2GGVB

Crystal structure of the west nile virus ns2b-ns3 protease, his51ala mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
169
structure length
169
Chain Sequence
PKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWATTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords non-structural protein 2B
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase
total genus 30
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ggvB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ggvB01
3BIVH 3LGTA 1OP8A 3M7UA 1GBEA 4DG4A 2G00A 1W7XH 4OS5A 1QJ6B 3LKWA 1Y59T 3MNBA 3V12A 4X2XA 4JZDH 4DOQA 4X1RU 4FU7A 7GCHF 2I6SA 3SYJA 1Y3XA 1AIXH 2BD9A 1GMDG 2Y80A 3UOPA 3RXTA 4DY7B 2XBXA 4Y71A 2BLWA 1KSNA 1ARCA 1P57B 2P94A 2PFEA 1ZLRA 4OS6A 6LPRA 1AD8H 1FMGA 4D8NA 1TNHA 1YLCA 1O3PB 1ZJDA 2ILNA 5DK1A 2WUBA 1MQ6A 1XX9A 1FAKH 3LH3A 4X6MA 3I29A 3BEIB 1TQ7B 3ZZBA 1F92A 2IPHA 4JK5A 1Z1JA 1FZZA 2WINI 1P10A 4AB9A 2Z3CA 1GBBA 4WJG2 1UTOA 2Z9GA 3BSQA 1ELCA 4FUGA 2BY6X 3A81A 3BTHE 1XUIA 1P2NA 1UK4A 1MTSA 4UDWH 4X8VH 3TJVA 2FOHA 1QB6A 3M36A 1GL0E 3TGIE 1QL9A 5A0AE 1C2IA 1BA8B 1K2I1 4IW4E 1GBTA 2Q6DA 2AFQB 1E34B 1GI8B 1GHBG 1O3BA 1Z6JH 3TNTA 3K6ZA 1YPHC 2BDYA 1P03A 3PV4A 4NA7A 1SGTA 3ODFA 4Z6AH 3PROA 1BTZA 4YO9A 1YCPM 1ELBA 1EAXA 2M5TA 4K8YA 2BX4A 3PV5A 1Y3YA 4FUIA 5EOKA 1O2GH 4BANB 3A80A 1O5BB 4D76A 1O3DA 1J16A 4NG9H 3MMGA 3F9GA 1SGFA 1AWFH 4AN7A 1N8OB 2ZU5A 1FV9A 7LPRA 1GI3A 4UEHH 2GTBA 3TGKE 2OLGA 2EI8A 2HGTH 5G4BA 3VB5A 1BMNH 3ATWA 1EP6A 3M5MA 3M7QA 4CRGA 1OSSA 3MOCA 1YPMH 3VB3A 1D4PB 7KMEH 3ZZ3A 1DX5M 1ZPZA 1TQ0B 3SI4H 1EZSC 2XBWA 4ISHH 4U01A 5HYOA 1BQYA 5C1XA 5L2YH 1EJNA 1RIWC 2A4QA 1H1BA 1L1NA 3BTKE 1C2LA 1ESBA 1N6XA 3UNQA 1NRRH 3UFAA 5GXPA 4Y6DA 4CBNA 1NN6A 3HK6B 2P3TB 2R2WU 1O39A 1HIAB 1BMLA 2ZCLP 2GCTC 2THFB 4BXWA 1NO9H 4VGCB 2R9PA 4H6SB 4J2YB 1AE5A 1CGJE 3A7WA 1TAWA 1AGJA 1O2OA 2ZPQA 4WH6A 1C2GA 1F7ZA 2VWNA 5L6NH 1IQFA 1NZQH 1O5AB 2XBVA 4NGAH 4LZ4B 5LPFA 1V2MT 3NPSA 4IN1A 1UTKA 1ZTLA 4CRBA 3QTVH 3SV9A 1UTQA 2G4UA 3TVJB 1T8OA 1UJ1A 2AEIH 3E0NB 4ZH8A 1GGDC 3MU0A 2QF3A 4NIWA 3FZDA 3N7OA 4FUFA 3BTDE 4NIXA 4BAMB 1P11E 1UK2A 4WWYA 2GCTB 1T4VH 1DSTA 1Y3WA 5T3HA 4CH8B 2FTMA 1WBGB 3PMBB 1O5EH 1O37A 4B6EA 3VXFH 1GI0A 1MD8A 3A7XA 5T6DA 1ZZZA 1PFXC 3URDA 3SU3A 2ODYB 2F9VA 2BOHB 1DY9A 1EZXC 3SQHE 1GWAA 2WYJA 3RXQA 3D62A 5FXLA 3ZVDA 2J92A 2Y6TA 1GHWH 2Y82A 1IQJA 2ALVA 3M5NA 5DP6A 5B6OA 5AFYH 1MCVA 4WXVA 4DVAU 3EA7A 4GCHF 4BAKB 1NFWA 3OTPA 1IAUA 4B73A 1QQ4A 4GPGA 1PJPA 3SI3H 5DPAA 3W94A 1LPGB 1WV7H 2XNIA 3GCOA 5JYIA 2QCYA 1O35A 1GBKA 3EE0B 4YOJA 2RA0A 2XYAA 4K69A 2B8OH 1GI4A 1GHAG 1GMHF 2UUFB 2ZG0H 3ODDA 1QR3E 2P3UB 3T28A 1AN1E 1GMCG 2QXHA 1BBRK 2PKSB 1AO5A 2ZF0H 1VCPA 1HAXB 1HJAC 1ZMJA 3P92A 1QCPA 3PO1C 3E1XB 3AVZA 3GY2A 1KDQA 1W10U 4ZAEA 5EXMA 3SUEA 1VGCC 1DWCH 3DT0H 4JZ1A 1T32A 1G3DA 4JYUH 4XDEA 4ZHLU 2F3CE 3RUOA 3H7TA 1PPHE 1ELAA 4UFEH 3D65E 5CHAC 3UWJH 4ABIA 1F0TA 1IQEA 1BJUA 1FDPA 3MTYA 4E7RG 1AVXA 2F9BH 1DLEA 1BMAA 1GJ7B 4MNVA 1GBDA 2OUAA 3RC5A 1SMFE 1EASA 1J15A 1G3CA 3O8CA 3PO1B 4B1TA 1L1JA 2W26A 3AASA 1MTNC 2BDCA 1VGCB 4BOHA 2TGTA 1G37A 1C1QA 2BYAX 4MNXA 2QF0A 1MKXH 4FUHA 4Y8YA 4OS2A 1HV7A 4FU9A 1W13U 5EPNA 1GJ9B 1GCDA 1VZQH 4IBLH 1SGIB 3PYHA 1W0ZU 1SHYA 4K2YA 3QN7A 2FPZA 4Y76A 2O8TA 5FX5A 1L4DA 1W11U 1Z8IB 4GLYA 1JBUH 2PGBB 1GI5A 1FXYA 4OS4A 1O3FA 3RXLA 1ESTA 3PLKA 2QA9E 4IC6A 5FPTA 4D7GA 3S0NA 3SUFA 1NPMA 1C2FA 4KELA 3SV8A 1PPEE 3GCHB 1JMOH 2RDLA 2VWMA 1LO6A 1HAOH 1AKSB 2B5TB 2BB4A 1GL1A 2P8OB 1MCTA 1SGFG 4ISOA 1CT0E 5E8EH 1DANH 4FU8A 1C1NA 3BTFE 2ZDAH 3E3TA 3OY6U 4HI3A 2D2DA 3KNXA 4X8SH 1ANDA 2GDEH 1MD7A 2HALA 3ATLA 4PROA 2GMTB 4CRDA 1ZJKA 1AI8H 2QYIA 2C8XB 1AHTH 2PTNA 1OWIA 4B74A 4ZKNU 2JH5D 1HFDA 2P95A 2PHBA 1FJSA 3ESTA 1LQEA 1ZYOA 5C5OA 1SQOA 3R0FA 1O3IA 5GCHG 1ANCA 1BDAA 1THSH 1A0LA 3ZZ7A 3TITA 1YC0A 2V35A 1SGQE 3DFLA 1GHBF 3U69H 3VGCC 3S69A 1AWHB 1TB6H 3ZZDA 3CS7A 3H7OA 2AGIX 3H09A 1LDTT 2HNTF 3SOSA 2NU0E 5FPYA 1GDNA 1HAHH 2BLVA 2AS9A 2AMDA 1O2VA 2BD2A 5EW2H 1H9LB 4NIYA 1FY4A 3M3TA 1H9HE 3HATH 1QIXB 4KTUA 4YT6H 3EAJA 3IITA 3BN9A 1C5VA 1QRXA 2KAIA 3TIUA 4CBOA 1F0UA 2ZDVH 2ZGJA 5DP9A 3BG4C 2DE9A 2QXIA 1EZUC 4DT7B 2A5KA 1DICA 2BM2A 2TPIZ 1VCQA 1C5LH 1C2DA 1W7GH 3KEEA 1KXFA 1RD3B 2BVSH 1TFXA 2GV7A 1CVWH 3SJIA 1YKTA 1GVLA 1O34A 2BLOA 3PWCA 1BTPA 2Q6FA 2XBYA 4MPWA 4X0WU 1H8DH 1EB1H 1QRWA 3V7TA 1C5OH 5F8XA 5DJ7A 1IOEA 2WUCA 3Q3KA 1K1PA 3BIUH 2F83A 2ZFQH 2EC9H 5A0BA 2AGGX 2ANMH 1O2XA 2ZHEH 2WHXA 3FP6E 1LQDB 1UCYE 1UHBA 2CF9H 1N1LA 3I77A 5DKMA 4O03A 1OWHA 1FUJA 1VJAU 1THRH 3NKKA 1JIMA 1LPKB 4Z0KA 1YCPH 1A4WH 3TK6A 4IC5A 4X2YA 5FCRA 2EA3A 2GP9B 2QC2A 2VWOA 1ANEA 1S82A 3KGPA 3T62A 4MG3A 1QHRB 2A0QB 3VB7A 2TGDA 3B23B 2BY5X 4UD9H 4ZKSU 8GCHF 3UWIA 5C3NA 5A8ZA 1AU8A 1KXEA 3GY8A 1TRYA 3TJOA 1AFQB 3CS0A 2BLQA 2QV1A 4QT8C 4B76A 3T25A 1D3TB 1GI9B 1HAPH 4NWKA 1MBMA 2LPRA 1UTPA 2BXTH 3LJJA 1PPGE 1OWEA 2ANYA 2YNBA 1P9UA 2GD4B 3KQBA 1C5PA 3RXIA 1V2NT 1O2WA 2ZKSA 1BB0B 1GJ6A 1GPZA 1CO7E 4MLFB 4B6FA 1ELEE 1CQQA 3GY4A 4IMQA 1GHXH 1W14U 1PQAA 4BAQB 1SLWB 1GVKB 