1FV9A

Crystal structure of human microurokinase in complex with 2-amino-5-hydroxy-benzimidazole
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords UROKINASE
publication title Identification of novel inhibitors of urokinase via NMR-based screening.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fv9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fv9A01
3ATKA 3QN7A 5F8ZA 3LIWA 4TWYA 1Y5UT 3RXRA 3GY6A 1TNKA 3ZV8A 1PPEE 1GBMA 3MNXA 1P9SA 3GISB 1GI2A 2GZ7A 4CH2B 5E0JA 1EB2A 3HK6B 1C5YB 5FBIA 4OS5A 3PO1B 2IOTA 3M5MA 2A2XH 1EAUA 1FZZA 3ZZ8A 4U32A 4X2VA 1E36B 2WV5A 4AB8A 2W7UA 4X6OA 1AVWA 3Q76A 3TNTA 1UVTH 1AB9C 2BTCE 4UE7H 5JBTA 2ZDKA 1C5XB 1QA7A 3QK1A 3MHWU 2RA3A 1SLVB 1A5HA 3ZZ4A 1CBWC 1KXAA 3ITIA 1C5PA 2Z9JA 4KTUA 1GVKB 4JZEH 1WAYB 1OP0A 2ANYA 4H42U 1PFXC 3O8CA 1MKXK 4X1SU 3D23A 2AMPA 1P2OA 1UVUH 1H1BA 1AVXA 1CT4E 1D6RA 1HJ8A 2C8ZB 2TPIZ 2LPRA 3M3SA 5JDUB 1MZDA 4DG4A 2R0LA 1CVWH 1GI4A 1DLEA 1OWKA 1SG8B 4Y8XA 1HJAC 4CRBA 1SLXB 1BBRE 3A7XA 2ZQ1A 1C1UH 3MO6A 3A7WA 1CA0B 1JBUH 3E1XB 4AGJA 4YT7H 1AFQC 1BRCE 2TRMA 3MU5A 1EQ9A 2C8YB 3EGKH 1QJ6B 1NU7B 1TB6H 2ZECA 3MOCA 4ISLA 1YPKH 2ZFQH 1GMCF 1V2LT 2ZHDA 3AW0A 5EQRA 1HXFH 1W14U 3MO9A 4GLYA 1OWHA 1WOFA 1NRNH 1UVPA 2B5TB 1NZQH 1EASA 1ZPZA 1LKAA 2TBSA 1O32A 2VJ1A 4UFGH 2ODYB 3ZZAA 1C1TA 5TJXA 3LOXA 3BTGE 1UCYE 3SU5A 3A82A 2PUQH 3PB1E 1D3PB 1BB0B 1O2MA 5DP9A 5DP4A 3M5LA 4Y76A 2ZHWH 4Y0YE 2G52A 3EQ0H 1C5WB 2WV4A 3NWUA 5FBEA 1C2HA 1FAKH 1BITA 1ETRH 4Z0KA 4AG2A 7LPRA 4AOQA 4ISHH 1BMNH 3HGNA 4LZ1H 1EB1H 3HKJB 5DP6A 2BMGB 3SV9A 1K1IA 1AVGH 5GCHG 1SGFA 2G5NA 1SHHB 2VIPA 2HOBA 3RU4T 1TPPA 4SGAE 3OU0A 3EA8A 3VB3A 1KXBA 2GCHG 1SMFE 2Y5GA 1W0YH 1DICA 3SU1A 5JPMH 1W10U 1DWDH 2VIDA 3ZZDA 2HNTF 1FY1A 1Z8GA 3TGIE 2BQ7B 3MTYA 4MPXA 4A5TS 5ESBA 1HV7A 3KL6A 1TALA 3I29A 2IN2A 2G4TA 4O3UA 3SU0A 3PWBA 1MCVA 2H5CA 2XC4A 1IQNA 3E0NB 4YESB 5ESTE 1OYQA 1UTLM 1HAGE 4WMFA 1C1RA 1WU1A 2BOKA 2OBQA 1O2TA 3RMNH 1GVZA 3DT0H 3PMBB 3GCNA 2AMDA 1XMNB 1QFKH 1O2PA 1QTFA 2CHAC 2CXVA 2FIRH 5E2PA 4YLQH 3CP7A 2GTBA 3EDXB 1QL8A 1YM0A 1C5RA 5JB9S 1A46H 4IBLH 1J14A 1T8LA 4UDWH 1P2JA 1L1JA 5JBAS 4IN2A 2BD7A 4ESTE 3BTEE 1E0FD 2AEIH 2UUKB 1KXDA 5HGGA 3Q3KA 1C1SA 1AHTH 2NU2E 4I31A 4XFQA 5GDSH 1KIGH 1QQ4A 3ZVDA 1TWXB 2H9TH 2B0FA 3B9FH 1ZPCA 1MTNB 1BRAA 2P16A 3ZVFA 2QGRA 2QF0A 1IQFA 1IQEA 1EZXC 4PROA 1VCWA 1AUJA 1UCYH 1LQDB 4J2YB 3UNQA 3SU3A 1MH0A 1BTHH 5E0GA 4X6MA 1DWCH 1A0LA 1C2GA 2G51A 4X1QU 1LHGH 2BDAA 3RXIA 3K6YA 3SJ9A 1MQ5A 1K9OE 2H9HA 2XBWA 3GY5A 2GCTB 3E0PB 3QUMP 3SO3A 1TNJA 3RXCA 2W3KA 4MQAA 9LPRA 3S9BA 3UR6A 4ABDA 1CQQA 4WWYA 2XTTB 2HVXA 4ISNA 1JXPA 3ZVEA 2ZP0H 1XXFA 3ZV9A 2ZGHA 1FI8A 4MNWA 1XUIA 1ELGA 1AO5A 1QNJA 4Z6AH 3K2UA 2GZ9A 3MU1A 3HPTB 4B2AA 3FZZA 4XDEA 4CREA 4FVDA 4NA7A 3A8BA 1DSTA 3BG8A 1BTXA 1K21H 3SBKA 1EPTC 1Y8TA 3MH7A 3U1JB 3SU2A 4K2YA 1O3AA 1DDJA 3F9FA 3FP8E 1KYNA 4I8HA 1C9PA 4XBDA 4YLUA 1BIOA 5HYOA 4SGBE 1JIRA 4FUFA 1EXFA 3UIRA 3F9HA 1GJDB 2GT7A 5F8XA 3DHKH 3FVFB 4JYTA 6CHAB 3RXMA 1H8IH 1C2DA 2ZI2H 2OC8A 4FUCA 3RXDA 1Y3WA 5JBCS 1O3DA 2YNAA 1ZRBA 2ZDNA 2F9OA 3BTTE 1IHTH 1V2NT 4MPWA 2BVSH 2VWLA 2BD3A 1IQJA 1MD7A 2QN5T 4CH8B 1P3CA 3NPSA 1RFNA 4ASHA 1AD8H 1QR3E 5L2ZH 4IC5A 1BMLA 1EAWA 1J9CH 2OD3B 2OP9A 2Y5FA 3SHAH 4DW2U 1K1LA 3VGCC 1MU6B 3TJVA 3BN9A 2DUCA 2STAE 4ZH8A 1GHYH 2BDGA 2ZF0H 1BTUA 3P6ZB 2ZU3A 1TRMA 1HCGA 3MYWA 3VXEH 3GY8A 1QB1A 4AFSA 1QURH 1K1OA 1YPJH 2CGAA 4MNYA 2AYWA 1B0EA 2VWNA 4FUIA 3S9AA 3E8LA 4A1TA 5DGJA 3PMHB 3U8RH 2YNBA 3AAVA 1O34A 1A61H 1XKBC 3BEFB 1O2IA 4BAOB 1HAPH 1LHFH 2JH6D 1N8OB 3GCOA 1ELAA 2FOHA 2QA9E 4TPYA 1OYTH 1KTSB 1MMJN 4H6TA 2W7SA 2STBE 1CGHA 1U6QA 4CRDA 1BHXB 2GMTB 2OC7A 3BSQA 2VWOA 2ALVA 2BDCA 2ANWA 2GDDA 3T2NA 3S7KB 1C5LH 2R2MB 1GMCG 7GCHF 1O5GH 3T5FH 1TABE 2OQ5A 1A5IA 4E05H 5EW1H 1NFWA 1ANCA 2BD4A 2P3TB 4Y8YA 1TX7A 1PPGE 1AKSB 5HM9A 5E8EH 4ABFA 4IMZA 1EX3A 3BTQE 1TE0A 4AZ2B 5GIBA 5C67A 3E6PH 2SGEE 3RLYH 2PSXA 2BQWB 3FZDA 5JB8S 4D7GA 2FOAA 3SUEA 4RKOB 3MU0A 4LZ4B 1UHBB 1VITF 1KLTA 1O2ZA 4A92A 4NG9H 4R0IA 3SQHE 4ZROA 8KME2 2JH0D 1PQ7A 4I8LA 1O3KA 1OS8A 1GJBB 1HAHH 2AERH 2BY9X 1SSXA 1V6DA 2PWXA 1C1OA 1SGIB 5AFZH 1ARBA 1W8BH 1ZRKA 1ZTKA 1B0FA 1GJAB 4THNH 3EE0B 1ACBE 2RA0A 1TAWA 1GBEA 1GCTC 1FY8E 3E90B 4FU8A 2WUCA 2Q1JA 2ZDLA 1F5LA 5EPNA 1AUTC 2VWMA 2SGDE 2PR3A 3UWJH 3QO6A 3R3GB 1V2KT 4FUDA 2BHGA 1E34B 3P8GA 1TONA 2RDLA 1GGDB 3Q3YA 3RC5A 2VGCB 1G2LA 2Z94A 2VVVA 1EAIA 2BLVA 3D62A 4ISIH 1EJAA 2J9NA 2P95A 1MU8B 5EXNA 1YLCA 1GI9B 2FTLE 2B9LA 3VXFH 3TGJE 4JZDH 4F49A 4BXSA 5IDKA 3UQVA 3IG6B 3RXSA 1CSOE 1TPAE 4OS1A 1CGIE 3TGKE 2ZO3H 1GJ7B 4NSYA 2O8TA 4U30A 2D26C 3A89A 3GOVB 2FOMB 2GGVB 1THRH 4NFEA 2UWPA 3N7OA 1SC8U 3M7TA 3F9EA 2ILNA 1HDTH 5DK1A 1GJCB 1INCA 1GI8B 4K60A 2VVUA 4CHAB 2G81E 1G37A 1XKAC 2J2UA 3KN2A 3VB4A 1QL9A 1GJ9B 1P03A 1KY9A 4F4OC 1QIXB 4I8JA 3A86A 1DWBH 3H5CB 1O5AB 1VGCB 4Q7XA 2GVFA 2VH0A 4KELA 5EPYA 1GG6B 4VGCC 3H7OA 5CHAC 2PV9B 4Y8ZA 1SR5C 1JMOH 1BHXF 3IITA 1O2GH 4BXWA 1DFPA 1TMTH 5K7RA 4MG3A 1DITH 4NWLA 1QHRB 4I32A 1GMDF 3S9CA 4CBOA 1V2WT 2FM2A 