3NWUA

Substrate induced remodeling of the active site regulates htra1 activity
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
204
structure length
190
Chain Sequence
DPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-induced remodeling of the active site regulates human HTRA1 activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine protease HTRA1
total genus 40
structure length 190
sequence length 204
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nwuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nwuA02
3U8OH 1TOCB 1OKXA 3M5MA 1AUTC 1GMCG 1BTHH 2PGBB 1C5ZB 3A89A 1EB2A 1VGCC 3LOXA 4KTUA 1DSTA 1P0SH 3MU5A 3M61U 5GCHG 1OWJA 5DP5A 1NESE 2ALVA 2ZTXA 3MU8A 4AGKA 1QR3E 4NZLA 2G55A 4AFQA 2HGTH 4TYDA 1V2ST 1ANCA 2BY6X 3PMAB 4ZROA 2QC2A 1O5FH 1KLIH 1TNLA 2EI8A 3DD2H 1TBZH 2SGAA 1TRNA 2NU4E 1QFKH 1WV7H 4UFEH 2BQ6B 3SJKA 1G9IE 1TGBA 1OX1A 2BD2A 2PKAB 3GCOA 2RDLA 3MNCA 2OXSA 3A8AA 1T32A 2ZDLA 3MH4A 1KTSB 1C1MA 2HPPH 2FO9A 1THPB 3A7ZA 1CT4E 2FPZA 1GDQA 1GHBG 1DWDH 4FUDA 4NZQA 4AFUA 1BITA 4Q7ZA 2FXRA 1QY6A 1ANEA 2BD5A 2VB0A 2G8TA 3MU4A 4NWKA 1DANH 1JOUB 3QZQA 1GHVH 3WY8A 3P8NA 2OTVA 4NA7A 2W7SA 1VR1H 3BTHE 5LGOA 2ZGJA 3UREA 4F4OC 2OC7A 3NUMA 3AAUA 1AHTH 4KTCA 4MQAA 2R0KA 3FZZA 5PTPA 1C2KA 4IGDA 1C5PA 3NWUA 1TPAE 2ZU3A 3RXIA 1OP2A 4DW2U 1NFUA 2Z7FE 5C20A 4ABGA 3KIDU 2Q6DA 4K69A 2J9NA 3VGCC 1LHCH 2FOGA 2P59A 1CT2E 3SV7A 5A09A 4LXBH 2ZHQH 3K9XB 1ZPCA 1O3PB 3KQBA 1BB0B 2WPIS 5HM9A 4FUBA 1Q31A 1QJ1B 4ABEA 3TJUA 3SNDA 3ZV8A 3A88A 4FXGH 2O8WA 1O5AB 2AEIH 4BXWA 1FIWA 5TCCA 1GMDG 3KCGH 1A2CH 1DY8A 1ANBA 2W3KA 1BRAA 2ZZUH 1DM4B 3RXDA 2TGDA 1GI4A 1CGHA 1GJBB 1BHXF 1BT7A 2FWWA 4INLA 1O3LA 2SNVA 3M3VA 4DT7B 5AFZH 4WH8A 4OS6A 3QDZB 2HVXA 2CGAA 3A7TA 4X6MA 1AKSB 3SNAA 2JH5D 2SGFE 2O8LA 5DP3A 4I32A 2FYQA 1XXFA 1V2QT 5J4SA 1FXYA 1YCPH 1AMHA 4YOJA 1TIOA 1FAXA 2FI4E 3VB7A 1EB1H 3BTWE 2XBYA 2HOBA 2UWLA 1SGEE 4AN7A 1DWBH 4AYVB 5GWZA 4DCDA 1BA8B 2G51A 5HM2A 4F49A 4OS2A 1YPEH 1V2OT 2WPJS 4JYUH 1BQYA 1C1QA 3ZZAA 2Z3EA 1K28D 1DOJA 1S0QA 5E2PA 1QIXB 3K6YA 2HLCA 1Z6JH 3EDXB 3ZVEA 1AVWA 2JH6D 4Q7XA 1YPHC 3IWMA 1AZZA 2C8XB 2CHAC 1RTFB 2F9UA 3QK1A 1B7XB 1GL0E 1DDJA 2C8ZB 3KGPA 3A7WA 1AU8A 1XUFA 5FCKA 9ESTA 2QYIA 5DP9A 1CE5A 1MCTA 1ZMLA 4KKDA 3BEIB 2HNTC 2Z9IA 1HAZB 2AGEX 1BTUA 3A82A 1DLKB 2XYAA 2F91A 4MNYA 1ZRKA 2BOKA 1O2QA 1E38B 3U98H 2Q1JA 1V2RT 1TX8A 3BEUA 4DIHH 1LPZB 4DIIH 2A4QA 1UO6A 3O8BA 3SJ8A 2OBQA 1Y59T 2GCTC 2ZFTA 1ZYOA 1EPTC 3ZVDA 2AERH 1P3CA 3NKKA 1GGDC 3HATH 3SU5A 3TJVA 4Y8XA 2QA9E 1BJUA 5JB9S 2QXIA 2R2WU 3U8TH 1O30A 3BTFE 1GI6A 3ZV9A 1ZHRA 2Z3CA 8GCHF 3S0NA 1NS3A 2ZDKA 4JMYA 1C2HA 2ZFSA 4KTSA 4K8BA 4LZ4B 3SV2H 2V0BA 2D8WA 3VB5A 2UWPA 4HZHA 5DP8A 3KNXA 1AWFH 1C2JA 3AVZA 2RCEA 2ZDMA 2HPQH 5GDSH 1CHOF 2QAAA 4THNH 4R8TB 2ZF0H 4X8VH 1Y5AT 1LCYA 1S85A 2P3TB 4CH2B 4DVAU 2R2MB 3BV9B 3A7VA 1F2SE 2ZWLH 3P8FA 1D4PB 2Y6TA 4UFDH 5G4BA 4MG3A 4IW4E 1O3EA 1LPKB 1ZGVA 3K65B 2W5EA 1N6XA 2KAIB 1IQFA 2Q6GA 1GJ5H 1TBRH 1H4WA 3BIUH 3TNSA 2UUFB 2FS8A 4IMQA 4MLFB 4FU8A 1GHWH 3P6ZB 1GI7B 2GV6A 3I78A 4YT6H 4E7RG 1K1JA 1F5KU 1HJAB 1G2LA 1FY3A 2STAE 1GDNA 4YESB 1O37A 1FPCH 2ESTE 1V2VT 3EA7A 3CENA 1BHXB 1Z71A 1GMHF 2XBVA 1QL9A 3PB1E 1KDQA 2ZQ1A 3GDVA 5C67A 4X1PU 1O38A 1V2NT 1EUFA 3M7UA 5EQRA 3M7TA 4X6NA 2V6NA 4O9VA 2RA3A 1ZOMA 1W11U 3F9HA 1YGCH 1YKTA 1YPJH 1AGJA 2ZG0H 3P8GA 2AGIX 2QXGA 1CU1A 1C5UA 2AYWA 2H9HA 7GCHF 4O3TA 2TBSA 1V2LT 1OWEA 4MNXA 3JZ2B 2PFEA 2JETB 4U01A 3NZIA 3F9EA 1SB1H 1D3TB 1C5WB 2FESH 1ARBA 5JYIA 1GBMA 3NK8A 2P16A 2ZGHA 1UJ1A 1BZXE 2OD3B 3BTME 2FOEA 3RXFA 2ZCKP 1GBLA 4CR5A 3MTYA 2YOLA 2RG3A 2P8OC 1GJAB 3UQOA 1BDAA 1AE8H 3ATIA 2YNAA 1V2MT 1SG8B 1ZSKA 2B0FA 1AZ8A 1HXFH 4JK6A 4X1NU 2BHGA 1C1OA 4H6TA 2UUKB 5A2MH 1ID5H 2CHAB 2ZO3H 1OSSA 2HWLB 1VITF 1MBQA 4KGAA 2BD4A 1C1SA 1GBJA 3QGJA 4GHTA 2FS9A 2Q6FA 3UNRA 4DY7B 4JZDH 3U9AH 2BVXH 4GHQA 1LHDH 1WQVH 5A0AE 3QO6A 2FX4A 1CA0C 1SGDE 4PROA 3GY7A 3T26A 2CF9H 2STBE 1GBBA 2BB4A 2ZPRA 2ODQA 1GHXH 1DPOA 1TX7A 3MU1A 4JZ1A 4K5ZA 1O36A 1Y3VA 1QQUA 2BM2A 5F8ZA 4YT7H 1UVOA 4FUHA 5LH8A 2D1JA 2XCNA 3ATLA 8GCHG 3IG6B 2NU3E 2KAIA 2BDBA 1C5LH 2GGVB 3KQEA 1IQJA 1DVAH 6CHAC 2BVRH 4I8KA 2GCTB 1HAHH 3E8LA 3GCHC 1OYQA 1TA2A 1TX6A 1JMOH 3IITA 3LIWA 3SI3H 3UQVA 1P05A 1C1VH 2OC8A 1IQIA 1DT2A 1GHZA 3P8OA 1SC8U 2PSYA 3HKJB 1P03A 3BSQA 3V12A 5DO4H 3NXPA 5J4QA 3AASA 3MFJA 4FUFA 1HJ8A 2SGPE 4WVPE 3SV9A 4MVNA 1H9HE 4D7FA 1WUNH 1BUIA 2ILNA 4RSPA 1O3CA 3C1KA 3K2UA 5DK1A 2ODYB 2O8TA 3HGPA 1W0YH 1C2GA 2ZC9H 5FX5A 1O5CB 5BPEA 1MD8A 4MPUA 1QBVH 1QL7A 4FVDA 1LHEH 1QBOA 5CMXH 3MH6A 4FVBA 2VH0A 5FPSA 4VGCB 2ZGCA 3SQEE 1XUKA 1O3AA 4B76A 2F9NA 1K22H 1QB1A 1V2PT 1VZQH 3RM0H 3F9FA 1K1OA 2P95A 1NRSH 1MAXA 3ATWA 1FIZA 5T3HA 1FONA 3URDA 5ABWA 1RXPA 4YOIA 1PQAA 4Y76A 5JBBS 4ZH8A 1TNHA 1SMFE 2J92A 1MTSA 1O2UA 4INHA 1ARCA 5AVDA 3SN8A 1GPZA 4D9RA 1AWHB 2DUCA 2GZ7A 4ZKOU 1C2EA 1HJAC 1IQLA 3E1XB 4O03A 1HAPH 4DOQA 3PWCA 1SGIB 3VPKA 1GHBF 4JZFH 1SPJA 1GG6C 4AFZA 3U1IB 2WYJA 1P12E 3B8JA 5HYOA 3S7KB 2O8UA 4Y7BA 2H9EH 1ORFA 2V35A 5DG6A 1C5RA 1EJNA 2BVSH 