5TJXA 1BZXE 1GBFA 2Z9KA 1SGPE 1UVPA 2CF8H 2WV4A 3K2UA 4Y0YE 3V3MA 4DCDA 1GG6B 1GCTC 1HLTH 2H9TH 4THNH 1JIRA 1V2OT 3P8NA 1PQ7A 2A7HA 2FOFA 1NRPH 5EQQA 2AYWA 3S9BA 4GVUA 2UUJB 3E6PH 4WF8A 1SGNE 1K9OE 2A7CA 5DGJA 3SJ9A 2JH0D 1C5YB 1NC6A 1CGHA 4CRAA 1AKSA 1O2PA 1ZPBA 3BF6H 1HDTH 3TK9A 2ZCHP 5CE1A 3GICB 4IGDA 3FVFB 1M9UA 1BRAA 3VEQB 1XXDA 1A46H 1BRCE 1DITH 1EJAA 1V2TT 1VITG 1XUHA 1C1MA 1GCTB 1GHAF 1QBOA 4Y8ZA 3ZVFA 1EP5A 4MNYA 4XBDA 5AHGH 5LGOA 1GMCF 2ZA5A 1C4U2 2WPMS 1C2MA 4K3JA 3P17H 2QY0B 1EOLA 1TGNA 5EU8A 1GJDB 1NU7B 4GSOA 5E2OA 3ZVEA 5A2MH 4JK6A 3RXPA 1TGCA 2VGCC 3PTNA 4O3TA 2FS9A 2ZTYA 3A7TA 3MFJA 2C93B 1ABIH 4LOYH 1G2LA 1RXPA 3SW2B 1Z6EA 1TOMH 1AQ7A 1IQLA 4Y0ZE 2C90B 1KXAA 4JZEH 3RXGA 2BD8A 1ABJH 1EUFA 1ETRH 2PUXB 2VU8E 3A84A 2XTTB 4JYTA 1T8NA 1DUAA 5GPIB 4B75A 3MO9A 2Q6GA 1P12E 1TLDA 4YOGA 1UK3A 4MPXA 1BOQA 3HK3B 5FHTA 3MU8A 5JB9S 2B9LA 1EX3A 1QFKH 2YNAA 4WMFA 5JDUB 5EODA 1FNIA 2VIQA 5FX6A 1TPAE 1K1MA 1O3CA 1V3XA 3FP7E 1SBWA 3U1IB 1HAGE 3ZVAA 2BD4A 1FQ3A 4TY7A 1YPKH 3AW0A 1ZPCA 1PQ8A 4XE4A 3RMOH 5T1VA 2FEQH 1E36B 2Z3EA 1DLKB 4YTAA 2R0KA 3OU0A 1UTMA 1UO6A 5FCKA 2H9EH 3PV2A 3SZEA 2QXJA 2W7SA 4XBBA 1KLTA 3OTJE 4RI0A 5JBTA 5T6FA 4NFFA 1GJAB 1CHOG 1CHGA 2VB0A 2Y7ZA 2C3SA 4I7YH 3GCNA 3L6PA 3ZZ4A 3L3TA 2FMJA 2ALPA 1GDQA 3GCTG 2IJD1 3SGAE 4KKDA 1P04A 3TU7H 4O9VA 1P2QA 1P3CA 5GNDA 1TYNA 3M5LA 4ZHMU 2PSYA 1CU1A 1HXFH 3SNEA 2XC4A 1P9SA 4OS1A 4Y79A 3A8DA 2GV6A 1A7SA 2NU1E 1AVGH 2ZHWH 2BY7X 3AAUA 2F9NA 1L4ZA 4AYVB 2NU2E 1HBTH 4CH2B 1PPCE 1XKBC 4INLA 1MBQA 1ELDE 5AFZH 2GX4A 5ABWA 4K5ZA 9LPRA 3KQDA 1S0QA 2WPIS 4RKJB 3BEUA 4A1XA 2J34A 4JZIA 2RCEA 5EW1H 4AG2A 1DSUA 4AFZA 3Q3YA 1LCYA 3EYDA 5IDKA 1TX6A 1W3CA 1GBLA 2TBSA 1QA7A 1HAVA 2IJOB 5DG6A 2V0BA 3SU5A 1IQKA 2F4LA 4MTBA 4Q7YA 1Z7KA 1C1VH 1Q2WA 5DO4H 1N6YA 3SUDA 1DWEH 2Z6BD 5C67A 1C2KA 3FANA 1WYKA 1C9PA 3QX5H 2FO9A 1O2NA 4FXGH 1IQHA 1TNKA 1G3EA 1EAIA 2PSXA 1HNEE 1BRUP 2SGPE 6GCHF 3SZNA 2ZTZA 1SGEE 2G5NA 3GY3A 1UVTH 3SUGA 1O3JA 1O2UA 4ABFA 5C1YA 1XVOA 2A4RA 1QY6A 4U30A 1SVPA 4Q7ZA 1S85A 3RXBA 1QGFA 2FOCA 3EDXB 1QURH 2TIOA 3KL6A 4UFFH 2A32A 2OQUA 3ENSB 5EXLA 4SGAE 3LPRA 1DDJA 3QGJA 3QO6A 5L2ZH 1C9TA 1O5GH 1UCYK 1BTWA 4FUBA 3MHWU 3U8TH 3LOXA 4K1TA 4X8UH 5EPYA 1ACBE 2ZDKA 4X2VA 1FN6A 1W12U 4AB8A 4I8JA 1ESAA 2VVVA 1RTKA 1TIOA 1RIWB 1SL3A 3ZZ9A 2V3OH 1QJ7B 1WXRA 2FLBH 1O3LA 2F9PA 1O3NA 3F9HA 2FYRA 1V2UT 1FY8E 1HB0B 1D3QB 1FPHH 2OINA 1YP9A 3SV6A 3OY5U 4A6LA 1QA0A 1F2SE 4TYDA 3RMNH 2P16A 3EA9A 2VJ1A 1ZMLA 3AK5A 1XUJA 4Q7XA 1ZGIA 1YM0A 2AMQA 2H9HA 1D3PB 3F68H 5T6GA 4IS5A 2OD3B 2XW9A 2WPLS 1J8AA 4ESTE 1GGDB 1O2IA 3LGVA 1C1OA 5HM9A 3BTQE 2ZFSA 2FOMB 2BOKA 2WYGA 1AB9C 2V6NA 4Y10E 3RXEA 1S83A 1KXCA 3QZRA 3QLPH 1GBMA 2J94A 1YPJH 1IQGA 2EI7A 4DIIH 5BPEA 3A89A 4AFSA 2D8WA 2OQ5A 2PLXA 2ZCKP 3A82A 1H9IE 2GKVE 1INCA 5EQRA 1P02A 2O8LA 3PMAB 1UVOA 2AMPA 1WTGH 3ATIA 1NS3A 1QL7A 2Z3DA 4OGXA 4M9FA 3SN8A 3QDZB 2D26C 3SHAH 4Y11E 3MYWA 1NU9A 3T5FH 1BUIA 3WY8A 4FUDA 5PTPA 2GDDA 1NROH 1BRBE 1AE8H 4OGYA 1C5ZB 4ZHAA 1O3EA 3UIRA 1JRTA 1LVOA 1JXPA 1SLXB 3ZVCA 1MKXK 4IMZA 4XBCA 2ZPRA 3PLBA 1O3OA 4TPYA 4WVPE 1G36A 4HFPB 1OWDA 2W3KA 1SB1H 3TJUA 1KTTB 1P09A 2G51A 1HPGA 1EQ9A 1IQMA 1SSXA 1VCWA 2CXVA 3U1JB 5JPMH 1D6RA 1HJAB 3RM0H 1C5QA 5DP7A 2TGPZ 1P2KA 2BQ6B 3S9AA 1C5NH 1GJBB 5GWZA 3A7VA 5DP3A 2ZDMA 1A5IA 1HRTH 2C8YB 3TPIZ 1ZTJA 3GDVA 5ETXA 2A5AA 5F8TA 1FPCH 5CHAB 1O3MA 2OCVB 3H5CB 2ZQ2A 1Z8JB 4LK4A 1GBAA 4K1EA 3T27A 1ELVA 3MU1A 3UQOA 1GMDF 4ZROA 1SPJA 4I32A 2Y7XA 4X1NU 2I6QA 1O32A 2H2ZA 1UMAH 1ZHPA 1X7AC 1XUKA 4X2WA 3SJKA 1P2JA 2A2QH 2PTCE 4JCNA 1WCZA 1MTNB 2SNVA 1HIAA 4AORA 1UTLM 2ASUB 1TWXB 1C2JA 3U9AH 4ABAA 1GI2A 4NFEA 1CHOF 1P05A 1O33A 1EPTC 1BT7A 4WH8A 3UNSA 1A0JA 4I31A 5A0CA 4JZFH 1E35B 1BITA 1TNJA 1Y8TA 1ZSLA 2ZFPH 1LHEH 1HYLA 1PPZA 3A8CA 1ZGVA 3RXKA 4R8TB 2ZPSA 3NXPA 3SGBE 4H6TA 1V6DA 1Y5AT 4GHTA 1TX7A 2FOBA 1GBCA 3F1SB 1K28D 1NFYA 1FI8A 1G3BA 2F9OA 1RS0A 1TNIA 2ANKH 5C2ZA 2G52A 1KY9A 1EPTB 3A85A 6ESTA 1O2ZA 1LPZB 3KHVA 4I8LA 3D49H 3VFEA 1V2VT 3NZIA 5J4QA 1P2IA 3VPKA 3E0PB 3RXCA 3QUMP 2XWAA 2OK5A 4TWWA 4H42U 2UUYA 3SBKA 4A7IB 2FX4A 2V3HH 2OC8A 4NA8A 4ABBA 1WTHD 1GHYH 1OOKB 1L2EA 7ESTE 2VVUA 4D7FA 4NSVA 2HLCA 1MTVA 5F8ZA 4M7GA 4U2WA 3RXSA 3LT3A 2FP7B 2RG3A 3UR9A 2H5CA 3VGCB 2BZ6H 4KP0A 3E8LA 1FAXA 1KTSB 1NTPA 3TH2H 4F4OC 1C4Y2 1ZRBA 3SU4A 2A7JA 1GBHA 2CHAC 1ZR0A 3ZZ6A 2IN2A 3C1KA 4MDSA 1HJ8A 4XOJA 4RSPA 5K7RA 2ZZUH 3LJOA 3S9CA 2BXUH 2OTVA 2JKHA 3U8OH 2ZHFH 1SOTA 1QRZA 2O8WA 2QGRA 3ZYDA 2AH4X 3T2NA 3P8OA 1A3BH 1HAZB 1CGIE 1D6WA 2Z9IA 1CBWC 5GJ4B 1O2MA 1OWKA 1XKAC 2FZZA 1XUFA 3BG4B 1OKXA 1S6FA 2BD5A 3OSYA 4O97A 1OS8A 1JRSA 2PW8H 1CT2E 4DW2U 1MTUA 1MZAA 2CHAB 1A1RA 3FFGA 2FX6A 1KXDA 1W0YH 1DE7H 2BX3A 3ZZCA 1O3GA 3P70B 2HNTE 5IYTA 1GJ8B 2G5VA 3M37A 4KTCA 1MU6B 2FI5E 4F49A 3DHKH 2Y5GA 1Y5UT 4MNWA 2Q1JA 2VIDA 1XM1A 1S84A 1MKWK 5H4IB 1TPSA 5HXFA 5GDSH 2A4GA 1TGBA 5I25A 1G2MA 2STBE 3NUMA 1NFUA 3ZVBA 1T8LA 4INHA 3RU4D 2SGDE 5LPEA 1B7XB 5F03A 3LONA 4X1PU 1C1PA 4RN6A 3PB1E 3RXJA 5JBCS 2A4OA 3RXFA 4Y8XA 3OX7U 4DGJA 3Q00A 2J38A 2ZU4A 