4Y71A 1UTKA 1ZTJA 3PTNA 2B8OH 1H8DH 1EJNA 2JKHA 4JMYA 3KEEA 2PTCE 4TY6A 2TIOA 1O3IA 4Q7YA 4A1VA 1SI5H 4DT7B 2TGDA 1YPGH 2FLBH 3S0NA 2SGAA 5FPSA 1SGPE 4DVAU 1NRSH 5C2ZA 5F6MA 2BQ6B 1A3EH 1EUFA 1GL1A 1Q3XA 3URDA 5TCAA 2ZU1A 1PYTC 1L2EA 1THSH 3ZVBA 2F83A 3PV4A 5H4IB 1Y5BT 3UOUA 2FLRH 1T8OA 1FXYA 3BEIB 3ZYDA 2GKVE 5HM2A 3S7HB 2FI5E 1A2CH 1O2UA 4NIXA 1C2LA 4UFEH 5IYTA 7ESTE 1QL7A 1O3FA 1JIMA 3KQEA 3U9AH 2QXIA 1D4PB 4IW4E 3KQCA 1OWEA 1C2IA 3A7YA 1G32B 1S82A 1HIAB 2Z9GA 1BT7A 1CU1A 2C4FH 1VCQA 2NU1E 3SV2H 1P2IA 1DLKB 1G3DA 2F91A 4NA9H 2G5VA 1GI3A 1T4UH 1D3TB 3TNSA 5EODA 3M5NA 2XRCA 4IC6A 2ZGJA 3LDXH 1G9IE 3U1IB 1WYKA 1N1LA 1O2VA 3UTUH 1ZR0A 2PKAB 5FX5A 3RXGA 1O2YA 1AFEH 2GD4B 1H4WA 1SLUB 4B76A 1SPJA 4E06H 2O8LA 1PPFE 2BYAX 2AS9A 1MTNC 3DUXH 1XM1A 2G8TA 2P8OC 4HI3A 1GMHF 1FY3A 1ELCA 2LNCA 3A88A 3MU4A 1OP8A 4AX9H 1RIWB 2FTMA 3LPRA 4NFFA 2ZCLP 1MTWA 2ZDAH 1DE7H 1ESTA 3PYHA 1P04A 1QRZA 2GV6A 2HLCA 3SN8A 2GCTC 1JWTA 2ZQ2A 1MUEB 1GJ5H 1FY5A 3LH1A 3DFJA 3TJOA 3SJ8A 2FP7B 1KTTB 5BRRE 1G3EA 2ALPA 1FN8A 5DP8A 3ZVCA 1QB6A 1YPHC 3GY3A 1C2MA 1F7ZA 3QX5H 2ZA5A 1PPHE 1ANDA 2ZC9H 1C4V2 2CF9H 2GZ8A 1C5VA 1A1RA 1W7XH 2BVXH 2A5IA 1ZHPA 3NKKA 2O8WA 3PMJA 1TNLA 2QYIA 2J95A 1UTMA 4X8VH 1O2JA 5EQSA 4D8NA 1K1MA 1C5QA 3AASA 1A7SA 3U8TH 2EI6A 2ZFTA 4NWKA 7GCHG 1UTQA 4DOQA 4WH8A 4ZKNU 1ABIH 2AH4X 3RM0H 1NU9A 1G2MA 3RXVA 4WVPE 1AN1E 2OC0A 2XCFA 3TK6A 2H1UA 3RLWH 3P95A 3P92A 6CHAC 3QTVH 1ETTH 4B1TA 5AFYH 5LGOA 1EP6A 1RTKA 3TVJB 4XOJA 1CGJE 5C1XA 1EJMA 1OWDA 1SGDE 4GPGA 1D3DB 1UK4A 1VITG 1S85A 3BG4C 1MAXA 2BDHA 2XBVA 3DD2H 4OS7A 4AFUA 1P9UA 4DIHH 1C1WH 5FPTA 1O2LA 1QBOA 1UTNA 4ZAEA 1B7XB 4K3JA 4DCDA 3QGNB 1CHOF 2FOBA 1DOJA 1RS0A 2FYQA 4TWWA 2V3OH 4OS6A 2C8WB 1F0RA 1AKSA 1DPOA 2BLOA 3ZYEA 2FDAA 3GY7A 2C8XB 3AVZA 1P2NA 5BPEA 1M9UA 4KTSA 2BD2A 2CF8H 2BX3A 5E0HA 1O3CA 4BAQB 3F9GA 3ZZCA 3V3MA 5A8ZA 1C2KA 4FU9A 1UHBA 5ETXA 3VB5A 3LGTA 3MMGA 1V3XA 1FUJA 1GJ8B 2F9NA 1HPGA 1T4VH 4INHA 1IQHA 2PFEA 3TIUA 1QBNA 2BOHB 1GL0E 3A80A 3MH4A 1PQ5A 1UK2A 3A83A 2WPJS 3RXOA 5FCKA 1E35B 1DX5M 1C4U2 2ZGXH 3SW2B 1P57B 1K22H 2FS9A 4WMEA 1GBCA 1BQYA 3GCHC 1O2RA 4HGCA 2HALA 2FZZA 3VB6A 1O5BB 6GCHG 1WTHD 4B2CA 1AMHA 2BB4A 5GJ4B 2BXTH 4IMQA 2ODPA 1C9TA 2OCVB 1XUJA 2A4OA 3TK9A 8GCHF 2OINA 1O31A 1UTPA 3URCA 4MLFB 1XUGA 3M35A 1SQOA 3B23B 4YOIA 3UQOA 2EEKA 1NO9H 3F1SB 4BAKB 1QGFA 8ESTE 5FXLA 1NC6A 1O3MA 3LGWA 4X8TH 2ESTE 1MCTA 3GICB 1DM4B 4AGKA 3OYPA 1D3QB 1GMDG 1UK3A 4WXVA 1BBRH 2CV3A 2PTNA 4NIVA 3SU4A 1OWIA 2JETB 1FPCH 3M37A 1NFYA 5EXMA 1F0SA 1BMAA 1CT0E 4MVNA 3UNRA 1GGDC 1H9IE 4E7RG 1WV7H 2D8WA 1P01A 3O8RA 1N6XA 3T25A 3A7ZA 1AE5A 1IQKA 1BTZA 3FP6E 1O2QA 3QZRA 4FU7A 5EOKA 5I25A 1C5NH 1G30B 2B7DH 4X6NA 4M7GA 3TH3H 4AFZA 1P0SH 3BTME 3TPIZ 1XUKA 5C1UA 1AB9B 2XXLA 2XBYA 4XE4A 1L0ZA 1RGQA 2A5KA 3K65B 2ZCHP 4OS2A 4A6LA 3DFLA 4O97A 1F5KU 1GHAG 1CBWB 1BDAA 4E7NA 1TQ7B 2OXSA 3UOPA 2BDYA 1A5GH 1MBQA 3L6PA 5F8TA 2OC1A 2XWAA 4IN1A 5C20A 2GT8A 1ZPBA 1ZMLA 1JOUB 1PPCE 1KLJH 2FOFA 1FNIA 4HTCH 2THFB 1EP5A 1EZSC 4GHQA 1EZUC 2ZCKP 4FUJA 1W2KH 4K5ZA 1NPMA 3RXKA 2FEQH 1SL3A 3OY5U 1BTPA 2VH6A 3E16B 4JYUH 2BD9A 3ODDA 4RSPA 3V13A 2AIQA 1P11E 4X1NU 3ODFA 3GY2A 1V2RT 1XXDA 1E37B 5G4BA 2O8UA 1O5FH 1ZJDA 4HFPB 2CMYA 4X2YA 1HJAB 2QXHA 2ULLA 1EKBB 1QY6A 2J94A 1FMGA 4UFFH 3SJOA 4AN7A 1GBLA 2G4UA 4YO9A 3JZ1B 1XVMA 1TFXA 3D49H 2WYGA 2ZHEH 1RJXB 3RP2A 4ABEA 1OPHB 1GMHG 1MTUA 5EGMA 4CRCA 1V2JT 1HIAA 4U01A 3PWCA 2VIOA 2BD8A 1CHGA 1GHXH 2ZHQH 1ELVA 1S0RA 3RXTA 4AFQA 4BANB 4XSKU 6LPRA 4X0WU 1P02A 2EC9H 1K1PA 5F03A 1DT2A 1C1QA 2Y80A 2F9BH 1SGTA 4ZXYH 2ZGCA 2PKAA 2FYRA 1TNGA 4U2WA 1K2I1 2BZAA 4X6PA 2Y5HA 3STJA 3V12A 3HGPA 1F5RA 3G01A 2BVRH 4INLA 1H9LB 4CRGA 2AIPA 1B5GH 4X1PU 1J8AA 1GBHA 2I6QA 3MU8A 1FV9A 1Y3VA 3BIUH 1LHEH 1RRKA 4DGJA 3PROA 1UJ1A 5K0HA 5T6FA 2Q6GA 2TGAA 1FAXA 1YF4A 1E38B 4O03A 3Q00A 4Y7AA 1XVOA 2VVCA 4DIIH 2ZZUH 4NIYA 1OKXA 1WTGH 3QWCH 2FPZA 1GI6A 1V2UT 4JK5A 3MNCA 2QIQA 2HNTC 1C5MD 1TA2A 1ANEA 3OY6U 3U8OH 3PO1C 1SQAA 1BBRK 2FESH 4ZKRU 4MPVA 1OXGA 2AGEX 3MNBA 2DE9A 3PMAB 2Q6FA 2W3IA 2F9PA 2BDIA 1F0UA 2OQUA 3AAUA 1GBFA 4ABAA 3KCGH 3RM2H 4Y10E 4GCHF 2Y6TA 4AB9A 4I8KA 1SQTA 2H6MA 5HXFA 1HUTH 1SFQB 1Y3UA 1ZYOA 4KGAA 4YZUA 1UCYK 1BJUA 3ELAH 1OP2A 1IHSH 1ZZZA 1S0QA 4GHTA 1HXEH 1RIWC 3M7QA 2VU8E 3RMLH 1HJ9A 2SNVA 1CHOG 2BZ6H 4I33A 4TPIZ 4D76A 3SV6A 2HPQH 3ZZBA 1O2SA 4NZLA 3GDSA 2CHAB 1T7CA 3TK5A 1BOQA 1BRUP 2VIVA 3BTHE 1C5SA 3LU9B 2OBOA 3E91A 4JZFH 3PLKA 5DP3A 1W12U 3KHVA 3SGBE 3SNAA 2VINA 3I77A 2A5AA 3SGQE 5CE1A 5JBBS 1YPMH 3WY8A 1TX8A 5FAHA 1H9HE 3CENA 3EYDA 1G3CA 1V2QT 2PKSB 1CA0C 1GWAA 2P93A 1OX1A 1ESAA 3O8BA 3UY9A 1K1JA 2ZDVH 4YM9A 3GCTG 3Q77A 1NM6A 3RXQA 1CT2E 1GCDA 2ASUB 2BLQA 2EI8A 3SNBA 1O5CB 3Q3XA 1FLEE 1O3JA 2QY0B 1GI7B 6GCHF 4X8SH 2YOLA 1ZHMA 1ELEE 3MWIU 2A45B 8GCHG 1RD3B 2R0KA 1PQAA 4Q2KA 1CO7E 2QC2A 2P94A 4KP0A 4UONA 2AGGX 1S84A 1LPZB 1MQ6A 3SJIA 1YLDA 1O3GA 1C2FA 1O37A 4MPUA 3RXFA 1UTOA 5GWZA 1P09A 1MAYA 2Y7ZA 2CJIA 2A7HA 3RXEA 3O8DA 4CRAA 2IJOB 1EPTB 4BTIB 3GYMA 2QCYA 5AF9H 1QJ1B 2WPIS 1O0DH 