3NWUA

Substrate induced remodeling of the active site regulates htra1 activity
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
204
structure length
190
Chain Sequence
DPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Serine protease HTRA1
publication title Substrate-induced remodeling of the active site regulates human HTRA1 activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 190
sequence length 204
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nwuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nwuA02
2XWAA 1OWJA 6LPRA 1GMHF 3GDUA 2BY5X 5K7RA 1ABJH 1FN6A 4ABGA 1SR5C 1Z8GA 1QR3E 5L6NH 1GBTA 1O38A 2CGAA 2FTLE 5SGAE 2BB4A 2BVSH 2H5DA 4Y71A 2QCYA 5DO4H 1AE5A 1YPEH 1QRZA 3S7HB 3FFGA 3GYLB 4NFEA 1H4WA 4KKDA 3TNTA 2FI3E 1C5NH 2J92A 2H6MA 2VIDA 3MHWU 4GHQA 5DK1A 1EPTB 1O5CB 3RXTA 4YT6H 3D62A 4MPUA 2BLWA 2RA0A 1ZHPA 3TK9A 3M3SA 1TNHA 1W14U 2BQWB 1C4U2 5DPAA 1AE8H 5T6FA 1L1JA 2ASUB 1OXGA 2LNCA 2BY7X 3ATKA 2XC4A 2Z9LA 1RTKA 2ZCKP 1G2LA 3TLOA 1D3DB 3EA9A 1Q31A 2O8WA 1GJ5H 3MMGA 3MO3A 1HUTH 5JB9S 2WV5A 4A5TS 1P02A 2QF3A 1G32B 1C2EA 2HNTE 1AUTC 4K69A 3SJ8A 1XUFA 9LPRA 1D6RA 2HALA 1LPZB 6CHAC 4FU7A 1GGDB 4R8TB 1ELEE 4BXWA 2WV4A 1DANH 2GKVE 9ESTA 4Y8XA 1EQ9A 2GCTC 2PV9B 1O32A 2JETC 3RLWH 1V2KT 3LONA 1UK3A 4ZHLU 2A2XH 1C9TA 4WH6A 1KTTB 3SJIA 4DGJA 4MNXA 4UFGH 1A5IA 5CMXH 2BY6X 3M7QA 4DIHH 1GJ8B 1RXPA 1V2JT 3RMOH 4BAHB 1HJ9A 4INKA 1O5AB 3LJJA 2K1QA 2ZNKH 1D3TB 1BHXB 3KQDA 2VVVA 4MPWA 2P3UB 3RXCA 1O0DH 2TGPZ 1EOLA 3QLPH 3SU0A 2G51A 1CBWB 2NU3E 2ZGCA 2ODPA 1VJAU 5EG4A 4JYVH 4U2WA 2AERH 3LGUA 4E7RG 5LPEA 3BEFB 1XVMA 1YM0A 2BXUH 2C8ZB 5TJXA 1D3PB 3Q77A 2AMQA 2ZFQH 1HIAB 1UCYH 2FI4E 1SGIB 2HPQH 2G5NA 1T4VH 2ZDMA 2VGCC 2W7SA 1AUJA 3BEUA 1PJPA 3K9XB 4I31A 1NY22 2J4IA 1CHGA 4DCDA 1O5GH 3KQCA 2CHAC 4FXGH 1ZRKA 3TPIZ 4ZXYH 4FU8A 1TALA 3BTQE 3T62A 3U1IB 1OP2A 2SNVA 3VB7A 2XC0A 3ENSB 3A88A 4MNVA 5EU8A 4BTUB 5C1UA 1NRRH 4WF8A 2ZFTA 4FUDA 1C5VA 3S69A 4ISNA 3S9BA 2ZFRH 4D8NA 4WMEA 1TYNA 2GTBA 2Z3CA 1FDPA 1QURH 1AMHA 2VIWA 1SGNE 2OC1A 4YLQH 1THRH 1O3GA 2C8YB 5I46H 3H7OA 1GDUA 1P10A 4H4FA 3A7WA 4MNYA 4WMFA 1A1RA 1NRSH 2I6SA 2D2DA 1ZPCA 1VCWA 3TJOA 4B2BA 3LC3A 1XX9A 1OWKA 4R0IA 5TCAA 1P2OA 5FXLA 4K1TA 1MQ6A 1JMOH 1E0FD 2QF0A 1A3BH 4XDEA 3A7ZA 3MO9A 1BOQA 1TA6A 2A5IA 2YNBA 3A8AA 4KP0A 1BQYA 1SQOA 3QK1A 4JZ1A 4HI3A 4Y10E 5L2YH 2ZP0H 1UTKA 1UVUH 3RDZA 2QXIA 1AFEH 1P9UA 1SG8B 1P2MA 1E34B 1QFKH 1ELGA 1ZZZA 1UHBB 4ZMAH 2NU4E 2J9NA 3ZZBA 2ZTXA 1NO9H 2FM2A 2BDYA 2FESH 3DT0H 2FOMB 2XC5A 1LCYA 2UUFB 4X8SH 1G3DA 1GJDB 3GY6A 3TJUA 1UMAH 1SB1H 1TB6H 3EA7A 1BBRE 1AVGH 3VGCC 1FONA 2CXVA 3FAOA 1N6YA 3LIWA 1FAKH 1O5FH 1L2EA 1EUFA 4UONA 1Y8TA 1BTPA 1LHGH 3P92A 2VNTA 4TY7A 4I8HA 1WSSH 1MU6B 3ZZAA 1KXAA 1C9PA 1NRNH 3B8JA 5ESTE 4MG3A 2F91A 2VWOA 3GCTG 3DD2H 2ZHEH 1C2DA 4B76A 1GBDA 4OS4A 5F8XA 2BMGB 1TAWA 1E35B 3PWBA 1C5ZB 1YCPH 1A3EH 2OTVA 3TITA 1QA0A 3UQOA 4DY7B 1SGFG 1XUGA 2H2ZA 1EOJA 4X1PU 5EXNA 4GCHG 1Y3YA 2Y6TA 1C1RA 2FWWA 1SMFE 1KLJH 1LPKB 2ZTYA 3F9FA 2ZFPH 4NGAH 5FBEA 3ODDA 2W26A 1WV7H 2FZZA 3V12A 3OX7U 3QUMP 3MNSA 4VGCC 2PSYA 4X6MA 1ELCA 1OWIA 1TMBH 3SU1A 3A81A 2OD3B 1E37B 1G3EA 2A0QB 4U32A 5J4SA 1SGDE 1T8OA 1XXFA 5DG6A 5A8XA 3M5MA 2ZCLP 2SGEE 3OY6U 1L4DA 1GVKB 2ZGHA 1P2KA 2A32A 3MYWA 1C2LA 1OP0A 1GBMA 1P57B 1GHVH 3MH7A 4CRDA 1QTFA 2Z7FE 1IQEA 1P2JA 2H1UA 3RXKA 1SSXA 1WU1A 3UR6A 4KTUA 1GMHG 3ESTA 1HAVB 2HRVA 2F3CE 4FUEA 2A7JA 3ZZ3A 2PWXA 3A7XA 3RXSA 2D1JA 1DITH 2A5KA 1BIOA 1MUEB 1T8NA 1QRWA 1HGTH 1O3AA 2VWLA 3DUXH 4X1QU 1FMGA 3MH6A 3KNXA 2KAIA 4THNH 2GDDA 1BA8B 3MNXA 1UTOA 2ZA5A 3ZZ4A 1IQFA 1XKAC 3UUZA 1ZMNA 1NPMA 1JBUH 2HLCA 2HVXA 3B9FH 3AVZA 4B2CA 2Q6FA 1CVWH 2ZQ1A 1FLEE 4ZKOU 4BTTB 3RXMA 1PPHE 2VJ1A 1VZQH 4WMDA 3A8DA 1GHYH 2EA3A 1ELTA 1NC6A 2GVFA 1Q3XA 5GWZA 4K1SA 2GZ8A 1HAYB 1J8AA 3GCNA 1V2TT 2VWNA 3GY5A 4D9RA 1TE0A 1P9SA 2ODQA 4FUFA 3VXEH 2BDIA 1P2IA 5HYOA 3UTUH 1GBHA 3SUFA 2B7DH 1B5GH 1OOKB 1K1NA 3T27A 3SU3A 3KEEA 1GBEA 3SV2H 3MOCA 4F4OC 4X2XA 1O2OA 2TGTA 1C1MA 1YPKH 1AY6H 1ZOMA 3AAUA 1CSOE 1SGYE 1UJ1A 4TYDA 4AFSA 4PROA 1TA2A 5C20A 5JB8S 1TGNA 1WTHD 3OYPA 1WQSA 1A5GH 2OXSA 3RXHA 1P0SH 3UNQA 3ZVBA 3DFLA 1AKSB 3DHKH 1DY9A 1L1NA 1HBTH 1QJ6B 2OQUA 2P3TB 1TBZH 2P3FH 3SUDA 1HLTH 2WINI 1W12U 4SGBE 2GCTB 4KGAA 1Z6JH 3F1SB 1GJ7B 1Q2WA 1D4PB 3T29A 1XVOA 1TGSZ 4X1NU 3GYMA 1OP8A 1F5LA 3SV8A 3OTJE 1V2WT 2UWLA 3T25A 4DOQA 1HAHH 1ZLRA 2JKHA 2AYWA 3K6YA 4MLFB 1L1GA 1YPMH 2PKAA 1KIGH 4ZKSU 4DT7B 1YC0A 5A8ZA 4IC5A 1W7GH 3TH4H 2W3IA 1W3CA 1FUJA 3ZZDA 1GJAB 3ATIA 5ESBA 3GY7A 4I32A 1O5EH 1Y3UA 4UFEH 1EX3A 3MWIU 1BRCE 3FANA 1JXPA 1N8OB 3URDA 1Z8IB 2VH0A 2BY9X 4WVPE 5GXPA 1WYKA 1IQJA 1EXFA 1TNJA 2ZFFH 4IN2A 2QGRA 4KTSA 1C1WH 2VH6A 1LVBA 3FVFB 4NIYA 3TVJB 1CA0B 1EZQA 1UTQA 1ESBA 3SQHE 4DURA 4GAWA 3TJVA 5AF9H 3HK6B 1LKBA 2VGCB 1C1PA 3U8TH 4K3JA 3BV9B 1PPCE 2QC2A 1F92A 1OS8A 3B23B 3EE0B 4ZKRU 4D7FA 3UOUA 4A92A 1HJAB 2A4OA 3MO6A 1HXFH 1CT2E 3M3TA 1GBLA 1O3KA 1ZMJA 2B9LA 3GISB 3LH3A 4CHAC 1O2QA 1GMDF 1F7ZA 4UE7H 3GCTF 4NWLA 4OGYA 2D8WA 2F9OA 2C4FH 4BAKB 4HGCA 2ANWA 1AB9C 