2GGVB

Crystal structure of the west nile virus ns2b-ns3 protease, his51ala mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
169
structure length
169
Chain Sequence
PKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWATTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords non-structural protein 2B
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase
total genus 30
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ggvB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ggvB01
1HBTH 2G5VA 1HFDA 3GYMA 1AO5A 1FPHH 2BY8X 2Y5FA 2ZTZA 1TX6A 1VCQA 2HNTC 3RP2A 1B0EA 3P8GA 2CJIA 1J14A 1KLTA 3H7OA 1GBLA 4CRDA 1YPHC 5FXLA 1V2OT 2Z3CA 1TPOA 2FTLE 3AASA 5SGAE 4OGXA 1INCA 4K1SA 1PPFE 5TJXA 1TNKA 1ZR0A 1O3CA 1ZHPA 3KNXA 3JZ1B 1A5HA 5EXMA 2ASUB 1CT2E 1VJ9U 4CRCA 1BHXB 1Y5AT 1GI2A 3LU9B 2Y5GA 2R9PA 1RS0A 2BHGA 2VVVA 2A4RA 1O34A 2GZ7A 1MKWK 1IHSH 3QK1A 4MNXA 2WPIS 1Y5BT 2HGTH 4B2CA 1O3HA 3Q00A 3VB4A 3RXOA 1FY5A 1UMAH 2QXIA 1QHRB 1NU9A 1PQ5A 4I8LA 2VJ1A 1DT2A 3V12A 1TQ7B 1GVZA 1UJ1A 3PO1B 5T6GA 3SGBE 2QN5T 1FQ3A 4OM9A 1BDAA 1EAUA 1XXFA 4KTSA 1CHGA 1UVPA 1EKBB 5A8ZA 3SU2A 2AEIH 3AVZA 4RKJB 3WY8A 3SW2B 2B5TB 4JYTA 4ZHMU 3RC6A 1GBDA 1Z8JB 2C8YB 2FS9A 2FDAA 1ETTH 1DX5M 2BZAA 5DKMA 4WF8A 5C5NA 4MPUA 1C2IA 1FNIA 2ZDLA 4CRAA 5L6NH 1KYNA 3E16B 2PW8H 4NZQA 1N8OB 1S6FA 2IJOB 2PV9B 1O3MA 3Q3XA 5EQRA 4FUFA 4NGAH 2OCVB 3TNSA 2A0QB 2XRCA 3TNTA 3H09A 1HAVA 3S9CA 1CSOE 5DGJA 3A85A 5EW1H 1QL9A 1TNIA 4KTCA 1EPTA 1K1LA 1TPPA 7KMEH 4NZLA 1AI8H 2DE8A 4JCNA 1FY3A 4ZKSU 1SFIA 3TU7H 4U2WA 5CE1A 2ZU5A 7LPRA 4SGAE 5IDKA 7ESTE 3UOUA 1XUIA 3ZZ5A 2FYQA 3PLPA 2PKSB 3SO3A 2CMYA 3OSYA 5AFYH 2M5TA 1SG8B 1D4PB 1ELVA 3NCLA 2ZPQA 4ZKNU 3T28A 2J38A 1ZSKA 2BLWA 4VGCC 1P03A 2XNIA 4ISLA 1O31A 5A0BA 3SV9A 1UK2A 1GI7B 4ESTE 2CXVA 2SGDE 3GY4A 4AGJA 4M9FA 1FIWA 1GBAA 2ZWLH 3LGWA 2BLQA 2XW9A 3MH6A 4A1TA 1EZSC 4NWKA 2JETB 1RIWB 2BM2A 1SC8U 1JIRA 3KHVA 1O2VA 1XMNB 1P02A 3SJIA 3F9EA 3MU5A 1YM0A 5DP7A 1HGTH 2B0FA 3A84A 2J2UA 2AS9A 2BVSH 2TGAA 3SJ9A 1BTZA 1GDUA 1MCVA 3RXSA 1TRNA 4I8JA 3VB5A 3BEIB 1PQ8A 3S9BA 3MOCA 3H5CB 2OBOA 3KGPA 3UNRA 4JYVH 4AX9H 1BJVA 1BRUP 1K1IA 1WUNH 2FOBA 4ABBA 1NZQH 4XBDA 3HK6B 1QGFA 3KF2A 5EXNA 1EX3A 3EDXB 2A7HA 1HNEE 2EI7A 1IQGA 1ZMJA 4AFSA 3BTKE 1OP0A 1DLKB 1MD8A 1B0FA 1CHOG 3K2UA 2CV3A 1O2UA 2WHXA 1OWHA 3S7KB 4MNYA 1C2HA 2VH6A 4I8HA 1C4U2 4AYYB 1O2GH 2ZPRA 1YC0A 4DJZB 4J1YA 1UVTH 1YPMH 2B9LA 3E91A 1L2EA 1O38A 1OYQA 4RSPA 1UO6A 1C1TA 5DPAA 1LHFH 3A7WA 5GWZA 3GY3A 2FOGA 1HAIH 2ZF0H 4NCYA 5FPTA 1V2MT 4IN1A 4CRFA 6CHAC 3LONA 4X1PU 1V2QT 1ARBA 3RXVA 3TK6A 1OP2A 4JYUH 4FVDA 4Y8XA 1FN8A 4B2AA 1GG6B 2SGFE 3SGAE 1GDNA 4FUHA 1NM6A 1GJCB 1RD3B 4NA8A 3MHWU 3MNSA 3VB7A 4ABFA 1J16A 4KTUA 2Y6TA 1FY8E 4D9QA 