3NWUA

Substrate induced remodeling of the active site regulates htra1 activity
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
204
structure length
190
Chain Sequence
DPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-induced remodeling of the active site regulates human HTRA1 activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine protease HTRA1
total genus 40
structure length 190
sequence length 204
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nwuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nwuA02
1CGHA 3F68H 4K8YA 4MPUA 2F9VA 7GCHF 2O8LA 4AYVB 3MMGA 2EC9H 1C1PA 3I29A 2PTNA 4JK5A 1C1VH 3SJ9A 1AQ7A 1BHXB 3ZZ3A 1P2NA 1ZRBA 2FPZA 3LDXH 1MQ5A 4ABJA 1QJ6B 2PSYA 5EG4A 2ZC9H 4CBOA 1LVYA 3SO3A 3K6ZA 1BRCE 3GCTG 4KKDA 3RXCA 1YLDA 3BG4C 3PMHB 2XRCA 2ANWA 4CH8B 4E7NA 1BMAA 1TAWA 3OU0A 1MZAA 1E0FD 1NRSH 1PQ5A 1LMWB 2RG3A 4UONA 3GY4A 1IQFA 1FJSA 3OSYA 2WUCA 3K9XB 5TCAA 6GCHF 3FZZA 4AFZA 3HGPA 4I8HA 3EAJA 2AMQA 2R2MB 1S84A 2ZPQA 1ZHPA 1QY6A 1ZGVA 3ZZ4A 1SHHB 1KXBA 2BD7A 1GBMA 1BT7A 3VGCB 3NK8A 2CXVA 3FAOA 3V7TA 2G5VA 1TQ7B 3UY9A 3V13A 1TFXA 1QA0A 3UIRA 1DWCH 1F5RA 2YNAA 1Z6EA 1NFWA 1PQ7A 3E0NB 4X6PA 5AFZH 1FPHH 3NCLA 1W7XH 1TLDA 2AIQA 5E2PA 2FP7B 2Y82A 2Z3EA 1YP9A 1H8IH 2J94A 3PTNA 4NIYA 2SGPE 5LGOA 1C1OA 3KCGH 3MH7A 1IQHA 3NUMA 3BG4B 1DS2E 2NU4E 5T6GA 1GVZA 1THPB 1HGTH 3A89A 3ITIA 3ZVDA 1DUAA 1C1UH 4TPIZ 2ZDMA 3UQVA 1C9PA 3RLYH 1TPSA 5HMAA 1OWHA 2H9HA 1Z8JB 3TNTA 1LPKB 3M3SA 1GJ7B 3L6PA 3VB7A 3QX5H 1A7SA 3PROA 5A8XA 3LJJA 1RXPA 8GCHG 1EX3A 3JZ1B 1HAPH 4F49A 1JWTA 3KQDA 4B75A 2BVSH 2HALA 2ZU2A 2ZO3H 5A09A 3UUZA 4ABBA 1U6QA 1BMLA 1V2UT 3GY2A 1PPHE 2ZDAH 2ANYA 1EATA 3LGIA 5J4QA 1W0ZU 4Y7BA 3N7OA 4K69A 5JBAS 3HK6B 1MTSA 2FTLE 1O36A 3E6PH 5JPMH 2QYIA 2H1UA 1JXPA 2OCVB 2VGCB 2PKSC 1XKAC 1AE8H 1SBWA 4AFQA 4D7FA 2LPRA 1J9CH 4DT7B 3RP2A 3M5NA 2VNTA 3LT3A 3SU6A 1T32A 2P3FH 2C3SA 3A80A 5JBBS 3M35A 1TQ0B 3DUXH 2FX6A 1HAVB 3TK6A 1ELDE 3A7VA 2FO9A 5EQRA 4AFSA 1P2MA 2Z9LA 1FQ3A 1D4PB 3P8NA 1TABE 1ELTA 1F92A 4WH6A 4FU8A 4CR5A 3BEUA 3E91A 4A5TS 1VGCC 1C5ZB 1C1NA 3NPSA 1MZDA 2V3OH 1BTHH 2A32A 4FUEA 1OYTH 3ELAH 5C67A 1WQVH 2GZ8A 2ZP0H 1EB1H 2D1JA 1O2PA 1P2OA 3F1SB 1Z71A 1IQEA 1BZXE 2BY7X 1B5GH 5DP7A 1AZZA 2OINA 3EA7A 3GDSA 1B7XB 2Y6TA 1WQSA 1QIXB 4YLUA 1O3IA 5FHTA 4IGDA 1HUTH 3ZZBA 3DHKH 1TOCB 2A2XH 1GBIA 1C2MA 2ALVA 4X2XA 1WBGB 4FUJA 4BAMB 1GHVH 2XCNA 1TMUH 2R9PA 2PFEA 2A5KA 1KXAA 3UWIA 4B2BA 4YOJA 2GMTB 1LKBA 4XSKU 1GDUA 1KTSB 3MNBA 5CHAB 4YOIA 2ZDKA 2STAE 2WPHS 4LZ1H 1UK3A 1TNJA 1O30A 8GCHF 4D9RA 3M3TA 4JYTA 3QWCH 4ISLA 3ZZ8A 1GMCF 4I8KA 4MNWA 1UCYE 1C5NH 4KTUA 4I31A 2R2WU 4A1VA 5FPSA 1KSNA 1G32B 3KGPA 4QT8C 4TY6A 3W95A 4CRCA 2J2UA 1DM4B 1PQ8A 4B71A 1HB0B 3SV6A 1MCTA 2OQUA 3RC6A 3LGWA 1QQUA 2V35A 1QL7A 1YLCA 3BEIB 4A6LA 1THRH 4AB9A 5I25A 2Z9IA 1PJPA 2ZHFH 2VIQA 4HI3A 1O2ZA 1QHRB 3HATH 1F0SA 1TNLA 1UMAH 2A7HA 4IC6A 1GHAG 3MH5A 1P09A 2NWNA 4Y71A 1WYKA 1O5CB 4MTBA 1O2UA 3KQCA 3E1XB 2J34A 4GCHG 1O33A 1SGYE 1Y3YA 1DOJA 2ZPSA 3AAVA 1C9TA 1AHTH 1YCPM 3LGVA 1VITF 1NRQH 4MLFB 3SORA 3VPKA 1HJ9A 4Y76A 2IJOB 5FPYA 2BOKA 2FWWA 3A82A 1HIAB 2C8YB 1G9IE 1G3CA 1BMNH 3OY5U 3FZDA 1O5FH 2NU3E 3T62A 4LZ4B 5GJ4B 4NZLA 3SJIA 4IMQA 2BD4A 9LPRA 2G81E 2C93B 1AN1E 1N8OB 1MQ6A 4OS7A 3TNSA 2G51A 1BMMH 1YPEH 1ZR0A 1Z7KA 2O8MA 1GBKA 2B0FA 3ZZ9A 2GDDA 1O3OA 1P9SA 1PPGE 1SQTA 3NWUA 1Y59T 4Y79A 4NIVA 4WMDA 1SGQE 2ZNKH 1QTFA 3GY6A 3RXEA 2V3HH 1FV9A 2FOBA 5K7RA 3SGQE 1K9OE 9ESTA 1TGBA 5E0JA 1GCTC 1C5RA 2KAIB 1OYQA 3DA9B 4D8NA 8LPRA 1BIOA 1QRXA 2HWLB 3MO9A 1V2WT 1AMHA 4H6TA 4AZ2B 2BYAX 2XNIA 3U98H 2C8XB 2Z9JA 1E36B 3GDUA 1OWIA 3BTHE 1ANEA 1L0ZA 1YF4A 1S85A 2WYJA 5FX5A 1BQYA 1K22H 3QK1A 5FBIA 1NPMA 4ESTE 1LHEH 5H4IB 1EJAA 1GCTB 2GDEH 3TGJE 1HJAB 5F8TA 5JBCS 4CREA 2VWNA 1UHBA 1D3TB 1TPOA 1IAUA 1OX1A 1EOJA 1TB6H 1QB9A 1S5SA 3PYHA 2XYAA 3SHCH 2GX4A 4FUFA 1TOMH 1UCYH 7ESTE 4YLQH 2WINI 3D23A 1INCA 1DFPA 2SFAA 5GCHF 4Y6DA 5GIBA 5F03A 3SNBA 1TBRH 2CJIA 3LKWA 2RCEA 5B6OA 1CHOG 1AVGH 1BJUA 1NRPH 1HFDA 4U30A 4X0WU 2BY6X 4OS2A 1QL9A 1T8NA 3LC5A 1RIWC 4WXIA 1L4ZA 1CGIE 1BOQA 1GJAB 3HK3B 4X2YA 4ZXXH 4ASHA 1TX6A 4X6OA 1H9IE 2K1QA 3LU9B 3RXKA 3MU8A 4HFPB 1OP2A 2VIOA 2FOHA 2ZHEH 5GDSH 2BQ6B 3MFJA 1XXFA 3MU0A 5T6DA 4K60A 1VGCB 5A0AE 5EXLA 4YT6H 1B0EA 1CHGA 1GJ6A 2O8WA 4DURA 1S0RA 4B2CA 3RC4A 3P6ZB 3RXQA 3C27B 3BTGE 4BANB 5A2MH 1FNIA 5HM9A 3A7TA 2G5NA 1O2QA 1AUTC 1J15A 2P94A 3SUGA 4J2YB 4OS1A 1L2EA 1MUEB 2FOGA 1VCQA 3R3GB 2H6MA 1CSOE 2SGEE 2ZGXH 1G2LA 2Y7ZA 1SQOA 3H5CB 4ZROA 1F0UA 5AVDA 4ABFA 2CN0H 1W14U 1EAXA 1TNHA 4A1XA 4ABEA 1K1IA 6CHAC 1ZYOA 2B9LA 1LHGH 2Y7XA 1SMFE 3RU4D 1TALA 1D9IA 1C1TA 1K1NA 2BY9X 1D6RA 3BN9A 2QAAA 3FP7E 3MH4A 4INHA 1O3DA 2VH6A 1Z8GA 1XM1A 1YYY1 2JETC 4KTCA 1SSXA 3ESTA 3M5MA 2QXHA 1F0TA 1E34B 2SNVA 1Q3XA 1GI4A 1O34A 1V2MT 2FM2A 3EGKH 4SGAE 3A7WA 6LPRA 1FY3A 4NFEA 1UK2A 2P59A 3M36A 3TH4H 2Y5GA 4MDSA 5EXNA 3BTTE 1HAXB 1C5LH 1ELFA 1P57B 2ZHDA 2UWOA 2OC0A 1ABIH 1G3EA 2ULLA 1LVBA 3ODDA 3EQ0H 1MU6B 4ZAEA 1WV7H 3HGNA 1C2EA 3OX7U 1GBCA 1LVOA 4TPYA 2NU1E 4KGAA 