4TWWA 5JBAS 1ESTA 2BZAA 2ULLA 1NRPH 3LU9B 4YLUA 3KIDU 2XNIA 4AB9A 4GCHF 3SHAH 3VB6A 3SBKA 3PO1C 3SGAE 1TX7A 4H42U 5HM2A 4CRBA 1IQKA 3TJNA 3PLPA 1UCYK 1T8MA 1P3CA 1GBJA 5AFYH 2FMJA 2EI6A 2ZHFH 4CRFA 1RTFB 1TPOA 1HB0B 2BLOA 5DJ7A 1T32A 1CHOF 1GL0E 1DWDH 1XUHA 4TWYA 4O3UA 4BNRA 1ID5H 4ZHAA 1P06A 2IPHA 1TGCA 1EZSC 1DXPA 1BTYA 2AGIX 1O2ZA 3RXVA 2BOHB 1Y3XA 2VB0A 1O2SA 2ZPSA 1QB1A 2V6NA 1TOCB 1JOUB 2PR3A 3MU4A 1G3BA 4ISLA 1XUIA 5J4QA 1NFUA 1C1OA 1H8IH 1UO6A 2GV6A 3ITIA 3ZZ6A 1GJCB 3PLBA 2BZ6H 1V2MT 2Z9IA 3SNAA 1BB0B 2WPKS 4CR5A 3I77A 3Q00A 5FX5A 2ZTZA 4X6PA 4ZROA 4IW4E 2QXHA 5EPNA 4FUCA 3ZZ5A 2OINA 3PM3A 1NN6A 2HWLB 5C5NA 2AMDA 1KXDA 1GG6B 1AU8A 1GBCA 1KSNA 1QA7A 2V35A 2ZKSA 3U1JB 1O2TA 1LMWB 1SI5H 4NSYA 3LGYA 3VPKA 1V2ST 3D23A 1CO7E 1C2FA 1GHZA 1C1QA 2PLXA 3PYHA 3SHCH 3W95A 2FYQA 5F6MA 3QWCH 1OX1A 4CBNA 1TPPA 4ZXXH 1O2XA 4Q7XA 3K2UA 2Z94A 3BN9A 1AHTH 1S83A 2J94A 1AQ7A 1O31A 2TPIZ 3RXEA 3VGCB 2BQ6B 3H5CB 5JBCS 2WUBA 3TGIE 2AGEX 3NZIA 1SGTA 1DUEA 1HRTH 3PTBA 5CE1A 1K21H 4WY3A 1D3QB 4LZ1H 3IITA 1PPFE 1A2CH 5DP6A 1IQIA 2F9UA 7LPRA 5CHAB 3SNEA 3M3VA 5GCHF 3CS7A 3FZDA 1O3PB 1CT4E 4MPXA 1KXFA 1YPJH 4ABEA 1CGJE 4NG9H 3U69H 1GBFA 2FX4A 1HAOH 5C2ZA 1ZSKA 1PYTC 2A31A 4YOIA 1BMMH 3VB3A 1MD7A 5FPTA 1EJAA 2G55A 1SVPA 2FEQH 1YF4A 1SC8U 1PQAA 3BEIB 2NU0E 3LJOA 3UR9A 3SUEA 1J15A 2OC7A 2ZC9H 3RC4A 5E0HA 1BDAA 2Y80A 3SU4A 3OSYA 1HPGA 2ODYB 2GMTB 4VGCB 3U9AH 2FOEA 1GMCG 2DE9A 2XWBI 3LC5A 5FCRA 2BDGA 3STIA 1BMLA 1QJ1B 1PPEE 1ZPBA 4ZHMU 1NTPA 1GI6A 4BTIB 5A09A 1O39A 5EQQA 1G30B 5EODA 3SUGA 1HAIH 1TRNA 3L3TA 4NZQA 1GHWH 5AHGH 1VR1H 1MKXH 3FZZA 2G00A 3UWJH 1EJMA 2ZU2A 1QBOA 1YCPK 2P93A 1AFQC 2PGBB 3CS0A 2QIQA 4Y8YA 2BLQA 5DP7A 2PSXA 4JZDH 1N1LA 2H9HA 4NWKA 4MPVA 1IQNA 3SU5A 2ZDNA 2C3SA 3E0PB 2P59A 5FBIA 1QL7A 1QNJA 1O5BB 1WAYB 3ZVCA 1AIXH 3MU8A 5LPRA 2G52A 1ZYOA 4XSKU 1GHAG 4OGXA 3GCHB 1FY1A 1GBKA 3M61U 2H9EH 1ELDE 1DSUA 1O2LA 1FY5A 1BJVA 1QCPA 2ZFSA 1BTUA 1C1SA 3QGNB 8LPRA 1O2PA 3F9GA 1IAUA 1GHXH 1C1UH 3F9HA 1MAXA 3S9AA 4I33A 3ZVGA 3TK5A 1C5UA 3QTOH 1WUNH 2XW9A 3CENA 4OS5A 3S9CA 2WPMS 3BF6H 4YTAA 1P05A 1MCVA 1P01A 3UREA 2ZPRA 4ZH8A 3ZZ8A 1LO6A 4X2YA 3LGIA 1MTNC 1KXEA 1LVOA 8ESTE 3UPEA 1O2JA 2O8TA 1EP6A 2ZG0H 3Q3KA 1S81A 2BX4A 4AYVB 1O3LA 2V0BA 3S7KB 4AZ2B 4X8VH 2J95A 3SN8A 3TIUA 2OBQA 4FVDA 4UDWH 2ZQ2A 5JDUB 3ODFA 3RXIA 4IMZA 3A7TA 1SQAA 3NK8A 3V13A 3NUMA 2FOAA 2A7CA 1C5TA 1GL1A 3A82A 1Z71A 4J2YB 1EB1H 2OP9A 3MTYA 4K8YA 2W5EA 1TQ0B 1FY4A 4NIWA 2AH4X 3KQBA 3RLYH 3TGKE 2OCVB 1JRSA 2BHGA 3SU2A 1GI5A 1C1NA 4H6SB 3HGNA 2FTMA 3BTME 1ANDA 1V3XA 1UTJA 1Y59T 2FS9A 2R3UA 4CRAA 1W7XH 1YPHC 4JCNA 1MMJN 2PKSC 5EQSA 4A1TA 4AN7A 3WY8A 5E0JA 3RM0H 1BT7A 1WTGH 2BD5A 1ACBE 5C1YA 1AVXA 1EAWA 5EW2H 2A45B 3D65E 2SGAA 3I78A 4YESB 2QN5T 1TNLA 4NZLA 1OWEA 1SQTA 1DPOA 3M35A 5DP4A 4ZUHA 3UY9A 1ZHRA 1CGIE 4D76A 1C5WB 1O2KA 1QJ7B 1EPTC 5A0AE 2RG3A 4UEHH 2F9NA 3M5OA 3PMHB 3QN7A 1E36B 2FOGA 3Q76A 3GICB 1O33A 1OWDA 1O3EA 1GVLA 2XYAA 2G81E 1K9OE 2XBWA 1V2LT 3FP8E 3PMAB 3SO3A 1GMDG 3A84A 3TNSA 1DOJA 3SGQE 1JRTA 1HAPH 1SGCA 4YOGA 4X1RU 4X6OA 1BBRH 3PROA 5E8EH 3RXUA 1QBVH 3TH3H 1QL9A 1IHSH 2Y7ZA 3HPTB 1C2HA 4CHAB 3Q3YA 1OWHA 3JZ1B 1QIXB 4IN1A 5I25A 1RRKA 3RXDA 3P6ZB 3A87A 1DFPA 1W0YH 2SFAA 1CHOG 5AFZH 4IC6A 4K2YA 1GI4A 1EAXA 2Z6BD 4I8LA 4ABJA 2OUAA 1HFDA 1V2NT 3RXPA 4GVUA 4RSPA 1ELBA 1UVSH 1Y3VA 3QZRA 1DE7H 1NFWA 2FS8A 1Y5AT 4BAQB 1OKXA 3HATH 6GCHF 4FUHA 2WPLS 5ETXA 1ZJKA 1GMCF 2EC9H 1VITF 3CP7A 3M37A 4ISOA 1FZZA 1K1OA 4Y0YE 1DSTA 4K1EA 3JZ2B 5EXLA 1DY8A 1XUKA 2BTCE 3E6PH 2P16A 3RM2H 4KELA 1CBWC 4FUIA 2Z9JA 1H1BA 1MAYA 1C5SA 1GJ4H 3P8NA 1MTUA 3LKWA 5L30H 2GCHF 3E3TA 3PMBB 1PPGE 1FY8E 1CU1A 1C2IA 4DG4A 3V0XA 1DLEA 3EAJA 4ISIH 2KAIB 2VIVA 1O34A 1SGPE 3E91A 3ZZ7A 2CMYA 1O3FA 2SGFE 1GI3A 2ZZUH 2ILNA 4B2AA 4RKOB 4JZIA 5GJ4B 1S5SA 1ZHMA 1O2IA 2ZWLH 1GHAF 1KY9A 4GSOA 1QL8A 4AGJA 3P8FA 1V2PT 4FUBA 1FJSA 1P8VC 3ZV8A 4JZFH 4MQAA 2CF8H 1KLIH 3OU0A 5DP8A 3LT3A 1P03A 1ZR0A 3GY8A 3LGWA 2VINA 1EB2A 1KLTA 1FY3A 1ZMLA 3L6PA 5LH8A 4Z6AH 5GCHG 2J2UA 4CBOA 3GY2A 1A0HB 2ZI2H 1TNGA 2VVUA 4K60A 1ABIH 1FIZA 2OC8A 4O03A 2BX3A 1ARCA 5BRRE 1YYY1 4D9QA 2PHBA 1DS2E 1G9IE 2CN0H 4NFFA 3U8RH 4AX9H 3HKIB 3P95A 3MU0A 1F5KU 4HTCH 1FPCH 1S6HA 3SW2B 2FXRA 1T4UH 3H7TA 5DP3A 1C2JA 2BDHA 1O2HA 1V2OT 2BOKA 1P09A 3SJKA 6CHAB 1DICA 5F8TA 1O3IA 3T2NA 3LDXH 4FVBA 2I6QA 4UD9H 1WOFA 2FPZA 1V2VT 1EASA 4CR9A 2ZHWH 4SGAE 1KDQA 3SI3H 2A2QH 3A86A 4BXSA 2NWNA 2JETB 5DP5A 1ELVA 1MD8A 2CF9H 7GCHF 3KL6A 1S85A 2FLBH 1Z1JA 1HXEH 1AZZA 1O2YA 1O2UA 4ABAA 3LOXA 1NZQH 2TGDA 1LVMA 1AO5A 3R0FA 2DUCA 2P8OC 3UQVA 4IBLH 2UUYA 2ZU1A 1X7AC 2GT7A 2FP7B 2UWPA 2FODA 5C3NA 4X0WU 1ETTH 2ZIQH 2ZDVH 4ABDA 2PKAB 3DFJA 5T6GA 3E0NB 2B0FA 1BITA 2AIPA 5B6OA 1H9LB 1W8BH 2WPHS 3BIVH 1BTHH 3MH5A 3RC5A 1YLDA 2FDAA 4B75A 2PTNA 2GZ9A 2WYGA 4FU9A 1C2MA 1GBBA 2TGAA 1LVYA 1TQ7B 3M36A 1J9CH 3NXPA 5GPIB 2TRMA 3P17H 3LGVA 5T3HA 3T28A 3UNSA 4XOJA 5T6DA 3A80A 2CHAB 4E06H 1ZRBA 2DE8A 2WPIS 2XBVA 2H5CA 4BOHA 1UTMA 3AASA 8GCHF 1QGFA 5DP9A 4CH2B 1O37A 1OYTH 1ZPZA 2R0KA 1PFXC 1TWXB 1T31A 