1RTKA 1KXAA 2YNAA 2FIRH 2ZHDA 3RXBA 2WINI 1GI8B 1MTUA 2ZKSA 3EQ0H 1O2XA 4WVPE 2ILNA 1YPLH 1WBGB 1A5GH 1N1LA 2A5IA 1YCPH 1K1PA 1A0JA 4XOJA 1S81A 1SLWB 1VJAU 1WQVH 3KEEA 1V2VT 4TY6A 2OC8A 1BTYA 4ISHH 2QC2A 3AW0A 3SUGA 2RCEA 2FI5E 3ATWA 4IC5A 1T7CA 3BV9B 1RGQA 3SNEA 3QO6A 3PLBA 5DP6A 1THSH 1ZTKA 1P12E 1SGEE 5ABWA 1FV9A 4JZEH 3VGCB 4DCDA 6ESTA 1O3EA 1C1MA 5DP5A 1VITG 3LT3A 3ZVCA 4X2VA 2PUXB 1PQAA 4LZ1H 1KY9A 2FOMB 2XC0A 3Q76A 1NY22 2G5NA 3SGQE 2GCHG 1QJ1B 4YLUA 1DUEA 1MTNC 2A4GA 4ZUHA 1L0ZA 2UWPA 4WY3A 5TCCA 2WPLS 1SVPA 4MVNA 3FZDA 3E8LA 4Q2KA 3RMOH 1OKXA 2SNVA 1TGSZ 1HCGA 2WPMS 5A8YA 1B5GH 3P92A 1V2PT 4JK6A 1C5VA 2VIVA 5T6FA 1PYTD 4OS5A 3E6PH 1DWDH 3SZNA 3W95A 2TPIZ 2W26A 3SJ8A 4Y11E 5JBAS 2OQUA 3ZVEA 1P10A 4F4OC 1HXFH 2AH4X 1GVKB 4YOIA 4CH2B 2AGGX 4O03A 3D23A 2F9NA 4YOJA 2ZNKH 3EAJA 1TOMH 2VGCB 8LPRA 2J9NA 1LCYA 4BANB 2BD4A 2BQ7B 2A4OA 3SQHE 3GCTG 4ABGA 1G32B 3QGNB 5HGGA 2FYRA 1V2TT 1CE5A 4KGAA 5CHAB 1ELAA 1TBQH 2ZI2H 2BVXH 3RXMA 3T26A 3GCTF 3GDSA 1LMWB 1SGFG 1EAIA 3MMGA 3KL6A 3E90B 1P8VC 3RC5A 2PR3A 1V2RT 3GY6A 1QR3E 1QQUA 4K1TA 2BDBA 1UTJA 2ZFSA 4FXGH 2KAIB 3FP8E 1PPGE 2W7UA 1O2IA 3PM3A 2I6QA 4FUEA 1O33A 1HAZB 1XKBC 3E3TA 3RXCA 1MKXK 2J92A 5DO4H 3RXLA 1BUIA 1GJ4H 5FBEA 2GDDA 1Z8RA 3MO9A 3RXKA 1RFNA 4FUJA 1DY9A 1Y3VA 3PROA 3PWCA 1ABJH 3SV6A 3RDZA 2GCTC 4B75A 1WXRA 1LHCH 1IQKA 1SGPE 2HNTE 5FPYA 2Y5HA 1D3QB 2BD7A 2H5CA 2P95A 4X1NU 1TMUH 3LGUA 5I25A 1C2GA 1GMCF 3ZVBA 1UTQA 4AB9A 3KQCA 1YPHE 3L33A 1O5CB 5E2OA 4NFEA 3SU3A 1GWAA 1MAYA 3I29A 2BYAX 2F91A 1GHBG 1QQ4A 4Z0KA 7GCHF 2DUCA 1C2KA 3GCHB 1BCUH 1D3PB 4UFFH 1DWCH 1AFQB 4SGBE 2F9OA 3TJUA 2CHAB 2BDAA 4X6OA 3M61U 2PWXA 2ZCHP 1MQ6A 1GPZA 4XE4A 4FU7A 3RLYH 1THRH 4AORA 3RMNH 1CVWH 2A7CA 4DW2U 4ABHA 5J4SA 3R3GB 1DS2E 3K9XB 2TGTA 1V6DA 5EOKA 4KELA 1O35A 1GHZA 4WMDA 1NRNH 2J4IA 1KXEA 2BXTH 2IN2A 1F5LA 2XBWA 2GDEH 1C5ZB 4ISIH 1C5MD 2NU2E 1HUTH 1SQTA 1GJ9B 5A2MH 1PPCE 3U8TH 2ZTXA 1MKWH 3RXEA 4K5ZA 1MU6B 1QRWA 3P6ZB 2ZU1A 4UEHH 1F0RA 1SMFE 3CS7A 1EP6A 1VCWA 1HXEH 3ELAH 4UE7H 3UUZA 1GCDA 2UUFB 3EE0B 3EA8A 2WZQA 4OS2A 1OSSA 1YPGH 3A7YA 2V3HH 4YO9A 1UVUH 5E0HA 1ACBE 1TPAE 2VVCA 4JZ1A 1TMTH 4LK4A 4UDWH 3LIWA 3L3TA 3ZVGA 1LDTT 4INKA 1KXDA 3DA9B 1CGIE 3EA9A 1K1MA 1BTUA 2BD8A 1QBVH 1D9IA 1CT0E 1QBOA 4BAHB 2GD4B 3KQBA 1QBNA 1XUHA 1T8OA 1BTHH 1J8AA 2BTCE 2R3UA 4GVUA 3GDUA 3TGKE 1ZMLA 4A7IB 1O0DH 1IQLA 2ZDNA 1EPTC 1OWIA 3UY9A 1EB2A 4UFDH 2RDLA 2GMTB 2V0BA 1UHBB 1UTMA 1HJAB 1AVWA 5H4IB 1GVLA 2PUQH 2AGIX 1GL1A 2VWNA 3LH1A 1G3CA 3BTQE 1P57B 3B8JA 4Y79A 1VR1H 2QIQA 1O3PB 2QGRA 3NXPA 4HTCH 4ABAA 4B1TA 1OOKB 3NPSA 4IMQA 2D26C 2QV1A 6LPRA 4DY7B 1O3IA 1C5QA 2DE9A 2EI8A 2OINA 3K65B 1ELGA 4CR5A 1FUJA 4U01A 1VITH 1OXGA 3OY5U 3T5FH 1Q2WA 3PB1E 1FLEE 4B73A 3QN7A 