3K9XB 3VXEH 2DUCA 2CMYA 3VB6A 1OWJA 4AGKA 1J9CH 4TY6A 2ESTE 1TA6A 1LKBA 2ZHDA 3M35A 4FVBA 3TK5A 2R3YA 3LU9B 1B5GH 4B2BA 1NM6A 5FBEA 2GVFA 3K65B 1SG8B 1UVUH 3MNSA 2W3IA 8LPRA 1B0EA 1LVMA 1QL8A 4MPUA 5AF9H 1ZOMA 4BTTB 1O3AA 1O3KA 1OYTH 1DXPA 2ZQ1A 1BTUA 1KLJH 4AG1A 1TMBH 2A2XH 3M3VA 1QJ1B 1TABE 1V2RT 3U98H 4X1SU 3S7HB 1H4WA 1L0ZA 3RXHA 5FAHA 4O3UA 1C5SA 2D1JA 1RFNA 3PMHB 3JZ2B 2QXGA 3IWMA 1K1IA 3KQCA 4GCHG 2BDBA 2FTLE 3ZV8A 4ABDA 1RJXB 2GZ7A 1MQ5A 1EAWA 2BY9X 1BTYA 3UQVA 1LMWB 4CHAC 1LVYA 2FOAA 5J4SA 5JBAS 4ZKRU 1F0SA 1V2WT 3KF2A 1P2OA 2LNCA 4I8HA 4AFQA 4YESB 3TGJE 6CHAC 3K6YA 1QBNA 3ZZAA 4NCYA 1OYQA 2FI4E 1O5FH 4AFUA 4A92A 1ANBA 2FS8A 1EZQA 2ZDLA 1ELFA 4RKOB 1UTNA 4UFDH 5TCAA 1WAYB 1HUTH 4DIHH 1T4UH 4NIVA 1DPOA 4ABJA 1OX1A 1WSSH 5K0HA 1GHZA 1DY8A 4A1TA 1PQ5A 3TH4H 2ZTXA 1SGDE 1HXEH 3PLPA 1VR1H 4JYVH 4NZLA 3CP7A 1GDUA 1XMNB 1SLVB 2VGCB 2O9QA 1C5TA 3LGWA 3A7ZA 3A83A 4NSYA 1LHCH 1KLIH 1YYY1 1ZHMA 1PYTC 1A5HA 1E0FD 4BTUB 2VIOA 1RGQA 3DFJA 1NRQH 1WUNH 5E0JA 3SORA 5EXNA 2ZC9H 3A8AA 3O8DA 4JMYA 2ZWLH 2A5IA 3P6ZB 1TPOA 3ZZ5A 2SGFE 3RU4E 1GBIA 2PR3A 3KN2A 1DWBH 1AZ8A 1QNJA 2BHGA 2NWNA 3BTGE 4AX9H 4OS7A 1O31A 2WZQA 3KQEA 5A09A 2F91A 4A1VA 1XXFA 1O2YA 1SI5H 3RXVA 2J4IA 3T29A 1S0RA 2ZECA 2ODPA 3SHCH 1G9IE 1PYTD 4X8TH 2ZDNA 3OYPA 2VWLA 2PKAB 1TA2A 1EXFA 2Y81A 1YLDA 1BHXB 1L1GA 2PV9B 1VITH 1CA8B 4MPVA 4UONA 5GCHF 2R3UA 2GCHG 4ZUHA 4B2AA 1ELGA 3A7YA 1DT2A 1HAIH 1SFIA 2JETC 2OBQA 1NY22 1TRMA 5FPSA 2J9NA 4Y7AA 2R0LA 2CJIA 1QQUA 2HPPH 2FESH 2P59A 2XRCA 3A86A 3T26A 3LGYA 4YLUA 1S5SA 3BEFB 1UVSH 5JB8S 3GDUA 2UWOA 3ITIA 2BDGA 2Z94A 2AGEX 1GI6A 1TRNA 3HKIB 1KDQB 2HVXA 3DA9B 3EQ0H 1T31A 2TRMA 3MO6A 2RA3A 1FLEE 2ZU3A 2OXSA 1TBQH 3QK1A 3RXMA 1N8OC 2FXRA 1O38A 4BTIB 4ABGA 4WXIA 3SGQE 2JETB 4K8BA 1FY3A 1PPFE 1AUJA 3RXUA 4FUEA 2JH6D 1GHVH 1RTLA 2BD3A 1YPGH 4Y7BA 3Q77A 2ZO3H 1OPHB 3ZZ8A 1GBJA 3P95A 1YPEH 5AVDA 1O2RA 1DUEA 1K1JA 1XVMA 2CV3A 3MO3A 3MWIU 1ELTA 2BQWB 1P0SH 4ISNA 3SU0A 3MH4A 2VIWA 2BVXH 4VGCC 2B0FA 5SGAE 1LTOA 1MAXA 1K1LA 2A45B 1AFEH 4I8KA 1O2QA 1EJMA 1FY5A 3BTWE 1ZSKA 1EKBB 3RXRA 3LC5A 1Z1IA 1G30B 2J95A 4BNRA 3V13A 3ATKA 3SNDA 5DP8A 3Q3XA 3LDXH 5HMAA 2ZIQH 1RRKA 1EAUA 3SJOA 3ELAH 4YZUA 1DS2E 3SV2H 1BHXF 1T7CA 3QGNB 3NK8A 2FWWA 1P01A 4YM9A 1A5GH 4XSKU 3LH1A 4AOQA 4AYYB 1V2PT 3GY5A 4SGBE 1IQNA 3U8RH 2XC5A 3Q76A 5HM2A 1A2CH 1MTWA 3HPTB 1TGSZ 3PMJA 2P3FH 1C2HA 4OM9A 3L33A 2WV9A 1O5CB 2J2UA 2BQ7B 1EB2A 3HKJB 3M5OA 3EA8A 4FVDA 4CR5A 3GYLB 5EQSA 1TOCB 5EG4A 1GI7B 2W7UA 1SR5C 8GCHG 3G01A 4H4FA 2OBOA 5ESBA 1F5KU 1JOUB 3SO3A 1FONA 1HJ9A 3V0XA 2VIVA 1YF4A 2BDIA 3RP2A 3GY6A 3FAOA 8KME2 1PPBH 2SGAA 4ZXYH 3AAVA 1W2KH 3A87A 2OC7A 5A8XA 1C1RA 1UCYH 4E06H 2FOEA 1A61H 2STAE 2FLRH 1HCGA 3UY9A 1SGRE 2VINA 2WPHS 1TMUH 2W5EA 3PWBA 5HGGA 2ZFTA 2HOBA 4R0IA 5I46H 1EOJA 1MMJN 3UTUH 1C5MD 2QN5T 4A5TS 2G81E 1O2JA 2KAIB 3QZQA 3R3GB 1BMMH 3SU6A 1D3DB 1GJ5H 1MU8B 1VITF 5GIBA 2BTCE 2PKSC 2ANWA 4UFGH 2AIPA 2PKAA 4E7NA 1AB9B 3W95A 4KGAA 1Y3UA 1DXWA 4ZXXH 2PUQH 5E2PA 5C1UA 1C5XB 4X6NA 2P93A 2GZ8A 1WOFA 2FI3E 2BVRH 1P06A 2H6MA 3M7TA 4XFQA 2HWLB 4ABEA 1GI1A 3SNBA 4MQAA 3ATMA 4HGCA 1BJVA 1H8IH 2F9UA 3F9FA 1J14A 1TNGA 2H5DA 3E16B 1A0HB 1K21H 3MNXA 1UHBB 2GT8A 2HNTC 3CENA 2UWPA 2ZHQH 4CRCA 5FBIA 1THPB 2WV5A 1C1TA 2GT7A 3M61U 1QB1A 1CT4E 3MI4A 3STIA 1U6QA 1RTFB 1YPHE 1NFXA 1BTXA 2BZAA 3O8RA 2ZI2H 4Q2KA 1IHTH 2UWLA 4FUJA 2BDAA 3LGUA 1O36A 4IN2A 4LZ1H 1SHHB 3GISB 5EGMA 2QAAA 5C5NA 1C1SA 1TGTA 4GUXA 3UR6A 2SNWA 1MAYA 1BBRH 3GY7A 1DOJA 4K60A 1AY6H 3SNCA 4I33A 3RC4A 1WU1A 3PM3A 2G8TA 1TX8A 4CR9A 3RU4T 1FIWA 5JBBS 1SFQB 3EGKH 3GCHC 2PGQB 1Q3XA 5C20A 1S81A 1OP0A 3SJ8A 3UREA 4GHQA 4INKA 4AGJA 1NRSH 1Z8GA 2P8OC 4AZ2B 3FP8E 2TGAA 4ZKOU 1NESE 1Q31A 1LVBA 1TONA 7GCHG 3F9EA 2XC0A 1NT1A 2ZGHA 1IHSH 5DP5A 1FIZA 1MZDA 4LXBH 1AVWA 2GMTC 5B6LA 1O0DH 1V2JT 2EEKA 2FYQA 1AUTC 3GCTF 3S7KB 4MVNA 5BRRE 3BTTE 5DP4A 3JZ1B 3STJA 2VIPA 1A3EH 1KIGH 1P8VC 1Y3VA 2ZFFH 1BTHH 3ZV9A 1GJ4H 1SGYE 3URCA 3ZYEA 3RC6A 1W8BH 1O2LA 1S6HA 2GCHF 2ZEBA 1TMTH 4GAWA 1D9IA 1O2TA 2XCNA 3TNSA 3RMMH 2UUKB 1V2LT 3UPEA 2ZU1A 1XUGA 4U32A 1ZRKA 1Z8RA 2FODA 2VNTA 1KYNA 2VVCA 1ETSH 4NZQA 2ZNKH 4X6OA 3SU2A 1LHGH 1FY1A 1CSOE 1AZZA 1ARBA 1F5LA 3SQEE 1O5DH 3UNRA 2OC0A 2Z7FE 2QIQA 1BIOA 1UTJA 4ASHA 1DFPA 2H1UA 2XCFA 4NWLA 3FZZA 1SC8U 2ZGCA 2YOLA 3LIWA 2O8UA 1MUEB 1YPLH 1Z71A 3TH3H 4E05H 2HRVA 4CRFA 1YCPK 1GJCB 3KCGH 3C27B 1TBRH 2GGVB 2ZU2A 4YT7H 4YOIA 2HPQH 2C8ZB 3DD2H 4CREA 1V2KT 3HGPA 3M3SA 3MU5A 1DM4B 3RXDA 3MH5A 1DVAH 3MH6A 4D9QA 1TPPA 2O8MA 3NCLA 5E0HA 1ETTH 5ESTE 4B71A 5F6MA 2G55A 1WQVH 1P2MA 1BCUH 1TALA 4WY3A 3GOVB 2CN0H 1B0FA 4KTSA 4X1QU 1SOZA 2FOGA 1O2SA 1SQTA 3BTEE 6GCHG 2VBCA 2ODQA 1GVZA 1C1WH 2AIQA 3D23A 3SNAA 3IG6B 2WPKS 3DUXH 1LHDH 1FN8A 2GZ9A 1MH0A 2VH6A 1KXBA 3ZVGA 4J1YA 4FUCA 2SGQE 1K22H 1C5WB 1AFQC 3RM2H 3QTOH 1DWDH 1ZHRA 2Y5HA 1C5UA 3RDZA 1CBWB 3BV9B 3RLWH 1EATA 2BMGB 2DE8A 4ISIH 2ZGBH 2C4FH 1O30A 3MNCA 1C1UH 1WQSA 1O3HA 3NWUA 4TWYA 4DURA 4WMEA 3GDSA 5LH8A 1J17T 1O2HA 1YGCH 4TPIZ 2EI6A 3MH7A 5L30H 1C4V2 2OP9A 3UOUA 1G32B 