3NWUA

Substrate induced remodeling of the active site regulates htra1 activity
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
204
structure length
190
Chain Sequence
DPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTTDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-induced remodeling of the active site regulates human HTRA1 activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine protease HTRA1
total genus 40
structure length 190
sequence length 204
chains with identical sequence B, C
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nwuA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nwuA02
1INCA 1AY6H 3L3TA 3FP7E 1DLEA 5DP6A 1HUTH 3LIWA 2F83A 4DOQA 1EAWA 8ESTE 2VWLA 3ENSB 1BRAA 4IMZA 1XUGA 1T8OA 1XUHA 3SNDA 1O5FH 3TH4H 1DWBH 2VB0A 1NU7B 3M5MA 1DVAH 1YM0A 3OY6U 5E0GA 3TJVA 1CHOF 3M36A 4IW4E 4ZUHA 1YPHE 1Z8RA 1VITG 3Q3KA 1JRSA 3EA8A 3TIUA 1K22H 3QTOH 5IDKA 1BTYA 1S0QA 2GMTC 4H6TA 1ZLRA 4WMEA 1D3DB 1S83A 4AZ2B 2H5CA 3PLPA 1P2JA 2BY6X 1P05A 3QZRA 1MU6B 2A7CA 1Z1JA 3U8OH 3A7TA 3GCNA 2BDAA 1O5DH 2PKSB 1OWEA 1P09A 2QGRA 4MG3A 3T62A 5A09A 4WH6A 3UNQA 2GP9B 4FU7A 1K9OE 3GCTF 2XXLA 3BEUA 2HWLB 1SLUB 5I46H 3KIDU 4BTIB 1UTQA 2M5TA 1EB1H 1O2QA 2PV9B 4PROA 1A0HB 3P8FA 1AVWA 3A8CA 3KQDA 4X6OA 1T32A 3EDXB 1A61H 1UK4A 2C8WB 4X6NA 4INHA 2AMDA 1DUEA 1AZZA 1O3LA 4WWYA 3DUXH 4NSVA 1V2RT 1Z8IB 3QX5H 1W10U 4DT7B 3F9HA 1V2ST 1Y59T 1GBJA 1QB9A 2EA3A 3SO3A 1XVOA 2H5DA 1FPHH 2R0LA 1CHGA 5LGOA 1C5QA 1O3NA 2ZDAH 1HB0B 1S6HA 2GDEH 3RXMA 1TA2A 4ABFA 2G81E 4MPUA 3BTTE 1RXPA 5JBBS 5A0CA 4LOYH 1FONA 5DKMA 2KAIA 3RU4D 1TE0A 3U9AH 2F91A 1T8NA 3E6PH 2WINI 1PJPA 2BB4A 2G51A 2OD3B 1HAGE 1GJAB 3LDXH 1AI8H 1TOMH 1LQDB 2BDIA 1XM1A 5EXLA 3LJJA 2PUXB 3FVFB 1T4VH 3HKJB 2BVXH 1P11E 2XCFA 3D23A 4JK5A 4X2XA 1ZMJA 5GWZA 2UUYA 3ATWA 4AG2A 1F0TA 3F9GA 2OC8A 3W95A 1EUFA 5J4SA 2BOKA 1CQQA 5ETXA 2FOBA 4FUHA 1BJVA 3BF6H 3ZVDA 5T3HA 1VGCB 2A4RA 2CXVA 1LHCH 2UWOA 2H6MA 1C1QA 1A5IA 1W11U 5HYOA 1VZQH 1SOZA 4X1SU 4ZKNU 1C5NH 1RGQA 3LGIA 6GCHG 4TPIZ 2ZFPH 5FBIA 3T2NA 2OC7A 2FLRH 2SNWA 2FOFA 2ALVA 2OC0A 2WV5A 1NM6A 1TX6A 3SJKA 1AFQC 4AORA 1ZHMA 2Z3DA 3SU2A 1SLWB 1SC8U 2UUKB 1FUJA 3D62A 1A5GH 2VU8E 1KLIH 2ZCLP 3LJOA 3P92A 2ZTZA 1AN1E 3S7HB 1BRBE 2FMJA 2W3IA 1GBDA 8GCHG 1PQ7A 1C5RA 2R0KA 3T25A 1TNKA 1BMAA 4MLFB 4GLYA 1TMBH 4AN7A 3S0NA 1DOJA 1C5XB 2ZHQH 3GISB 2CF8H 2PUQH 1KY9A 1SSXA 1GHAG 3QUMP 1ARCA 1IQKA 2D1JA 2HGTH 2ZFTA 3FAOA 1SG8B 1QBNA 4SGBE 1SBWA 1AU8A 2ZDKA 2XWBI 4U01A 1O2ZA 5GCHG 1XKBC 2P95A 4GCHG 5EQRA 3BTGE 4FVBA 1BUIA 4NA9H 4ISNA 1PFXC 1ETRH 1O2NA 2GCHF 3RDZA 7ESTE 1C2KA 3ZV8A 1CGHA 1H9LB 1LHDH 2ZO3H 1BTWA 3P8GA 1Q31A 2CHAB 4Q7YA 2C93B 1A0LA 3T29A 1DWCH 2WPHS 1T7CA 3TPIZ 1IQLA 4SGAE 1GBKA 3T27A 1NN6A 1RD3B 2Z3CA 3GICB 3VFEA 3MO6A 1TPOA 1TGBA 3RC5A 3UFAA 4X8TH 1HAVB 3RXVA 2PTNA 3ELAH 4KGAA 1P03A 1UCYE 2BDBA 1HFDA 1SGFA 3GDVA 1BRCE 4I32A 4A1VA 5SGAE 1SGIB 1YP9A 1B0EA 2PKSC 1EPTB 1V2UT 3TVJB 3BEIB 3LH3A 3TK5A 3MU4A 5F8ZA 1LCYA 2AEIH 1FY5A 2BD5A 3T26A 3SU6A 3TU7H 1A1RA 3BG8A 2FI5E 3MH5A 2ZU4A 2ZECA 4YZUA 2HOBA 1AMHA 5FX6A 2OC1A 5GIBA 1UCYH 1DPOA 1MBQA 4CRAA 8KME2 3MNBA 2B9LA 2A2QH 3SGAE 1W0ZU 1GHBF 1O5GH 4FUIA 5FCKA 1MTWA 2Y5GA 1Z8JB 4K8BA 2HNTF 1EPTA 2FTLE 1FAXA 1OXGA 1GI2A 2ZF0H 3RXSA 3I78A 1C2JA 1ESBA 3UUZA 1K1MA 1P57B 1C5YB 2BQWB 4JMYA 1D3PB 1TQ7B 2A1DB 2HVXA 1Y3VA 4B73A 1DITH 2YOLA 5EXNA 1ELVA 1GI1A 2A5KA 1BT7A 3RU4E 1HAPH 3BIVH 1FNIA 2B5TB 3UQOA 1HIAB 1L1NA 4BTUB 2O9QA 3SU0A 1O3PB 1GDUA 3ATIA 3SU1A 5CHAB 1QURH 3DD2H 2Z9KA 1L1JA 2P8OC 1G3DA 2RDLA 1FDPA 2BLWA 4E7NA 3VB3A 1L2EA 3LU9B 1O3JA 5JBTA 4CBOA 3SV7A 5E2OA 2D26C 2C3SA 3K6ZA 1G2LA 1WYKA 1HLTH 1GBLA 1CT0E 3GCTG 1P12E 1TX7A 1RTKA 2IOTA 1V2QT 3LGTA 1E37B 2ZFSA 4Y71A 3S9CA 5C20A 4CRCA 2OXSA 1ZHRA 2BD3A 4WXVA 5FPSA 3NXPA 1BITA 7GCHG 1IHSH 1HV7A 3A82A 1SFIA 4CH2B 2PKAA 3QZQA 2QY0B 3B8JA 3E0PB 3HK3B 2ZGBH 3ZV9A 1CBWB 1SGEE 4AGJA 5K0HA 4NIVA 3A83A 1FV9A 4B76A 1GMDF 3AAVA 4AFZA 1EAXA 4ABAA 6CHAC 4K69A 4NZLA 1AB9C 1UTOA 2BX4A 2BOHB 1YPGH 1GI8B 5L6NH 1YPLH 2GVFA 4CRBA 4MNWA 3RLWH 4GHQA 1KXEA 1GCTC 3A8DA 1N6XA 1GG6B 1LKBA 1C5MD 4JYUH 1C1PA 1NZQH 3QTVH 1GJ5H 1C5ZB 3M5OA 4ISOA 2PW8H 2ODQA 4AG1A 2FPZA 2ZI2H 1ZHPA 3B9FH 1AHTH 1O2RA 4DJZB 1GGDC 1NFUA 5FPTA 1O36A 4YO9A 1BBRH 2BDCA 2GX4A 5JDUB 1RRKA 4OS4A 1O2LA 4HFPB 3UOPA 3K6YA 3U98H 1KXDA 2Z9GA 3MWIU 1UTJA 3R0FA 4UE7H 2O8WA 2ZTXA 2ZWLH 3SGQE 2TBSA 4TY7A 3A8BA 2C8YB 4UFFH 4ZKOU 3TJUA 3RXUA 6GCHF 1QB1A 4RKJB 4Y8ZA 2UUFB 3QN7A 1ZPBA 1ELDE 4I7YH 1C4Y2 5G4BA 4VGCB 3SGBE 1AVGH 3MTYA 5AFZH 2F3CE 4NFFA 1PQ8A 1JOUB 2XRCA 4ISIH 4WF8A 1DWEH 3JZ1B 2AERH 1NFXA 2VGCB 2Y80A 3UWIA 2I6SA 1M9UA 1FLEE 1QIXB 5EODA 3SHCH 3A7WA 1GCTB 1AQ7A 1CA0C 5F6MA 4GAWA 1ARBA 1AE8H 1YCPH 2OINA 1P9UA 2YNAA 2ZFFH 3ODDA 2JKHA 1EAIA 2XWAA 4AYYB 1AB9B 1V2OT 3HPTB 2STAE 4Q2KA 1D3TB 1F0RA 1MU8B 1Y5BT 3H7TA 1NC6A 1Y8TA 4XE4A 1H4WA 1TQ0B 1WQVH 3C1KA 5LPFA 1G36A 1LO6A 2F9OA 1K1LA 1MZDA 1SGFG 2BDHA 1SGQE 2BY5X 4GCHF 2C90B 3U1IB 2YNBA 2WV4A 1ETTH 3D65E 2V35A 4BTTB 1YLDA 5BRRE 1FZZA 1UVUH 2OBOA 2W3KA 3M3TA 3SNCA 3SNEA 