5E0HA 3S9AA 4O3UA 3SQEE 3K65B 4GHTA 1LHFH 5HYOA 1T8MA 3VXEH 2R3YA 4R0IA 4UFFH 1E38B 2FOMB 3SUEA 1TRMA 1C1QA 1GJ8B 3KQEA 1O5AB 2BDCA 4ISNA 1GHXH 3GOVB 2ZGJA 2H2ZA 1JBUH 1OWDA 1A0HB 1FY8E 1AWHB 2GKVE 3LGUA 1N1LA 1OWJA 1SLUB 2BDGA 4AG1A 1DWDH 4YOGA 2OLGA 1GJCB 2GT8A 3SGAE 1AWFH 1BITA 2A5IA 2JH5D 3RXUA 3SZNA 5DP5A 3UOUA 4WF8A 4F4OC 1ZHMA 5BRRE 2AS9A 1SPJA 2VGCC 4MPWA 3SNEA 4MQAA 2VVUA 4NSVA 1HJ8A 1EP6A 1AFQC 1HBTH 3MO6A 4XBBA 1BTWA 1FY4A 1V2TT 3RXAA 3K6YA 3ZZ6A 3PLBA 5FAHA 3RXFA 3RXSA 4VGCB 5EGMA 3RM2H 5GPIB 1GI3A 2ZCHP 3TJOA 3SI4H 3E0PB 4XOJA 5HGGA 3SW2B 1AB9B 1GMDG 1C4V2 2ZECA 4UFGH 1ACBE 3MNSA 3RUOA 1CQQA 3U9AH 1C2FA 4LXBH 4NIXA 2P8OC 3L3TA 1YCPH 2ZHWH 1EXFA 4XE4A 3SU0A 3RXDA 1RD3B 3ATLA 1GBEA 1YPLH 2BXTH 1JIRA 2BMGB 2ZCLP 1YPHC 3A8DA 2AGGX 5C5NA 3SV9A 3STIA 5K0HA 3M7TA 1AU8A 1PYTC 1FIWA 5J4SA 2WUBA 3BTWE 3HKJB 1HAOH 3PV4A 2ZF0H 1Y5UT 4BTIB 3IWMA 1V6DA 1A3BH 4WXVA 2ZGBH 5T3HA 1TGTA 2PKAA 1EJNA 2FEQH 1YBWA 3P8GA 1RTKA 1V2KT 4OGYA 2EEKA 1SGPE 3VB3A 3PMAB 3M7UA 5ESBA 3GISB 5GXPA 3ENSB 3ZYDA 1OP0A 3P8FA 1UTNA 3PMBB 2SGDE 4LK4A 4TWYA 1OOKB 4O03A 1Z8RA 3BTFE 3UR6A 1GHBG 3LONA 5JB9S 2PGBB 1CA8B 4XDEA 2GZ9A 1ELAA 1BBRE 3ZVAA 1G3DA 1FAXA 1S82A 1F0RA 1O32A 1XMNB 2LNCA 4YZUA 5I46H 1EZXC 1UCYK 4WH8A 4OS6A 1C5YB 1DUEA 1V2RT 4FVBA 4PROA 1GMHG 2UUYA 5DGJA 1YPGH 1C4Y2 2IPHA 1SFQB 2ZFQH 4I8JA 1C4U2 1GMHF 1TX8A 3U1IB 2OBOA 3P8OA 4MPXA 3B8JA 5EOKA 4UD9H 2W26A 1ELEE 2BZ6H 1W7GH 2NU2E 1DWEH 1O2RA 3M7QA 2PW8H 3HPTB 1AD8H 2FI4E 1P2IA 2FODA 1ETTH 4VGCC 3STJA 1KTTB 1ZOMA 2ZU3A 1UTMA 5C2ZA 3UFAA 1C1MA 4Y8ZA 1RIWB 2F91A 1SGRE 1MD7A 1TBZH 3RXHA 3A88A 2CHAC 2P93A 3H7TA 1A5IA 1QR3E 3GCTF 3T29A 1C1RA 1VCPA 3PO1B 1BRBE 1C5VA 1K1MA 3ATIA 1EASA 1GBDA 2CMYA 1P01A 1LCYA 2F83A 1O3JA 4H4FA 3S9CA 2PKSB 4B2AA 3T27A 1RFNA 4D9QA 4Q7YA 4K3JA 4DGJA 1HAHH 4X8SH 1MBMA 3FP6E 2BLVA 1TA2A 3SV8A 1N6XA 1ZTJA 4WMFA 1G30B 1K28D 1TRYA 1O2YA 2KAIA 5HXFA 1D3DB 1FIZA 3GICB 3QLPH 1BRUP 1A1RA 1K1PA 1JRTA 1MAYA 1SGIB 1C5XB 1UTPA 4O3TA 1MD8A 3BSQA 1KIGH 5TJXA 1CGJE 4D76A 1W13U 2O9QA 4X8TH 3SOSA 3SU3A 1V2OT 2HLCA 2SGAA 4Q7ZA 1SQAA 5L2YH 1LPZB 1AZ8A 3RMLH 1XKBC 1W0YH 1C5PA 1P02A 1ETRH 1XUIA 4WY3A 1MMJN 4GSOA 1BUIA 1HRTH 4O9VA 2TGDA 2ZFTA 1JOUB 1ZTKA 2PGQB 1KY9A 2XC4A 1X7AC 3GCHB 2OUAA 3V12A 3MNXA 1ESAA 2FYRA 4ABAA 2FOFA 4X1NU 3NZIA 3KF2A 1GJBB 3PB1E 3LGYA 3D62A 1N6YA 4AFUA 2W3IA 1EAIA 1XUFA 1QRWA 3AAUA 3TJNA 1BTXA 8ESTE 3SUFA 2DE8A 3URDA 2PUXB 3MO3A 1O3KA 4Y0ZE 4RKJB 1L1GA 1QFKH 4IW4E 2B7DH 4BAQB 2BTCE 3MOCA 4DCDA 3T28A 1MTNB 1T4VH 1FUJA 1ZSJA 4CHAC 1K1OA 1ANCA 1ZPZA 3QGJA 4XBDA 5EW1H 1KYNA 2BB4A 1AVWA 1O3LA 3BEFB 1HAVA 2BDIA 2G52A 4X8VH 1ESBA 1AKSB 3V0XA 1AFEH 1GI1A 3PM3A 4ABGA 1L1JA 1C2GA 4DVAU 2VWMA 2I6SA 3PMJA 2CGAA 2GCTB 1PYTD 2Q6GA 4X1QU 3O8DA 1ZSLA 3SUDA 1MTUA 1O2IA 2BLQA 3W94A 5AHGH 1RRKA 1DXWA 2RA0A 4Y8XA 3LC3A 3RXVA 2QIQA 2FTMA 1IQGA 2HVXA 1MTWA 1L4DA 2IOTA 3A7ZA 4CRGA 3I77A 1QCPA 1NU9A 3BIUH 3D49H 1FDPA 2A5AA 2J4IA 1QJ1B 5AF9H 3Q00A 1O3NA 1BDAA 1ZZZA 3PWCA 2PV9B 1PFXC 1EPTB 3S9BA 1P3EA 2C4FH 1LQEA 2FLRH 2WPKS 1IQKA 1IQLA 1H9LB 2QF3A 1ELBA 3K2UA 1AE5A 3ODFA 3O8BA 1C5QA 1BRAA 1XXDA 2ZFRH 1FAKH 1QB1A 1V2VT 4FVDA 3ZZAA 1V2QT 3M5OA 2D8WA 4AOQA 4KELA 4BNRA 2FOCA 2ZA5A 3CS0A 3GY5A 3OYPA 1FPCH 2ZFFH 3U69H 2Q1JA 1C5WB 1O37A 1P9UA 5FX6A 4U01A 7LPRA 5GWZA 5L2ZH 3Q3YA 1NTPA 3QGNB 4CHAB 4DIIH 2GGVB 1DX5M 2A4OA 5EU8A 1CE5A 2BLWA 4HTCH 5FBEA 2JH0D 4AORA 3UR9A 1F5KU 2QXJA 1DANH 3RU4T 1EOLA 1O2VA 3QZQA 1VZQH 4Y10E 3TK5A 1WTGH 4M7GA 4ZKOU 2ZKSA 2QY0B 1TWXB 1O31A 4MNVA 2BD9A 2VVVA 4K2YA 1FY1A 3MH6A 3QO6A 1GMCG 1GI7B 3RMOH 4YM9A 1C5SA 1QBOA 5DP6A 1LO6A 1ZJKA 4I8LA 2P16A 1O2KA 4JK6A 2OC1A 2AEIH 1Z6JH 5DK1A 3MHWU 3UWJH 2F3CE 4IS5A 3U1JB 3SU4A 4WVPE 1S83A 1T8LA 2J9NA 1CHOF 4NWKA 1A0LA 1RJXB 4DW2U 2BVRH 4O97A 5C1UA 4FUIA 1LDTT 1V2NT 4CR9A 1ABJH 2GD4B 1O0DH 3TLOA 1HV7A 3Q3KA 1HAIH 5CHAC 2GTBA 4DJZB 2PSXA 1DDJA 5EPNA 1NY22 2FI5E 3TJUA 4A7IB 1NZQH 3E8LA 2GT7A 1BJVA 1O38A 2BDHA 4AB8A 3A87A 2BX4A 1W12U 1OS8A 1GMDF 3Q77A 2AYWA 1D3QB 1J17T 1UTOA 2QV1A 4CRAA 5IDKA 2ZI2H 1LTOA 2HNTF 2FXRA 1LHDH 1MKXH 5A8ZA 2P3TB 4AGJA 5L6NH 1H4WA 2OQ5A 3M37A 1P04A 1IHSH 1XUJA 1OKXA 1BTYA 3RU4E 2FLBH 4XFQA 1Z8IB 5DP3A 1CBWB 1TGSZ 1G37A 4AG2A 5DKMA 1OWKA 3ZVBA 1ANDA 1SGEE 2J95A 2Q6FA 1FN6A 2ZG0H 3EYDA 4GPGA 1TMBH 5JDUB 2J38A 1NM6A 3ZVCA 5DP8A 2TPIZ 3MI4A 3LGTA 1NRRH 2CHAB 4INKA 1H1BA 2Y5FA 1AUJA 4NFFA 3DFLA 1MU8B 5JBTA 3EE0B 1SOTA 2JETB 1LQDB 1ZLRA 2J92A 2BDYA 1VITH 1J14A 3C1KA 3P70B 3ZV8A 5G4BA 1EAUA 1NS3A 1Z1JA 3VB6A 2ZGCA 2TRMA 1Y3VA 4D7GA 1BTPA 1T31A 2AGIX 3RC5A 3SN8A 1ORFA 3CP7A 1P10A 1S6HA 2PR3A 4ZH8A 5F8ZA 2VU8E 4B76A 5CMXH 1NU7B 3Q3XA 4MG3A 2Y5HA 7KMEH 4NA7A 2P3UB 3A7YA 4K1SA 3O8CA 2R0LA 2DE9A 3OY6U 1WAYB 1O2WA 3S0NA 2A0QB 1NC6A 2Z9KA 2R3UA 1ELGA 1TX7A 1A0JA 1O5EH 1PPFE 3AVZA 2SNWA 2Z94A 2QC2A 1YPJH 4KTSA 1J16A 4K8BA 1GGDC 1A5HA 2ZTXA 3QZRA 1V2JT 4NA8A 1V2LT 5DPAA 5FCKA 2WV4A 2BQ7B 2FOAA 5L30H 3I78A 1K21H 3KEEA 4ABDA 2F9UA 1AB9C 2Y81A 4YTAA 4XBCA 5EODA 3KNXA 3S69A 1O2GH 4FUGA 1DICA 4UE7H 2PKAB 1C2KA 3KQBA 3NXPA 1G3BA 1O2SA 1D3PB 