2EEKA 4WXIA 3F6UH 1C5OH 2XCFA 4O9VA 2B5TB 2VVCA 1MTSA 3ELAH 3T26A 1GBAA 1PPZA 1Y5UT 3UNRA 1SBWA 4WXVA 1MKXK 1C5QA 2J34A 3BIUH 3SV7A 5EXMA 7KMEH 2HNTC 1NFYA 2C93B 3GOVB 1P3EA 3E8LA 1BUIA 3RMNH 1RTLA 3RXLA 1O30A 2FX6A 3O8RA 5F8ZA 4AFUA 4NA8A 1S84A 2ALVA 5GDSH 1E38B 3DA9B 1RIWC 4X2WA 2Z9KA 1TRMA 1TPAE 3KN2A 1PQ5A 5FAHA 1PYTD 2AFQB 1O5DH 3PLKA 5FPYA 1TGTA 2YOLA 2ZU4A 1AGJA 3ZV9A 2G4TA 5HXFA 1ANEA 4DW2U 1TABE 1F0UA 2FI5E 3L33A 1J17T 2V3OH 4WWYA 3ZZCA 2BY8X 1GHBF 2PTCE 3SORA 2BM2A 1BRUP 2ALPA 1ELAA 1YBWA 2O8UA 5E0GA 1IQMA 3FP6E 3MU1A 4AFQA 4K8BA 5C67A 3MI4A 5LGOA 4XBCA 3BTHE 1EZUC 1H9HE 2SGPE 3ZVDA 2XXLA 3SNCA 4Z0KA 3RP2A 1WCZA 3ZYEA 3SNBA 2PKSB 1NU7B 1MQ5A 1HAZB 1ELFA 2Q6GA 1GI2A 1O3JA 3RMMH 2BVXH 4JZEH 3BTKE 1C4V2 1O3CA 1EPTA 4M7GA 3HKJB 4KTCA 4YM9A 1UVPA 5JPMH 1MTWA 2XBYA 3V7TA 4X8TH 3BTDE 1O36A 4GLYA 3SV6A 4AORA 1FV9A 1GDQA 2QY0B 3VFEA 3RMLH 2AMPA 4XE4A 3C27B 1UTNA 3O8BA 5EQRA 2BD3A 1JWTA 2BD8A 1TMUH 1J14A 2GV7A 5EGMA 3EQ0H 1FI8A 4UFDH 3U8OH 3SQEE 1ZGVA 4NA7A 1Y5BT 1Z8RA 1DVAH 2HOBA 4I8JA 1OPHB 1HYLA 2Z3EA 4QT8C 1GJ9B 4ABIA 4CH8B 1SGQE 1ZGIA 5JYIA 4LXBH 5A2MH 1G37A 3RXBA 3SI4H 2G8TA 4FUJA 1A46H 3Q3XA 1AI8H 4WJG2 4INHA 3P70B 3UFAA 4INLA 1TNKA 1SPJA 4YOJA 1L0ZA 6GCHG 1GI7B 4Y8ZA 1D9IA 1P11E 1MH0A 1HCGA 1O2RA 1VITG 2OC0A 4JYUH 2J38A 1K28D 3M7TA 4Y0ZE 1Y3WA 2B8OH 5F03A 1K1JA 5IDKA 3LPRA 4E7NA 1GPZA 1V2UT 1VGCC 5A0CA 1A61H 1BMNH 2GCHG 2D26C 5IYTA 3E90B 4YO9A 4Y6DA 1UCYE 3PV4A 1ETSH 2OQ5A 3VB4A 3FP7E 3MFJA 1GI0A 4WH8A 4B74A 1TONA 4MDSA 2A7HA 4BAMB 4YZUA 3U98H 2SNWA 3E16B 1BBRK 4TPIZ 4K5ZA 3MNBA 2ZDLA 1A7SA 2PW8H 4Q7YA 1S0QA 4TY6A 3QZQA 3RXQA 1GWAA 1HIAA 4AGKA 3ATWA 1N8OC 3SJ9A 2HPPH 4CRCA 4ISHH 3BSQA 5BPEA 4IS5A 1EJNA 1QQ4A 5EOKA 3QX5H 4X6NA 1UTLM 1TNIA 1CA0C 2A1DB 3A8CA 5DGJA 5C1XA 1NFXA 3RXAA 1H8DH 1GCTC 1NU9A 3KQEA 4OS1A 2GT8A 3LGTA 5HMAA 1NESE 2IOTA 2A4RA 2UUJB 3D49H 1HJAC 1MZDA 4Y7AA 1W10U 1ETRH 1FQ3A 2QAAA 1EKBB 3TK6A 3SOSA 5LPFA 3NPSA 2O8MA 4BAOB 3R3GB 1GVZA 2SGDE 4LK4A 1PQ7A 2QXGA 3SGBE 3N7OA 1GJBB 1CE5A 1IHTH 4X8UH 1LHEH 2PUXB 1HJ8A 1CA8B 1T7CA 1LHDH 3IWMA 1O3MA 5ABWA 1TX8A 2ZU5A 1LQDB 4Y76A 5E2OA 2FYRA 1J16A 1MZAA 3BG4C 1SL3A 4Y11E 1EP5A 3K6ZA 1CGHA 7GCHG 2GGVB 1L4ZA 1KYNA 2EI8A 2R2WU 4FUGA 1N6XA 2BDAA 1C5MD 1RJXB 4A7IB 3VXFH 1LHCH 1S82A 4YT7H 2GD4B 2ZEBA 4JK5A 3AAVA 2W7UA 2WYJA 3MH4A 1C2KA 2FOHA 5FPSA 1BCUH 4NSVA 4U30A 1W2KH 1SFIA 2ZDKA 3NKKA 4ABFA 2V3HH 2F9BH 1CT0E 4B1TA 1DWCH 1S0RA 2ZHDA 1Z7KA 1GDNA 2XCNA 2C8XB 4DIIH 2JH0D 2JH6D 1AN1E 1YLCA 3UOPA 1V2RT 2GX4A 3SV9A 3KF2A 2WPJS 1K1MA 2BD9A 3BTEE 3RU4D 4ABBA 4F49A 1DDJA 1O3BA 1UHBA 2QXJA 3ZVEA 1C5RA 1ZSJA 3QTVH 1GG6C 1GCDA 1LQEA 2P8OB 3GDVA 3PTNA 4MNWA 2Q6DA 2FOBA 1C2GA 1FAXA 3BG8A 2O8LA 1VCPA 2ZDAH 4HFPB 1TLDA 3GDSA 4AOQA 2QYIA 4JK6A 4OS7A 1W13U 2VU8E 2F83A 5HGGA 1KXBA 1RD3B 1KXCA 3UWIA 2UWOA 1IQHA 1ARBA 3A89A 3GCOA 4OS6A 2BD7A 3V3MA 8GCHG 1C1VH 1DWBH 3MNCA 2TBSA 3STJA 3RXGA 2GP9B 1KTSB 1SLVB 1TBRH 2SGQE 1MKWK 1SFQB 2Y5HA 1AZ8A 1LKAA 1FXYA 1QY6A 3AW1A 3M7UA 1WQVH 6ESTA 1AWFH 1F5RA 3IG6B 4HZHA 1SGFA 1OSSA 1YP9A 3KHVA 1O3OA 3EA8A 3W94A 2G4UA 4JYTA 1LTOA 4AG1A 3ZZ9A 2OBOA 2ZGBH 1AWHB 4H6TA 1U6QA 1F0TA 5C5OA 1ANCA 1MCTA 5CHAC 1TMTH 2P95A 1GGDC 1DX5M 1RFNA 2ZECA 1K1PA 1MBQA 2O9QA 4D7GA 1ESAA 8KME2 1TOMH 2R3YA 2Y5FA 1F2SE 1O2GH 1NS3A 2BDCA 3GY4A 1THSH 1AB9B 5GIBA 1GI1A 3O8CA 1BTXA 3TGJE 2ZGXH 3A85A 1C5LH 1C5XB 1PPBH 4XBDA 2Z9GA 3BTGE 3K65B 2FOFA 3PO1B 1TFXA 1SGRE 4CRGA 3SNDA 3ZYDA 2GMTC 1ANBA 1IOEA 2ANMH 4ASHA 3RXOA 1XM1A 1GHBG 2PGQB 5K0HA 1P04A 4GUXA 1O2NA 1NT1A 2VWMA 3PMJA 3QO6A 2VIQA 1JIMA 1RIWB 4NIXA 4JMYA 5L2ZH 1H9IE 2BDBA 2ZHQH 4Y7BA 3M5NA 4NIVA 3SU6A 1TGBA 1HAVA 2A4GA 1D6WA 1BTWA 4XFQA 1QB6A 1G3CA 2A4QA 3HK3B 3M5LA 4LOYH 2H9TH 1YPHE 1UK4A 5DKMA 4NA9H 1A0JA 2QA9E 2XTTB 1HNEE 1A4WH 1B7XB 1O2VA 1XKBC 2ZPQA 3VEQB 1C4Y2 4IGDA 4AB8A 2R2MB 2Y7XA 1QB9A 2P94A 2RA3A 3QDZB 1MBMA 1AD8H 1QQUA 1K1LA 7ESTE 1BHXF 1SOTA 2F9PA 4GPGA 5EW1H 3VB5A 2LPRA 3GCHC 1LHFH 1B0FA 2R9PA 1JIRA 1UVTH 1A5HA 1C5YB 2AEIH 2QV1A 2RCEA 1Z8JB 1P2NA 3HGPA 1K22H 1FPHH 3RXJA 2Z3DA 1G2MA 3NCLA 2GZ7A 1O35A 3C1KA 1FN8A 2Y82A 5A8YA 1BRAA 1V6DA 3AW0A 1GBIA 4DJZB 1BRBE 4BANB 2R0LA 2Y5GA 2ZO3H 2FIRH 5JBBS 1O2WA 3RXFA 4GHTA 3PB1E 3GY3A 1YPLH 2XRCA 1BZXE 2ZF0H 4J1YA 2EI7A 4UFFH 3UIRA 4AG2A 3E1XB 1EAIA 1DWEH 1XMNB 2BYAX 4ESTE 2ANKH 2VIOA 1THPB 1M9UA 2C8WB 3SZNA 2BXTH 2YNAA 4O97A 2IN2A 1ZJDA 4RKJB 4NCYA 2GDEH 2AS9A 1VCQA 3S0NA 1F0SA 1A0LA 1AKSA 1GI9B 1FIWA 4TPYA 1NRQH 2RDLA 1HDTH 1RS0A 1B0EA 3URCA 5FCKA 1NROH 4A1VA 1MKWH 3ZVFA 3BTTE 2OLGA 1KDQB 1UK2A 1HAGE 3ATLA 1GJ6A 1SHHB 1VITH 1W11U 4A1XA 1HAXB 2NU2E 2C90B 3RU4E 1SLXB 4B73A 2IJOB 1BJUA 2M5TA 1QBNA 5E2PA 4A6LA 2FOCA 2Q1JA 2FO9A 3TU7H 1O3HA 5H4IB 3P8OA 5FX6A 2WUCA 1HV7A 1VGCB 1YCPM 1OYQA 2A5AA 4ZKNU 2FLRH 2TIOA 3EYDA 3LH1A 3KCGH 4B71A 1EAUA 1GI8B 1AFQB 4MVNA 3ATMA 1V2QT 1XXDA 1ZTJA 3A83A 1O3DA 1F0RA 3G01A 4Q7ZA 1SOZA 2W3KA 3QGJA 5AVDA 2ESTE 1TPSA 2CJIA 1YKTA 3TH2H 1BMAA 1UTPA 1S6FA 3A8BA 5HM9A 4AFZA 1DT2A 1ZTLA 1FNIA 4Q80A 4AYYB 2JH5D 2AIQA 3RC6A 3F9EA 2UUKB 1T8LA 2HGTH 1PQ8A 