1AMHA 2ZFRH 1NRNH 1GG6C 4Q80A 5TCCA 4ZMAH 1T8MA 3UUZA 4WMDA 4BXSA 2FIRH 2Z9LA 1IQIA 1E38B 1QTFA 3LC3A 1ORFA 2A1DB 4HTCH 1YBWA 1HGTH 4I8GA 1K1NA 1V2QT 3RMLH 1C5RA 1SLUB 3KIDU 4NA9H 1TBZH 3RLYH 5A8YA 1HAYB 2G4TA 2R2MB 2C8WB 2NU4E 4UE7H 1SQAA 3SV7A 2ZP0H 1OXGA 4X6PA 2CGAA 2AERH 4ABHA 4DJZB 1MKWH 3MU4A 1ID5H 1HAVB 1K1OA 3HGNA 3PTBA 3B8JA 1ZTKA 2NU3E 2Z9JA 1ZMNA 1F5RA 2BY8X 1LHFH 3TJNA 2XXLA 2ZGXH 1Y5BT 3AW1A 3P8GA 2K1QA 1OP2A 3VB4A 3E90B 2IOTA 3QWCH 2B7DH 1QBVH 4D9RA 3P8FA 1CA0C 3TLOA 4BAOB 1CE5A 1BBRE 2PWXA 4HZHA 1EPTA 3BG8A 1SGCA 2ULLA 1GMHG 2SGEE 1VJ9U 2XWBI 2A31A 4ISLA 4YLQH 3RXAA 1QB9A 4K1SA 1E37B 1TNLA 4B2CA 9ESTA 1V2ST 2Y5FA 1P3EA 3BTME 4CHAB 2FM2A 2BD7A 3RXOA 1O2KA 2OC1A 8ESTE 2WPJS 3E91A 3A8BA 4BAHB 5E0GA 3F6UH 6CHAB 2BDHA 1CA0B 5LPRA 3I78A 1JWTA 3LGIA 3SU1A 5CMXH 3O8BA 3B9FH 1LKAA 2SFAA 1F0RA 3GYMA 3A88A 1ZSJA 2FDAA 1C2EA 2VH0A 1TE0A
chains in the Genus database with same CATH superfamily
3BIVH 3LGTA 1OP8A 3M7UA 1GBEA 4DG4A 2G00A 1W7XH 4OS5A 1EFRD 1QJ6B 3LKWA 3OAAD 1Y59T 4ZCNA 3MNBA 3DSPA 3V12A 4X2XA 4JZDH 4DOQA 4X1RU 4FU7A 7GCHF 2I6SA 3SYJA 1Y3XA 1AIXH 1NBMD 2BD9A 3OE7D 1GMDG 2Y80A 3UOPA 3RXTA 4DY7B 2XBXA 4Y71A 2BLWA 1KSNA 1ARCA 1P57B 2P94A 2PFEA 5CDFE 1ZLRA 4OS6A 6LPRA 1AD8H 1FMGA 4D8NA 1TNHA 1YLCA 1O3PB 1ZJDA 2ILNA 5DK1A 2WUBA 1MQ6A 1XX9A 1FAKH 3LH3A 4X6MA 3I29A 3BEIB 1TQ7B 3ZZBA 1F92A 2IPHA 4JK5A 1Z1JA 1FZZA 2WINI 1P10A 4AB9A 2Z3CA 1GBBA 2JIZD 4WJG2 1UTOA 2Z9GA 3BSQA 1ELCA 4FUGA 2BY6X 3A81A 3BTHE 1XUIA 1P2NA 1UK4A 1MTSA 4UDWH 4X8VH 3TJVA 2FOHA 1QB6A 3M36A 1GL0E 3TGIE 1QL9A 5A0AE 3WW7A 1C2IA 1BA8B 1K2I1 4IW4E 1GBTA 2Q6DA 2AFQB 1E34B 1GI8B 1GHBG 1O3BA 3GS9A 1Z6JH 3TNTA 3K6ZA 1YPHC 2BDYA 1P03A 3PV4A 4NA7A 1SGTA 3ODFA 4Z6AH 3PROA 1BTZA 4YO9A 1YCPM 1ELBA 1EAXA 2M5TA 4K8YA 2BX4A 3PV5A 1Y3YA 4FUIA 5EOKA 1O2GH 4BANB 3A80A 2KCAA 1O5BB 4D76A 1O3DA 1J16A 4NG9H 3MMGA 3F9GA 1SGFA 5C0UA 1AWFH 4AN7A 1N8OB 2ZU5A 1FV9A 7LPRA 1GI3A 4UEHH 2GTBA 3TGKE 2OLGA 2EI8A 2HGTH 5G4BA 2J98B 3VB5A 1BMNH 3ATWA 1EP6A 3M5MA 5KECA 3M7QA 4CRGA 1OSSA 3MOCA 1YPMH 3VB3A 1D4PB 7KMEH 2YMSD 3ZZ3A 1DX5M 1ZPZA 1TQ0B 3SI4H 1EZSC 2XBWA 4ISHH 4U01A 5HYOA 1BQYA 5C1XA 5L2YH 1EJNA 1RIWC 2A4QA 1H1BA 1L1NA 3BTKE 1C2LA 3NRLA 1ESBA 1N6XA 3UNQA 1NRRH 3UFAA 5GXPA 4Y6DA 4CBNA 1K0HA 1NN6A 3HK6B 2P3TB 2R2WU 1O39A 1HIAB 1BMLA 2ZCLP 2GCTC 2THFB 4BXWA 1NO9H 4VGCB 2R9PA 4H6SB 4J2YB 3KQ5A 1AE5A 1CGJE 3A7WA 1TAWA 1AGJA 1O2OA 3F2GA 2ZPQA 4WH6A 1C2GA 1F7ZA 2VWNA 5L6NH 1IQFA 1NZQH 1O5AB 2XBVA 4NGAH 4LZ4B 5LPFA 1V2MT 3NPSA 4IN1A 1UTKA 1ZTLA 4CRBA 3QTVH 3SV9A 1UTQA 2G4UA 3TVJB 1T8OA 1UJ1A 2AEIH 3E0NB 4ZH8A 1GGDC 3MU0A 2QF3A 4NIWA 3FZDA 3N7OA 4FUFA 3BTDE 4NIXA 4BAMB 1P11E 1UK2A 4WWYA 2GCTB 1T4VH 1DSTA 1Y3WA 5T3HA 4CH8B 2FTMA 1WBGB 3PMBB 1O5EH 1O37A 4B6EA 3F0OA 3VXFH 1GI0A 1MD8A 3A7XA 5T6DA 1ZZZA 1PFXC 3URDA 3SU3A 2ODYB 2F9VA 2BOHB 1DY9A 1EZXC 3SQHE 1GWAA 2WYJA 3RXQA 3D62A 5FXLA 3ZVDA 2J92A 2Y6TA 1GHWH 5IK2D 2Y82A 2W6JD 1IQJA 2K8IA 2ALVA 3M5NA 5DP6A 5B6OA 5AFYH 1MCVA 1E79D 4WXVA 4DVAU 3EA7A 4GCHF 4BAKB 1NFWA 1W0JD 1IAUA 3OTPA 4B73A 1QQ4A 4GPGA 1PJPA 3SI3H 5DPAA 3W94A 2PP6A 1LPGB 1WV7H 2XNIA 3GCOA 5JYIA 2QCYA 1O35A 1GBKA 3EE0B 1E1RD 4YOJA 2RA0A 2XYAA 4K69A 2B8OH 1GI4A 1GHAG 1GMHF 2UUFB 2ZG0H 3ODDA 1QR3E 2P3UB 3T28A 1AN1E 1GMCG 2QXHA 1BBRK 2PKSB 1AO5A 2ZF0H 1VCPA 1HAXB 1HJAC 1ZMJA 3P92A 1QCPA 3PO1C 3E1XB 2EY4C 3AVZA 3GY2A 1KDQA 1W10U 4ZAEA 5EXMA 3SUEA 1VGCC 1DWCH 3DT0H 4JZ1A 1T32A 1G3DA 4JYUH 4XDEA 4ZHLU 2F3CE 3RUOA 3H7TA 1PPHE 1ELAA 4UFEH 3D65E 5CHAC 3UWJH 4ABIA 1F0TA 1IQEA 1BJUA 1FDPA 3MTYA 4E7RG 1AVXA 2F9BH 1DLEA 3OFND 1BMAA 1GJ7B 2EQNA 4MNVA 1GBDA 2OUAA 3RC5A 1SMFE 1EASA 1J15A 1G3CA 3O8CA 3PO1B 4B1TA 1L1JA 2W26A 3AASA 1MTNC 2BDCA 1VGCB 4BOHA 2TGTA 1G37A 1C1QA 2BYAX 4MNXA 2QF0A 1MKXH 4FUHA 4Y8YA 4OS2A 1HV7A 4FU9A 1W13U 4TT3D 5EPNA 1GJ9B 1GCDA 1VZQH 4IBLH 1SGIB 3PYHA 1W0ZU 1SHYA 4K2YA 3QN7A 2FPZA 4Y76A 2O8TA 5FX5A 1L4DA 1W11U 1Z8IB 4GLYA 1JBUH 2PGBB 1GI5A 1FXYA 4OS4A 2KR7A 1O3FA 3RXLA 1ESTA 3PLKA 2QA9E 4IC6A 5FPTA 4D7GA 3S0NA 3SUFA 1NPMA 1C2FA 4KELA 3SV8A 1PPEE 3GCHB 1JMOH 2RDLA 2VWMA 1LO6A 1HAOH 1AKSB 2B5TB 2BB4A 1GL1A 2P8OB 5C94A 1MCTA 1SGFG 4ISOA 1CT0E 5E8EH 1DANH 4FU8A 1C1NA 3BTFE 2ZDAH 3E3TA 3OY6U 4HI3A 2D2DA 3KNXA 4X8SH 1ANDA 2GDEH 1MD7A 2HALA 3ATLA 4PROA 2GMTB 4CRDA 1ZJKA 1AI8H 2QE7D 2QYIA 2C8XB 1AHTH 2PTNA 1OWIA 4B74A 4ZKNU 2JH5D 1HFDA 2P95A 2PHBA 5DN6D 1FJSA 3ESTA 1LQEA 1ZYOA 5C5OA 1SQOA 3F2FA 3R0FA 1O3IA 5GCHG 1ANCA 1BDAA 1THSH 1A0LA 3ZZ7A 3TITA 1YC0A 2V35A 1SGQE 3DFLA 1GHBF 3U69H 3VGCC 3S69A 1AWHB 1TB6H 3ZZDA 3CS7A 3H7OA 2AGIX 3H09A 1LDTT 2HNTF 3SOSA 2NU0E 5FPYA 1GDNA 1HAHH 2BLVA 2AS9A 2AMDA 1O2VA 2BD2A 5EW2H 1H9LB 4NIYA 1FY4A 3M3TA 1H9HE 3HATH 1QIXB 4KTUA 4YT6H 3EAJA 3IITA 3BN9A 1C5VA 1QRXA 2KAIA 3TIUA 4CBOA 1F0UA 2ZDVH 2ZGJA 5DP9A 3BG4C 2DE9A 4RT0A 2QXIA 1EZUC 4DT7B 2A5KA 1DICA 2BM2A 2TPIZ 1VCQA 1C5LH 1C2DA 1W7GH 3KEEA 1KXFA 1RD3B 2BVSH 1TFXA 2GV7A 1CVWH 3SJIA 1YKTA 1GVLA 1O34A 2BLOA 3PWCA 1BTPA 2Q6FA 2XBYA 4MPWA 4X0WU 1H8DH 1EB1H 1QRWA 3V7TA 1C5OH 5F8XA 5DJ7A 1IOEA 2WUCA 3Q3KA 