5I25A 2ZC9H 1H8DH 3EQ0H 1QJ7B 1FMGA 1GBAA 1Y3UA 4DVAU 2AGIX 4Z0KA 1J8AA 1O3DA 2PLXA 4GVUA 5DP8A 4VGCC 2AH4X 3VPKA 2GZ8A 1DE7H 1ZRKA 2F9PA 4ZH8A 2C8ZB 2FYQA 3GY2A 1UK3A 1UO6A 4YOGA 1SR5C 5CHAC 4XBBA 1DXWA 3HK6B 2PWXA 2WPJS 1SGCA 1O2OA 5L2ZH 1G9IE 3E1XB 1SGRE 5FCRA 3S9AA 4F49A 1V2VT 1G3BA 1HAYB 1AWFH 1BDAA 3AW1A 3ZZ3A 1G3EA 5C5OA 3TLOA 2VIQA 1O3GA 4THNH 1FIZA 5HMAA 3DHKH 4Y8XA 1C5TA 4INLA 2VIPA 2BVSH 4WVPE 4ABDA 3MFJA 1O3MA 2FWWA 1V2PT 4MQAA 2TPIZ 1OYQA 2XC5A 2AMPA 3KNXA 5L30H 4X1RU 2WPMS 1ZMLA 4OGYA 1WCZA 1E0FD 3P95A 3A7VA 2ZDVH 6ESTA 1DWDH 3A86A 3F9EA 2Q1JA 1G32B 4X1QU 1ESAA 1S82A 1TBQH 4TPYA 4YESB 4D7GA 5CE1A 2O8TA 4NZQA 3V7TA 3DFJA 2NU0E 1P3CA 1O35A 1BTPA 4NA8A 1K21H 5B6OA 2XBXA 1YCPK 1S6FA 6LPRA 1GMHG 2W26A 3SV8A 1ZSKA 4Y0ZE 3AAUA 1W2KH 1ANEA 2XNIA 4Q7XA 2OCVB 4MPXA 2BX3A 2R2MB 2BD9A 2KAIB 1PYTC 2Y7ZA 3KN2A 3ATLA 1GG6C 1GI5A 1E34B 3GCHC 1UTMA 3RP2A 4X8UH 3PROA 3GY5A 1G2MA 1EXFA 1OP2A 3FANA 2AYWA 1O3BA 2J95A 2PSYA 3SV9A 1ZR0A 2HALA 1FIWA 2BXTH 3SBKA 4UDWH 2BD8A 4MNXA 1SGNE 2Q6DA 2XC0A 2NU4E 2TGAA 2RA0A 1GI4A 1VITF 3GDUA 7GCHF 2G00A 3SQEE 4AFQA 2P16A 3M7TA 1VCWA 4K2YA 2CMYA 4I8LA 1KXCA 4OS2A 1ZPZA 2NWNA 4A92A 4AB8A 4ABHA 1LHEH 1WSSH 4X1PU 3SI3H 1KXBA 1CGIE 1YGCH 2GD4B 3K65B 2Q6FA 1P2MA 2ZHWH 4O3TA 3SJOA 1FPCH 1JIRA 3PMBB 3QGNB 4NFEA 4X6MA 2G5NA 1K1PA 3QO6A 1BBRE 1EJMA 1H9IE 3BV9B 1QA0A 4WMFA 1MTVA 1FN8A 4Y6DA 1FY4A 1GJ9B 1OWJA 4LK4A 3KQCA 1BTZA 1EKBB 1C2FA 4MDSA 2GGVB 1EQ9A 3VXEH 1IQGA 3P6ZB 1L4DA 1OWIA 1V2NT 4K60A 4QT8C 4K8YA 4XBDA 4IMQA 1GI3A 4B2CA 1GI6A 1Z6JH 3SN8A 3U8TH 3BTFE 1DXPA 1EX3A 3LOXA 3P8OA 4AX9H 1RTFB 4R0IA 1HBTH 4CREA 7LPRA 1VCQA 1MH0A 3S9BA 2VWNA 1ANDA 2QAAA 4NCYA 1MKWH 1P01A 1ZTJA 2ANMH 1GI7B 3GY4A 2ZGHA 5LH8A 2CF9H 1UTNA 4ZXYH 2AGGX 2ZNKH 1O2HA 2A7HA 2AIPA 4IC5A 1QR3E 4O9VA 3ZVEA 4TWWA 4U32A 3MO3A 1XX9A 3E90B 1A4WH 1HAZB 1LPZB 1KXAA 1OP8A 1TBZH 3EYDA 3LGWA 5T6DA 1GBCA 4RKOB 5GXPA 1FQ3A 4B71A 1K1JA 1W7XH 1LPGB 1NRRH 4BXWA 3KCGH 2WUBA 4B1TA 2ZA5A 1GBMA 1SGTA 3A85A 1J16A 1P2NA 1QCPA 2PSXA 3ZVAA 1XUJA 1GJBB 3LH1A 1P3EA 1GJ6A 1HAHH 1Y3WA 1SHHB 2FI3E 3OX7U 3IITA 5EXMA 1LDTT 3VB4A 2EI7A 4BNRA 2B7DH 1AFEH 1G3CA 2ZHFH 1YCPM 3MO9A 3TJOA 4BOHA 5EW2H 3TNTA 4ZKSU 1YPKH 1F5RA 3O8DA 2GZ7A 3VB7A 1TPAE 3QGJA 3NCLA 2PTCE 3PYHA 1N8OB 4ZMAH 1O2VA 1MBMA 3BTEE 1OS8A 5DP3A 2ZU3A 4JZIA 1MD7A 2BYAX 1Q2WA 3U8RH 1EAUA 1O34A 1P2OA 1TONA 3RXBA 2GCHG 1SGYE 1HGTH 2XBYA 1HPGA 1ZYOA 1YYY1 1ZJDA 1TPPA 1VCPA 3MI4A 1GMHF 2Z9IA 4D9QA 1CA8B 1ZGIA 1KLJH 2NU2E 3DT0H 2BY8X 1V2LT 1ZRBA 1TNHA 1LVOA 2FX4A 4F4OC 4NA7A 1G30B 4FUDA 3F6UH 1Y3YA 2ZQ1A 1W12U 5DK1A 1O2YA 3CP7A 4O3UA 3B23B 3QK1A 1MTUA 1O33A 3URCA 4WMDA 2P8OB 2EEKA 2H9HA 1O3OA 5A0BA 1CU1A 3L33A 1IHTH 1SQTA 2ZCHP 1P04A 1S84A 1TNGA 2ZGCA 1CVWH 2AMQA 1L1GA 1TGCA 3A7ZA 3TH2H 1BJUA 3VGCC 2STBE 4X1NU 1C1TA 1QBVH 1LMWB 2FOCA 3OYPA 5C1YA 2DE9A 3BTWE 1O3FA 3TJNA 3MNSA 2DE8A 3HKIB 1HJ9A 5DP7A 1YLCA 4MVNA 4D7FA 2FXRA 2SFAA 3Q77A 2PHBA 1PQ5A 1AUTC 2CHAC 1IQIA 2FIRH 3ZZ6A 1CBWC 1PPFE 5PTPA 2WYGA 1MUEB 2VNTA 2BY9X 1ELAA 3LGYA 2VIVA 1WUNH 5GDSH 1EPTC 2BLOA 3ZZ4A 3URDA 3PWCA 2A4QA 2ASUB 3T5FH 2PKAB 2K1QA 1TFXA 1QL9A 1BHXF 4Y79A 2ZHEH 5C1UA 1O2PA 2ANWA 1DLKB 1EZSC 3OTJE 4R8TB 2H9TH 1ZTLA 1GCDA 2ZGJA 2B0FA 1XUIA 4DG4A 2QC2A 4OS6A 1WTHD 2QN5T 3BEFB 5JBAS 4NIWA 1TLDA 4BANB 3MNCA 1KDQA 3RXTA 4KTUA 1V2KT 4D9RA 1P06A 1GHZA 1DX5M 5ESTE 1FAKH 1HDTH 3V13A 3ZZCA 4JYTA 3CS0A 3A7YA 3S69A 4FUJA 4YLQH 3M7UA 1DDJA 2SGDE 1TAWA 1GMCG 2JH5D 3VGCB 4TYDA 2GZ9A 1EATA 1HJAB 2QXJA 4E05H 3PTBA 2OQ5A 3M7QA 1BQYA 1S81A 4Y8YA 1OWKA 2G52A 2O8UA 2VINA 3PB1E 3STJA 1NFWA 2H9EH 5TCAA 1H8IH 3M5LA 1AZ8A 3RMMH 3RXRA 1P2QA 2J34A 5C67A 1XXFA 3MH4A 3RXFA 3HGPA 5A0AE 1GL0E 4X8VH 4FUFA 1IQHA 1DICA 5DJ7A 3EAJA 1A2CH 1O3IA 3UIRA 4JZDH 1O2IA 1C5UA 3C27B 4MNVA 3UPEA 4D76A 3P70B 1BBRK 1ZTKA 5C1XA 2FOEA 4FUEA 4BAQB 2PR3A 1O2SA 2P3UB 2XBVA 3OU0A 9LPRA 1CO7E 1FN6A 4K1EA 3TNSA 3F9FA 1ESTA 1TOCB 2XTTB 1ELEE 2V3HH 1UVSH 1SHYA 4KELA 4BAKB 5J4QA 2OLGA 4K5ZA 1CE5A 2I6QA 4M7GA 4OS1A 4HI3A 1C1RA 1ZMNA 1UTLM 5HM2A 1DY8A 1UHBA 3BTME 3QWCH 3BTQE 3PO1C 2BD4A 4A7IB 3SORA 2RCEA 3RC6A 1QJ6B 4BAOB 1VJAU 1QNJA 1V3XA 1W14U 1DT2A 3GCOA 3ZZ9A 2FO9A 4YT6H 3RM2H 3U69H 4OGXA 1HXFH 3KQBA 1MKXH 4BAMB 4ZHLU 1BMLA 5E0HA 1HJAC 1QBOA 5DO4H 1THRH 2A2XH 2CGAA 2ANYA 1KIGH 4UFDH 5AF9H 1AUJA 2BM2A 5DP4A 2LPRA 2HRVA 2FZZA 3BTDE 2IPHA 2OTVA 1SLXB 4LXBH 3M61U 1L0ZA 4U2WA 3QLPH 5C3NA 3RXIA 3LPRA 1O2TA 3NPSA 3M35A 4JK6A 3ZVGA 2GT8A 1BMNH 2ZU2A 3PM3A 1GDQA 2VH6A 2Y6TA 3I77A 5JB9S 1QRXA 3RMLH 2BLVA 3LC3A 4MTBA 4ABBA 2JH0D 1NROH 3G01A 1SVPA 3KEEA 4K3JA 1LVMA 3RXAA 2QV1A 1GHBG 2WUCA 3O8RA 3Q3XA 1ZSJA 1UK2A 1WOFA 1ORFA 1C5VA 2Q6GA 1PPHE 1QB6A 5E0JA 1YPJH 2G5VA 2G4TA 2A31A 1ABIH 5FX5A 3ZZ5A 3A81A 2QA9E 1AKSA 1O2KA 5FAHA 3A84A 2VIOA 2GMTB 1C4V2 2ZDNA 5EG4A 3ESTA 4DGJA 5JBCS 3BG4C 3FZDA 2A32A 2SGEE 5FPYA 2C8XB 4MPVA 3I29A 2HPPH 1GJ4H 2RA3A 4FUGA 1NY22 3EE0B 2C4FH 2R3UA 2ZKSA 3MU8A 1FXYA 3E8LA 1XXDA 1C5PA 3FP6E 1S0RA 4FU9A 1QRZA 3HGNA 1Q3XA 2ANKH 2J4IA 1QTFA 1HRTH 2GCTB 2Z9LA 4DIHH 2P59A 2BZ6H 1F0UA 1W0YH 4KTCA 1O3KA 