3UR9A 2VGCC 5F8XA 1K28D 3SN8A 3T27A 4DIIH 1O3IA 4LXBH 4Y6DA 3OU0A 1VITG 3AVZA 1O3FA 4X6PA 1ARBA 1QJ6B 1CVWH 3L33A 4IMZA 3BTEE 1MTNC 1O3DA 4X8SH 3T29A 3B9FH 1LQDB 1UMAH 1V2ST 2ALVA 1IQKA 2FO9A 4Y10E 4MNYA 2BD8A 3GCOA 4HGCA 4UD9H 5CMXH 1GHBG 1OWIA 2GVFA 4INKA 3VB7A 3URCA 2ZU4A 4JYUH 2NU3E 3BSQA 2GZ8A 1GGDC 3RXMA 2AGEX 2B7DH 2PV9B 4CBNA 2V0BA 4BAHB 1HV7A 4NZLA 3MO3A 1XUHA 1GBFA 3ZZ9A 1FDPA 2UWPA 3PO1B 3RLWH 1H9LB 1JMOH 1ANEA 1V2QT 1SLUB 2BD4A 1A61H 1N6XA 1YPGH 3HPTB 1O31A 1W7XH 4J1YA 4THNH 5ESTE 2R0KA 2O8WA 1W13U 1PJPA 5SGAE 1VITH 1BOQA 3BG8A 1P05A 4NSYA 3ZVCA 4D7FA 1O3MA 1THSH 3ENSB 3MH7A 4DT7B 3RXLA 3RU4E 1CT2E 4WJG2 2I6QA 4TWWA 3EAJA 2BZ6H 2TIOA 4TPYA 4HFPB 3SGQE 1D3PB 2G81E 2H9HA 3K6ZA 3FP7E 1XMNB 1OKXA 1KLTA 4CRAA 3SU5A 1LHCH 3ITIA 2TGDA 1AB9C 4K1TA 5I25A 2P59A 3A7TA 3M5NA 3KIDU 4ZHMU 3LC3A 1AQ7A 2Z9KA 5FBEA 1GJ9B 4AOQA 4DGJA 1S81A 4RN6A 3O8RA 1E36B 1QCPA 1TOMH 5GCHF 2Q6GA 3SJOA 1UVPA 1KTTB 2A2XH 3KQEA 1LHDH 5ABWA 1GJAB 2PSYA 1UCYH 1TRYA 4R8TB 3W95A 1GG6C 4ZKSU 1QA7A 1QY6A 2VH0A 2XXLA 2Z7FE 3ZZ8A 3SHCH 1UVUH 4B1TA 2AIQA 4HTCH 3E1XB 1OP8A 3LDXH 4AYYB 2LPRA 3EYDA 5FCKA 2OLGA 3QUMP 5L2YH 1FAKH 1A3BH 1DE7H 2ZG0H 3DFJA 1UK4A 1WYKA 1BTUA 1O2HA 5E0HA 2V3HH 2BXTH 2XTTB 2ZTYA 1P57B 1QRXA 1QGFA 2QXJA 1MU6B 1O5GH 3VFEA 3RUOA 4MDSA 1SOTA 1PQ8A 3RXKA 2O8MA 1KXBA 1E37B 3K2UA 1HBTH 2A31A 1W14U 3BN9A 4JMYA 3RM2H 1ARCA 4IMQA 3I29A 1O2JA 4Q80A 3UY9A 4HI3A 1SGIB 1ZOMA 1YM0A 1C5PA 2IJOB 3RXRA 1HJ9A 1L4ZA 1W11U 1UCYK 4R0IA 1NFXA 1TMUH 2P94A 3SO3A 3ZZCA 1YBWA 2ZGHA 3ZVBA 2XBWA 1P09A 1FMGA 3QLPH 4AN7A 1QQ4A 2XCNA 5FPSA 3A8BA 2Z6BD 1CE5A 3M7UA 3PYHA 1F0SA 1TABE 4IS5A 3NPSA 2Q6FA 1HPGA 2TPIZ 3Q77A 3PLKA 1C5QA 2A4OA 3TH3H 1F5RA 3AASA 3UWJH 1DDJA 4FXGH 4WMEA 5LH8A 3ODDA 1GCTC 2ZEBA 1ZR0A 3KEEA 1KLJH 1UK3A 4CR5A 1AZ8A 2PKAB 1P10A 5CE1A 1GBEA 2QN5T 4BNRA 1CBWB 5E2PA 2BLWA 2WPKS 1ESBA 1YPHE 3OX7U 4CR9A 2ZQ1A 1C4Y2 2A1DB 5EQSA 1PPEE 2BDCA 3KN2A 4TPIZ 2XBXA 5T6GA 3RXCA 1P2OA 2STAE 1C1WH 1A4WH 4D8NA 5CHAC 1H8DH 2BD2A 3RMLH 1GI8B 3UNRA 2P93A 1KDQA 3R0FA 1C2EA 4A1TA 1S85A 1SVPA 5F8ZA 2FX4A 1TX7A 1C1SA 3SV7A 1GL0E 1TBRH 3HK3B 1O32A 1DLKB 4OS1A 4VGCB 4WMDA 4B75A 4BAOB 1XKBC 4YZUA 1HAXB 1LVOA 4LZ4B 3TJUA 3LOXA 3TLOA 2ZFPH 1PQ5A 1E38B 2ZHDA 2ZDAH 4ZAEA 2ZDKA 1WAYB 4GUXA 4X1RU 4X0WU 3ZZBA 5HMAA 3V13A 2VINA 1A7SA 5JB8S 1Q2WA 1FNIA 3T62A 3MU8A 3PMJA 3B8JA 4Y79A 2BD3A 4ZXXH 4GPGA 1IHTH 2FOHA 1GJ6A 3EQ0H 2H6MA 3P95A 2BDAA 3ZZ5A 1E0FD 1S84A 3SHAH 4YO9A 3MU4A 1ANBA 2HOBA 1C5VA 2Y81A 4XSKU 1NU9A 1EKBB 1HAPH 4INLA 1B0FA 1RIWB 5HM9A 5EG4A 2AGIX 3CS0A 4WVPE 4B74A 5A09A 2ZCHP 5HM2A 2C8ZB 2FWWA 5AFYH 1P11E 2FM2A 1ZJDA 4BXSA 3CS7A 4DVAU 3U69H 3DT0H 5F8TA 5GDSH 4JYTA 4YT7H 3T28A 2CV3A 3O8DA 1HXEH 4XOJA 1YGCH 3GYMA 1O37A 4OS6A 5JB9S 1LDTT 1BHXB 4FU8A 1AHTH 2BDBA 4NWKA 5TCAA 1VZQH 1XUJA 2Z9JA 4BAQB 1EP6A 2Q1JA 4X2XA 4BOHA 3D49H 1O5FH 2PTCE 3QWCH 4MLFB 1CSOE 2H5CA 1GBJA 2G5VA 1NFWA 1YP9A 2GDDA 1K1IA 3F6UH 5FHTA 8LPRA 4QT8C 4CBOA 2P8OB 1P2QA 2P3FH 2CHAC 1P2IA 1B5GH 2BQ6B 1FIWA 1BIOA 1KLIH 1QBNA 3GCHC 1ZHRA 4OGXA 1BRBE 1UTMA 2ZFFH 3BTQE 1O38A 4D9RA 4AGJA 1Y3XA 1LKAA 1ZGIA 1ZTJA 1AO5A 1FY3A 5FX5A 2J92A 2ESTE 2ZFQH 1TIOA 3KF2A 3P8GA 1SGFA 1KXFA 4WH8A 1Q3XA 1XX9A 3E0PB 5EOKA 3RXTA 2QIQA 1VCWA 4ABFA 5BRRE 1BMMH 1FUJA 1TNKA 3ATKA 1PPHE 3O8BA 1P2MA 3TU7H 5GCHG 1C1QA 1Z71A 2J2UA 5PTPA 2A4RA 1WCZA 2P16A 1JRTA 5DP7A 4MPWA 2BTCE 2FTLE 2SGQE 2GT8A 1IHSH 1SG8B 1YPLH 2PFEA 4Y76A 5EODA 3ZYEA 2XNIA 3BTGE 5EXLA 4ABIA 3TK9A 3LGVA 1GHBF 3CP7A 7ESTE 3AAVA 1SGDE 5FPYA 4JZFH 2C93B 1XVMA 2ANWA 1FN8A 4Y7BA 1O2KA 3M5MA 4M7GA 4YLQH 1K1PA 1TNIA 3F9GA 4KELA 1O2GH 1TPSA 2D26C 3DHKH 4MPVA 3SNAA 1C5XB 3BTME 2CMYA 3KGPA 2OXSA 5L6NH 1TNJA 3F1SB 1WQVH 1BRAA 2AERH 1GHYH 1TE0A 5DJ7A 1F92A 1AGJA 1AVGH 2UWLA 2F9OA 1NFYA 1W0ZU 2XWBI 3M5LA 3FAOA 2EI7A 1HAGE 3MU0A 1V2UT 5TCCA 4AGKA 5DGJA 1Y59T 3KCGH 1T32A 1DUAA 2F9VA 3RMMH 1SC8U 4I31A 4IC5A 3Q00A 1ZLRA 3VGCC 1RTLA 3VPKA 4IN2A 3MTYA 4OS7A 2ZHFH 1EOLA 1QNJA 1GI5A 3UREA 1UO6A 4X1SU 1XUKA 1DS2E 1GVKB 1AU8A 4JYVH 1K1MA 2HNTE 1TGBA 1NESE 1QA0A 2WYGA 3E16B 3MNCA 3Q3YA 1INCA 4FVDA 2YOLA 3MWIU 1O35A 1O2MA 3P8OA 1S6HA 2BQWB 1SHYA 1Z1IA 5L30H 1ZHMA 3I77A 4UEHH 3P92A 3MU5A 4HZHA 4ISIH 2QV1A 5F6MA 1P03A 2G8TA 3C1KA 1QQUA 1H9IE 3QGNB 2FI4E 4GSOA 1NRQH 1GBIA 1C2KA 1MBQA 4UDWH 1O3GA 2A7CA 2FI3E 4A1XA 1GI0A 1TX6A 3BV9B 4GCHG 2XW9A 3BEIB 3RXEA 3TITA 1QBOA 4UFGH 1GHAG 1MKWH 1ZYOA 2G51A 1S0QA 3LONA 1SGFG 1C5LH 3A83A 5E0JA 1PPGE 3L3TA 2GT7A 2SGDE 5JYIA 1ZZZA 3S9AA 4E06H 1TPPA 2GGVB 2Z9LA 1EZQA 2WPJS 3ELAH 1GMHG 3RP2A 2TRMA 1AE8H 1QURH 1Y3VA 1CA8B 3GICB 3A89A 2RA3A 3QO6A 1C9TA 1DUEA 2SGEE 3U98H 1T8NA 3V3MA 6CHAC 2AMPA 1A3EH 2AMDA 5C67A 3STJA 1TGNA 3TVJB 1XXFA 1JIRA 3UQVA 4DJZB 1MKXH 2G52A 2A5AA 3ZVEA 4B2BA 5K7RA 4ABHA 1AFQC 4OGYA 1V2MT 1MTUA 2C8XB 2C90B 4Y11E 5EQRA 3EGKH 1CT0E 3GY6A 1MKWK 