2RA0A 2TRMA 1PPEE 1DPOA 5DJ7A 1LQDB 3TK9A 1TPSA 1HAGE 3HGPA 1VZQH 2JH6D 4A1VA 2ZA5A 1GJBB 1Z7KA 3LDXH 5DK1A 3T2NA 1MQ5A 3AK5A 4I8KA 1ZPCA 1KSNA 1GHAF 2QAAA 1O5AB 1F0TA 1QY6A 1VGCC 1GGDC 4DURA 1C2MA 1H9IE 1V2LT 2CF9H 2HPPH 2VU8E 3PMAB 4Q7XA 1P0SH 1KLIH 3V13A 1HAOH 2Z3EA 1NRPH 3UNSA 1GJ7B 3E1XB 1ZOMA 2Z9JA 2Y82A 1E36B 1SGTA 2HRVA 2QYIA 4YOGA 2GZ9A 4D7FA 3T25A 5A8XA 1BTPA 1KIGH 1Z6EA 3U69H 1GCTB 4KP0A 3SUEA 4DIHH 1SBWA 1C1UH 4I32A 3RXTA 3UOPA 1SHYA 3ZZAA 6GCHG 3SU4A 2WV5A 1AB9C 2BD3A 4U30A 3BTFE 1BMNH 1IHTH 3A86A 5JBBS 4NG9H 1AVGH 1LPZB 1E35B 5EXLA 3GOVB 6GCHF 4ISNA 1NFWA 2LPRA 1NO9H 5K0HA 1KXCA 1TGBA 3QDZB 1KXFA 1N6XA 2Y7ZA 5F03A 4UD9H 1TGTA 1HYLA 3M7QA 1CBWB 3ZVAA 2WV4A 6CHAB 4NA9H 1QCPA 1UTKA 1RJXB 1HAHH 3CENA 2J34A 1ELCA 3UR6A 1ANDA 1S82A 3M3TA 4X0WU 1EASA 1W11U 1O3OA 1DM4B 1D6RA 3M5OA 4CHAB 3GISB 1ZSJA 2QF0A 1P2NA 1C1OA 4UFGH 1D6WA 3ODDA 2VWMA 3FZZA 3O8RA 3R0FA 3RMLH 2ZHQH 2J95A 1ELBA 4CRGA 3ZZCA 1F0UA 1EAWA 4D7GA 5T1VA 1P09A 1W7GH 4KKDA 1S84A 3SJOA 3M3SA 2RG3A 1DWBH 1LHDH 1Y3XA 3MH4A 5I46H 1ZYOA 2VIQA 3NZIA 4X6MA 4TY7A 5EGMA 5FPSA 1NESE 3GYLB 1HIAB 4Y8YA 2BB4A 1DWEH 3ZZDA 4IS5A 1MTVA 4TYDA 1WTHD 3STJA 2A31A 1OWDA 1P3CA 1XXDA 4R8TB 3PV4A 1DSTA 4GAWA 1SGRE 2VVUA 4E7NA 5GXPA 2BX4A 1C9TA 1MBQA 3SJKA 1SGQE 3TGIE 4H6TA 1LTOA 1ZZZA 3W94A 3GICB 4WMFA 2P8OB 1ABIH 1LVMA 1CA0C 1Q31A 2ZC9H 1O2YA 1BRCE 1W10U 1CGHA 2C8ZB 1G3DA 4X6NA 2ZFPH 1DFPA 3BIVH 1HV7A 1W2KH 1EAXA 3BTDE 4FUIA 4OS1A 2YOLA 4AGKA 1OPHB 2A32A 2VIDA 3STIA 4ABDA 4MNVA 1GI3A 1D3DB 3GY7A 1WCZA 1Y3WA 3GY5A 4XBBA 5B6OA 3RXAA 2UUJB 1QURH 3I78A 4X2XA 3U8RH 4AZ2B 1DOJA 1G30B 4FUGA 4NWLA 1SI5H 3AW1A 1XUJA 3MTYA 3P70B 4WJG2 2PGBB 2ZZUH 3PV2A 1O2QA 3ZZ3A 3TIUA 2CGAA 3MH7A 3BG4B 4DT7B 2GZ8A 2UUYA 5C3NA 1AWHB 2XWBI 4Y7BA 1ELDE 1DXPA 3U1JB 1AZZA 2GX4A 3RXFA 4B71A 5DP4A 3BG8A 1LHEH 1OWJA 3DT0H 3ESTA 1JXPA 3MFJA 1GBJA 3O8CA 4GCHG 3SU5A 2XC4A 3NK8A 1K1JA 5F8XA 1SB1H 1T8NA 3TH3H 2W7SA 3BSQA 2XCFA 1XUKA 2WPJS 3SUFA 1O32A 1BOQA 2D8WA 2H9EH 4GCHF 1G3BA 1O36A 3RXPA 2STBE 3M3VA 2HLCA 2PTNA 1ETRH 1GL0E 4QT8C 2BDYA 2J94A 2OC1A 3TLOA 1UVOA 4WH8A 1BHXF 2FP7B 1FY4A 1AU8A 3K6YA 1O2OA 1Y59T 3SHAH 2ZGJA 3QX5H 2ZQ2A 2P16A 4MPXA 1IOEA 3B23B 2F9UA 2QCYA 3QTVH 3ATLA 2ZU2A 1Z1JA 2OLGA 4B74A 8ESTE 2BDHA 2C4FH 3PMBB 2PGQB 2BY5X 4X8SH 1NFYA 1SQOA 5DP8A 1G2LA 3VB3A 1EZXC 3EA7A 1GBEA 4BAMB 1ELTA 2PHBA 1TA6A 2G00A 2JH0D 2NU3E 2ZDMA 3M36A 2H5DA 1BMLA 3S0NA 4CR9A 3LJJA 3M5MA 1ELEE 1EB1H 5LPRA 5E8EH 2ZFFH 5C1XA 3V0XA 4X6PA 2FLBH 5DG6A 3VFEA 1MD7A 1NPMA 5FBIA 1MKXH 1A3BH 1TABE 5LPFA 3PO1C 2V6NA 2OQ5A 3S69A 3A7XA 1GJ8B 2SFAA 3SU6A 1CGJE 1IQMA 1MZDA 2UWOA 4YT7H 4OS6A 4E05H 1XX9A 3MU1A 3EYDA 4ABJA 1FN6A 3DUXH 1UCYK 2XBVA 4Y0YE 2Y7XA 2W3KA 3HATH 1QA7A 3RXIA 4GHQA 5F8ZA 