1O5DH 5L30H 1GDQA 1SOZA 1P2MA 2J34A 1SLWB 1IQGA 4Q7ZA 1A4WH 3SU6A 1TBZH 1TOCB 2BY8X 1SGYE 4CRFA 1FN6A 5AVDA 1W7GH 1EOJA 4NCYA 2VIQA 3PTBA 1VITH 3TJUA 4TYDA 3SI4H 3ZZ5A 1GHBG 2SGFE 5EW2H 2FODA 2A4GA 1P3EA 1S5SA 2Z3DA 1MBMA 1W11U 4NIWA 2A4QA 3HK3B 1C4Y2 1HYLA 1P05A 2R2WU 4LOYH 1HGTH 2Z9KA 1O2NA 3RU4E 4I8GA 1LVMA 3MI4A 1GHAF 2DE8A 1GJ6A 4JZIA 4J1YA 4NGAH 5DPAA 3T62A 1NRQH 4AYYB 1MTSA 1AI8H 2ZU5A 3EA9A 3T29A 1KDQB 2D2DA 1V2ST 2Y82A 1W0ZU 3QZQA 1FIWA 1O33A 4JCNA 1DXWA 1MZAA 4X2WA 2W26A 1TOMH 1UMAH 1LO6A 5DP5A 2ZU4A 4WH6A 3P70B 1QB9A 1Z71A 4FVBA 4GVUA 1HAYB 2Z7FE 1QBVH 3BV9B 1VR1H 2FX6A 5DJ7A 9ESTA 1TPSA 1ZTLA 2ZNKH 3A87A 1S6HA 1ZGVA 4A1XA 1GDNA 1GI1A 1YCPH 3U69H 2G00A 2P3FH 1WQVH 1HAOH 1NN6A 2PHBA 1O2KA 3LGUA 5TCCA 1Z6EA 1J15A 2XCNA 4ZUHA 2PGQB 3VB7A 1F92A 1TNIA 2O8MA 1GBDA 1VJAU 2WPHS 4MDSA 4YT6H 3I78A 4Q80A 2HWLB 3KQDA 1HAXB 1C5UA 1TA6A 3TITA 4YOJA 5EXLA 1EZQA 1TIOA 1ZSLA 1PPZA 2QAAA 4XBCA 2BY5X 3M3VA 5PTPA 4CR9A 4Y6DA 3UFAA 2H2ZA 2UWOA 3EAJA 1BUIA 4D9QA 4BOHA 5L6NH 3A7VA 1SHYA 5A09A 1G36A 3NCLA 5T3HA 2ANKH 3P8FA 5A0AE 2XWBI 1Z6JH 1Y3XA 2BDBA 4R8TB 1YPLH 1FONA 1GBTA 1GCTB 2EA3A 1K1NA 3D65E 1NY22 2Z3EA 3BEUA 1GBAA 1FDPA 1JRTA 3KNXA 2JH5D 3LJJA 1HFDA 1C5TA 1CA8B 2XW9A 1DY9A 3OX7U 2FS8A 3SORA 1Z8JB 2ZPSA 2M5TA 5EQQA 3UUZA 1EOLA 1TPOA 3BTKE 3TU7H 2SGPE 1DVAH 1C5OH 4K1EA 5FCRA 1LKBA 1LMWB 3ESTA 1XUFA 1T8NA 1HAVB 1ZMJA 1P06A 2J92A 4GCHG 1A0JA 3QGJA 4ABJA 1L4ZA 2HPPH 4B75A 2H9EH 1TMUH 2D1JA 2XBXA 1ESBA 3EA7A 1LVYA 3PM3A 5LPRA 1SB1H 3MO3A 2FXRA 2ZG0H 1ANBA 3GY4A 4GUXA 3RDZA 4HZHA 1TGNA 1C2EA 2R9PA 1BZXE 2WPMS 1DANH 1ELTA 3L3TA 2SGQE 5DG6A 3KGPA 2NWNA 4Y79A 1YCPM 3HATH 2QXGA 3LGYA 1GBIA 1C1VH 2BLWA 1ELFA 1O2WA 3FP7E 1Y5AT 2C93B 4RN6A 4ZKSU 1PJPA 2A32A 2A4RA 5FHTA 2KAIB 1AE8H 1P8VC 4VGCB 1N8OC 4B74A 3UPEA 5CHAB 1V2OT 2TGPZ 1O2XA 1CE5A 2P59A 1MKWH 1AQ7A 3LJOA 5A0CA 1HAIH 2HNTE 2GMTC 2PLXA 3FANA 1LTOA 2ZIQH 2OTVA 1NROH 1O39A 1T32A 3P8NA 1AIXH 2A7JA 1V2VT 3NUMA 4IS5A 1BA8B 5AHGH 2PSYA 2ZFPH 4WY3A 3JZ2B 2A2QH 1KXFA 1SGCA 3UWIA 1S83A 2HGTH 1SGNE 1PPBH 2ZPQA 2SNWA 1T31A 2PGBB 3LC3A 3GCTF 1HRTH 1LPKB 3FAOA 1YCPK 3V7TA 2ZFRH 3C1KA 1Y59T 4OS4A 3BIVH 1QA0A 3LH3A 5DP7A 1BTYA 1GBJA 4CBNA 5B6OA 2UUFB 3ZVAA 2ZTZA 2ZHFH 3RXHA 3KIDU 1BTWA 3M36A 2XYAA 1QJ7B 1EATA 4BNRA 2TGTA 1BMMH 3RXPA 2AGIX 1NTPA 1DUAA 4NA8A 4WXIA 1Z8IB 1DY8A 2FI3E 3SHCH 1X7AC 3SUDA 1Z8RA 3RUOA 2ODQA 3ZZ7A 1O5EH 1Q2WA 1JRSA 2V0BA 2ZDMA 1L1NA 1UVSH 1C1NA 4TY7A 1QRWA 3R0FA 3ATWA 3S69A 1IQIA 1ABJH 2CN0H 1TRNA 2FMJA 1Q31A 2Q6DA 2ZWLH 4FXGH 4GAWA 4OGXA 1O3EA 1GI0A 3F6UH 1GI5A 1O3OA 4ZHAA 5LH8A 1D9IA 1WCZA 2BY7X 3SNEA 3W94A 5JYIA 3M5OA 2VGCC 1TBRH 1LVOA 1QCPA 5C3NA 3GDVA 2Y7XA 1GHZA 2ANMH 4FUBA 1IQMA 1S6FA 1P2KA 1NFXA 4B71A 3W95A 4K8BA 3P8OA 1FJSA 2A0QB 2PKSC 4Y11E 4FUHA 1SGFG 2FX4A 4O3TA 1GHBF 2BM2A 2V6NA 3SGAE 3UR9A 1WBGB 3TLOA 4Y0ZE 1S81A 2P8OB 3BTDE 2IPHA 3ATLA 4ABIA 1EPTA 5C5OA 1IAUA 1YKTA 2OLGA 1GJ4H 1HAZB 1V2PT 7KMEH 1Z1IA 1FQ3A 3NZIA 2AFQB 4AYVB 1ZSKA 5HMAA 4B73A 1HNEE 1V2TT 4WF8A 2BY6X 1GDUA 1AZZA 1GHVH 1O3HA 1IOEA 4CHAC 1O38A 1SGRE 2QV1A 1PYTD 6ESTA 1BCUH 3SJKA 1KXEA 1ARCA 2OUAA 2HRVA 1VGCC 2NU3E 1Z7KA 1GBBA 1P12E 1O2HA 1YPEH 1DSUA 3K9XB 2GX4A 1GG6C 3RC6A 3UREA 5A0BA 3CS7A 1HLTH 4OGYA 3RXBA 3SUFA 3ENSB 4WMDA 3PLPA 4D9RA 2WPKS 1L1GA 2BX4A 1K28D 1AFQB 3A84A 2ZPRA 3ZZ6A 4K69A 1L4DA 3BTFE 5I46H 3DA9B 4JYVH 1KDQA 4ZXXH 5A8YA 4ZHLU 1D6WA 1GVLA 1TNHA 5FX6A 1MKWK 1LCYA 2Z6BD 1SGQE 4UEHH 4AORA 1O36A 1AZ8A 3QTOH 5LPFA 2A7CA 3KQBA 5SGAE 2XC0A 1LHCH 3QDZB 1TBQH 3SZNA 1V2MT 3CS0A 1NT1A 4BAMB 4ZKOU 2PUXB 1TGSZ 3NK8A 3BG4B 3VPKA 3VEQB 4RKJB 3RXAA 4A7IB 3ZZ3A 3GDUA 1MD8A 4UD9H 4XBBA 3RMOH 4YOGA 1F2SE 3L33A 1F0TA 3SV7A 2A31A 2QF3A 4ZHMU 2F3CE 2WPLS 3LONA 3M7UA 4IGDA 1UVOA 3H7TA 4GSOA 1YP9A 1ZGIA 2ZKSA 4ABGA 2RG3A 1YC0A 1LVBA 2VIWA 1YGCH 4NZQA 2FO9A 1HB0B 3LGIA 3SUGA 1G3BA 1O3BA 4KKDA 4X1RU 2H5DA 1UO6A 3MH6A 4DURA 3A7TA 3TH4H 3SOSA 3TH2H 3BF6H 4YTAA 1T8MA 1W13U 1TGTA 2FWWA 3SNDA 1ORFA 4DJZB 1TGBA 1C1MA 3A8CA 1LPGB 1DWEH 2WYJA 1VCPA 1TYNA 2ZFFH 3VFEA 1XUHA 1WQSA 3LKWA 4ABHA 1DS2E 4WJG2 1ETSH 2F9UA 3OTJE 4H4FA 2WINI 4AG1A 5CMXH 5EU8A 1FIZA 3STIA 4JZ1A 1ID5H 2V35A 3GCHB 3T27A 3RXJA 2A1DB 1Z1JA 2XNIA 2ZTYA 3PLBA 4MNVA 3K6ZA 1NRPH 2XC5A 3MNSA 3U98H 1YPHE 2UUYA 1LDTT 4LXBH 1KSNA 3C27B 8LPRA 3AW1A 3LC5A 1C5ZB 1FPHH 3M61U 4LK4A 2SFAA 1Y3YA 2BXUH 2G55A 5C1YA 1LHDH 1C2JA 2Z9IA 1UTJA 5A8XA 2RCEA 1NFUA 1HAVA 1GPZA 2PW8H 3MH5A 1AWHB 3E3TA 1RTFB 1TRYA 2NU4E 5GCHF 2ZFSA 2VB0A 4FUGA 4O9VA 3T28A 5DO4H 1P2QA 4I7YH 2FOGA 2NU0E 3KF2A 1J16A 1SGEE 2BD5A 5EG4A 4INKA 1NS3A 2Z9LA 3V0XA 2K1QA 1YYY1 4K8YA 3RMMH 2GCHF 1VJ9U 4JK6A 1O3NA 5LPEA 2UWLA 3A81A 5FPYA 1ZMNA 1SVPA 1OWJA 1O3LA 2Y81A 2ZEBA 3A8DA 5J4SA 1HBTH 1ZHRA 1THPB 4K1TA 2C90B 1EAXA 3F68H 1ELDE 3RC4A 3ZVGA 2W5EA 3IWMA 3OSYA 2KAIA 2ZU2A 5E2OA 2FI4E 4NSVA 5GPIB 1TX6A 1KXCA 2GP9B 1LQEA 4DY7B 1QQUA 1VZQH 4ISOA 1ZJKA 1AGJA 5T6DA 4ABBA 3SQEE 2Z3CA 1MKXH 2GDEH 3A8AA 3HKIB 1PQ8A 2J38A 5T6GA 4B2BA 1A0HB 1O3PB 4BTTB 1C1PA 2V3HH 2C3SA 2WUBA 1XX9A 1MTVA 1O2OA 1A3BH 1IQLA 4CR5A 1ZSJA 2P3UB 3LGVA 2AMQA 4D7FA 3RU4D 1W3CA 3RXUA 2R3UA 4Y7BA 1AY6H 2VNTA 3BTWE 4FUEA 4MNXA 5GXPA 4UFDH 1BJVA 3QLPH 3TJNA 1ZLRA 1SOTA 1P10A 3B8JA 3SI3H 3M3TA 2ZTXA 1AU8A 1OOKB 3A85A 1O30A 1NESE 3NXPA 3UNSA 1RXPA 2UUJB 2R3YA 1KLIH 2ZGBH 4QT8C 1ZOMA 1TGCA 1AWFH 3SV8A 1SBWA 5J4QA 1OSSA 1ELBA 1GBKA 2EI7A 5DKMA 2I6SA 5ABWA 5C5NA 1O35A 2FOEA 3T26A 3VGCB 3SNCA 5L2YH 4KTCA 1TMBH 4BTUB 2GV7A 1YBWA 1J17T 1RTLA 4ZMAH 2O9QA 4MTBA 1QRXA 2F9VA 1N6YA 1NRRH 4H6SB 1TLDA 3ZZ9A 4X2XA 1FY4A 3ATMA 2J4IA 3LT3A 3ATIA 4BAHB 1DUEA 3RXLA 5A2MH 3GYLB 3FFGA 3P17H 1WSSH 1BRBE 4K1SA 1GHWH 4X8UH 1DXPA 2FOCA 1TQ0B 3MFJA 1WUNH 2QXJA 1SFIA 2JETC