1TYNA 1O2XA 2FEQH 1YPHC 2Y81A 4DURA 2W7UA 1TRNA 4GSOA 1GL1A 4Q7ZA 1Y3XA 1BOQA 1GHXH 5TJXA 1TRYA 2XCNA 3SZNA 3ZYDA 1FI8A 4ABJA 2QCYA 2UWPA 2V6NA 1TBRH 1AD8H 4O97A 1P9SA 1YF4A 3MHWU 1C2HA 1O2JA 3SJIA 1O5BB 1QGFA 4A5TS 3LGVA 3SQHE 3SJ9A 1KTTB 3MU5A 1O32A 3Q76A 2FLBH 2ZG0H 2ZCKP 4I8GA 3GDSA 3SUFA 1K1IA 2V3OH 3LT3A 3BN9A 4H4FA 3VB5A 5F03A 2FM2A 5HGGA 1NPMA 2FODA 1RJXB 9ESTA 3D49H 3A7XA 1EOJA 2ZDMA 5T6GA 1EP6A 1J15A 4AGKA 1GWAA 1LVBA 2FOHA 1H1BA 1QL7A 2J2UA 4WJG2 1MZAA 2R9PA 4ZAEA 1CT4E 1VITH 1P2IA 2UWLA 3O8BA 3PLBA 1RTLA 1EOLA 4ZHMU 2F9NA 1BMMH 3BTKE 1WU1A 1BA8B 1A3BH 2H1UA 1OPHB 3AW0A 2A4GA 3E3TA 1D6RA 1P10A 1TNJA 2FS9A 4BAHB 1GI9B 3PLKA 1GPZA 5FHTA 1PPCE 2QIQA 2BQ7B 1DFPA 1E36B 1ANBA 1HAIH 4H6SB 1C5OH 2SGAA 2XC4A 1F92A 1EZXC 1SGDE 4CHAB 3TK6A 4X8SH 4AOQA 4X2YA 1W7GH 2VVUA 4LZ4B 1SLVB 1TMTH 1TX8A 3P17H 4FVDA 2RG3A 1SGPE 2QYIA 1WBGB 4Y10E 1P2KA 2ZP0H 1O0DH 1QJ1B 3RUOA 2VGCC 1GBTA 1HIAA 1ZOMA 1WV7H 1JMOH 1GMCF 3RM0H 1E38B 3UREA 1O31A 3SW2B 1O3CA 4AFSA 2NU1E 4BXSA 1P8VC 4MNYA 4FUCA 3PV4A 3RMNH 3RXEA 1IOEA 1IQNA 4Y0YE 1UVOA 2ZU5A 2VIWA 3GY8A 4IN2A 4XOJA 4Y7AA 1THPB 4CRGA 3ZYEA 1Z6EA 1GJCB 1ZSLA 5DP5A 2TGTA 2PGBB 3KF2A 1NS3A 3GCHB 3HATH 4ZXXH 4Z6AH 1N8OC 2FX6A 2VH0A 3ITIA 3VEQB 2AS9A 2ZHDA 5L2YH 3RXPA 1FY8E 1JBUH 2HNTE 4J2YB 1YPMH 2ZPQA 1CGJE 3ZVBA 1LQEA 1NRQH 1G37A 1S85A 4CHAC 4Y11E 4LZ1H 2ZIQH 2ILNA 1KYNA 4ABGA 1SB1H 1C5SA 1NT1A 1ZZZA 3AASA 3VB6A 3TITA 1GDNA 3GY6A 2WPLS 3GYLB 2ALPA 1KSNA 3PTNA 4E06H 5A8ZA 2OBQA 3KQEA 4IC6A 2THFB 1BCUH 1AKSB 2D8WA 1NRNH 2ZPRA 2ZZUH 1MCTA 2GDDA 4GPGA 3V0XA 5T6FA 1SQOA 3F1SB 1V2WT 2FOGA 1PYTD 2HLCA 3FFGA 1EJAA 1MKWK 2W7SA 2Y5HA 1TGNA 2FYRA 2TGDA 1LKAA 2FP7B 4K1SA 1Z71A 2R3YA 4FXGH 3SU5A 1FY1A 2WPKS 1GHWH 4YT7H 1EZUC 2J94A 5BPEA 3SUGA 4Q80A 1PPBH 4FU8A 1MAXA 1LVYA 2FTMA 4MPWA 1F7ZA 2JH6D 4DIIH 1O2WA 1ZGVA 2GV6A 3M5NA 5LPRA 1A5HA 2GCTC 4IS5A 2LNCA 2Y82A 4D8NA 5GCHF 2EC9H 1C1UH 1PPZA 4IGDA 4NWLA 5AVDA 3RU4T 1DS2E 1K28D 1QQ4A 1O3EA 3TGKE 5E2PA 4KKDA 4B2AA 3T28A 1O30A 2ZTYA 3GOVB 2SNVA 1SMFE 1IQEA 3PMAB 1Z8GA 2ZFQH 5EPNA 3LKWA 1TPSA 2A4OA 4TY6A 1A7SA 4Y76A 1XMNB 3U1JB 2CN0H 4U30A 2BY7X 1GJ7B 1P0SH 3E91A 1HJ8A 3UTUH 4X6PA 2B8OH 1TALA 3TH3H 2BDYA 2TIOA 1T8MA 1V6DA 1O38A 2VWMA 4HGCA 5EU8A 1YBWA 1MTSA 1B0FA 3EA7A 1EB2A 2Z9JA 3VXFH 3TK9A 1RS0A 4AB9A 1AO5A 1BTXA 5F8XA 1C2IA 2IJOB 4INKA 1MQ6A 2FOMB 4ABEA 1TNIA 2ESTE 1D3QB 1W3CA 1SPJA 1FJSA 4UONA 4JCNA 3TGIE 1A46H 3ZZBA 1SI5H 3NKKA 1RFNA 1W13U 3JZ2B 2BHGA 3UOUA 2WYJA 4ESTE 1TB6H 1N1LA 5ABWA 4GUXA 1J14A 4ASHA 3SV6A 3K9XB 1HAXB 1YC0A 2D2DA 2TGPZ 1JWTA 5C2ZA 1BIOA 1DY9A 2Z7FE 3LONA 3GYMA 8LPRA 3M3SA 1OOKB 1SQAA 4CRFA 1OWHA 4JZ1A 2A45B 4AFUA 1HYLA 3E0NB 3EA9A 4IBLH 1EP5A 1NRPH 4I33A 1GVLA 1HXEH 1THSH 1TNLA 1K1NA 2BLQA 4OS5A 3BIUH 2V0BA 5GPIB 3ATKA 5EPYA 1QL8A 2A7JA 1KLTA 1HCGA 1SFQB 1A0JA 1O37A 5A2MH 1DANH 1NO9H 2XYAA 1TMUH 2ZGXH 1LHFH 3M3VA 3RXHA 1DSTA 1UTKA 1T4UH 1WQSA 2CJIA 2QXIA 3RMOH 2Y5FA 3SU4A 1B5GH 1GI0A 4UD9H 5DGJA 3OSYA 5E8EH 3R3GB 5EQQA 3ZZ8A 5FBEA 1AWHB 4YLUA 1O39A 1LTOA 1QFKH 3KHVA 2OQUA 5ESBA 3A87A 4RSPA 4H42U 1GHYH 2BMGB 3ZZ7A 1C5WB 1GGDB 4I8KA 1VGCC 1MTNB 1O2GH 3RC4A 3MOCA 2A5AA 1TWXB 5C5NA 2Z3EA 1AVXA 1C5LH 4NGAH 3UQVA 2ULLA 3K2UA 2BZAA 3WY8A 1C1WH 3O8CA 2VJ1A 1GVZA 2ODYB 1GVKB 2BQ6B 1ELFA 1QA7A 2F9VA 3PO1B 4ISLA 1O5CB 2GT7A 1BTHH 5A8YA 4WXIA 1KXFA 1NFYA 3UR9A 1DUAA 4KP0A 1IQMA 2P3TB 4XDEA 1O5EH 3PWBA 1DM4B 4KTSA 1ELTA 3SUEA 2UUJB 4A1TA 1GMDG 2QXHA 4I8JA 3P8NA 1O5AB 5GJ4B 3SU3A 1AGJA 3ZVCA 1C1OA 1TGTA 1AFQB 1GHAF 2OP9A 3CENA 1L4ZA 3EGKH 1UHBB 3A89A 3MU0A 1WAYB 1K2I1 2DUCA 1LHGH 3M37A 3SOSA 2F9UA 5TCCA 4JZEH 5JB8S 2CV3A 1MMJN 4YOIA 1UJ1A 4ZHAA 1WTGH 5LPEA 1QHRB 3L6PA 2BD7A 1GBHA 4I8HA 4X0WU 4ZKRU 2ZFRH 4WH8A 1AIXH 1T31A 1MTNC 1Z7KA 3SJ8A 4JZFH 1C2GA 1ZPCA 3F68H 5AFYH 3UWJH 2H2ZA 3ATMA 3A8AA 1MD8A 2P93A 1BHXB 3MNXA 1XKAC 1UCYK 1VJ9U 2G55A 1F5LA 2FESH 1C1VH 1D6WA 2PFEA 1UVTH 2GKVE 4CR9A 4CR5A 2ODPA 1UVPA 1C2EA 2ZQ2A 1B7XB 1IAUA 2AFQB 3GY7A 3W94A 1KTSB 1V2MT 1XUKA 2P94A 2Y7XA 4OS7A 3RXQA 1P02A 3ODFA 2W5EA 1GHVH 6CHAB 5HM9A 3V12A 3NK8A 1JIMA 3BSQA 3RXLA 2AIQA 3RXKA 4E7RG 1U6QA 4B75A 4B2BA 4YM9A 2BVRH 4O03A 3H7OA 4UFEH 2ZU1A 2FDAA 5IYTA 3UR6A 1HNEE 1BZXE 1HAOH 5AHGH 2PGQB 5K7RA 1MQ5A 5FXLA 3S7KB 1ZJKA 3UY9A 2VWOA 2XW9A 1H9HE 1Y5UT 4X2WA 1C4U2 2AGEX 3CS7A 3OY5U 1OX1A 2EI6A 3DFLA 1ETSH 1C1SA 3RXGA 3STIA 2FS8A 5DG6A 3IG6B 4ISHH 3A80A 1PPGE 1CHOG 2BTCE 1GJDB 5F8TA 5CMXH 1W8BH 1XUFA 5EQSA 3NUMA 1TABE 2ZEBA 1QQUA 1S5SA 1NTPA 4WY3A 4XFQA 1E35B 3SI4H 1F2SE 2FOAA 2O8LA 3SUDA 1AE5A 1C2DA 1QRWA 1NRSH 2ZPSA 1EZQA 5A8XA 1NESE 4YOJA 5JYIA 2VVCA 3N7OA 3MH6A 1MAYA 4NSYA 4HZHA 3MMGA 4UEHH 4X2VA 3MH7A 1BRUP 4NIXA 1FY3A 1ABJH 5HXFA 2IN2A 1BB0B 2GV7A 3Q00A 2O8MA 1CA0B 4NWKA 4YTAA 3GY3A 2XBWA 2SGPE 1C1NA 1GBIA 3KGPA 3SHAH 1ACBE 2HPQH 2QF0A 3RLYH 4ABIA 1QY6A 1C9TA 5EOKA 1YPEH 3BTHE 1SOTA 2ZDLA 2G8TA 2BXUH 2R2WU 4AYVB 3UNSA 1D4PB 1CT2E 3QDZB 2NU3E 1J17T 4A1XA 5DP9A 1IQJA 1HAVA 2Z6BD 4FUBA 1ELCA 7KMEH 2TRMA 1BTUA 1RIWC 3MYWA 3RXOA 3IWMA 3ZVFA 4CBNA 3SNAA 3AVZA 4CH8B 1O2MA 1UTPA 3TGJE 3ZZAA 4RN6A 