1K1PA 3BIUH 2F83A 2ZFQH 2EC9H 5A0BA 2AGGX 2ANMH 1O2XA 2ZHEH 2WHXA 3FP6E 1LQDB 1UCYE 1UHBA 2CF9H 1N1LA 3I77A 5DKMA 4O03A 1OWHA 1FUJA 1VJAU 1THRH 3NKKA 1JIMA 1LPKB 4Z0KA 1YCPH 1A4WH 3TK6A 4IC5A 4X2YA 5FCRA 5KEDA 2EA3A 2GP9B 2QC2A 2VWOA 1ANEA 1S82A 3KGPA 3T62A 4MG3A 1QHRB 2A0QB 3VB7A 2TGDA 3B23B 2BY5X 4UD9H 4ZKSU 8GCHF 3UWIA 2JDID 5C3NA 5A8ZA 1AU8A 1KXEA 3GY8A 1TRYA 3TJOA 1AFQB 3CS0A 2BLQA 2QV1A 4QT8C 4B76A 3T25A 1D3TB 1GI9B 5EJ1A 1HAPH 4NWKA 1MBMA 2LPRA 1UTPA 2BXTH 3LJJA 1PPGE 1OWEA 2ANYA 2YNBA 1P9UA 2GD4B 3KQBA 1C5PA 3RXIA 1V2NT 1O2WA 2ZKSA 1BB0B 1GJ6A 1GPZA 1CO7E 4MLFB 4B6FA 1ELEE 1CQQA 4ACAA 3GY4A 4IMQA 1GHXH 1W14U 1PQAA 4BAQB 1SLWB 1GVKB 5TJXA 1BZXE 1GBFA 2Z9KA 1SGPE 1UVPA 2CF8H 2WV4A 3K2UA 4Y0YE 3V3MA 4DCDA 1GG6B 1GCTC 1HLTH 2H9TH 4THNH 1JIRA 3FN8A 1V2OT 3P8NA 4Q4LA 1PQ7A 2A7HA 2FOFA 1NRPH 5EQQA 2AYWA 3S9BA 4GVUA 2UUJB 3E6PH 4WF8A 1SGNE 1K9OE 2A7CA 5DGJA 3SJ9A 2JH0D 1C5YB 1NC6A 1CGHA 4CRAA 4YXWD 1AKSA 1O2PA 3FOAA 2V3MA 1ZPBA 3BF6H 1HDTH 3TK9A 5EJZA 2ZCHP 5CE1A 3GICB 4IGDA 3FVFB 1M9UA 1BRAA 3VEQB 1XXDA 1A46H 1BRCE 1DITH 1EJAA 1V2TT 1VITG 1XUHA 1C1MA 1GCTB 1GHAF 1QBOA 4Y8ZA 3ZVFA 1EP5A 4MNYA 4XBDA 5AHGH 5LGOA 1GMCF 2ZA5A 1C4U2 2WPMS 1C2MA 4K3JA 3P17H 2QY0B 1EOLA 1TGNA 5EU8A 1GJDB 1NU7B 4GSOA 5E2OA 3ZVEA 5A2MH 4JK6A 3RXPA 1TGCA 2VGCC 3PTNA 4O3TA 2FS9A 2ZTYA 3A7TA 3MFJA 2C93B 1ABIH 4LOYH 1G2LA 1RXPA 3SW2B 1Z6EA 1TOMH 1AQ7A 1IQLA 4Y0ZE 2C90B 1KXAA 4JZEH 3RXGA 2BD8A 1ABJH 1EUFA 1ETRH 2PUXB 2VU8E 3A84A 2XTTB 4JYTA 1T8NA 1DUAA 5GPIB 4B75A 3MO9A 1E1QD 2Q6GA 2KCPA 1P12E 1TLDA 4YOGA 1UK3A 4MPXA 2RDEA 3N7EA 1BOQA 3HK3B 5FHTA 3MU8A 5JB9S 2B9LA 1EX3A 1QFKH 2YNAA 4WMFA 5JDUB 5EODA 1FNIA 2VIQA 5FX6A 1TPAE 1K1MA 1O3CA 1V3XA 3FP7E 1SBWA 3U1IB 1HAGE 3ZVAA 2BD4A 1FQ3A 4TY7A 1YPKH 3AW0A 1ZPCA 1PQ8A 4XE4A 5T1VA 3RMOH 2FEQH 1E36B 2Z3EA 1DLKB 3U28C 4YTAA 2R0KA 2J97A 3OU0A 1UTMA 4Q63A 5EIYA 1UO6A 5FCKA 2H9EH 3PV2A 3SZEA 2QXJA 2W7SA 4XBBA 1KLTA 3OTJE 4RI0A 5JBTA 5T6FA 4NFFA 1GJAB 1CHOG 1CHGA 2VB0A 2Y7ZA 2C3SA 4I7YH 3GCNA 3L6PA 3ZZ4A 2F43B 3L3TA 2FMJA 2ALPA 1GDQA 3GCTG 2IJD1 3SGAE 4KKDA 1P04A 3TU7H 4O9VA 1P2QA 1P3CA 5GNDA 1TYNA 3M5LA 4ZHMU 2PSYA 1CU1A 1HXFH 3SNEA 2XC4A 1P9SA 4OS1A 4Y79A 3A8DA 2GV6A 1A7SA 2NU1E 1AVGH 2ZHWH 2BY7X 3AAUA 2F9NA 1L4ZA 4AYVB 2NU2E 2YMSC 1HBTH 4CH2B 1PPCE 1XKBC 4INLA 1MBQA 1ELDE 1WDIA 2GX4A 5AFZH 5ABWA 4K5ZA 9LPRA 3KQDA 1S0QA 2WPIS 4RKJB 3BEUA 4A1XA 2J34A 4JZIA 2RCEA 5EW1H 4AG2A 1DSUA 4AFZA 3Q3YA 1LCYA 3EYDA 5IDKA 1TX6A 1W3CA 1GBLA 2TBSA 1QA7A 1HAVA 2IJOB 5DG6A 2V0BA 3SU5A 1IQKA 2F4LA 4MTBA 4Q7YA 1Z7KA 1C1VH 1Q2WA 5DO4H 1N6YA 3SUDA 1DWEH 2Z6BD 5C67A 1C2KA 3FANA 1WYKA 1C9PA 3QX5H 2FO9A 1O2NA 4FXGH 1IQHA 1TNKA 1G3EA 1EAIA 2PSXA 1HNEE 1BRUP 2SGPE 6GCHF 3SZNA 2ZTZA 1SGEE 2G5NA 3GY3A 1UVTH 3SUGA 1O3JA 1O2UA 4ABFA 5C1YA 1XVOA 2A4RA 1QY6A 4U30A 1SVPA 4Q7ZA 1S85A 3RXBA 1QGFA 2FOCA 3EDXB 1QURH 2TIOA 4DT4A 3KL6A 4UFFH 2A32A 2OQUA 3ENSB 5EXLA 4SGAE 3LPRA 1DDJA 3QGJA 2W6ID 3QO6A 5L2ZH 1C9TA 1COWD 1O5GH 5EJLA 1UCYK 1BTWA 4FUBA 3MHWU 3U8TH 3LOXA 4K1TA 4X8UH 5EPYA 1ACBE 2ZDKA 4X2VA 1FN6A 1W12U 4P02A 4I8JA 4AB8A 1ESAA 2VVVA 1RTKA 1TIOA 1RIWB 1SL3A 3ZZ9A 2V3OH 1QJ7B 1WXRA 2FLBH 1O3LA 4F55A 2F9PA 1O3NA 3F9HA 2FYRA 1V2UT 3VG8A 1FY8E 1HB0B 1D3QB 1FPHH 2OINA 1YP9A 3SV6A 3OY5U 4A6LA 1QA0A 1F2SE 4TYDA 3RMNH 2P16A 3EA9A 2VJ1A 4ASUD 1ZMLA 3AK5A 1XUJA 4Q7XA 1ZGIA 1YM0A 2AMQA 2H9HA 1D3PB 3F68H 5T6GA 4IS5A 2KCOA 2OD3B 1YY3A 2XW9A 2WPLS 1J8AA 4ESTE 1GGDB 1O2IA 3LGVA 1C1OA 4XRNA 5HM9A 3BTQE 2ZFSA 2FOMB 2BOKA 1YLNA 2WYGA 1AB9C 2V6NA 4Y10E 3RXEA 1S83A 1KXCA 3QZRA 3QLPH 1GBMA 2J94A 1YPJH 4FETA 1IQGA 2WSSD 2EI7A 4DIIH 5BPEA 3A89A 4AFSA 2D8WA 4FOUC 1YWUA 2OQ5A 2PLXA 2ZCKP 3A82A 1H9IE 2GKVE 1INCA 3KYGA 5EQRA 1P02A 2O8LA 3PMAB 1UVOA 2AMPA 1WTGH 3ATIA 1NS3A 1QL7A 2Z3DA 4OGXA 4M9FA 3SN8A 3OEHD 3QDZB 2KM0A 2D26C 3SHAH 4Y11E 3MYWA 1NU9A 3T5FH 1BUIA 3WY8A 4FUDA 5PTPA 2GDDA 1NROH 1BRBE 1AE8H 4OGYA 1C5ZB 4ZHAA 1O3EA 3UIRA 1JRTA 1LVOA 1JXPA 1SLXB 3ZVCA 1MKXK 4IMZA 4XBCA 2ZPRA 3PLBA 1O3OA 4TPYA 4WVPE 1G36A 4HFPB 1OWDA 2W3KA 1SB1H 3TJUA 1KTTB 1P09A 2G51A 1HPGA 1EQ9A 1IQMA 1SSXA 1VCWA 2CXVA 3U1JB 5JPMH 1D6RA 1HJAB 3RM0H 1C5QA 5DP7A 2TGPZ 1P2KA 2BQ6B 3S9AA 2KZ4A 1C5NH 1GJBB 5GWZA 3A7VA 5DP3A 2ZDMA 1VKYA 1A5IA 1HRTH 2C8YB 3TPIZ 1ZTJA 3GDVA 5ETXA 2A5AA 5F8TA 1FPCH 5CHAB 1O3MA 2OCVB 3H5CB 2ZQ2A 1Z8JB 2J98A 4LK4A 1GBAA 4K1EA 3T27A 1ELVA 3MU1A 3UQOA 1GMDF 4ZROA 2K0QA 1SPJA 4I32A 2Y7XA 4X1NU 2I6QA 1O32A 2H2ZA 1UMAH 1ZHPA 1X7AC 1XUKA 4X2WA 3SJKA 1P2JA 2A2QH 2PTCE 4JCNA 1WCZA 2JJ1D 1MTNB 2SNVA 1HIAA 4AORA 5KGOA 1UTLM 2ASUB 1TWXB 1C2JA 3U9AH 4ABAA 3DSOA 1GI2A 4NFEA 1CHOF 1P05A 1O33A 1EPTC 1BT7A 4WH8A 3UNSA 1A0JA 4I31A 5A0CA 4JZFH 1E35B 1BITA 1TNJA 1Y8TA 1ZSLA 2ZFPH 1LHEH 1HYLA 1PPZA 3A8CA 1ZGVA 3RXKA 4R8TB 2ZPSA 3NXPA 3SGBE 4H6TA 1V6DA 1Y5AT 4GHTA 1TX7A 2FOBA 1GBCA 3UB0A 3F1SB 1K28D 1NFYA 1FI8A 1G3BA 2F9OA 1RS0A 1TNIA 2ANKH 5C2ZA 2G52A 1KY9A 1EPTB 3A85A 6ESTA 1O2ZA 1LPZB 3KHVA 4I8LA 3D49H 3VFEA 1V2VT 3NZIA 5J4QA 1P2IA 3VPKA 3E0PB 3RXCA 3QUMP 2XWAA 2OK5A 4TWWA 4H42U 2UUYA 3SBKA 