chains in the Genus database with same CATH superfamily
3ATKA 3QN7A 5F8ZA 3LIWA 4TWYA 5KECA 1Y5UT 3RXRA 3GY6A 1TNKA 3ZV8A 1PPEE 1GBMA 3MNXA 1P9SA 3GISB 1GI2A 2GZ7A 4CH2B 5E0JA 1EB2A 3HK6B 1C5YB 5FBIA 4OS5A 3PO1B 2IOTA 3M5MA 2A2XH 1EAUA 1FZZA 3ZZ8A 4U32A 4X2VA 1E36B 2WV5A 4AB8A 2W7UA 4X6OA 1AVWA 3Q76A 3TNTA 1UVTH 4AC9A 1AB9C 2BTCE 4UE7H 5JBTA 2ZDKA 1C5XB 1QA7A 3QK1A 3MHWU 2RA3A 1SLVB 1A5HA 3ZZ4A 1CBWC 1KXAA 3ITIA 1C5PA 2Z9JA 3OEED 4KTUA 1GVKB 4JZEH 1WAYB 1OP0A 2ANYA 4H42U 1PFXC 3DCLA 3O8CA 1MKXK 4X1SU 3D23A 1QZ8A 2AMPA 1P2OA 1UVUH 1H1BA 1AVXA 1CT4E 1D6RA 1HJ8A 2C8ZB 2TPIZ 2LPRA 3M3SA 5JDUB 1MZDA 4DG4A 2R0LA 1CVWH 1GI4A 1DLEA 1OWKA 1SG8B 4Y8XA 1HJAC 4CRBA 1SLXB 1BBRE 3A7XA 2ZQ1A 1C1UH 3MO6A 2OK5A 3A7WA 1CA0B 1JBUH 3E1XB 4AGJA 4YT7H 1AFQC 1BRCE 2TRMA 2QF4A 1EQ9A 3MU5A 2C8YB 3EGKH 1QJ6B 3WWFA 1NU7B 1TB6H 2ZECA 3MOCA 4ISLA 1YPKH 2ZFQH 1GMCF 1V2LT 2ZHDA 3AW0A 5EQRA 1HXFH 1W14U 3MO9A 4GLYA 1OWHA 1WOFA 1NRNH 1UVPA 2B5TB 1NZQH 1EASA 1ZPZA 1LKAA 2TBSA 1O32A 2VJ1A 4UFGH 2ODYB 3ZZAA 1C1TA 5TJXA 3LOXA 3BTGE 1UCYE 3SU5A 3A82A 2PUQH 3PB1E 1D3PB 1BB0B 1O2MA 5DP9A 2WV9A 5DP4A 3M5LA 4Y76A 2ZHWH 1W0JD 4Y0YE 2G52A 3EQ0H 1C5WB 2WV4A 3NWUA 5FBEA 1C2HA 1FAKH 1BITA 1ETRH 4Z0KA 4AG2A 7LPRA 4AOQA 4ISHH 1BMNH 3HGNA 4LZ1H 1EB1H 3HKJB 5DP6A 2BMGB 3SV9A 1K1IA 1AVGH 5GCHG 1SGFA 2G5NA 1SHHB 2VIPA 2HOBA 3RU4T 1TPPA 4SGAE 3OU0A 3EA8A 3VB3A 1KXBA 2GCHG 1SMFE 2Y5GA 1W0YH 1DICA 3SU1A 5JPMH 1W10U 1DWDH 2VIDA 3ZZDA 2HNTF 1FY1A 1Z8GA 3TGIE 2JJ1D 2BQ7B 3MTYA 4MPXA 4A5TS 5ESBA 1HV7A 3KL6A 1TALA 3I29A 2IN2A 2G4TA 4O3UA 3SU0A 3PWBA 1MCVA 2H5CA 2XC4A 1IQNA 3E0NB 4YESB 5ESTE 1OYQA 1UTLM 1HAGE 4WMFA 1C1RA 1WU1A 2BOKA 2OBQA 1O2TA 3RMNH 1GVZA 3DT0H 3PMBB 3GCNA 2AMDA 1XMNB 3WW7A 1QFKH 1O2PA 1QTFA 2CHAC 2CXVA 2FIRH 5E2PA 4YLQH 3EE7A 3CP7A 2GTBA 3EDXB 1QL8A 2CK3D 1YM0A 1C5RA 5JB9S 1A46H 4IBLH 1J14A 1T8LA 4UDWH 1P2JA 1L1JA 5JBAS 4IN2A 2BD7A 4ESTE 3BTEE 1E0FD 2AEIH 4ASUD 2UUKB 1KXDA 5C94A 5HGGA 3Q3KA 1C1SA 1AHTH 2NU2E 4I31A 4XRNA 4XFQA 5GDSH 1KIGH 1QQ4A 3ZVDA 1TWXB 2H9TH 2B0FA 3B9FH 1ZPCA 1MTNB 1BRAA 2P16A 3F3BA 3ZVFA 2QGRA 2QF0A 1IQFA 1IQEA 1EZXC 4PROA 1VCWA 1AUJA 1UCYH 1LQDB 4J2YB 3UNQA 3SU3A 1MH0A 1BTHH 5E0GA 4X6MA 1DWCH 1A0LA 1C2GA 2G51A 4X1QU 1LHGH 2BDAA 3RXIA 3K6YA 3SJ9A 1MQ5A 1K9OE 2H9HA 2XBWA 3GY5A 2GCTB 3E0PB 3QUMP 3SO3A 1TNJA 3RXCA 2W3KA 4MQAA 9LPRA 3S9BA 3UR6A 4ABDA 1CQQA 2J5UA 4WWYA 2XTTB 2HVXA 4ISNA 1JXPA 3ZVEA 2ZP0H 1XXFA 3ZV9A 2ZGHA 1FI8A 4MNWA 1XUIA 1ELGA 4YXWD 1AO5A 1QNJA 4Z6AH 3K2UA 2GZ9A 3MU1A 3HPTB 4B2AA 3FZZA 4XDEA 4CREA 4FVDA 4NA7A 1NBME 3A8BA 1DSTA 3BG8A 1BTXA 1K21H 3SBKA 2RFKC 1EPTC 1Y8TA 3MH7A 3U1JB 3SU2A 4K2YA 1O3AA 1DDJA 3F9FA 3FP8E 1KYNA 4I8HA 1C9PA 4XBDA 4YLUA 2JDID 1BIOA 5HYOA 4SGBE 1JIRA 4FUFA 1EXFA 3UIRA 3F9HA 1GJDB 2GT7A 5F8XA 2IJD1 3DHKH 3FVFB 4JYTA 6CHAB 3RXMA 1H8IH 1C2DA 2ZI2H 2OC8A 4FUCA 3RXDA 1Y3WA 5JBCS 1O3DA 2YNAA 1ZRBA 2ZDNA 2F9OA 3BTTE 1IHTH 1V2NT 4MPWA 2BVSH 2VWLA 2BD3A 1IQJA 1MD7A 2QN5T 4CH8B 1P3CA 3NPSA 5C0UA 1RFNA 4ASHA 1AD8H 1QR3E 5L2ZH 4IC5A 1BMLA 1EAWA 1J9CH 2OD3B 2OP9A 2Y5FA 3SHAH 3PRBA 4DW2U 1K1LA 3VGCC 1MU6B 3TJVA 3BN9A 2DUCA 2STAE 4ZH8A 3KYFA 1GHYH 2BDGA 2ZF0H 1BTUA 3P6ZB 2ZU3A 1TRMA 1HCGA 3MYWA 3UB0A 3VXEH 3GY8A 1QB1A 4AFSA 1QURH 1K1OA 1YPJH 2CGAA 4MNYA 2AYWA 1B0EA 2VWNA 4FUIA 3S9AA 3E8LA 4A1TA 5DGJA 3PMHB 3U8RH 2YNBA 3AAVA 1O34A 1A61H 1XKBC 3BEFB 4B6FA 1O2IA 4BAOB 1HAPH 1LHFH 2JH6D 1N8OB 3GCOA 1ELAA 2FOHA 2QA9E 4TPYA 1OYTH 2KZ4A 1KTSB 1MMJN 1E1QD 4H6TA 2STBE 2W7SA 2KCPA 1CGHA 1U6QA 4CRDA 1BHXB 5C0TA 2GMTB 2OC7A 3BSQA 2VWOA 2ALVA 2BDCA 2ANWA 2GDDA 3T2NA 3S7KB 1C5LH 2R2MB 1GMCG 7GCHF 1O5GH 3T5FH 1TABE 2OQ5A 1A5IA 4E05H 5EW1H 1NFWA 1ANCA 2BD4A 2P3TB 2K8IA 4Y8YA 3OAAD 1TX7A 1PPGE 1AKSB 5HM9A 5E8EH 4ABFA 4IMZA 1EX3A 3BTQE 1TE0A 4AZ2B 5GIBA 5C67A 3E6PH 2SGEE 3RLYH 2PSXA 2BQWB 3FZDA 5JB8S 4D7GA 2FOAA 3SUEA 4RKOB 3MU0A 4LZ4B 1UHBB 2WZQA 1VITF 1KLTA 1O2ZA 4A92A 4NG9H 4R0IA 3SQHE 4ZROA 8KME2 2JH0D 1EFRD 1PQ7A 4I8LA 1O3KA 1OS8A 1GJBB 1HAHH 2AERH 2BY9X 1SSXA 1V6DA 2JIZD 2PWXA 1C1OA 1SGIB 5AFZH 1ARBA 1W8BH 1ZRKA 1ZTKA 1B0FA 1GJAB 4OM9A 4THNH 3EE0B 1ACBE 5EIYA 2RA0A 1TAWA 1GBEA 1GCTC 1FY8E 3E90B 4FU8A 2WUCA 2Q1JA 2ZDLA 1F5LA 5EPNA 1AUTC 2VWMA 2SGDE 2PR3A 3UWJH 3QO6A 3R3GB 1V2KT 4FUDA 2BHGA 1E34B 3P8GA 1TONA 2RDLA 1GGDB 3Q3YA 3RC5A 2VGCB 1G2LA 2Z94A 2VVVA 1EAIA 3KQ5A 2BLVA 3D62A 4ISIH 1EJAA 2J9NA 2P95A 1MU8B 