3TJVA 3PTBA 1N8OC 1TMBH 3Q3YA 5EW2H 1KLJH 4BTTB 4Z6AH 9LPRA 2H9TH 2WV9A 3RC4A 3MNCA 3G01A 3P8NA 4Y71A 3MNBA 2JH5D 3OYPA 4I8GA 4CH8B 1QJ6B 1C5TA 4INHA 3RXJA 3A7TA 2FZZA 1C1WH 2AIQA 3M7UA 3HGNA 1IQNA 1C1RA 1FAKH 4BTUB 2ULLA 1LVBA 3F68H 1UCYE 4B6FA 3ZVFA 3GCOA 1T8LA 2A5AA 4ASHA 1BTXA 2ZGXH 1TONA 1SGDE 1WV7H 1FPCH 2K1QA 3ATKA 2PKSC 2ANKH 1O2PA 4A92A 5BPEA 1GBHA 4BAKB 8GCHF 1L4ZA 1GI9B 3SHCH 4GUXA 2VBCA 1GMDF 5A0CA 2Z9IA 1DLEA 4YM9A 1ZPBA 4MNWA 3SI4H 2Z94A 2QY0B 1C5WB 4TWYA 9ESTA 2G8TA 1HAXB 1J15A 3D62A 1ZMNA 2ZFTA 3A8DA 4JZFH 2R0LA 1YKTA 1HAVB 3LKWA 1C5NH 1ZRKA 2BQ6B 2JETC 1RIWC 3UWJH 4B76A 4ZMAH 1MMJN 1UTOA 1C1PA 1HJ9A 1DUAA 1JRSA 3OY6U 1T31A 5GNDA 1HRTH 1A7SA 1Y5UT 1SGYE 2ANYA 3TJOA 5HXFA 1YPJH 5EU8A 4NIYA 3F1SB 5EODA 2FESH 1HB0B 2ZFQH 1TFXA 1C2EA 4NIWA 3NUMA 5EPNA 2O8WA 2ZGBH 4ABIA 1KDQB 4MPWA 2GV7A 1JIMA 2VIPA 1P3EA 2Z3DA 4K60A 1ANBA 1SHHB 1ID5H 1WYKA 1EJNA 2AYWA 3V7TA 1W14U 1A3EH 2XC5A 1H8DH 1RXPA 1F7ZA 4DOQA 2GT7A 1SQAA 1C4Y2 1Y3UA 1O2WA 1C1SA 2XYAA 3B9FH 1O2ZA 2ZHWH 1GI5A 1GMCG 4THNH 1QTFA 1FMGA 1BMMH 2HPQH 2PSYA 1GJ6A 1BRBE 4IN2A 1ZSLA 5JPMH 2SNWA 5FX6A 1HJ8A 2CN0H 1YF4A 2ZO3H 1DE7H 1F2SE 5LPEA 4MQAA 1GHYH 2OBQA 3A83A 7GCHG 3TH2H 1KXBA 1O3NA 2NU1E 3U8OH 3KCGH 2A2XH 2FO9A 2TIOA 3BTTE 1S0RA 1FONA 4WH6A 1MH0A 3KQEA 4UFEH 2SGAA 1HPGA 4ZKOU 1YLCA 3PV5A 1QL7A 5C67A 2F9BH 1BB0B 1YYY1 1Z71A 1GG6C 2IPHA 1O2MA 4X8UH 5AF9H 4A1XA 4GPGA 2ZHFH 1V3XA 3LGYA 2H2ZA 3ZZ4A 1P01A 1E38B 1BITA 3TK5A 1O37A 3HKJB 5HM9A 3OTJE 1S85A 3SOSA 4DG4A 1O2NA 1CO7E 1W7XH 1V2NT 3ZZBA 1O3FA 1JMOH 2FOFA 2D2DA 1A4WH 1TAWA 1W8BH 3ITIA 1L4DA 2P3TB 2WUBA 3F6UH 1HAPH 4Y0ZE 1YLDA 2O8TA 3URDA 2O8MA 2P94A 1Z8IB 3S9AA 4E06H 2GGVB 2XBYA 1C2FA 4DGJA 1FI8A 4INLA 3F9HA 3E0NB 3A8BA 3TVJB 3K6ZA 4RKOB 4X8VH 1EQ9A 2ZTYA 3A89A 2OC0A 5T3HA 3ZYEA 4HFPB 2OUAA 3FP6E 4H4FA 4OGYA 3SNCA 1O5EH 5AFZH 1UTNA 1TALA 3T29A 3Q3KA 4HI3A 4FUCA 1P05A 3LGTA 3BTWE 3P95A 2ZEBA 3MU4A 1BIOA 5JB8S 2GT8A 3LPRA 2FMJA 5A0AE 1P11E 1T8MA 2YNBA 3TITA 2HALA 2VNTA 3H7TA 3DFLA 4MDSA 2ZCKP 4IC6A 2EI6A 1UK4A 5C1YA 1OX1A 4AYVB 3Q77A 1TWXB 1O30A 2AFQB 3SNAA 1J17T 4I7YH 1SGNE 2FX6A 4ZAEA 2G4TA 4MPVA 2NU0E 1GI0A 1Y3YA 3VXEH 1GHWH 1WAYB 4YTAA 1Q3XA 3DD2H 1PPBH 4Q7ZA 1DSUA 2PKAB 4DIIH 3QWCH 4VGCB 4E7RG 3SORA 3OTPA 1O2HA 1ORFA 2FWWA 3U1IB 3SI3H 3FVFB 2FLRH 2VGCC 5F6MA 2ODYB 3ATIA 3L6PA 1A46H 1LPKB 3ZYDA 1DVAH 3MWIU 2GKVE 1TNLA 5EQSA 4YZUA 1HAYB 2BQWB 3SNBA 2FOAA 1O5GH 5E2PA 1BBRK 2PFEA 1C2JA 2BOKA 2BY7X 1NFXA 3MO3A 1AN1E 1S83A 1WOFA 5HYOA 3AAVA 4AB8A 5JBCS 4X8TH 5A09A 1SFQB 3SV8A 1GHAG 4O97A 3MI4A 1DDJA 1SGFA 4B6EA 1TGNA 4A6LA 1PPZA 2Y81A 2EA3A 4K69A 1SOTA 1W12U 2R2MB 4PROA 2QF3A 4X1RU 1ZGVA 2C8WB 1NN6A 1PQ7A 1K9OE 4GHTA 1ZGIA 1XKAC 1P2JA 4NIVA 5G4BA 1P2IA 2OXSA 3SV2H 