4O3TA 1K2I1 2BD4A 3PWCA 2BVRH 4U01A 3OY5U 2STBE 3A7YA 3BTWE 1XUJA 1MU8B 2CV3A 2ZGJA 1CQQA 1AVWA 2PFEA 4MTBA 1GCTB 4X2VA 1TBQH 1NM6A 1LDTT 1Z6EA 1QRXA 1P12E 4IMQA 1EZXC 1DUAA 5PTPA 1C5PA 1YGCH 4I8KA 3P8GA 1RGQA 1INCA 3EDXB 1TRYA 1SGEE 2BLVA 3EGKH 5EPYA 1W0ZU 2STAE 1O2MA 1TIOA 1DM4B 1SLUB 4I8GA 1MTNB 2NU1E 1BTZA 2BD2A 3RXRA 4ZAEA 4Q2KA 3T5FH 2F9VA 2XBXA 4E05H 1ZTKA 2G5VA 4OS2A 4LZ4B 2THFB 5A0BA 1ZSLA 3RU4T 3BTFE 3KGPA 4DVAU 3I29A 1C1TA 1SHYA 2PUQH 1O3NA 3O8DA 4X1SU 3BG4B 1VJ9U 2BQ7B 1LPGB 4ABHA 3ZVAA 5TCCA 2HNTF 1MTVA 1TX6A 2Y81A 1IQGA 4CREA 3F68H 3RUOA 2ZCHP 1SLWB 1ORFA 1WBGB 1P2QA 1EATA 3MU5A 1DXWA 4XBBA 1IQLA 1Z1IA 1UVOA 5FHTA 3NWUA 2AGGX 1QHRB 4Y79A 5JBTA 2VIPA 4RN6A 2ANYA 3SJOA 4I7YH 3A7VA 1K1IA 1YPGH 2ZU3A 1DLKB 1G36A 5G4BA
chains in the Genus database with same CATH superfamily
2XWAA 1OWJA 6LPRA 1GMHF 3GDUA 2BY5X 5K7RA 1ABJH 1FN6A 4ABGA 1SR5C 1Z8GA 1QR3E 5L6NH 1GBTA 1O38A 2CGAA 2FTLE 5SGAE 2BB4A 2BVSH 2H5DA 4Y71A 2QCYA 5DO4H 1AE5A 1YPEH 1QRZA 3S7HB 3FFGA 3GYLB 4NFEA 1H4WA 4KKDA 3F2GA 2FI3E 3TNTA 1C5NH 2J92A 2H6MA 2VIDA 3MHWU 4GHQA 4RT1A 5DK1A 1EPTB 1O5CB 3RXTA 4YT6H 3D62A 4MPUA 2BLWA 2RA0A 1ZHPA 3TK9A 3M3SA 1TNHA 1W14U 2BQWB 1C4U2 5DPAA 1AE8H 5T6FA 1L1JA 2ASUB 1OXGA 2LNCA 2BY7X 3ATKA 2XC4A 3N7EA 2Z9LA 1RTKA 2ZCKP 1G2LA 3TLOA 1D3DB 3EA9A 1Q31A 2O8WA 1GJ5H 3MMGA 3MO3A 1HUTH 5JB9S 2WV5A 5HKKD 4A5TS 1P02A 2QF3A 1G32B 3DCLA 1C2EA 2HNTE 1AUTC 4K69A 3SJ8A 1XUFA 9LPRA 1D6RA 2HALA 1LPZB 6CHAC 4FU7A 1GGDB 4R8TB 1ELEE 4BXWA 2WV4A 1DANH 2GKVE 9ESTA 2M2AA 4Y8XA 1EQ9A 2GCTC 2PV9B 1O32A 2JETC 3RLWH 1V2KT 4P02A 3LONA 1UK3A 4ZHLU 2A2XH 1C9TA 4WH6A 1KTTB 3SJIA 4DGJA 4MNXA 4UFGH 1A5IA 5CMXH 2BY6X 3M7QA 4DIHH 1GJ8B 1RXPA 1V2JT 3RMOH 4BAHB 1HJ9A 4INKA 1O5AB 3LJJA 2K1QA 2HVYB 2ZNKH 1D3TB 1BHXB 3KQDA 2VVVA 4MPWA 2P3UB 3RXCA 1O0DH 2TGPZ 1EOLA 3QLPH 3SU0A 2G51A 2RDEA 1CBWB 2NU3E 2ZGCA 2ODPA 1VJAU 5EG4A 4JYVH 4U2WA 2AERH 3LGUA 3WWBA 4E7RG 5LPEA 3BEFB 1XVMA 1YM0A 2BXUH 2C8ZB 5TJXA 1D3PB 3Q77A 2AMQA 2ZFQH 1HIAB 1UCYH 2FI4E 1SGIB 2HPQH 2G5NA 1T4VH 2ZDMA 2VGCC 2W7SA 1AUJA 2EQNA 3BEUA 2LP6A 1PJPA 3K9XB 4I31A 4YXWD 1NY22 2J4IA 1CHGA 4DCDA 1O5GH 3KQCA 2CHAC 1FX0B 4FXGH 1ZRKA 3TPIZ 4ZXYH 4FU8A 1TALA 3BTQE 3T62A 3U1IB 1OP2A 2SNVA 3VB7A 2XC0A 3ENSB 3A88A 4MNVA 5EU8A 4BTUB 5C1UA 1NRRH 1H8HD 4WF8A 2ZFTA 4FUDA 1C5VA 3S69A 4ISNA 3S9BA 2ZFRH 4D8NA 1SQRA 4WMEA 1TYNA 2GTBA 2Z3CA 1FDPA 1QURH 1AMHA 2VIWA 1SGNE 2OC1A 4YLQH 1THRH 1O3GA 2C8YB 5I46H 3H7OA 1GDUA 1P10A 4H4FA 3A7WA 4MNYA 4WMFA 1WXRA 1A1RA 1NRSH 2I6SA 2D2DA 1ZPCA 1VCWA 3TJOA 4B2BA 3LC3A 1XX9A 1OWKA 4R0IA 5TCAA 1P2OA 5FXLA 4K1TA 1MQ6A 3SYJA 1JMOH 1E0FD 2QF0A 1A3BH 4XDEA 5EIYA 1KMHB 3A7ZA 3MO9A 1BOQA 1TA6A 2A5IA 2YNBA 3A8AA 4KP0A 1BQYA 1SQOA 3QK1A 4JZ1A 4HI3A 4Y10E 5L2YH 2ZP0H 1UTKA 1UVUH 3RDZA 2QXIA 1AFEH 1P9UA 1SG8B 1P2MA 1E34B 1QFKH 1ELGA 1ZZZA 1UHBB 4ZMAH 2NU4E 2J9NA 3ZZBA 2ZTXA 1NO9H 2FM2A 2BDYA 2FESH 3DT0H 2FOMB 2XC5A 1LCYA 2UUFB 4X8SH 1G3DA 1GJDB 3GY6A 3TJUA 1UMAH 1SB1H 1TB6H 2K0QA 3EA7A 1BBRE 1AVGH 3VGCC 1FONA 2CXVA 3FAOA 1N6YA 3LIWA 1FAKH 1O5FH 1L2EA 1EUFA 4UONA 1Y8TA 1BTPA 1LHGH 3P92A 2VNTA 4TY7A 4I8HA 1WSSH 1MU6B 3ZZAA 1KXAA 1C9PA 1NRNH 3B8JA 5ESTE 4MG3A 2F91A 2VWOA 3GCTG 3DD2H 2ZHEH 1C2DA 4B76A 1GBDA 4OS4A 5F8XA 2BMGB 1TAWA 1E35B 3PWBA 5GNDA 1C5ZB 1YCPH 1A3EH 2OTVA 3TITA 1QA0A 3UQOA 4DY7B 1SGFG 1XUGA 2H2ZA 1EOJA 4X1PU 5EXNA 4GCHG 2LELA 1SKYE 1Y3YA 2Y6TA 1C1RA 2FWWA 1SMFE 1KLJH 1LPKB 2ZTYA 3F9FA 2ZFPH 4NGAH 5FBEA 3ODDA 2W26A 1WV7H 2FZZA 3V12A 3OX7U 3QUMP 4ASUD 3MNSA 4VGCC 2PSYA 4X6MA 1ELCA 1OWIA 1TMBH 3SU1A 3A81A 2OD3B 1E37B 1G3EA 2A0QB 4U32A 5J4SA 1SGDE 1T8OA 1XXFA 5DG6A 5A8XA 3M5MA 2ZCLP 3WW7A 2SGEE 3OY6U 1L4DA 1GVKB 2ZGHA 1P2KA 2A32A 3MYWA 1C2LA 1OP0A 1GBMA 1P57B 1GHVH 3MH7A 4CRDA 1QTFA 2Z7FE 1IQEA 1P2JA 2H1UA 3RXKA 1SSXA 1WU1A 2WHXA 3UR6A 2IPQX 4KTUA 1GMHG 3ESTA 1HAVB 2HRVA 5C0UA 2F3CE 4FUEA 2A7JA 2J97A 3ZZ3A 2PWXA 3A7XA 3RXSA 2D1JA 1DITH 2A5KA 1BIOA 1MUEB 1T8NA 1QRWA 1HGTH 1O3AA 2VWLA 3DUXH 4X1QU 1FMGA 3AK5A 3MH6A 3KNXA 2KAIA 4THNH 2GDDA 1BA8B 3MNXA 1UTOA 2ZA5A 3ZZ4A 3OEED 1IQFA 1XKAC 3UUZA 1ZMNA 1NPMA 1JBUH 2HLCA 2HVXA 3B9FH 2AHME 3AVZA 4B2CA 2Q6FA 1CVWH 2ZQ1A 1FLEE 4ZKOU 4BTTB 3RXMA 1PPHE 2VJ1A 1VZQH 5C17A 4WMDA 3A8DA 1GHYH 2EA3A 1ELTA 1NC6A 2GVFA 1Q3XA 5GWZA 4K1SA 2GZ8A 1HAYB 1H8ED 3GS9A 1J8AA 3GCNA 1V2TT 2VWNA 3GY5A 4D9RA 1TE0A 1P9SA 2ODQA 4FUFA 3VXEH 2BDIA 1P2IA 5HYOA 3UTUH 1GBHA 3SUFA 2B7DH 1B5GH 1OOKB 1K1NA 3T27A 3SU3A 3KEEA 1GBEA 3SV2H 3MOCA 4F4OC 4X2XA 1O2OA 2TGTA 1C1MA 1YPKH 1AY6H 1ZOMA 3AAUA 1CSOE 1SGYE 3UAIC 1UJ1A 4TYDA 4AFSA 4PROA 1TA2A 5C20A 5JB8S 1TGNA 1WTHD 3OYPA 1WQSA 1A5GH 3NRLA 2OXSA 3RXHA 1P0SH 3UNQA 3ZVBA 3DFLA 1AKSB 3DHKH 1DY9A 1L1NA 1HBTH 1QJ6B 2OQUA 2P3TB 1TBZH 2P3FH 5KGOA 3SUDA 1HLTH 2RFKC 2WINI 1W12U 4SGBE 2GCTB 4KGAA 1Z6JH 3F1SB 1GJ7B 1Q2WA 1D4PB 3T29A 1XVOA 1TGSZ 4X1NU 3GYMA 2VBCA 1OP8A 1F5LA 3SV8A 3OTJE 1V2WT 2UWLA 3T25A 4DOQA 1HAHH 1ZLRA 2JKHA 2AYWA 3K6YA 4MLFB 1L1GA 1YPMH 2PKAA 1QZ8A 1KIGH 4ZKSU 4DT7B 1YC0A 5A8ZA 4IC5A 1W7GH 3TH4H 2W3IA 1W3CA 3UB0A 1FUJA 3ZZDA 1GJAB 