4M9FA 5EXNA 1YLCA 2KCYA 1GI9B 2FTLE 2B9LA 3VXFH 3TGJE 4JZDH 4F49A 4BXSA 5IDKA 3UQVA 3IG6B 3RXSA 1CSOE 1TPAE 2L74A 1CGIE 4OS1A 3TGKE 2ZO3H 1GJ7B 4NSYA 2O8TA 4U30A 2D26C 3A89A 3GOVB 2FOMB 2GGVB 1THRH 4NFEA 2UWPA 3N7OA 1SC8U 3M7TA 2KM0A 3F9EA 2ILNA 2L6OA 1HDTH 3N99A 5DK1A 1GJCB 1INCA 1GI8B 4K60A 2VVUA 4CHAB 5EJ1A 2G81E 1G37A 1XKAC 2J2UA 3KN2A 3VB4A 1QL9A 1GJ9B 1P03A 1KY9A 4F4OC 1QIXB 5CHBA 4I8JA 3A86A 1DWBH 3H5CB 1O5AB 1VGCB 4Q7XA 2GVFA 2VH0A 4KELA 5EPYA 1GG6B 4VGCC 3H7OA 5CHAC 2PV9B 4Y8ZA 1SR5C 1JMOH 1BHXF 2HVYB 3IITA 1O2GH 4BXWA 1DFPA 1TMTH 5K7RA 4MG3A 1DITH 4NWLA 1QHRB 4I32A 1GMDF 3S9CA 4CBOA 1V2WT 2FM2A 4Y71A 5GNDA 1UTKA 1ZTJA 3PTNA 2B8OH 1H8DH 2IPQX 1EJNA 2JKHA 2YMSC 5KGOA 4JMYA 3KEEA 2PTCE 4TY6A 2TIOA 1O3IA 4Q7YA 3UAIC 4A1VA 1SI5H 4DT7B 2TGDA 1YPGH 2FLBH 3S0NA 2SGAA 5FPSA 1SGPE 4DVAU 1NRSH 5C2ZA 5F6MA 2BQ6B 1A3EH 1EUFA 1GL1A 1Q3XA 3URDA 5TCAA 2ZU1A 1PYTC 1L2EA 1THSH 3ZVBA 2F83A 3PV4A 5H4IB 1Y5BT 3UOUA 2FLRH 1T8OA 1FXYA 3BEIB 3ZYDA 2GKVE 5HM2A 3S7HB 2FI5E 1A2CH 1O2UA 4NIXA 1C2LA 3SZEA 4UFEH 5IYTA 3PRDA 7ESTE 1QL7A 2KFWA 1O3FA 1JIMA 3KQEA 3U9AH 2QXIA 1D4PB 4IW4E 3KQCA 1OWEA 1C2IA 3A7YA 1G32B 1S82A 1HIAB 2Z9GA 1BT7A 1CU1A 2C4FH 1VCQA 2NU1E 3SV2H 1P2IA 1DLKB 1G3DA 2F91A 4NA9H 2G5VA 1GI3A 1T4UH 1D3TB 3TNSA 5EODA 3GS9A 3M5NA 2XRCA 4IC6A 2ZGJA 3LDXH 1G9IE 3U1IB 1WYKA 3FN8A 1N1LA 1O2VA 3UTUH 1ZR0A 2PKAB 5FX5A 3RXGA 1O2YA 1AFEH 2GD4B 1H4WA 1SLUB 4B76A 1SPJA 4E06H 2O8LA 2EQNA 1PPFE 2BYAX 3DSPA 2AS9A 1MTNC 3DUXH 1XM1A 2G8TA 2P8OC 4HI3A 5DN6D 1GMHF 1FY3A 1ELCA 2LNCA 3A88A 3MU4A 1OP8A 4AX9H 1RIWB 2FTMA 3LPRA 4NFFA 2EY4C 2ZCLP 1MTWA 2ZDAH 1DE7H 1ESTA 3PYHA 4F55A 1P04A 1QRZA 2GV6A 2HLCA 3SN8A 2GCTC 1JWTA 2ZQ2A 1MUEB 1GJ5H 1FY5A 3LH1A 3DFJA 3TJOA 3SJ8A 2FP7B 1KTTB 5BRRE 1G3EA 2ALPA 1FN8A 5DP8A 3ZVCA 1QB6A 1YPHC 3GY3A 1C2MA 1W0KD 1F7ZA 3QX5H 2XOKD 2ZA5A 1PPHE 1ANDA 2ZC9H 1C4V2 2CF9H 2GZ8A 1C5VA 1A1RA 1W7XH 2BVXH 2A5IA 1ZHPA 3NKKA 2O8WA 3PMJA 1TNLA 2QYIA 2J95A 1UTMA 4X8VH 1O2JA 5EQSA 4D8NA 1K1MA 1C5QA 3AASA 1A7SA 3U8TH 2EI6A 2ZFTA 4NWKA 7GCHG 1UTQA 2XNDD 4DOQA 4WH8A 4ZKNU 1ABIH 2AH4X 3RM0H 1NU9A 1G2MA 3RXVA 4WVPE 1AN1E 2OC0A 2XCFA 3TK6A 2H1UA 3RLWH 3P95A 3N7EA 3P92A 1OHHD 6CHAC 3QTVH 1ETTH 4B1TA 5AFYH 5LGOA 1EP6A 1RTKA 3TVJB 4XOJA 1CGJE 5C1XA 1EJMA 1OWDA 1SGDE 4GPGA 1D3DB 1UK4A 2LELA 1VITG 1S85A 3BG4C 1MAXA 2BDHA 2XBVA 3DD2H 4OS7A 4AFUA 1P9UA 4DIHH 1C1WH 5FPTA 1O2LA 1QBOA 1UTNA 4ZAEA 1B7XB 4K3JA 4DCDA 3QGNB 1CHOF 2FOBA 1DOJA 1RS0A 2FYQA 4TWWA 2V3OH 2LP6A 4OS6A 2C8WB 1F0RA 1AKSA 1DPOA 2BLOA 3ZYEA 2FDAA 3GY7A 2C8XB 3AVZA 1P2NA 5BPEA 1M9UA 4KTSA 2BD2A 2CF8H 2BX3A 5E0HA 1O3CA 4BAQB 3F9GA 3ZZCA 3V3MA 5A8ZA 1C2KA 4FU9A 1UHBA 5ETXA 3VB5A 3LGTA 3MMGA 1V3XA 5EJLA 1FUJA 1GJ8B 2F9NA 1HPGA 1T4VH 4INHA 1K0HA 1IQHA 2PFEA 3PV2A 4B6EA 4RI0A 3TIUA 1QBNA 2BOHB 1GL0E 3A80A 3MH4A 1PQ5A 1UK2A 3A83A 2WPJS 3RXOA 5FCKA 1E35B 1DX5M 1C4U2 2ZGXH 3SW2B 1P57B 1K22H 2FS9A 4WMEA 1GBCA 1BQYA 3GCHC 1O2RA 4HGCA 2HALA 2FZZA 3VB6A 1O5BB 6GCHG 1WTHD 4B2CA 1AMHA 2BB4A 5GJ4B 5FL7D 2BXTH 4IMQA 2ODPA 1C9TA 2OCVB 1XUJA 2A4OA 3TK9A 8GCHF 2OINA 1O31A 1UTPA 3URCA 4MLFB 1XUGA 3M35A 1SQOA 3B23B 4YOIA 3UQOA 2EEKA 1NO9H 3F1SB 4BAKB 1QGFA 8ESTE 5FXLA 1NC6A 1O3MA 3LGWA 4X8TH 2ESTE 1MCTA 3GICB 1DM4B 4AGKA 3OYPA 1D3QB 3VG8A 1GMDG 1UK3A 4WXVA 1BBRH 2CV3A 2PTNA 4NIVA 3SU4A 1WDIA 1OWIA 3FO8D 2JETB 1FPCH 3M37A 1NFYA 5EXMA 1F0SA 1BMAA 1CT0E 4MVNA 3UNRA 1COWD 1GGDC 1H9IE 4E7RG 1WV7H 2D8WA 1P01A 3O8RA 1NBMD 1N6XA 3T25A 3A7ZA 1AE5A 1IQKA 1BTZA 3FP6E 1O2QA 3QZRA 4FU7A 5EOKA 5I25A 1C5NH 1G30B 2B7DH 4X6NA 4M7GA 3TH3H 4AFZA 5HKKD 1P0SH 3BTME 3TPIZ 1XUKA 5C1UA 1AB9B 2XXLA 2XBYA 4XE4A 1L0ZA 1RGQA 2A5KA 3K65B 2ZCHP 4OS2A 4A6LA 3DFLA 4O97A 2PP6A 1F5KU 1GHAG 1CBWB 1BDAA 4E7NA 1TQ7B 2OXSA 3UOPA 2BDYA 1A5GH 1MBQA 3L6PA 5F8TA 2OC1A 2XWAA 5DSFA 4IN1A 5C20A 2GT8A 1ZPBA 1ZMLA 1JOUB 1PPCE 1KLJH 2FOFA 2WPDD 1FNIA 4HTCH 2THFB 1EP5A 1EZSC 4GHQA 1EZUC 2ZCKP 4FUJA 1W2KH 4K5ZA 1NPMA 3RXKA 2FEQH 1SL3A 3OY5U 1BTPA 2VH6A 3E16B 4JYUH 2BD9A 3ODDA 4RSPA 3V13A 2AIQA 1P11E 4X1NU 3ODFA 3GY2A 1V2RT 1XXDA 1E37B 5G4BA 2O8UA 1O5FH 1ZJDA 4HFPB 2CMYA 4X2YA 1HJAB 2QXHA 2ULLA 1EKBB 1QY6A 2J94A 1FMGA 4UFFH 3SJOA 4AN7A 1GBLA 2G4UA 4YO9A 3JZ1B 1XVMA 1TFXA 5KEDA 3D49H 2WYGA 2ZHEH 1RJXB 3RP2A 4ABEA 1OPHB 1GMHG 1MTUA 5EGMA 4CRCA 1V2JT 1HIAA 4U01A 3PWCA 2VIOA 2BD8A 1CHGA 1GHXH 2ZHQH 1ELVA 2GJGA 1S0RA 3RXTA 4AFQA 4BANB 4XSKU 6LPRA 4X0WU 1P02A 2EC9H 1K1PA 5F03A 1DT2A 1C1QA 2Y80A 4DT4A 2F9BH 1SGTA 4ZXYH 2ZGCA 2PKAA 3FKSD 2FYRA 1TNGA 4U2WA 1K2I1 2BZAA 4X6PA 2Y5HA 3STJA 3V12A 3HGPA 1F5RA 3G01A 2BVRH 4INLA 1H9LB 4CRGA 2AIPA 1B5GH 4X1PU 1J8AA 1GBHA 2I6QA 3MU8A 1FV9A 1Y3VA 3BIUH 1LHEH 1RRKA 4DGJA 3PROA 1UJ1A 5K0HA 5T6FA 2Q6GA 2TGAA 1FAXA 1YF4A 1E38B 4O03A 3Q00A 4Y7AA 1XVOA 2V3MA 2VVCA 4DIIH 2ZZUH 4NIYA 1OKXA 1WTGH 3QWCH 2FPZA 1GI6A 1V2UT 4JK5A 3MNCA 2QF5A 2QIQA 2HNTC 1C5MD 1TA2A 1ANEA 3OY6U 3U8OH 3PO1C 1SQAA 1BBRK 2FESH 4ZKRU 4MPVA 2J98B 1OXGA 2AGEX 3MNBA 2DE9A 3PMAB 2Q6FA 2W3IA 2F9PA 2BDIA 1F0UA 2OQUA 3AAUA 1GBFA 4ABAA 3KCGH 3RM2H 4Y10E 