1N8OC 1SL3A 1P8VC 1BMNH 1RD3B 1SQAA 1YPMH 1GI4A 1W2KH 1AKSB 1KDQB 1AD8H 2ZGXH 4BTUB 1O3KA 2UUFB 2ZCKP 5DP8A 2GCTB 1EAIA 4JK6A 5DKMA 2W5EA 3VB3A 3NCLA 2PR3A 4YESB 3U8TH 4K5ZA 2VGCB 2C3SA 1T4UH 1ZSJA 4X2YA 1KXCA 1O5EH 2Y7XA 4NG9H 1HDTH 2OC1A 3KQCA 2FLRH 1CQQA 3NKKA 2VIVA 1SLWB 2OP9A 4NIWA 1PFXC 4UE7H 3UR6A 4ZROA 1MKXK 3SGBE 1MTNB 1P9SA 2EEKA 2DUCA 5HXFA 4CHAC 1Y5BT 1O2XA 1BTXA 2K1QA 4MNWA 3BIUH 3VEQB 3M3TA 1GMCG 1O2YA 1C2FA 3SNBA 1AI8H 1TA2A 1GGDB 1C2DA 1LQEA 2JETC 2ZDNA 4KP0A 2VWMA 2BD7A 2AMQA 2NU0E 4NFFA 1FAXA 5AFZH 1HJAC 3RXSA 3SUFA 5HGGA 2OQUA 1G3DA 1IQEA 4MVNA 3V0XA 1O30A 1FY1A 7KMEH 1DXWA 1FQ3A 3RLYH 1YPHC 3PV4A 1ANDA 3QDZB 3KL6A 2H1UA 1HXFH 2WV4A 2PW8H 4OS2A 3DFLA 2WUCA 3QTOH 5L2ZH 3GDUA 1P2NA 1MD8A 3NK8A 1YYY1 1D3QB 3SU4A 5AVDA 3TH4H 3LGTA 1UK2A 1EASA 1EPTC 4FUEA 2ZDVH 4X1PU 1H8IH 1GDUA 1QL8A 1DT2A 1CGIE 1ZMJA 2ZZUH 1GJ7B 1QL7A 1V6DA 2G4UA 1EP5A 1AB9B 3KHVA 1P06A 1IQLA 5DO4H 1C1OA 2ANYA 2SGFE 3SGAE 1BBRE 1FY4A 1SFIA 1VCPA 2ZHWH 3MYWA 3T5FH 1F2SE 3S7HB 2HWLB 1VJ9U 6LPRA 1CHOG 2C8YB 1GMDG 2J4IA 1V2KT 4DW2U 2G5NA 2D8WA 2VH6A 4LZ1H 4WF8A 2ODPA 1GG6B 1Z8GA 2HGTH 1C1TA 2QGRA 3KQDA 1ELCA 2VVUA 3FFGA 3TIUA 2RA0A 4NWLA 1BA8B 1DPOA 4O3TA 5TJXA 1C2LA 1H4WA 2NU4E 2GP9B 1TBZH 1C2HA 4E7NA 2ZF0H 1K22H 1AIXH 1K9OE 6GCHG 4AFQA 1A1RA 3WY8A 2VVCA 3Q76A 1EXFA 1G2LA 2VIOA 2ZFTA 4XBDA 2FOGA 2VIDA 4WMFA 2A2QH 3RC4A 3RU4T 2ASUB 2KAIA 5C1YA 1FXYA 3M5OA 1W12U 1UVSH 1BRCE 2Z3EA 1A2CH 4H42U 4TY7A 1TAWA 2HALA 1BTWA 1ELDE 4FUIA 3T2NA 1FY5A 1G3CA 4NIVA 4I32A 3G01A 3IITA 2BVXH 2SNWA 4U32A 5JBAS 4IC6A 2A7HA 1QB9A 1GVZA 4X2VA 1UVOA 2GV6A 1GDNA 2ZWLH 2P3TB 4AG2A 1GCTB 4WWYA 4X6NA 1XXDA 3P70B 1S5SA 3OSYA 2P95A 3TJOA 1O33A 3LJOA 2HVXA 1WQSA 3TH2H 2A5IA 1DY8A 4Y8XA 4ZXYH 2TGTA 1DICA 4Z6AH 1P01A 1O2WA 2OTVA 2ZFRH 3ATMA 3PROA 4Q7ZA 1O5BB 4BAKB 2W7SA 4ZKOU 1SBWA 2F9UA 1D9IA 1MZDA 5IDKA 5CHAB 2FOEA 3UFAA 1TLDA 1JRSA 3H7TA 1YLDA 1C1VH 2WUBA 3A7WA 1UVTH 1K1JA 1MQ6A 1S82A 3AAUA 3SV8A 3KNXA 4FUCA 4E05H 3ZZAA 1VR1H 2W3KA 1TNGA 3SU2A 1Z6EA 2H9TH 4YOIA 2FMJA 2FTMA 1GCDA 5JBBS 1LHGH 5G4BA 4H4FA 1JXPA 1AE5A 2SGAA 1ELBA 3RMNH 5BPEA 1CHGA 5GXPA 1FJSA 1SSXA 1T8OA 2CF8H 1O39A 2OC8A 4KTCA 2J34A 2H5DA 3W94A 1ZRBA 3BTKE 1AKSA 2V35A 2D2DA 4FUGA 1VJAU 1O2SA 4WY3A 5T3HA 3PLPA 3M7QA 1O2UA 1ELAA 1ETTH 1HUTH 4JZEH 3UTUH 1C2JA 5E2OA 4GCHF 1DWBH 1RJXB 2FOFA 4CRBA 1PPZA 1NC6A 2VB0A 3UOUA 4ABBA 5A0CA 3ZZ4A 3A81A 3GDVA 1GHAF 4CH8B 2R2WU 1O0DH 2TBSA 3AW0A 1ZGVA 1FPHH 2QF3A 3SV9A 1UTOA 3S0NA 1YKTA 1C4V2 5DP9A 1K1NA 2R3UA 3BG4C 3MNBA 3LT3A 1O3NA 1EJAA 1WOFA 3NUMA 3ESTA 2BYAX 2Z9GA 2FOCA 4A92A 4CRCA 1P0SH 1GMHF 1BQYA 1NM6A 4FUDA 4CRDA 1EPTA 1ZRKA 4O03A 4O9VA 3U1IB 2ZHEH 1T8MA 1MH0A 2HNTC 3ZVGA 4OS4A 1MU8B 1UTNA 4FU9A 3MOCA 4JZ1A 5FXLA 3E6PH 3URDA 1XKAC 1K21H 2CHAB 2ZI2H 1A0JA 2ZO3H 1TOCB 4YOJA 1NROH 1O5DH 3GCHB 1CA0C 3MMGA 2XRCA 2UUYA 3M35A 2B9LA 1IAUA 2PKSC 3DA9B 1C5ZB 3TGKE 2V6NA 2GTBA 2FXRA 1RRKA 1AMHA 1D4PB 4Y71A 2QAAA 5A8ZA 2ZDLA 3ZZ7A 1BBRH 1T4VH 1C9PA 1P3CA 2R3YA 4DY7B 2O8UA 3U1JB 3LKWA 1P2JA 3MFJA 1DWCH 3PTBA 5FAHA 2BLVA 3BTHE 3SUGA 2Y5HA 9ESTA 1Y3YA 3ATWA 4NCYA 2ZFSA 4ZUHA 1SLVB 4RSPA 2BHGA 1JIMA 1O2IA 5J4SA 5JPMH 5EU8A 3EE0B 1GBHA 3GY3A 3UUZA 3F9FA 2VWLA 2IOTA 1UTKA 1GMCF 2FESH 2O9QA 5H4IB 1BCUH 3D65E 1TWXB 1SOZA 1BT7A 1GJ4H 1BTYA 4AB8A 4B71A 1B7XB 1C5YB 5GIBA 2W26A 2J9NA 2B8OH 3GY8A 4MQAA 4O3UA 4K69A 1EAUA 4NA9H 1G37A 3BTTE 3LH3A 3ZZDA 1GI7B 5DP5A 1SHHB 3K9XB 1UTPA 1BJVA 2YNBA 1O5CB 3BIVH 2WPHS 2QXIA 1BTPA 3RXBA 4WXVA 2DE8A 3RXQA 3MO6A 4AX9H 4IW4E 1HAYB 1IQIA 1T8LA 6ESTA 3OY6U 2QXGA 1VGCC 1O2OA 3SOSA 1EZXC 3M36A 8GCHG 3OYPA 3V12A 3SNDA 1P3EA 3VGCB 3PMBB 5AF9H 4KTSA 2OQ5A 3MO9A 1C5OH 1GBDA 5DP6A 1D3TB 3MH5A 2ZTZA 5HYOA 1RS0A 5FPTA 2H9EH 1ANCA 2HNTF 3TPIZ 4NGAH 2ZU3A 3S9BA 1Z6JH 2ZNKH 1TPOA 1NT1A 1Z7KA 4IGDA 1BDAA 2I6SA 5E8EH 4Q7YA 1O3OA 4RKOB 4AG1A 1CHOF 2QA9E 1OYQA 2FOMB 2SFAA 1GMDF 1O3EA 2BDIA 1EOJA 4ISOA 1N6YA 1C1PA 2Y5FA 3Q3XA 1TX8A 4ABGA 1DITH 2F9BH 1XM1A 4NZQA 1C4U2 3VB4A 3SU1A 4DG4A 3SBKA 1F5KU 3QX5H 1A46H 1HAOH 4SGBE 1OWKA 1FI8A 1TQ7B 5FX6A 1F0RA 1J14A 1GPZA 4NSVA 1L4DA 2BY7X 3SQEE 3Q3KA 2KAIB 1UJ1A 6GCHF 5A8YA 1AZZA 3M37A 4ABDA 1BTHH 1THPB 2Z94A 1GJBB 1Y3WA 3ZV9A 1W10U 5JBCS 3RU4D 4XDEA 3VB6A 3ZV8A 2BDYA 1E35B 5EXMA 4Y0YE 1NU7B 1C5MD 1LVBA 2OC7A 1ELFA 1HRTH 2HLCA 5C2ZA 1C5RA 4IBLH 5FBIA 1AUTC 2ZC9H 2FYRA 4AB9A 6CHAB 2VNTA 2J95A 4UFEH 1SGQE 1GBCA 3UIRA 4CRGA 2BD9A 3RXAA 2ODQA 4LK4A 1EJMA 3T25A 2Y7ZA 3V7TA 2V3OH 3PM3A 3EDXB 3LGWA 1AFQB 1DX5M 2UWOA 3F68H 1LMWB 1TGCA 1GBTA 3ZZ3A 1LVMA 1O3PB 1H9HE 1N1LA 3RXJA 1HIAA 2F3CE 3TNTA 4CH2B 3GY2A 1N8OB 2VIWA 2FDAA 2BQ7B 4ESTE 4U2WA 1FONA 1P12E 2ILNA 4Y8YA 5DG6A 1C5TA 1HYLA 1NO9H 1DFPA 3MU1A 3LU9B 1UTQA 4XBBA 1PYTD 3QN7A 3A85A 5IYTA 1TYNA 1J16A 1IQMA 3EA7A 3K6YA 3MHWU 5DPAA 3A7YA 3SUEA 1FY8E 1P9UA 1MCVA 1UTLM 2BX3A 2ZPQA 1W0YH 1NRRH 