1H8IH 1JRTA 3RXBA 3L33A 1TABE 5DP4A 1HAVA 2Z9LA 1EZUC 1TPPA 5AHGH 4LZ1H 4NIYA 3UIRA 3DT0H 4HI3A 1SFIA 1NPMA 1MKWH 2SFAA 1TBQH 2BX3A 1O3JA 3QUMP 1GBKA 3SJOA 3ZVBA 4FUIA 3PMHB 1IQGA 5JBTA 1ESBA 3M37A 2AIPA 3D65E 4X2WA 1ESAA 2JETC 4K3JA 1WQSA 1QURH 2XC5A 3SV6A 3KHVA 5JBAS 5HGGA 1XUJA 4WMFA 4BAOB 1FV9A 2Y81A 1D6WA 3LJJA 4AG2A 4ESTE 1C5QA 3GY6A 1GVLA 3D23A 3VGCB 3RU4T 2G00A 3R3GB 5FAHA 3A7XA 3RXTA 1V2WT 1LMWB 1MKXH 1ZHMA 1A3EH 1BMLA 1O2XA 5DKMA 2WPMS 4ZKSU 2ZFQH 1C1NA 1P57B 3RXLA 4OGXA 1AD8H 1SQOA 4WJG2 1LVOA 3MO9A 1V3XA 1CVWH 3MYWA 4MTBA 1GI1A 1DLEA 2PKSB 1EAXA 3HPTB 1C5YB 1PPGE 2FOMB 4K60A 3RXPA 1FY5A 3S9AA 1LPGB 4TY6A 1DSUA 2TGPZ 1QJ6B 1S6HA 5DPAA 1UTLM 2FI5E 3F6UH 1P11E 2SNWA 2A45B 1KYNA 1CA0B 3PO1C 1K9OE 1KLJH 2A2QH 1ZR0A 2PHBA 5DGJA 4ZKRU 1SVPA 3MI4A 4X6OA 1XKAC 4J2YB 2BDIA 2ZCHP 4CHAC 1MQ6A 2SGDE 1JBUH 1F0UA 1UTNA 1UTOA 3MO6A 1UHBB 4FUGA 4WY3A 1UK4A 5HXFA 4Q2KA 3AAVA 3RXJA 1A7SA 1MD7A 2FM2A 6CHAB 1OWDA 4AB9A 2R3UA 3GCHB 3MWIU 1TPOA 4FU7A 4JCNA 1J17T 3RMNH 3SV8A 1B0FA 1SGFA 1RIWB 1YPGH 3C27B 5A8YA 1LDTT 3EE0B 3V0XA 1D3QB 4SGAE 3PTBA 5F6MA 4NIXA 2XNIA 5JBCS 4I33A 4CRAA 7LPRA 2IN2A 3PTNA 3E91A 4GPGA 1BTWA 4E7NA 1GWAA 2A31A 1ESTA 3QLPH 2AMDA 1EAIA 2FMJA 1G3CA 1Q3XA 1QA0A 1GJDB 1SLXB 2WPLS 5GCHF 2VGCB 3MOCA 1GHAG 1MCVA 1RJXB 2ZPQA 1EP5A 2G4UA 1UK3A 1MMJN 2FIRH 4RKJB 1KXFA 5EQQA 2Y5FA 1GBCA 1PPHE 5FXLA 1LO6A 3ZVFA 4VGCC 1CQQA 2VWNA 2J34A 2CV3A 3RM2H 1FNIA 2ALPA 5B6OA 4X2YA 4WF8A 4ISNA 2GCHF 4DGJA 1YBWA 3ATMA 3JZ1B 1MTVA 3A8CA 1YLCA 3LH1A 3KN2A 3D49H 1HRTH 1EOLA 5AFYH 3SUDA 1QA7A 4UE7H 3RXEA 3ZYEA 1EP6A 2ZGBH 1C2IA 1BBRK 2GX4A 2GT7A 4BAQB 2BMGB 4MDSA 1UVPA 2F9OA 2P93A 2ULLA 1W0ZU 3PYHA 3T2NA 3FP7E 2GZ9A 4WMEA 1MKWK 1QJ7B 2OC1A 1GMCF 1ACBE 2H9TH 4X8UH 2BDGA 3A87A 1PPFE 1HIAB 1WU1A 1GG6B 1J9CH 1QGFA 3A8DA 4JYTA 4K2YA 5FCRA 2FLBH 1LKAA 2R9PA 1HPGA 2VINA 1EXFA 1H8DH 3VB3A 2FX6A 3UR6A 4X8TH 3ZZDA 2BD7A 1EZXC 5C1YA 4U30A 2QCYA 1KTTB 3UOPA 3OY6U 3ZZ6A 3O8CA 1GBTA 1XM1A 5A8XA 4RN6A 3URCA 1FY8E 1C5OH 1G3BA 1V2UT 1LVYA 4OS5A 3SUGA 1P01A 1QCPA 1J15A 2R0LA 3UOUA 4H6SB 5C5NA 1C5VA 1L1JA 4X8SH 4D9QA 1YP9A 2ZFRH 1O2GH 3FVFB 1NY22 5L6NH 1SGQE 4U32A 1K2I1 1QRZA 5L2YH 1KY9A 1AB9C 4NIWA 2F9BH 1NRRH 1XVMA 1OXGA 2ZU4A 1T8LA 2OQ5A 1Y5UT 5JPMH 1XVOA 1FAKH 2ODPA 5EW1H 2VVUA 4BTIB 1TNGA 5LPFA 1K1NA 4YO9A 3RMLH 1S0RA 1WAYB 1PQ5A 4D76A 4AGJA 4OS1A 2EI6A 1GBEA 1F0TA 4AORA 1F5RA 1OOKB 2BDCA 2OUAA 1P2MA 1DICA 4MNVA 1X7AC 2RA0A 3RC6A 3T62A 1OWKA 1O3GA 1HAIH 1FDPA 3PO1B 3QTVH 4JZIA 4E05H 1L4ZA 3RDZA 1KXCA 1GBHA 1SGTA 5GJ4B 1NRPH 2F3CE 2QXJA 3UWJH 3UY9A 2BY9X 1SLVB 2EI7A 4BANB 1O2TA 3SGQE 1O3FA 1TLDA 1L1NA 5C2ZA 2OQUA 5EQSA 1LTOA 1T8OA 2OINA 2WYGA 2QV1A 3SUEA 1A3BH 3UUZA 2GD4B 3SGBE 1P2QA 1Z8RA 4GCHG 1RTKA 1RIWC 1S5SA 1QNJA 1N8OC 4E06H 1SLWB 1AO5A 4XBCA 5FPTA 3CP7A 1TGSZ 3E6PH 4JK5A 3T27A 3W95A 3GY2A 2P8OB 1ELTA 2VIOA 4J1YA 1NT1A 2QGRA 2V3OH 1CA8B 5IDKA 1CO7E 4NG9H 2AH4X 1Z6EA 4TY7A 5EU8A 2J95A 2QF3A 3SW2B 2ANWA 3TH3H 3PLPA 1DXWA 1SHYA 1FPHH 4RKOB 2VGCC 1UTMA 4X1SU 4Y79A 1HBTH 4I31A 2VH6A 4XFQA 2A1DB 1KXBA 3OY5U 2FDAA 4MPXA 1GI0A 2ZNKH 1A61H 1IHSH 4XBBA 3SHAH 4X1QU 5TCAA 1KIGH 1AFEH 2ANKH 2Y7ZA 3I29A 2PR3A 1GVKB 2ZTZA 2AS9A 4DG4A 1O3DA 2BQWB 5TJXA 5E2OA 3AW1A 3RXVA 1YC0A 1ETRH 3GDSA 1O5DH 1GMHG 3P17H 4CRGA 4ISIH 1BIOA 2VIQA 2PTCE 4IN2A 5EPNA 3SO3A 3TK5A 1SSXA 3SNBA 1ZTKA 4AYYB 1F0RA 1SHHB 4H4FA 1UHBA 3TLOA 3GISB 3KF2A 3GCTG 1S6FA 5FBEA 4ABIA 3RUOA 5I46H 3A84A 3ITIA 4TWYA 2NWNA 4WMDA 1QRXA 4Y10E 2VIVA 3SU2A 1Z7KA 2WINI 4I8GA 2C3SA 2BDAA 2W26A 7ESTE 2ZPSA 3EAJA 1GJCB 4GUXA 1ANDA 1AQ7A 2BD3A 4B2CA 2QXHA 1GJ6A 4BTTB 2VWOA 3M7QA 1NRNH 1RS0A 2ZTYA 2PV9B 4UONA 4ZHAA 2NU1E 1EAUA 4DJZB 1UVSH 3OSYA 1GJ9B 3SU1A 3EQ0H 4Y8ZA 1SOTA 1XMNB 1NROH 3ZZ3A 2A4GA 2A7HA 1C4V2 2ZHDA 1Q2WA 1C4U2 1H9IE 3U1JB 4Q80A 1IQKA 2I6QA 3Q3XA 2V3HH 3PMBB 2TPIZ 5L2ZH 4NA8A 5FX6A 4I7YH 2Y5GA 4TPIZ 4ZMAH 1THRH 2G81E 1TGNA 1VJAU 3RMOH 3F68H 1FUJA 4Y71A 1MKXK 4ISHH 4BOHA 1JIMA 3VB6A 4HFPB 1A46H 3ESTA 1V6DA 1XUGA 2H1UA 2PGQB 3T5FH 3Q00A 2G4TA 3ZZ4A 2ZU2A 1A4WH 1AB9B 2ZFFH 4ABBA 4WXIA 2VWLA 5EG4A 2ZCLP 4GLYA 5IYTA 5JDUB 7GCHG 1C9TA 3VXEH 2FP7B 1MQ5A 2FTMA 4LOYH 4I8HA 1YPMH 2B8OH 1IQMA 3HK6B 3RU4D 3R0FA 1QB9A 2FI3E 5L30H 1GJ8B 4BNRA 5T6GA 2NU2E 3RXMA 4CRBA 5C5OA 1TRMA 1V2JT 2WV4A 3ELAH 1C1PA 3S69A 2XBXA 2BYAX 2BDYA 1E35B 3DHKH 3SU0A 1TAWA 2HRVA 2ZHFH 3V3MA 2BOHB 2GT8A 1UMAH 1TQ0B 1ZTJA 3M5OA 2J94A 3ZZ5A 4OGYA 1ETSH 1B5GH 2W7UA 1O32A 2XXLA 1BCUH 1O5BB 3VXFH 1TWXB 2BLOA 5DP7A 1TALA 3ATKA 1W14U 1OS8A 3TK9A 1QHRB 2HNTF 2GV7A 1W3CA 1CGIE 1RGQA 1O5GH 1UTQA 1SFQB 2P3UB 2A5KA 1HUTH 1AN1E 1NU9A 3TIUA 2XRCA 1KLTA 5ESTE 2F83A 2CJIA 1N1LA 3PV4A 1HAXB 3LGWA 3TK6A 1NO9H 5T6FA 2P3FH 2THFB 2IOTA 3FANA 1XUHA 1O2PA 1P2NA 1DS2E 2VNTA 3QZRA 2BXUH 2TGAA 2TRMA 2UWOA 1T31A 2G5VA 7KMEH 3ZZ7A 3LH3A 1K1PA 2WPHS 4AOQA 1CT0E 2VVCA 2BQ7B 2UUYA 4X1RU 4OS7A 3SUFA 1ELGA 2WUCA 2ASUB 4B2BA 1PYTD 1O3NA 1PPCE 1BJVA 1D9IA 2FODA 3ODDA 2BY7X 1O2IA 2C93B 3OU0A 3FP6E 3Q77A 3DFLA 2PKSC 1AFQC 3TGJE 4MPWA 1S83A 1O2HA 1ZTLA 4MPVA 1TNJA 2F9PA 4YLQH 1SLUB 3KQDA 