1OSSA 4A6LA 1V2JT 1ANCA 2WPIS 8GCHF 1K1OA 2JETB 3A88A 4CRDA 4XSKU 1A3EH 1F5KU 4K1TA 2QXGA 4HTCH 1JRTA 3KL6A 1C2LA 1OKXA 2Z94A 2EI8A 2A5IA 1ELGA 5EGMA 1IQFA 1CSOE 1F0SA 2F9BH 1NU9A 3UNRA 3LC5A 1TA6A 5DPAA 3SNBA 3RXCA 5JPMH 1J9CH 1ELBA 1MKXK 1EASA 1N6YA 3BG4B 1V2TT 1TRMA 4DCDA 4ZROA 2VVVA 1MCVA 4IN1A 1JXPA 1C2MA 4B74A 1KDQB 5EW1H 4JYVH 3E16B 1DSUA 1VR1H 2OUAA 1T8LA 1C1MA 2BD2A 3FP8E 4Y7BA 4DW2U 3Q3YA 4UFGH 3LGUA 3NWUA 3ZZDA 1TIOA 1O2UA 4XBCA 1PQAA 3MU1A 2SGQE 2P3FH 3H5CB 1GBEA 2JETC 1GBBA 3SV2H 3PMHB 2G4UA 2A0QB 1RIWB 1TGSZ 4I31A 1LPKB 4J1YA 4GHTA 3RXJA 3DA9B 1SL3A 1GJ8B 1OWDA 2VIDA 3FZZA 3V3MA 1Z1IA 1XVMA 1ID5H 2QF3A 2FI4E 2GTBA 1X7AC 1Y5AT 1C9PA 2SGFE 1GBFA 5H4IB 4NG9H 3RXDA 4DY7B 2J92A 1OYTH 2HNTC 3PMJA 1UMAH 2BDGA 3NZIA 2J38A 1O3AA 1EJNA 1D9IA 1PPEE 4NIYA 1OP0A 4TWYA 2J9NA 1O3HA 1YKTA
chains in the Genus database with same CATH superfamily
1INCA 1AY6H 3L3TA 3FP7E 1DLEA 5DP6A 1HUTH 3LIWA 2F83A 4DOQA 1EAWA 4Q63A 8ESTE 2VWLA 3ENSB 1BRAA 4IMZA 1XUGA 1T8OA 1XUHA 3SNDA 1O5FH 3TH4H 1DWBH 2VB0A 1NU7B 3M5MA 1DVAH 1YM0A 3OY6U 5E0GA 3TJVA 1CHOF 3M36A 4IW4E 4ZUHA 1YPHE 1Z8RA 1VITG 3Q3KA 1JRSA 3EA8A 4ASUD 3TIUA 1K22H 2PP6A 3QTOH 5IDKA 1BTYA 1S0QA 2GMTC 4H6TA 1ZLRA 4WMEA 1D3DB 1S83A 4AZ2B 2H5CA 3PLPA 1P2JA 2BY6X 1P05A 3QZRA 1MU6B 2A7CA 1Z1JA 3U8OH 3A7TA 3GCNA 2BDAA 1O5DH 2PKSB 1OWEA 1P09A 2QGRA 4MG3A 3T62A 5A09A 4WH6A 3UNQA 2GP9B 4FU7A 1K9OE 3GCTF 2XXLA 3BEUA 2HWLB 1SLUB 5I46H 3KIDU 4BTIB 1UTQA 2M5TA 1EB1H 1O2QA 2PV9B 4PROA 1A0HB 3P8FA 1AVWA 3A8CA 3KQDA 4X6OA 1T32A 3EDXB 1A61H 1UK4A 2C8WB 4X6NA 4INHA 2AMDA 1DUEA 1AZZA 1O3LA 2F4LA 4WWYA 3WWBA 3DUXH 4NSVA 1V2RT 1Z8IB 3QX5H 1W10U 3FOAA 3F9HA 4DT7B 1V2ST 1Y59T 1GBJA 1QB9A 2EA3A 3SO3A 1XVOA 2H5DA 1FPHH 2R0LA 1CHGA 5LGOA 1C5QA 1O3NA 2ZDAH 1HB0B 1S6HA 2GDEH 3RXMA 1TA2A 4ABFA 2G81E 4MPUA 3BTTE 1RXPA 5JBBS 5A0CA 4LOYH 1FONA 5DKMA 2KAIA 3RU4D 1TE0A 3U9AH 2F91A 1T8NA 3E6PH 2WINI 1PJPA 2BB4A 2G51A 2OD3B 1HAGE 1GJAB 3LDXH 1AI8H 1TOMH 1LQDB 2BDIA 1XM1A 5EXLA 4ACAA 3LJJA 2PUXB 3FVFB 1T4VH 3HKJB 1KMHB 2BVXH 1P11E 2XCFA 3D23A 4JK5A 4X2XA 1ZMJA 5GWZA 2UUYA 3ATWA 4AG2A 1F0TA 3F9GA 2OC8A 3W95A 1EUFA 1S6LA 5J4SA 2BOKA 1CQQA 5ETXA 2FOBA 4FUHA 1BJVA 3BF6H 3ZVDA 5T3HA 1VGCB 2WSSD 2A4RA 2CXVA 1LHCH 2UWOA 2H6MA 1C1QA 1A5IA 1W11U 5HYOA 1VZQH 1SOZA 4X1SU 4ZKNU 1C5NH 1RGQA 3LGIA 6GCHG 4TPIZ 2ZFPH 5FBIA 3T2NA 2OC7A 4F55A 2FLRH 2SNWA 2FOFA 2ALVA 2OC0A 2WV5A 1NM6A 1TX6A 3SJKA 1AFQC 4AORA 1ZHMA 2Z3DA 3SU2A 1SLWB 1SC8U 2UUKB 1FUJA 3D62A 1A5GH 2VU8E 1KLIH 2ZCLP 3LJOA 3P92A 2ZTZA 1AN1E 3S7HB 1BRBE 2FMJA 2W3IA 1GBDA 8GCHG 1PQ7A 1C5RA 2R0KA 3T25A 1TNKA 1BMAA 4MLFB 4GLYA 1TMBH 4AN7A 3S0NA 1DOJA 1C5XB 2ZHQH 3GISB 2CF8H 2PUQH 1KY9A 1SSXA 1GHAG 3QUMP 1ARCA 1IQKA 2D1JA 2HGTH 2ZFTA 4F48B 3FAOA 1SG8B 1QBNA 4SGBE 1SBWA 1AU8A 2ZDKA 2XWBI 4U01A 3N7DA 1O2ZA 5GCHG 5DN6D 1XKBC 3MQKC 2P95A 4GCHG 5EQRA 3BTGE 4FVBA 1BUIA 4NA9H 4ISNA 1PFXC 1ETRH 1O2NA 2GCHF 3RDZA 7ESTE 4FOUC 4B6FA 1C2KA 3ZV8A 1CGHA 1H9LB 1LHDH 5T1VA 1OHHD 2ZO3H 1BTWA 3P8GA 1Q31A 2CHAB 4Q7YA 2C93B 1A0LA 3T29A 1DWCH 2WPHS 1T7CA 3TPIZ 1IQLA 4SGAE 1GBKA 3T27A 1NN6A 1RD3B 2Z3CA 3GICB 3VFEA 3MO6A 1TPOA 1TGBA 3RC5A 3UFAA 4X8TH 1HAVB 3RXVA 2PTNA 3ELAH 4KGAA 1P03A 1UCYE 2BDBA 1HFDA 1SGFA 3GDVA 1BRCE 4I32A 4A1VA 5SGAE 1SGIB 1YP9A 1B0EA 2PKSC 1EPTB 1V2UT 3TVJB 3BEIB 3LH3A 3TK5A 3MU4A 5F8ZA 3KYFA 1LCYA 2AEIH 1FY5A 2BD5A 3T26A 3SU6A 3TU7H 1A1RA 3BG8A 2FI5E 3MH5A 2ZU4A 2ZECA 1YWUA 4YZUA 2HOBA 1AMHA 5FX6A 2OC1A 5GIBA 1UCYH 1DPOA 1MBQA 4CRAA 8KME2 3MNBA 2B9LA 2A2QH 3SGAE 1W0ZU 1GHBF 1O5GH 4FUIA 5FCKA 1MTWA 2Y5GA 1Z8JB 4K8BA 2HNTF 1EPTA 2FTLE 1FAXA 1OXGA 3DSOA 1GI2A 2ZF0H 3RXSA 3I78A 3PRBA 1C2JA 1ESBA 3UUZA 1K1MA 1P57B 1C5YB 2BQWB 4JMYA 1D3PB 1TQ7B 2KCPA 2A1DB 2HVXA 1Y3VA 4B73A 1DITH 2YOLA 2F43B 5EXNA 1ELVA 1GI1A 2A5KA 1BT7A 3RU4E 1HAPH 3BIVH 1FNIA 2B5TB 3UQOA 1HIAB 1L1NA 4BTUB 2O9QA 3SU0A 1O3PB 3DSGA 1GDUA 3ATIA 3SU1A 5CHAB 1QURH 2XOKD 3DD2H 2Z9KA 1L1JA 2P8OC 1G3DA 2RDLA 1FDPA 2BLWA 4E7NA 3VB3A 1L2EA 3LU9B 1O3JA 5JBTA 4CBOA 3SV7A 5E2OA 2D26C 2C3SA 3K6ZA 1G2LA 1WYKA 1HLTH 1GBLA 1CT0E 3GCTG 1P12E 1TX7A 1RTKA 2IOTA 1V2QT 3LGTA 1E37B 2ZFSA 4Y71A 3S9CA 5C20A 4CRCA 2OXSA 1ZHRA 2BD3A 4WXVA 5FPSA 3NXPA 1BITA 7GCHG 1IHSH 3WWFA 1HV7A 3A82A 1SFIA 3DCLA 4CH2B 2PKAA 3QZQA 2QY0B 3B8JA 3E0PB 3HK3B 2ZGBH 3ZV9A 1CBWB 1SGEE 4AGJA 5K0HA 4NIVA 3A83A 1FV9A 4B76A 1GMDF 3AAVA 4AFZA 1EAXA 4ABAA 6CHAC 4K69A 4NZLA 1AB9C 1UTOA 2BX4A 2BOHB 3GS9A 1YPGH 1GI8B 5L6NH 5KGOA 1YPLH 5FL7D 2GVFA 4CRBA 4MNWA 3RLWH 4GHQA 1KXEA 1GCTC 3A8DA 1N6XA 1GG6B 1LKBA 2KCOA 3F2GA 1C5MD 4JYUH 1C1PA 1NZQH 3QTVH 4DT4A 1GJ5H 1C5ZB 3M5OA 4ISOA 2PW8H 2ODQA 4AG1A 2FPZA 2ZI2H 1ZHPA 3B9FH 1AHTH 1O2RA 4DJZB 1GGDC 1NFUA 5FPTA 1O36A 4YO9A 1BBRH 2BDCA 2GX4A 5JDUB 1RRKA 4OS4A 1O2LA 4HFPB 3UOPA 3K6YA 3U98H 1KXDA 2Z9GA 3MWIU 1UTJA 3R0FA 4UE7H 2O8WA 2ZTXA 2ZWLH 3SGQE 2TBSA 4TY7A 3A8BA 2C8YB 4UFFH 4ZKOU 3TJUA 3RXUA 6GCHF 1QB1A 4RKJB 4Y8ZA 2UUFB 3QN7A 1ZPBA 1ELDE 4I7YH 1C4Y2 5G4BA 4VGCB 3SGBE 1AVGH 3MTYA 5AFZH 1MABB 2F3CE 4NFFA 1YLNA 1PQ8A 1JOUB 2XRCA 4ISIH 4WF8A 1DWEH 3JZ1B 