3ATIA 5ESBA 3GY7A 4I32A 1O5EH 1Y3UA 4UFEH 1EX3A 3MWIU 1BRCE 3FANA 1JXPA 1N8OB 3URDA 1Z8IB 2VH0A 2BY9X 4WVPE 5GXPA 1WYKA 1IQJA 1EXFA 1TNJA 2ZFFH 4IN2A 2QGRA 4KTSA 1C1WH 2VH6A 1LVBA 3FVFB 4NIYA 3TVJB 1CA0B 1EZQA 1UTQA 1ESBA 3SQHE 4DURA 1VKYA 4GAWA 3TJVA 5AF9H 3HK6B 1LKBA 2VGCB 1C1PA 3U8TH 4K3JA 3BV9B 1PPCE 2QC2A 1F92A 1OS8A 3B23B 3EE0B 4ZKRU 4D7FA 3UOUA 4A92A 1HJAB 2A4OA 3MO6A 1HXFH 1CT2E 3M3TA 1GBLA 1O3KA 1ZMJA 2B9LA 2KX4A 3GISB 3LH3A 4CHAC 1O2QA 1GMDF 1F7ZA 4UE7H 2V7QD 3GCTF 4NWLA 4OGYA 2D8WA 2F9OA 2C4FH 4BAKB 4HGCA 1E1RD 2ANWA 1AB9C 4TWWA 4B6FA 5JBAS 1ESTA 2BZAA 2ULLA 1NRPH 3LU9B 4YLUA 3KIDU 2XNIA 4AB9A 4GCHF 3SHAH 3VB6A 3SBKA 3PO1C 3SGAE 1TX7A 4H42U 5HM2A 4CRBA 1IQKA 3TJNA 3PLPA 1UCYK 1T8MA 1P3CA 3OFND 1GBJA 5AFYH 2FMJA 2EI6A 2ZHFH 4CRFA 1RTFB 2L74A 1TPOA 1HB0B 2BLOA 5DJ7A 3N7DA 1T32A 1CHOF 1GL0E 1DWDH 1XUHA 4TWYA 4O3UA 4BNRA 1ID5H 4ZHAA 1P06A 2IPHA 1TGCA 1EZSC 1DXPA 1BTYA 2AGIX 1O2ZA 3RXVA 2BOHB 1Y3XA 2VB0A 1O2SA 2ZPSA 1QB1A 2V6NA 1TOCB 1JOUB 2PR3A 3MU4A 1G3BA 4ISLA 1XUIA 5J4QA 1NFUA 1C1OA 1H8IH 1UO6A 2GV6A 3ITIA 3ZZ6A 1GJCB 3PLBA 2BZ6H 1V2MT 2Z9IA 3SNAA 1BB0B 2WPKS 4CR5A 3I77A 3Q00A 5FX5A 2ZTZA 4X6PA 4ZROA 4IW4E 2QXHA 5EPNA 4FUCA 3ZZ5A 2OINA 3PM3A 1NN6A 2HWLB 5C5NA 2AMDA 1KXDA 1GG6B 3OEHD 1AU8A 1GBCA 1KSNA 1QA7A 2V35A 2ZKSA 3U1JB 1O2TA 1LMWB 1SI5H 2WSSD 4NSYA 3LGYA 3VPKA 1V2ST 3D23A 1CO7E 1C2FA 1GHZA 1C1QA 2PLXA 3PYHA 3SHCH 3W95A 2FYQA 5F6MA 3QWCH 5C94A 1OX1A 4CBNA 1TPPA 4RT0A 4ZXXH 1O2XA 4Q7XA 3K2UA 2Z94A 3BN9A 1AHTH 1S83A 2J94A 2W6ID 1AQ7A 1O31A 2TPIZ 3RXEA 3VGCB 2BQ6B 3H5CB 5JBCS 2WUBA 3TGIE 2AGEX 3NZIA 1SGTA 1DUEA 2XOKD 4XD7D 1HRTH 3PTBA 2K8IA 5CE1A 1K21H 4WY3A 4Q63A 1D3QB 4LZ1H 3IITA 1PPFE 1A2CH 5DP6A 1IQIA 2F9UA 7LPRA 5CHAB 3SNEA 3M3VA 5GCHF 3CS7A 3FZDA 1O3PB 1CT4E 4MPXA 1KXFA 1YPJH 4ABEA 1CGJE 4NG9H 3U69H 1GBFA 2FX4A 1HAOH 5C2ZA 1ZSKA 1PYTC 2KZ4A 2A31A 4YOIA 1BMMH 3VB3A 1MD7A 5FPTA 1EJAA 2G55A 1SVPA 2FEQH 1YF4A 1SC8U 1PQAA 3BEIB 2NU0E 3LJOA 3UR9A 3SUEA 1J15A 2OC7A 2ZC9H 3RC4A 4OM9A 5E0HA 1BDAA 3PRDA 2Y80A 3SU4A 3OSYA 1HPGA 2ODYB 2GMTB 4VGCB 3U9AH 2FOEA 1GMCG 2DE9A 2XWBI 3FO8D 3LC5A 5FCRA 2BDGA 3STIA 4HG6A 1BMLA 1QJ1B 1PPEE 1ZPBA 4ZHMU 1NTPA 1GI6A 4BTIB 5A09A 1O39A 5EQQA 1G30B 5EODA 3SUGA 3OE7D 1HAIH 1TRNA 3L3TA 4NZQA 1GHWH 5AHGH 1VR1H 1MKXH 3FZZA 2G00A 3UWJH 1EJMA 2ZU2A 1QBOA 1YCPK 2KM0A 2P93A 1AFQC 2PGBB 3CS0A 2QIQA 4Y8YA 2BLQA 5DP7A 2PSXA 4B6EA 4JZDH 1N1LA 2H9HA 4NWKA 4MPVA 1IQNA 3SU5A 2ZDNA 2C3SA 3E0PB 2JJ2D 2P59A 5FBIA 1QL7A 1QNJA 1O5BB 1WAYB 3ZVCA 2GJGA 1AIXH 5DSFA 3MU8A 5LPRA 2G52A 1ZYOA 4XSKU 1GHAG 4OGXA 4P00A 3GCHB 1FY1A 1GBKA 3M61U 2H9EH 1ELDE 1DSUA 1O2LA 1FY5A 2KCPA 1BJVA 1QCPA 2ZFSA 1BTUA 1C1SA 3QGNB 8LPRA 3F0PA 1O2PA 3F9GA 1IAUA 5EJZA 1GHXH 1C1UH 3F9HA 1MAXA 3S9AA 4I33A 3ZVGA 2F43B 3TK5A 4M9FA 1C5UA 3QTOH 1WUNH 4I86A 2XW9A 3CENA 4OS5A 3S9CA 2WPMS 3BF6H 4YTAA 1P05A 1MCVA 4Z1MD 1P01A 3UREA 2ZPRA 4ZH8A 3ZZ8A 1LO6A 4X2YA 3LGIA 1MTNC 1KXEA 1LVOA 8ESTE 3UPEA 1O2JA 2O8TA 1EP6A 2ZG0H 3Q3KA 1S81A 2BX4A 4AYVB 1O3LA 2V0BA 3S7KB 4AZ2B 4X8VH 2J95A 3SN8A 3TIUA 2OBQA 4FVDA 4UDWH 2ZQ2A 5JDUB 3ODFA 3RXIA 4IMZA 3A7TA 1SQAA 3NK8A 3V13A 3NUMA 2FOAA 2A7CA 1C5TA 1GL1A 3A82A 1Z71A 4J2YB 1EB1H 2OP9A 3MTYA 4K8YA 2W5EA 1TQ0B 1FY4A 4NIWA 2AH4X 3KQBA 3RLYH 3TGKE 5C0TA 2OCVB 1JRSA 2BHGA 3SU2A 1GI5A 1C1NA 4H6SB 3HGNA 2FTMA 3BTME 1ANDA 1V3XA 1UTJA 1Y59T 2FS9A 2R3UA 4CRAA 4ZCNA 1W7XH 2WZQA 1YPHC 4JCNA 1MMJN 2PKSC 5EQSA 4A1TA 2F4LA 4AN7A 2KCYA 3WY8A 5E0JA 3RM0H 1BT7A 1WTGH 2BD5A 1ACBE 5C1YA 1AVXA 1EAWA 5EW2H 2A45B 3D65E 2SGAA 3I78A 4YESB 2QN5T 1TNLA 4NZLA 2JJ1D 1OWEA 1SQTA 1DPOA 3M35A 5DP4A 4ZUHA 3UY9A 2KFWA 1ZHRA 1CGIE 4D76A 1C5WB 1O2KA 1QJ7B 1EPTC 5A0AE 2RG3A 4UEHH 2F9NA 3M5OA 3PMHB 3DSGA 3QN7A 1E36B 2FOGA 3Q76A 3GICB 1O33A 1OWDA 1O3EA 1GVLA 2XYAA 2G81E 1K9OE 2XBWA 1V2LT 3FP8E 3PMAB 3SO3A 1GMDG 3A84A 3TNSA 1DOJA 3SGQE 1JRTA 1HAPH 1SGCA 4YOGA 4X1RU 4X6OA 1BBRH 3PROA 5E8EH 3RXUA 1QBVH 3TH3H 3DSPA 1QL9A 1IHSH 2Y7ZA 3HPTB 1NBMD 1C2HA 4CHAB 3Q3YA 1OWHA 3JZ1B 1QIXB 4IN1A 5I25A 1RRKA 3RXDA 3P6ZB 3A87A 1DFPA 1W0YH 2SFAA 1CHOG 5AFZH 2OK5A 4IC6A 4K2YA 1GI4A 1EAXA 2Z6BD 4I8LA 4ABJA 2OUAA 1HFDA 1V2NT 3RXPA 4GVUA 4RSPA 1ELBA 1UVSH 1W0JD 1Y3VA 2QE7D 3QZRA 1DE7H 1NFWA 2FS8A 1Y5AT 4BAQB 1OKXA 3HATH 4XRNA 6GCHF 1K0HA 2JIZD 4FUHA 2WPLS 5ETXA 3CNRA 1ZJKA 1GMCF 2EC9H 1VITF 3CP7A 3M37A 4ISOA 1FZZA 1K1OA 4Y0YE 1DSTA 4K1EA 3JZ2B 5EXLA 1DY8A 1XUKA 2BTCE 3E6PH 2P16A 3RM2H 3U28C 4KELA 1CBWC 4FUIA 2Z9JA 3FKSD 1H1BA 1MAYA 1C5SA 1GJ4H 3P8NA 1MTUA 3LKWA 5L30H 2GCHF 3E3TA 3PMBB 1PPGE 1FY8E 1MABB 1CU1A 1C2IA 4DG4A 3V0XA 1DLEA 3EAJA 4ISIH 2KAIB 2VIVA 1O34A 1SGPE 3E91A 3ZZ7A 5CDFE 2CMYA 1O3FA 2SGFE 1GI3A 2ZZUH 2ILNA 4B2AA 4RKOB 4JZIA 5GJ4B 1S5SA 3ZIAD 1ZHMA 1O2IA 2ZWLH 1GHAF 1KY9A 4GSOA 1QL8A 1W0KD 5FL7D 4AGJA 3P8FA 1V2PT 4FUBA 1FJSA 1BMFD 1P8VC 3ZV8A 4JZFH 4MQAA 2CF8H 1KLIH 3OU0A 5DP8A 3LT3A 1P03A 1ZR0A 3GY8A 3LGWA 2VINA 1EB2A 1KLTA 1FY3A 1ZMLA 3L6PA 5LH8A 4Z6AH 5GCHG 2J2UA 4CBOA 3GY2A 1A0HB 2YMSD 2ZI2H 1TNGA 2CK3D 2VVUA 4K60A 3H09A 1ABIH 1FIZA 2OC8A 4O03A 2BX3A 1ARCA 