4Z6AH 1UK2A 3UWIA 2ZHEH 2ZI2H 1JXPA 3LGIA 4NA9H 3M5LA 2GMTC 2GP9B 1E0FD 2J2UA 1O2YA 3SNCA 5F8TA 4CHAB 5SGAE 4A1VA 1C2LA 2A4OA 1TMTH 2FOFA 2Z6BD 3H7OA 3OTJE 1GDUA 3MH5A 1GI3A 4GVUA 3M35A 3BTGE 1GBAA 3TPIZ 1F7ZA 2FYRA 3GCNA 1ZSJA 5E0HA 3MNXA 1OP0A 3KEEA 3ZVCA 4BTUB 1S84A 1O2VA 3SQHE 1O3KA 2JKHA 1KXEA 2BD9A 1PFXC 1TA6A 2K1QA 2Y80A 2Z9KA 5JB8S 4Y7AA 3RLWH 3G01A 3MU0A 5FHTA 1PPEE 1T4VH 1TGCA 3RLYH 3RU4E 1VCPA 3EA9A 1HJ9A 3EGKH 3ZZBA 1O2RA 4B2AA 1Z1IA 2H6MA 1BRCE 2PW8H 4HGCA 1SGCA 3BTQE 4BAHB 8LPRA 1WOFA 1KXAA 1O34A 4ZHMU 5A0BA 2O9QA 2ZU1A 1TYNA 1W2KH 4IBLH 5E0JA 1TMUH 3A81A 3UNQA 2CF8H 3LKWA 4XSKU 3GY3A 1YPKH 4UFGH 2XBWA 1FN8A 2ZDVH 2A7JA 1WTGH 1K1IA 3HGNA 3LGUA 3TGIE 1P10A 1OPHB 4IC6A 1P8VC 1NFXA 5EW2H 1GJ7B 2CXVA 3FAOA 4ISOA 3SU6A 3LC5A 3GICB 1DWEH 2BLQA 1IHTH 4A7IB 1XXDA 1Y3XA 4WWYA 1MTWA 2OBOA 5ESBA 1ZRBA 1IOEA 1OYTH 2SGQE 3V13A 3A83A 5E0GA 1K1LA 1HLTH 4A5TS 2ANMH 2BLWA 4I8LA 1VJ9U 3STJA 2FEQH 2EEKA 4Q7YA 1T8NA 1A5GH 2A2XH 2AMQA 2VIDA 1MAYA 1GMDF 2QF0A 4ABAA 3QX5H 1BTZA 1ZPBA 2QIQA 1G2MA 1L4DA 4ABFA 2CN0H 3BTTE 1FY1A 4SGBE 1Z8GA 1ZMJA 2FZZA 2FOBA 2G5NA 3RMMH 1W8BH 3EYDA 4CR9A 3V7TA 4AZ2B 2DE8A 2BY8X 4GSOA 1P2IA 3MMGA 3NCLA 3EA8A 5ETXA 1TE0A 3A7YA 4B74A 4Y0YE 1FI8A 2GDEH 1HAGE 1BRUP 4CH8B 1TFXA 1C2MA 2P94A 2JH0D 1AY6H 5C3NA 1JRSA 1AVXA 1CBWB 3MO3A 1QQ4A 1PJPA 1ELAA 1A5HA 5AF9H 1Z8JB 4IN1A 1MTNC 2G52A 5I25A 2Y7XA 4NFEA 1T4UH 1V2KT 6ESTA 1O2WA 4QT8C 1MUEB 1C5SA 1WSSH 5DP6A 1WCZA 3P70B 2H5DA 1NFWA 1YPHE 1Y5BT 1SQAA 3Q3YA 4ZHLU 4U2WA 3RXKA 3TVJB 2FOHA 1EPTA 1L1GA 1O39A 1MZDA 1TMBH 4GAWA 3LONA 3ZVGA 1V2TT 1F92A 1DWCH 1LHFH 2PWXA 1O0DH 1C2FA 2GMTB 3A80A 1PPBH 3UFAA 4TWWA 1EATA 1DXPA 2AIQA 1H1BA 1ELBA 1BRBE 1O3HA 2LNCA 2B5TB 1SBWA 1NM6A 1GCTB 2PUQH 3MNSA 1D6RA 2ZDAH 1PPZA 3PM3A 6GCHF 3UNSA 2J4IA 1AIXH 1EZQA 1O2LA 3SZNA 3S9BA 2XC0A 4A92A 1C5MD 1YYY1 1C1TA 1CHGA 2ZGXH 1N8OB 3SGAE 1C5XB 1O2KA 3LGTA 1VCQA 2ZU5A 1G30B 2C8WB 2D2DA 2GKVE 2GZ8A 2IPHA 1P9SA 1ZPZA 5GPIB 4NSYA 2VVVA 4TPYA 1WTHD 1DX5M 1ELEE 1IQNA 2Z94A 3B23B 1C5TA 3KL6A 3GYLB 1F5LA 1M9UA 1RFNA 1EQ9A 1MZAA 3T29A 1DITH 1HAOH 3UPEA 4Z0KA 3FFGA 1D3DB 2GDDA 3E0NB 4A6LA 2QN5T 1ELVA 1HB0B 4XOJA 1S81A 2FOCA 1ZSLA 1DY9A 4NSVA 3S7HB 3F1SB 3SOSA 2YNBA 1SGYE 4B1TA 2GCHG 2UUJB 2XW9A 1NN6A 3D62A 3MHWU 5T6DA 1GHAF 1K21H 3LPRA 4R0IA 1VCWA 4JYVH 1UTKA 1FMGA 1P02A 1C1WH 3P95A 4INKA 1BTYA 4CRFA 1C2DA 3SU4A 2EA3A 4NFFA 1NRQH 1O33A 4NCYA 1WBGB 2VWMA 4B75A 1SQTA 2IJOB 1A1RA 2FLRH 2GVFA 1AI8H 3MNBA 1EAWA 2PTNA 5LPEA 1G36A 1AKSA 1HDTH 3PMJA 4B73A 1FJSA 1TNKA 5EXNA 1D3PB 1LHGH 1EJMA 1F0SA 1NU7B 3PLBA 3A85A 2W3IA 4WXVA 3HKIB 4H42U 1Y3WA 3PWBA 3BTDE 2VIPA 1S82A 1BMMH 1TB6H 1MU8B 2VU8E 1GVZA 1C4Y2 3GY5A 3M5NA 4ABDA 3VEQB 1A0HB 1ZJDA 3LDXH 5EOKA 4IS5A 1THSH 3LJOA 2ZFPH 3M3SA 1ABJH 1U6QA 1BTPA 1E37B 2XC4A 1O3IA 2BZAA 2H5CA 3DUXH 2SGEE 5BRRE 2XCFA 3M3TA 2XTTB 1A5IA 2WV5A 4X2VA 3W94A 1IQEA 4K1EA 2ZA5A 5EPYA 3OX7U 4K8YA 1K1MA 3HK3B 1GI9B 2ZQ2A 2F9VA 3GY4A 3U8RH 1OP8A 3BF6H 3RC5A 3SHCH 5FBIA 4K1SA 1A0JA 1RRKA 1XX9A 4D7GA 1XKBC 1CHOG 3RXGA 3BG8A 4YLUA 1C1UH 4GCHF 1MU6B 2A0QB 4NGAH 3H5CB 1E34B 1HYLA 3GCTF 3VB4A 2ZKSA 1HFDA 4XDEA 1P2KA 1Z1JA 1ZLRA 2BX4A 3TU7H 4KP0A 1Y3UA 2NU0E 4AFSA 6GCHG 3TJNA 3TH2H 4DURA 2ANYA 2HALA 1L0ZA 3SJ9A 4D8NA 2FTLE 1RTLA 1VITH 1DE7H 5CHAC 1OWIA 5EGMA 3L6PA 1SL3A 4AB8A 1L2EA 2I6SA 1W13U 1QL8A 2AMPA 3TITA 2EC9H 2ZDNA 1P9UA 1FLEE 1GI2A 4NIVA 4FU9A 4UDWH 1GCTC 1HV7A 1C5NH 1VITG 1QB6A 1C9PA 4YZUA 3GY8A 1QRWA 1BTXA 1TNIA 4CBNA 4CRDA 5K7RA 1KXDA 4ZKNU 1CGJE 3KQCA 1AVGH 4X0WU 2BXTH 3L3TA 5K0HA 4NWLA 4ABHA 2AFQB 1JIRA 3BTEE 1O2ZA 1SGNE 1TQ7B 3DA9B 1YCPK 1W7GH 3RXQA 2Z9JA 1RD3B 1BBRH 4OS4A 6LPRA 4FUEA 3DFJA 1ELDE 1N6YA 3STIA 4UFFH 1GCDA 4YM9A 3N7OA 1HAYB 3SNEA 1FQ3A 1GL1A 2VIWA 3CS0A 5F8XA 4CRCA 1B0EA 3RXAA 3CS7A 3SJIA 3ZZCA 3TNTA 3Q3KA 2A32A 4ASHA 1LQEA 2ZECA 1IQHA 9LPRA 1P2JA 1Y8TA 3SI4H 1AFQB 3ZYDA 5F03A 3QGNB 1C1RA 1ZHPA 1MTUA 2ZHWH 1ELCA 1SGFG 2PKAA 3S9CA 1J16A 2ZEBA 1O2NA 1LQDB 1EPTB 1HCGA 1GGDB 4FUJA 1BOQA 3RXCA 4X2XA 5H4IB 1IAUA 3BG4B 5LPRA 3QN7A 1EOJA 3QWCH 3TH4H 3VFEA 5C1XA 1KDQB 1NC6A 3PLKA 2J38A 4FUCA 4YTAA 1PQ7A 1W10U 1BBRE 1H9LB 1INCA 4BAKB 3LGVA 3F9GA 1BMAA 1O3MA 1ETTH 4UEHH 2C90B 2A5AA 2A5IA 1LKBA 1UCYH 3P92A 3E16B 3NPSA 1NTPA 1W7XH 5DJ7A 1GBIA 5CE1A 1O35A 1DUEA 5EODA 3GDUA 1NZQH 1VGCB 4X6PA 1SI5H 1W12U 1WYKA 3M36A 1J14A 1UTPA 1SGPE 1P06A 2H2ZA 3SORA 2OP9A 2OCVB 3UR9A 1ZJKA 4CREA 5A0CA 4A1TA 1SR5C 3ZZ8A 1YF4A 8ESTE 3O8DA 3E3TA 8KME2 1DUAA 3O8RA 2B9LA 5EXMA 1GBDA 1P04A 1ELFA 3RXUA 3RC4A 4HTCH 4IC5A 3QTOH 3U69H 4B71A 1SOZA 1O31A 1G37A 1UCYK 3BIVH 1TPSA 1O2OA 2CMYA 4XBDA 4ZUHA 3RXOA 1EKBB 1EZSC 3LT3A 1NFYA 1O3OA 4M7GA 1TOMH 1O2JA 4K1TA 4MNWA 2VJ1A 2Y82A 2GTBA 5E8EH 4BAMB 1EJAA 3SBKA 4ZAEA 3BN9A 1AUJA 1UTJA 3LGYA 3AW0A 5HMAA 1E36B 1TONA 4IMZA 2Z9GA 1YM0A 4BXSA 2OLGA 3E90B 1XUIA 2R3YA 5A8ZA 3ZZ9A 3ENSB 1G3DA 2B7DH 1QTFA 1FY4A 3RXHA 4CBOA 3K6ZA 1UVTH 3GOVB 2A7CA 1T8MA 4O3UA 2WPKS 3RXSA 1G32B 2WUBA 4AG1A 2BY5X 3BEFB 1GI8B 2Y5HA 5CHAB 1HIAA 3PROA 1LVBA 1P3EA 2PUXB 2D26C 3H7TA 4LK4A 2LPRA 2HNTE 