2AERH 1NFXA 2VGCB 2Y80A 3UWIA 2I6SA 1M9UA 1FLEE 1QIXB 5EODA 3SHCH 3A7WA 1GCTB 1AQ7A 1CA0C 5F6MA 4GAWA 1ARBA 1AE8H 1YCPH 2OINA 1P9UA 2YNAA 2ZFFH 3ODDA 2JKHA 2KR7A 1EAIA 2XWAA 4AYYB 1AB9B 1V2OT 3HPTB 2STAE 4Q2KA 1D3TB 1F0RA 1MU8B 1Y5BT 3H7TA 1NC6A 4Z1MD 1Y8TA 4XE4A 1H4WA 1TQ0B 1WQVH 3C1KA 5LPFA 1G36A 1LO6A 2F9OA 1K1LA 1MZDA 1SGFG 2BDHA 1SGQE 2BY5X 4GCHF 1QZ8A 2C90B 3SZEA 3U1IB 2YNBA 2WV4A 1ETTH 2AHME 3D65E 2V35A 1FX0B 4BTTB 1YLDA 5BRRE 1FZZA 1UVUH 2OBOA 2W3KA 3M3TA 3SNCA 3SNEA 5I25A 2ZC9H 1H8DH 3EQ0H 1QJ7B 2KX4A 1FMGA 1GBAA 1Y3UA 4DVAU 1K0HA 2AGIX 4Z0KA 1J8AA 1O3DA 2PLXA 4GVUA 5DP8A 4VGCC 2AH4X 3VPKA 2GZ8A 1DE7H 1ZRKA 2F9PA 4ZH8A 2C8ZB 2FYQA 3GY2A 1UK3A 1UO6A 4YOGA 1SR5C 5CHAC 4XBBA 1DXWA 3HK6B 2HLDD 2PWXA 2WPJS 1SGCA 1O2OA 5L2ZH 1G9IE 3E1XB 1SGRE 5FCRA 3S9AA 4RT0A 4F49A 1V2VT 1G3BA 1HAYB 1AWFH 1BDAA 3AW1A 3ZZ3A 1G3EA 5C5OA 3TLOA 2VIQA 1O3GA 1WDIA 4THNH 1FIZA 5HMAA 3DHKH 4Y8XA 1C5TA 4INLA 2VIPA 2BVSH 4WVPE 4ABDA 3MFJA 1O3MA 2FWWA 1V2PT 4MQAA 2TPIZ 5GNDA 2EY4C 1OYQA 2XC5A 2VBCA 2AMPA 3KNXA 3OE7D 5L30H 4X1RU 2V7QD 2WPMS 1ZMLA 1BMFD 4OGYA 1WCZA 1E0FD 3P95A 3A7VA 2ZDVH 6ESTA 1DWDH 3A86A 3F9EA 2Q1JA 1G32B 4RT1A 1ESAA 1S82A 1TBQH 4TPYA 4X1QU 4YESB 4D7GA 5CE1A 2O8TA 4NZQA 5IK2D 3V7TA 2YMSB 4XD7D 3DFJA 2NU0E 1P3CA 1O35A 1BTPA 4NA8A 1K21H 5B6OA 2XBXA 1YCPK 1S6FA 1E1RD 6LPRA 1GMHG 2W26A 3SV8A 1ZSKA 4Y0ZE 3AAUA 1W2KH 1ANEA 2XNIA 4Q7XA 2OCVB 4MPXA 2BX3A 2R2MB 2BD9A 3VG8A 2KAIB 1PYTC 2Y7ZA 3KN2A 3ATLA 1GG6C 1GI5A 1E34B 3GCHC 1UTMA 3RP2A 4X8UH 3PROA 3GY5A 1G2MA 1EXFA 1OP2A 3FANA 2AYWA 1O3BA 2J95A 2PSYA 3SV9A 1ZR0A 2HALA 1FIWA 2BXTH 3SBKA 2M2AA 4UDWH 2BD8A 4MNXA 1SGNE 2Q6DA 2XC0A 2NU4E 2TGAA 2RA0A 1GI4A 1VITF 3GDUA 7GCHF 2G00A 3SQEE 4AFQA 2P16A 3M7TA 1VCWA 2YMSC 3FO8D 4K2YA 2CMYA 4I8LA 1KXCA 4OS2A 1ZPZA 2NWNA 4A92A 4AB8A 4ABHA 1LHEH 1WSSH 4X1PU 3SI3H 1KXBA 1CGIE 1YGCH 2GD4B 3K65B 2Q6FA 1P2MA 2ZHWH 4O3TA 3SJOA 1FPCH 1JIRA 3PMBB 3QGNB 4NFEA 2KCAA 4X6MA 2G5NA 1K1PA 3QO6A 1BBRE 1EJMA 1H9IE 3BV9B 1QA0A 4WMFA 5C0UA 1MTVA 1FN8A 4Y6DA 1FY4A 1GJ9B 1OWJA 4LK4A 3KQCA 1BTZA 1EKBB 1C2FA 4MDSA 3F2HA 2GGVB 1EQ9A 3VXEH 1IQGA 4M9FA 3P6ZB 1L4DA 1OWIA 1V2NT 4K60A 4QT8C 4K8YA 4XBDA 4IMQA 1GI3A 4B2CA 1GI6A 1Z6JH 3SN8A 3U8TH 3BTFE 1DXPA 1EX3A 3LOXA 3P8OA 4AX9H 1RTFB 4R0IA 1HBTH 3PV5A 4CREA 7LPRA 1VCQA 1MH0A 3S9BA 2VWNA 1ANDA 2QAAA 4NCYA 1MKWH 1P01A 1ZTJA 5EIYA 2ANMH 1GI7B 3GY4A 2ZGHA 4TT3D 5LH8A 2JIZD 5EJ1A 2CF9H 1UTNA 4ZXYH 2AGGX 2ZNKH 1O2HA 2A7HA 2AIPA 4IC5A 1QR3E 4O9VA 3ZVEA 4TWWA 4U32A 3MO3A 1VKYA 3N99A 1XX9A 3E90B 5CDFE 1A4WH 1HAZB 1LPZB 1KXAA 1OP8A 1TBZH 3EYDA 3LGWA 3AK5A 5T6DA 1GBCA 4RKOB 5GXPA 1FQ3A 4B71A 1K1JA 1W7XH 1LPGB 1NRRH 4BXWA 3KCGH 2WUBA 4B1TA 2ZA5A 1GBMA 1SGTA 3A85A 1J16A 1H8ED 1P2NA 1QCPA 2PSXA 3ZVAA 1XUJA 1GJBB 3LH1A 1P3EA 1GJ6A 1HAHH 1Y3WA 1SHHB 2FI3E 3OX7U 3H09A 3IITA 5EXMA 1LDTT 3VB4A 2EI7A 4BNRA 2B7DH 5CHBA 1AFEH 1G3CA 2ZHFH 1YCPM 3MO9A 3TJOA 4BOHA 5EW2H 3TNTA 4ZKSU 1YPKH 1F5RA 3O8DA 2GZ7A 3VB7A 1TPAE 3QGJA 2J98A 3NCLA 2PTCE 3PYHA 1N8OB 4ZMAH 1O2VA 1MBMA 3BTEE 1OS8A 5DP3A 2ZU3A 4JZIA 1MD7A 2BYAX 2EQNA 1Q2WA 3U8RH 1EAUA 1O34A 1P2OA 1TONA 3RXBA 2GCHG 1SGYE 1HGTH 2XBYA 1HPGA 1ZYOA 1YYY1 1ZJDA 1TPPA 5C17A 1VCPA 3MI4A 1GMHF 3OEHD 2Z9IA 4D9QA 1CA8B 1ZGIA 1KLJH 2NU2E 3DT0H 2BY8X 1V2LT 1ZRBA 1TNHA 3F3BA 1LVOA 2FX4A 4F4OC 4NA7A 1G30B 4FUDA 3F6UH 1Y3YA 2ZQ1A 1W12U 5DK1A 1O2YA 3CP7A 4O3UA 3B23B 3QK1A 1MTUA 1O33A 3URCA 4WMDA 2P8OB 2EEKA 2H9HA 1O3OA 5A0BA 5KEDA 1CU1A 3L33A 1IHTH 1SQTA 2ZCHP 1P04A 1S84A 1TNGA 2ZGCA 1CVWH 2AMQA 1L1GA 1TGCA 3A7ZA 3TH2H 2YMSD 1BJUA 3VGCC 2STBE 2W6JD 4X1NU 1C1TA 1QBVH 1LMWB 2FOCA 3OYPA 5C1YA 2DE9A 2XNDD 3BTWE 1O3FA 3TJNA 3MNSA 2DE8A 3HKIB 1HJ9A 5DP7A 1YLCA 4MVNA 5HIZA 4D7FA 2FXRA 2SFAA 2J97A 3Q77A 2PHBA 1PQ5A 1AUTC 2CHAC 1IQIA 2FIRH 3ZZ6A 1CBWC 1PPFE 5PTPA 2WYGA 1MUEB 2VNTA 2BY9X 1ELAA 3LGYA 2VIVA 1WUNH 5GDSH 1EPTC 2BLOA 3ZZ4A 3URDA 3PWCA 2A4QA 2ASUB 3T5FH 2PKAB 2K1QA 1TFXA 1QL9A 1BHXF 5EJLA 4Y79A 2ZHEH 5C1UA 1O2PA 2ANWA 1DLKB 1EZSC 3OTJE 4R8TB 2H9TH 1ZTLA 1GCDA 2ZGJA 2B0FA 1XUIA 4DG4A 2QC2A 4OS6A 1WTHD 2QN5T 3BEFB 5JBAS 4NIWA 1TLDA 4BANB 3MNCA 1KDQA 3RXTA 4KTUA 1V2KT 4D9RA 1P06A 1GHZA 1DX5M 5ESTE 1FAKH 1HDTH 3V13A 3ZZCA 4JYTA 3CS0A 3A7YA 3S69A 4FUJA 4YLQH 3M7UA 1DDJA 2SGDE 1NBMD 1GMCG 1TAWA 2JH5D 3VGCB 4TYDA 2GZ9A 1EATA 1HJAB 2QXJA 4E05H 3PTBA 2OQ5A 2WHXA 3M7QA 1BQYA 1S81A 4Y8YA 1OWKA 2G52A 2O8UA 2VINA 3PB1E 3STJA 1NFWA 2H9EH 5TCAA 1H8IH 3M5LA 1AZ8A 3RMMH 3RXRA 1P2QA 2J34A 5C67A 2CK3D 1XXFA 3MH4A 3RXFA 3HGPA 5A0AE 1GL0E 4X8VH 4FUFA 1IQHA 1DICA 5DJ7A 3EAJA 1A2CH 1O3IA 3UIRA 4JZDH 1O2IA 1C5UA 3C27B 4MNVA 3UPEA 4D76A 3P70B 1BBRK 1ZTKA 5C1XA 2FOEA 4FUEA 5EJZA 4BAQB 2PR3A 1O2SA 2P3UB 2XBVA 3OU0A 3U28C 9LPRA 4HG6A 1CO7E 1FN6A 4K1EA 3TNSA 3F9FA 1ESTA 1TOCB 2XTTB 1ELEE 2WZQA 2V3HH 4I86A 1UVSH 1SHYA 4KELA 4BAKB 2LELA 5J4QA 2OLGA 4K5ZA 1CE5A 2I6QA 4M7GA 4OS1A 4ZCNA 4HI3A 4RI0A 1C1RA 2L6OA 1ZMNA 1UTLM 5HM2A 1DY8A 1UHBA 3BTME 3QWCH 3BTQE 3PO1C 2BD4A 4A7IB 3SORA 2RCEA 3RC6A 1QJ6B 4BAOB 1VJAU 1QNJA 1V3XA 1W14U 1DT2A 3GCOA 3ZZ9A 2FO9A 4YT6H 3RM2H 3U69H 