2GZ7A 3VXFH 2AEIH 4XBCA 2FX6A 1ACBE 1LVYA 1S83A 1P04A 3FANA 1AVXA 2VWOA 3JZ1B 4FU7A 1Z8RA 1ZSLA 4ASHA 1FV9A 1NTPA 4CHAB 2JH6D 1H1BA 3A7ZA 1FZZA 3SU3A 1SPJA 1HGTH 3ZYDA 1GI1A 3S69A 2J38A 3RXPA 2FLBH 2WPMS 2FS9A 1ESAA 1QRWA 2JETB 2ZGCA 5EW2H 1O3HA 1V2TT 4D76A 1JBUH 2HRVA 3U8OH 2OCVB 1Z8JB 1HJAB 1UTJA 2VVVA 1G36A 2JH0D 4NFEA 2BM2A 4H6SB 1SI5H 2VU8E 1VCQA 3HGNA 4FVBA 4GHQA 1YPEH 1C1RA 3E90B 2THFB 5GWZA 1RTFB 1HAIH 2GV7A 2XCFA 1NY22 5EGMA 1RXPA 1DANH 1PPCE 1BRUP 3UWIA 1GDQA 3GCTG 5A0AE 1O36A 1QTFA 4X8VH 4BANB 5LGOA 5GJ4B 1F5LA 3RXUA 4A1VA 4BTTB 1B0EA 2ALPA 1YLCA 1LPGB 1EPTB 1TRMA 1X7AC 2BB4A 2PGQB 4ZH8A 1NN6A 1NRPH 1IQNA 1AVWA 2BD5A 2ZQ2A 3JZ2B 4I33A 3IG6B 2QY0B 3A88A 1TGSZ 2O8LA 1L1GA 3U8RH 2FI5E 2Z3DA 1TONA 1TGTA 2GDEH 3PMHB 5ESBA 1NZQH 2AYWA 2ULLA 5J4QA 1BJUA 9LPRA 1C1NA 2QCYA 1A5IA 1K1LA 1TNHA 3GY5A 3PMAB 2A5KA 3SQHE 3BEUA 2D1JA 1TB6H 1G32B 1SQOA 2BVSH 2OC0A 4MNVA 3SNEA 3LC5A 3FVFB 1EAWA 2CF9H 1OX1A 2GMTC 1HJ8A 1MTWA 1FPCH 3NWUA 1M9UA 5AHGH 5T6FA 3QZRA 4WH6A 2FOAA 1C5WB 3M61U 1O3CA 2FPZA 3MI4A 1O3AA 1MAXA 3OY5U 1PPFE 5A8XA 1DLEA 1V2RT 3STIA 2ZU2A 2VJ1A 4Y0ZE 2GCHG 3CENA 1TMBH 1S6FA 2QYIA 5JDUB 4UONA 1BB0B 3QZQA 3A86A 4KGAA 2W3IA 3HGPA 1BTZA 3GCNA 4XE4A 1IQGA 1MQ5A 2C4FH 2PLXA 1LHEH 4D9QA 1SMFE 2IN2A 1GHWH 3E0NB 4AFZA 3TGJE 4NA8A 2M5TA 3HATH 4IN1A 5A0BA 1LTOA 2BXUH 2XYAA 2F83A 4B2AA 1QBVH 4X8TH 5EQQA 1HLTH 3GY7A 1O5AB 1C5NH 1G30B 1RGQA 2ZCLP 4GVUA 4B76A 3DD2H 2OBQA 5DP4A 3RDZA 5K0HA 1K1OA 2ZU5A 4FUHA 3C27B 1G9IE 1SGPE 4AFSA 5EW1H 5A2MH 1O2PA 1SLXB 3PO1C 2ZKSA 4X6MA 1WV7H 2FEQH 2Y6TA 4Y7AA 2XC0A 1ZJKA 1ZPZA 2R0LA 1E34B 1HAZB 2ZPSA 3PWCA 1WBGB 3LH1A 2VWNA 3RM0H 1G2MA 4JZDH 4Y8ZA 1AWFH 1K2I1 1Y5AT 3A8CA 2A7JA 2A4QA 3RXOA 3PWBA 3LGUA 1UHBA 1WUNH 1OWHA 4AYVB 5LPRA 3RXFA 4YM9A 4ISNA 2RG3A 1YCPM 5LPFA 8GCHF 1XUIA 3E3TA 4MPXA 5C1XA 4X1QU 3ZZ6A 1DSUA 1EATA 2WV5A 5LPEA 1S0RA 3VXEH 3F9HA 5GPIB 4SGAE 4A6LA 1HB0B 1PPBH 3QGJA 2ZIQH 2F9PA 3MNXA 5DP3A 1TQ0B 2R9PA 2WINI 4ABEA 2BDGA 1QIXB 3D62A 1KTSB 3MNSA 1MZAA 1V3XA 3ATLA 1D3DB 1HAVA 2BY9X 1GHVH 3UPEA 4ABAA 1GWAA 3SU6A 3SJ8A 1KYNA 3SJKA 1W7GH 3IWMA 1NRSH 1O2VA 3LGIA 3E8LA 3A7XA 1O3LA 2OUAA 3KQBA 1F0UA 4B73A 3A8DA 3S9CA 2VIPA 2A0QB 1SQTA 2GD4B 3SU0A 4TWYA 3D23A 1F7ZA 2UUKB 1YCPH 5C20A 2EA3A 3H7OA 3LGYA 3SW2B 1AFEH 2XC4A 4K8BA 3GOVB 2AIPA 1DOJA 2CJIA 1Y5UT 3SORA 1AWHB 4I7YH 3HKIB 2RDLA 4MNXA 1SGYE 1GI2A 2PHBA 3BG4B 1WU1A 2ZPRA 4MG3A 1SGCA 5B6OA 3M7TA 1GVLA 4GHTA 1C2IA 1FIZA 2BOHB 3QK1A 2OBOA 1KXAA 2EC9H 4X1NU 2BX4A 3P8FA 4YT6H 1TRNA 1IQJA 3LPRA 1W3CA 3UQOA 1HIAB 2XWAA 4PROA 1J17T 1T31A 1TNLA 1YCPK 3UNQA 1CO7E 3LJJA 4YTAA 1ZTLA 4D7GA 1SB1H 1BMAA 3P8NA 1D6RA 2OINA 1O2NA 1QRZA 3MH4A 1EAXA 1CA0B 1CBWC 1THRH 1FN6A 1WSSH 2BY5X 2LNCA 2WPLS 4BXWA 1MTVA 1ESTA 1A0LA 2PKSB 4GLYA 2A32A 4K2YA 1MMJN 3A84A 5C1UA 4I8HA 4FUBA 4X6OA 4Z0KA 1ZPBA 2A45B 1O2RA 3EA8A 1OWEA 1TALA 4UFFH 1KSNA 3VB5A 2BLOA 1L0ZA 2HPPH 2XC5A 8ESTE 1YPKH 4FUJA 2ZTXA 2Z3CA 5E0GA 1GBBA 1OSSA 1QHRB 3E91A 2FYQA 2BDHA 2ZU1A 4VGCC 1J15A 4ZKRU 4AORA 2WYJA 2SGPE 2FS8A 2G55A 1WTGH 3BTWE 1L1JA 3BF6H 2FODA 1O2TA 1QR3E 2AGGX 4I8KA 3L6PA 3RXVA 4YLUA 1YPJH 1ELTA 3GDSA 4U01A 4A5TS 4YOGA 1V2OT 1AN1E 7GCHF 3OTJE 1MD7A 1GI6A 5I46H 4TYDA 1P2KA 4I8GA 1YC0A 5ETXA 4BTIB 4AZ2B 1L1NA 2GZ9A 1LKBA 1EX3A 3RXIA 1ZHPA 5EPYA 2JH5D 3P6ZB 3RXDA 1C2GA 1AY6H 3SNCA 1RIWC 2CXVA 1DSTA 1C5UA 1D6WA 2CGAA 2ZDMA 3TJVA 2ZHQH 4FUFA 1CU1A 1V2VT 1EQ9A 3FZZA 1DM4B 3I78A 2BLQA 1TPAE 2QC2A 1DVAH 1QL9A 2J94A 4K1SA 4OS5A 3GCTF 4RKJB 4WXIA 3TGIE 1MBMA 2OD3B 1BZXE 2AFQB 1F0TA 1VGCB 2NU2E 2EI6A 1LCYA 1C2MA 2Q6DA 1JOUB 2ZGJA 1BBRK 3RXHA 5C5OA 2DE9A 1OOKB 1IOEA 1SGEE 1O34A 1O2ZA 4UFDH 3SJ9A 2ANKH 1GHXH 1O2QA 3RC5A 1SGTA 4B2CA 3FZDA 2TGPZ 2P8OC 3QTVH 2UUJB 4AFUA 1SR5C 1Y8TA 1BMLA 4X8UH 3GY4A 1VITF 1ELVA 1MAYA 2FOBA 3NXPA 1TMTH 4O97A 4DURA 1V2JT 1SGNE 3TNSA 3R3GB 2TGAA 1P02A 1CGJE 2ZP0H 1ETRH 1NS3A 1MTSA 4CRFA 3TK5A 3BTDE 4J2YB 4MTBA 5C5NA 1OP0A 4E7RG 3TK6A 1RFNA 1LHFH 3FP8E 3M3SA 2B0FA 1CGHA 4TY6A 2Y80A 3SZNA 1O2LA 2SNVA 3F9EA 3PB1E 2O8TA 1ID5H 4F49A 3HK6B 1TBQH 2GCHF 3GYLB 1OXGA 5T6DA 1XVOA 2R2MB 1GBAA 2BZAA 1NFUA 1DWEH 3DUXH 1KXDA 2AS9A 1QB1A 2BY8X 1EZSC 3HKJB 2Y5GA 3M3VA 4U30A 4XFQA 1DXPA 1HCGA 1EB1H 4BAMB 1J8AA 2G00A 1SFQB 4K3JA 2BMGB 3A82A 3BTFE 8KME2 1W8BH 4Q7XA 2NU1E 2ZECA 3B23B 3ODFA 4NA7A 2F9NA 1ZPCA 1V2WT 1NRNH 4LOYH 5FCRA 1OS8A 2PUQH 1OYTH 4ZHAA 3EA9A 4A7IB 4ISLA 2ODYB 4K60A 4NIYA 2H2ZA 4ISHH 1GBLA 1IQFA 1OWDA 1QJ7B 4K8YA 3SI4H 5JBTA 4I8JA 1UHBB 1ABIH 4INHA
chains in the Genus database with same CATH superfamily