2OC0A 4Y8YA 1GI5A 1ABIH 2QY0B 3TJOA 4A1XA 3I77A 1ZZZA 4AX9H 2Z3DA 2XWAA 3GYMA 1Y3YA 4Y11E 4UD9H 3FZDA 2M5TA 1MBMA 2C8YB 1GHYH 1A0LA 5EXLA 1PQ8A 1J8AA 4YOGA 1LVMA 2C4FH 1TGTA 1CBWC 4ZXXH 1ZMNA 2TGTA 2A4RA 2AGGX 3E0PB 4Y0ZE 5GIBA 3ZVAA 3LC3A 1YLDA 1MTNB 1JWTA 1MH0A 1QBNA 3MH7A 2BDHA 4XE4A 4Y6DA 2DE9A 2PLXA 3A86A 3RXRA 3Q76A 4WH6A 5C1UA 3T28A 1P09A 1EASA 1O2SA 3T25A 1UVUH 1GJ4H 5GXPA 2BTCE 3LU9B 3B9FH 3A8BA 2O8MA 1KSNA 1GBFA 1P2OA 2ZIQH 1T7CA 3BTKE 1FN6A 2BLVA 1FZZA 2BD8A 4ZXYH 3ODFA 1DFPA 3SU3A 1EX3A 1YCPM 1SGRE 4JZEH 5FPYA 1HXEH 3BG4C 1TRYA 1OWHA 2XWBI 1G3EA 1ZGIA 1YPLH 1AE5A 1BMNH 4O97A 4ISLA 1HAVB 3RP2A 3TGKE 1O3BA 2FOAA 1O5EH 4I8JA 2BZ6H 3UTUH 2TIOA 3FP8E 3OYPA 1O2MA 4ABJA 1Z8IB 4KELA 1HGTH 1UCYE 1HNEE 1CSOE 1PYTC 2ZP0H 2PSXA
chains in the Genus database with same CATH superfamily
3U8OH 1TOCB 1OKXA 3M5MA 1AUTC 1GMCG 1BTHH 2PGBB 1C5ZB 3A89A 1EB2A 1VGCC 3LOXA 4KTUA 1DSTA 1P0SH 3MU5A 3M61U 5GCHG 1OWJA 5DP5A 1NESE 2ALVA 1COWD 2ZTXA 3MU8A 4AGKA 1QR3E 4NZLA 2G55A 4AFQA 2HGTH 4TYDA 1V2ST 1ANCA 2BY6X 3PMAB 4ZROA 2QC2A 1O5FH 1KLIH 1TNLA 2EI8A 3DD2H 1TBZH 2SGAA 1TRNA 2NU4E 1QFKH 1WV7H 4UFEH 2BQ6B 2WSSD 3SJKA 1G9IE 1TGBA 1OX1A 2BD2A 5KECA 2PKAB 3GCOA 2RDLA 3MNCA 2OXSA 3A8AA 1T32A 2ZDLA 3MH4A 1KTSB 5EJ1A 1C1MA 2HPPH 2FO9A 1THPB 3A7ZA 1CT4E 2FPZA 1GDQA 1GHBG 1DWDH 4FUDA 4NZQA 4AFUA 1BITA 4Q7ZA 2FXRA 1QY6A 1ANEA 2BD5A 2VB0A 2G8TA 3MU4A 4NWKA 1DANH 1JOUB 3QZQA 1GHVH 2M2AA 3WY8A 3P8NA 2OTVA 4NA7A 2W7SA 1VR1H 2XOKD 3BTHE 5LGOA 2ZGJA 3UREA 4F4OC 2OC7A 3NUMA 3AAUA 1AHTH 4KTCA 4MQAA 2R0KA 3FZZA 5PTPA 1C2KA 4IGDA 5T1VA 1C5PA 3NWUA 1TPAE 2ZU3A 3RXIA 1OP2A 4DW2U 1NFUA 2Z7FE 5C20A 4ABGA 3KIDU 2Q6DA 4K69A 2J9NA 3VGCC 1LHCH 2FOGA 2P59A 1CT2E 3SV7A 5A09A 4LXBH 2ZHQH 3K9XB 1ZPCA 2GJGA 1O3PB 3KQBA 1BB0B 2WPIS 5HM9A 3OTPA 4FUBA 1Q31A 1QJ1B 4ABEA 3TJUA 3SNDA 1W0JD 3ZV8A 3A88A 4FXGH 5C0TA 2O8WA 1O5AB 2AEIH 4BXWA 1FIWA 1EFRD 5TCCA 1GMDG 3KCGH 1A2CH 1DY8A 1ANBA 2W3KA 1BRAA 2ZZUH 1DM4B 3RXDA 5GNDA 2TGDA 5HIZA 1GI4A 1CGHA 1GJBB 1BHXF 1BT7A 2FWWA 4INLA 1O3LA 2SNVA 3M3VA 4DT7B 5AFZH 4WH8A 4OS6A 3QDZB 2HVXA 2CGAA 3A7TA 4M9FA 4X6MA 1AKSB 3SNAA 2JH5D 2SGFE 4OM9A 2O8LA 5DP3A 4I32A 2FYQA 1XXFA 1V2QT 5J4SA 1FXYA 1YCPH 1AMHA 4YOJA 1TIOA 1FAXA 2FI4E 3VB7A 1EB1H 3BTWE 2XBYA 2HOBA 2UWLA 1SGEE 4AN7A 1DWBH 4AYVB 5GWZA 4DCDA 5DSFA 1BA8B 2G51A 5HM2A 4F49A 4OS2A 2W6JD 1YPEH 1V2OT 2JJ2D 2WPJS 4JYUH 1BQYA 1C1QA 3ZZAA 2Z3EA 1K28D 1DOJA 1S0QA 5E2PA 1QIXB 3K6YA 2HLCA 1Z6JH 3EDXB 3ZVEA 1AVWA 2JH6D 4Q7XA 1YPHC 3IWMA 1AZZA 2C8XB 2CHAC 1RTFB 2F9UA 3QK1A 1B7XB 1GL0E 2WPDD 1DDJA 2C8ZB 3KGPA 3A7WA 1AU8A 1XUFA 5FCKA 4AC9A 2QYIA 9ESTA 5DP9A 2KM0A 1CE5A 1MCTA 5CHBA 1ZMLA 4KKDA 3BEIB 2HNTC 2Z9IA 1HAZB 2AGEX 1BTUA 3A82A 1DLKB 2XYAA 2F91A 4MNYA 1ZRKA 2BOKA 1O2QA 1E38B 3U98H 2Q1JA 1V2RT 1TX8A 4Q4LA 4B6EA 3BEUA 4DIHH 1LPZB 4DIIH 2A4QA 1UO6A 4XRNA 3O8BA 3SJ8A 2OBQA 1Y59T 2GCTC 2ZFTA 1ZYOA 3MQKC 1EPTC 3ZVDA 2AERH 1P3CA 3NKKA 1GGDC 3HATH 3SU5A 3TJVA 4Y8XA 2QA9E 1BJUA 5JB9S 2QXIA 2R2WU 3U8TH 1O30A 3BTFE 1GI6A 3ZV9A 1ZHRA 2Z3CA 8GCHF 3S0NA 1NS3A 2ZDKA 4JMYA 1C2HA 2VBCA 2ZFSA 4KTSA 4K8BA 4LZ4B 3SV2H 2V0BA 2D8WA 3VB5A 2UWPA 4HZHA 5DP8A 3KNXA 1AWFH 1OHHD 1C2JA 3AVZA 2RCEA 2ZDMA 2HPQH 5GDSH 1CHOF 2QAAA 2JIZD 4R8TB 4THNH 2ZF0H 4X8VH 1Y5AT 1LCYA 1S85A 2P3TB 4CH2B 4DVAU 2R2MB 3BV9B 3A7VA 1F2SE 2ZWLH 3P8FA 1D4PB 2Y6TA 4UFDH 5G4BA 4MG3A 4IW4E 1O3EA 1LPKB 1ZGVA 3K65B 2W5EA 1N6XA 2KAIB 1IQFA 2Q6GA 1GJ5H 1TBRH 1H4WA 3BIUH 3TNSA 2UUFB 2FS8A 4IMQA 4MLFB 4FU8A 1GHWH 3P6ZB 3F2HA 1GI7B 2GV6A 3I78A 4YT6H 4E7RG 1K1JA 1F5KU 1HJAB 1G2LA 4XD7D 1FY3A 2STAE 1BMFD 3OEHD 1GDNA 4YESB 1O37A 1FPCH 2ESTE 1V2VT 3EA7A 1NBMD 3CENA 1BHXB 1Z71A 1GMHF 2XBVA 1QL9A 3PB1E 1KDQA 2ZQ1A 3GDVA 5C67A 4X1PU 1O38A 1V2NT 1EUFA 3M7UA 2F43B 5EQRA 3M7TA 4X6NA 2V6NA 4O9VA 3PV5A 4ACAA 2RA3A 1ZOMA 1W11U 3F9HA 1YGCH 1YKTA 1YPJH 1AGJA 2ZG0H 3P8GA 2AGIX 2QXGA 1CU1A 1C5UA 2AYWA 2H9HA 7GCHF 4O3TA 2TBSA 1V2LT 1OWEA 4MNXA 3JZ2B 2PFEA 2JETB 4U01A 3NZIA 3F9EA 1SB1H 1D3TB 3KYFA 1C5WB 2FESH 1ARBA 5JYIA 1GBMA 3NK8A 2P16A 2ZGHA 1UJ1A 1BZXE 2OD3B 3BTME 2FOEA 3RXFA 2ZCKP 1GBLA 4CR5A 3MTYA 2YOLA 2RG3A 2P8OC 1GJAB 2J97A 1BDAA 3UQOA 1AE8H 3ATIA 2YNAA 1V2MT 1SG8B 1ZSKA 2B0FA 1AZ8A 1HXFH 4JK6A 4X1NU 2BHGA 1C1OA 4H6TA 2UUKB 5A2MH 1ID5H 2CHAB 2J98B 2ZO3H 1OSSA 2HWLB 3ZIAD 1VITF 1MBQA 4KGAA 2K8IA 2BD4A 1C1SA 1GBJA 3QGJA 4GHTA 2FS9A 2Q6FA 3UNRA 4DY7B 4JZDH 1YY3A 3U9AH 2BVXH 4GHQA 1LHDH 1WQVH 5A0AE 3QO6A 2FX4A 1CA0C 1SGDE 4PROA 3GY7A 3T26A 2CF9H 2STBE 1GBBA 2BB4A 2ZPRA 2ODQA 1GHXH 1DPOA 1TX7A 3MU1A 4JZ1A 4K5ZA 1O36A 1Y3VA 1QQUA 2BM2A 5F8ZA 4YT7H 1UVOA 4FUHA 2EY4C 5LH8A 2D1JA 2XCNA 3ATLA 8GCHG 3IG6B 2NU3E 2XNDD 2KAIA 2BDBA 1C5LH 2GGVB 3KQEA 1IQJA 1DVAH 6CHAC 2BVRH 4I8KA 2GCTB 1HAHH 3E8LA 3GCHC 1OYQA 1TA2A 1TX6A 1JMOH 3IITA 3LIWA 3SI3H 3UQVA 1P05A 1C1VH 2OC8A 2AHME 2OK5A 1IQIA 2QF4A 1DT2A 1GHZA 3P8OA 1SC8U 2PSYA 3HKJB 1P03A 3BSQA 3V12A 5DO4H 3NXPA 5J4QA 3AASA 3MFJA 4FUFA 1HJ8A 2SGPE 4WVPE 3SV9A 4MVNA 1H9HE 4D7FA 1WUNH 1BUIA 2ILNA 4RSPA 1O3CA 3C1KA 3K2UA 5DK1A 2ODYB 2O8TA 3HGPA 1W0YH 