1BBRE 1GJDB 2FEQH 4WXVA 4HGCA 5EQQA 3BF6H 2VINA 5LH8A 1UK3A 4J2YB 8KME2 5DP9A 3U9AH 3UFAA 3BN9A 1L1JA 1IQJA 3BEUA 1AUTC 3HKIB 1ESTA 1JOUB 1MAXA 1NS3A 3C1KA 2W3IA 4UONA 4LXBH 1MBMA 4CBOA 1ESAA 5ESBA 1GBKA 4Y6DA 3A7ZA 3SN8A 2RA3A 1C1NA 1AHTH 4H42U 2CF8H 2F9PA 4OS4A 2GVFA 4R0IA 2V35A 3M7TA 1O3AA 2EC9H 1TBRH 4OS7A 1F92A 1U6QA 3UWIA 4U32A 5FCKA 1P9UA 5C2ZA 1TB6H 1TIOA 2BLOA 2G52A 2ZECA 3DHKH 3P8FA 1O3JA 1OS8A 3GCHC 3NKKA 2ODQA 1WU1A 2Z9LA 1G37A 2WYJA 1ZTLA 1AFQC 1TNGA 2CHAC 1ZHRA 4BXWA 2F83A 1V2UT 2Q6FA 3VEQB 1G3EA 1P04A 2V3OH 1SR5C 2XCNA 1GBTA 1K1OA 1TOCB 1ZPZA 2SGPE 1AQ7A 2H9HA 5GJ4B 1K1NA 5JBTA 1NFUA 3QGJA 1TX8A 2Y80A 1BT7A 5L2YH 1QNJA 2THFB 3UPEA 1QJ7B 3CS0A 4LOYH 5JB9S 1E0FD 2ANMH 1V2JT 1FIZA 1O39A 3PYHA 4JK5A 1E34B 1GBMA 3T27A 1BQYA 2C3SA 2TGDA 1YPEH 4MLFB 3UQVA 2FXRA 2O8LA 2BY9X 3ZV8A 1O2TA 4I31A 1SGIB 1A0HB 1P06A 2AIPA 1GDQA 3JZ2B 4WXIA 5GPIB 2A5KA 2EEKA 2VH0A 4IMZA 4WWYA 1EOJA 1NRQH 2QXGA 3TGJE 3P17H 4GLYA 2HOBA 4Q80A 1PPHE 4Y7AA 2VIOA 3VB6A 4DVAU 1K21H 2P59A 1ZHMA 1Z8GA 4JMYA 1TRMA 4BTIB 1TA2A 3A8CA 1MTNB 1C1VH 1N6YA 3AAUA 2XBXA 1F5RA 2FPZA 1W13U 4NA7A 3LC3A 1AKSB 5GCHG 1UCYH 3M37A 1GBBA 1FY1A 1NT1A 1V2WT 1A2CH 2NWNA 3MO6A 3RXRA 1BZXE 1ESBA 2A1DB 3MU8A 2KAIA 1A5IA 2ZDAH 3ENSB 1KDQA 5GCHF 1EZQA 1NTPA 5L30H 2FX4A 4K8BA 2P3UB 2C8XB 4JZIA 2GMTC 1GBCA 1MTSA 2XTTB 1HJAC 2BX3A 3A80A 4NSYA 1GJAB 2BY6X 2ALVA 3LJOA 4AN7A 2Q6GA 1DXWA 1ZTJA 1CQQA 2BVRH 2OP9A 3LOXA 3NWUA 1G2MA 2FI4E 4FU8A 5FAHA 3URCA 1SLXB 1O5FH 3A88A 2BD2A 4TWWA 3BEFB 5AVDA 2GV6A 2G55A 4ZH8A 3FP7E 3BTGE 5JYIA 1O2SA 1C4V2 3UNQA 3SYJA 5F8TA 1H9HE 5E0JA 1UVSH 4O9VA 1K28D 1NU7B 1TX7A 1ZJDA 3D49H 2STAE 2ZU4A 3A8AA 4CRBA 1ELFA 1IQIA 2B8OH 3IG6B 4IW4E 1ZJKA 4XBCA 2LNCA 1SL3A 2BD5A 3IWMA 4A5TS 2QXJA 4XDEA 1A1RA 4AFQA 1GBFA 5JDUB 1AD8H 3M35A 1AY6H 3UTUH 4AFZA 1K22H 2PSXA 1J9CH 2FI3E 3PMHB 1C2LA 1T4VH 2WYGA 3RXQA 4D9RA 1W0YH 4ZROA 3UQOA 1P2QA 2ZQ1A 3DFJA 1PFXC 1A0LA 2F9VA 4ZHLU 1XVOA 3RU4E 2OK5A 3E0PB 1XUGA 1W0ZU 1GCTC 1ZRBA 2GCTB 1ARCA 2WPKS 3SV7A 5EG4A 1LPGB 1C5OH 2AGEX 3RU4D 1GMHG 2G51A 2FOCA 1PJPA 1CHOF 3S7HB 2ANWA 1CU1A 1P2MA 4Y10E 4AOQA 1AGJA 1WSSH 1O3BA 2VB0A 2BDCA 4D8NA 1GMHF 2R0KA 1CA8B 3KN2A 4MG3A 2ZHEH 1CBWC 1KTTB 1FZZA 1HDTH 2OD3B 2ZFRH 1TGCA 5HMAA 1LKBA 1O3DA 5C1UA 3MYWA 5CMXH 1XUFA 2HWLB 2PTCE 1F5KU 1IAUA 3BTHE 1E37B 4CHAC 1OP8A 3ZZ6A 1SLUB 2PLXA 1EXFA 1DANH 1GI4A 1MUEB 1C5RA 1K2I1 1OYTH 2Z6BD 4YT6H 1LQEA 4FU9A 3TH4H 1P9SA 1AIXH 2GP9B 3LGVA 1C1QA 2ZIQH 1XM1A 1FXYA 2FOHA 1G9IE 1C5LH 3QUMP 4K3JA 2FM2A 1RRKA 4FUBA 4H6SB 2HVXA 4YESB 4AFUA 1W3CA 5J4QA 3V3MA 5GDSH 2BDGA 1S6HA 1ETSH 1QB6A 1UHBA 2PKAA 1UTLM 1OWKA 2ESTE 4NFFA 8GCHG 2ZU3A 1BMAA 2C93B 1O5BB 3TJNA 4X2YA 1S0QA 2BLVA 1QL8A 4ZXYH 1GMDG 2G81E 2OC7A 3M5LA 3SUDA 