4DOQA 1EB2A 2GX4A 3SUDA 1NPMA 1EUFA 3A80A 4X2WA 2NWNA 2AHME 1G3EA 2PSXA 4GAWA 1G3BA 2PKAA 3MH6A 3P17H 1V2NT 1ELGA 2YNAA 1XUGA 3A8AA 1UCYE 1EJNA 3AW1A 3U9AH 3ZVFA 1V2LT 3BEFB 2RCEA 2HPQH 1TA6A 2GKVE 1BHXF 3S7KB 1RTKA 1GHZA 4JK5A 1Z8IB 1HFDA 2XBYA 7LPRA 2FIRH 1GI3A 1ORFA 1HAVB 2B5TB 5C17A 1IQHA 3GISB 1QJ1B 2EY4C 5EPNA 1SGRE 1GJCB 3H5CB 4KTUA 2CN0H 1GJDB 2CK3D 4ABJA 1ZMLA 4ZKNU 1LPKB 1EZUC 1GJ8B 1U6QA 4OM9A 2PUXB 4H6TA 4DCDA 4MPUA 1MUEB 3ATIA 1PQ7A 1Y3UA 1A5HA 3TJNA 1QB6A 1BITA 1ZSKA 2FP7B 2W7UA 3ZVDA 3SJIA 1ABJH 2P3UB 2WPIS 3A87A 4Q2KA 1KIGH 1HAHH 3UNSA 2C8WB 1Z1JA 4NIXA 1LO6A 1OWJA 2KZ4A 3SV2H 3RMOH 3SI3H 2VIQA 3SV6A 5EXNA 1Q31A 1AUJA 3N7OA 4ZHLU 1A0HB 1ETSH 4JZIA 1DWDH 2YMSC 3FP6E 3T26A 2QF0A 2JKHA 3A7VA 1ELEE 7GCHG 1HNEE 4JCNA 1O3JA 5GNDA 1A5GH 2L6OA 1LPZB 2BY6X 4F4OC 1KY9A 2IPHA 3LIWA 2ZGBH 2PWXA 3RXGA 2ZA5A 1PQAA 1UW7A 1OPHB 1GL1A 2QXHA 2STBE 1PYTC 1GBMA 2EI8A 1W0KD 1KXEA 1J9CH 1GJ5H 1MCTA 4KKDA 5DK1A 2QF4A 1YF4A 1C5SA 5F03A 2KCAA 1CT4E 2FZZA 3NRLA 3UOPA 2AH4X 1JWTA 3ZVAA 1FLEE 1V2PT 4I8LA 2PGBB 1C1MA 3SYJA 2G4TA 1L2EA 1C1UH 1ZMNA 5C3NA 3U28C 1T7CA 1QFKH 3PLBA 2WV9A 1TFXA 1OHHD 2XBVA 1O3BA 2Y82A 3O8CA 4CREA 1DY9A 1GBKA 2BOKA 2GMTB 2A4GA 1BUIA 2ANMH 2F91A 3NZIA 4P02A 3PTNA 2Z9IA 2BVRH 2GCTC 2PTNA 3K65B 1WTHD 1XUFA 1ZTKA 1K0HA 3RC6A 4DIHH 4ZMAH 1OP2A 4K1EA 1GI9B 1VKYA 3UR9A 2VGCC 5F8XA 1K28D 3SN8A 3T27A 4DIIH 1O3IA 3N7DA 4LXBH 4Y6DA 3OU0A 1VITG 3AVZA 1O3FA 4X6PA 1ARBA 1QJ6B 1CVWH 3L33A 4IMZA 3BTEE 1MTNC 1O3DA 4X8SH 3T29A 3B9FH 1LQDB 1UMAH 1V2ST 2ALVA 1IQKA 2FO9A 4Y10E 4MNYA 2BD8A 3GCOA 4HGCA 4UD9H 5CMXH 1GHBG 1OWIA 2GVFA 4INKA 3VB7A 3URCA 2ZU4A 4JYUH 2NU3E 3BSQA 2GZ8A 1GGDC 3RXMA 2AGEX 2B7DH 2PV9B 4CBNA 2V0BA 4BAHB 1HV7A 4NZLA 3MO3A 1XUHA 1GBFA 3ZZ9A 1FDPA 2UWPA 3PO1B 3RLWH 1H9LB 1JMOH 1ANEA 1V2QT 1SLUB 2BD4A 1A61H 1N6XA 1YPGH 3HPTB 1O31A 1W7XH 4J1YA 4THNH 5ESTE 2R0KA 2O8WA 1W13U 1PJPA 5SGAE 1VITH 1BOQA 3BG8A 1P05A 4NSYA 3ZVCA 4D7FA 1O3MA 1THSH 3ENSB 3MH7A 4DT7B 3RXLA 3RU4E 1CT2E 4WJG2 2I6QA 4TWWA 3EAJA 2BZ6H 2TIOA 4TPYA 4HFPB 3SGQE 1D3PB 2G81E 2H9HA 3K6ZA 3FP7E 1XMNB 4RT0A 1OKXA 1KLTA 4CRAA 3SU5A 1LHCH 3ITIA 2TGDA 1AB9C 2RFKC 4K1TA 5I25A 2P59A 3A7TA 3M5NA 3KIDU 4ZHMU 3LC3A 1AQ7A 2Z9KA 5FBEA 1GJ9B 4AOQA 4DGJA 1S81A 4RN6A 3O8RA 1E36B 1QCPA 1TOMH 5GCHF 2Q6GA 3SJOA 1UVPA 1KTTB 2A2XH 3KQEA 1LHDH 5ABWA 1GJAB 2PSYA 1UCYH 1TRYA 4R8TB 3W95A 3AK5A 1GG6C 4ZKSU 1QA7A 1QY6A 2VH0A 2XXLA 4ACAA 2Z7FE 3ZZ8A 5EIYA 3SHCH 1UVUH 4B1TA 2AIQA 4HTCH 3E1XB 1OP8A 3LDXH 4AYYB 2LPRA 3EYDA 5FCKA 2OLGA 3QUMP 5L2YH 1FAKH 1A3BH 1DE7H 2ZG0H 3DFJA 1UK4A 1WYKA 1BTUA 2JJ1D 1O2HA 5E0HA 2V3HH 2BXTH 2XTTB 2ZTYA 1P57B 1QRXA 1QGFA 2QXJA 1MU6B 1O5GH 1YWUA 3VFEA 3RUOA 4MDSA 1SOTA 1PQ8A 2J98B 2O8MA 3RXKA 1KXBA 1E37B 3K2UA 1HBTH 2A31A 1W14U 3BN9A 4JMYA 3RM2H 1ARCA 4IMQA 3I29A 1O2JA 4Q80A 3UY9A 4HI3A 1SGIB 1ZOMA 1YM0A 1C5PA 2IJOB 3RXRA 1S6LA 1HJ9A 1L4ZA 1W11U 1UCYK 4R0IA 1NFXA 1TMUH 2P94A 3SO3A 3ZZCA 1SQRA 1YBWA 2ZGHA 3ZVBA 2XBWA 1P09A 1FMGA 3QLPH 4AN7A 1QQ4A 2XCNA 5FPSA 3A8BA 3GS9A 2Z6BD 1CE5A 3M7UA 3PYHA 1F0SA 1TABE 4IS5A 3NPSA 2Q6FA 1HPGA 2TPIZ 3Q77A 3H09A 3PLKA 1C5QA 2A4OA 3TH3H 1F5RA 3AASA 3UWJH 1DDJA 4FXGH 4WMEA 5LH8A 3ODDA 1GCTC 2ZEBA 1ZR0A 3KEEA 1KLJH 1UK3A 4CR5A 1AZ8A 3UAIC 2PKAB 1P10A 2QF5A 5CE1A 1GBEA 4P00A 2QN5T 4BNRA 1CBWB 5E2PA 2BLWA 2WPKS 1ESBA 1YPHE 3OX7U 4CR9A 2ZQ1A 1C4Y2 2A1DB 5EQSA 1PPEE 2BDCA 3KN2A 4TPIZ 2XBXA 2V3MA 5EJLA 5T6GA 3RXCA 1P2OA 2STAE 1C1WH 1A4WH 4D8NA 2KM0A 5CHAC 1H8DH 2BD2A 3RMLH 1GI8B 3UNRA 2P93A 1KDQA 3R0FA 1C2EA 4F48B 4A1TA 1S85A 1SVPA 5F8ZA 2FX4A 1TX7A 1C1SA 3SV7A 1GL0E 1TBRH 3HK3B 2WPDD 3F0PA 1O32A 1DLKB 4OS1A 4VGCB 4WMDA 4B75A 4BAOB 1XKBC 4YZUA 1HAXB 1LVOA 4LZ4B 3TJUA 3LOXA 3TLOA 2ZFPH 1PQ5A 1E38B 2ZHDA 2ZDAH 1NBME 4ZAEA 2ZDKA 1WAYB 4GUXA 4X1RU 4X0WU 3ZZBA 5HMAA 3V13A 2VINA 1A7SA 5JB8S 1Q2WA 1FNIA 3T62A 3MU8A 3PMJA 3B8JA 4Y79A 2BD3A 4ZXXH 4GPGA 1IHTH 2FOHA 1GJ6A 3EQ0H 2H6MA 3P95A 2BDAA 3ZZ5A 1E0FD 1S84A 3SHAH 4YO9A 3MU4A 1ANBA 2HOBA 1C5VA 2Y81A 4XSKU 1NU9A 1EKBB 1HAPH 4INLA 1B0FA 1RIWB 5HM9A 4HG6A 5EG4A 2AGIX 3CS0A 4WVPE 4B74A 2EQNA 5A09A 2ZCHP 5HM2A 2C8ZB 2FWWA 5AFYH 1P11E 2FM2A 1ZJDA 4BXSA 3CS7A 4DVAU 3U69H 3DT0H 5F8TA 5GDSH 4JYTA 4YT7H 5HIZA 3T28A 2CV3A 3O8DA 1HXEH 4XOJA 1YGCH 3GYMA 1O37A 4OS6A 5JB9S 1LDTT 1BHXB 4FU8A 1AHTH 3KYGA 4B6FA 2BDBA 4NWKA 5TCAA 1VZQH 1XUJA 2Z9JA 3F2HA 4BAQB 1EP6A 2Q1JA 4X2XA 4BOHA 3D49H 1O5FH 2PTCE 3QWCH 4MLFB 4Q4LA 1CSOE 2H5CA 1GBJA 2G5VA 3PV5A 1NFWA 1YP9A 2GDDA 1K1IA 3F6UH 5FHTA 8LPRA 4QT8C 4CBOA 2P8OB 1P2QA 2P3FH 2CHAC 1P2IA 4Z1MD 1B5GH 2BQ6B 1FIWA 1BIOA 2WHXA 1KLIH 3PRDA 1QBNA 3GCHC 1ZHRA 4OGXA 1BRBE 1UTMA 2ZFFH 3BTQE 1O38A 4D9RA 4AGJA 1Y3XA 1LKAA 1ZGIA 1ZTJA 1AO5A 1FY3A 5FX5A 2KCPA 2J92A 2ESTE 2ZFQH 1TIOA 3KF2A 3P8GA 1SGFA 1KXFA 4WH8A 1Q3XA 1XX9A 3E0PB 5EOKA 3RXTA 2QIQA 1VCWA 4ABFA 5BRRE 1BMMH 1FUJA 1TNKA 3ATKA 1PPHE 3O8BA 1P2MA 3TU7H 5GCHG 2HVYB 1C1QA 1Z71A 2J2UA 5PTPA 4TT3D 2A4RA 1WCZA 2P16A 1JRTA 2L74A 5DP7A 4MPWA 2BTCE 2FTLE 2SGQE 2GT8A 1IHSH 1SG8B 1YPLH 2PFEA 3FKSD 4Y76A 5EODA 3ZYEA 2XNIA 3BTGE 5EXLA 4ABIA 3TK9A 3LGVA 1GHBF 3CP7A 7ESTE 3AAVA 1SGDE 5FPYA 4JZFH 