1GI2A 1VJ9U 1IQNA 1RS0A 1BCUH 2ZFSA 4FU7A 1GDNA 1NN6A 1MBQA 4K5ZA 5LH8A 1YKTA 4ZHLU 3PWBA 4J1YA 1HJAC 1QJ7B 3G01A 3RXGA 4JZ1A 2XC0A 2UUFB 1HAZB 1EAWA 3V3MA 4IN1A 5PTPA 1SGNE 2C90B 3AASA 2BHGA 4JCNA 4UEHH 2BD8A 1UTLM 1G36A 2XCFA 3BTQE 2GZ7A 1L1NA 1AY6H 2ODYB 1WOFA 2W7UA 4DIHH 1RGQA 2VWLA 3BIVH 3SI3H 4X8UH 1SI5H 2BY8X 2STBE 5EQQA 3ZVEA 3SJOA 6GCHG 2H5CA 3LIWA 3B9FH 2GP9B 2BY5X 3MYWA 2GCTC 1O3BA 2HNTC 1EQ9A 1CA0B 1G2MA 4AGKA 2I6QA 3IG6B 1W11U 4FUBA 2DUCA 2FX4A 4Y7AA 1GVLA 2V0BA 1FY5A 1A46H 2HOBA 3A7XA 3ZVGA 1A61H 1GI9B 1GI0A 3MU5A 2ZHQH 5A0CA 5JYIA 3CS7A 4ISOA 4MNXA 3RXMA 2WPIS 1O2HA 1ZJDA 3SU2A 4Q80A 2TGPZ 1SGFA 2B8OH 3SBKA 1QRZA 3RXLA 4E7RG 3R0FA 1GBFA 1A2CH 1SB1H 3P95A 3T5FH 5F6MA 1P2JA 1SHYA 4YT7H 2P95A 3TPIZ 7GCHG 1IOEA 5FCRA 1IHTH 3F9EA 1KXCA 1SL3A 5DP9A 3LH1A 1Y8TA 4I33A 4ABIA 2ANMH 1UVTH 1O3PB 2XWBI 3QN7A 1FONA 1EZSC 4B1TA 3RMMH 2RA3A 1O2OA 4R8TB 4X2VA 1K1JA 2CF9H 1UVPA 1EPTC 1SLWB 2QF0A 3BTKE 1KLTA 2FS8A 1HDTH 1QQ4A 2G4UA 2W7SA 4UFDH 2XBXA 4ISHH 3ZVFA 2HNTE 3ZZCA 1UO6A 4THNH 1H9HE 2PHBA 5EQSA 1GJ9B 4TYDA 2OC8A 1XUKA 3EA8A 3CENA 5C1XA 1HYLA 5FXLA 3UPEA 2C8ZB 1UTKA 1W10U 1P0SH 1Y3WA 1AKSA 2ZTYA 3VB4A 5HM2A 2UUJB 3A83A 3SHAH 3A8AA 2XTTB 3FP8E 1SLXB 1Y5BT 3LH3A 4BAOB 1SGFG 1V3XA 2G55A 1O2XA 1GBHA 3UTUH 1GHZA 1W3CA 2AFQB 4LOYH 2PLXA 3U8TH 1BBRK 2TIOA 3WY8A 4Y0YE 3T26A 1QGFA 3RMNH 2VB0A 1ZTLA 4TY7A 4NCYA 3UOPA 1SOZA 1HCGA 3BF6H 2M5TA 1GJ5H 1O3MA 2GMTC 2H9TH 1TGCA 2QXGA 1AVXA 3GY3A 1O3AA 3TVJB 5C3NA 1EZUC 5EPYA 1RTFB 3LOXA 1TE0A 1HNEE 3TGKE 1QL8A 1DLEA 1O5DH 3E3TA 3U8RH 2AMDA 4I7YH 3TH3H 1BHXF 4Z0KA 2D2DA 4GVUA 4I32A 1F5LA 1DY9A 2CV3A 4WMEA 4SGBE 1HAYB 1HLTH 2PWXA 1EPTA 4GUXA 1IQMA 1HPGA 3AW0A 1FI8A 1J8AA 1EZQA 1O2MA 3SQHE 4RSPA 1GBJA 1GL1A 5EW2H 4BTTB 2VJ1A 1GBAA 1QA7A 1P3CA 1SVPA 2A7JA 4Q2KA 2GVFA 4AYYB 1HAGE 4ABHA 2VIDA 2A2QH 1GHAF 2HPPH 1SC8U 2FIRH 1GVKB 1ZPCA 1QB6A 1NO9H 1JMOH 1KLJH 4JZEH 1TBQH 1GGDB 1O3HA 4GLYA 1IQIA 1W2KH 5F8XA 2XBWA 1YGCH 3BV9B 1O3GA 4FXGH 3TK9A 1TNKA 3MWIU 1KXEA 2ZWLH 3UREA 1CU1A 1A5GH 1P2QA 2BM2A 1CO7E 4E06H 4INLA 4E05H 1BB0B 4CRFA 2A4RA 1WU1A 1GBTA 2Z7FE 1MTNC 4AN7A 1TA6A 1FXYA 1UHBB 3AW1A 1Y3XA 5DG6A 3M3VA 1DPOA 3P17H 3F9FA 3Q76A 4MPVA 1P06A 1QBNA 1ZHRA 5LPEA 2OXSA 1S0QA 1N8OC 2JH6D 1LVMA 4X6MA 1ZGIA 3RM0H 4CBNA 6ESTA 3A8CA 3M5LA 1QURH 4B74A 8KME2 2Y80A 1S6FA 4ZKSU 1MTVA 2OC7A 1UVUH 1BBRH 1O5GH 2ZQ2A 3RDZA 5A8YA 5T6FA 2FOEA 4NIWA 2QCYA 1VJAU 1PPZA 2THFB 1GHYH 1SG8B 1V2ST 1DWBH 3BTME 4NZQA 1YPHE 2VIVA 1TIOA 4OGXA 1O3FA 4Q7XA 2ZQ1A 1LHCH 3PLKA 1TGNA 3KIDU 2IN2A 2RDLA 4X6NA 1GJDB 1HXEH 1MAXA 5FPTA 2BVXH 3RXTA 2BZAA 2AMPA 3A81A 4JYUH 4MVNA 3QTOH 1O5BB 2OBQA 1OP8A 1UTQA 2QXIA 1M9UA 3MU4A 4JYVH 1ZRKA 1OWEA 4HGCA 2P8OB 2XWAA 1MKXK 2ZDLA 2EI6A 2QGRA 1MKWK 4ZKNU 3VB5A 1RTLA 3KN2A 1YPKH 5EXMA 1CVWH 1BTZA 4ZHMU 2F9NA 4GAWA 1P8VC 2V6NA 3T2NA 4JMYA 1TPAE 1UVSH 1DVAH 1GDQA 3A8BA 3MTYA 4Y8YA 1MCVA 2VIPA 3TIUA 1C2IA 1ZMJA 1Y5AT 1C2DA 1H8DH 2BD5A 2XBVA 3VGCC 4YESB 2ZIQH 3ZV9A 1YC0A 2O8UA 2ODQA 5ABWA 1OPHB 2O8TA 1ARCA 2ZU5A 1ID5H 4H42U 4JZIA 3PTBA 1K2I1 1O2LA 1P05A 1KXDA 3OTJE 4IMZA 3P92A 4ZUHA 1PQAA 3RXJA 1C5MD 1YCPK 1UJ1A 2JKHA 3GCHC 2UUKB 2FZZA 3KHVA 3BTEE 3SJ8A 3ZZDA 4FUHA 5DO4H 1PPEE 1EUFA 1O35A 3QUMP 4IC5A 4NWLA 4OS5A 2Z6BD 1C5OH 2ASUB 5BPEA 3SNCA 2ESTE 4DG4A 1CT0E 2W5EA 2GCHG 1GHWH 2FS9A 1C1SA 1DY8A 3GCOA 1PPBH 2CF8H 4AX9H 2ZU4A 2ZZUH 1LPGB 1TNGA 4BXSA 1Q31A 3GCNA 2FMJA 3F6UH 1FMGA 4ZHAA 1O39A 5LPFA 3TJVA 2ALPA 2BQWB 3RXPA 1SLVB 3JZ2B 1DSTA 2ZCKP 1KXFA 3ZZ5A 1SGDE 4K1TA 1ETSH 3RLWH 1Z1IA 2OTVA 4OS4A 1WSSH 4CRBA 2EI8A 1NFYA 1DXPA 4BTUB 5E8EH 2ZU1A 1NROH 5C20A 1O3CA 4ZMAH 1YPMH 1GI5A 1LKAA 3NKKA 3UQOA 2YOLA 5C5OA 1TYNA 2PUQH 2UWPA 3TGIE 1SGTA 2VVCA 4IBLH 1F7ZA 3DD2H 2A7CA 1UK4A 4NGAH 1ANBA 1XUGA 4JZDH 3PO1C 4MNYA 4X2WA 6CHAB 2WYGA 2FESH 1GCDA 1C2JA 5JB8S 2PTCE 3TITA 1TNIA 1UTJA 3D65E 4U2WA 1PPCE 1DT2A 1EKBB 2AGEX 1BA8B 1JIMA 4NA9H 2WPLS 2Z3DA 2ODPA 1ZMNA 3B23B 3A84A 2ZPRA 4U32A 3TU7H 3FANA 3U8OH 5DJ7A 3VEQB 2BD2A 1BTUA 1GJ4H 3A86A 3TH2H 2WPJS 3GY8A 1Y3UA 3SGBE 3GDVA 2ZFPH 1AFQB 1XUHA 2OP9A 4IN2A 5AFYH 2F9OA 2QN5T 1SGCA 1W8BH 2NU0E 1P11E 2XW9A 3VXFH 1GWAA 3VFEA 1GL0E 4UDWH 1JRSA 4X1PU 3SU5A 4Z6AH 2B5TB 1ELVA 3ATKA 4TWWA 4WJG2 1CT4E 1EB2A 1HIAA 2BXUH 3MNCA 1KLIH 1AIXH 4BAKB 1DSUA 1P12E 1TMTH 4FUCA 1AO5A 1OXGA 4FU9A 1CT2E 5LPRA 2FI3E 3F9GA 1O2NA 2GV6A 1OSSA 1C2LA 2AH4X 3SJKA 3URCA 3SNDA 2UWLA 4X1SU 1GG6C 1ZMLA 5ETXA 4CH2B 3F9HA 3FFGA 1C5UA 1D6WA 2A45B 3RXOA 1EJMA 2D26C 3ZZ7A 1GI8B 4NSYA 1GHBF 1B0FA 2WV5A 3QTVH 4Y11E 1S81A 1GBBA 1VCWA 1WCZA 5GCHG 2H9EH 3S7HB 3HKIB 1KDQB 2SGQE 1XVMA 2ZDNA 4X1RU 1NFXA 3SNAA 3SU1A 2EI7A 2BDBA 1IQJA 2TGAA 1SFIA 4DOQA 3UNRA 3IITA 4DY7B 3KL6A 2ZEBA 2OD3B 2F9BH 1MH0A 2Z9GA 1NESE 2AERH 2XC5A 1FN8A 2EA3A 1DITH 2R0KA 5SGAE 3EA9A 2GCHF 1YM0A 3QDZB 3LJOA 2FYQA 3E90B 3ATWA 1TPPA 5DP4A 3RXRA 3BG8A 2C8WB 2ILNA 1A4WH 4KP0A 5CE1A 1WTHD 2BLOA 1TONA 2AIPA 1EP5A 3E16B 3GY7A 4FUDA 3MU1A 4YO9A 3S7KB 4JZFH 3M61U 2BD3A 1SR5C 2HGTH 1AI8H 1A3EH 1T4UH 4K1EA 1NFUA 1THSH 3RXIA 1WUNH 1GBLA 3A85A 1AGJA 1P03A 3UNSA 