1C2GA 2ZC9H 5FX5A 1O5CB 5BPEA 1MD8A 2KX4A 4MPUA 1QBVH 1QL7A 4FVDA 4RT0A 1LHEH 1QBOA 5CMXH 3MH6A 4FVBA 2VH0A 5FPSA 4VGCB 2ZGCA 3SQEE 1XUKA 1O3AA 4B76A 2RDEA 2F9NA 1K22H 1QB1A 1V2PT 1VZQH 3RM0H 3F9FA 1K1OA 2P95A 1NRSH 1MAXA 3ATWA 1FIZA 5T3HA 1FONA 3URDA 5ABWA 1RXPA 4YOIA 1PQAA 4Y76A 5JBBS 4ZH8A 1TNHA 1SMFE 2J92A 2YMSD 1MTSA 1O2UA 4INHA 1ARCA 5AVDA 3SN8A 1GPZA 4D9RA 1AWHB 5B6LA 2DUCA 2GZ7A 4HG6A 4ZKOU 1C2EA 1HJAC 1IQLA 3E1XB 2J5UA 4O03A 1HAPH 4DOQA 3WWFA 3PWCA 1SGIB 3VPKA 4F55A 1GHBF 4JZFH 1SPJA 1GG6C 4AFZA 3U1IB 2WYJA 1P12E 3B8JA 5HYOA 3S7KB 2O8UA 4Y7BA 2H9EH 1ORFA 2V35A 5DG6A 1C5RA 1EJNA 2BVSH 1H8IH 1JRTA 3RXBA 3L33A 1TABE 5DP4A 1HAVA 2Z9LA 5C0UA 1EZUC 1TPPA 5AHGH 4LZ1H 4NIYA 3UIRA 3DT0H 4HI3A 1SFIA 1NPMA 1MKWH 2SFAA 1TBQH 2BX3A 1O3JA 3QUMP 1GBKA 3SJOA 3ZVBA 4FUIA 2YMSC 1IQGA 3PMHB 1ESBA 5JBTA 3M37A 2AIPA 3D65E 1MABB 4X2WA 1ESAA 2JETC 4K3JA 1WQSA 1QURH 2XC5A 3SV6A 3KHVA 5JBAS 5HGGA 1XUJA 4WMFA 4BAOB 1FV9A 2Y81A 1D6WA 3LJJA 4AG2A 4ESTE 1C5QA 3GY6A 1GVLA 3D23A 3VGCB 3RU4T 2G00A 3R3GB 5FAHA 3A7XA 3RXTA 2KR7A 1V2WT 1LMWB 1MKXH 1ZHMA 1A3EH 1BMLA 1O2XA 5DKMA 2WPMS 4ZKSU 2ZFQH 1C1NA 1P57B 3RXLA 4OGXA 1AD8H 1SQOA 4WJG2 1LVOA 3MO9A 1V3XA 3SYJA 1CVWH 3MYWA 4MTBA 1GI1A 1DLEA 2PKSB 1EAXA 3HPTB 1C5YB 1PPGE 2FOMB 3SZEA 3OAAD 4K60A 3RXPA 1FY5A 3S9AA 5HKKD 1LPGB 4TY6A 1DSUA 2TGPZ 1QJ6B 1S6HA 5DPAA 1UTLM 2FI5E 3F6UH 1P11E 2SNWA 2A45B 1KYNA 1CA0B 3PO1C 1K9OE 1KLJH 2A2QH 1ZR0A 2PHBA 5DGJA 4ZKRU 1SVPA 3MI4A 4X6OA 1XKAC 4J2YB 2BDIA 2ZCHP 4CHAC 1MQ6A 2SGDE 5EIYA 1JBUH 1F0UA 1UTNA 1UTOA 3MO6A 1UHBB 4FUGA 4WY3A 1UK4A 5HXFA 4Q2KA 3AAVA 3RXJA 1A7SA 1MD7A 2FM2A 6CHAB 1OWDA 4AB9A 2R3UA 3GCHB 3MWIU 1TPOA 4FU7A 4JCNA 1J17T 3RMNH 3SV8A 1B0FA 1SGFA 1RIWB 1YPGH 3C27B 3U28C 5A8YA 1LDTT 2WHXA 3EE0B 3V0XA 1D3QB 4SGAE 3PTBA 5F6MA 4NIXA 2XNIA 5JBCS 4I33A 4CRAA 7LPRA 2IN2A 3PTNA 3E91A 4GPGA 1BTWA 4E7NA 1GWAA 2A31A 1ESTA 3QLPH 2AMDA 1EAIA 1QZ8A 2FMJA 1G3CA 1Q3XA 1QA0A 1GJDB 1SLXB 2WPLS 5GCHF 2VGCB 3MOCA 1GHAG 1MCVA 1RJXB 2ZPQA 1EP5A 2G4UA 5KGOA 1UK3A 1MMJN 2FIRH 4RKJB 1KXFA 5EQQA 2Y5FA 1GBCA 1PPHE 5FXLA 1LO6A 3ZVFA 4VGCC 1CQQA 2VWNA 2J34A 2CV3A 3RM2H 1FNIA 2ALPA 5B6OA 4X2YA 4WF8A 4ISNA 2GCHF 4DGJA 1YBWA 3ATMA 3JZ1B 1MTVA 3A8CA 1YLCA 3LH1A 3KN2A 3D49H 1HRTH 1EOLA 5AFYH 1H8HD 3SUDA 1QA7A 4UE7H 3RXEA 3ZYEA 1WXRA 1EP6A 3F0OA 2ZGBH 1C2IA 1BBRK 2GX4A 2GT7A 4BAQB 2BMGB 4MDSA 1UVPA 2F9OA 2P93A 2ULLA 1W0ZU 3PYHA 3T2NA 3FP7E 2GZ9A 4WMEA 1MKWK 1QJ7B 2OC1A 1GMCF 1ACBE 2H9TH 4X8UH 2BDGA 3A87A 1PPFE 1HIAB 1WU1A 1GG6B 1J9CH 1QGFA 3A8DA 4JYTA 4K2YA 5FCRA 2FLBH 1LKAA 2R9PA 1HPGA 2VINA 1EXFA 1H8DH 3VB3A 2FX6A 3EE7A 3UR6A 4X8TH 3ZZDA 2BD7A 1EZXC 2HVYB 5C1YA 4U30A 2QCYA 1KTTB 2KZ4A 3UOPA 3OY6U 3ZZ6A 2YMSB 3O8CA 1GBTA 1XM1A 5A8XA 4RN6A 3URCA 1FY8E 1C5OH 1G3BA 1V2UT 1LVYA 4OS5A 3SUGA 1P01A 1QCPA 1J15A 2R0LA 3UOUA 4H6SB 5C5NA 1C5VA 1L1JA 4X8SH 4D9QA 4DT4A 1YP9A 2ZFRH 1O2GH 3FVFB 1NY22 5L6NH 1SGQE 4U32A 1K2I1 1QRZA 3DSGA 5L2YH 1KY9A 1AB9C 4NIWA 2F9BH 1NRRH 1XVMA 1OXGA 2ZU4A 3PRBA 1T8LA 2OQ5A 1Y5UT 5JPMH 1XVOA 1FAKH 2ODPA 5EW1H 2VVUA 4BTIB 1TNGA 5LPFA 1K1NA 4YO9A 3RMLH 1S0RA 1WAYB 1PQ5A 4D76A 4AGJA 4OS1A 2EI6A 1GBEA 1F0TA 4AORA 1F5RA 5C94A 1OOKB 2BDCA 5C17A 2OUAA 1P2MA 1DICA 4MNVA 1X7AC 2RA0A 3RC6A 3T62A 1OWKA 1O3GA 1HAIH 3KQ5A 1FDPA 3PO1B 3QTVH 4JZIA 4E05H 3F2FA 1L4ZA 3RDZA 1KXCA 1GBHA 1SGTA 5GJ4B 1NRPH 3WWBA 2F3CE 2QXJA 3UWJH 3UY9A 2BY9X 1SLVB 2EI7A 4BANB 1O2TA 3SGQE 1O3FA 1TLDA 1L1NA 3CNRA 5C2ZA 2OQUA 5EQSA 1LTOA 1T8OA 2OINA 2WYGA 3FKSD 2QV1A 3SUEA 1A3BH 3UUZA 2GD4B 3SGBE 1P2QA 1Z8RA 4GCHG 1RTKA 1RIWC 1S5SA 1QNJA 1N8OC 4E06H 1SLWB 1AO5A 3FO8D 3PRDA 4XBCA 5FPTA 3CP7A 1TGSZ 3E6PH 4JK5A 3T27A 3W95A 3GY2A 2P8OB 1ELTA 2VIOA 4J1YA 1NT1A 2QGRA 2V3OH 1CA8B 5IDKA 1CO7E 4NG9H 2AH4X 1Z6EA 4TY7A 5EU8A 2J95A 2QF3A 3SW2B 2ANWA 3TH3H 3PLPA 1DXWA 1SHYA 1FPHH 4RKOB 2VGCC 1UTMA 4X1SU 4Y79A 1HBTH 4I31A 2VH6A 4XFQA 2A1DB 1KXBA 1E1RD 3OY5U 2FDAA 4MPXA 1GI0A 2ZNKH 1A61H 1IHSH 4XBBA 3SHAH 4X1QU 5TCAA 1KIGH 1AFEH 2ANKH 2Y7ZA 1H8ED 3I29A 2PR3A 1GVKB 2ZTZA 2AS9A 4DG4A 1O3DA 2BQWB 5TJXA 5E2OA 3AW1A 3RXVA 1YC0A 3WW7A 1ETRH 3GDSA 1O5DH 1GMHG 3P17H 4CRGA 4ISIH 1BIOA 2VIQA 2PTCE 4IN2A 5EPNA 3SO3A 3TK5A 1SSXA 3SNBA 1ZTKA 4AYYB 1NBME 1F0RA 1SHHB 4H4FA 1UHBA 3TLOA 3GISB 3KF2A 3GCTG 1S6FA 5FBEA 4ABIA 3RUOA 5I46H 3A84A 3ITIA 4TWYA 2NWNA 3OE7D 1QRXA 4WMDA 4Y10E 2JJ1D 2VIVA 3SU2A 1Z7KA 2WINI 4I8GA 2C3SA 2BDAA 2W26A 7ESTE 2ZPSA 3EAJA 1GJCB 4GUXA 1ANDA 1AQ7A 2BD3A 4B2CA 2QXHA 1GJ6A 4BTTB 2VWOA 1UW7A 3M7QA 1NRNH 1RS0A 2ZTYA 2PV9B 4UONA 4ZHAA 2NU1E 1EAUA 4DJZB 4ACBA 1UVSH 3OSYA 1GJ9B 3SU1A 3EQ0H 4Y8ZA 1SOTA 1XMNB 1NROH 3ZZ3A 2A4GA 2A7HA 1C4V2 2ZHDA 1Q2WA 1C4U2 1H9IE 3U1JB 4Q80A 1IQKA 2I6QA 3Q3XA 2V3HH 3PMBB 2TPIZ 5L2ZH 4NA8A 5FX6A 4I7YH 2Y5GA 4TPIZ 4ZMAH 1THRH 1FX0B 2G81E 1TGNA 1VJAU 3RMOH 3F68H 2PP6A 2KCAA 1FUJA 4Y71A 1MKXK 4ISHH 4BOHA 1JIMA 3VB6A 4HFPB 1A46H 3ESTA 1V6DA 1XUGA 2H1UA 2PGQB 3T5FH 3Q00A 2G4TA 3ZZ4A 2ZU2A 1A4WH 1AB9B 2ZFFH 4ABBA 4WXIA 2VWLA 5EG4A 2ZCLP 4GLYA 5IYTA 5JDUB 7GCHG 1C9TA 3VXEH 2FP7B 1MQ5A 2FTMA 4LOYH 5HIYA 