2C93B 2KCYA 1XVMA 2ANWA 1FN8A 4Y7BA 5KGOA 1O2KA 3M5MA 4M7GA 4YLQH 1K1PA 1TNIA 3F9GA 4KELA 1O2GH 1TPSA 3ZIAD 2D26C 3DHKH 4MPVA 3SNAA 1C5XB 3BTME 2CMYA 3KGPA 2OXSA 5L6NH 1TNJA 3F1SB 1WQVH 1BRAA 2AERH 1GHYH 5KECA 1TE0A 5DJ7A 3UB0A 1F92A 1AGJA 1AVGH 2UWLA 2F9OA 1NFYA 1W0ZU 2XWBI 3M5LA 3FAOA 2EI7A 1HAGE 3MU0A 1V2UT 5TCCA 4AGKA 5DGJA 5CHBA 1Y59T 3KCGH 1T32A 1DUAA 2F9VA 3RMMH 1SC8U 4I31A 4IC5A 3Q00A 1ZLRA 1EFRD 3VGCC 1RTLA 3F2FA 3VPKA 4IN2A 3MTYA 4OS7A 2ZHFH 1EOLA 1QNJA 1GI5A 3UREA 1UO6A 4X1SU 1XUKA 1DS2E 1GVKB 1YLNA 1AU8A 4JYVH 1K1MA 2HNTE 1TGBA 1NESE 1QA0A 2WYGA 3E16B 3MNCA 3Q3YA 1INCA 4FVDA 2YOLA 2JDID 3MWIU 1O35A 3OE7D 1O2MA 3P8OA 1S6HA 2BQWB 1SHYA 1Z1IA 5L30H 1ZHMA 3I77A 4UEHH 3P92A 3MU5A 4HZHA 4ISIH 2QV1A 5F6MA 1P03A 2G8TA 3C1KA 1QQUA 1H9IE 3QGNB 2FI4E 4GSOA 1NRQH 1GBIA 1C2KA 1MBQA 3DSOA 4UDWH 1O3GA 2A7CA 2FI3E 4A1XA 1GI0A 1TX6A 3BV9B 4GCHG 2XW9A 3BEIB 3RXEA 2YMSB 3TITA 1QBOA 4UFGH 1H8ED 1GHAG 1MKWH 1ZYOA 2G51A 1S0QA 3LONA 1SGFG 1C5LH 3A83A 5E0JA 1PPGE 3L3TA 2GT7A 2SGDE 5JYIA 1ZZZA 3S9AA 4E06H 1TPPA 2GGVB 2Z9LA 1EZQA 2WPJS 3ELAH 1GMHG 3RP2A 2TRMA 1AE8H 1QURH 1Y3VA 1CA8B 3GICB 2KR7A 3A89A 2RA3A 3QO6A 1C9TA 1DUEA 2SGEE 3U98H 1T8NA 3V3MA 6CHAC 2AMPA 1A3EH 2AMDA 5C67A 3STJA 1TGNA 3TVJB 1XXFA 1JIRA 3UQVA 5EJZA 4DJZB 1MKXH 2G52A 5DN6D 2A5AA 3ZVEA 4B2BA 5K7RA 4ABHA 1AFQC 4OGYA 1V2MT 1MTUA 2C8XB 2C90B 4Y11E 5EQRA 3EGKH 1CT0E 3GY6A 1MKWK 1N8OC 1SL3A 1P8VC 1BMNH 1RD3B 1SQAA 2LP6A 1YPMH 1GI4A 1W2KH 1AKSB 1KDQB 1AD8H 2W6ID 2ZGXH 4BTUB 1O3KA 2UUFB 2ZCKP 5DP8A 2GCTB 1EAIA 4JK6A 5DKMA 3WWFA 2W5EA 3VB3A 3NCLA 2PR3A 4YESB 3U8TH 4K5ZA 2VGCB 2C3SA 1T4UH 1ZSJA 4X2YA 5F53A 1KXCA 1O5EH 2Y7XA 4NG9H 1HDTH 2OC1A 3KQCA 2FLRH 1CQQA 3NKKA 2VIVA 1SLWB 2OP9A 4NIWA 1PFXC 4UE7H 3UR6A 4ZROA 1MKXK 3SGBE 1MTNB 1P9SA 2EEKA 2DUCA 5HXFA 4CHAC 1Y5BT 1O2XA 1BTXA 2K8IA 2K1QA 4MNWA 3BIUH 3VEQB 3M3TA 1GMCG 1O2YA 1C2FA 3SNBA 1AI8H 1TA2A 1GGDB 1C2DA 1LQEA 2JETC 2ZDNA 4KP0A 2VWMA 2BD7A 2AMQA 2NU0E 4NFFA 1FAXA 1E1QD 5AFZH 1HJAC 3RXSA 3SUFA 5HGGA 2OQUA 1G3DA 1IQEA 4MVNA 3V0XA 1O30A 1FY1A 7KMEH 1DXWA 1FQ3A 3RLYH 1YPHC 3PV4A 1ANDA 3QDZB 3KL6A 1WDIA 2H1UA 1HXFH 2WV4A 2PW8H 4OS2A 3DFLA 5CDFE 2WUCA 3QTOH 5L2ZH 3GDUA 1P2NA 1MD8A 3NK8A 1YYY1 1D3QB 3SU4A 5AVDA 3TH4H 3LGTA 1UK2A 1EASA 1EPTC 4FUEA 2ZDVH 4X1PU 1H8IH 1GDUA 1QL8A 1DT2A 1CGIE 1ZMJA 2ZZUH 1GJ7B 1QL7A 1V6DA 2G4UA 1EP5A 1AB9B 3KHVA 1P06A 1IQLA 5DO4H 1C1OA 2ANYA 2SGFE 3SGAE 3FO8D 1BBRE 1FY4A 1SFIA 1VCPA 2ZHWH 3MYWA 3T5FH 1F2SE 3S7HB 2HWLB 2PP6A 1VJ9U 6LPRA 1CHOG 2C8YB 1GMDG 2J4IA 1V2KT 4DW2U 2G5NA 2D8WA 2VH6A 4LZ1H 4WF8A 2K0QA 5IK2D 2ODPA 1GG6B 1Z8GA 2HGTH 1C1TA 4F55A 2QGRA 3KQDA 1ELCA 2VVUA 3FFGA 3TIUA 1MABB 2RA0A 4NWLA 1BA8B 2OK5A 1DPOA 4O3TA 5TJXA 1C2LA 1H4WA 2RDEA 2NU4E 2GP9B 1TBZH 1C2HA 4E7NA 2ZF0H 1K22H 1AIXH 1K9OE 6GCHG 4AFQA 1A1RA 3WY8A 2VVCA 3Q76A 1EXFA 1G2LA 2VIOA 2ZFTA 3DSGA 4XBDA 2FOGA 2VIDA 4WMFA 2A2QH 3RC4A 3RU4T 2ASUB 2VBCA 2KAIA 4FOUC 5C1YA 1FXYA 3M5OA 1W12U 1UVSH 1BRCE 2Z3EA 1A2CH 4H42U 4TY7A 1TAWA 2HALA 1BTWA 1ELDE 4FUIA 3T2NA 1FY5A 1G3CA 4NIVA 4I32A 3G01A 2GJGA 3IITA 2BVXH 2SNWA 4U32A 5JBAS 4IC6A 2A7HA 1QB9A 1GVZA 4X2VA 1UVOA 3FOAA 2GV6A 1GDNA 2ZWLH 2P3TB 4AG2A 1GCTB 4WWYA 4X6NA 1XXDA 3P70B 1S5SA 4YXWD 3OSYA 2P95A 3TJOA 1O33A 3LJOA 2HVXA 3CNRA 1WQSA 3TH2H 2A5IA 1DY8A 4Y8XA 4ZXYH 2TGTA 1DICA 4Z6AH 1P01A 1O2WA 2OTVA 2ZFRH 3ATMA 3PROA 4ASUD 4Q7ZA 1O5BB 4BAKB 4I86A 2W7SA 4ZKOU 1SBWA 2F9UA 1D9IA 1MZDA 5IDKA 5CHAB 2FOEA 2JIZD 3UFAA 1TLDA 1JRSA 3H7TA 1YLDA 1C1VH 2WUBA 3A7WA 1UVTH 3MQKC 1K1JA 1MQ6A 1S82A 3AAUA 3SV8A 3KNXA 4FUCA 4E05H 3ZZAA 1VR1H 2W3KA 1TNGA 1SKYE 1Z6EA 3SU2A 2H9TH 4YOIA 2FMJA 2FTMA 1GCDA 5JBBS 1LHGH 5G4BA 4H4FA 1JXPA 1AE5A 2SGAA 1ELBA 3RMNH 4XRNA 5BPEA 1CHGA 5GXPA 1FJSA 1SSXA 1T8OA 2CF8H 1O39A 2OC8A 4KTCA 2J34A 2H5DA 3W94A 1ZRBA 3BTKE 1AKSA 2V35A 2D2DA 4FUGA 1VJAU 1O2SA 4WY3A 5T3HA 3PLPA 2QE7D 3M7QA 1O2UA 3F3BA 1ELAA 1ETTH 1HUTH 4JZEH 3UTUH 1C2JA 5E2OA 4GCHF 1DWBH 1RJXB 2FOFA 4CRBA 1PPZA 1NC6A 2VB0A 3UOUA 4ABBA 5A0CA 3ZZ4A 3A81A 3GDVA 1GHAF 4CH8B 2R2WU 1O0DH 2TBSA 3AW0A 1ZGVA 1FPHH 2QF3A 3SV9A 1UTOA 3S0NA 1YKTA 1C4V2 5DP9A 1E79D 1K1NA 2R3UA 3BG4C 2M2AA 3MNBA 3LT3A 1O3NA 1EJAA 1WOFA 3NUMA 3ESTA 2BYAX 2Z9GA 2FOCA 4A92A 4CRCA 1P0SH 1GMHF 1BQYA 1NM6A 4FUDA 4CRDA 1EPTA 1ZRKA 4O03A 4O9VA 3U1IB 2ZHEH 1T8MA 1MH0A 2HNTC 3ZVGA 4OS4A 1MU8B 1UTNA 4FU9A 3MOCA 3OEHD 4JZ1A 5FXLA 3E6PH 3URDA 1XKAC 1K21H 2CHAB 2ZI2H 3W1EA 1A0JA 2ZO3H 1TOCB 4YOJA 1NROH 5C0TA 1O5DH 3GCHB 1CA0C 3MMGA 2XRCA 2UUYA 3M35A 2B9LA 1IAUA 2PKSC 3DA9B 1C5ZB 3TGKE 2V6NA 2GTBA 2FXRA 1RRKA 1AMHA 1D4PB 2F43B 4Y71A 2QAAA 5A8ZA 2ZDLA 3ZZ7A 1BBRH 1T4VH 1C9PA 1P3CA 2R3YA 4DY7B 2O8UA 3U1JB 3LKWA 1P2JA 3MFJA 2KCOA 1H8HD 1DWCH 3PTBA 5FAHA 2BLVA 3BTHE 4M9FA 3SUGA 2Y5HA 9ESTA 1Y3YA 3ATWA 4NCYA 2ZFSA 4ZUHA 1SLVB 4RSPA 2BHGA 1JIMA 1O2IA 5J4SA 4XD7D 5JPMH 