2SGFE 3GYMA 1Q2WA 2GV7A 2Q6DA 1FLEE 3EDXB 3ATMA 4UFEH 4A1TA 1E35B 2W3KA 2ZTZA 1F2SE 3GYLB 3DFJA 1NT1A 4BOHA 4I8GA 2ZGHA 1T8OA 5IYTA 3H7OA 3L33A 5E0GA 1QNJA 1T7CA 4H6SB 4HZHA 1KDQA 2YNBA 1ELCA 1O3EA 2VINA 2TBSA 2XBYA 1ZPBA 2BOHB 3SV2H 1V2PT 2XXLA 2Z3CA 2ANKH 3LPRA 1C5TA 3PLPA 3T25A 4CRDA 2G8TA 4ZKRU 4RN6A 2H5DA 1XVOA 4BAHB 3RXBA 2TGTA 2G00A 2VIWA 2F9PA 1C1WH 1ZSKA 2HPQH 4B73A 1E37B 3UNQA 1XX9A 2QA9E 2A4GA 1CA0C 3O8RA 3SV7A 1ESTA 4WWYA 2A1DB 1O2TA 1VITG 2G4TA 1GPZA 5ESTE 2A4QA 1UVOA 1HXFH 2VH0A 1C2HA 4GCHF 1ARBA 4ZXYH 1NRNH 5A0BA 4BXWA 3FVFB 4A92A 1MKWH 2ZDVH 4RKOB 3ZYEA 1FZZA 5C1YA 1K1LA 2BX3A 3DT0H 4ISIH 5TCCA 1P2KA 1QBVH 1DE7H 1GG6B 1GI6A 3BTDE 1TRNA 4NG9H 1DLKB 1CBWC 1O2JA 2VWOA 2BDAA 2HRVA 2FDAA 2A31A 5E2OA 1VR1H 2WPMS 4GHQA
chains in the Genus database with same CATH superfamily
1CGHA 3F68H 4K8YA 4MPUA 2F9VA 7GCHF 2O8LA 4AYVB 3MMGA 2EC9H 5C0TA 1C1PA 3I29A 2PTNA 4JK5A 1C1VH 3SJ9A 1AQ7A 1BHXB 3ZZ3A 1P2NA 2J98A 2YMSB 1ZRBA 2FPZA 3LDXH 1MQ5A 4ABJA 1QJ6B 2PSYA 5EG4A 2ZC9H 4CBOA 1LVYA 3SO3A 3K6ZA 1BRCE 3GCTG 4KKDA 3RXCA 1YLDA 3BG4C 3PMHB 2XRCA 2ANWA 4CH8B 4E7NA 1BMAA 1TAWA 3OU0A 1MZAA 1E0FD 1NRSH 1PQ5A 1LMWB 2RG3A 4UONA 3GY4A 1IQFA 1FJSA 3OSYA 2WUCA 3K9XB 5TCAA 6GCHF 3FZZA 4AFZA 5EJLA 1K0HA 3HGPA 4I8HA 3EAJA 2AMQA 2R2MB 1S84A 2ZPQA 1ZHPA 1QY6A 1ZGVA 3ZZ4A 1SHHB 1KXBA 2BD7A 1GBMA 2LP6A 3VGCB 1BT7A 2VBCA 2CXVA 3FAOA 3NK8A 2G5VA 1TQ7B 5DSFA 3UY9A 3V7TA 3V13A 1TFXA 1QA0A 3UIRA 1DWCH 1F5RA 1OHHD 2YNAA 1Z6EA 1NFWA 1PQ7A 3E0NB 4X6PA 5AFZH 1FPHH 3NCLA 1W7XH 1TLDA 2AIQA 5E2PA 2FP7B 2Y82A 2Z3EA 1YP9A 1H8IH 2J94A 3PTNA 4NIYA 2SGPE 5LGOA 1C1OA 3KCGH 3MH7A 1IQHA 3NUMA 3BG4B 1DS2E 2NU4E 2PP6A 5T6GA 1GVZA 1THPB 1HGTH 3A89A 3ITIA 3ZVDA 1DUAA 2W6ID 1C1UH 4TPIZ 2ZDMA 3UQVA 1C9PA 3RLYH 1TPSA 5HMAA 1OWHA 2H9HA 1Z8JB 5CHBA 3TNTA 1LPKB 3M3SA 1GJ7B 3L6PA 3VB7A 3QX5H 1A7SA 5HKKD 3PROA 5A8XA 3LJJA 1RXPA 8GCHG 1EX3A 3JZ1B 1HAPH 4F49A 1JWTA 3KQDA 4B75A 2BVSH 2HALA 3U28C 2ZU2A 2ZO3H 4ASUD 2WPDD 5A09A 3UUZA 4ABBA 1U6QA 4RT0A 1BMLA 1V2UT 3OEHD 3GY2A 1PPHE 2ZDAH 2ANYA 1EATA 3LGIA 5J4QA 1W0ZU 4Y7BA 3N7OA 4K69A 5JBAS 3HK6B 1MTSA 2FTLE 1O36A 3E6PH 5JPMH 2GJGA 2QYIA 2H1UA 1JXPA 2OCVB 2VGCB 1SKYE 2PKSC 1XKAC 1AE8H 1SBWA 4AFQA 4D7FA 2LPRA 1J9CH 4DT7B 3RP2A 3M5NA 2VNTA 3LT3A 3SU6A 1T32A 2P3FH 2C3SA 3A80A 5JBBS 3M35A 1TQ0B 3DUXH 2FX6A 1HAVB 3TK6A 1ELDE 3A7VA 2FO9A 2YMSD 5EQRA 4AFSA 1P2MA 2Z9LA 1FQ3A 1D4PB 3P8NA 4I86A 1TABE 1ELTA 1F92A 4WH6A 4FU8A 4CR5A 3BEUA 3E91A 4A5TS 1VGCC 1C5ZB 1C1NA 3NPSA 1MZDA 2V3OH 1BTHH 2A32A 4FUEA 1OYTH 3ELAH 5C67A 1WQVH 2GZ8A 2ZP0H 1EB1H 5C0UA 2D1JA 1O2PA 1P2OA 3F1SB 1Z71A 1IQEA 1BZXE 2BY7X 1B5GH 5DP7A 1AZZA 2OINA 2EY4C 3EA7A 3GDSA 1B7XB 2Y6TA 1WQSA 1QIXB 4YLUA 1O3IA 5FHTA 2V3MA 4IGDA 1HUTH 3ZZBA 3DHKH 1TOCB 2A2XH 1GBIA 1C2MA 2ALVA 4X2XA 1WBGB 4FUJA 4BAMB 1GHVH 2XCNA 1TMUH 2R9PA 2PFEA 2A5KA 1KXAA 3UWIA 4B2BA 4YOJA 2GMTB 1LKBA 4XSKU 1GDUA 1KTSB 3MNBA 5CHAB 4YOIA 2ZDKA 2STAE 2WPHS 4LZ1H 1UK3A 1TNJA 1O30A 8GCHF 3N7EA 4D9RA 3M3TA 4JYTA 3QWCH 4ISLA 3ZZ8A 1GMCF 4I8KA 4MNWA 1UCYE 1C5NH 4KTUA 4FETA 4I31A 2R2WU 4A1VA 5FPSA 1KSNA 1G32B 3KGPA 4QT8C 4TY6A 3W95A 4CRCA 2J2UA 1DM4B 1PQ8A 4B71A 1HB0B 3SV6A 1MCTA 2OQUA 3RC6A 3LGWA 1QQUA 2V35A 1QL7A 1YLCA 3BEIB 4A6LA 1THRH 4AB9A 5I25A 2Z9IA 1PJPA 2ZHFH 2VIQA 4HI3A 1O2ZA 1QHRB 3HATH 1F0SA 1TNLA 1UMAH 2A7HA 4IC6A 1WDIA 1GHAG 3MH5A 1P09A 2NWNA 4Y71A 1WYKA 1O5CB 4MTBA 1O2UA 3KQCA 3E1XB 2J34A 4GCHG 1O33A 1SGYE 1Y3YA 1DOJA 2ZPSA 3AAVA 1C9TA 1AHTH 5KECA 1YCPM 3LGVA 1VITF 1NRQH 4MLFB 3SORA 3VPKA 3W1EA 1HJ9A 4Y76A 2IJOB 5FPYA 2BOKA 2FWWA 3A82A 1HIAB 2C8YB 1G9IE 1G3CA 2QF5A 1BMNH 3OY5U 3FZDA 1O5FH 2NU3E 3T62A 4LZ4B 5GJ4B 4NZLA 3SJIA 4IMQA 2BD4A 9LPRA 2G81E 2C93B 1AN1E 1N8OB 1MQ6A 4OS7A 3TNSA 4P02A 2G51A 1BMMH 1YPEH 1ZR0A 2O8MA 1Z7KA 1GBKA 3F0OA 2B0FA 3ZZ9A 2GDDA 2EQNA 1O3OA 1P9SA 1PPGE 1SQTA 3NWUA 1Y59T 4Y79A 2F43B 4NIVA 4WMDA 1SGQE 5EJ1A 2ZNKH 1QTFA 3GY6A 3RXEA 2V3HH 1FV9A 2FOBA 5K7RA 3SGQE 1K9OE 9ESTA 1TGBA 5E0JA 1GCTC 1C5RA 2KAIB 1OYQA 3DA9B 4D8NA 8LPRA 1BIOA 1QRXA 2HWLB 3MO9A 1V2WT 1AMHA 4H6TA 4AZ2B 2BYAX 2XNIA 3U98H 2C8XB 2Z9JA 1E36B 3GDUA 1OWIA 3BTHE 1ANEA 1L0ZA 1YF4A 1S85A 2WYJA 5FX5A 1BQYA 1K22H 3QK1A 4Q63A 5FBIA 1NPMA 4ESTE 1LHEH 5H4IB 1EJAA 1GCTB 2GDEH 3TGJE 1HJAB 5F8TA 5JBCS 4CREA 2VWNA 1UHBA 1D3TB 1TPOA 1IAUA 1OX1A 1EOJA 1TB6H 1QB9A 1S5SA 3PYHA 2XYAA 3SHCH 1YLNA 2GX4A 4FUFA 1TOMH 1UCYH 7ESTE 4YLQH 2WINI 3D23A 1INCA 1DFPA 2SFAA 5GCHF 4Y6DA 5GIBA 5F03A 3SNBA 1TBRH 2CJIA 3LKWA 2RCEA 5B6OA 1CHOG 1AVGH 1BJUA 1NRPH 1HFDA 4U30A 4X0WU 2BY6X 4OS2A 1QL9A 1T8NA 3LC5A 1RIWC 4WXIA 1L4ZA 1CGIE 1BOQA 1GJAB 3HK3B 4X2YA 4ZXXH 4ASHA 1TX6A 4X6OA 1H9IE 2K1QA 3LU9B 3RXKA 3MU8A 4HFPB 1OP2A 2VIOA 2FOHA 2ZHEH 5GDSH 2BQ6B 3MFJA 1W0JD 1XXFA 3MU0A 5T6DA 4K60A 1VGCB 5A0AE 5EXLA 4YT6H 1B0EA 1CHGA 1GJ6A 2O8WA 4DURA 1S0RA 4B2CA 3RC4A 3P6ZB 3RXQA 3C27B 3BTGE 4BANB 5A2MH 1FNIA 5HM9A 3A7TA 2G5NA 1O2QA 1AUTC 1J15A 2P94A 3SUGA 4J2YB 4OS1A 1L2EA 1MUEB 2FOGA 1VCQA 3R3GB 2H6MA 1CSOE 2SGEE 2ZGXH 1G2LA 2Y7ZA 1SQOA 2YMSC 3H5CB 4ZROA 1F0UA 5AVDA 4ABFA 