4I8HA 1YPMH 2B8OH 1IQMA 3HK6B 3RU4D 3R0FA 1QB9A 2FI3E 5L30H 1GJ8B 4BNRA 5T6GA 2NU2E 3RXMA 4CRBA 5C5OA 1TRMA 1V2JT 2WV4A 3ELAH 1C1PA 3S69A 2XBXA 2BYAX 2BDYA 3F2GA 1E35B 3DHKH 3SU0A 1TAWA 2HRVA 2ZHFH 3V3MA 2BOHB 2GT8A 1UMAH 1TQ0B 1ZTJA 3M5OA 2J94A 3DCLA 3ZZ5A 4OGYA 1ETSH 1B5GH 2W7UA 1O32A 2XXLA 1BCUH 1O5BB 3VXFH 1TWXB 2BLOA 5DP7A 1TALA 3ATKA 1W14U 1OS8A 3TK9A 1QHRB 2HNTF 2GV7A 1W3CA 1CGIE 1RGQA 1O5GH 1UTQA 1SFQB 2P3UB 2A5KA 3PV2A 1HUTH 1AN1E 5EJZA 1NU9A 3TIUA 2XRCA 1KLTA 5ESTE 2F83A 2CJIA 1N1LA 3PV4A 1HAXB 3LGWA 3TK6A 1NO9H 5T6FA 2P3FH 2THFB 2IOTA 3FANA 1XUHA 1O2PA 1P2NA 1DS2E 2VNTA 5IK2D 3QZRA 2BXUH 2TGAA 2TRMA 2UWOA 1T31A 2G5VA 7KMEH 3ZZ7A 3LH3A 1K1PA 2WPHS 4AOQA 1CT0E 2VVCA 2BQ7B 2UUYA 4X1RU 4OS7A 3SUFA 1ELGA 2WUCA 2ASUB 4B2BA 1PYTD 2KCPA 1O3NA 1PPCE 1BJVA 1D9IA 2FODA 3ODDA 2BY7X 1O2IA 2C93B 3OU0A 3FP6E 4RI0A 3Q77A 3DFLA 2PKSC 1AFQC 4F48B 3TGJE 4MPWA 4YXWD 1S83A 1O2HA 1ZTLA 4MPVA 1TNJA 2F9PA 4YLQH 1SLUB 3KQDA 4Z6AH 1UK2A 3UWIA 2ZHEH 2ZI2H 1JXPA 3LGIA 3AK5A 4NA9H 3M5LA 2GMTC 2GP9B 1E0FD 2J2UA 1O2YA 3SNCA 5F8TA 4CHAB 5SGAE 4A1VA 1C2LA 2A4OA 1TMTH 2FOFA 2Z6BD 3H7OA 3OTJE 1GDUA 3MH5A 1GI3A 4GVUA 3M35A 3BTGE 1GBAA 3TPIZ 1F7ZA 2FYRA 3GCNA 1ZSJA 5E0HA 3MNXA 1OP0A 3KEEA 3ZVCA 5F53A 4BTUB 1S84A 1O2VA 3SQHE 1O3KA 2JKHA 1KXEA 2BD9A 1PFXC 1TA6A 2K1QA 2Y80A 2Z9KA 5JB8S 4Y7AA 3RLWH 3G01A 3MU0A 5FHTA 1PPEE 1T4VH 1TGCA 2F4LA 3RLYH 3RU4E 1VCPA 3EA9A 1HJ9A 3EGKH 3ZZBA 1O2RA 4B2AA 1Z1IA 2H6MA 1BRCE 2PW8H 4HGCA 1SGCA 3BTQE 4BAHB 8LPRA 1WOFA 1KXAA 1O34A 4ZHMU 5A0BA 2O9QA 2ZU1A 1TYNA 1W2KH 4IBLH 5E0JA 1TMUH 3A81A 3UNQA 2CF8H 3LKWA 4XSKU 3GY3A 1YPKH 4UFGH 2XBWA 1FN8A 2ZDVH 2A7JA 1WTGH 1K1IA 3HGNA 3LGUA 3TGIE 3UAIC 1P10A 1OPHB 4TT3D 4IC6A 1P8VC 1NFXA 3OEED 5EW2H 1GJ7B 2CXVA 3FAOA 4ISOA 3SU6A 3LC5A 3GICB 1DWEH 2BLQA 1IHTH 4A7IB 1SQRA 1XXDA 1Y3XA 4WWYA 1MTWA 2OBOA 5ESBA 2WV9A 1ZRBA 1IOEA 2K0QA 1OYTH 2SGQE 3V13A 3A83A 5E0GA 1K1LA 1HLTH 4A5TS 2ANMH 2BLWA 4I8LA 1VJ9U 5EJLA 3STJA 2FEQH 2EEKA 4Q7YA 1T8NA 1A5GH 2A2XH 2AMQA 2VIDA 1MAYA 1GMDF 2QF0A 4ABAA 3QX5H 1BTZA 1ZPBA 2QIQA 1G2MA 1L4DA 4ABFA 2CN0H 3BTTE 1FY1A 4SGBE 1Z8GA 1ZMJA 2FZZA 2HLDD 2FOBA 2G5NA 3RMMH 1W8BH 3EYDA 4CR9A 3V7TA 4AZ2B 2DE8A 1SKYE 2BY8X 4GSOA 1P2IA 3MMGA 3NCLA 3EA8A 5ETXA 1TE0A 3A7YA 4B74A 4Y0YE 1FI8A 2GDEH 1HAGE 1BRUP 4CH8B 1TFXA 1C2MA 2P94A 2JH0D 1AY6H 5C3NA 1JRSA 1AVXA 1CBWB 4FETA 3MO3A 1QQ4A 2KFWA 1PJPA 1ELAA 1A5HA 5AF9H 1Z8JB 4IN1A 1MTNC 2G52A 5I25A 2Y7XA 4NFEA 1T4UH 1V2KT 6ESTA 1O2WA 4QT8C 1MUEB 1C5SA 1WSSH 4B6FA 5DP6A 1WCZA 3P70B 2H5DA 1NFWA 1YPHE 1Y5BT 1SQAA 3Q3YA 4ZHLU 4U2WA 3RXKA 3TVJB 2FOHA 1EPTA 1L1GA 1O39A 1MZDA 1TMBH 4GAWA 3LONA 4P02A 3ZVGA 1V2TT 1F92A 1DWCH 1LHFH 2PWXA 1O0DH 1C2FA 2GMTB 3A80A 1PPBH 3F0PA 3UFAA 4TWWA 5CDFE 1EATA 1DXPA 2AIQA 1H1BA 1ELBA 1BRBE 1O3HA 2LNCA 2B5TB 1SBWA 1NM6A 1GCTB 2PUQH 3MNSA 1D6RA 3VG8A 2ZDAH 1PPZA 3PM3A 6GCHF 3UNSA 2J4IA 1AIXH 1EZQA 1O2LA 3SZNA 3S9BA 2XC0A 4A92A 1C5MD 1YYY1 1S6LA 2IJD1 1C1TA 1CHGA 2ZGXH 1N8OB 3SGAE 1C5XB 1O2KA 1E1QD 3LGTA 1VCQA 2ZU5A 4TSFD 1G30B 2C8WB 2D2DA 2GKVE 2GZ8A 2IPHA 1P9SA 1ZPZA 5GPIB 4NSYA 2VVVA 4TPYA 1WTHD 1DX5M 1ELEE 1IQNA 2Z94A 3B23B 1C5TA 3KL6A 3GYLB 1F5LA 1M9UA 1RFNA 1EQ9A 1MZAA 3T29A 1DITH 1HAOH 3UPEA 4Z0KA 3FFGA 1D3DB 2GDDA 3E0NB 4A6LA 2QN5T 1ELVA 1HB0B 4XOJA 1S81A 2FOCA 1ZSLA 1DY9A 1WDIA 4NSVA 3S7HB 3F1SB 3SOSA 2YNBA 1SGYE 4B1TA 2GCHG 2UUJB 2XW9A 1NN6A 3UB0A 3D62A 3MHWU 5T6DA 1GHAF 1K21H 3LPRA 4R0IA 1VCWA 1W0KD 1YLNA 4JYVH 1UTKA 2CK3D 1FMGA 1P02A 1C1WH 4ASUD 3P95A 4INKA 1BTYA 4CRFA 1C2DA 3SU4A 2EA3A 4NFFA 1NRQH 1O33A 4NCYA 1WBGB 2VWMA 4B75A 1SQTA 2IJOB 1A1RA 2FLRH 2GVFA 1AI8H 3MNBA 1EAWA 2PTNA 5LPEA 1G36A 1AKSA 1HDTH 3PMJA 4B73A 1FJSA 1TNKA 5EXNA 1D3PB 1LHGH 1EJMA 1F0SA 1NU7B 3PLBA 3A85A 2W3IA 3OFND 4WXVA 3HKIB 4H42U 1Y3WA 3PWBA 3BTDE 2VIPA 1S82A 1BMMH 1TB6H 1MU8B 2VU8E 1GVZA 1C4Y2 3GY5A 3M5NA 4ABDA 3VEQB 1A0HB 1ZJDA 3LDXH 5EOKA 4IS5A 1THSH 3FOAA 3LJOA 2ZFPH 3M3SA 1ABJH 1U6QA 1BTPA 1E37B 2XC4A 1O3IA 2BZAA 1KMHB 2H5CA 2L74A 3DUXH 2SGEE 5BRRE 2XCFA 3M3TA 2XTTB 1A5IA 2WV5A 4X2VA 3W94A 1IQEA 2LELA 4K1EA 2ZA5A 5EPYA 3OX7U 4K8YA 1K1MA 3HK3B 1GI9B 2ZQ2A 2F9VA 3GY4A 3U8RH 1OP8A 3BF6H 3RC5A 3SHCH 2KCOA 5FBIA 4K1SA 1A0JA 1RRKA 1XX9A 4D7GA 1XKBC 1CHOG 3RXGA 3BG8A 4YLUA 1C1UH 2W6ID 4GCHF 1MU6B 2A0QB 4NGAH 3H5CB 1E34B 1HYLA 3GCTF 3VB4A 2ZKSA 1HFDA 3N7DA 4XDEA 1P2KA 1Z1JA 1ZLRA 2BX4A 3TU7H 4KP0A 3KYGA 1Y3UA 2NU0E 4AFSA 6GCHG 3TJNA 1E79D 3TH2H 4DURA 2ANYA 2HALA 3DSPA 1L0ZA 3F3BA 3SJ9A 4D8NA 2FTLE 1RTLA 1VITH 1DE7H 5CHAC 1OWIA 5EGMA 3L6PA 1SL3A 2QF5A 4AB8A 1L2EA 2I6SA 4P00A 1W13U 1QL8A 2AMPA 3TITA 2EC9H 2ZDNA 1P9UA 1FLEE 1GI2A 4NIVA 4FU9A 4UDWH 1GCTC 3N99A 1HV7A 1C5NH 1VITG 1QB6A 1C9PA 4YZUA 3GY8A 1QRWA 1BTXA 1TNIA 4CBNA 4CRDA 5K7RA 1KXDA 4ZKNU 1CGJE 3KQCA 1AVGH 4X0WU 2QE7D 2BXTH 3L3TA 5K0HA 4NWLA 4ABHA 2AFQB 1JIRA 3BTEE 1O2ZA 1SGNE 1TQ7B 3DA9B 1YCPK 1W7GH 2L6OA 3RXQA 2Z9JA 1RD3B 1BBRH 4OS4A 6LPRA 4FUEA 3DFJA 1ELDE 1N6YA 3STIA 4UFFH 1GCDA 4YM9A 3N7OA 1HAYB 3SNEA 1FQ3A 1GL1A 2VIWA 3CS0A 5F8XA 4CRCA 1B0EA 3RXAA 3CS7A 3SJIA 3ZZCA 