5EU8A 3EE0B 1GBHA 3GY3A 3UUZA 3F9FA 2VWLA 2IOTA 1UTKA 1GMCF 2FESH 2O9QA 5H4IB 3OAAD 1BCUH 3D65E 1TWXB 1SOZA 5DSFA 1BT7A 1GJ4H 1BTYA 4AB8A 4B71A 1B7XB 1C5YB 5GIBA 2W26A 2J9NA 2B8OH 3GY8A 4MQAA 4O3UA 4K69A 1EAUA 4NA9H 1G37A 3BTTE 3LH3A 3ZZDA 1GI7B 5DP5A 1SHHB 3K9XB 1UTPA 1BJVA 2YNBA 1O5CB 3BIVH 2WPHS 2QXIA 1BTPA 3RXBA 4WXVA 2DE8A 3RXQA 3MO6A 4AX9H 4IW4E 1HAYB 1IQIA 3N7EA 1T8LA 6ESTA 3OY6U 2QXGA 1VGCC 1O2OA 3SOSA 1BMFD 1EZXC 3M36A 8GCHG 3OYPA 3V12A 3SNDA 1P3EA 3VGCB 3PMBB 5AF9H 4KTSA 3OEED 2OQ5A 3MO9A 1C5OH 1GBDA 5DP6A 1D3TB 3MH5A 2ZTZA 5HYOA 1RS0A 5FPTA 2H9EH 1ANCA 2HNTF 3TPIZ 4NGAH 2ZU3A 3S9BA 1Z6JH 2ZNKH 1TPOA 1NT1A 1Z7KA 4IGDA 5B6LA 1BDAA 2I6SA 5E8EH 4Q7YA 1O3OA 4RKOB 4AG1A 1CHOF 2QA9E 1OYQA 2FOMB 2SFAA 1GMDF 1O3EA 2BDIA 1EOJA 4ISOA 1N6YA 1C1PA 2Y5FA 3Q3XA 1TX8A 4ABGA 1DITH 2F9BH 1XM1A 4NZQA 1C4U2 3VB4A 3SU1A 4DG4A 3SBKA 1F5KU 4RT1A 3QX5H 1A46H 1HAOH 4SGBE 5FL7D 1OWKA 1FI8A 1TQ7B 5FX6A 1F0RA 1J14A 1GPZA 4NSVA 1L4DA 2BY7X 3SQEE 3WW7A 3Q3KA 2KAIB 1UJ1A 3F0OA 6GCHF 5A8YA 1AZZA 3M37A 4ABDA 1BTHH 3OFND 1THPB 2Z94A 1GJBB 1Y3WA 3ZV9A 1W10U 1WXRA 2F4LA 5JBCS 3RU4D 4XDEA 3SZEA 3VB6A 3ZV8A 2BDYA 1E35B 5EXMA 4Y0YE 1NU7B 1C5MD 1LVBA 2OC7A 1ELFA 1HRTH 2HLCA 5C2ZA 1C5RA 4IBLH 5FBIA 1AUTC 2ZC9H 2FYRA 4AB9A 1FX0B 6CHAB 2VNTA 2J95A 4UFEH 1SGQE 1GBCA 3UIRA 4CRGA 2BD9A 3RXAA 2ODQA 4LK4A 1EJMA 3T25A 2Y7ZA 3V7TA 2V3OH 3PM3A 3EDXB 3LGWA 2HLDD 1AFQB 1DX5M 2UWOA 3F68H 1LMWB 1TGCA 4AC9A 1GBTA 2YMSD 3ZZ3A 1LVMA 1O3PB 1H9HE 1N1LA 3RXJA 1HIAA 2KX4A 2F3CE 3TNTA 4CH2B 3GY2A 1N8OB 2VIWA 2FDAA 2BQ7B 4ESTE 4U2WA 1FONA 1P12E 2ILNA 4Y8YA 5DG6A 1C5TA 1HYLA 1NO9H 1DFPA 3MU1A 3LU9B 1UTQA 4XBBA 1PYTD 3QN7A 3A85A 5IYTA 1TYNA 3PV2A 1J16A 5HIYA 1IQMA 3EA7A 3K6YA 3MHWU 5DPAA 3A7YA 3SUEA 1FY8E 1COWD 1P9UA 1MCVA 1UTLM 2BX3A 2ZPQA 1W0YH 1NRRH 2GZ7A 3VXFH 2AEIH 4XBCA 2FX6A 1ACBE 1LVYA 1S83A 5EJ1A 1P04A 3FANA 1AVXA 2VWOA 3JZ1B 4FU7A 1Z8RA 1ZSLA 4ASHA 1FV9A 1NTPA 4CHAB 2JH6D 1H1BA 3A7ZA 1FZZA 3SU3A 1SPJA 1HGTH 3ZYDA 1GI1A 3S69A 2J38A 3RXPA 2FLBH 2WPMS 2FS9A 1ESAA 1QRWA 2JETB 2ZGCA 5EW2H 1O3HA 1V2TT 4D76A 1JBUH 2HRVA 3U8OH 2OCVB 1Z8JB 1HJAB 1UTJA 2VVVA 1G36A 2JH0D 4NFEA 2BM2A 4H6SB 1SI5H 2VU8E 1VCQA 3HGNA 4FVBA 4GHQA 1YPEH 1C1RA 3E90B 2THFB 5GWZA 1RTFB 1HAIH 2GV7A 2XCFA 1NY22 5EGMA 1RXPA 1DANH 1PPCE 1E1RD 1BRUP 3UWIA 1GDQA 3GCTG 2W6JD 5A0AE 1O36A 1QTFA 4X8VH 4BANB 5LGOA 5GJ4B 1F5LA 3RXUA 4A1VA 4BTTB 1B0EA 2ALPA 1YLCA 2J97A 1LPGB 1EPTB 1TRMA 1X7AC 2BB4A 2PGQB 4ZH8A 1NN6A 1NRPH 1IQNA 1AVWA 2BD5A 2ZQ2A 3JZ2B 4I33A 3IG6B 2QY0B 3A88A 1TGSZ 2O8LA 1L1GA 3U8RH 2FI5E 2Z3DA 1TONA 1TGTA 2GDEH 3PMHB 2XOKD 5ESBA 1NZQH 2AYWA 2ULLA 5J4QA 1BJUA 9LPRA 1C1NA 2QCYA 1A5IA 1K1LA 1QZ8A 1TNHA 3GY5A 1NBMD 3PMAB 2A5KA 3SQHE 3BEUA 2D1JA 1TB6H 1G32B 1SQOA 2BVSH 2OC0A 4MNVA 3SNEA 3LC5A 3FVFB 1EAWA 2CF9H 1OX1A 2GMTC 1HJ8A 1MTWA 1FPCH 3NWUA 1M9UA 5AHGH 5T6FA 3QZRA 4WH6A 2FOAA 1C5WB 3M61U 1O3CA 2FPZA 3MI4A 1O3AA 1MAXA 3OY5U 1PPFE 5A8XA 1DLEA 2LELA 5HKKD 1V2RT 3STIA 2ZU2A 2VJ1A 4Y0ZE 2GCHG 3CENA 3DCLA 1TMBH 1S6FA 2QYIA 5JDUB 4UONA 3F2GA 1BB0B 3QZQA 3A86A 4KGAA 2W3IA 3HGPA 2IPQX 1BTZA 3GCNA 4XE4A 1IQGA 1MQ5A 2C4FH 2PLXA 1LHEH 4D9QA 1SMFE 2IN2A 1GHWH 3E0NB 4AFZA 3TGJE 4NA8A 2M5TA 3HATH 4IN1A 5A0BA 1LTOA 2BXUH 2XYAA 2F83A 4B2AA 1QBVH 4X8TH 5EQQA 1HLTH 3GY7A 1O5AB 1C5NH 1G30B 1RGQA 2ZCLP 4GVUA 4B76A 3DD2H 2OBQA 5DP4A 3RDZA 5K0HA 1K1OA 2ZU5A 4FUHA 3C27B 1G9IE 1SGPE 4AFSA 5EW1H 5A2MH 1O2PA 1SLXB 3FN8A 3PO1C 2ZKSA 4X6MA 1WV7H 2FEQH 2V7QD 2Y6TA 4Y7AA 2XC0A 1ZJKA 1ZPZA 2R0LA 1E34B 1HAZB 2ZPSA 3PWCA 1WBGB 3LH1A 2VWNA 3RM0H 1G2MA 4JZDH 4Y8ZA 1AWFH 1K2I1 1Y5AT 3A8CA 3KQ5A 2A7JA 2A4QA 3RXOA 3PWBA 3LGUA 1UHBA 1WUNH 1OWHA 4AYVB 5LPRA 3RXFA 4YM9A 4ISNA 2RG3A 1YCPM 5LPFA 8GCHF 1XUIA 4ACBA 3E3TA 4MPXA 5C1XA 4X1QU 3ZZ6A 1DSUA 1EATA 2WV5A 5LPEA 1S0RA 3VXEH 3F9HA 5GPIB 4SGAE 4A6LA 1HB0B 1PPBH 3QGJA 4TSFD 2ZIQH 2F9PA 3MNXA 5DP3A 1TQ0B 2R9PA 2WINI 4ABEA 2BDGA 1QIXB 3D62A 1KTSB 3MNSA 1MZAA 1V3XA 3ATLA 1D3DB 1HAVA 2BY9X 1GHVH 3UPEA 4ABAA 1GWAA 3SU6A 3SJ8A 1KYNA 3SJKA 1W7GH 3IWMA 1NRSH 1KMHB 1O2VA 3LGIA 3E8LA 3A7XA 1O3LA 2OUAA 3KQBA 1F0UA 4B73A 3A8DA 3S9CA 2VIPA 4DT4A 2A0QB 1SQTA 1YY3A 2GD4B 3SU0A 4TWYA 3D23A 1F7ZA 2UUKB 1YCPH 5C20A 5C94A 2EA3A 3H7OA 3LGYA 3SW2B 1AFEH 2XC4A 4K8BA 3GOVB 2AIPA 3PRBA 1DOJA 2CJIA 1Y5UT 3SORA 1AWHB 4I7YH 3HKIB 2RDLA 4MNXA 1SGYE 1GI2A 2PHBA 3BG4B 1WU1A 2ZPRA 4MG3A 1SGCA 5B6OA 3M7TA 1GVLA 4GHTA 1C2IA 1FIZA 2BOHB 3QK1A 2OBOA 1KXAA 2EC9H 4X1NU 2BX4A 3P8FA 4YT6H 1TRNA 1IQJA 3LPRA 1W3CA 3UQOA 1HIAB 2XWAA 4PROA 1J17T 1T31A 2WZQA 1TNLA 1YCPK 4Q63A 3UNQA 1CO7E 3LJJA 4YTAA 1ZTLA 4D7GA 1SB1H 1BMAA 3P8NA 1D6RA 2OINA 1O2NA 1QRZA 3MH4A 1EAXA 1CA0B 1CBWC 1THRH 1FN6A 1WSSH 2BY5X 2LNCA 2WPLS 4BXWA 1MTVA 1ESTA 1A0LA 2PKSB 4GLYA 2A32A 4K2YA 1MMJN 3A84A 2JJ2D 5C1UA 4I8HA 4FUBA 4X6OA 4Z0KA 1ZPBA 2A45B 1O2RA 3EA8A 1OWEA 