4GCHF 2Y6TA 4AB9A 4I8KA 1SQTA 2H6MA 5HXFA 1HUTH 1SFQB 1Y3UA 1ZYOA 4KGAA 4YZUA 1UCYK 1BJUA 3ELAH 2JJ2D 1OP2A 1IHSH 1ZZZA 2W6JD 3CNRA 1S0QA 4GHTA 1HXEH 1RIWC 3M7QA 2VU8E 3RMLH 1HJ9A 2SNVA 1CHOG 2BZ6H 4I33A 4TPIZ 4D76A 3SV6A 2HPQH 2KCAA 3ZZBA 1O2SA 4NZLA 3GDSA 2CHAB 1T7CA 3TK5A 1BOQA 1BRUP 2VIVA 3BTHE 1C5SA 3LU9B 2OBOA 3E91A 4JZFH 3PLKA 5DP3A 1W12U 3KHVA 3SGBE 3SNAA 2VINA 3I77A 2A5AA 3SGQE 5CE1A 5JBBS 1YPMH 1S6LA 3WY8A 1H8ED 1TX8A 5FAHA 1H9HE 3CENA 3EYDA 1G3CA 1V2QT 2PKSB 1CA0C 1GWAA 2P93A 1OX1A 2WHXA 1ESAA 3O8BA 3UY9A 1K1JA 2ZDVH 4YM9A 3GCTG 3Q77A 3OFND 1NM6A 3RXQA 1CT2E 1GCDA 2ASUB 2BLQA 2EI8A 3SNBA 1O5CB 3Q3XA 1FLEE 1O3JA 2QY0B 1GI7B 6GCHF 4X8SH 2YOLA 1ZHMA 1ELEE 3MWIU 2A45B 8GCHG 1RD3B 2R0KA 1PQAA 5HIYA 4Q2KA 1CO7E 2QC2A 2P94A 4KP0A 4UONA 2AGGX 1S84A 1LPZB 1MQ6A 3SJIA 1YLDA 1O3GA 4XD7D 1C2FA 1O37A 4MPUA 3RXFA 1UTOA 5GWZA 1P09A 3AK5A 1MAYA 2Y7ZA 2CJIA 2A7HA 3RXEA 3O8DA 4CRAA 2IJOB 3F2GA 1EPTB 4BTIB 3DSGA 1VKYA 3GYMA 2QCYA 5AF9H 1QJ1B 2WPIS 1O0DH 1O5DH 5L30H 1GDQA 1SOZA 1P2MA 2J34A 1SLWB 5EJZA 1IQGA 4Q7ZA 1A4WH 3SU6A 1TBZH 1TOCB 2BY8X 1SGYE 4CRFA 1FN6A 5AVDA 1W7GH 5IK2D 1EOJA 4RT1A 4NCYA 2VIQA 3PTBA 1VITH 3TJUA 4TYDA 3SI4H 3DSOA 3ZZ5A 1GHBG 2SGFE 2W6ID 5EW2H 2FODA 2A4GA 1P3EA 1S5SA 2Z3DA 1MBMA 1W11U 4NIWA 2A4QA 1E79D 3HK3B 1C4Y2 1HYLA 1P05A 2R2WU 4LOYH 1HGTH 2M2AA 2Z9KA 1O2NA 3RU4E 4I8GA 1LVMA 3MI4A 1GHAF 2DE8A 1GJ6A 4JZIA 4J1YA 4NGAH 5DPAA 3T62A 1NRQH 4AYYB 1MTSA 1AI8H 2ZU5A 3EA9A 3T29A 1KDQB 2D2DA 1V2ST 2Y82A 1W0ZU 3QZQA 1FIWA 1O33A 4JCNA 1DXWA 1MZAA 4X2WA 2W26A 1TOMH 1UMAH 1LO6A 5DP5A 2ZU4A 4WH6A 3P70B 1QB9A 1Z71A 3F0OA 4FVBA 4GVUA 1HAYB 2Z7FE 1QBVH 3BV9B 1VR1H 2FX6A 5DJ7A 9ESTA 1TPSA 1ZTLA 2ZNKH 3A87A 1YY3A 1S6HA 1ZGVA 4A1XA 1GDNA 1GI1A 1YCPH 3U69H 2G00A 2P3FH 1WQVH 1HAOH 1NN6A 2PHBA 1O2KA 3LGUA 5TCCA 1Z6EA 1J15A 2XCNA 4ZUHA 2PGQB 3VB7A 1F92A 1TNIA 2O8MA 1GBDA 1VJAU 2WPHS 4MDSA 4YT6H 3I78A 4Q80A 4FETA 2HWLB 3KQDA 1HAXB 1C5UA 1TA6A 3TITA 4YOJA 5EXLA 1EZQA 1TIOA 1YLNA 1ZSLA 1PPZA 2QAAA 4XBCA 2BY5X 3M3VA 5PTPA 4CR9A 4Y6DA 3UFAA 2H2ZA 2UWOA 3EAJA 1BUIA 4D9QA 4BOHA 5L6NH 3A7VA 1SHYA 5A09A 1G36A 3NCLA 5T3HA 2ANKH 3P8FA 5A0AE 2XWBI 1Z6JH 3OEHD 1Y3XA 1YWUA 2BDBA 2KCOA 2QE7D 1YPLH 4R8TB 1FONA 1GBTA 1GCTB 2EA3A 1K1NA 3D65E 1NY22 2Z3EA 3BEUA 1GBAA 1FDPA 1JRTA 3KNXA 4I86A 2JH5D 3LJJA 1HFDA 3F2HA 1C5TA 1CA8B 2XW9A 1DY9A 3OX7U 2FS8A 3SORA 1Z8JB 2ZPSA 2M5TA 5EQQA 3UUZA 4F48B 1EOLA 1TPOA 4P02A 1WXRA 3BTKE 3TU7H 2SGPE 1DVAH 1C5OH 4K1EA 4P00A 1LKBA 5FCRA 1LMWB 3ESTA 1XUFA 1T8NA 1HAVB 1ZMJA 1P06A 2J92A 4GCHG 1A0JA 3QGJA 4ABJA 4TT3D 5CDFE 1L4ZA 2HPPH 4B75A 2H9EH 1TMUH 4TSFD 2D1JA 2XBXA 1ESBA 3EA7A 1LVYA 3PM3A 5LPRA 1SB1H 3MO3A 2FXRA 2ZG0H 1ANBA 3GY4A 4GUXA 4HG6A 3RDZA 4ACBA 4HZHA 1TGNA 1C2EA 2R9PA 1BZXE 2WPMS 1DANH 1ELTA 3L3TA 2SGQE 5DG6A 3KGPA 2NWNA 4Y79A 1YCPM 3HATH 2QXGA 3LGYA 1GBIA 1C1VH 2BLWA 1ELFA 1O2WA 2J98A 3FP7E 1Y5AT 2C93B 4RN6A 4ZKSU 1PJPA 2A32A 2A4RA 5FHTA 2KAIB 1AE8H 1P8VC 4VGCB 1N8OC 4B74A 3UPEA 5CHAB 1V2OT 2TGPZ 1O2XA 1CE5A 2P59A 1MKWH 1AQ7A 3LJOA 5A0CA 1HAIH 2HNTE 2GMTC 2PLXA 3FANA 1LTOA 2ZIQH 2OTVA 1NROH 1O39A 1T32A 3P8NA 1AIXH 2A7JA 1V2VT 3NUMA 4IS5A 1BA8B 5AHGH 2PSYA 5HIZA 2HLDD 2ZFPH 4WY3A 2YMSB 2A2QH 3JZ2B 1KXFA 1SGCA 3UWIA 1S83A 2HGTH 1SGNE 3F2FA 1PPBH 2ZPQA 2SNWA 1T31A 2PGBB 3LC3A 3GCTF 1HRTH 1LPKB 3FAOA 5C17A 1YCPK 3V7TA 2ZFRH 3C1KA 1Y59T 4OS4A 3BIVH 1QA0A 3LH3A 5DP7A 1BTYA 1GBJA 4CBNA 5B6OA 2UUFB 3ZVAA 2ZTZA 2ZHFH 3RXHA 3KIDU 1BTWA 3M36A 2XYAA 1QJ7B 1EATA 4BNRA 1E1RD 2TGTA 1BMMH 3RXPA 4ZCNA 2AGIX 1NTPA 3OTPA 1DUAA 4NA8A 4WXIA 1Z8IB 1DY8A 2FI3E 3SHCH 1X7AC 3SUDA 1Z8RA 3RUOA 2ODQA 3ZZ7A 1O5EH 1Q2WA 1JRSA 2V0BA 2ZDMA 1L1NA 1UVSH 1C1NA 4TY7A 2VBCA 1QRWA 3R0FA 3ATWA 3S69A 1IQIA 1ABJH 2CN0H 1TRNA 2FMJA 1Q31A 2Q6DA 2ZWLH 3KYGA 4FXGH 4GAWA 4OGXA 1O3EA 1GI0A 3F6UH 1GI5A 1O3OA 4ZHAA 5LH8A 1D9IA 1WCZA 2BY7X 3SNEA 3W94A 5JYIA 3M5OA 2VGCC 1TBRH 2RDEA 1LVOA 1QCPA 5C3NA 3GDVA 2Y7XA 1GHZA 2ANMH 3NRLA 4FUBA 1IQMA 1S6FA 1P2KA 1NFXA 4B71A 3W95A 4K8BA 3P8OA 1FJSA 2A0QB 2PKSC 4Y11E 4FUHA 1SGFG 2FX4A 4O3TA 1GHBF 2BM2A 2V6NA 3SGAE 3UR9A 1WBGB 3TLOA 4Y0ZE 1S81A 2P8OB 3BTDE 4Q63A 2IPHA 3ATLA 4ABIA 1EPTA 3FOAA 5C5OA 2YMSD 1BMFD 1IAUA 1YKTA 2OLGA 1GJ4H 1HAZB 1V2PT 7KMEH 1Z1IA 1FQ3A 3NZIA 2AFQB 4AYVB 1ZSKA 5HMAA 4B73A 1HNEE 1V2TT 4WF8A 2BY6X 1GDUA 1AZZA 1GHVH 1O3HA 1IOEA 4CHAC 1O38A 1SGRE 2QV1A 1PYTD 6ESTA 1BCUH 3SJKA 1KXEA 1ARCA 2OUAA 2HRVA 1VGCC 2NU3E 1Z7KA 1GBBA 1P12E 1O2HA 1YPEH 1DSUA 3K9XB 2GX4A 1GG6C 3RC6A 3UREA 5A0BA 3CS7A 1HLTH 4OGYA 3U28C 3RXBA 3SUFA 3ENSB 4WMDA 3PLPA 4D9RA 2WPKS 1L1GA 2BX4A 1K28D 1AFQB 3A84A 2ZPRA 3N7DA 3ZZ6A 4K69A 1L4DA 1MABB 3BTFE 4Z1MD 5I46H 3DA9B 4JYVH 1KDQA 4ZXXH 5A8YA 4ZHLU 1D6WA 1GVLA 1TNHA 5FX6A 1MKWK 1LCYA 2Z6BD 1SGQE 4UEHH 4AORA 1O36A 1AZ8A 3QTOH 5LPFA 2A7CA 3KQBA 5SGAE 4RT0A 2XC0A 2KR7A 1LHCH 3QDZB 3WWBA 1TBQH 3SZNA 1V2MT 3CS0A 1NT1A 4BAMB 4ZKOU 2PUXB 1TGSZ 3NK8A 3BG4B 3VPKA 3VEQB 3ZIAD 4RKJB 3RXAA 4A7IB 3ZZ3A 3GDUA 1MD8A 4UD9H 4XBBA 3RMOH 4YOGA 1F2SE 3L33A 1F0TA 3SV7A 2A31A 2QF3A 4ZHMU 2F3CE 