5BRRE 1YYY1 4D9QA 2PHBA 1DS2E 1G9IE 2CN0H 4NFFA 3U8RH 4AX9H 3HKIB 3P95A 3MU0A 1F5KU 4HTCH 1FPCH 1S6HA 3SW2B 2FXRA 1T4UH 3H7TA 5DP3A 1C2JA 2BDHA 1O2HA 1V2OT 2BOKA 2W6JD 1P09A 3SJKA 6CHAB 1DICA 5F8TA 1O3IA 3T2NA 3LDXH 4FVBA 2I6QA 4UD9H 1WOFA 2FPZA 5EJ1A 3FN8A 1V2VT 1EASA 4CR9A 2ZHWH 4SGAE 1KDQA 3SI3H 2A2QH 3A86A 4BXSA 2NWNA 2JETB 5DP5A 1ELVA 1MD8A 2CF9H 1E1QD 7GCHF 3KL6A 1S85A 2FLBH 1Z1JA 1HXEH 1AZZA 4TSFD 1O2YA 1O2UA 4ABAA 3EE7A 3LOXA 1NZQH 2TGDA 1LVMA 1AO5A 5HIZA 3R0FA 2DUCA 2P8OC 3UQVA 4IBLH 2UUYA 2ZU1A 1X7AC 2GT7A 2FP7B 2KCOA 2UWPA 2FODA 5C3NA 4X0WU 1ETTH 2ZIQH 2ZDVH 4ABDA 2PKAB 3DFJA 5T6GA 3E0NB 2B0FA 1BITA 2AIPA 5B6OA 1H9LB 1W8BH 2WPHS 3BIVH 1BTHH 3MH5A 3RC5A 1YLDA 2FDAA 4B75A 2PTNA 2GZ9A 3WWFA 2WYGA 4FU9A 3PV5A 1C2MA 1GBBA 2TGAA 1LVYA 1TQ7B 3M36A 1J9CH 3NXPA 5GPIB 2TRMA 3P17H 3LGVA 2YMSC 5T3HA 3T28A 3UNSA 4XOJA 5T6DA 3A80A 2CHAB 4E06H 1ZRBA 2DE8A 2WPIS 2XBVA 2H5CA 4BOHA 1UTMA 3AASA 8GCHF 1QGFA 5DP9A 4CH2B 1YLNA 1O37A 1OYTH 1ZPZA 1NBME 2R0KA 1PFXC 1TWXB 1T31A 2EEKA 4WXIA 3F6UH 2J98A 1C5OH 2XCFA 4O9VA 2B5TB 2VVCA 1MTSA 3ELAH 3T26A 1GBAA 1PPZA 1Y5UT 3UNRA 1SBWA 4WXVA 1MKXK 1C5QA 2J34A 3BIUH 3SV7A 5EXMA 7KMEH 2HNTC 1NFYA 2C93B 3GOVB 3KQ5A 1P3EA 3E8LA 1BUIA 3RMNH 1RTLA 3RXLA 1O30A 2FX6A 3O8RA 5F8ZA 4AFUA 4NA8A 1S84A 2ALVA 5GDSH 1E38B 3DA9B 1RIWC 4X2WA 2Z9KA 1TRMA 1TPAE 3KN2A 1PQ5A 5FAHA 1PYTD 2AFQB 1O5DH 3PLKA 5FPYA 1TGTA 2YOLA 2ZU4A 1AGJA 3ZV9A 2G4TA 5HXFA 1ANEA 4DW2U 1TABE 4F55A 1F0UA 2FI5E 3L33A 1J17T 2V3OH 4WWYA 3ZZCA 2BY8X 1GHBF 1UW7A 2HLDD 2PTCE 3SORA 2BM2A 1BRUP 4ACAA 2ALPA 1ELAA 1YBWA 2O8UA 5E0GA 1IQMA 3FP6E 3MU1A 4AFQA 4K8BA 5C67A 3MI4A 5LGOA 4XBCA 3BTHE 1EZUC 1H9HE 2SGPE 3ZVDA 2XXLA 3SNCA 4Z0KA 3RP2A 1WCZA 3ZYEA 3SNBA 2PKSB 1NU7B 1MQ5A 1HAZB 1ELFA 2Q6GA 1GI2A 1O3JA 3RMMH 2BVXH 4JZEH 3BTKE 5HIYA 1YWUA 1C4V2 1O3CA 1EPTA 4M7GA 3HKJB 4KTCA 4YM9A 1UVPA 5JPMH 1MTWA 2XBYA 3V7TA 4X8TH 5EJLA 3BTDE 5CHBA 1O36A 4GLYA 5DN6D 3SV6A 4AORA 1FV9A 1GDQA 2QY0B 3VFEA 3RMLH 2AMPA 4XE4A 3C27B 1UTNA 3O8BA 5EQRA 2BD3A 1JWTA 2BD8A 1TMUH 1J14A 2GV7A 5EGMA 2IJD1 3EQ0H 1FI8A 4UFDH 3U8OH 3SQEE 1ZGVA 4NA7A 1Y5BT 1Z8RA 1DVAH 2HOBA 4I8JA 1OPHB 1HYLA 2Z3EA 4QT8C 1GJ9B 4ABIA 4CH8B 1SGQE 1ZGIA 5JYIA 4LXBH 5A2MH 1G37A 3F0OA 3RXBA 3SI4H 2G8TA 4FUJA 1A46H 3Q3XA 1AI8H 3PV2A 4WJG2 3OAAD 4INHA 3P70B 3UFAA 4INLA 1TNKA 1SPJA 4YOJA 1L0ZA 6GCHG 2KR7A 1GI7B 4Y8ZA 1D9IA 1P11E 1MH0A 1HCGA 1O2RA 1VITG 2OC0A 4JYUH 2J38A 1K28D 3M7TA 4Y0ZE 1Y3WA 2B8OH 5F03A 1K1JA 5IDKA 3LPRA 4E7NA 1GPZA 1V2UT 1VGCC 5A0CA 3W1EA 1A61H 1BMNH 2GCHG 2D26C 5IYTA 3E90B 4YO9A 4Y6DA 1UCYE 3PV4A 1ETSH 5F53A 2OQ5A 3VB4A 3FP7E 3MFJA 1GI0A 4TT3D 4WH8A 4B74A 1TONA 4MDSA 2A7HA 4BAMB 4YZUA 3U98H 2SNWA 3E16B 1BBRK 4TPIZ 4K5ZA 3MNBA 2ZDLA 1A7SA 2PW8H 4Q7YA 1S0QA 4TY6A 3QZQA 3RXQA 5B6LA 1GWAA 1HIAA 4AGKA 3ATWA 1N8OC 3SJ9A 2HPPH 4CRCA 4ISHH 3BSQA 3PRBA 5BPEA 4IS5A 5KEDA 1EJNA 1QQ4A 5EOKA 3QX5H 4X6NA 1UTLM 1TNIA 1CA0C 2A1DB 3A8CA 5DGJA 5C1XA 1NFXA 3RXAA 1H8DH 1GCTC 1NU9A 3KQEA 4OS1A 2GT8A 3LGTA 5HMAA 1NESE 2IOTA 2A4RA 2UUJB 3D49H 1HJAC 1MZDA 1COWD 4Y7AA 1W10U 3KYFA 1ETRH 1FQ3A 2QAAA 1EKBB 3TK6A 3SOSA 5LPFA 3NPSA 2O8MA 4BAOB 3R3GB 1GVZA 2SGDE 4LK4A 1PQ7A 2QXGA 3SGBE 3N7OA 1GJBB 1CE5A 1IHTH 4X8UH 1LHEH 2PUXB 1HJ8A 1CA8B 1T7CA 1LHDH 3DSOA 3IWMA 1O3MA 5ABWA 1TX8A 2ZU5A 3N99A 1LQDB 4Y76A 5E2OA 2FYRA 1J16A 1MZAA 3BG4C 1SL3A 4Y11E 1EP5A 3K6ZA 1CGHA 7GCHG 2GGVB 1L4ZA 1KYNA 2EI8A 2R2WU 4FUGA 1N6XA 2BDAA 1C5MD 1RJXB 4A7IB 3VXFH 1LHCH 1S82A 4YT7H 2GD4B 2ZEBA 4JK5A 3AAVA 2W7UA 2WYJA 3MH4A 1C2KA 5KECA 2FOHA 5FPSA 1BCUH 4NSVA 4U30A 1W2KH 1SFIA 2ZDKA 3NKKA 4ABFA 2V3HH 2F9BH 1CT0E 4B1TA 1DWCH 1S0RA 2ZHDA 1Z7KA 1GDNA 2XCNA 2C8XB 4DIIH 2JH0D 2JH6D 1AN1E 1YLCA 3UOPA 1V2RT 1OHHD 2GX4A 3KF2A 3SV9A 2WPJS 1K1MA 2BD9A 3BTEE 3RU4D 4ABBA 4F49A 1DDJA 1O3BA 1UHBA 2QXJA 3ZVEA 1C5RA 1ZSJA 3QTVH 1GG6C 1GCDA 1LQEA 2P8OB 3GDVA 3PTNA 4MNWA 2Q6DA 2FOBA 1C2GA 1FAXA 3BG8A 2O8LA 1VCPA 2ZDAH 4HFPB 1TLDA 3GDSA 4AOQA 2QYIA 4JK6A 4OS7A 1W13U 2WV9A 2VU8E 2F83A 5HGGA 5IK2D 1KXBA 1RD3B 1KXCA 3UWIA 2UWOA 1IQHA 1ARBA 3A89A 3GCOA 4OS6A 2BD7A 3V3MA 8GCHG 1C1VH 1DWBH 3MNCA 2TBSA 3STJA 3MQKC 3RXGA 2GP9B 1KTSB 1SLVB 1TBRH 2SGQE 2V3MA 1MKWK 1SFQB 2Y5HA 1AZ8A 1LKAA 1FXYA 1QY6A 3AW1A 3M7UA 1WQVH 6ESTA 1AWFH 1F5RA 3IG6B 4HZHA 1SGFA 1OSSA 1YP9A 2YMSB 3KHVA 1O3OA 3EA8A 3W94A 2G4UA 4JYTA 1LTOA 4AG1A 3ZZ9A 2OBOA 2ZGBH 4FETA 1AWHB 4H6TA 1U6QA 3F3BA 1F0TA 5C5OA 1ANCA 1MCTA 5CHAC 1TMTH 2P95A 1GGDC 1DX5M 1RFNA 2ZECA 1K1PA 1MBQA 2O9QA 4D7GA 1ESAA 8KME2 1TOMH 2R3YA 2Y5FA 1F2SE 1O2GH 1NS3A 2BDCA 3GY4A 1THSH 1AB9B 5GIBA 1GI1A 3O8CA 1BTXA 3TGJE 2ZGXH 3A85A 1C5LH 1C5XB 1PPBH 4XBDA 2Z9GA 3BTGE 5T1VA 3K65B 2FOFA 3PO1B 4F48B 1TFXA 1SGRE 4CRGA 3SNDA 3ZYDA 2GMTC 1ANBA 1IOEA 2ANMH 4ASHA 4ACBA 3RXOA 1XM1A 3KYGA 1GHBG 2PGQB 5K0HA 1P04A 4GUXA 1O2NA 1NT1A 2VWMA 3PMJA 3QO6A 2VIQA 1JIMA 1RIWB 4NIXA 4JMYA 5L2ZH 1H9IE 2BDBA 2ZHQH 4Y7BA 3M5NA 4NIVA 3SU6A 1TGBA 1HAVA 2QF5A 2A4GA 1D6WA 1BTWA 4XFQA 1QB6A 1G3CA 2A4QA 3HK3B 3M5LA 4LOYH 2H9TH 1YPHE 1UK4A 5DKMA 4NA9H 1A0JA 2QA9E 2XTTB 1HNEE 1A4WH 