1TALA 4UFFH 1KSNA 3VB5A 2BLOA 1L0ZA 2HPPH 2XC5A 8ESTE 1YPKH 4FUJA 2ZTXA 2Z3CA 5E0GA 1GBBA 1OSSA 1QHRB 3E91A 2FYQA 2BDHA 2ZU1A 4VGCC 1J15A 4ZKRU 4AORA 2WYJA 2SGPE 5KEDA 2FS8A 2G55A 5T1VA 1WTGH 3BTWE 1L1JA 3BF6H 2FODA 1O2TA 3OTPA 1QR3E 2AGGX 4I8KA 3L6PA 3KYFA 4YLUA 3RXVA 1YPJH 1ELTA 3GDSA 1W0JD 4U01A 4A5TS 4YOGA 1V2OT 1AN1E 7GCHF 2IJD1 1MD7A 3OTJE 1GI6A 3EE7A 5I46H 4TYDA 1P2KA 4I8GA 1YC0A 5ETXA 4BTIB 4AZ2B 1L1NA 2GZ9A 1LKBA 1EX3A 3RXIA 1ZHPA 5EPYA 2JH5D 3P6ZB 3RXDA 1C2GA 1AY6H 3SNCA 1RIWC 2CXVA 1DSTA 2CGAA 1C5UA 1D6WA 2ZDMA 3TJVA 2ZHQH 4FUFA 1CU1A 1V2VT 1EQ9A 3FZZA 1DM4B 4RI0A 3I78A 2BLQA 1TPAE 2QC2A 1DVAH 4B6EA 1QL9A 3WWBA 2J94A 4K1SA 4OS5A 3GCTF 4RKJB 4WXIA 3TGIE 1MBMA 2OD3B 1BZXE 2AFQB 1F0TA 1VGCB 2NU2E 2EI6A 1LCYA 1C2MA 2Q6DA 1JOUB 2ZGJA 1BBRK 3RXHA 5C5OA 2DE9A 1OOKB 1IOEA 1SGEE 1O34A 1O2ZA 4UFDH 3SJ9A 2ANKH 1GHXH 1O2QA 3RC5A 2WSSD 1SGTA 2XNDD 4B2CA 3FZDA 2TGPZ 2P8OC 3QTVH 2UUJB 4AFUA 1SR5C 5C0UA 1Y8TA 3VG8A 1BMLA 4X8UH 3GY4A 1VITF 1ELVA 1MAYA 2FOBA 3NXPA 1TMTH 4O97A 4DURA 1V2JT 1SGNE 3TNSA 3R3GB 2TGAA 1P02A 1CGJE 2ZP0H 1ETRH 1NS3A 1MTSA 4CRFA 3TK5A 3BTDE 4J2YB 4MTBA 5C5NA 1OP0A 4E7RG 3TK6A 1RFNA 1LHFH 3FP8E 3M3SA 2B0FA 1CGHA 4TY6A 2Y80A 3SZNA 1O2LA 2SNVA 3F9EA 3PB1E 4ZCNA 2O8TA 1ID5H 4F49A 3HK6B 1TBQH 2GCHF 3GYLB 1OXGA 5T6DA 1XVOA 2R2MB 1GBAA 2BZAA 1NFUA 1DWEH 3DUXH 1KXDA 2AS9A 1QB1A 2BY8X 1EZSC 3HKJB 2Y5GA 3M3VA 4U30A 4XFQA 2J98A 1DXPA 1HCGA 1EB1H 4BAMB 1J8AA 2G00A 1SFQB 4K3JA 2BMGB 3A82A 3BTFE 8KME2 1W8BH 2KFWA 4Q7XA 2NU1E 2ZECA 3B23B 3ODFA 4NA7A 2F9NA 1ZPCA 1V2WT 1NRNH 4LOYH 5FCRA 1OS8A 3DSPA 2PUQH 1OYTH 4ZHAA 2J5UA 3EA9A 4FETA 4A7IB 4ISLA 2ODYB 4K60A 4NIYA 2H2ZA 4ISHH 1GBLA 3N99A 1IQFA 1OWDA 1QJ7B 4K8YA 3SI4H 5JBTA 4I8JA 1UHBB 1ABIH 4INHA
chains in the Genus database with same CATH topology
4DOQA 1EB2A 2GX4A 3SUDA 1NPMA 1EUFA 3A80A 4X2WA 2NWNA 1G3EA 2PSXA 4GAWA 1G3BA 2PKAA 3MH6A 3P17H 1V2NT 1ELGA 2YNAA 1XUGA 3A8AA 1UCYE 1EJNA 3AW1A 3U9AH 3ZVFA 1V2LT 3BEFB 2RCEA 2HPQH 1TA6A 2GKVE 1BHXF 3S7KB 1RTKA 1GHZA 4JK5A 1Z8IB 1HFDA 2XBYA 7LPRA 2FIRH 1GI3A 1ORFA 1HAVB 2B5TB 1IQHA 3GISB 1QJ1B 5EPNA 1SGRE 1GJCB 3H5CB 4KTUA 2CN0H 1GJDB 4ABJA 1ZMLA 4ZKNU 1LPKB 1EZUC 1GJ8B 1U6QA 2PUXB 4H6TA 4DCDA 4MPUA 1MUEB 3ATIA 1PQ7A 1Y3UA 1A5HA 3TJNA 1QB6A 1BITA 1ZSKA 2FP7B 2W7UA 3ZVDA 3SJIA 1ABJH 2P3UB 2WPIS 3A87A 4Q2KA 1KIGH 1HAHH 3UNSA 2C8WB 1Z1JA 4NIXA 1LO6A 1OWJA 3SV2H 3RMOH 3SI3H 2VIQA 3SV6A 5EXNA 1Q31A 1AUJA 3N7OA 4ZHLU 1A0HB 1ETSH 4JZIA 1DWDH 3FP6E 3T26A 2QF0A 2JKHA 3A7VA 1ELEE 7GCHG 1HNEE 4JCNA 1O3JA 1A5GH 1LPZB 2BY6X 4F4OC 1KY9A 2IPHA 3LIWA 2ZGBH 2PWXA 3RXGA 2ZA5A 1PQAA 1OPHB 1GL1A 2QXHA 2STBE 1PYTC 1GBMA 2EI8A 1KXEA 1J9CH 1GJ5H 1MCTA 4KKDA 5DK1A 1YF4A 1C5SA 5F03A 1CT4E 2FZZA 3UOPA 2AH4X 1JWTA 3ZVAA 1FLEE 1V2PT 4I8LA 2PGBB 1C1MA 2G4TA 1L2EA 1C1UH 1ZMNA 5C3NA 1T7CA 1QFKH 3PLBA 1TFXA 2XBVA 1O3BA 2Y82A 3O8CA 4CREA 1DY9A 1GBKA 2BOKA 2GMTB 2A4GA 1BUIA 2ANMH 2F91A 3NZIA 3PTNA 2Z9IA 2BVRH 2GCTC 2PTNA 3K65B 1WTHD 1XUFA 1ZTKA 3RC6A 4DIHH 4ZMAH 1OP2A 4K1EA 1GI9B 3UR9A 2VGCC 5F8XA 1K28D 3SN8A 3T27A 4DIIH 1O3IA 4LXBH 4Y6DA 3OU0A 1VITG 3AVZA 1O3FA 4X6PA 1ARBA 1QJ6B 1CVWH 3L33A 4IMZA 3BTEE 1MTNC 1O3DA 4X8SH 3T29A 3B9FH 1LQDB 1UMAH 1V2ST 2ALVA 1IQKA 2FO9A 4Y10E 4MNYA 2BD8A 3GCOA 4HGCA 4UD9H 5CMXH 1GHBG 1OWIA 2GVFA 4INKA 3VB7A 3URCA 2ZU4A 4JYUH 2NU3E 3BSQA 2GZ8A 1GGDC 3RXMA 2AGEX 2B7DH 2PV9B 4CBNA 2V0BA 4BAHB 1HV7A 4NZLA 3MO3A 1XUHA 1GBFA 3ZZ9A 1FDPA 2UWPA 3PO1B 3RLWH 1H9LB 1JMOH 1ANEA 1V2QT 1SLUB 2BD4A 1A61H 1N6XA 1YPGH 3HPTB 1O31A 1W7XH 4J1YA 4THNH 5ESTE 2R0KA 2O8WA 1W13U 1PJPA 5SGAE 1VITH 1BOQA 3BG8A 1P05A 4NSYA 3ZVCA 4D7FA 1O3MA 1THSH 3ENSB 3MH7A 4DT7B 3RXLA 3RU4E 1CT2E 4WJG2 2I6QA 4TWWA 3EAJA 2BZ6H 2TIOA 4TPYA 4HFPB 3SGQE 1D3PB 2G81E 2H9HA 3K6ZA 3FP7E 1XMNB 1OKXA 1KLTA 4CRAA 3SU5A 1LHCH 3ITIA 2TGDA 1AB9C 4K1TA 5I25A 2P59A 3A7TA 3M5NA 3KIDU 4ZHMU 3LC3A 1AQ7A 2Z9KA 5FBEA 1GJ9B 4AOQA 4DGJA 1S81A 4RN6A 3O8RA 1E36B 1QCPA 1TOMH 5GCHF 2Q6GA 3SJOA 1UVPA 1KTTB 2A2XH 3KQEA 1LHDH 5ABWA 1GJAB 2PSYA 1UCYH 1TRYA 4R8TB 3W95A 1GG6C 4ZKSU 1QA7A 1QY6A 2VH0A 2XXLA 2Z7FE 3ZZ8A 3SHCH 1UVUH 4B1TA 2AIQA 4HTCH 3E1XB 1OP8A 3LDXH 4AYYB 2LPRA 3EYDA 5FCKA 2OLGA 3QUMP 5L2YH 1FAKH 1A3BH 1DE7H 2ZG0H 3DFJA 1UK4A 1WYKA 1BTUA 1O2HA 5E0HA 2V3HH 2BXTH 2XTTB 2ZTYA 1P57B 1QRXA 1QGFA 2QXJA 1MU6B 1O5GH 3VFEA 3RUOA 4MDSA 1SOTA 1PQ8A 3RXKA 2O8MA 1KXBA 1E37B 3K2UA 1HBTH 2A31A 1W14U 3BN9A 4JMYA 3RM2H 1ARCA 4IMQA 3I29A 1O2JA 4Q80A 3UY9A 4HI3A 1SGIB 1ZOMA 1YM0A 1C5PA 2IJOB 3RXRA 1HJ9A 1L4ZA 1W11U 1UCYK 4R0IA 1NFXA 1TMUH 2P94A 3SO3A 3ZZCA 1YBWA 2ZGHA 3ZVBA 2XBWA 1P09A 1FMGA 3QLPH 4AN7A 1QQ4A 2XCNA 5FPSA 3A8BA 2Z6BD 1CE5A 3M7UA 3PYHA 1F0SA 1TABE 4IS5A 3NPSA 2Q6FA 1HPGA 2TPIZ 3Q77A 3PLKA 1C5QA 2A4OA 3TH3H 1F5RA 3AASA 3UWJH 1DDJA 4FXGH 4WMEA 5LH8A 3ODDA 1GCTC 2ZEBA 1ZR0A 3KEEA 1KLJH 1UK3A 4CR5A 