3TNTA 3Q3KA 2A32A 3N7EA 4ASHA 1LQEA 2ZECA 1IQHA 9LPRA 1P2JA 1Y8TA 1K0HA 3SI4H 1AFQB 3ZYDA 5F03A 3QGNB 1C1RA 5KEDA 1ZHPA 1MTUA 2ZHWH 1ELCA 1SGFG 2PKAA 3S9CA 4FOUC 1J16A 2ZEBA 1O2NA 1LQDB 1EPTB 1HCGA 1GGDB 4FUJA 1BOQA 3RXCA 4X2XA 5H4IB 1IAUA 3BG4B 5LPRA 2LP6A 3QN7A 1EOJA 3QWCH 3TH4H 3VFEA 5C1XA 1KDQB 1NC6A 3PLKA 2J38A 4FUCA 4YTAA 1YWUA 1PQ7A 2V3MA 1W10U 1BBRE 1H9LB 1INCA 5DN6D 4BAKB 3LGVA 3F9GA 1BMAA 1O3MA 1ETTH 4UEHH 2C90B 2A5AA 2A5IA 1LKBA 1UCYH 3P92A 3E16B 3NPSA 1NTPA 1W7XH 5DJ7A 1GBIA 5CE1A 1O35A 1DUEA 5EODA 3GDUA 1NZQH 1VGCB 4X6PA 1SI5H 1W12U 1WYKA 3M36A 1J14A 1UTPA 1SGPE 1P06A 2H2ZA 3SORA 2OP9A 2OCVB 3UR9A 1ZJKA 4CREA 3DSOA 5A0CA 4A1TA 2J98A 1SR5C 3ZZ8A 1YF4A 8ESTE 3O8DA 3E3TA 8KME2 1DUAA 3O8RA 2B9LA 5EXMA 1GBDA 1P04A 1ELFA 3RXUA 3RC4A 2IPQX 4HTCH 4IC5A 3QTOH 3U69H 2JDID 4B71A 1VKYA 4Z1MD 1SOZA 3H09A 1O31A 1G37A 5FL7D 1UCYK 3BIVH 1TPSA 1O2OA 2CMYA 4XBDA 4ZUHA 3RXOA 1EKBB 1EZSC 3LT3A 1NFYA 1O3OA 4M7GA 1TOMH 1O2JA 4K1TA 4MNWA 2VJ1A 2Y82A 2GTBA 5E8EH 4BAMB 1EJAA 3SBKA 4ZAEA 3BN9A 1AUJA 1UTJA 3LGYA 3AW0A 5HMAA 1E36B 2RFKC 1TONA 4IMZA 2Z9GA 1YM0A 4BXSA 2OLGA 3E90B 1XUIA 2R3YA 5A8ZA 3ZZ9A 3ENSB 1G3DA 2B7DH 1QTFA 1FY4A 3RXHA 4CBOA 3K6ZA 1UVTH 3GOVB 2A7CA 1T8MA 4O3UA 2WPKS 3RXSA 1G32B 2WUBA 4AG1A 2BY5X 2EQNA 4Q63A 3BEFB 1GI8B 2Y5HA 5CHAB 1HIAA 3PROA 1LVBA 1P3EA 2PUXB 2D26C 4I86A 3H7TA 4LK4A 2LPRA 2HNTE 2OC0A 4Y8YA 3W1EA 1GI5A 1ABIH 2QY0B 3TJOA 4A1XA 3I77A 1ZZZA 4AX9H 2Z3DA 2XWAA 3GYMA 2WZQA 1Y3YA 4Y11E 4UD9H 3FZDA 2M5TA 1MBMA 2C8YB 1GHYH 1A0LA 5EXLA 1PQ8A 1J8AA 4YOGA 1LVMA 2C4FH 1TGTA 1CBWC 4ZXXH 1ZMNA 2TGTA 2A4RA 2AGGX 3E0PB 4Y0ZE 5GIBA 3ZVAA 3LC3A 1YLDA 1MTNB 1JWTA 1MH0A 1QBNA 3MH7A 2BDHA 4XE4A 4RT1A 4Y6DA 2DE9A 2PLXA 3A86A 3RXRA 3Q76A 4WH6A 5C1UA 3T28A 1P09A 1EASA 1O2SA 3T25A 1UVUH 1GJ4H 5GXPA 2BTCE 3LU9B 3B9FH 3A8BA 3NRLA 2O8MA 1KSNA 1GBFA 1P2OA 2ZIQH 1T7CA 3BTKE 1FN6A 2BLVA 1FZZA 2BD8A 4ZXYH 3ODFA 1DFPA 3SU3A 1EX3A 1YCPM 1SGRE 4JZEH 3FN8A 5FPYA 1HXEH 3BG4C 1TRYA 1OWHA 2XWBI 1G3EA 4ZCNA 2V7QD 1ZGIA 1YPLH 1AE5A 1BMNH 4O97A 4ISLA 1HAVB 3RP2A 3TGKE 1O3BA 2FOAA 1O5EH 4I8JA 2BZ6H 3GS9A 3UTUH 2TIOA 3FP8E 3OYPA 1O2MA 4ABJA 1Z8IB 4KELA 1HGTH 1UCYE 1HNEE 2KCYA 1CSOE 1PYTC 2ZP0H 2PSXA
chains in the Genus database with same CATH topology
3U8OH 1TOCB 1OKXA 3M5MA 1AUTC 1GMCG 1BTHH 2PGBB 1C5ZB 3A89A 1EB2A 1VGCC 3LOXA 4KTUA 1DSTA 1P0SH 3MU5A 3M61U 5GCHG 1OWJA 5DP5A 1NESE 2ALVA 2ZTXA 3MU8A 4AGKA 1QR3E 4NZLA 2G55A 4AFQA 2HGTH 4TYDA 1V2ST 1ANCA 2BY6X 3PMAB 4ZROA 2QC2A 1O5FH 1KLIH 1TNLA 2EI8A 3DD2H 1TBZH 2SGAA 1TRNA 2NU4E 1QFKH 1WV7H 4UFEH 2BQ6B 3SJKA 1G9IE 1TGBA 1OX1A 2BD2A 2PKAB 3GCOA 2RDLA 3MNCA 2OXSA 3A8AA 1T32A 2ZDLA 3MH4A 1KTSB 1C1MA 2HPPH 2FO9A 1THPB 3A7ZA 1CT4E 2FPZA 1GDQA 1GHBG 1DWDH 4FUDA 4NZQA 4AFUA 1BITA 4Q7ZA 2FXRA 1QY6A 1ANEA 2BD5A 2VB0A 2G8TA 3MU4A 4NWKA 1DANH 1JOUB 3QZQA 1GHVH 3WY8A 3P8NA 2OTVA 4NA7A 2W7SA 1VR1H 3BTHE 5LGOA 2ZGJA 3UREA 4F4OC 2OC7A 3NUMA 3AAUA 1AHTH 4KTCA 4MQAA 2R0KA 3FZZA 5PTPA 1C2KA 4IGDA 1C5PA 3NWUA 1TPAE 2ZU3A 3RXIA 1OP2A 4DW2U 1NFUA 2Z7FE 5C20A 4ABGA 3KIDU 2Q6DA 4K69A 2J9NA 3VGCC 1LHCH 2FOGA 2P59A 1CT2E 3SV7A 5A09A 4LXBH 2ZHQH 3K9XB 1ZPCA 1O3PB 3KQBA 1BB0B 2WPIS 5HM9A 4FUBA 1Q31A 1QJ1B 4ABEA 3TJUA 3SNDA 3ZV8A 3A88A 4FXGH 2O8WA 1O5AB 2AEIH 4BXWA 1FIWA 5TCCA 1GMDG 3KCGH 1A2CH 1DY8A 1ANBA 2W3KA 1BRAA 2ZZUH 1DM4B 3RXDA 2TGDA 1GI4A 1CGHA 1GJBB 1BHXF 1BT7A 2FWWA 4INLA 1O3LA 2SNVA 3M3VA 4DT7B 5AFZH 4WH8A 4OS6A 3QDZB 2HVXA 2CGAA 3A7TA 4X6MA 1AKSB 3SNAA 2JH5D 2SGFE 2O8LA 5DP3A 4I32A 2FYQA 1XXFA 1V2QT 5J4SA 1FXYA 1YCPH 1AMHA 4YOJA 1TIOA 1FAXA 2FI4E 3VB7A 1EB1H 3BTWE 2XBYA 2HOBA 2UWLA 1SGEE 4AN7A 1DWBH 4AYVB 5GWZA 4DCDA 1BA8B 2G51A 5HM2A 4F49A 4OS2A 1YPEH 1V2OT 2WPJS 4JYUH 1BQYA 1C1QA 3ZZAA 2Z3EA 1K28D 1DOJA 1S0QA 5E2PA 1QIXB 3K6YA 2HLCA 1Z6JH 3EDXB 3ZVEA 1AVWA 2JH6D 4Q7XA 1YPHC 3IWMA 1AZZA 2C8XB 2CHAC 1RTFB 2F9UA 3QK1A 1B7XB 1GL0E 1DDJA 2C8ZB 3KGPA 3A7WA 1AU8A 1XUFA 5FCKA 9ESTA 2QYIA 5DP9A 1CE5A 1MCTA 1ZMLA 4KKDA 3BEIB 2HNTC 2Z9IA 1HAZB 2AGEX 1BTUA 3A82A 1DLKB 2XYAA 2F91A 4MNYA 1ZRKA 2BOKA 1O2QA 1E38B 3U98H 2Q1JA 1V2RT 1TX8A 3BEUA 4DIHH 1LPZB 4DIIH 2A4QA 1UO6A 3O8BA 3SJ8A 2OBQA 1Y59T 2GCTC 2ZFTA 1ZYOA 1EPTC 3ZVDA 2AERH 1P3CA 3NKKA 1GGDC 3HATH 3SU5A 3TJVA 4Y8XA 2QA9E 1BJUA 5JB9S 2QXIA 2R2WU 3U8TH 1O30A 3BTFE 1GI6A 3ZV9A 1ZHRA 2Z3CA 8GCHF 3S0NA 1NS3A 2ZDKA 4JMYA 1C2HA 2ZFSA 4KTSA 4K8BA 4LZ4B 3SV2H 2V0BA 2D8WA 3VB5A 2UWPA 4HZHA 5DP8A 3KNXA 1AWFH 1C2JA 3AVZA 2RCEA 2ZDMA 2HPQH 5GDSH 1CHOF 2QAAA 4THNH 4R8TB 2ZF0H 4X8VH 1Y5AT 1LCYA 1S85A 2P3TB 4CH2B 4DVAU 2R2MB 3BV9B 3A7VA 1F2SE 2ZWLH 3P8FA 1D4PB 2Y6TA 4UFDH 5G4BA 4MG3A 4IW4E 1O3EA 1LPKB 1ZGVA 3K65B 2W5EA 1N6XA 2KAIB 1IQFA 2Q6GA 1GJ5H 1TBRH 1H4WA 3BIUH 3TNSA 2UUFB 2FS8A 4IMQA 4MLFB 4FU8A 1GHWH 3P6ZB 1GI7B 2GV6A 3I78A 4YT6H 4E7RG 1K1JA 1F5KU 1HJAB 1G2LA 1FY3A 2STAE 1GDNA 4YESB 1O37A 1FPCH 2ESTE 1V2VT 3EA7A 3CENA 1BHXB 1Z71A 1GMHF 2XBVA 1QL9A 3PB1E 1KDQA 2ZQ1A 3GDVA 5C67A 4X1PU 1O38A 1V2NT 1EUFA 3M7UA 5EQRA 3M7TA 4X6NA 2V6NA 4O9VA 2RA3A 1ZOMA 1W11U 3F9HA 1YGCH 1YKTA 1YPJH 1AGJA 2ZG0H 