4OGXA 3OFND 1HXFH 3KQBA 1MKXH 4BAMB 4ZHLU 1BMLA 5E0HA 1HJAC 1QBOA 5DO4H 1THRH 2A2XH 3SYJA 2CGAA 4AC9A 2ANYA 1KIGH 4UFDH 5AF9H 1AUJA 2BM2A 5DP4A 2LPRA 2HRVA 2FZZA 3BTDE 2IPHA 2OTVA 1SLXB 4LXBH 3M61U 1L0ZA 4U2WA 3QLPH 5C3NA 3RXIA 3LPRA 1O2TA 3NPSA 3M35A 4JK6A 3UAIC 3ZVGA 2GT8A 1BMNH 2ZU2A 3PM3A 1GDQA 1WXRA 2VH6A 2Y6TA 3I77A 5JB9S 1QRXA 3RMLH 2BLVA 3W1EA 3LC3A 4MTBA 4ABBA 2JH0D 1NROH 3G01A 1SVPA 3KEEA 4K3JA 1LVMA 3RXAA 2QV1A 1GHBG 2WUCA 3O8RA 3Q3XA 1ZSJA 1UK2A 1WOFA 1ORFA 1C5VA 2Q6GA 1PPHE 1QB6A 5E0JA 1E1QD 1YPJH 2G5VA 2JJ1D 2G4TA 2A31A 1ABIH 5FX5A 3ZZ5A 3A81A 2QA9E 1AKSA 1O2KA 5FAHA 3A84A 2VIOA 2GMTB 1C4V2 2ZDNA 5EG4A 3ESTA 4DGJA 5JBCS 3BG4C 3FZDA 2A32A 2SGEE 5FPYA 2C8XB 4MPVA 3I29A 2HPPH 1GJ4H 2RA3A 4FUGA 1NY22 3EE0B 5KECA 2C4FH 2R3UA 2ZKSA 3MU8A 4Q4LA 1FXYA 3E8LA 5HIYA 1XXDA 1C5PA 3FP6E 1S0RA 3CNRA 4FU9A 1QRZA 2LP6A 3HGNA 1Q3XA 2ANKH 2J4IA 1QTFA 1HRTH 2GCTB 2Z9LA 4DIHH 2P59A 3OEED 2BZ6H 1F0UA 1W0YH 4KTCA 1O3KA 3PRDA 1TYNA 1O2XA 2FEQH 1YPHC 2Y81A 4DURA 2W7UA 1TRNA 4GSOA 1GL1A 4Q7ZA 1Y3XA 1BOQA 1GHXH 5TJXA 1EFRD 1TRYA 2XCNA 3SZNA 3ZYDA 1FI8A 4ABJA 2QCYA 2UWPA 2V6NA 1TBRH 1AD8H 4O97A 1P9SA 1YF4A 3MHWU 2KCYA 1C2HA 1O2JA 3SJIA 1O5BB 1QGFA 4A5TS 3LGVA 3SQHE 3SJ9A 1KTTB 3MU5A 1O32A 3Q76A 2FLBH 2ZG0H 2ZCKP 4I8GA 3GDSA 3SUFA 5C94A 1K1IA 2V3OH 3LT3A 3BN9A 4H4FA 3VB5A 5F03A 2FM2A 5HGGA 1NPMA 2FODA 1RJXB 9ESTA 3D49H 3A7XA 1EOJA 2ZDMA 5T6GA 1EP6A 1J15A 4AGKA 1GWAA 1LVBA 2FOHA 1H1BA 1QL7A 2J2UA 4WJG2 1MZAA 2R9PA 4ZAEA 3OAAD 1CT4E 1VITH 1P2IA 2UWLA 3O8BA 3PLBA 4TSFD 1RTLA 1EOLA 4ZHMU 2F9NA 1BMMH 3BTKE 1WU1A 1BA8B 1A3BH 1SQRA 2H1UA 1OPHB 3AW0A 2A4GA 3E3TA 1D6RA 1P10A 1TNJA 2FS9A 4BAHB 1GI9B 3PLKA 1GPZA 1UW7A 2L74A 5FHTA 1PPCE 2QIQA 2BQ7B 1DFPA 1E36B 1ANBA 1HAIH 4H6SB 1C5OH 2SGAA 1F92A 2XC4A 1EZXC 3DSPA 1SGDE 4CHAB 3TK6A 4X8SH 4AOQA 4X2YA 1W7GH 2KM0A 2VVUA 4LZ4B 3FKSD 1SLVB 1TMTH 1TX8A 3P17H 4FVDA 2RG3A 1SGPE 2QYIA 1WBGB 2KFWA 4Y10E 1SKYE 1P2KA 2ZP0H 1O0DH 1QJ1B 3RUOA 2VGCC 1GBTA 1HIAA 1ZOMA 1WV7H 1JMOH 1GMCF 3RM0H 1E38B 3UREA 1O31A 3SW2B 5DSFA 3EE7A 1O3CA 4AFSA 2NU1E 4BXSA 1P8VC 4MNYA 4FUCA 3PV4A 3RMNH 3RXEA 1IOEA 1IQNA 4Y0YE 1UVOA 2ZU5A 2VIWA 3GY8A 4IN2A 4OM9A 4XOJA 4Y7AA 1THPB 4CRGA 2HVYB 3ZYEA 1Z6EA 1GJCB 1ZSLA 5DP5A 2TGTA 2PGBB 3KF2A 2QF4A 1NS3A 3GCHB 3HATH 4ZXXH 4Z6AH 1N8OC 2FX6A 2VH0A 3ITIA 3VEQB 2AS9A 2ZHDA 5L2YH 3RXPA 1FY8E 1JBUH 2HNTE 4J2YB 1YPMH 2ZPQA 1CGJE 3ZVBA 1LQEA 1NRQH 1G37A 1S85A 2QE7D 4CHAC 4Y11E 4LZ1H 2ZIQH 2ILNA 1KYNA 1E79D 4ABGA 1SB1H 1C5SA 1NT1A 1ZZZA 3AASA 3VB6A 3TITA 1GDNA 3GY6A 2WPLS 3GYLB 2ALPA 1KSNA 3PTNA 4E06H 5A8ZA 2OBQA 3KQEA 4IC6A 2THFB 1BCUH 1AKSB 2D8WA 1NRNH 4P02A 2ZPRA 2ZZUH 1MCTA 2GDDA 4GPGA 3V0XA 5T6FA 1SQOA 3F1SB 5HKKD 1V2WT 2FOGA 1PYTD 2HLCA 3FFGA 1EJAA 1MKWK 2W7SA 2Y5HA 1TGNA 2FYRA 2TGDA 1LKAA 2FP7B 4K1SA 1Z71A 2R3YA 4FXGH 3SU5A 1FY1A 2WPKS 1GHWH 4YT7H 1EZUC 2J94A 5BPEA 3SUGA 4Q80A 1PPBH 4FU8A 1MAXA 1LVYA 2FTMA 4MPWA 1F7ZA 2JH6D 4DIIH 1O2WA 1ZGVA 2GV6A 3M5NA 5LPRA 1A5HA 2GCTC 3KYGA 4IS5A 2LNCA 2Y82A 4D8NA 5GCHF 2EC9H 1C1UH 1PPZA 4IGDA 4NWLA 5AVDA 3RU4T 1DS2E 4ACBA 1K28D 1QQ4A 1O3EA 3TGKE 5E2PA 4KKDA 4B2AA 3T28A 2JDID 1O30A 2ZTYA 3GOVB 2SNVA 1SMFE 1IQEA 3PMAB 1Z8GA 2ZFQH 5EPNA 3LKWA 1TPSA 2A4OA 4TY6A 3PV2A 1A7SA 4Y76A 1XMNB 3U1JB 2CN0H 4U30A 2BY7X 1GJ7B 3KQ5A 1P0SH 3E91A 1HJ8A 5C0TA 3UTUH 4X6PA 2B8OH 1TALA 3TH3H 2BDYA 2TIOA 1T8MA 1V6DA 1O38A 2VWMA 4HGCA 5EU8A 1YBWA 1MTSA 1B0FA 3EA7A 1EB2A 2Z9JA 3VXFH 3TK9A 1RS0A 4AB9A 1AO5A 1BTXA 5F8XA 1C2IA 2IJOB 4INKA 1MQ6A 2FOMB 4ABEA 1TNIA 2ESTE 1D3QB 1W3CA 1SPJA 1FJSA 4UONA 4JCNA 3TGIE 1A46H 3ZZBA 1SI5H 3NKKA 1RFNA 1W13U 3JZ2B 2BHGA 3UOUA 2WYJA 4ESTE 1TB6H 1N1LA 5ABWA 4GUXA 1J14A 4ASHA 3SV6A 3K9XB 1HAXB 3ZIAD 1YC0A 2D2DA 2TGPZ 1JWTA 5C2ZA 1BIOA 1DY9A 2Z7FE 3LONA 3GYMA 8LPRA 3M3SA 1OOKB 1SQAA 4CRFA 1OWHA 4JZ1A 2A45B 4AFUA 1HYLA 3E0NB 3EA9A 4IBLH 1EP5A 1NRPH 4I33A 1GVLA 1HXEH 2WV9A 1THSH 1TNLA 1K1NA 2BLQA 4OS5A 3F0PA 3BIUH 2V0BA 5GPIB 3ATKA 5EPYA 1QL8A 2A7JA 1KLTA 1HCGA 1SFQB 1A0JA 1O37A 5A2MH 1DANH 1NO9H 2XYAA 1TMUH 2ZGXH 1LHFH 3M3VA 3RXHA 1DSTA 1UTKA 1T4UH 1WQSA 2CJIA 2QXIA 3RMOH 2Y5FA 3SU4A 1B5GH 1GI0A 4UD9H 5DGJA 3OSYA 5E8EH 3R3GB 5EQQA 3ZZ8A 5FBEA 1AWHB 4YLUA 1YY3A 1O39A 1LTOA 1QFKH 3KHVA 2OQUA 5ESBA 3A87A 4RSPA 3UB0A 4H42U 1GHYH 2BMGB 3ZZ7A 1C5WB 1GGDB 4I8KA 1VGCC 1MTNB 1O2GH 3RC4A 3MOCA 2A5AA 1TWXB 5C5NA 3WW7A 2Z3EA 1AVXA 1C5LH 4NGAH 3UQVA 2ULLA 3K2UA 2BZAA 3WY8A 1C1WH 3O8CA 2VJ1A 1GVZA 4YXWD 2ODYB 1GVKB 2BQ6B 2OK5A 1ELFA 1QA7A 2F9VA 3PO1B 4ISLA 1O5CB 2GT7A 1BTHH 5A8YA 4WXIA 1KXFA 1NFYA 3UR9A 1DUAA 4KP0A 1IQMA 2P3TB 4XDEA 1O5EH 3PWBA 1DM4B 4KTSA 1ELTA 3SUEA 2UUJB 4A1TA 1GMDG 2J98B 2QXHA 4I8JA 3P8NA 1O5AB 5GJ4B 3SU3A 1AGJA 3ZVCA 1C1OA 1TGTA 1AFQB 1GHAF 2OP9A 3CENA 1L4ZA 3EGKH 2GJGA 1UHBB 3A89A 3MU0A 1WAYB 1K2I1 2DUCA 1LHGH 3M37A 3SOSA 2F9UA 5TCCA 4JZEH 5JB8S 1W0KD 2CV3A 1MMJN 4YOIA 1UJ1A 4ZHAA 1WTGH 5LPEA 1QHRB 2KZ4A 2BD7A 3L6PA 1GBHA 4I8HA 1W0JD 4X0WU 4ZKRU 2ZFRH 4WH8A 1AIXH 1T31A 1MTNC 1Z7KA 3SJ8A 4JZFH 1COWD 1C2GA 1ZPCA 3F68H 5AFYH 3UWJH 2H2ZA 3ATMA 3A8AA 1MD8A 2P93A 1BHXB 