4A7IB 2FX4A 2L6OA 2V3HH 2OC8A 1KMHB 4NA8A 1WTHD 4ABBA 1GHYH 1OOKB 1L2EA 7ESTE 2VVUA 4D7FA 4NSVA 2HLCA 1MTVA 5F8ZA 4M7GA 4U2WA 3RXSA 3LT3A 2FP7B 2RG3A 2J5UA 3UR9A 2H5CA 3VGCB 2BZ6H 4KP0A 3E8LA 1FAXA 1KTSB 1NTPA 3TH2H 4F4OC 1C4Y2 1ZRBA 3SU4A 2A7JA 1GBHA 2CHAC 1ZR0A 3ZZ6A 2IN2A 3C1KA 4MDSA 1HJ8A 4XOJA 4RSPA 5K7RA 2ZZUH 3LJOA 3S9CA 2BXUH 2OTVA 2JKHA 3U8OH 2ZHFH 1SOTA 1QRZA 2O8WA 2QGRA 3ZYDA 2AH4X 3T2NA 3P8OA 1A3BH 1HAZB 3N7DA 1CGIE 1D6WA 2Z9IA 1CBWC 5GJ4B 1O2MA 1OWKA 1XKAC 2FZZA 1XUFA 3BG4B 1OKXA 1S6FA 2BD5A 3OSYA 4O97A 1OS8A 1JRSA 2PW8H 1CT2E 4DW2U 1MTUA 1MZAA 2CHAB 1A1RA 3FFGA 2FX6A 1KXDA 1W0YH 1DE7H 2BX3A 3ZZCA 1O3GA 3P70B 2HNTE 5IYTA 1GJ8B 2G5VA 3M37A 4KTCA 1MU6B 2FI5E 2V7QD 4F49A 3DHKH 2Y5GA 1Y5UT 4MNWA 2Q1JA 2VIDA 1XM1A 1S84A 1MKWK 5H4IB 1TPSA 5HXFA 5GDSH 2A4GA 1TGBA 5I25A 1G2MA 2STBE 3NUMA 1NFUA 3ZVBA 1T8LA 4INHA 3RU4D 2SGDE 5LPEA 1B7XB 5F03A 3LONA 4X1PU 1C1PA 4RN6A 3PB1E 3RXJA 5JBCS 2A4OA 3RXFA 4Y8XA 3OX7U 4DGJA 3Q00A 2J38A 2ZU4A 3K9XB 3VXEH 2DUCA 2CMYA 3VB6A 1OWJA 4AGKA 1J9CH 4TY6A 2ESTE 1TA6A 1LKBA 2ZHDA 3M35A 4FVBA 3TK5A 2RFKC 2R3YA 3LU9B 1B5GH 4B2BA 1NM6A 5FBEA 2GVFA 3K65B 4AC9A 1SG8B 1UVUH 3MNSA 2W3IA 8LPRA 1B0EA 1LVMA 1QL8A 4MPUA 5AF9H 1ZOMA 4BTTB 1O3AA 1O3KA 1OYTH 1DXPA 2ZQ1A 1BTUA 1KLJH 4AG1A 1TMBH 2A2XH 3M3VA 1QJ1B 1TABE 1V2RT 3U98H 3CNRA 4X1SU 3S7HB 1H4WA 5CHBA 1L0ZA 3RXHA 5FAHA 4O3UA 1C5SA 2D1JA 1RFNA 3PMHB 3JZ2B 2QXGA 3IWMA 1K1IA 3KQCA 4GCHG 2BDBA 2FTLE 2WPDD 3ZV8A 4ABDA 1RJXB 2GZ7A 1MQ5A 1EAWA 2BY9X 1BTYA 3UQVA 1LMWB 4CHAC 1LVYA 2FOAA 5J4SA 5JBAS 4ZKRU 1F0SA 1V2WT 3KF2A 1P2OA 2LNCA 4I8HA 4AFQA 4YESB 3TGJE 6CHAC 3K6YA 1QBNA 3ZZAA 4NCYA 1OYQA 3F0PA 2FI4E 1O5FH 4AFUA 4A92A 1ANBA 2FS8A 1EZQA 2ZDLA 1ELFA 4RKOB 1UTNA 4UFDH 5TCAA 1WAYB 1HUTH 4DIHH 1T4UH 4NIVA 1DPOA 4ABJA 1OX1A 1WSSH 5K0HA 1GHZA 1DY8A 4A1TA 1OHHD 1PQ5A 3TH4H 2ZTXA 1SGDE 1HXEH 3PLPA 1VR1H 4JYVH 4NZLA 3CP7A 1GDUA 1XMNB 4TSFD 1SLVB 2VGCB 2O9QA 1C5TA 3LGWA 3A7ZA 3A83A 4NSYA 1LHCH 1KLIH 1YYY1 1ZHMA 1PYTC 1A5HA 1E0FD 4BTUB 2VIOA 2KCYA 1RGQA 3DFJA 1NRQH 1WUNH 5E0JA 3SORA 5EXNA 2ZC9H 3A8AA 3O8DA 3F2HA 4JMYA 2ZWLH 2A5IA 3P6ZB 1TPOA 3ZZ5A 2SGFE 3RU4E 1GBIA 2PR3A 3KN2A 1DWBH 1MABB 1AZ8A 1QNJA 2BHGA 2NWNA 3BTGE 4AX9H 2WZQA 1O31A 4OS7A 5C0TA 3KQEA 3EE7A 5A09A 2F91A 4A1VA 1XXFA 1O2YA 1SI5H 3RXVA 2J4IA 3T29A 1S0RA 2ZECA 2ODPA 5FL7D 3SHCH 1G9IE 1PYTD 4X8TH 2ZDNA 3OYPA 2VWLA 2PKAB 1TA2A 1EXFA 2Y81A 1YLDA 1SQRA 1BHXB 1L1GA 2PV9B 1VITH 1CA8B 4MPVA 4UONA 5GCHF 2R3UA 2GCHG 4ZUHA 4B2AA 1ELGA 3A7YA 1W0KD 2JETC 1DT2A 1HAIH 1SFIA 2OBQA 1NY22 1TRMA 5FPSA 2J9NA 4Y7AA 3KYFA 2R0LA 2CJIA 1QQUA 3PRDA 2HPPH 2FESH 2P59A 2XRCA 3A86A 3T26A 3LGYA 4YLUA 1S5SA 3BEFB 1UVSH 5JB8S 3GDUA 2UWOA 3ITIA 2BDGA 2Z94A 2AGEX 1GI6A 1TRNA 4RT1A 3HKIB 1KDQB 2HVXA 3DA9B 3EQ0H 1T31A 2TRMA 3MO6A 2RA3A 1FLEE 2ZU3A 2OXSA 1TBQH 3QK1A 3RXMA 1N8OC 2FXRA 2CK3D 1O38A 4BTIB 4ABGA 4WXIA 3SGQE 2JETB 4K8BA 1FY3A 1PPFE 2M2AA 1AUJA 2YMSB 3RXUA 4FUEA 2JH6D 1GHVH 1RTLA 2BD3A 1YPGH 4Y7BA 3Q77A 2ZO3H 1OPHB 3ZZ8A 1GBJA 3P95A 1YPEH 5AVDA 1O2RA 1DUEA 1K1JA 1XVMA 2CV3A 2KFWA 3MO3A 3MWIU 1ELTA 2BQWB 1P0SH 4ISNA 3SU0A 3MH4A 2VIWA 2BVXH 4VGCC 2B0FA 5SGAE 1LTOA 1MAXA 1K1LA 2A45B 1AFEH 4I8KA 1UW7A 1O2QA 1EJMA 1FY5A 3BTWE 1ZSKA 1EKBB 3RXRA 3LC5A 1Z1IA 1G30B 2J95A 4BNRA 3V13A 3ATKA 3SNDA 5DP8A 3Q3XA 3LDXH 5HMAA 2ZIQH 1RRKA 1EAUA 3SJOA 3ELAH 4YZUA 1DS2E 3SV2H 1BHXF 1T7CA 3QGNB 3NK8A 2FWWA 1P01A 4YM9A 1A5GH 4XSKU 3LH1A 4AOQA 4AYYB 1V2PT 3GY5A 4SGBE 1IQNA 3U8RH 2XC5A 3Q76A 5HM2A 1A2CH 1NBME 5C17A 1MTWA 3HPTB 1TGSZ 2L74A 3PMJA 2P3FH 1C2HA 4OM9A 3L33A 2WV9A 1O5CB 2J2UA 2BQ7B 1EB2A 3HKJB 3M5OA 2AHME 3EA8A 4FVDA 4CR5A 3GYLB 5EQSA 1TOCB 5EG4A 1GI7B 2W7UA 1SR5C 8GCHG 3G01A 4H4FA 2OBOA 5ESBA 5HIYA 1F5KU 1JOUB 3SO3A 1FONA 1HJ9A 3V0XA 2VIVA 1YF4A 2BDIA 3RP2A 3GY6A 3FAOA 8KME2 1PPBH 2SGAA 4ZXYH 3AAVA 1W2KH 3A87A 2OC7A 3MQKC 5HKKD 5A8XA 1C1RA 1UCYH 4E06H 2FOEA 1A61H 2STAE 3N99A 2FLRH 1HCGA 3UY9A 4HG6A 1SGRE 3WWBA 2VINA 2WPHS 1TMUH 2W5EA 3PWBA 5HGGA 2ZFTA 2HOBA 4R0IA 5I46H 1EOJA 1MMJN 3UTUH 1C5MD 2QN5T 4A5TS 2G81E 1O2JA 2KAIB 3QZQA 3R3GB 1BMMH 3SU6A 1D3DB 1GJ5H 1H8ED 1MU8B 1VITF 5GIBA 2BTCE 2PKSC 2ANWA 4UFGH 2AIPA 3UAIC 2PKAA 4E7NA 1AB9B 3W95A 4KGAA 1Y3UA 1DXWA 4ZXXH 2PUQH 5E2PA 5C1UA 1C5XB 4X6NA 2P93A 2GZ8A 1WOFA 2FI3E 3W1EA 2BVRH 1P06A 2H6MA 3M7TA 4XFQA 2HWLB 4ABEA 1GI1A 3SNBA 4MQAA 3ATMA 4HGCA 1BJVA 1H8IH 2F9UA 3F9FA 1J14A 1TNGA 2H5DA 3E16B 1A0HB 1K21H 3MNXA 1UHBB 2GT8A 2HNTC 3CENA 2UWPA 2ZHQH 4CRCA 5FBIA 1THPB 2WV5A 1C1TA 2GT7A 3M61U 1QB1A 1CT4E 3MI4A 3STIA 1U6QA 1RTFB 1YPHE 1NFXA 1BTXA 2BZAA 3O8RA 2ZI2H 4Q2KA 1IHTH 2UWLA 4FUJA 2BDAA 3LGUA 1O36A 4IN2A 4LZ1H 1SHHB 3GISB 5EGMA 2QAAA 5C5NA 1C1SA 1TGTA 4GUXA 3UR6A 2SNWA 1MAYA 1BBRH 3GY7A 1DOJA 4K60A 1AY6H 3SNCA 4ACBA 4I33A 3RC4A 1WU1A 3PM3A 2G8TA 1TX8A 4CR9A 3RU4T 1FIWA 5JBBS 1SFQB 3EGKH 3GCHC 2PGQB 1Q3XA 5C20A 1S81A 1OP0A 3SJ8A 3UREA 4GHQA 4INKA 4AGJA 1NRSH 1Z8GA 2P8OC 2QF5A 3FP8E 2TGAA 4AZ2B 1NESE 1Q31A 1LVBA 1TONA 4ZKOU 7GCHG 3F9EA 2XC0A 1NT1A 2ZGHA 1IHSH 5DP5A 1FIZA 1MZDA 4LXBH 1AVWA 2GMTC 5B6LA 