3P8GA 2AGIX 2QXGA 1CU1A 1C5UA 2AYWA 2H9HA 7GCHF 4O3TA 2TBSA 1V2LT 1OWEA 4MNXA 3JZ2B 2PFEA 2JETB 4U01A 3NZIA 3F9EA 1SB1H 1D3TB 1C5WB 2FESH 1ARBA 5JYIA 1GBMA 3NK8A 2P16A 2ZGHA 1UJ1A 1BZXE 2OD3B 3BTME 2FOEA 3RXFA 2ZCKP 1GBLA 4CR5A 3MTYA 2YOLA 2RG3A 2P8OC 1GJAB 3UQOA 1BDAA 1AE8H 3ATIA 2YNAA 1V2MT 1SG8B 1ZSKA 2B0FA 1AZ8A 1HXFH 4JK6A 4X1NU 2BHGA 1C1OA 4H6TA 2UUKB 5A2MH 1ID5H 2CHAB 2ZO3H 1OSSA 2HWLB 1VITF 1MBQA 4KGAA 2BD4A 1C1SA 1GBJA 3QGJA 4GHTA 2FS9A 2Q6FA 3UNRA 4DY7B 4JZDH 3U9AH 2BVXH 4GHQA 1LHDH 1WQVH 5A0AE 3QO6A 2FX4A 1CA0C 1SGDE 4PROA 3GY7A 3T26A 2CF9H 2STBE 1GBBA 2BB4A 2ZPRA 2ODQA 1GHXH 1DPOA 1TX7A 3MU1A 4JZ1A 4K5ZA 1O36A 1Y3VA 1QQUA 2BM2A 5F8ZA 4YT7H 1UVOA 4FUHA 5LH8A 2D1JA 2XCNA 3ATLA 8GCHG 3IG6B 2NU3E 2KAIA 2BDBA 1C5LH 2GGVB 3KQEA 1IQJA 1DVAH 6CHAC 2BVRH 4I8KA 2GCTB 1HAHH 3E8LA 3GCHC 1OYQA 1TA2A 1TX6A 1JMOH 3IITA 3LIWA 3SI3H 3UQVA 1P05A 1C1VH 2OC8A 1IQIA 1DT2A 1GHZA 3P8OA 1SC8U 2PSYA 3HKJB 1P03A 3BSQA 3V12A 5DO4H 3NXPA 5J4QA 3AASA 3MFJA 4FUFA 1HJ8A 2SGPE 4WVPE 3SV9A 4MVNA 1H9HE 4D7FA 1WUNH 1BUIA 2ILNA 4RSPA 1O3CA 3C1KA 3K2UA 5DK1A 2ODYB 2O8TA 3HGPA 1W0YH 1C2GA 2ZC9H 5FX5A 1O5CB 5BPEA 1MD8A 4MPUA 1QBVH 1QL7A 4FVDA 1LHEH 1QBOA 5CMXH 3MH6A 4FVBA 2VH0A 5FPSA 4VGCB 2ZGCA 3SQEE 1XUKA 1O3AA 4B76A 2F9NA 1K22H 1QB1A 1V2PT 1VZQH 3RM0H 3F9FA 1K1OA 2P95A 1NRSH 1MAXA 3ATWA 1FIZA 5T3HA 1FONA 3URDA 5ABWA 1RXPA 4YOIA 1PQAA 4Y76A 5JBBS 4ZH8A 1TNHA 1SMFE 2J92A 1MTSA 1O2UA 4INHA 1ARCA 5AVDA 3SN8A 1GPZA 4D9RA 1AWHB 2DUCA 2GZ7A 4ZKOU 1C2EA 1HJAC 1IQLA 3E1XB 4O03A 1HAPH 4DOQA 3PWCA 1SGIB 3VPKA 1GHBF 4JZFH 1SPJA 1GG6C 4AFZA 3U1IB 2WYJA 1P12E 3B8JA 5HYOA 3S7KB 2O8UA 4Y7BA 2H9EH 1ORFA 2V35A 5DG6A 1C5RA 1EJNA 2BVSH 1H8IH 1JRTA 3RXBA 3L33A 1TABE 5DP4A 1HAVA 2Z9LA 1EZUC 1TPPA 5AHGH 4LZ1H 4NIYA 3UIRA 3DT0H 4HI3A 1SFIA 1NPMA 1MKWH 2SFAA 1TBQH 2BX3A 1O3JA 3QUMP 1GBKA 3SJOA 3ZVBA 4FUIA 3PMHB 1IQGA 5JBTA 1ESBA 3M37A 2AIPA 3D65E 4X2WA 1ESAA 2JETC 4K3JA 1WQSA 1QURH 2XC5A 3SV6A 3KHVA 5JBAS 5HGGA 1XUJA 4WMFA 4BAOB 1FV9A 2Y81A 1D6WA 3LJJA 4AG2A 4ESTE 1C5QA 3GY6A 1GVLA 3D23A 3VGCB 3RU4T 2G00A 3R3GB 5FAHA 3A7XA 3RXTA 1V2WT 1LMWB 1MKXH 1ZHMA 1A3EH 1BMLA 1O2XA 5DKMA 2WPMS 4ZKSU 2ZFQH 1C1NA 1P57B 3RXLA 4OGXA 1AD8H 1SQOA 4WJG2 1LVOA 3MO9A 1V3XA 1CVWH 3MYWA 4MTBA 1GI1A 1DLEA 2PKSB 1EAXA 3HPTB 1C5YB 1PPGE 2FOMB 4K60A 3RXPA 1FY5A 3S9AA 1LPGB 4TY6A 1DSUA 2TGPZ 1QJ6B 1S6HA 5DPAA 1UTLM 2FI5E 3F6UH 1P11E 2SNWA 2A45B 1KYNA 1CA0B 3PO1C 1K9OE 1KLJH 2A2QH 1ZR0A 2PHBA 5DGJA 4ZKRU 1SVPA 3MI4A 4X6OA 1XKAC 4J2YB 2BDIA 2ZCHP 4CHAC 1MQ6A 2SGDE 1JBUH 1F0UA 1UTNA 1UTOA 3MO6A 1UHBB 4FUGA 4WY3A 1UK4A 5HXFA 4Q2KA 3AAVA 3RXJA 1A7SA 1MD7A 2FM2A 6CHAB 1OWDA 4AB9A 2R3UA 3GCHB 3MWIU 1TPOA 4FU7A 4JCNA 1J17T 3RMNH 3SV8A 1B0FA 1SGFA 1RIWB 1YPGH 3C27B 5A8YA 1LDTT 3EE0B 3V0XA 1D3QB 4SGAE 3PTBA 5F6MA 4NIXA 2XNIA 5JBCS 4I33A 4CRAA 7LPRA 2IN2A 3PTNA 3E91A 4GPGA 1BTWA 4E7NA 1GWAA 2A31A 1ESTA 3QLPH 2AMDA 1EAIA 2FMJA 1G3CA 1Q3XA 1QA0A 1GJDB 1SLXB 2WPLS 5GCHF 2VGCB 3MOCA 1GHAG 1MCVA 1RJXB 2ZPQA 1EP5A 2G4UA 1UK3A 1MMJN 2FIRH 4RKJB 1KXFA 5EQQA 2Y5FA 1GBCA 1PPHE 5FXLA 1LO6A 3ZVFA 4VGCC 1CQQA 2VWNA 2J34A 2CV3A 3RM2H 1FNIA 2ALPA 5B6OA 4X2YA 4WF8A 4ISNA 2GCHF 4DGJA 1YBWA 3ATMA 3JZ1B 1MTVA 3A8CA 1YLCA 3LH1A 3KN2A 3D49H 1HRTH 1EOLA 5AFYH 3SUDA 1QA7A 4UE7H 3RXEA 3ZYEA 1EP6A 2ZGBH 1C2IA 1BBRK 2GX4A 2GT7A 4BAQB 2BMGB 4MDSA 1UVPA 2F9OA 2P93A 2ULLA 1W0ZU 3PYHA 3T2NA 3FP7E 2GZ9A 4WMEA 1MKWK 1QJ7B 2OC1A 1GMCF 1ACBE 2H9TH 4X8UH 2BDGA 3A87A 1PPFE 1HIAB 1WU1A 1GG6B 1J9CH 1QGFA 3A8DA 4JYTA 4K2YA 5FCRA 2FLBH 1LKAA 2R9PA 1HPGA 2VINA 1EXFA 1H8DH 3VB3A 2FX6A 3UR6A 4X8TH 3ZZDA 2BD7A 1EZXC 5C1YA 4U30A 2QCYA 1KTTB 3UOPA 3OY6U 3ZZ6A 3O8CA 1GBTA 1XM1A 5A8XA 4RN6A 3URCA 1FY8E 1C5OH 1G3BA 1V2UT 1LVYA 4OS5A 3SUGA 1P01A 1QCPA 1J15A 2R0LA 3UOUA 4H6SB 5C5NA 1C5VA 1L1JA 4X8SH 4D9QA 1YP9A 2ZFRH 1O2GH 3FVFB 1NY22 5L6NH 1SGQE 4U32A 1K2I1 1QRZA 5L2YH 1KY9A 1AB9C 4NIWA 2F9BH 1NRRH 1XVMA 1OXGA 2ZU4A 1T8LA 2OQ5A 1Y5UT 5JPMH 1XVOA 1FAKH 2ODPA 5EW1H 2VVUA 4BTIB 1TNGA 5LPFA 1K1NA 4YO9A 3RMLH 1S0RA 1WAYB 1PQ5A 4D76A 4AGJA 4OS1A 2EI6A 1GBEA 1F0TA 4AORA 1F5RA 1OOKB 2BDCA 2OUAA 1P2MA 1DICA 4MNVA 1X7AC 2RA0A 3RC6A 3T62A 1OWKA 1O3GA 1HAIH 1FDPA 3PO1B 3QTVH 4JZIA 4E05H 1L4ZA 3RDZA 1KXCA 1GBHA 1SGTA 5GJ4B 1NRPH 2F3CE 2QXJA 3UWJH 3UY9A 2BY9X 1SLVB 2EI7A 4BANB 1O2TA 3SGQE 1O3FA 1TLDA 1L1NA 5C2ZA 2OQUA 5EQSA 1LTOA 1T8OA 2OINA 2WYGA 2QV1A 3SUEA 1A3BH 3UUZA 2GD4B 3SGBE 1P2QA 1Z8RA 4GCHG 1RTKA 1RIWC 1S5SA 1QNJA 1N8OC 4E06H 1SLWB 1AO5A 4XBCA 5FPTA 3CP7A 1TGSZ 3E6PH 4JK5A 3T27A 3W95A 3GY2A 2P8OB 1ELTA 2VIOA 4J1YA 1NT1A 2QGRA 2V3OH 1CA8B 5IDKA 1CO7E 4NG9H 2AH4X 1Z6EA 4TY7A 5EU8A 2J95A 2QF3A 3SW2B 2ANWA 3TH3H 3PLPA 1DXWA 1SHYA 1FPHH 4RKOB 2VGCC 1UTMA 4X1SU 4Y79A 1HBTH 4I31A 2VH6A 4XFQA 2A1DB 1KXBA 3OY5U 2FDAA 4MPXA 1GI0A 2ZNKH 1A61H 1IHSH 4XBBA 3SHAH 4X1QU 5TCAA 1KIGH 1AFEH 2ANKH 2Y7ZA 3I29A 2PR3A 1GVKB 2ZTZA 2AS9A 4DG4A 1O3DA 2BQWB 5TJXA 5E2OA 3AW1A 3RXVA 1YC0A 1ETRH 3GDSA 1O5DH 1GMHG 3P17H 4CRGA 4ISIH 1BIOA 2VIQA 2PTCE 4IN2A 5EPNA 3SO3A 3TK5A 1SSXA 3SNBA 1ZTKA 4AYYB