2CN0H 1W14U 1EAXA 5KEDA 1TNHA 4A1XA 4ABEA 1K1IA 6CHAC 1ZYOA 2B9LA 1LHGH 2Y7XA 1SMFE 3RU4D 1TALA 1D9IA 1C1TA 1K1NA 2BY9X 1D6RA 3BN9A 2QAAA 3PRBA 3FP7E 3MH4A 4INHA 1O3DA 2VH6A 1Z8GA 1XM1A 1YYY1 2JETC 4KTCA 1SSXA 3ESTA 3M5MA 2QXHA 1F0TA 2JIZD 1E34B 2SNVA 1Q3XA 1GI4A 1O34A 1V2MT 2FM2A 3EGKH 4SGAE 3A7WA 6LPRA 1FY3A 4NFEA 1UK2A 2P59A 3M36A 3TH4H 2Y5GA 4MDSA 5EXNA 3BTTE 1HAXB 1C5LH 1ELFA 3F2FA 1P57B 2ZHDA 2UWOA 2OC0A 1ABIH 1G3EA 2ULLA 1LVBA 3ODDA 1KMHB 1BMFD 3EQ0H 1MU6B 4ZAEA 1WV7H 3HGNA 1C2EA 3OX7U 1GBCA 1LVOA 4TPYA 2AHME 2NU1E 4KGAA 5E0HA 2QE7D 3S9AA 4O3UA 3SQEE 3K65B 4GHTA 1LHFH 5HYOA 1T8MA 3VXEH 2R3YA 4R0IA 4UFFH 1E38B 2FOMB 3SUEA 1TRMA 1C1QA 1GJ8B 3KQEA 1O5AB 2BDCA 4ISNA 1GHXH 3GOVB 1S6LA 2ZGJA 2H2ZA 1JBUH 1OWDA 1A0HB 1FY8E 1AWHB 2GKVE 3LGUA 1N1LA 1OWJA 1SLUB 2BDGA 4AG1A 1DWDH 4YOGA 2OLGA 1GJCB 2GT8A 3SGAE 1AWFH 1BITA 2A5IA 2JH5D 3RXUA 3SZNA 5DP5A 3UOUA 4WF8A 4F4OC 1ZHMA 5BRRE 2AS9A 1SPJA 2VGCC 4MPWA 3SNEA 4MQAA 2VVUA 4NSVA 1HJ8A 1EP6A 1AFQC 1HBTH 3FO8D 3MO6A 4XBBA 1BTWA 1FY4A 1V2TT 3RXAA 3K6YA 3ZZ6A 3PLBA 5FAHA 3RXFA 3OFND 3RXSA 4VGCB 5EGMA 3RM2H 5GPIB 1GI3A 2ZCHP 3TJOA 3SI4H 3E0PB 4XOJA 5HGGA 3SW2B 1AB9B 1GMDG 1C4V2 2ZECA 4UFGH 1ACBE 3MNSA 2KCYA 1CQQA 3RUOA 3U9AH 1C2FA 4LXBH 4NIXA 2P8OC 3L3TA 2KX4A 1YCPH 2ZHWH 5HIYA 1EXFA 4XE4A 3SU0A 3RXDA 1RD3B 3ATLA 1GBEA 1YPLH 2BXTH 1JIRA 2BMGB 2ZCLP 1YPHC 3A8DA 2AGGX 5C5NA 3SYJA 3SV9A 3STIA 5K0HA 3M7TA 1AU8A 1PYTC 1FIWA 5J4SA 2WUBA 3BTWE 3HKJB 1HAOH 3PV4A 2ZF0H 1Y5UT 4BTIB 3IWMA 1V6DA 1A3BH 4WXVA 2ZGBH 5C94A 5T3HA 1TGTA 2PKAA 1EJNA 2FEQH 1YBWA 3P8GA 1RTKA 2K8IA 1V2KT 4OGYA 2EEKA 1SGPE 3FOAA 3VB3A 3PMAB 3M7UA 5ESBA 3GISB 5GXPA 3ENSB 3WWFA 3ZYDA 1OP0A 3P8FA 1UTNA 3PMBB 2SGDE 4LK4A 5EIYA 4TWYA 4AC9A 1OOKB 4O03A 1Z8RA 3BTFE 3UR6A 1GHBG 3LONA 5JB9S 2PGBB 1CA8B 4XDEA 2GZ9A 1ELAA 1BBRE 3ZVAA 1G3DA 1FAXA 1S82A 1F0RA 1O32A 1XMNB 2LNCA 4YZUA 5I46H 1EZXC 1UCYK 4WH8A 4OS6A 1C5YB 1DUEA 1V2RT 4FVBA 4PROA 1GMHG 2UUYA 5DGJA 1YPGH 1C4Y2 2IPHA 2M2AA 1SFQB 2ZFQH 4I8JA 1C4U2 1GMHF 1TX8A 3U1IB 3KYGA 2OBOA 3P8OA 4MPXA 3F0PA 3B8JA 5EOKA 4UD9H 2W26A 1ELEE 2BZ6H 1W7GH 2NU2E 1DWEH 1O2RA 3M7QA 2PW8H 3HPTB 1AD8H 2FI4E 1P2IA 2FODA 1ETTH 4VGCC 3STJA 1KTTB 1ZOMA 2ZU3A 1UTMA 5C2ZA 3UFAA 1C1MA 4Y8ZA 1RIWB 2F91A 2CK3D 1SGRE 1MD7A 1TBZH 3RXHA 3A88A 2CHAC 2P93A 3H7TA 1A5IA 1QR3E 5CDFE 3GCTF 3T29A 1C1RA 1VCPA 3PO1B 1BRBE 1C5VA 1K1MA 3ATIA 1EASA 1GBDA 2CMYA 3OTPA 1P01A 1LCYA 2F83A 1O3JA 4H4FA 3S9CA 4ZCNA 2PKSB 4B2AA 3T27A 1RFNA 4D9QA 4Q7YA 4K3JA 4DGJA 1HAHH 4X8SH 1MBMA 3FP6E 2BLVA 1TA2A 3SV8A 1N6XA 1ZTJA 1E1QD 4WMFA 1G30B 1K28D 1TRYA 1O2YA 2KAIA 5HXFA 1D3DB 1FIZA 3GICB 3QLPH 1BRUP 1A1RA 1YWUA 1K1PA 1JRTA 1MAYA 1SGIB 1H8ED 1C5XB 1UTPA 4O3TA 1MD8A 3BSQA 1KIGH 5TJXA 1CGJE 4D76A 1W13U 2O9QA 4X8TH 3SOSA 3SU3A 1V2OT 2HLCA 2SGAA 4Q7ZA 1SQAA 5L2YH 1LPZB 1AZ8A 3RMLH 1XKBC 1W0YH 1C5PA 1P02A 1ETRH 1XUIA 4WY3A 1MMJN 4GSOA 1BUIA 1HRTH 4O9VA 2TGDA 2ZFTA 1JOUB 1ZTKA 2PGQB 1KY9A 3OAAD 2XC4A 1X7AC 3GCHB 2OUAA 3V12A 3MNXA 5HIZA 1ESAA 2FYRA 4ABAA 2FOFA 4X1NU 3NZIA 3KF2A 1GJBB 3PB1E 3LGYA 3D62A 1N6YA 4AFUA 2W3IA 1EAIA 1XUFA 1QRWA 3AAUA 3TJNA 1BTXA 8ESTE 3SUFA 2DE8A 3URDA 2PUXB 3MO3A 2L74A 1O3KA 4Y0ZE 4RKJB 4ACBA 1L1GA 1QFKH 4IW4E 2B7DH 4BAQB 2BTCE 3MOCA 3KYFA 3PRDA 4DCDA 3T28A 1MTNB 1T4VH 1FUJA 1ZSJA 5FL7D 1K1OA 3WW7A 4CHAC 4OM9A 1ANCA 1ZPZA 3F3BA 3QGJA 4XBDA 5EW1H 1KYNA 2BB4A 1AVWA 1O3LA 3BEFB 1HAVA 2BDIA 2G52A 4X8VH 1ESBA 2HLDD 1AKSB 3V0XA 1AFEH 1GI1A 3PM3A 4ABGA 1L1JA 1C2GA 4DVAU 2VWMA 2I6SA 3PMJA 1NBME 2CGAA 2GCTB 1PYTD 2Q6GA 4X1QU 3O8DA 1ZSLA 3SUDA 1MTUA 1O2IA 2BLQA 3W94A 5AHGH 1RRKA 1DXWA 2RA0A 4Y8XA 3LC3A 3RXVA 2QIQA 2FTMA 1IQGA 2HVXA 1MTWA 1L4DA 2IOTA 3A7ZA 4CRGA 3I77A 1QCPA 1NU9A 3BIUH 3D49H 1FDPA 2A5AA 2J4IA 3WWBA 1QJ1B 5AF9H 3Q00A 1O3NA 3CNRA 3FN8A 1BDAA 1ZZZA 3PWCA 2PV9B 1PFXC 1EPTB 3S9BA 1P3EA 2C4FH 1LQEA 2FLRH 2WPKS 1IQKA 1IQLA 1H9LB 2QF3A 1ELBA 3K2UA 1AE5A 3ODFA 3O8BA 1C5QA 1BRAA 1XXDA 2ZFRH 1FAKH 1QB1A 1V2VT 4FVDA 3ZZAA 1V2QT 1WXRA 3M5OA 2D8WA 4AOQA 4KELA 4BNRA 2FOCA 2ZA5A 2W6JD 3CS0A 4Z1MD 3GY5A 3OYPA 1FPCH 2ZFFH 3U69H 2Q1JA 1C5WB 1O37A 1P9UA 5FX6A 4U01A 7LPRA 5GWZA 5L2ZH 3Q3YA 1NTPA 3QGNB 4CHAB 4DIIH 2GGVB 1DX5M 2A4OA 5EU8A 1CE5A 5F53A 2BLWA 4HTCH 5FBEA 2JH0D 4AORA 3UR9A 1F5KU 2QXJA 1DANH 3RU4T 1EOLA 1O2VA 1MABB 3QZQA 1VZQH 4Y10E 3TK5A 1WTGH 4M7GA 4ZKOU 2ZKSA 2QY0B 1TWXB 1O31A 4MNVA 2BD9A 2VVVA 4K2YA 1FY1A 3MH6A 4TSFD 3QO6A 1GMCG 1GI7B 3RMOH 4YM9A 1C5SA 1QBOA 5DP6A 1LO6A 1ZJKA 4I8LA 2P16A 1O2KA 4JK6A 2OC1A 2AEIH 1Z6JH 5DK1A 3MHWU 3UWJH 2F3CE 4IS5A 3U1JB 3SU4A 4WVPE 1S83A 1T8LA 2J9NA 1CHOF 4NWKA 1A0LA 1RJXB 4DW2U 2BVRH 4O97A 5C1UA 4FUIA 1LDTT 1V2NT 3PV2A 4CR9A 1ABJH 2GD4B 1O0DH 3TLOA 1HV7A 2K0QA 3Q3KA 1HAIH 5CHAC 2GTBA 4DJZB 2PSXA 1DDJA 4DT4A 5EPNA 1NY22 2FI5E 3TJUA 4A7IB 1NZQH 3E8LA 2GT7A 1NBMD 1BJVA 1O38A 2BDHA 4AB8A 3A87A 2BX4A 1W12U 1OS8A 1GMDF 3Q77A 2AYWA 1D3QB 1J17T 1UTOA 2QV1A 4CRAA 5IDKA 2ZI2H 1LTOA 2HNTF 2FXRA 1LHDH 1MKXH 5A8ZA 2P3TB 4AGJA 5L6NH 1H4WA 2OQ5A 3M37A 4XD7D 2JJ1D 1P04A 1IHSH 1XUJA 1OKXA 1BTYA 3NRLA 3RU4E 2FLBH 