4MTBA 3UR9A 1IQHA 1YBWA 2P8OC 1VITF 5FCRA 5GIBA 4K8YA 3SNDA 1C9PA 1O2LA 2ZDVH 2XXLA 4O3UA 1C5PA 1THPB 1EP5A 1IQEA 2GCHF 5FX5A 1AE5A 1M9UA 4M7GA 5T6DA 1AUJA 1WTGH 2ZP0H 1TE0A 2ODPA 1LHGH 2BD9A 3RLWH 1FJSA 1EPTB 4AG2A 2Z9GA 1B7XB 1TBZH 1SPJA 2R2WU 1SSXA 1D3TB 1LKAA 1QIXB 1XVMA 2Z9KA 4B2BA 4D76A 5LGOA 2IJD1 3BTEE 1C5YB 5DP3A 1EZUC 3BG4C 3LGIA 1LVOA 2I6SA 2VWOA 1NRRH 3PWBA 3FFGA 1IQFA 1JWTA 1BTWA 2UUKB 1RTFB 3TPIZ 1YP9A 4ZHAA 2VIWA 2B7DH 4X2WA 1MCTA 4BXSA 1AZ8A 4TPIZ 2O8UA 3ZV9A 3ODFA 3QLPH 2NU4E 2A2QH 2WUCA 1MU8B 3OU0A 2VWLA 2H1UA 4Y76A 1Z1IA 3O8DA 1GHVH 1MZAA 3SU1A 3HPTB 3UIRA 3LH3A 2D1JA 1S5SA 5BRRE 1VGCB 1YPKH 1GGDB 3GCNA 2P3FH 1MTWA 4BOHA 1TNJA 1V2KT 3QTOH 5K7RA 3PMJA 1YCPK 3HK3B 5TCAA 1NRSH 1BBRH 3MU0A 3RXHA 1H8IH 3BTME 3VXFH 2SGEE 2P93A 4NSVA 2BZ6H 1H9LB 2F3CE 2BXUH 2R3YA 1AMHA 2WPHS 3A87A 1Z6JH 2FTMA 1JBUH 1L1GA 3QZQA 4JZDH 1TRYA 3SZEA 1AB9B 3GY8A 3M5NA 2QA9E 1AFEH 3ZZ9A 2ZPSA 4FUDA 3SU0A 1EJMA 4GSOA 5L2ZH 1O3LA 5ESTE 1QFKH 1P2KA 1QRZA 3FANA 4F49A 4IBLH 1SOZA 1L1NA 3A7VA 1HIAA 3VPKA 4CBNA 1O3KA 2TBSA 1O3GA 3F9GA 4WMEA 4Y8ZA 1O5DH 4ISOA 1C5XB 3ATMA 3RM2H 4ABEA 1DICA 1GHBF 1DITH 1WQSA 4FVBA 3PTNA 1QB9A 4ZXXH 1FDPA 1ZLRA 1T32A 5HM2A 1C5SA 1RTLA 3I77A 2A7JA 1C5UA 1DY8A 3IITA 3BIUH 1EJAA 1LVYA 2H6MA 2FS8A 5C20A 3N7OA 3A82A 3VGCC 5PTPA 2ZGCA 4RI0A 1EATA 1GJ5H 4AG1A 1ANEA 1X7AC 1FAXA 1AKSA 1TNHA 4K1EA 1P2OA 1V2ST 1GBIA 3OX7U 1AE8H 3U98H 2TGPZ 1A61H 1G36A 1C2DA 2ZG0H 2ZDKA 3UREA 3QZRA 2AERH 2Z7FE 3RM0H 2BMGB 3RXGA 3D65E 3F9FA 1F0SA 3CP7A 1O2RA 3GY2A 1OWEA 1PYTC 1TQ0B 5FHTA 1LO6A 4YLQH 2UWLA 3A81A 1CT4E 3ZZ7A 3SBKA 1NROH 4ZKRU 2AMQA 2AMPA 2A4QA 3ZZ8A 2GTBA 3PLKA 3KQDA 1HLTH 2ZCLP 4HZHA 5EPYA 1TLDA 1AWFH 1H1BA 3O8BA 3MH5A 3T62A 1CA0B 1O2JA 3ZVDA 1ANCA 1O2KA 2SGQE 1T4UH 2W5EA 3EGKH 4BNRA 4TPYA 1QRXA 4IGDA 2AMDA 1VCPA 1GI1A 3FAOA 1SGCA 1GI6A 2BOHB 3RMMH 5B6LA 4I33A 2Q1JA 2IOTA 2ZGHA 1H4WA 4XSKU 2JKHA 2QXHA 1QB1A 2O9QA 1BJUA 3GDVA 5ETXA 5CHAC 1NC6A 2ALPA 2A45B 1SLVB 3LC5A 4BAQB 4CREA 1AVXA 4XFQA 1BA8B 4X1SU 1GHXH 1TYNA 1EUFA 5AHGH 1QA0A 2G4UA 4RN6A 2BDIA 2F4LA 4X1QU 3C27B 2FOEA 4LZ4B 5C5OA 1UTPA 3KIDU 3RXDA 2HNTF 2FODA 1KTSB 2C90B 5IYTA 4BAOB 3MNXA 1BRAA 2OTVA 1Y8TA 4O3TA 3RU4T 2XWAA 1YCPM 3P8OA 1EOLA 4K2YA 3RXUA 3SQEE 1YGCH 1JRTA 2Q6DA 4Q7YA 3RUOA 5E0GA 4NIXA
chains in the Genus database with same CATH superfamily