1O0DH 1V2JT 2EEKA 2FYQA 1AUTC 4I86A 3GCTF 3S7KB 4MVNA 5BRRE 3BTTE 5DP4A 3JZ1B 3STJA 2VIPA 1A3EH 1KIGH 1P8VC 1Y3VA 2ZFFH 1BTHH 3ZV9A 1GJ4H 1SGYE 3URCA 3ZYEA 3RC6A 1W8BH 1O2LA 1S6HA 2GCHF 2ZEBA 1TMTH 4GAWA 1D9IA 1O2TA 2XCNA 3TNSA 3RMMH 3DCLA 2UUKB 1V2LT 3UPEA 2ZU1A 1XUGA 4U32A 1ZRKA 1Z8RA 2FODA 2VNTA 1KYNA 2VVCA 1ETSH 4NZQA 2ZNKH 4X6OA 3SU2A 1LHGH 1FY1A 1CSOE 1AZZA 1ARBA 1F5LA 3OEED 3SQEE 1O5DH 3UNRA 2OC0A 2Z7FE 2QIQA 1BIOA 1UTJA 4ASHA 1DFPA 2H1UA 2XCFA 4NWLA 3FZZA 1SC8U 2ZGCA 3WWFA 2YOLA 3LIWA 2O8UA 1MUEB 1YPLH 1Z71A 3TH3H 4E05H 2HRVA 4CRFA 1YCPK 1GJCB 3KCGH 3C27B 1TBRH 2GGVB 2ZU2A 4YT7H 4YOIA 2HPQH 2C8ZB 1SKYE 3DD2H 4CREA 1V2KT 3HGPA 3M3SA 3MU5A 2HVYB 1DM4B 2IPQX 3RXDA 3MH5A 1DVAH 3MH6A 4D9QA 1TPPA 2O8MA 3NCLA 5E0HA 1ETTH 5ESTE 4B71A 5F6MA 2G55A 2XOKD 1WQVH 1P2MA 1BCUH 1TALA 4WY3A 3GOVB 2CN0H 1B0FA 2GJGA 4KTSA 4X1QU 1SOZA 2FOGA 1O2SA 1SQTA 2VBCA 3BTEE 5HIZA 2ODQA 6GCHG 1GVZA 1C1WH 2AIQA 3D23A 3SNAA 3IG6B 2WPKS 3DUXH 1LHDH 1FN8A 2GZ9A 1MH0A 2VH6A 1KXBA 3ZVGA 4J1YA 4FUCA 2SGQE 1K22H 1C5WB 1AFQC 3RM2H 5F53A 3QTOH 3F3BA 1DWDH 1ZHRA 2LP6A 2Y5HA 1C5UA 3RDZA 1CBWB 2QF4A 3BV9B 3RLWH 1EATA 2BMGB 2DE8A 4ISIH 2ZGBH 2C4FH 1O30A 3MNCA 2XNDD 1C1UH 1WQSA 1O3HA 3NWUA 4TWYA 4DURA 4WMEA 3GDSA 1QZ8A 5LH8A 1J17T 1O2HA 3PRBA 1YGCH 4TPIZ 2HLDD 2EI6A 3MH7A 5L30H 1C4V2 2OP9A 3UOUA 1G32B 1AMHA 2ZFRH 4Z1MD 1NRNH 1GG6C 4Q80A 3FO8D 5TCCA 1T8MA 4ZMAH 3UUZA 4WMDA 4BXSA 2FIRH 2Z9LA 1IQIA 1E38B 1QTFA 3LC3A 1ORFA 2A1DB 4HTCH 1YBWA 5DSFA 1HGTH 4I8GA 1K1NA 2LELA 1V2QT 3RMLH 1C5RA 1SLUB 3KIDU 4NA9H 1TBZH 3RLYH 5A8YA 1HAYB 2G4TA 2R2MB 2C8WB 2NU4E 4UE7H 1SQAA 3SV7A 2ZP0H 1OXGA 4X6PA 2CGAA 2AERH 4ABHA 1BMFD 4DJZB 1MKWH 3MU4A 1ID5H 1HAVB 1K1OA 2KX4A 3HGNA 3PTBA 3B8JA 1ZTKA 2NU3E 1S6LA 2Z9JA 1ZMNA 1F5RA 2BY8X 1LHFH 3TJNA 2XXLA 2ZGXH 1Y5BT 4P00A 3AW1A 3DSGA 3P8GA 2K1QA 1OP2A 4F48B 3VB4A 3E90B 2IOTA 3QWCH 1FX0B 2B7DH 1QBVH 4D9RA 3P8FA 1CA0C 3TLOA 4BAOB 1CE5A 1BBRE 2PWXA 4HZHA 1EPTA 3BG8A 3ZIAD 1SGCA 2ULLA 4XD7D 1GMHG 2SGEE 1VJ9U 2XWBI 1H8HD 2A31A 4ISLA 4YLQH 3RXAA 1QB9A 4K1SA 1E37B 1TNLA 4B2CA 3FKSD 9ESTA 1V2ST 2Y5FA 1P3EA 3BTME 4CHAB 2FM2A 2BD7A 3RXOA 1O2KA 2OC1A 8ESTE 2WPJS 3E91A 3A8BA 4BAHB 5E0GA 3F6UH 6CHAB 2BDHA 1CA0B 5LPRA 3I78A 1JWTA 2JJ2D 3LGIA 3SU1A 5CMXH 3O8BA 3B9FH 1LKAA 2SFAA 1F0RA 3GYMA 3A88A 1ZSJA 2FDAA 1C2EA 2VH0A 1TE0A
chains in the Genus database with same CATH topology
3BIVH 3LGTA 1OP8A 3M7UA 1GBEA 4DG4A 2G00A 1W7XH 4OS5A 1EFRD 1QJ6B 3LKWA 3OAAD 1Y59T 4ZCNA 3MNBA 3DSPA 3V12A 4X2XA 4JZDH 4DOQA 4X1RU 4FU7A 7GCHF 2I6SA 3SYJA 1Y3XA 1AIXH 1NBMD 2BD9A 3OE7D 1GMDG 2Y80A 3UOPA 3RXTA 4DY7B 2XBXA 4Y71A 2BLWA 1KSNA 1ARCA 1P57B 2P94A 2PFEA 5CDFE 1ZLRA 4OS6A 6LPRA 1AD8H 1FMGA 4D8NA 1TNHA 1YLCA 1O3PB 1ZJDA 2ILNA 5DK1A 2WUBA 1MQ6A 1XX9A 1FAKH 3LH3A 4X6MA 3I29A 3BEIB 1TQ7B 3ZZBA 1F92A 2IPHA 4JK5A 1Z1JA 1FZZA 2WINI 1P10A 4AB9A 2Z3CA 1GBBA 2JIZD 4WJG2 1UTOA 2Z9GA 3BSQA 1ELCA 4FUGA 2BY6X 3A81A 3BTHE 1XUIA 1P2NA 1UK4A 1MTSA 4UDWH 4X8VH 3TJVA 2FOHA 1QB6A 3M36A 1GL0E 3TGIE 1QL9A 5A0AE 3WW7A 1C2IA 1BA8B 1K2I1 4IW4E 1GBTA 2Q6DA 2AFQB 1E34B 1GI8B 1GHBG 1O3BA 3GS9A 1Z6JH 3TNTA 3K6ZA 1YPHC 2BDYA 1P03A 3PV4A 4NA7A 1SGTA 3ODFA 4Z6AH 3PROA 1BTZA 4YO9A 1YCPM 1ELBA 1EAXA 2M5TA 4K8YA 2BX4A 3PV5A 1Y3YA 4FUIA 5EOKA 1O2GH 4BANB 3A80A 2KCAA 1O5BB 4D76A 1O3DA 1J16A 4NG9H 3MMGA 3F9GA 1SGFA 5C0UA 1AWFH 4AN7A 1N8OB 2ZU5A 1FV9A 7LPRA 1GI3A 4UEHH 2GTBA 3TGKE 2OLGA 2EI8A 2HGTH 5G4BA 3VB5A 1BMNH 3ATWA 1EP6A 3M5MA 3M7QA 4CRGA 1OSSA 3MOCA 1YPMH 3VB3A 1D4PB 7KMEH 3ZZ3A 2YMSD 1DX5M 1ZPZA 1TQ0B 3SI4H 1EZSC 2XBWA 4ISHH 4U01A 5HYOA 1BQYA 5C1XA 5L2YH 1EJNA 1RIWC 2A4QA 1H1BA 1L1NA 3BTKE 1C2LA 3NRLA 1ESBA 1N6XA 3UNQA 1NRRH 3UFAA 5GXPA 4Y6DA 4CBNA 1NN6A 3HK6B 2P3TB 2R2WU 1O39A 1HIAB 1BMLA 2ZCLP 2GCTC 2THFB 4BXWA 1NO9H 4VGCB 2R9PA 4H6SB 4J2YB 1AE5A 1CGJE 3A7WA 1TAWA 1AGJA 1O2OA 3F2GA 2ZPQA 4WH6A 1C2GA 1F7ZA 2VWNA 5L6NH 1IQFA 1NZQH 1O5AB 2XBVA 4NGAH 4LZ4B 5LPFA 1V2MT 3NPSA 4IN1A 1UTKA 1ZTLA 4CRBA 3QTVH 3SV9A 1UTQA 2G4UA 3TVJB 1T8OA 1UJ1A 2AEIH 3E0NB 4ZH8A 1GGDC 3MU0A 2QF3A 4NIWA 3FZDA 3N7OA 4FUFA 3BTDE 4NIXA 4BAMB 1P11E 1UK2A 4WWYA 2GCTB 1T4VH 1DSTA 1Y3WA 5T3HA 4CH8B 2FTMA 1WBGB 3PMBB 1O5EH 1O37A 4B6EA 3F0OA 3VXFH 1GI0A 1MD8A 3A7XA 5T6DA 1ZZZA 1PFXC 3URDA 3SU3A 2ODYB 2F9VA 2BOHB 1DY9A 1EZXC 3SQHE 1GWAA 2WYJA 3RXQA 3D62A 5FXLA 3ZVDA 2J92A 2Y6TA 1GHWH 5IK2D 2Y82A 2W6JD 1IQJA 2K8IA 2ALVA 3M5NA 5DP6A 5B6OA 5AFYH 1MCVA 1E79D 4WXVA 4DVAU 3EA7A 4GCHF 4BAKB 1NFWA 1W0JD 1IAUA 3OTPA 4B73A 1QQ4A 4GPGA 1PJPA 3SI3H 5DPAA 3W94A 1LPGB 1WV7H 2XNIA 3GCOA 5JYIA 2QCYA 1O35A 1GBKA 3EE0B 1E1RD 4YOJA 2RA0A 2XYAA 4K69A 2B8OH 1GI4A 1GHAG 1GMHF 2UUFB 2ZG0H 3ODDA 1QR3E 2P3UB 3T28A 1AN1E 1GMCG 2QXHA 1BBRK 2PKSB 1AO5A 2ZF0H 1VCPA 1HAXB 1HJAC 1ZMJA 3P92A 1QCPA 3PO1C 3E1XB 3AVZA 3GY2A 1KDQA 1W10U 4ZAEA 5EXMA 3SUEA 1VGCC 1DWCH 3DT0H 4JZ1A 1T32A 1G3DA 4JYUH 4XDEA 4ZHLU 2F3CE 3RUOA 3H7TA 1PPHE 1ELAA 4UFEH 3D65E 5CHAC 3UWJH 4ABIA 1F0TA 1IQEA 1BJUA 1FDPA 3MTYA 4E7RG 1AVXA 2F9BH 1DLEA 3OFND 1BMAA 1GJ7B 4MNVA 1GBDA 2OUAA 3RC5A 1SMFE 1EASA 1J15A 