4XFQA 1Z8IB 5DP3A 1QZ8A 1CBWB 1TGSZ 1G37A 4AG2A 5DKMA 1OWKA 3ZVBA 1ANDA 2KCPA 1SGEE 2J95A 2Q6FA 1FN6A 2ZG0H 3EYDA 4GPGA 1TMBH 5JDUB 2J38A 1NM6A 3MQKC 3ZVCA 5DP8A 2TPIZ 3MI4A 3LGTA 1NRRH 2CHAB 4INKA 1H1BA 3OEED 2KZ4A 1AUJA 2Y5FA 4NFFA 3DFLA 1MU8B 5JBTA 3EE0B 1SOTA 2JETB 1LQDB 1ZLRA 2J92A 2BDYA 1VITH 1J14A 3C1KA 3P70B 3ZV8A 5G4BA 1EAUA 1NS3A 1Z1JA 3VB6A 2ZGCA 2TRMA 1Y3VA 4D7GA 1BTPA 1T31A 2AGIX 3RC5A 3SN8A 1ORFA 3CP7A 1P10A 1S6HA 2PR3A 4ZH8A 5F8ZA 3OE7D 3VG8A 2VU8E 4TT3D 4B76A 5CMXH 1NU7B 3Q3XA 4MG3A 2Y5HA 7KMEH 4NA7A 2P3UB 3A7YA 2WSSD 4K1SA 3O8CA 2R0LA 2DE9A 3OY6U 1WAYB 1O2WA 3S0NA 2A0QB 1NC6A 2Z9KA 2R3UA 1ELGA 1TX7A 1A0JA 1EFRD 1O5EH 1PPFE 3AVZA 2SNWA 2Z94A 2QC2A 1YPJH 4KTSA 1J16A 4K8BA 1GGDC 1A5HA 2ZTXA 3QZRA 1V2JT 4NA8A 1V2LT 5DPAA 5FCKA 2WV4A 2BQ7B 2FOAA 3PV5A 5L30H 3I78A 1K21H 3KEEA 4ABDA 2F9UA 1AB9C 2Y81A 4YTAA 4XBCA 5EODA 3KNXA 3S69A 1O2GH 4FUGA 1DICA 3DCLA 4UE7H 2PKAB 1C2KA 1E79D 3KQBA 3NXPA 1G3BA 1O2SA 1D3PB 1GI2A 1VJ9U 1IQNA 2J98B 1RS0A 1BCUH 2ZFSA 4FU7A 1GDNA 1NN6A 1MBQA 1E1RD 4K5ZA 5LH8A 1YKTA 4ZHLU 3PWBA 4J1YA 1HJAC 1QJ7B 3G01A 3RXGA 4JZ1A 2UUFB 2XC0A 1HAZB 1EAWA 3V3MA 4IN1A 5PTPA 1SGNE 2C90B 3AASA 3SZEA 2BHGA 4JCNA 4UEHH 2BD8A 1UTLM 1G36A 5DN6D 2XCFA 3BTQE 2GZ7A 1L1NA 1AY6H 2ODYB 1WOFA 2W7UA 4DIHH 1RGQA 2VWLA 3BIVH 3SI3H 4X8UH 1SI5H 2BY8X 2STBE 5EQQA 3ZVEA 3SJOA 6GCHG 2H5CA 3LIWA 3B9FH 2GP9B 2BY5X 2XOKD 3MYWA 2GCTC 1O3BA 2HNTC 1EQ9A 1CA0B 1G2MA 4AGKA 2I6QA 3IG6B 1W11U 4FUBA 2DUCA 2FX4A 4Y7AA 1GVLA 2V0BA 1FY5A 1A46H 2HOBA 3A7XA 4Q4LA 1A61H 3ZVGA 1GI9B 1GI0A 3MU5A 2ZHQH 5A0CA 5JYIA 3CS7A 4ISOA 4MNXA 3RXMA 2WPIS 1O2HA 1ZJDA 3SU2A 4Q80A 2TGPZ 1SGFA 2B8OH 3SBKA 1QRZA 3RXLA 4E7RG 3R0FA 1GBFA 1A2CH 1SB1H 3EE7A 3P95A 4YXWD 3T5FH 5F6MA 1P2JA 1SHYA 4YT7H 2P95A 3TPIZ 7GCHG 1IOEA 5FCRA 1IHTH 3F9EA 2RFKC 1KXCA 1SL3A 5DP9A 3LH1A 1Y8TA 4I33A 4ABIA 2ANMH 1UVTH 1O3PB 2XWBI 4ACAA 3QN7A 1FONA 1EZSC 4B1TA 3RMMH 2RA3A 1O2OA 4R8TB 4X2VA 1K1JA 2CF9H 1UVPA 1EPTC 1SLWB 2QF0A 3BTKE 1KLTA 2FS8A 1HDTH 1QQ4A 2J97A 2G4UA 2W7SA 4UFDH 2XBXA 4F55A 4ISHH 3ZVFA 2HNTE 3F2GA 3ZZCA 1UO6A 4THNH 1H9HE 2PHBA 5EQSA 1GJ9B 4TYDA 2OC8A 1XUKA 3EA8A 3CENA 5C1XA 1HYLA 5FXLA 3UPEA 2C8ZB 1UTKA 1W10U 1P0SH 1Y3WA 1AKSA 2ZTYA 3VB4A 5HM2A 2UUJB 3A83A 3SHAH 1COWD 3A8AA 2XTTB 3FP8E 1SLXB 1Y5BT 3LH3A 4BAOB 1SGFG 1V3XA 2G55A 1O2XA 1GBHA 3UTUH 1GHZA 1W3CA 2AFQB 4LOYH 2PLXA 3U8TH 1BBRK 2TIOA 3WY8A 4Y0YE 3T26A 2JDID 1QGFA 3RMNH 2VB0A 1ZTLA 4TY7A 4NCYA 3UOPA 1SOZA 1HCGA 3BF6H 4F48B 2M5TA 1GJ5H 1O3MA 2GMTC 2H9TH 1TGCA 2QXGA 1AVXA 3DSPA 3GY3A 1O3AA 2WV9A 3TVJB 5C3NA 1EZUC 5EPYA 1RTFB 3LOXA 1TE0A 1HNEE 3TGKE 1QL8A 4XRNA 1DLEA 1FX0B 1O5DH 3E3TA 3U8RH 2AMDA 4I7YH 3TH3H 1BHXF 4Z0KA 2D2DA 4GVUA 4I32A 1F5LA 1DY9A 2CV3A 4WMEA 4SGBE 1HAYB 1HLTH 2PWXA 1EPTA 4GUXA 1IQMA 1HPGA 3AW0A 1FI8A 2KFWA 1J8AA 1EZQA 2RDEA 1O2MA 3SQHE 4RSPA 1GBJA 1GL1A 5EW2H 4BTTB 2VJ1A 1GBAA 1QA7A 1P3CA 1SVPA 2A7JA 4Q2KA 2GVFA 4AYYB 1HAGE 4ABHA 2VIDA 1H8HD 2A2QH 1GHAF 2HPPH 1SC8U 2FIRH 1GVKB 1ZPCA 1QB6A 1NO9H 2KCOA 1JMOH 1KLJH 4JZEH 1TBQH 1GGDB 1O3HA 4GLYA 1IQIA 1W2KH 5F8XA 2XBWA 1YGCH 3BV9B 1O3GA 4FXGH 3TK9A 1TNKA 3MWIU 1KXEA 2ZWLH 3UREA 4RT1A 1CU1A 1A5GH 1P2QA 2BM2A 1CO7E 4E06H 4INLA 4E05H 1BB0B 4CRFA 2A4RA 1WU1A 1GBTA 2Z7FE 1MTNC 4AN7A 1TA6A 1FXYA 1UHBB 3AW1A 1Y3XA 5DG6A 3M3VA 1DPOA 3P17H 3F9FA 3Q76A 4MPVA 1P06A 1QBNA 1ZHRA 5LPEA 2OXSA 1S0QA 1N8OC 2JH6D 1LVMA 4X6MA 1ZGIA 3RM0H 4CBNA 6ESTA 2KR7A 3A8CA 3M5LA 1QURH 4B74A 8KME2 2Y80A 1S6FA 4ZKSU 1MTVA 2OC7A 1UVUH 1BBRH 1O5GH 2ZQ2A 2J5UA 3RDZA 5A8YA 5T6FA 2FOEA 4NIWA 2QCYA 1VJAU 1PPZA 2THFB 2JJ2D 1GHYH 1SG8B 1V2ST 1DWBH 3BTME 4NZQA 1YPHE 2VIVA 1TIOA 4OGXA 1O3FA 4Q7XA 1SQRA 2ZQ1A 1LHCH 3PLKA 1TGNA 3KIDU 2IN2A 2RDLA 4X6NA 1GJDB 1HXEH 1MAXA 2L6OA 5FPTA 2BVXH 3RXTA 2BZAA 2AMPA 3A81A 4JYUH 4MVNA 3QTOH 1O5BB 2OBQA 1OP8A 1UTQA 2QXIA 1M9UA 3MU4A 4JYVH 1ZRKA 1OWEA 3F2HA 4HGCA 2P8OB 2XWAA 1MKXK 2ZDLA 2EI6A 2QGRA 1MKWK 4ZKNU 3VB5A 1RTLA 5GNDA 3KN2A 1YPKH 5EXMA 1CVWH 1BTZA 4ZHMU 2F9NA 4GAWA 1P8VC 2V6NA 3T2NA 4JMYA 1TPAE 1UVSH 1DVAH 1GDQA 3A8BA 3MTYA 4Y8YA 1MCVA 2VIPA 3TIUA 1C2IA 1ZMJA 1Y5AT 1C2DA 1H8DH 2BD5A 2XBVA 2KM0A 3VGCC 4YESB 2ZIQH 3ZV9A 1UW7A 1YC0A 2O8UA 2ODQA 5ABWA 1OPHB 2O8TA 1ARCA 2ZU5A 2HVYB 1ID5H 4H42U 4JZIA 3KQ5A 3PTBA 1K2I1 1O2LA 1P05A 1KXDA 3OTJE 4IMZA 3P92A 4ZUHA 1PQAA 3RXJA 1C5MD 1YCPK 5KGOA 1UJ1A 2JKHA 3GCHC 2F4LA 2UUKB 2FZZA 3KHVA 3BTEE 3SJ8A 3ZZDA 4FUHA 5DO4H 1PPEE 1EUFA 1O35A 3QUMP 1YY3A 4IC5A 4NWLA 4OS5A 2Z6BD 1C5OH 2ASUB 5BPEA 3SNCA 2ESTE 4DG4A 1CT0E 2W5EA 2GCHG 1GHWH 2FS9A 1C1SA 1DY8A 3GCOA 1PPBH 2CF8H 4AX9H 2ZU4A 2ZZUH 1LPGB 4P00A 1TNGA 4BXSA 1Q31A 3GCNA 2FMJA 3F6UH 1FMGA 4ZHAA 1O39A 5LPFA 3TJVA 2ALPA 2BQWB 3RXPA 1SLVB 3JZ2B 1DSTA 2ZCKP 1KXFA 3ZZ5A 1SGDE 4K1TA 1ETSH 3RLWH 1Z1IA 2OTVA 3N99A 4OS4A 1WSSH 4CRBA 2EI8A 1NFYA 1DXPA 4BTUB 5E8EH 2ZU1A 1NROH 5C20A 1O3CA 1W0KD 4ZMAH 1YPMH 1GI5A 1LKAA 3DSOA 3NKKA 3UQOA 2YOLA 4M9FA 5C5OA 1TYNA 2PUQH 2UWPA 5T1VA 3TGIE 1SGTA 2VVCA 4IBLH 1F7ZA 3DD2H 2A7CA 1UK4A 4NGAH 1ANBA 1XUGA 4JZDH 3PO1C 4MNYA 4X2WA 6CHAB 2WYGA 2FESH 