1HBTH 2G5VA 1HFDA 3GYMA 1AO5A 1FPHH 2BY8X 2Y5FA 2ZTZA 1TX6A 1VCQA 2HNTC 3RP2A 1B0EA 3P8GA 2CJIA 1J14A 1KLTA 3H7OA 3KYFA 1GBLA 4CRDA 1YPHC 5FXLA 4Q4LA 1V2OT 2Z3CA 1TPOA 2FTLE 3AASA 5SGAE 4OGXA 1INCA 4K1SA 1PPFE 5TJXA 1TNKA 1ZR0A 2KCYA 1O3CA 1ZHPA 3KNXA 3JZ1B 1A5HA 5EXMA 2ASUB 1CT2E 1VJ9U 4CRCA 1BHXB 1Y5AT 1GI2A 3LU9B 2Y5GA 2R9PA 1RS0A 2BHGA 2VVVA 2A4RA 1O34A 3DSOA 2GZ7A 1MKWK 1IHSH 3QK1A 4MNXA 2WPIS 1Y5BT 2HGTH 4B2CA 1O3HA 3Q00A 3VB4A 3RXOA 5HIZA 1FY5A 1UMAH 2QXIA 1QHRB 1NU9A 1PQ5A 4I8LA 2VJ1A 1DT2A 3V12A 1TQ7B 1GVZA 1UJ1A 3PO1B 5T6GA 5HIYA 2QN5T 3SGBE 1FQ3A 4OM9A 1BDAA 1EAUA 1XXFA 4KTSA 1CHGA 1UVPA 1EKBB 5A8ZA 3SU2A 2AEIH 3AVZA 4RKJB 3WY8A 3SW2B 2B5TB 4JYTA 4ZHMU 3RC6A 1GBDA 1Z8JB 2C8YB 2FS9A 2JJ1D 2FDAA 1ETTH 1DX5M 2BZAA 5DKMA 5FL7D 4WF8A 5C5NA 4MPUA 1C2IA 1FNIA 2ZDLA 4CRAA 5L6NH 1KYNA 3E16B 2PW8H 4NZQA 1N8OB 1S6FA 2IJOB 2PV9B 1O3MA 3Q3XA 5HKKD 2CK3D 5EQRA 4FUFA 4NGAH 2OCVB 3TNSA 2A0QB 2XRCA 3H09A 3TNTA 1HAVA 2KZ4A 3S9CA 1CSOE 5DGJA 3A85A 5EW1H 1QL9A 1TNIA 4KTCA 5DSFA 1EPTA 1K1LA 1TPPA 7KMEH 4NZLA 1AI8H 2DE8A 4JCNA 2K8IA 1FY3A 4ZKSU 1SFIA 3TU7H 4U2WA 5CE1A 3CNRA 2ZU5A 7LPRA 4SGAE 5IDKA 7ESTE 1E1QD 3UOUA 1XUIA 3ZZ5A 2FYQA 2IPQX 3PLPA 2PKSB 2YMSC 3SO3A 2CMYA 3OSYA 5AFYH 2M5TA 1SG8B 1D4PB 2KX4A 1ELVA 3NCLA 2ZPQA 4ZKNU 3T28A 2J38A 2XNDD 1ZSKA 2BLWA 4VGCC 1P03A 2XNIA 4ISLA 1O31A 5A0BA 5C0UA 3SV9A 1UK2A 1GI7B 4ESTE 2CXVA 2SGDE 3GY4A 4AGJA 4M9FA 1FIWA 1GBAA 2ZWLH 3LGWA 2BLQA 2XW9A 3MH6A 2JDID 4A1TA 1EZSC 4NWKA 2JETB 1RIWB 2BM2A 1SC8U 1JIRA 3KHVA 1O2VA 1XMNB 1P02A 3UB0A 3SJIA 5KGOA 3F9EA 3MU5A 1YM0A 5DP7A 1HGTH 2B0FA 3A84A 2J2UA 2AS9A 2BVSH 2TGAA 3SJ9A 1BTZA 1GDUA 4XRNA 1MCVA 1OHHD 3RXSA 1TRNA 4I8JA 3VB5A 3BEIB 1PQ8A 3S9BA 3MOCA 3H5CB 2OBOA 3KGPA 2HVYB 3UNRA 4JYVH 4AX9H 1BJVA 1BRUP 1K1IA 1WUNH 2FOBA 4ABBA 1NZQH 4XBDA 3HK6B 1QGFA 3KF2A 5EXNA 1EX3A 3EDXB 2A7HA 1HNEE 2EI7A 1IQGA 1ZMJA 4AFSA 3BTKE 1OP0A 1DLKB 1MD8A 1B0FA 1CHOG 3K2UA 2CV3A 1O2UA 1OWHA 3S7KB 4MNYA 1C2HA 2VH6A 4I8HA 1C4U2 4AYYB 1O2GH 2ZPRA 1YC0A 4DJZB 4J1YA 1UVTH 1YPMH 2B9LA 3E91A 1L2EA 2J98B 1O38A 1OYQA 4RSPA 1UO6A 1C1TA 5DPAA 1LHFH 3A7WA 5GWZA 3GY3A 2FOGA 1HAIH 4TSFD 2QE7D 2ZF0H 4NCYA 5FPTA 1V2MT 2M2AA 1S6LA 4IN1A 4CRFA 6CHAC 3LONA 4X1PU 1V2QT 1ARBA 4ZCNA 3RXVA 3TK6A 1OP2A 4JYUH 4FVDA 4Y8XA 1FN8A 4B2AA 1GG6B 2SGFE 3SGAE 1GDNA 4FUHA 1NM6A 1GJCB 1RD3B 4NA8A 3MHWU 3MNSA 3VB7A 4ABFA 1J16A 4KTUA 2Y6TA 1FY8E 3F0OA 5IK2D 4D9QA 1RTKA 1KXAA 2YNAA 2FIRH 2ZHDA 4ACBA 3RXBA 2WINI 1GI8B 1MTUA 2ZKSA 3EQ0H 1O2XA 4WVPE 2ILNA 1YPLH 1WBGB 1A5GH 1N1LA 2A5IA 1YCPH 1K1PA 1A0JA 4XOJA 1S81A 1SLWB 1VJAU 1WQVH 3KEEA 1V2VT 4TY6A 2OC8A 1BTYA 4ISHH 2QC2A 3AW0A 3SUGA 2RCEA 2FI5E 2RFKC 3ATWA 4IC5A 1T7CA 3BV9B 1RGQA 3SNEA 3PRDA 3QO6A 3N99A 3PLBA 5DP6A 1THSH 1ZTKA 1P12E 1SGEE 5ABWA 1FV9A 4JZEH 3VGCB 4DCDA 1MABB 6ESTA 2EY4C 3WWBA 1O3EA 1C1MA 5DP5A 1VITG 3LT3A 3ZVCA 4X2VA 2PUXB 1PQAA 4LZ1H 1KY9A 2FOMB 2XC0A 3Q76A 1NY22 2G5NA 3SGQE 2GCHG 1QJ1B 1VKYA 4YLUA 3W1EA 1DUEA 1MTNC 2A4GA 4ZUHA 1L0ZA 2UWPA 4WY3A 5TCCA 2WPLS 1SVPA 4MVNA 3FZDA 3E8LA 4Q2KA 3RMOH 1OKXA 2SNVA 1TGSZ 1HCGA 2WPMS 5A8YA 1B5GH 3P92A 1V2PT 4JK6A 1C5VA 2VIVA 5T6FA 