1B7XB 1O2VA 1XKBC 2ZPQA 3VEQB 1C4Y2 4IGDA 4AB8A 2R2MB 2Y7XA 1QB9A 2P94A 2RA3A 3QDZB 1MBMA 1AD8H 1QQUA 1K1LA 2QF4A 7ESTE 1BHXF 1SOTA 2F9PA 4GPGA 5EW1H 3VB5A 2LPRA 3GCHC 1LHFH 1B0FA 2R9PA 1JIRA 1UVTH 1A5HA 1C5YB 2AEIH 2QV1A 2RCEA 1Z8JB 1P2NA 1YY3A 1K22H 1FPHH 3HGPA 3RXJA 4AC9A 2Z3DA 1G2MA 3NCLA 2GZ7A 1O35A 3C1KA 1FN8A 2Y82A 5A8YA 1BRAA 1V6DA 3AW0A 1GBIA 4DJZB 1BRBE 4BANB 2R0LA 2Y5GA 2ZO3H 2FIRH 5JBBS 1O2WA 3RXFA 4GHTA 1E79D 3PB1E 3GY3A 1YPLH 2XRCA 1BZXE 2ZF0H 4J1YA 2EI7A 4UFFH 3UIRA 4AG2A 3E1XB 1EAIA 1DWEH 1XMNB 2BYAX 4ESTE 2ANKH 2VIOA 1S6LA 1THPB 1M9UA 2C8WB 3SZNA 2BXTH 4FOUC 2YNAA 4O97A 2IN2A 1ZJDA 4RKJB 4NCYA 2GDEH 2AS9A 1VCQA 3S0NA 1F0SA 1A0LA 1AKSA 1GI9B 1FIWA 4TPYA 1NRQH 2RDLA 1HDTH 1RS0A 1B0EA 3URCA 5FCKA 1NROH 4Q4LA 4A1VA 1MKWH 3F2HA 3F2FA 3ZVFA 3BTTE 2L6OA 2OLGA 1KDQB 1UK2A 1HAGE 3ATLA 1GJ6A 1SHHB 1VITH 1W11U 4A1XA 1HAXB 3SZEA 2NU2E 2C90B 3RU4E 1SLXB 4B73A 2IJOB 1BJUA 2M5TA 1QBNA 5E2PA 2PP6A 4A6LA 2FOCA 2Q1JA 2FO9A 3TU7H 1O3HA 5H4IB 3P8OA 5FX6A 2WUCA 1HV7A 1VGCB 1YCPM 1OYQA 3OTPA 2A5AA 4ZKNU 2FLRH 2TIOA 3VG8A 3EYDA 3LH1A 3KCGH 4B71A 1EAUA 1GI8B 1AFQB 4MVNA 3ATMA 2J5UA 1V2QT 1XXDA 1ZTJA 3A83A 1O3DA 2KCAA 1F0RA 3G01A 4Q7ZA 1SOZA 2W3KA 3QGJA 5AVDA 2ESTE 1TPSA 2CJIA 1YKTA 3TH2H 2XNDD 1BMAA 1UTPA 1S6FA 3A8BA 4DT4A 5HM9A 4AFZA 1DT2A 3FOAA 1ZTLA 1FNIA 4Q80A 4AYYB 2JH5D 2AIQA 3RC6A 3F9EA 2UUKB 1T8LA 2HGTH 1PQ8A 4O3TA 4RI0A 1K2I1 2BD4A 3PWCA 2BVRH 4U01A 3OY5U 2STBE 3A7YA 3BTWE 1XUJA 1MU8B 2CV3A 2ZGJA 1CQQA 1AVWA 2PFEA 4MTBA 1GCTB 1WDIA 4X2VA 1TBQH 1NM6A 1LDTT 1Z6EA 1QRXA 1P12E 2J98B 4IMQA 1EZXC 1DUAA 5PTPA 1C5PA 1YGCH 4I8KA 3P8GA 1RGQA 1INCA 3EDXB 1TRYA 1SGEE 2BLVA 3EGKH 5EPYA 1W0ZU 2STAE 1O2MA 1TIOA 1DM4B 1SLUB 4I8GA 1MTNB 2NU1E 1BTZA 2BD2A 2EY4C 3RXRA 4ZAEA 4Q2KA 3T5FH 2JDID 2F9VA 2XBXA 4E05H 1ZTKA 2G5VA 4OS2A 4LZ4B 2THFB 5A0BA 1ZSLA 3RU4T 3BTFE 3KGPA 4DVAU 3I29A 1C1TA 1SHYA 2PUQH 1O3NA 3O8DA 4X1SU 3BG4B 1VJ9U 1EFRD 1LPGB 2BQ7B 2WPDD 4ABHA 3ZVAA 5TCCA 2HNTF 1MTVA 1TX6A 2Y81A 1IQGA 4CREA 3F68H 3RUOA 2ZCHP 1SLWB 1ORFA 1WBGB 1P2QA 1EATA 3MU5A 1DXWA 4XBBA 1IQLA 1Z1IA 1UVOA 5FHTA 3NWUA 2AGGX 1QHRB 4Y79A 5JBTA 2VIPA 4RN6A 2ANYA 3SJOA 4I7YH 3A7VA 1K1IA 1YPGH 2ZU3A 1DLKB 1G36A 5G4BA
chains in the Genus database with same CATH topology
2XWAA 1OWJA 6LPRA 1GMHF 3GDUA 2BY5X 5K7RA 1ABJH 1FN6A 4ABGA 1SR5C 1Z8GA 1QR3E 5L6NH 1GBTA 1O38A 2CGAA 2FTLE 5SGAE 2BB4A 2BVSH 2H5DA 4Y71A 2QCYA 5DO4H 1AE5A 1YPEH 1QRZA 3S7HB 3FFGA 3GYLB 4NFEA 1H4WA 4KKDA 3TNTA 2FI3E 1C5NH 2J92A 2H6MA 2VIDA 3MHWU 4GHQA 5DK1A 1EPTB 1O5CB 3RXTA 4YT6H 3D62A 4MPUA 2BLWA 2RA0A 1ZHPA 3TK9A 3M3SA 1TNHA 1W14U 2BQWB 1C4U2 5DPAA 1AE8H 5T6FA 1L1JA 2ASUB 1OXGA 2LNCA 2BY7X 3ATKA 2XC4A 2Z9LA 1RTKA 2ZCKP 1G2LA 3TLOA 1D3DB 3EA9A 1Q31A 2O8WA 1GJ5H 3MMGA 3MO3A 1HUTH 5JB9S 2WV5A 4A5TS 1P02A 2QF3A 1G32B 1C2EA 2HNTE 1AUTC 4K69A 3SJ8A 1XUFA 9LPRA 1D6RA 2HALA 1LPZB 6CHAC 4FU7A 1GGDB 4R8TB 1ELEE 4BXWA 2WV4A 1DANH 2GKVE 9ESTA 4Y8XA 1EQ9A 2GCTC 2PV9B 1O32A 2JETC 3RLWH 1V2KT 3LONA 1UK3A 4ZHLU 2A2XH 1C9TA 4WH6A 1KTTB 3SJIA 4DGJA 4MNXA 4UFGH 1A5IA 5CMXH 2BY6X 3M7QA 4DIHH 1GJ8B 1RXPA 1V2JT 3RMOH 4BAHB 1HJ9A 4INKA 1O5AB 3LJJA 2K1QA 2ZNKH 1D3TB 1BHXB 3KQDA 2VVVA 4MPWA 2P3UB 3RXCA 1O0DH 2TGPZ 1EOLA 3QLPH 3SU0A 2G51A 1CBWB 2NU3E 2ZGCA 2ODPA 1VJAU 5EG4A 4JYVH 4U2WA 2AERH 3LGUA 4E7RG 5LPEA 3BEFB 1XVMA 1YM0A 2BXUH 2C8ZB 5TJXA 1D3PB 3Q77A 2AMQA 2ZFQH 1HIAB 1UCYH 2FI4E 1SGIB 2HPQH 2G5NA 1T4VH 2ZDMA 2VGCC 2W7SA 1AUJA 3BEUA 1PJPA 3K9XB 4I31A 1NY22 2J4IA 1CHGA 4DCDA 1O5GH 3KQCA 2CHAC 4FXGH 1ZRKA 3TPIZ 4ZXYH 4FU8A 1TALA 3BTQE 3T62A 3U1IB 1OP2A 2SNVA 3VB7A 2XC0A 3ENSB 3A88A 4MNVA 5EU8A 4BTUB 5C1UA 1NRRH 4WF8A 2ZFTA 4FUDA 1C5VA 3S69A 4ISNA 3S9BA 2ZFRH 4D8NA 4WMEA 1TYNA 2GTBA 2Z3CA 1FDPA 1QURH 1AMHA 2VIWA 1SGNE 2OC1A 4YLQH 1THRH 1O3GA 2C8YB 5I46H 3H7OA 1GDUA 1P10A 4H4FA 3A7WA 4MNYA 4WMFA 1A1RA 1NRSH 2I6SA 2D2DA 1ZPCA 1VCWA 3TJOA 4B2BA 3LC3A 1XX9A 1OWKA 4R0IA 5TCAA 1P2OA 5FXLA 4K1TA 1MQ6A 1JMOH 1E0FD 2QF0A 1A3BH 4XDEA 3A7ZA 3MO9A 1BOQA 1TA6A 2A5IA 2YNBA 3A8AA 4KP0A 1BQYA 1SQOA 3QK1A 4JZ1A 4HI3A 4Y10E 5L2YH 2ZP0H 1UTKA 1UVUH 3RDZA 2QXIA 1AFEH 1P9UA 1SG8B 1P2MA 1E34B 1QFKH 1ELGA 1ZZZA 1UHBB 4ZMAH 2NU4E 2J9NA 3ZZBA 2ZTXA 1NO9H 2FM2A 2BDYA 2FESH 3DT0H 2FOMB 2XC5A 1LCYA 2UUFB 4X8SH 1G3DA 1GJDB 3GY6A 3TJUA 1UMAH 1SB1H 1TB6H 3EA7A 1BBRE 1AVGH 3VGCC 1FONA 2CXVA 3FAOA 1N6YA 3LIWA 1FAKH 1O5FH 1L2EA 1EUFA 4UONA 1Y8TA 1BTPA 1LHGH 3P92A 2VNTA 4TY7A 4I8HA 1WSSH 1MU6B 3ZZAA 1KXAA 1C9PA 1NRNH 3B8JA 5ESTE 4MG3A 2F91A 2VWOA 3GCTG 3DD2H 2ZHEH 1C2DA 4B76A 1GBDA 4OS4A 5F8XA 2BMGB 1TAWA 1E35B 3PWBA 1C5ZB 1YCPH 1A3EH 2OTVA 3TITA 1QA0A 3UQOA 4DY7B 1SGFG 1XUGA 2H2ZA 1EOJA 4X1PU 5EXNA 4GCHG 1Y3YA 2Y6TA 1C1RA 2FWWA 1SMFE 1KLJH 1LPKB 2ZTYA 3F9FA 2ZFPH 4NGAH 5FBEA 3ODDA 2W26A 1WV7H 2FZZA 3V12A 3OX7U 3QUMP 3MNSA 4VGCC 2PSYA 4X6MA 1ELCA 1OWIA 1TMBH 3SU1A 3A81A 2OD3B 1E37B 1G3EA 2A0QB 4U32A 5J4SA 1SGDE 1T8OA 1XXFA 5DG6A 5A8XA 3M5MA 2ZCLP 2SGEE 3OY6U 1L4DA 1GVKB 2ZGHA 1P2KA 2A32A 3MYWA 1C2LA 1OP0A 1GBMA 1P57B 1GHVH 3MH7A 4CRDA 1QTFA 2Z7FE 1IQEA 1P2JA 2H1UA 