1GCDA 1C2JA 5JB8S 2PTCE 3TITA 1TNIA 1UTJA 3D65E 4U2WA 1PPCE 1DT2A 1EKBB 2AGEX 1BA8B 1JIMA 4NA9H 2WPLS 2Z3DA 2ODPA 1ZMNA 3B23B 3A84A 2ZPRA 3UB0A 4U32A 3TU7H 3FANA 5IK2D 3U8OH 5DJ7A 3VEQB 2BD2A 1BTUA 1GJ4H 3A86A 3TH2H 2WPJS 3GY8A 1Y3UA 3SGBE 3GDVA 2ZFPH 1AFQB 2WZQA 2IJD1 1XUHA 2OP9A 4IN2A 5AFYH 2F9OA 2QN5T 1SGCA 1W8BH 2NU0E 1P11E 2XW9A 3VXFH 1GWAA 3VFEA 1GL0E 4UDWH 4B6EA 1JRSA 4X1PU 3SU5A 4Z6AH 2B5TB 1ELVA 3ATKA 4TWWA 4HG6A 4WJG2 1CT4E 1EB2A 1HIAA 2BXUH 3MNCA 5C17A 2IPQX 1KLIH 1AIXH 4BAKB 1DSUA 1P12E 1TMTH 4FUCA 1AO5A 1OXGA 3DSGA 4FU9A 1CT2E 5LPRA 2FI3E 3F9GA 1O2NA 2GV6A 4B6FA 1OSSA 1C2LA 2AH4X 3SJKA 3URCA 3SNDA 2UWLA 4X1SU 1GG6C 1ZMLA 5ETXA 4CH2B 3F9HA 3FFGA 1C5UA 1D6WA 2A45B 3RXOA 1EJMA 2D26C 3ZZ7A 1GI8B 4NSYA 1GHBF 1B0FA 2WV5A 3QTVH 4Y11E 1S81A 1GBBA 1VCWA 1WCZA 5GCHG 2H9EH 3S7HB 3HKIB 1KDQB 2SGQE 1XVMA 2ZDNA 4X1RU 1NFXA 3SNAA 3SU1A 2EI7A 2BDBA 2WHXA 1IQJA 2TGAA 1SFIA 4DOQA 3UNRA 3IITA 4DY7B 3KL6A 2ZEBA 2OD3B 2F9BH 1MH0A 2Z9GA 1NESE 2AERH 2XC5A 1FN8A 2EA3A 1DITH 2R0KA 2LELA 5SGAE 3EA9A 2GCHF 1YM0A 3QDZB 3ZIAD 3LJOA 2FYQA 3E90B 3ATWA 1TPPA 5DP4A 3RXRA 3BG8A 2C8WB 2ILNA 1A4WH 4KP0A 5CE1A 3N7DA 1WTHD 2BLOA 1TONA 2AIPA 1EP5A 3E16B 3GY7A 4FUDA 3MU1A 4YO9A 3S7KB 4JZFH 3M61U 2BD3A 2QF4A 1SR5C 2HGTH 1AI8H 1A3EH 1T4UH 4K1EA 1NFUA 1THSH 3RXIA 1WUNH 1GBLA 3A85A 1AGJA 1P03A 3UNSA 2SGFE 3GYMA 1Q2WA 2GV7A 2Q6DA 1FLEE 2KCAA 3EDXB 3ATMA 4UFEH 4A1TA 1E35B 2W3KA 2ZTZA 1F2SE 3GYLB 3DFJA 1NT1A 4BOHA 4I8GA 2ZGHA 1T8OA 2OK5A 5IYTA 3H7OA 3L33A 5E0GA 1QNJA 1T7CA 4H6SB 4HZHA 1KDQA 2YNBA 1ELCA 1O3EA 3GS9A 2VINA 2TBSA 2XBYA 1ZPBA 2BOHB 3SV2H 1V2PT 2XXLA 2Z3CA 2ANKH 3LPRA 1C5TA 3PLPA 3T25A 4CRDA 4RI0A 2G8TA 5B6LA 4ZKRU 4RN6A 2H5DA 1XVOA 4BAHB 3RXBA 1VKYA 2TGTA 2G00A 2VIWA 2F9PA 1C1WH 1ZSKA 4FOUC 2HPQH 4B73A 1E37B 3UNQA 1XX9A 2QA9E 2A4GA 3UAIC 1CA0C 2XNDD 3O8RA 3SV7A 1ESTA 4WWYA 2A1DB 1O2TA 1VITG 2G4TA 1GPZA 5ESTE 2A4QA 1UVOA 1HXFH 2VH0A 1C2HA 4GCHF 1ARBA 4ZXYH 1NRNH 3FKSD 5A0BA 4BXWA 3FVFB 3H09A 4A92A 1MKWH 2ZDVH 4RKOB 3AK5A 3ZYEA 1FZZA 5C1YA 1K1LA 2BX3A 3DT0H 4ISIH 5TCCA 1P2KA 1QBVH 2V7QD 1DE7H 1GG6B 1GI6A 3BTDE 1TRNA 4NG9H 1DLKB 5EJZA 1CBWC 1O2JA 2VWOA 2BDAA 2HRVA 2FDAA 2A31A 5E2OA 1VR1H 2WPMS 4GHQA
chains in the Genus database with same CATH topology
1CGHA 3F68H 4K8YA 4MPUA 2F9VA 7GCHF 2O8LA 4AYVB 3MMGA 2EC9H 1C1PA 3I29A 2PTNA 4JK5A 1C1VH 3SJ9A 1AQ7A 1BHXB 3ZZ3A 1P2NA 1ZRBA 2FPZA 3LDXH 1MQ5A 4ABJA 1QJ6B 2PSYA 5EG4A 2ZC9H 4CBOA 1LVYA 3SO3A 3K6ZA 1BRCE 3GCTG 4KKDA 3RXCA 1YLDA 3BG4C 3PMHB 2XRCA 2ANWA 4CH8B 4E7NA 1BMAA 1TAWA 3OU0A 1MZAA 1E0FD 1NRSH 1PQ5A 1LMWB 2RG3A 4UONA 3GY4A 1IQFA 1FJSA 3OSYA 2WUCA 3K9XB 5TCAA 6GCHF 3FZZA 4AFZA 3HGPA 4I8HA 3EAJA 2AMQA 2R2MB 1S84A 2ZPQA 1ZHPA 1QY6A 1ZGVA 3ZZ4A 1SHHB 1KXBA 2BD7A 1GBMA 1BT7A 3VGCB 3NK8A 2CXVA 3FAOA 3V7TA 2G5VA 1TQ7B 3UY9A 3V13A 1TFXA 1QA0A 3UIRA 1DWCH 1F5RA 2YNAA 1Z6EA 1NFWA 1PQ7A 3E0NB 4X6PA 5AFZH 1FPHH 3NCLA 1W7XH 1TLDA 2AIQA 5E2PA 2FP7B 2Y82A 2Z3EA 1YP9A 1H8IH 2J94A 3PTNA 4NIYA 2SGPE 5LGOA 1C1OA 3KCGH 3MH7A 1IQHA 3NUMA 3BG4B 1DS2E 2NU4E 5T6GA 1GVZA 1THPB 1HGTH 3A89A 3ITIA 3ZVDA 1DUAA 1C1UH 4TPIZ 2ZDMA 3UQVA 1C9PA 3RLYH 1TPSA 5HMAA 1OWHA 2H9HA 1Z8JB 3TNTA 1LPKB 3M3SA 1GJ7B 3L6PA 3VB7A 3QX5H 1A7SA 3PROA 5A8XA 3LJJA 1RXPA 8GCHG 1EX3A 3JZ1B 1HAPH 4F49A 1JWTA 3KQDA 4B75A 2BVSH 2HALA 2ZU2A 2ZO3H 5A09A 3UUZA 4ABBA 1U6QA 1BMLA 1V2UT 3GY2A 1PPHE 2ZDAH 2ANYA 1EATA 3LGIA 5J4QA 1W0ZU 4Y7BA 3N7OA 4K69A 5JBAS 3HK6B 1MTSA 2FTLE 1O36A 3E6PH 5JPMH 2QYIA 2H1UA 1JXPA 2OCVB 2VGCB 2PKSC 1XKAC 1AE8H 1SBWA 4AFQA 4D7FA 2LPRA 1J9CH 4DT7B 3RP2A 3M5NA 2VNTA 3LT3A 3SU6A 1T32A 2P3FH 2C3SA 3A80A 5JBBS 3M35A 1TQ0B 3DUXH 2FX6A 1HAVB 3TK6A 1ELDE 3A7VA 2FO9A 5EQRA 4AFSA 1P2MA 2Z9LA 1FQ3A 1D4PB 3P8NA 1TABE 1ELTA 1F92A 4WH6A 4FU8A 4CR5A 3BEUA 3E91A 4A5TS 1VGCC 1C5ZB 1C1NA 3NPSA 1MZDA 2V3OH 1BTHH 2A32A 4FUEA 1OYTH 3ELAH 5C67A 1WQVH 2GZ8A 2ZP0H 1EB1H 2D1JA 1O2PA 1P2OA 3F1SB 1Z71A 1IQEA 1BZXE 2BY7X 1B5GH 5DP7A 1AZZA 2OINA 3EA7A 3GDSA 1B7XB 2Y6TA 1WQSA 1QIXB 4YLUA 1O3IA 5FHTA 4IGDA 1HUTH 3ZZBA 3DHKH 1TOCB 2A2XH 1GBIA 1C2MA 2ALVA 4X2XA 1WBGB 4FUJA 4BAMB 1GHVH 2XCNA 1TMUH 2R9PA 2PFEA 2A5KA 1KXAA 3UWIA 4B2BA 4YOJA 2GMTB 1LKBA 4XSKU 1GDUA 1KTSB 3MNBA 5CHAB 4YOIA 2ZDKA 2STAE 2WPHS 4LZ1H 1UK3A 1TNJA 1O30A 8GCHF 4D9RA 3M3TA 4JYTA 3QWCH 4ISLA 3ZZ8A 1GMCF 4I8KA 4MNWA 1UCYE 1C5NH 4KTUA 4I31A 2R2WU 4A1VA 5FPSA 1KSNA 1G32B 3KGPA 4QT8C 4TY6A 3W95A 4CRCA 2J2UA 1DM4B 1PQ8A 4B71A 1HB0B 3SV6A 1MCTA 2OQUA 3RC6A 3LGWA 1QQUA 2V35A 1QL7A 1YLCA 3BEIB 4A6LA 1THRH 4AB9A 5I25A 2Z9IA 1PJPA 2ZHFH 2VIQA 4HI3A 1O2ZA 1QHRB 3HATH 1F0SA 1TNLA 1UMAH 2A7HA 4IC6A 1GHAG 3MH5A 1P09A 2NWNA 4Y71A 1WYKA 1O5CB 4MTBA 1O2UA 3KQCA 3E1XB 2J34A 4GCHG 1O33A 1SGYE 1Y3YA 1DOJA 2ZPSA 3AAVA 1C9TA 1AHTH 1YCPM 3LGVA 1VITF 1NRQH 4MLFB 3SORA 3VPKA 1HJ9A 4Y76A 2IJOB 5FPYA 2BOKA 2FWWA 3A82A 1HIAB 2C8YB 1G9IE 1G3CA 1BMNH 3OY5U 3FZDA 1O5FH 2NU3E 3T62A 4LZ4B 5GJ4B 4NZLA 3SJIA 4IMQA 2BD4A 9LPRA 2G81E 2C93B 1AN1E 1N8OB 1MQ6A 4OS7A 3TNSA 2G51A 1BMMH 1YPEH 1ZR0A 1Z7KA 2O8MA 1GBKA 2B0FA 3ZZ9A 2GDDA 1O3OA 1P9SA 