2F43B 2WPLS 3LONA 3M7UA 4IGDA 1UVOA 2V7QD 3H7TA 4GSOA 1YP9A 1ZGIA 2ZKSA 4ABGA 2RG3A 1YC0A 1LVBA 2VIWA 1YGCH 2J97A 1FX0B 4NZQA 2FO9A 1HB0B 3LGIA 3SUGA 1G3BA 1O3BA 4KKDA 2WSSD 4X1RU 2H5DA 1UO6A 3MH6A 4DURA 3A7TA 3TH4H 3SOSA 3TH2H 3BF6H 4YTAA 1T8MA 1W13U 1TGTA 2FWWA 3SNDA 1ORFA 4DJZB 1TGBA 1C1MA 3A8CA 1LPGB 1DWEH 2WYJA 1VCPA 1TYNA 2ZFFH 3VFEA 1XUHA 1WQSA 3LKWA 3F0PA 4ABHA 1DS2E 4WJG2 1ETSH 2F9UA 3OTJE 4H4FA 2WINI 4AG1A 5CMXH 5EU8A 1FIZA 3STIA 4JZ1A 1ID5H 2V35A 3GCHB 3T27A 3RXJA 2A1DB 1Z1JA 2XNIA 2ZTYA 3PLBA 4MNVA 3K6ZA 1NRPH 2XC5A 3MNSA 4FOUC 3U98H 1YPHE 2UUYA 1LDTT 3H09A 4LXBH 1KSNA 3C27B 8LPRA 3AW1A 3LC5A 1C5ZB 1FPHH 3M61U 4LK4A 2SFAA 1Y3YA 2BXUH 2G55A 5C1YA 1LHDH 1C2JA 2Z9IA 1UTJA 5A8XA 2RCEA 1NFUA 1HAVA 1GPZA 2PW8H 3MH5A 1AWHB 3E3TA 1RTFB 1TRYA 2NU4E 5GCHF 2ZFSA 2VB0A 4FUGA 4O9VA 3T28A 5DO4H 1P2QA 4I7YH 2FOGA 2NU0E 3KF2A 1J16A 1SGEE 2BD5A 5EG4A 4INKA 1NS3A 2Z9LA 3V0XA 2K1QA 1YYY1 4K8YA 5T1VA 3RMMH 2GCHF 1VJ9U 4JK6A 1O3NA 5LPEA 2UWLA 3A81A 5FPYA 1ZMNA 1SVPA 1OWJA 1O3LA 2Y81A 2ZEBA 3A8DA 5J4SA 1HBTH 1ZHRA 3PV5A 1THPB 4K1TA 2C90B 1EAXA 3F68H 1ELDE 3RC4A 3ZVGA 2W5EA 3IWMA 3OSYA 2KAIA 2ZU2A 5E2OA 2FI4E 3SYJA 4NSVA 5GPIB 1TX6A 3W1EA 1KXCA 2GP9B 1LQEA 4DY7B 1QQUA 3OE7D 1VZQH 4ISOA 1ZJKA 1AGJA 5T6DA 4ABBA 3SQEE 2Z3CA 1MKXH 2GDEH 3A8AA 3HKIB 1PQ8A 2J38A 5T6GA 4B2BA 1A0HB 1O3PB 4BTTB 1C1PA 2V3HH 2C3SA 2WUBA 1XX9A 1MTVA 1O2OA 1A3BH 1IQLA 4CR5A 1ZSJA 2P3UB 2F4LA 3LGVA 2AMQA 4D7FA 3RU4D 1W3CA 3RXUA 2R3UA 4Y7BA 1AY6H 2VNTA 3BTWE 4FUEA 4MNXA 4ACAA 5GXPA 4UFDH 1BJVA 3QLPH 3TJNA 1ZLRA 1SOTA 1P10A 3B8JA 3SI3H 3M3TA 2ZTXA 3MQKC 1AU8A 1OOKB 3A85A 1O30A 1NESE 1UW7A 3NXPA 3UNSA 1RXPA 2UUJB 1SQRA 2R3YA 1KLIH 2ZGBH 4QT8C 1ZOMA 1TGCA 1AWFH 3SV8A 1SBWA 5J4QA 1OSSA 5B6LA 1ELBA 1GBKA 2EI7A 5DKMA 2I6SA 5ABWA 2AHME 5C5NA 1O35A 2FOEA 3T26A 3VGCB 3SNCA 5L2YH 4KTCA 1TMBH 4BTUB 4Q4LA 2GV7A 1YBWA 2K0QA 1J17T 1RTLA 4ZMAH 2O9QA 4MTBA 1QRXA 2F9VA 1N6YA 1NRRH 4H6SB 1TLDA 3ZZ9A 4X2XA 1FY4A 3ATMA 2J4IA 1H8HD 3LT3A 3ATIA 4BAHB 1DUEA 3RXLA 5A2MH 3GYLB 3FFGA 2KX4A 3P17H 1WSSH 1BRBE 4K1SA 1GHWH 1KMHB 4X8UH 1DXPA 2FOCA 1TQ0B 5F53A 3MFJA 1SKYE 1WUNH 2QXJA 1SFIA 2JETC
chains in the Genus database with same CATH topology
3ATKA 3QN7A 5F8ZA 3LIWA 4TWYA 1Y5UT 3RXRA 3GY6A 1TNKA 3ZV8A 1PPEE 1GBMA 3MNXA 1P9SA 3GISB 1GI2A 2GZ7A 4CH2B 5E0JA 1EB2A 3HK6B 1C5YB 5FBIA 4OS5A 3PO1B 2IOTA 3M5MA 2A2XH 1EAUA 1FZZA 3ZZ8A 4U32A 4X2VA 1E36B 2WV5A 4AB8A 2W7UA 4X6OA 1AVWA 3Q76A 3TNTA 1UVTH 1AB9C 2BTCE 4UE7H 5JBTA 2ZDKA 1C5XB 1QA7A 3QK1A 3MHWU 2RA3A 1SLVB 1A5HA 3ZZ4A 1CBWC 1KXAA 3ITIA 1C5PA 2Z9JA 4KTUA 1GVKB 4JZEH 1WAYB 1OP0A 2ANYA 4H42U 1PFXC 3O8CA 1MKXK 4X1SU 3D23A 2AMPA 1P2OA 1UVUH 1H1BA 1AVXA 1CT4E 1D6RA 1HJ8A 2C8ZB 2TPIZ 2LPRA 3M3SA 5JDUB 1MZDA 4DG4A 2R0LA 1CVWH 1GI4A 1DLEA 1OWKA 1SG8B 4Y8XA 1HJAC 4CRBA 1SLXB 1BBRE 3A7XA 2ZQ1A 1C1UH 3MO6A 3A7WA 1CA0B 1JBUH 3E1XB 4AGJA 4YT7H 1AFQC 1BRCE 2TRMA 3MU5A 1EQ9A 2C8YB 3EGKH 1QJ6B 1NU7B 1TB6H 2ZECA 3MOCA 4ISLA 1YPKH 2ZFQH 1GMCF 1V2LT 2ZHDA 3AW0A 5EQRA 1HXFH 1W14U 3MO9A 4GLYA 1OWHA 1WOFA 1NRNH 1UVPA 2B5TB 1NZQH 1EASA 1ZPZA 1LKAA 2TBSA 1O32A 2VJ1A 4UFGH 2ODYB 3ZZAA 1C1TA 5TJXA 3LOXA 3BTGE 1UCYE 3SU5A 3A82A 2PUQH 3PB1E 1D3PB 1BB0B 1O2MA 5DP9A 5DP4A 3M5LA 4Y76A 2ZHWH 4Y0YE 2G52A 3EQ0H 1C5WB 2WV4A 3NWUA 5FBEA 1C2HA 1FAKH 1BITA 1ETRH 4Z0KA 4AG2A 7LPRA 4AOQA 4ISHH 1BMNH 3HGNA 4LZ1H 1EB1H 3HKJB 5DP6A 2BMGB 3SV9A 1K1IA 1AVGH 5GCHG 1SGFA 2G5NA 1SHHB 2VIPA 2HOBA 3RU4T 1TPPA 4SGAE 3OU0A 3EA8A 3VB3A 1KXBA 2GCHG 1SMFE 2Y5GA 1W0YH 1DICA 3SU1A 5JPMH 1W10U 1DWDH 2VIDA 3ZZDA 2HNTF 1FY1A 1Z8GA 3TGIE 2BQ7B 3MTYA 4MPXA 4A5TS 5ESBA 1HV7A 3KL6A 1TALA 3I29A 2IN2A 2G4TA 4O3UA 3SU0A 3PWBA 1MCVA 2H5CA 2XC4A 1IQNA 3E0NB 4YESB 5ESTE 1OYQA 1UTLM 1HAGE 4WMFA 1C1RA 1WU1A 2BOKA 2OBQA 1O2TA 3RMNH 1GVZA 3DT0H 3PMBB 3GCNA 2AMDA 1XMNB 1QFKH 1O2PA 1QTFA 2CHAC 2CXVA 2FIRH 5E2PA 4YLQH 3CP7A 2GTBA 3EDXB 1QL8A 1YM0A 1C5RA 5JB9S 1A46H 4IBLH 1J14A 1T8LA 4UDWH 1P2JA 1L1JA 5JBAS 4IN2A 2BD7A 4ESTE 3BTEE 1E0FD 2AEIH 2UUKB 1KXDA 5HGGA 3Q3KA 1C1SA 1AHTH 2NU2E 4I31A 4XFQA 5GDSH 1KIGH 1QQ4A 3ZVDA 1TWXB 2H9TH 2B0FA 3B9FH 1ZPCA 1MTNB 1BRAA 2P16A 3ZVFA 2QGRA 2QF0A 1IQFA 1IQEA 1EZXC 4PROA 1VCWA 1AUJA 1UCYH 1LQDB 4J2YB 3UNQA 3SU3A 1MH0A 1BTHH 5E0GA 4X6MA 1DWCH 1A0LA 1C2GA 2G51A 4X1QU 1LHGH 2BDAA 3RXIA 3K6YA 3SJ9A 1MQ5A 1K9OE 2H9HA 2XBWA 3GY5A 2GCTB 3E0PB 3QUMP 3SO3A 1TNJA 3RXCA 2W3KA 4MQAA 9LPRA 3S9BA 3UR6A 4ABDA 1CQQA 4WWYA 2XTTB 2HVXA 4ISNA 1JXPA 3ZVEA 2ZP0H 1XXFA 3ZV9A 2ZGHA 1FI8A 4MNWA 1XUIA 1ELGA 1AO5A 1QNJA 4Z6AH 3K2UA 2GZ9A 3MU1A 3HPTB 4B2AA 3FZZA 4XDEA 4CREA 4FVDA 4NA7A 3A8BA 1DSTA 3BG8A 1BTXA 1K21H 3SBKA 1EPTC 1Y8TA 3MH7A 3U1JB 3SU2A 4K2YA 1O3AA 1DDJA 3F9FA 3FP8E 1KYNA 4I8HA 1C9PA 4XBDA 4YLUA 1BIOA 5HYOA 4SGBE 1JIRA 4FUFA 1EXFA 3UIRA 3F9HA 1GJDB 2GT7A 5F8XA 3DHKH 3FVFB 4JYTA 6CHAB 3RXMA 1H8IH 1C2DA 2ZI2H 2OC8A 4FUCA 3RXDA 1Y3WA 5JBCS 1O3DA 2YNAA 1ZRBA 2ZDNA 2F9OA 3BTTE 1IHTH 1V2NT 4MPWA 2BVSH 2VWLA 2BD3A 1IQJA 1MD7A 2QN5T 4CH8B 1P3CA 3NPSA 1RFNA 4ASHA 1AD8H 1QR3E 5L2ZH 4IC5A 1BMLA 