3RXKA 1SSXA 1WU1A 3UR6A 4KTUA 1GMHG 3ESTA 1HAVB 2HRVA 2F3CE 4FUEA 2A7JA 3ZZ3A 2PWXA 3A7XA 3RXSA 2D1JA 1DITH 2A5KA 1BIOA 1MUEB 1T8NA 1QRWA 1HGTH 1O3AA 2VWLA 3DUXH 4X1QU 1FMGA 3MH6A 3KNXA 2KAIA 4THNH 2GDDA 1BA8B 3MNXA 1UTOA 2ZA5A 3ZZ4A 1IQFA 1XKAC 3UUZA 1ZMNA 1NPMA 1JBUH 2HLCA 2HVXA 3B9FH 3AVZA 4B2CA 2Q6FA 1CVWH 2ZQ1A 1FLEE 4ZKOU 4BTTB 3RXMA 1PPHE 2VJ1A 1VZQH 4WMDA 3A8DA 1GHYH 2EA3A 1ELTA 1NC6A 2GVFA 1Q3XA 5GWZA 4K1SA 2GZ8A 1HAYB 1J8AA 3GCNA 1V2TT 2VWNA 3GY5A 4D9RA 1TE0A 1P9SA 2ODQA 4FUFA 3VXEH 2BDIA 1P2IA 5HYOA 3UTUH 1GBHA 3SUFA 2B7DH 1B5GH 1OOKB 1K1NA 3T27A 3SU3A 3KEEA 1GBEA 3SV2H 3MOCA 4F4OC 4X2XA 1O2OA 2TGTA 1C1MA 1YPKH 1AY6H 1ZOMA 3AAUA 1CSOE 1SGYE 1UJ1A 4TYDA 4AFSA 4PROA 1TA2A 5C20A 5JB8S 1TGNA 1WTHD 3OYPA 1WQSA 1A5GH 2OXSA 3RXHA 1P0SH 3UNQA 3ZVBA 3DFLA 1AKSB 3DHKH 1DY9A 1L1NA 1HBTH 1QJ6B 2OQUA 2P3TB 1TBZH 2P3FH 3SUDA 1HLTH 2WINI 1W12U 4SGBE 2GCTB 4KGAA 1Z6JH 3F1SB 1GJ7B 1Q2WA 1D4PB 3T29A 1XVOA 1TGSZ 4X1NU 3GYMA 1OP8A 1F5LA 3SV8A 3OTJE 1V2WT 2UWLA 3T25A 4DOQA 1HAHH 1ZLRA 2JKHA 2AYWA 3K6YA 4MLFB 1L1GA 1YPMH 2PKAA 1KIGH 4ZKSU 4DT7B 1YC0A 5A8ZA 4IC5A 1W7GH 3TH4H 2W3IA 1W3CA 1FUJA 3ZZDA 1GJAB 3ATIA 5ESBA 3GY7A 4I32A 1O5EH 1Y3UA 4UFEH 1EX3A 3MWIU 1BRCE 3FANA 1JXPA 1N8OB 3URDA 1Z8IB 2VH0A 2BY9X 4WVPE 5GXPA 1WYKA 1IQJA 1EXFA 1TNJA 2ZFFH 4IN2A 2QGRA 4KTSA 1C1WH 2VH6A 1LVBA 3FVFB 4NIYA 3TVJB 1CA0B 1EZQA 1UTQA 1ESBA 3SQHE 4DURA 4GAWA 3TJVA 5AF9H 3HK6B 1LKBA 2VGCB 1C1PA 3U8TH 4K3JA 3BV9B 1PPCE 2QC2A 1F92A 1OS8A 3B23B 3EE0B 4ZKRU 4D7FA 3UOUA 4A92A 1HJAB 2A4OA 3MO6A 1HXFH 1CT2E 3M3TA 1GBLA 1O3KA 1ZMJA 2B9LA 3GISB 3LH3A 4CHAC 1O2QA 1GMDF 1F7ZA 4UE7H 3GCTF 4NWLA 4OGYA 2D8WA 2F9OA 2C4FH 4BAKB 4HGCA 2ANWA 1AB9C 4TWWA 5JBAS 1ESTA 2BZAA 2ULLA 1NRPH 3LU9B 4YLUA 3KIDU 2XNIA 4AB9A 4GCHF 3SHAH 3VB6A 3SBKA 3PO1C 3SGAE 1TX7A 4H42U 5HM2A 4CRBA 1IQKA 3TJNA 3PLPA 1UCYK 1T8MA 1P3CA 1GBJA 5AFYH 2FMJA 2EI6A 2ZHFH 4CRFA 1RTFB 1TPOA 1HB0B 2BLOA 5DJ7A 1T32A 1CHOF 1GL0E 1DWDH 1XUHA 4TWYA 4O3UA 4BNRA 1ID5H 4ZHAA 1P06A 2IPHA 1TGCA 1EZSC 1DXPA 1BTYA 2AGIX 1O2ZA 3RXVA 2BOHB 1Y3XA 2VB0A 1O2SA 2ZPSA 1QB1A 2V6NA 1TOCB 1JOUB 2PR3A 3MU4A 1G3BA 4ISLA 1XUIA 5J4QA 1NFUA 1C1OA 1H8IH 1UO6A 2GV6A 3ITIA 3ZZ6A 1GJCB 3PLBA 2BZ6H 1V2MT 2Z9IA 3SNAA 1BB0B 2WPKS 4CR5A 3I77A 3Q00A 5FX5A 2ZTZA 4X6PA 4ZROA 4IW4E 2QXHA 5EPNA 4FUCA 3ZZ5A 2OINA 3PM3A 1NN6A 2HWLB 5C5NA 2AMDA 1KXDA 1GG6B 1AU8A 1GBCA 1KSNA 1QA7A 2V35A 2ZKSA 3U1JB 1O2TA 1LMWB 1SI5H 4NSYA 3LGYA 3VPKA 1V2ST 3D23A 1CO7E 1C2FA 1GHZA 1C1QA 2PLXA 3PYHA 3SHCH 3W95A 2FYQA 5F6MA 3QWCH 1OX1A 4CBNA 1TPPA 4ZXXH 1O2XA 4Q7XA 3K2UA 2Z94A 3BN9A 1AHTH 1S83A 2J94A 1AQ7A 1O31A 2TPIZ 3RXEA 3VGCB 2BQ6B 3H5CB 5JBCS 2WUBA 3TGIE 2AGEX 3NZIA 1SGTA 1DUEA 1HRTH 3PTBA 5CE1A 1K21H 4WY3A 1D3QB 4LZ1H 3IITA 1PPFE 1A2CH 5DP6A 1IQIA 2F9UA 7LPRA 5CHAB 3SNEA 3M3VA 5GCHF 3CS7A 3FZDA 1O3PB 1CT4E 4MPXA 1KXFA 1YPJH 4ABEA 1CGJE 4NG9H 3U69H 1GBFA 2FX4A 1HAOH 5C2ZA 1ZSKA 1PYTC 2A31A 4YOIA 1BMMH 3VB3A 1MD7A 5FPTA 1EJAA 2G55A 1SVPA 2FEQH 1YF4A 1SC8U 1PQAA 3BEIB 2NU0E 3LJOA 3UR9A 3SUEA 1J15A 2OC7A 2ZC9H 3RC4A 5E0HA 1BDAA 2Y80A 3SU4A 3OSYA 1HPGA 2ODYB 2GMTB 4VGCB 3U9AH 2FOEA 1GMCG 2DE9A 2XWBI 3LC5A 5FCRA 2BDGA 3STIA 1BMLA 1QJ1B 1PPEE 1ZPBA 4ZHMU 1NTPA 1GI6A 4BTIB 5A09A 1O39A 5EQQA 1G30B 5EODA 3SUGA 1HAIH 1TRNA 3L3TA 4NZQA 1GHWH 5AHGH 1VR1H 1MKXH 3FZZA 2G00A 3UWJH 1EJMA 2ZU2A 1QBOA 1YCPK 2P93A 1AFQC 2PGBB 3CS0A 2QIQA 4Y8YA 2BLQA 5DP7A 2PSXA 4JZDH 1N1LA 2H9HA 4NWKA 4MPVA 1IQNA 3SU5A 2ZDNA 2C3SA 3E0PB 2P59A 5FBIA 1QL7A 1QNJA 1O5BB 1WAYB 3ZVCA 1AIXH 3MU8A 5LPRA 2G52A 1ZYOA 4XSKU 1GHAG 4OGXA 3GCHB 1FY1A 1GBKA 3M61U 2H9EH 1ELDE 1DSUA 1O2LA 1FY5A 1BJVA 1QCPA 2ZFSA 1BTUA 1C1SA 3QGNB 8LPRA 1O2PA 3F9GA 1IAUA 1GHXH 1C1UH 3F9HA 1MAXA 3S9AA 4I33A 3ZVGA 3TK5A 1C5UA 3QTOH 1WUNH 2XW9A 3CENA 4OS5A 3S9CA 2WPMS 3BF6H 4YTAA 1P05A 1MCVA 1P01A 3UREA 2ZPRA 4ZH8A 3ZZ8A 1LO6A 4X2YA 3LGIA 1MTNC 1KXEA 1LVOA 8ESTE 3UPEA 1O2JA 2O8TA 1EP6A 2ZG0H 3Q3KA 1S81A 2BX4A 4AYVB 1O3LA 2V0BA 3S7KB 4AZ2B 4X8VH 2J95A 3SN8A 3TIUA 2OBQA 4FVDA 4UDWH 2ZQ2A 5JDUB 3ODFA 3RXIA 4IMZA 3A7TA 1SQAA 3NK8A 3V13A 3NUMA 2FOAA 2A7CA 1C5TA 1GL1A 3A82A 1Z71A 4J2YB 1EB1H 2OP9A 3MTYA 4K8YA 2W5EA 1TQ0B 1FY4A 4NIWA 2AH4X 3KQBA 3RLYH 3TGKE 2OCVB 1JRSA 2BHGA 3SU2A 1GI5A 1C1NA 4H6SB 3HGNA 2FTMA 3BTME 1ANDA 1V3XA 1UTJA 1Y59T 2FS9A 2R3UA 4CRAA 1W7XH 1YPHC 4JCNA 1MMJN 2PKSC 5EQSA 4A1TA 4AN7A 3WY8A 5E0JA 3RM0H 1BT7A 1WTGH 2BD5A 1ACBE 5C1YA 1AVXA 1EAWA 5EW2H 2A45B 3D65E 2SGAA 3I78A 4YESB 2QN5T 1TNLA 4NZLA 1OWEA 1SQTA 1DPOA 3M35A 5DP4A 4ZUHA 3UY9A 1ZHRA 1CGIE 4D76A 1C5WB 1O2KA 1QJ7B 1EPTC 5A0AE 2RG3A 4UEHH 2F9NA 3M5OA 3PMHB 3QN7A 1E36B 2FOGA 3Q76A 3GICB 1O33A 1OWDA 1O3EA 1GVLA 2XYAA 2G81E 1K9OE 2XBWA 1V2LT 3FP8E 3PMAB 3SO3A 1GMDG 3A84A 3TNSA 1DOJA 3SGQE 1JRTA 1HAPH 1SGCA 4YOGA 4X1RU 4X6OA 1BBRH 3PROA 5E8EH 3RXUA 1QBVH 3TH3H 1QL9A 1IHSH 2Y7ZA 3HPTB 1C2HA 4CHAB 3Q3YA 1OWHA 3JZ1B 1QIXB 4IN1A 5I25A 1RRKA 3RXDA 3P6ZB 3A87A 1DFPA 1W0YH 2SFAA 1CHOG 5AFZH 4IC6A 4K2YA 1GI4A 1EAXA 2Z6BD 4I8LA 4ABJA 2OUAA 1HFDA 1V2NT 3RXPA 4GVUA 4RSPA 1ELBA 1UVSH 1Y3VA