1G3CA 3O8CA 3PO1B 4B1TA 1L1JA 2W26A 3AASA 1MTNC 2BDCA 1VGCB 4BOHA 2TGTA 1G37A 1C1QA 2BYAX 4MNXA 2QF0A 1MKXH 4FUHA 4Y8YA 4OS2A 1HV7A 4FU9A 1W13U 5EPNA 4TT3D 1GJ9B 1GCDA 1VZQH 4IBLH 1SGIB 3PYHA 1W0ZU 1SHYA 4K2YA 3QN7A 2FPZA 4Y76A 2O8TA 5FX5A 1L4DA 1W11U 1Z8IB 4GLYA 1JBUH 2PGBB 1GI5A 1FXYA 4OS4A 2KR7A 1O3FA 3RXLA 1ESTA 3PLKA 2QA9E 4IC6A 5FPTA 4D7GA 3S0NA 3SUFA 1NPMA 1C2FA 4KELA 3SV8A 1PPEE 3GCHB 1JMOH 2RDLA 2VWMA 1LO6A 1HAOH 1AKSB 2B5TB 2BB4A 1GL1A 2P8OB 1MCTA 1SGFG 4ISOA 1CT0E 5E8EH 1DANH 4FU8A 1C1NA 3BTFE 2ZDAH 3E3TA 3OY6U 4HI3A 2D2DA 3KNXA 4X8SH 1ANDA 2GDEH 1MD7A 2HALA 3ATLA 4PROA 2GMTB 4CRDA 1ZJKA 1AI8H 2QYIA 2QE7D 2C8XB 1AHTH 2PTNA 1OWIA 4B74A 4ZKNU 2JH5D 1HFDA 2P95A 2PHBA 5DN6D 1FJSA 3ESTA 1LQEA 1ZYOA 5C5OA 1SQOA 3F2FA 3R0FA 1O3IA 5GCHG 1ANCA 1BDAA 1THSH 1A0LA 3ZZ7A 3TITA 1YC0A 2V35A 1SGQE 3DFLA 1GHBF 3U69H 3VGCC 3S69A 1AWHB 1TB6H 3ZZDA 3CS7A 3H7OA 2AGIX 3H09A 1LDTT 2HNTF 3SOSA 2NU0E 5FPYA 1GDNA 1HAHH 2BLVA 2AS9A 2AMDA 1O2VA 2BD2A 5EW2H 1H9LB 4NIYA 1FY4A 3M3TA 1H9HE 3HATH 1QIXB 4KTUA 4YT6H 3EAJA 3IITA 3BN9A 1C5VA 1QRXA 2KAIA 3TIUA 4CBOA 1F0UA 2ZDVH 2ZGJA 5DP9A 3BG4C 2DE9A 2QXIA 1EZUC 4DT7B 2A5KA 1DICA 2BM2A 2TPIZ 1VCQA 1C5LH 1C2DA 1W7GH 3KEEA 1KXFA 1RD3B 2BVSH 1TFXA 2GV7A 1CVWH 3SJIA 1YKTA 1GVLA 1O34A 2BLOA 3PWCA 1BTPA 2Q6FA 2XBYA 4MPWA 4X0WU 1H8DH 1EB1H 1QRWA 3V7TA 1C5OH 5F8XA 5DJ7A 1IOEA 2WUCA 3Q3KA 1K1PA 3BIUH 2F83A 2ZFQH 2EC9H 5A0BA 2AGGX 2ANMH 1O2XA 2ZHEH 2WHXA 3FP6E 1LQDB 1UCYE 1UHBA 2CF9H 1N1LA 3I77A 5DKMA 4O03A 1OWHA 1FUJA 1VJAU 1THRH 3NKKA 1JIMA 1LPKB 4Z0KA 1YCPH 1A4WH 3TK6A 4IC5A 4X2YA 5FCRA 2EA3A 2GP9B 2QC2A 2VWOA 1ANEA 1S82A 3KGPA 3T62A 4MG3A 1QHRB 2A0QB 3VB7A 2TGDA 3B23B 2BY5X 4UD9H 4ZKSU 8GCHF 3UWIA 2JDID 5C3NA 5A8ZA 1AU8A 1KXEA 3GY8A 1TRYA 3TJOA 1AFQB 3CS0A 2BLQA 2QV1A 4QT8C 4B76A 3T25A 1D3TB 1GI9B 1HAPH 4NWKA 1MBMA 2LPRA 1UTPA 2BXTH 3LJJA 1PPGE 1OWEA 2ANYA 2YNBA 1P9UA 2GD4B 3KQBA 1C5PA 3RXIA 1V2NT 1O2WA 2ZKSA 1BB0B 1GJ6A 1GPZA 1CO7E 4MLFB 4B6FA 1ELEE 1CQQA 3GY4A 4IMQA 1GHXH 1W14U 1PQAA 4BAQB 1SLWB 1GVKB 5TJXA 1BZXE 1GBFA 2Z9KA 1SGPE 1UVPA 2CF8H 2WV4A 3K2UA 4Y0YE 3V3MA 4DCDA 1GG6B 1GCTC 1HLTH 2H9TH 4THNH 1JIRA 3FN8A 1V2OT 3P8NA 4Q4LA 1PQ7A 2A7HA 2FOFA 1NRPH 5EQQA 2AYWA 3S9BA 4GVUA 2UUJB 3E6PH 4WF8A 1SGNE 1K9OE 2A7CA 5DGJA 3SJ9A 2JH0D 1C5YB 1NC6A 1CGHA 4CRAA 4YXWD 1AKSA 1O2PA 3FOAA 1ZPBA 3BF6H 1HDTH 3TK9A 2ZCHP 5CE1A 3GICB 4IGDA 3FVFB 1M9UA 1BRAA 3VEQB 1XXDA 1A46H 1BRCE 1DITH 1EJAA 1V2TT 1VITG 1XUHA 1C1MA 1GCTB 1GHAF 1QBOA 4Y8ZA 3ZVFA 1EP5A 4MNYA 4XBDA 5AHGH 5LGOA 1GMCF 2ZA5A 1C4U2 2WPMS 1C2MA 4K3JA 3P17H 2QY0B 1EOLA 1TGNA 5EU8A 1GJDB 1NU7B 4GSOA 5E2OA 3ZVEA 5A2MH 4JK6A 3RXPA 1TGCA 2VGCC 3PTNA 4O3TA 2FS9A 2ZTYA 3A7TA 3MFJA 2C93B 1ABIH 4LOYH 1G2LA 1RXPA 3SW2B 1Z6EA 1TOMH 1AQ7A 1IQLA 4Y0ZE 2C90B 1KXAA 4JZEH 3RXGA 2BD8A 1ABJH 1EUFA 1ETRH 2PUXB 2VU8E 3A84A 2XTTB 4JYTA 1T8NA 1DUAA 5GPIB 4B75A 3MO9A 1E1QD 2Q6GA 2KCPA 1P12E 1TLDA 4YOGA 1UK3A 4MPXA 3N7EA 1BOQA 3HK3B 5FHTA 3MU8A 5JB9S 2B9LA 1EX3A 1QFKH 2YNAA 4WMFA 5JDUB 5EODA 1FNIA 2VIQA 5FX6A 1TPAE 1K1MA 1O3CA 1V3XA 3FP7E 1SBWA 3U1IB 1HAGE 3ZVAA 2BD4A 1FQ3A 4TY7A 1YPKH 3AW0A 1ZPCA 1PQ8A 4XE4A 3RMOH 5T1VA 2FEQH 1E36B 2Z3EA 1DLKB 4YTAA 2R0KA 3OU0A 1UTMA 4Q63A 1UO6A 5FCKA 2H9EH 3PV2A 3SZEA 2QXJA 2W7SA 4XBBA 1KLTA 3OTJE 4RI0A 5JBTA 5T6FA 4NFFA 1GJAB 1CHOG 1CHGA 2VB0A 2Y7ZA 2C3SA 4I7YH 3GCNA 3L6PA 3ZZ4A 2F43B 3L3TA 2FMJA 2ALPA 1GDQA 3GCTG 2IJD1 3SGAE 4KKDA 1P04A 3TU7H 4O9VA 1P2QA 1P3CA 5GNDA 1TYNA 3M5LA 4ZHMU 2PSYA 1CU1A 1HXFH 3SNEA 2XC4A 1P9SA 4OS1A 4Y79A 3A8DA 2GV6A 1A7SA 2NU1E 1AVGH 2ZHWH 2BY7X 3AAUA 2F9NA 1L4ZA 4AYVB 2NU2E 2YMSC 1HBTH 4CH2B 1PPCE 1XKBC 4INLA 1MBQA 1ELDE 5AFZH 2GX4A 5ABWA 4K5ZA 9LPRA 3KQDA 1S0QA 2WPIS 4RKJB 3BEUA 4A1XA 2J34A 4JZIA 2RCEA 5EW1H 4AG2A 1DSUA 4AFZA 3Q3YA 1LCYA 3EYDA 5IDKA 1TX6A 1W3CA 1GBLA 2TBSA 1QA7A 1HAVA 2IJOB 5DG6A 2V0BA 3SU5A 1IQKA 2F4LA 4MTBA 4Q7YA 1Z7KA 1C1VH 1Q2WA 5DO4H 1N6YA 3SUDA 1DWEH 2Z6BD 5C67A 1C2KA 3FANA 1WYKA 1C9PA 3QX5H 2FO9A 1O2NA 4FXGH 1IQHA 1TNKA 1G3EA 1EAIA 2PSXA 1HNEE 1BRUP 2SGPE 6GCHF 3SZNA 2ZTZA 1SGEE 2G5NA 3GY3A 1UVTH 3SUGA 1O3JA 1O2UA 4ABFA 5C1YA 1XVOA 2A4RA 1QY6A 4U30A 1SVPA 4Q7ZA 1S85A 3RXBA 1QGFA 2FOCA 3EDXB 1QURH 2TIOA 4DT4A 3KL6A 4UFFH 2A32A 2OQUA 3ENSB 5EXLA 4SGAE 3LPRA 1DDJA 3QGJA 2W6ID 3QO6A 5L2ZH 1C9TA 1COWD 1O5GH 1UCYK 1BTWA 4FUBA 3MHWU 3U8TH 3LOXA 4K1TA 4X8UH 5EPYA 1ACBE 2ZDKA 4X2VA 1FN6A 1W12U 4AB8A 4I8JA 1ESAA 2VVVA 1RTKA 1TIOA 1RIWB 1SL3A 3ZZ9A 2V3OH 1QJ7B 1WXRA 2FLBH 1O3LA 4F55A 2F9PA 1O3NA 3F9HA 2FYRA 1V2UT 3VG8A 1FY8E 1HB0B 1D3QB 1FPHH 2OINA 1YP9A 3SV6A 3OY5U 4A6LA 1QA0A 1F2SE 4TYDA 3RMNH 2P16A 3EA9A 2VJ1A 4ASUD 1ZMLA 3AK5A 1XUJA 4Q7XA 1ZGIA 1YM0A 2AMQA 2H9HA 1D3PB 3F68H 5T6GA 4IS5A 2OD3B 2KCOA 2XW9A 2WPLS 1J8AA 4ESTE 1GGDB 1O2IA 3LGVA 1C1OA 5HM9A 3BTQE 2ZFSA 2FOMB 2BOKA 2WYGA 1AB9C 2V6NA 4Y10E 3RXEA 1S83A 1KXCA 3QZRA 3QLPH 1GBMA 2J94A 1YPJH 4FETA 1IQGA 2WSSD 2EI7A 4DIIH 5BPEA 3A89A 4AFSA 2D8WA 2OQ5A 2PLXA 2ZCKP 3A82A 1H9IE 2GKVE 1INCA 5EQRA 1P02A 2O8LA 3PMAB 1UVOA 2AMPA 1WTGH 3ATIA 1NS3A 1QL7A 2Z3DA