3MNXA 1XKAC 3FN8A 1UCYK 1VJ9U 2G55A 1F5LA 2FESH 2RFKC 1C1VH 1D6WA 2PFEA 1UVTH 3N7EA 2GKVE 4CR9A 4CR5A 2ODPA 1NBME 1UVPA 1C2EA 2ZQ2A 1B7XB 1IAUA 2AFQB 3GY7A 3W94A 1KTSB 1V2MT 1XUKA 2P94A 2Y7XA 4OS7A 3RXQA 1P02A 3ODFA 2W5EA 1GHVH 6CHAB 2RDEA 5HM9A 2V3MA 3V12A 3NK8A 1JIMA 3BSQA 3RXLA 2AIQA 3RXKA 4E7RG 1U6QA 4B75A 4B2BA 4YM9A 2BVRH 4O03A 5B6LA 3H7OA 4UFEH 2ZU1A 2FDAA 5IYTA 3UR6A 1HNEE 1BZXE 1HAOH 5AHGH 2PGQB 5K7RA 1MQ5A 5FXLA 3S7KB 1ZJKA 3UY9A 2VWOA 1H9HE 1Y5UT 2XW9A 4X2WA 1C4U2 2AGEX 3CS7A 3OY5U 1OX1A 2EI6A 3DFLA 1ETSH 1C1SA 3RXGA 3STIA 2FS8A 5DG6A 3IG6B 4ISHH 3A80A 1PPGE 1CHOG 2BTCE 4P00A 1GJDB 5F8TA 5CMXH 1W8BH 1XUFA 5EQSA 3NUMA 1TABE 2ZEBA 1QQUA 1S5SA 1NTPA 4WY3A 4XFQA 1E35B 3SI4H 1F2SE 2FOAA 2O8LA 3SUDA 1AE5A 1C2DA 2IPQX 1QRWA 1NRSH 2ZPSA 1EZQA 5A8XA 1NESE 4YOJA 5JYIA 2VVCA 3N7OA 3MH6A 3F0OA 1MAYA 2J5UA 4NSYA 4HZHA 3MMGA 3NRLA 4UEHH 4FETA 4X2VA 3MH7A 1BRUP 4NIXA 1FY3A 1ABJH 5HXFA 2IN2A 1BB0B 2GV7A 3Q00A 2O8MA 1CA0B 4NWKA 4YTAA 3GY3A 2XBWA 2SGPE 2K8IA 1C1NA 1GBIA 3KGPA 3SHAH 1ACBE 2QF0A 2HPQH 3RLYH 4ABIA 1QY6A 1C9TA 5EOKA 2W6ID 1YPEH 3BTHE 1SOTA 2ZDLA 2G8TA 2JJ2D 2BXUH 2R2WU 4AYVB 3UNSA 1D4PB 1CT2E 3QDZB 2NU3E 1J17T 3F2FA 4A1XA 5DP9A 1IQJA 1HAVA 2Z6BD 4FUBA 1ELCA 7KMEH 2TRMA 1BTUA 1RIWC 3MYWA 3RXOA 3IWMA 3ZVFA 4CBNA 3SNAA 3AVZA 4CH8B 1O2MA 1UTPA 3TGJE 3ZZAA 4RN6A 1OSSA 4A6LA 1V2JT 1ANCA 2WPIS 8GCHF 1K1OA 2JETB 3A88A 4CRDA 4XSKU 1A3EH 1F5KU 4K1TA 2QXGA 4HTCH 1JRTA 3KL6A 1C2LA 1OKXA 2Z94A 2EI8A 2A5IA 1ELGA 5EGMA 1IQFA 1CSOE 1F0SA 2F9BH 1NU9A 3UNRA 3LC5A 1TA6A 5DPAA 3SNBA 3RXCA 5JPMH 1J9CH 1ELBA 1MKXK 1EASA 1N6YA 3BG4B 1V2TT 4B6EA 1TRMA 1H8HD 4DCDA 4ZROA 2VVVA 1MCVA 2K0QA 4IN1A 1JXPA 1C2MA 4B74A 1KDQB 5EW1H 4JYVH 3E16B 1DSUA 1VR1H 2OUAA 1T8LA 1C1MA 2BD2A 3FP8E 4Y7BA 4DW2U 2WPDD 3Q3YA 4UFGH 2IJD1 3LGUA 3NWUA 3ZZDA 1TIOA 1O2UA 5F53A 4XBCA 2QF5A 1PQAA 3MU1A 2SGQE 2P3FH 3H5CB 1GBEA 2JETC 1GBBA 3SV2H 3PMHB 2G4UA 2A0QB 1RIWB 1TGSZ 4I31A 1LPKB 4J1YA 3OTPA 4GHTA 3RXJA 3DA9B 1SL3A 1GJ8B 1OWDA 2VIDA 3FZZA 3V3MA 1Z1IA 1XVMA 1ID5H 2QF3A 2FI4E 2GTBA 1X7AC 1Y5AT 1C9PA 2SGFE 1GBFA 5H4IB 4NG9H 3RXDA 4DY7B 2J92A 1OYTH 2HNTC 3PMJA 1UMAH 2BDGA 3NZIA 2J38A 1O3AA 1EJNA 1D9IA 1PPEE 4NIYA 1OP0A 4XRNA 4TWYA 2J9NA 1O3HA 1YKTA
chains in the Genus database with same CATH topology
1INCA 1AY6H 3L3TA 3FP7E 1DLEA 5DP6A 1HUTH 3LIWA 2F83A 4DOQA 1EAWA 8ESTE 2VWLA 3ENSB 1BRAA 4IMZA 1XUGA 1T8OA 1XUHA 3SNDA 1O5FH 3TH4H 1DWBH 2VB0A 1NU7B 3M5MA 1DVAH 1YM0A 3OY6U 5E0GA 3TJVA 1CHOF 3M36A 4IW4E 4ZUHA 1YPHE 1Z8RA 1VITG 3Q3KA 1JRSA 3EA8A 3TIUA 1K22H 3QTOH 5IDKA 1BTYA 1S0QA 2GMTC 4H6TA 1ZLRA 4WMEA 1D3DB 1S83A 4AZ2B 2H5CA 3PLPA 1P2JA 2BY6X 1P05A 3QZRA 1MU6B 2A7CA 1Z1JA 3U8OH 3A7TA 3GCNA 2BDAA 1O5DH 2PKSB 1OWEA 1P09A 2QGRA 4MG3A 3T62A 5A09A 4WH6A 3UNQA 2GP9B 4FU7A 1K9OE 3GCTF 2XXLA 3BEUA 2HWLB 1SLUB 5I46H 3KIDU 4BTIB 1UTQA 2M5TA 1EB1H 1O2QA 2PV9B 4PROA 1A0HB 3P8FA 1AVWA 3A8CA 3KQDA 4X6OA 1T32A 3EDXB 1A61H 1UK4A 2C8WB 4X6NA 4INHA 2AMDA 1DUEA 1AZZA 1O3LA 4WWYA 3DUXH 4NSVA 1V2RT 1Z8IB 3QX5H 1W10U 4DT7B 3F9HA 1V2ST 1Y59T 1GBJA 1QB9A 2EA3A 3SO3A 1XVOA 2H5DA 1FPHH 2R0LA 1CHGA 5LGOA 1C5QA 1O3NA 2ZDAH 1HB0B 1S6HA 2GDEH 3RXMA 1TA2A 4ABFA 2G81E 4MPUA 3BTTE 1RXPA 5JBBS 5A0CA 4LOYH 1FONA 5DKMA 2KAIA 3RU4D 1TE0A 3U9AH 2F91A 1T8NA 3E6PH 2WINI 1PJPA 2BB4A 2G51A 2OD3B 1HAGE 1GJAB 3LDXH 1AI8H 1TOMH 1LQDB 2BDIA 1XM1A 5EXLA 3LJJA 2PUXB 3FVFB 1T4VH 3HKJB 2BVXH 1P11E 2XCFA 3D23A 4JK5A 4X2XA 1ZMJA 5GWZA 2UUYA 3ATWA 4AG2A 1F0TA 3F9GA 2OC8A 3W95A 1EUFA 5J4SA 2BOKA 1CQQA 5ETXA 2FOBA 4FUHA 1BJVA 3BF6H 3ZVDA 5T3HA 1VGCB 2A4RA 2CXVA 1LHCH 2UWOA 2H6MA 1C1QA 1A5IA 1W11U 5HYOA 1VZQH 1SOZA 4X1SU 4ZKNU 1C5NH 1RGQA 3LGIA 6GCHG 4TPIZ 2ZFPH 5FBIA 3T2NA 2OC7A 2FLRH 2SNWA 2FOFA 2ALVA 2OC0A 2WV5A 1NM6A 1TX6A 3SJKA 1AFQC 4AORA 1ZHMA 2Z3DA 3SU2A 1SLWB 1SC8U 2UUKB 1FUJA 3D62A 1A5GH 2VU8E 1KLIH 2ZCLP 3LJOA 3P92A 2ZTZA 1AN1E 3S7HB 1BRBE 2FMJA 2W3IA 1GBDA 8GCHG 1PQ7A 1C5RA 2R0KA 3T25A 1TNKA 1BMAA 4MLFB 4GLYA 1TMBH 4AN7A 3S0NA 1DOJA 1C5XB 2ZHQH 3GISB 2CF8H 2PUQH 1KY9A 1SSXA 1GHAG 3QUMP 1ARCA 1IQKA 2D1JA 2HGTH 2ZFTA 3FAOA 1SG8B 1QBNA 4SGBE 1SBWA 1AU8A 2ZDKA 2XWBI 4U01A 1O2ZA 5GCHG 1XKBC 2P95A 4GCHG 5EQRA 3BTGE 4FVBA 1BUIA 4NA9H 4ISNA 1PFXC 1ETRH 1O2NA 2GCHF 3RDZA 7ESTE 1C2KA 3ZV8A 1CGHA 1H9LB 1LHDH 2ZO3H 1BTWA 3P8GA 1Q31A 2CHAB 4Q7YA 2C93B 1A0LA 3T29A 1DWCH 2WPHS 1T7CA 3TPIZ 1IQLA 4SGAE 1GBKA 3T27A 1NN6A 1RD3B 2Z3CA 3GICB 3VFEA 3MO6A 1TPOA 1TGBA 3RC5A 3UFAA 4X8TH 1HAVB 3RXVA 2PTNA 3ELAH 4KGAA 1P03A 1UCYE 2BDBA 1HFDA 1SGFA 3GDVA 1BRCE 4I32A 4A1VA 5SGAE 1SGIB 1YP9A 1B0EA 2PKSC 1EPTB 1V2UT 3TVJB 3BEIB 3LH3A 3TK5A 3MU4A 5F8ZA 1LCYA 2AEIH 1FY5A 2BD5A 3T26A 3SU6A 3TU7H 1A1RA 3BG8A 2FI5E 3MH5A 2ZU4A 2ZECA 4YZUA 2HOBA 1AMHA 5FX6A 2OC1A 5GIBA 1UCYH 1DPOA 1MBQA 4CRAA 8KME2 3MNBA 2B9LA 2A2QH 3SGAE 1W0ZU 1GHBF 1O5GH 4FUIA 5FCKA 1MTWA 2Y5GA 1Z8JB 4K8BA 2HNTF 1EPTA 2FTLE 1FAXA 1OXGA 1GI2A 2ZF0H 3RXSA 3I78A 1C2JA 1ESBA 3UUZA 1K1MA 1P57B 1C5YB 2BQWB 4JMYA 1D3PB 1TQ7B 2A1DB 2HVXA 1Y3VA 4B73A 1DITH 2YOLA 5EXNA 1ELVA 1GI1A 2A5KA 1BT7A 3RU4E 1HAPH 3BIVH 1FNIA 