1EAWA 1J9CH 2OD3B 2OP9A 2Y5FA 3SHAH 4DW2U 1K1LA 3VGCC 1MU6B 3TJVA 3BN9A 2DUCA 2STAE 4ZH8A 1GHYH 2BDGA 2ZF0H 1BTUA 3P6ZB 2ZU3A 1TRMA 1HCGA 3MYWA 3VXEH 3GY8A 1QB1A 4AFSA 1QURH 1K1OA 1YPJH 2CGAA 4MNYA 2AYWA 1B0EA 2VWNA 4FUIA 3S9AA 3E8LA 4A1TA 5DGJA 3PMHB 3U8RH 2YNBA 3AAVA 1O34A 1A61H 1XKBC 3BEFB 1O2IA 4BAOB 1HAPH 1LHFH 2JH6D 1N8OB 3GCOA 1ELAA 2FOHA 2QA9E 4TPYA 1OYTH 1KTSB 1MMJN 4H6TA 2W7SA 2STBE 1CGHA 1U6QA 4CRDA 1BHXB 2GMTB 2OC7A 3BSQA 2VWOA 2ALVA 2BDCA 2ANWA 2GDDA 3T2NA 3S7KB 1C5LH 2R2MB 1GMCG 7GCHF 1O5GH 3T5FH 1TABE 2OQ5A 1A5IA 4E05H 5EW1H 1NFWA 1ANCA 2BD4A 2P3TB 4Y8YA 1TX7A 1PPGE 1AKSB 5HM9A 5E8EH 4ABFA 4IMZA 1EX3A 3BTQE 1TE0A 4AZ2B 5GIBA 5C67A 3E6PH 2SGEE 3RLYH 2PSXA 2BQWB 3FZDA 5JB8S 4D7GA 2FOAA 3SUEA 4RKOB 3MU0A 4LZ4B 1UHBB 1VITF 1KLTA 1O2ZA 4A92A 4NG9H 4R0IA 3SQHE 4ZROA 8KME2 2JH0D 1PQ7A 4I8LA 1O3KA 1OS8A 1GJBB 1HAHH 2AERH 2BY9X 1SSXA 1V6DA 2PWXA 1C1OA 1SGIB 5AFZH 1ARBA 1W8BH 1ZRKA 1ZTKA 1B0FA 1GJAB 4THNH 3EE0B 1ACBE 2RA0A 1TAWA 1GBEA 1GCTC 1FY8E 3E90B 4FU8A 2WUCA 2Q1JA 2ZDLA 1F5LA 5EPNA 1AUTC 2VWMA 2SGDE 2PR3A 3UWJH 3QO6A 3R3GB 1V2KT 4FUDA 2BHGA 1E34B 3P8GA 1TONA 2RDLA 1GGDB 3Q3YA 3RC5A 2VGCB 1G2LA 2Z94A 2VVVA 1EAIA 2BLVA 3D62A 4ISIH 1EJAA 2J9NA 2P95A 1MU8B 5EXNA 1YLCA 1GI9B 2FTLE 2B9LA 3VXFH 3TGJE 4JZDH 4F49A 4BXSA 5IDKA 3UQVA 3IG6B 3RXSA 1CSOE 1TPAE 4OS1A 1CGIE 3TGKE 2ZO3H 1GJ7B 4NSYA 2O8TA 4U30A 2D26C 3A89A 3GOVB 2FOMB 2GGVB 1THRH 4NFEA 2UWPA 3N7OA 1SC8U 3M7TA 3F9EA 2ILNA 1HDTH 5DK1A 1GJCB 1INCA 1GI8B 4K60A 2VVUA 4CHAB 2G81E 1G37A 1XKAC 2J2UA 3KN2A 3VB4A 1QL9A 1GJ9B 1P03A 1KY9A 4F4OC 1QIXB 4I8JA 3A86A 1DWBH 3H5CB 1O5AB 1VGCB 4Q7XA 2GVFA 2VH0A 4KELA 5EPYA 1GG6B 4VGCC 3H7OA 5CHAC 2PV9B 4Y8ZA 1SR5C 1JMOH 1BHXF 3IITA 1O2GH 4BXWA 1DFPA 1TMTH 5K7RA 4MG3A 1DITH 4NWLA 1QHRB 4I32A 1GMDF 3S9CA 4CBOA 1V2WT 2FM2A 4Y71A 1UTKA 1ZTJA 3PTNA 2B8OH 1H8DH 1EJNA 2JKHA 4JMYA 3KEEA 2PTCE 4TY6A 2TIOA 1O3IA 4Q7YA 4A1VA 1SI5H 4DT7B 2TGDA 1YPGH 2FLBH 3S0NA 2SGAA 5FPSA 1SGPE 4DVAU 1NRSH 5C2ZA 5F6MA 2BQ6B 1A3EH 1EUFA 1GL1A 1Q3XA 3URDA 5TCAA 2ZU1A 1PYTC 1L2EA 1THSH 3ZVBA 2F83A 3PV4A 5H4IB 1Y5BT 3UOUA 2FLRH 1T8OA 1FXYA 3BEIB 3ZYDA 2GKVE 5HM2A 3S7HB 2FI5E 1A2CH 1O2UA 4NIXA 1C2LA 4UFEH 5IYTA 7ESTE 1QL7A 1O3FA 1JIMA 3KQEA 3U9AH 2QXIA 1D4PB 4IW4E 3KQCA 1OWEA 1C2IA 3A7YA 1G32B 1S82A 1HIAB 2Z9GA 1BT7A 1CU1A 2C4FH 1VCQA 2NU1E 3SV2H 1P2IA 1DLKB 1G3DA 2F91A 4NA9H 2G5VA 1GI3A 1T4UH 1D3TB 3TNSA 5EODA 3M5NA 2XRCA 4IC6A 2ZGJA 3LDXH 1G9IE 3U1IB 1WYKA 1N1LA 1O2VA 3UTUH 1ZR0A 2PKAB 5FX5A 3RXGA 1O2YA 1AFEH 2GD4B 1H4WA 1SLUB 4B76A 1SPJA 4E06H 2O8LA 1PPFE 2BYAX 2AS9A 1MTNC 3DUXH 1XM1A 2G8TA 2P8OC 4HI3A 1GMHF 1FY3A 1ELCA 2LNCA 3A88A 3MU4A 1OP8A 4AX9H 1RIWB 2FTMA 3LPRA 4NFFA 2ZCLP 1MTWA 2ZDAH 1DE7H 1ESTA 3PYHA 1P04A 1QRZA 2GV6A 2HLCA 3SN8A 2GCTC 1JWTA 2ZQ2A 1MUEB 1GJ5H 1FY5A 3LH1A 3DFJA 3TJOA 3SJ8A 2FP7B 1KTTB 5BRRE 1G3EA 2ALPA 1FN8A 5DP8A 3ZVCA 1QB6A 1YPHC 3GY3A 1C2MA 1F7ZA 3QX5H 2ZA5A 1PPHE 1ANDA 2ZC9H 1C4V2 2CF9H 2GZ8A 1C5VA 1A1RA 1W7XH 2BVXH 2A5IA 1ZHPA 3NKKA 2O8WA 3PMJA 1TNLA 2QYIA 2J95A 1UTMA 4X8VH 1O2JA 5EQSA 4D8NA 1K1MA 1C5QA 3AASA 1A7SA 3U8TH 2EI6A 2ZFTA 4NWKA 7GCHG 1UTQA 4DOQA 4WH8A 4ZKNU 1ABIH 2AH4X 3RM0H 1NU9A 1G2MA 3RXVA 4WVPE 1AN1E 2OC0A 2XCFA 3TK6A 2H1UA 3RLWH 3P95A 3P92A 6CHAC 3QTVH 1ETTH 4B1TA 5AFYH 5LGOA 1EP6A 1RTKA 3TVJB 4XOJA 1CGJE 5C1XA 1EJMA 1OWDA 1SGDE 4GPGA 1D3DB 1UK4A 1VITG 1S85A 3BG4C 1MAXA 2BDHA 2XBVA 3DD2H 4OS7A 4AFUA 1P9UA 4DIHH 1C1WH 5FPTA 1O2LA 1QBOA 1UTNA 4ZAEA 1B7XB 4K3JA 4DCDA 3QGNB 1CHOF 2FOBA 1DOJA 1RS0A 2FYQA 4TWWA 2V3OH 4OS6A 2C8WB 1F0RA 1AKSA 1DPOA 2BLOA 3ZYEA 2FDAA 3GY7A 2C8XB 3AVZA 1P2NA 5BPEA 1M9UA 4KTSA 2BD2A 2CF8H 2BX3A 5E0HA 1O3CA 4BAQB 3F9GA 3ZZCA 3V3MA 5A8ZA 1C2KA 4FU9A 1UHBA 5ETXA 3VB5A 3LGTA 3MMGA 1V3XA 1FUJA 1GJ8B 2F9NA 1HPGA 1T4VH 4INHA 1IQHA 2PFEA 3TIUA 1QBNA 2BOHB 1GL0E 3A80A 3MH4A 1PQ5A 1UK2A 3A83A 2WPJS 3RXOA 5FCKA 1E35B 1DX5M 1C4U2 2ZGXH 3SW2B 1P57B 1K22H 2FS9A 4WMEA 1GBCA 1BQYA 3GCHC 1O2RA 4HGCA 2HALA 2FZZA 3VB6A 1O5BB 6GCHG 1WTHD 4B2CA 1AMHA 2BB4A 5GJ4B 2BXTH 4IMQA 2ODPA 1C9TA 2OCVB 1XUJA 2A4OA 3TK9A 8GCHF 2OINA 1O31A 1UTPA 3URCA 4MLFB 1XUGA 3M35A 1SQOA 3B23B 4YOIA 3UQOA 2EEKA 1NO9H 3F1SB 4BAKB 1QGFA 8ESTE 5FXLA 1NC6A 1O3MA 3LGWA 4X8TH 2ESTE 1MCTA 3GICB 1DM4B 4AGKA 3OYPA 1D3QB 1GMDG 1UK3A 4WXVA 1BBRH 2CV3A 2PTNA 4NIVA 3SU4A 1OWIA 2JETB 1FPCH 3M37A 1NFYA 5EXMA 1F0SA 1BMAA 1CT0E 4MVNA 3UNRA 1GGDC 1H9IE 4E7RG 1WV7H 2D8WA 1P01A 3O8RA 1N6XA 3T25A 3A7ZA 1AE5A 1IQKA 1BTZA 3FP6E 1O2QA 3QZRA 4FU7A 5EOKA 5I25A 1C5NH 1G30B 2B7DH 4X6NA 4M7GA 3TH3H 4AFZA 1P0SH 3BTME 3TPIZ 1XUKA 5C1UA 1AB9B 2XXLA 2XBYA 4XE4A 1L0ZA 1RGQA 2A5KA 3K65B 2ZCHP 4OS2A 4A6LA 3DFLA 4O97A 1F5KU 1GHAG 1CBWB 1BDAA 4E7NA 1TQ7B 2OXSA 3UOPA 2BDYA 1A5GH 1MBQA 3L6PA 5F8TA 2OC1A 2XWAA 4IN1A 5C20A 2GT8A 1ZPBA 1ZMLA 1JOUB 1PPCE 1KLJH 2FOFA 1FNIA 4HTCH 2THFB 1EP5A 1EZSC 4GHQA 1EZUC 2ZCKP 4FUJA 1W2KH 4K5ZA 1NPMA 3RXKA 2FEQH 1SL3A 3OY5U 1BTPA 2VH6A 3E16B 4JYUH 2BD9A 3ODDA 4RSPA 3V13A 2AIQA 1P11E 4X1NU 3ODFA 3GY2A 1V2RT 1XXDA 1E37B 5G4BA 2O8UA 1O5FH