1PPGE 1SQTA 3NWUA 1Y59T 4Y79A 4NIVA 4WMDA 1SGQE 2ZNKH 1QTFA 3GY6A 3RXEA 2V3HH 1FV9A 2FOBA 5K7RA 3SGQE 1K9OE 9ESTA 1TGBA 5E0JA 1GCTC 1C5RA 2KAIB 1OYQA 3DA9B 4D8NA 8LPRA 1BIOA 1QRXA 2HWLB 3MO9A 1V2WT 1AMHA 4H6TA 4AZ2B 2BYAX 2XNIA 3U98H 2C8XB 2Z9JA 1E36B 3GDUA 1OWIA 3BTHE 1ANEA 1L0ZA 1YF4A 1S85A 2WYJA 5FX5A 1BQYA 1K22H 3QK1A 5FBIA 1NPMA 4ESTE 1LHEH 5H4IB 1EJAA 1GCTB 2GDEH 3TGJE 1HJAB 5F8TA 5JBCS 4CREA 2VWNA 1UHBA 1D3TB 1TPOA 1IAUA 1OX1A 1EOJA 1TB6H 1QB9A 1S5SA 3PYHA 2XYAA 3SHCH 2GX4A 4FUFA 1TOMH 1UCYH 7ESTE 4YLQH 2WINI 3D23A 1INCA 1DFPA 2SFAA 5GCHF 4Y6DA 5GIBA 5F03A 3SNBA 1TBRH 2CJIA 3LKWA 2RCEA 5B6OA 1CHOG 1AVGH 1BJUA 1NRPH 1HFDA 4U30A 4X0WU 2BY6X 4OS2A 1QL9A 1T8NA 3LC5A 1RIWC 4WXIA 1L4ZA 1CGIE 1BOQA 1GJAB 3HK3B 4X2YA 4ZXXH 4ASHA 1TX6A 4X6OA 1H9IE 2K1QA 3LU9B 3RXKA 3MU8A 4HFPB 1OP2A 2VIOA 2FOHA 2ZHEH 5GDSH 2BQ6B 3MFJA 1XXFA 3MU0A 5T6DA 4K60A 1VGCB 5A0AE 5EXLA 4YT6H 1B0EA 1CHGA 1GJ6A 2O8WA 4DURA 1S0RA 4B2CA 3RC4A 3P6ZB 3RXQA 3C27B 3BTGE 4BANB 5A2MH 1FNIA 5HM9A 3A7TA 2G5NA 1O2QA 1AUTC 1J15A 2P94A 3SUGA 4J2YB 4OS1A 1L2EA 1MUEB 2FOGA 1VCQA 3R3GB 2H6MA 1CSOE 2SGEE 2ZGXH 1G2LA 2Y7ZA 1SQOA 3H5CB 4ZROA 1F0UA 5AVDA 4ABFA 2CN0H 1W14U 1EAXA 1TNHA 4A1XA 4ABEA 1K1IA 6CHAC 1ZYOA 2B9LA 1LHGH 2Y7XA 1SMFE 3RU4D 1TALA 1D9IA 1C1TA 1K1NA 2BY9X 1D6RA 3BN9A 2QAAA 3FP7E 3MH4A 4INHA 1O3DA 2VH6A 1Z8GA 1XM1A 1YYY1 2JETC 4KTCA 1SSXA 3ESTA 3M5MA 2QXHA 1F0TA 1E34B 2SNVA 1Q3XA 1GI4A 1O34A 1V2MT 2FM2A 3EGKH 4SGAE 3A7WA 6LPRA 1FY3A 4NFEA 1UK2A 2P59A 3M36A 3TH4H 2Y5GA 4MDSA 5EXNA 3BTTE 1HAXB 1C5LH 1ELFA 1P57B 2ZHDA 2UWOA 2OC0A 1ABIH 1G3EA 2ULLA 1LVBA 3ODDA 3EQ0H 1MU6B 4ZAEA 1WV7H 3HGNA 1C2EA 3OX7U 1GBCA 1LVOA 4TPYA 2NU1E 4KGAA 5E0HA 3S9AA 4O3UA 3SQEE 3K65B 4GHTA 1LHFH 5HYOA 1T8MA 3VXEH 2R3YA 4R0IA 4UFFH 1E38B 2FOMB 3SUEA 1TRMA 1C1QA 1GJ8B 3KQEA 1O5AB 2BDCA 4ISNA 1GHXH 3GOVB 2ZGJA 2H2ZA 1JBUH 1OWDA 1A0HB 1FY8E 1AWHB 2GKVE 3LGUA 1N1LA 1OWJA 1SLUB 2BDGA 4AG1A 1DWDH 4YOGA 2OLGA 1GJCB 2GT8A 3SGAE 1AWFH 1BITA 2A5IA 2JH5D 3RXUA 3SZNA 5DP5A 3UOUA 4WF8A 4F4OC 1ZHMA 5BRRE 2AS9A 1SPJA 2VGCC 4MPWA 3SNEA 4MQAA 2VVUA 4NSVA 1HJ8A 1EP6A 1AFQC 1HBTH 3MO6A 4XBBA 1BTWA 1FY4A 1V2TT 3RXAA 3K6YA 3ZZ6A 3PLBA 5FAHA 3RXFA 3RXSA 4VGCB 5EGMA 3RM2H 5GPIB 1GI3A 2ZCHP 3TJOA 3SI4H 3E0PB 4XOJA 5HGGA 3SW2B 1AB9B 1GMDG 1C4V2 2ZECA 4UFGH 1ACBE 3MNSA 3RUOA 1CQQA 3U9AH 1C2FA 4LXBH 4NIXA 2P8OC 3L3TA 1YCPH 2ZHWH 1EXFA 4XE4A 3SU0A 3RXDA 1RD3B 3ATLA 1GBEA 1YPLH 2BXTH 1JIRA 2BMGB 2ZCLP 1YPHC 3A8DA 2AGGX 5C5NA 3SV9A 3STIA 5K0HA 3M7TA 1AU8A 1PYTC 1FIWA 5J4SA 2WUBA 3BTWE 3HKJB 1HAOH 3PV4A 2ZF0H 1Y5UT 4BTIB 3IWMA 1V6DA 1A3BH 4WXVA 2ZGBH 5T3HA 1TGTA 2PKAA 1EJNA 2FEQH 1YBWA 3P8GA 1RTKA 1V2KT 4OGYA 2EEKA 1SGPE 3VB3A 3PMAB 3M7UA 5ESBA 3GISB 5GXPA 3ENSB 3ZYDA 1OP0A 3P8FA 1UTNA 3PMBB 2SGDE 4LK4A 4TWYA 1OOKB 4O03A 1Z8RA 3BTFE 3UR6A 1GHBG 3LONA 5JB9S 2PGBB 1CA8B 4XDEA 2GZ9A 1ELAA 1BBRE 3ZVAA 1G3DA 1FAXA 1S82A 1F0RA 1O32A 1XMNB 2LNCA 4YZUA 5I46H 1EZXC 1UCYK 4WH8A 4OS6A 1C5YB 1DUEA 1V2RT 4FVBA 4PROA 1GMHG 2UUYA 5DGJA 1YPGH 1C4Y2 2IPHA 1SFQB 2ZFQH 4I8JA 1C4U2 1GMHF 1TX8A 3U1IB 2OBOA 3P8OA 4MPXA 3B8JA 5EOKA 4UD9H 2W26A 1ELEE 2BZ6H 1W7GH 2NU2E 1DWEH 1O2RA 3M7QA 2PW8H 3HPTB 1AD8H 2FI4E 1P2IA 2FODA 1ETTH 4VGCC 3STJA 1KTTB 1ZOMA 2ZU3A 1UTMA 5C2ZA 3UFAA 1C1MA 4Y8ZA 1RIWB 2F91A 1SGRE 1MD7A 1TBZH 3RXHA 3A88A 2CHAC 2P93A 3H7TA 1A5IA 1QR3E 3GCTF 3T29A 1C1RA 1VCPA 3PO1B 1BRBE 1C5VA 1K1MA 3ATIA 1EASA 1GBDA 2CMYA 1P01A 1LCYA 2F83A 1O3JA 4H4FA 3S9CA 2PKSB 4B2AA 3T27A 1RFNA 4D9QA 4Q7YA 4K3JA 4DGJA 1HAHH 4X8SH 1MBMA 3FP6E 2BLVA 1TA2A 3SV8A 1N6XA 1ZTJA 4WMFA 1G30B 1K28D 1TRYA 1O2YA 2KAIA 5HXFA 1D3DB 1FIZA 3GICB 3QLPH 1BRUP 1A1RA 1K1PA 1JRTA 1MAYA 1SGIB 1C5XB 1UTPA 4O3TA 1MD8A 3BSQA 1KIGH 5TJXA 1CGJE 4D76A 1W13U 2O9QA 4X8TH 3SOSA 3SU3A 1V2OT 2HLCA 2SGAA 4Q7ZA 1SQAA 5L2YH 1LPZB 1AZ8A 3RMLH 1XKBC 1W0YH 1C5PA 1P02A 1ETRH 1XUIA 4WY3A 1MMJN 4GSOA 1BUIA 1HRTH 4O9VA 2TGDA 2ZFTA 1JOUB 1ZTKA 2PGQB 1KY9A 2XC4A 1X7AC 3GCHB 2OUAA 3V12A 3MNXA 1ESAA 2FYRA 4ABAA 2FOFA 4X1NU 3NZIA 3KF2A 1GJBB 3PB1E 3LGYA 3D62A 1N6YA 4AFUA 2W3IA 1EAIA 1XUFA 1QRWA 3AAUA 3TJNA 1BTXA 8ESTE 3SUFA 2DE8A 3URDA 2PUXB 3MO3A 1O3KA 4Y0ZE 4RKJB 1L1GA 1QFKH 4IW4E 2B7DH 4BAQB 2BTCE 3MOCA 4DCDA 3T28A 1MTNB 1T4VH 1FUJA 1ZSJA 4CHAC 1K1OA 1ANCA 1ZPZA 3QGJA 4XBDA 5EW1H 1KYNA 2BB4A 1AVWA 1O3LA 3BEFB 1HAVA 2BDIA 2G52A 4X8VH 1ESBA 1AKSB 3V0XA 1AFEH 1GI1A 3PM3A 4ABGA 1L1JA 1C2GA 4DVAU 2VWMA 2I6SA 3PMJA 2CGAA 2GCTB 1PYTD 2Q6GA 4X1QU 3O8DA 1ZSLA 3SUDA 1MTUA 1O2IA 2BLQA 3W94A 5AHGH 1RRKA 1DXWA 2RA0A 4Y8XA 3LC3A 3RXVA 2QIQA 2FTMA 1IQGA 2HVXA 1MTWA 1L4DA 2IOTA 3A7ZA 4CRGA 3I77A 1QCPA 1NU9A 3BIUH 3D49H 1FDPA 2A5AA 2J4IA 1QJ1B 5AF9H 3Q00A 1O3NA 1BDAA 1ZZZA 3PWCA 2PV9B 1PFXC 1EPTB 3S9BA 1P3EA 2C4FH 1LQEA 2FLRH 2WPKS 1IQKA 1IQLA 1H9LB 2QF3A 1ELBA 3K2UA 1AE5A 3ODFA 3O8BA 1C5QA 1BRAA 1XXDA 2ZFRH 1FAKH 1QB1A 1V2VT 4FVDA 3ZZAA 1V2QT 3M5OA 2D8WA 4AOQA 4KELA 4BNRA 2FOCA 2ZA5A 3CS0A 3GY5A 3OYPA 1FPCH 2ZFFH 3U69H 2Q1JA 1C5WB 1O37A 1P9UA 5FX6A 4U01A 7LPRA 5GWZA 5L2ZH 3Q3YA 1NTPA 3QGNB 4CHAB 4DIIH 2GGVB 1DX5M