2B5TB 3UQOA 1HIAB 1L1NA 4BTUB 2O9QA 3SU0A 1O3PB 1GDUA 3ATIA 3SU1A 5CHAB 1QURH 3DD2H 2Z9KA 1L1JA 2P8OC 1G3DA 2RDLA 1FDPA 2BLWA 4E7NA 3VB3A 1L2EA 3LU9B 1O3JA 5JBTA 4CBOA 3SV7A 5E2OA 2D26C 2C3SA 3K6ZA 1G2LA 1WYKA 1HLTH 1GBLA 1CT0E 3GCTG 1P12E 1TX7A 1RTKA 2IOTA 1V2QT 3LGTA 1E37B 2ZFSA 4Y71A 3S9CA 5C20A 4CRCA 2OXSA 1ZHRA 2BD3A 4WXVA 5FPSA 3NXPA 1BITA 7GCHG 1IHSH 1HV7A 3A82A 1SFIA 4CH2B 2PKAA 3QZQA 2QY0B 3B8JA 3E0PB 3HK3B 2ZGBH 3ZV9A 1CBWB 1SGEE 4AGJA 5K0HA 4NIVA 3A83A 1FV9A 4B76A 1GMDF 3AAVA 4AFZA 1EAXA 4ABAA 6CHAC 4K69A 4NZLA 1AB9C 1UTOA 2BX4A 2BOHB 1YPGH 1GI8B 5L6NH 1YPLH 2GVFA 4CRBA 4MNWA 3RLWH 4GHQA 1KXEA 1GCTC 3A8DA 1N6XA 1GG6B 1LKBA 1C5MD 4JYUH 1C1PA 1NZQH 3QTVH 1GJ5H 1C5ZB 3M5OA 4ISOA 2PW8H 2ODQA 4AG1A 2FPZA 2ZI2H 1ZHPA 3B9FH 1AHTH 1O2RA 4DJZB 1GGDC 1NFUA 5FPTA 1O36A 4YO9A 1BBRH 2BDCA 2GX4A 5JDUB 1RRKA 4OS4A 1O2LA 4HFPB 3UOPA 3K6YA 3U98H 1KXDA 2Z9GA 3MWIU 1UTJA 3R0FA 4UE7H 2O8WA 2ZTXA 2ZWLH 3SGQE 2TBSA 4TY7A 3A8BA 2C8YB 4UFFH 4ZKOU 3TJUA 3RXUA 6GCHF 1QB1A 4RKJB 4Y8ZA 2UUFB 3QN7A 1ZPBA 1ELDE 4I7YH 1C4Y2 5G4BA 4VGCB 3SGBE 1AVGH 3MTYA 5AFZH 2F3CE 4NFFA 1PQ8A 1JOUB 2XRCA 4ISIH 4WF8A 1DWEH 3JZ1B 2AERH 1NFXA 2VGCB 2Y80A 3UWIA 2I6SA 1M9UA 1FLEE 1QIXB 5EODA 3SHCH 3A7WA 1GCTB 1AQ7A 1CA0C 5F6MA 4GAWA 1ARBA 1AE8H 1YCPH 2OINA 1P9UA 2YNAA 2ZFFH 3ODDA 2JKHA 1EAIA 2XWAA 4AYYB 1AB9B 1V2OT 3HPTB 2STAE 4Q2KA 1D3TB 1F0RA 1MU8B 1Y5BT 3H7TA 1NC6A 1Y8TA 4XE4A 1H4WA 1TQ0B 1WQVH 3C1KA 5LPFA 1G36A 1LO6A 2F9OA 1K1LA 1MZDA 1SGFG 2BDHA 1SGQE 2BY5X 4GCHF 2C90B 3U1IB 2YNBA 2WV4A 1ETTH 3D65E 2V35A 4BTTB 1YLDA 5BRRE 1FZZA 1UVUH 2OBOA 2W3KA 3M3TA 3SNCA 3SNEA 5I25A 2ZC9H 1H8DH 3EQ0H 1QJ7B 1FMGA 1GBAA 1Y3UA 4DVAU 2AGIX 4Z0KA 1J8AA 1O3DA 2PLXA 4GVUA 5DP8A 4VGCC 2AH4X 3VPKA 2GZ8A 1DE7H 1ZRKA 2F9PA 4ZH8A 2C8ZB 2FYQA 3GY2A 1UK3A 1UO6A 4YOGA 1SR5C 5CHAC 4XBBA 1DXWA 3HK6B 2PWXA 2WPJS 1SGCA 1O2OA 5L2ZH 1G9IE 3E1XB 1SGRE 5FCRA 3S9AA 4F49A 1V2VT 1G3BA 1HAYB 1AWFH 1BDAA 3AW1A 3ZZ3A 1G3EA 5C5OA 3TLOA 2VIQA 1O3GA 4THNH 1FIZA 5HMAA 3DHKH 4Y8XA 1C5TA 4INLA 2VIPA 2BVSH 4WVPE 4ABDA 3MFJA 1O3MA 2FWWA 1V2PT 4MQAA 2TPIZ 1OYQA 2XC5A 2AMPA 3KNXA 5L30H 4X1RU 2WPMS 1ZMLA 4OGYA 1WCZA 1E0FD 3P95A 3A7VA 2ZDVH 6ESTA 1DWDH 3A86A 3F9EA 2Q1JA 1G32B 4X1QU 1ESAA 1S82A 1TBQH 4TPYA 4YESB 4D7GA 5CE1A 2O8TA 4NZQA 3V7TA 3DFJA 2NU0E 1P3CA 1O35A 1BTPA 4NA8A 1K21H 5B6OA 2XBXA 1YCPK 1S6FA 6LPRA 1GMHG 2W26A 3SV8A 1ZSKA 4Y0ZE 3AAUA 1W2KH 1ANEA 2XNIA 4Q7XA 2OCVB 4MPXA 2BX3A 2R2MB 2BD9A 2KAIB 1PYTC 2Y7ZA 3KN2A 3ATLA 1GG6C 1GI5A 1E34B 3GCHC 1UTMA 3RP2A 4X8UH 3PROA 3GY5A 1G2MA 1EXFA 1OP2A 3FANA 2AYWA 1O3BA 2J95A 2PSYA 3SV9A 1ZR0A 2HALA 1FIWA 2BXTH 3SBKA 4UDWH 2BD8A 4MNXA 1SGNE 2Q6DA 2XC0A 2NU4E 2TGAA 2RA0A 1GI4A 1VITF 3GDUA 7GCHF 2G00A 3SQEE 4AFQA 2P16A 3M7TA 1VCWA 4K2YA 2CMYA 4I8LA 1KXCA 4OS2A 1ZPZA 2NWNA 4A92A 4AB8A 4ABHA 1LHEH 1WSSH 4X1PU 3SI3H 1KXBA 1CGIE 1YGCH 2GD4B 3K65B 2Q6FA 1P2MA 2ZHWH 4O3TA 3SJOA 1FPCH 1JIRA 3PMBB 3QGNB 4NFEA 4X6MA 2G5NA 1K1PA 3QO6A 1BBRE 1EJMA 1H9IE 3BV9B 1QA0A 4WMFA 1MTVA 1FN8A 4Y6DA 1FY4A 1GJ9B 1OWJA 4LK4A 3KQCA 1BTZA 1EKBB 1C2FA 4MDSA 2GGVB 1EQ9A 3VXEH 1IQGA 3P6ZB 1L4DA 1OWIA 1V2NT 4K60A 4QT8C 4K8YA 4XBDA 4IMQA 1GI3A 4B2CA 1GI6A 1Z6JH 3SN8A 3U8TH 3BTFE 1DXPA 1EX3A 3LOXA 3P8OA 4AX9H 1RTFB 4R0IA 1HBTH 4CREA 7LPRA 1VCQA 1MH0A 3S9BA 2VWNA 1ANDA 2QAAA 4NCYA 1MKWH 1P01A 1ZTJA 2ANMH 1GI7B 3GY4A 2ZGHA 5LH8A 2CF9H 1UTNA 4ZXYH 2AGGX 2ZNKH 1O2HA 2A7HA 2AIPA 4IC5A 1QR3E 4O9VA 3ZVEA 4TWWA 4U32A 3MO3A 1XX9A 3E90B 1A4WH 1HAZB 1LPZB 1KXAA 1OP8A 1TBZH 3EYDA 3LGWA 5T6DA 1GBCA 4RKOB 5GXPA 1FQ3A 4B71A 1K1JA 1W7XH 1LPGB 1NRRH 4BXWA 3KCGH 2WUBA 4B1TA 2ZA5A 1GBMA 1SGTA 3A85A 1J16A 1P2NA 1QCPA 2PSXA 3ZVAA 1XUJA 1GJBB 3LH1A 1P3EA 1GJ6A 1HAHH 1Y3WA 1SHHB 2FI3E 3OX7U 3IITA 5EXMA 1LDTT 3VB4A 2EI7A 4BNRA 2B7DH 1AFEH 1G3CA 2ZHFH 1YCPM 3MO9A 3TJOA 4BOHA 5EW2H 3TNTA 4ZKSU 1YPKH 1F5RA 3O8DA 2GZ7A 3VB7A 1TPAE 3QGJA 3NCLA 2PTCE 3PYHA 1N8OB 4ZMAH 1O2VA 1MBMA 3BTEE 1OS8A 5DP3A 2ZU3A 4JZIA 1MD7A 2BYAX 1Q2WA 3U8RH 1EAUA 1O34A 1P2OA 1TONA 3RXBA 2GCHG 1SGYE 1HGTH 2XBYA 1HPGA 1ZYOA 1YYY1 1ZJDA 1TPPA 1VCPA 3MI4A 1GMHF 2Z9IA 4D9QA 1CA8B 1ZGIA 1KLJH 2NU2E 3DT0H 2BY8X 1V2LT 1ZRBA 1TNHA 1LVOA 2FX4A 4F4OC 4NA7A 1G30B 4FUDA 3F6UH 1Y3YA 2ZQ1A 1W12U 5DK1A 1O2YA 3CP7A 4O3UA 3B23B 3QK1A 1MTUA 1O33A 3URCA 4WMDA 2P8OB 2EEKA 2H9HA 1O3OA 5A0BA 1CU1A 3L33A 1IHTH 1SQTA 2ZCHP 1P04A 1S84A 1TNGA 2ZGCA 1CVWH 2AMQA 1L1GA 1TGCA 3A7ZA 3TH2H 1BJUA 3VGCC 2STBE 4X1NU 1C1TA 1QBVH 1LMWB 2FOCA 3OYPA 5C1YA 2DE9A 3BTWE 1O3FA 3TJNA 3MNSA 2DE8A 3HKIB 1HJ9A 5DP7A 1YLCA 4MVNA 4D7FA 2FXRA 2SFAA 3Q77A 2PHBA 1PQ5A 1AUTC 2CHAC 1IQIA 2FIRH 3ZZ6A 1CBWC 1PPFE 5PTPA 2WYGA 1MUEB 2VNTA 2BY9X 1ELAA 3LGYA 2VIVA 1WUNH 5GDSH 1EPTC 2BLOA 3ZZ4A 3URDA 3PWCA 2A4QA 2ASUB 3T5FH 2PKAB 2K1QA 1TFXA 1QL9A 1BHXF 4Y79A 2ZHEH 5C1UA 1O2PA 2ANWA 1DLKB 1EZSC 3OTJE 4R8TB 2H9TH 1ZTLA 1GCDA 2ZGJA 2B0FA 1XUIA 4DG4A 2QC2A 4OS6A 1WTHD 2QN5T 3BEFB 5JBAS 4NIWA 1TLDA 4BANB 3MNCA 1KDQA 3RXTA 4KTUA 1V2KT 4D9RA 1P06A 1GHZA 1DX5M 5ESTE 1FAKH 1HDTH 3V13A 3ZZCA 4JYTA 3CS0A 3A7YA 3S69A 4FUJA 4YLQH 3M7UA 1DDJA