1AZ8A 2PKAB 1P10A 5CE1A 1GBEA 2QN5T 4BNRA 1CBWB 5E2PA 2BLWA 2WPKS 1ESBA 1YPHE 3OX7U 4CR9A 2ZQ1A 1C4Y2 2A1DB 5EQSA 1PPEE 2BDCA 3KN2A 4TPIZ 2XBXA 5T6GA 3RXCA 1P2OA 2STAE 1C1WH 1A4WH 4D8NA 5CHAC 1H8DH 2BD2A 3RMLH 1GI8B 3UNRA 2P93A 1KDQA 3R0FA 1C2EA 4A1TA 1S85A 1SVPA 5F8ZA 2FX4A 1TX7A 1C1SA 3SV7A 1GL0E 1TBRH 3HK3B 1O32A 1DLKB 4OS1A 4VGCB 4WMDA 4B75A 4BAOB 1XKBC 4YZUA 1HAXB 1LVOA 4LZ4B 3TJUA 3LOXA 3TLOA 2ZFPH 1PQ5A 1E38B 2ZHDA 2ZDAH 4ZAEA 2ZDKA 1WAYB 4GUXA 4X1RU 4X0WU 3ZZBA 5HMAA 3V13A 2VINA 1A7SA 5JB8S 1Q2WA 1FNIA 3T62A 3MU8A 3PMJA 3B8JA 4Y79A 2BD3A 4ZXXH 4GPGA 1IHTH 2FOHA 1GJ6A 3EQ0H 2H6MA 3P95A 2BDAA 3ZZ5A 1E0FD 1S84A 3SHAH 4YO9A 3MU4A 1ANBA 2HOBA 1C5VA 2Y81A 4XSKU 1NU9A 1EKBB 1HAPH 4INLA 1B0FA 1RIWB 5HM9A 5EG4A 2AGIX 3CS0A 4WVPE 4B74A 5A09A 2ZCHP 5HM2A 2C8ZB 2FWWA 5AFYH 1P11E 2FM2A 1ZJDA 4BXSA 3CS7A 4DVAU 3U69H 3DT0H 5F8TA 5GDSH 4JYTA 4YT7H 3T28A 2CV3A 3O8DA 1HXEH 4XOJA 1YGCH 3GYMA 1O37A 4OS6A 5JB9S 1LDTT 1BHXB 4FU8A 1AHTH 2BDBA 4NWKA 5TCAA 1VZQH 1XUJA 2Z9JA 4BAQB 1EP6A 2Q1JA 4X2XA 4BOHA 3D49H 1O5FH 2PTCE 3QWCH 4MLFB 1CSOE 2H5CA 1GBJA 2G5VA 1NFWA 1YP9A 2GDDA 1K1IA 3F6UH 5FHTA 8LPRA 4QT8C 4CBOA 2P8OB 1P2QA 2P3FH 2CHAC 1P2IA 1B5GH 2BQ6B 1FIWA 1BIOA 1KLIH 1QBNA 3GCHC 1ZHRA 4OGXA 1BRBE 1UTMA 2ZFFH 3BTQE 1O38A 4D9RA 4AGJA 1Y3XA 1LKAA 1ZGIA 1ZTJA 1AO5A 1FY3A 5FX5A 2J92A 2ESTE 2ZFQH 1TIOA 3KF2A 3P8GA 1SGFA 1KXFA 4WH8A 1Q3XA 1XX9A 3E0PB 5EOKA 3RXTA 2QIQA 1VCWA 4ABFA 5BRRE 1BMMH 1FUJA 1TNKA 3ATKA 1PPHE 3O8BA 1P2MA 3TU7H 5GCHG 1C1QA 1Z71A 2J2UA 5PTPA 2A4RA 1WCZA 2P16A 1JRTA 5DP7A 4MPWA 2BTCE 2FTLE 2SGQE 2GT8A 1IHSH 1SG8B 1YPLH 2PFEA 4Y76A 5EODA 3ZYEA 2XNIA 3BTGE 5EXLA 4ABIA 3TK9A 3LGVA 1GHBF 3CP7A 7ESTE 3AAVA 1SGDE 5FPYA 4JZFH 2C93B 1XVMA 2ANWA 1FN8A 4Y7BA 1O2KA 3M5MA 4M7GA 4YLQH 1K1PA 1TNIA 3F9GA 4KELA 1O2GH 1TPSA 2D26C 3DHKH 4MPVA 3SNAA 1C5XB 3BTME 2CMYA 3KGPA 2OXSA 5L6NH 1TNJA 3F1SB 1WQVH 1BRAA 2AERH 1GHYH 1TE0A 5DJ7A 1F92A 1AGJA 1AVGH 2UWLA 2F9OA 1NFYA 1W0ZU 2XWBI 3M5LA 3FAOA 2EI7A 1HAGE 3MU0A 1V2UT 5TCCA 4AGKA 5DGJA 1Y59T 3KCGH 1T32A 1DUAA 2F9VA 3RMMH 1SC8U 4I31A 4IC5A 3Q00A 1ZLRA 3VGCC 1RTLA 3VPKA 4IN2A 3MTYA 4OS7A 2ZHFH 1EOLA 1QNJA 1GI5A 3UREA 1UO6A 4X1SU 1XUKA 1DS2E 1GVKB 1AU8A 4JYVH 1K1MA 2HNTE 1TGBA 1NESE 1QA0A 2WYGA 3E16B 3MNCA 3Q3YA 1INCA 4FVDA 2YOLA 3MWIU 1O35A 1O2MA 3P8OA 1S6HA 2BQWB 1SHYA 1Z1IA 5L30H 1ZHMA 3I77A 4UEHH 3P92A 3MU5A 4HZHA 4ISIH 2QV1A 5F6MA 1P03A 2G8TA 3C1KA 1QQUA 1H9IE 3QGNB 2FI4E 4GSOA 1NRQH 1GBIA 1C2KA 1MBQA 4UDWH 1O3GA 2A7CA 2FI3E 4A1XA 1GI0A 1TX6A 3BV9B 4GCHG 2XW9A 3BEIB 3RXEA 3TITA 1QBOA 4UFGH 1GHAG 1MKWH 1ZYOA 2G51A 1S0QA 3LONA 1SGFG 1C5LH 3A83A 5E0JA 1PPGE 3L3TA 2GT7A 2SGDE 5JYIA 1ZZZA 3S9AA 4E06H 1TPPA 2GGVB 2Z9LA 1EZQA 2WPJS 3ELAH 1GMHG 3RP2A 2TRMA 1AE8H 1QURH 1Y3VA 1CA8B 3GICB 3A89A 2RA3A 3QO6A 1C9TA 1DUEA 2SGEE 3U98H 1T8NA 3V3MA 6CHAC 2AMPA 1A3EH 2AMDA 5C67A 3STJA 1TGNA 3TVJB 1XXFA 1JIRA 3UQVA 4DJZB 1MKXH 2G52A 2A5AA 3ZVEA 4B2BA 5K7RA 4ABHA 1AFQC 4OGYA 1V2MT 1MTUA 2C8XB 2C90B 4Y11E 5EQRA 3EGKH 1CT0E 3GY6A 1MKWK 1N8OC 1SL3A 1P8VC 1BMNH 1RD3B 1SQAA 1YPMH 1GI4A 1W2KH 1AKSB 1KDQB 1AD8H 2ZGXH 4BTUB 1O3KA 2UUFB 2ZCKP 5DP8A 2GCTB 1EAIA 4JK6A 5DKMA 2W5EA 3VB3A 3NCLA 2PR3A 4YESB 3U8TH 4K5ZA 2VGCB 2C3SA 1T4UH 1ZSJA 4X2YA 1KXCA 1O5EH 2Y7XA 4NG9H 1HDTH 2OC1A 3KQCA 2FLRH 1CQQA 3NKKA 2VIVA 1SLWB 2OP9A 4NIWA 1PFXC 4UE7H 3UR6A 4ZROA 1MKXK 3SGBE 1MTNB 1P9SA 2EEKA 2DUCA 5HXFA 4CHAC 1Y5BT 1O2XA 1BTXA 2K1QA 4MNWA 3BIUH 3VEQB 3M3TA 1GMCG 1O2YA 1C2FA 3SNBA 1AI8H 1TA2A 1GGDB 1C2DA 1LQEA 2JETC 2ZDNA 4KP0A 2VWMA 2BD7A 2AMQA 2NU0E 4NFFA 1FAXA 5AFZH 1HJAC 3RXSA 3SUFA 5HGGA 2OQUA 1G3DA 1IQEA 4MVNA 3V0XA 1O30A 1FY1A 7KMEH 1DXWA 1FQ3A 3RLYH 1YPHC 3PV4A 1ANDA 3QDZB 3KL6A 2H1UA 1HXFH 2WV4A 2PW8H 4OS2A 3DFLA 2WUCA 3QTOH 5L2ZH 3GDUA 1P2NA 1MD8A 3NK8A 1YYY1 1D3QB 3SU4A 5AVDA 3TH4H 3LGTA 1UK2A 1EASA 1EPTC 4FUEA 2ZDVH 4X1PU 1H8IH 1GDUA 1QL8A 1DT2A 1CGIE 1ZMJA 2ZZUH 1GJ7B 1QL7A 1V6DA 2G4UA 1EP5A 1AB9B 3KHVA 1P06A 1IQLA 5DO4H 1C1OA 2ANYA 2SGFE 3SGAE 1BBRE 1FY4A 1SFIA 1VCPA 2ZHWH 3MYWA 3T5FH 1F2SE 3S7HB 2HWLB 1VJ9U 6LPRA 1CHOG 2C8YB 1GMDG 2J4IA 1V2KT 4DW2U 2G5NA 2D8WA 2VH6A 4LZ1H 4WF8A 2ODPA 1GG6B 1Z8GA 2HGTH 1C1TA 2QGRA 3KQDA 1ELCA 2VVUA 3FFGA 3TIUA 2RA0A 4NWLA 1BA8B 1DPOA 4O3TA 5TJXA 1C2LA 1H4WA 2NU4E 2GP9B 1TBZH 1C2HA 4E7NA 2ZF0H 1K22H 1AIXH 1K9OE 6GCHG 4AFQA 1A1RA 3WY8A 2VVCA 3Q76A 1EXFA 1G2LA 2VIOA 2ZFTA 4XBDA 2FOGA 2VIDA 4WMFA 2A2QH 3RC4A 3RU4T 2ASUB 2KAIA 5C1YA 1FXYA 3M5OA 1W12U 1UVSH 1BRCE 2Z3EA 1A2CH 4H42U 4TY7A 1TAWA 2HALA 1BTWA 1ELDE 4FUIA 3T2NA 1FY5A 1G3CA 4NIVA 4I32A 3G01A 3IITA 2BVXH 2SNWA 4U32A 5JBAS 4IC6A 2A7HA 1QB9A 1GVZA 4X2VA 1UVOA 2GV6A 1GDNA 2ZWLH 2P3TB 4AG2A 1GCTB 4WWYA 4X6NA 1XXDA 3P70B 1S5SA 3OSYA 2P95A 3TJOA 1O33A 3LJOA 2HVXA 1WQSA 3TH2H 2A5IA 1DY8A 4Y8XA 4ZXYH 2TGTA 1DICA 4Z6AH 1P01A 1O2WA 2OTVA 2ZFRH 3ATMA