1PYTD 4OS5A 3E6PH 1DWDH 3SZNA 3W95A 2TPIZ 2W26A 3SJ8A 4Y11E 5JBAS 2OQUA 3ZVEA 1P10A 4F4OC 1HXFH 2AH4X 3FOAA 1GVKB 2QF4A 4YOIA 4CH2B 2AGGX 4O03A 3D23A 2F9NA 4YOJA 2ZNKH 3EAJA 1TOMH 2VGCB 8LPRA 2J9NA 1LCYA 4BANB 2BD4A 2BQ7B 2A4OA 3SQHE 3GCTG 4ABGA 1G32B 5C0TA 3QGNB 5HGGA 3F2HA 2FYRA 3F2FA 1V2TT 1CE5A 4KGAA 5CHAB 1ELAA 1TBQH 2ZI2H 2BVXH 3RXMA 3T26A 3GCTF 3GDSA 1LMWB 1SGFG 3MQKC 1NBMD 1EAIA 3MMGA 3KL6A 3E90B 1P8VC 3RC5A 2PR3A 1V2RT 3GY6A 1QR3E 1QQUA 4K1TA 2AHME 2BDBA 1UTJA 2ZFSA 4FXGH 2KAIB 3FP8E 1PPGE 2W7UA 1O2IA 3PM3A 2I6QA 4FUEA 1O33A 1HAZB 1XKBC 3E3TA 3RXCA 1MKXK 1COWD 2J92A 5DO4H 3RXLA 1BUIA 1GJ4H 5FBEA 3DSGA 2GDDA 1Z8RA 3MO9A 3RXKA 1RFNA 4FUJA 1DY9A 1Y3VA 3PROA 3PWCA 1ABJH 3SV6A 3RDZA 2GCTC 4B75A 1WXRA 1LHCH 1IQKA 1SGPE 2HNTE 5FPYA 2Y5HA 1D3QB 2BD7A 2H5CA 2P95A 4X1NU 1TMUH 3LGUA 2KCOA 5I25A 1WDIA 1C2GA 1GMCF 3ZVBA 1UTQA 4AB9A 3KQCA 1YPHE 3L33A 1O5CB 5E2OA 4NFEA 3SU3A 1GWAA 1MAYA 3I29A 2BYAX 2F91A 1GHBG 1QQ4A 5E0GA 4Z0KA 7GCHF 2DUCA 1C2KA 3GCHB 1BCUH 1D3PB 4UFFH 2XOKD 1DWCH 1AFQB 4SGBE 2F9OA 3TJUA 2CHAB 2BDAA 4X6OA 3M61U 2PWXA 2ZCHP 4RT0A 1MQ6A 1GPZA 4XE4A 4FU7A 3RLYH 1THRH 4AORA 3RMNH 1CVWH 2F43B 2A7CA 4DW2U 4ABHA 5J4SA 3R3GB 1DS2E 3K9XB 2TGTA 1V6DA 5EOKA 4KELA 1O35A 1GHZA 4WMDA 1NRNH 2J4IA 1KXEA 2BXTH 2IN2A 1F5LA 2XBWA 2GDEH 1C5ZB 4ISIH 1C5MD 1SQRA 2NU2E 1HUTH 1SQTA 1GJ9B 5A2MH 1PPCE 3U8TH 2ZTXA 1MKWH 3RXEA 4K5ZA 1E79D 1MU6B 1QRWA 3P6ZB 2ZU1A 4UEHH 1F0RA 1SMFE 3CS7A 1EP6A 1VCWA 1FX0B 1HXEH 3ELAH 4UE7H 3UUZA 2WPDD 1GCDA 2UUFB 3EE0B 3EA8A 2WZQA 4OS2A 1OSSA 1YPGH 3A7YA 2V3HH 4YO9A 1UVUH 5E0HA 1ACBE 1TPAE 2VVCA 4JZ1A 1TMTH 4LK4A 4UDWH 3LIWA 3L3TA 4FOUC 3ZVGA 1LDTT 4INKA 1KXDA 3DA9B 1CGIE 3EA9A 1K1MA 1BTUA 2BD8A 1QBVH 1D9IA 1CT0E 1QBOA 1W0KD 4BAHB 2GD4B 3KQBA 1QBNA 1XUHA 1T8OA 1BTHH 1J8AA 2BTCE 2R3UA 4GVUA 1YLNA 2KFWA 3GDUA 3TGKE 1ZMLA 5EJZA 4A7IB 1O0DH 1IQLA 2ZDNA 1EPTC 1OWIA 3UY9A 1EB2A 4UFDH 2RDLA 2GMTB 2V0BA 1UHBB 1UTMA 1HJAB 1AVWA 5H4IB 1GVLA 2PUQH 2AGIX 1GL1A 2VWNA 3LH1A 5DN6D 1G3CA 3BTQE 1P57B 3B8JA 4Y79A 1VR1H 2QIQA 2YMSD 1O3PB 2QGRA 3NXPA 4FETA 4HTCH 4ABAA 4B1TA 1OOKB 3NPSA 4IMQA 2D26C 2QV1A 6LPRA 4DY7B 1O3IA 1C5QA 2DE9A 2EI8A 2OINA 3K65B 1ELGA 4CR5A 1FUJA 4U01A 1VITH 1OXGA 3OY5U 3T5FH 1Q2WA 3PB1E 1FLEE 4B73A 3QN7A 2RA0A 2TRMA 1PPEE 1DPOA 2J98A 1LQDB 5DJ7A 1TPSA 3TK9A 1HAGE 3HGPA 1VZQH 2JH6D 4A1VA 2ZA5A 1GJBB 1Z7KA 3FKSD 3LDXH 5DK1A 1MQ5A 3T2NA 4AC9A 3AK5A 4I8KA 1ZPCA 1KSNA 1GHAF 2QAAA 1O5AB 1F0TA 1QY6A 1VGCC 1GGDC 4DURA 1C2MA 1H9IE 1V2LT 2CF9H 2HPPH 2VU8E 3PMAB 4Q7XA 1P0SH 1KLIH 3V13A 1HAOH 2Z3EA 1NRPH 3UNSA 1GJ7B 3E1XB 1ZOMA 2HLDD 2Z9JA 2Y82A 1E36B 1SGTA 2HRVA 2QYIA 4YOGA 2GZ9A 4D7FA 3T25A 5A8XA 1BTPA 1KIGH 1Z6EA 3U69H 1GCTB 4KP0A 3SUEA 4DIHH 1SBWA 2L6OA 1C1UH 4I32A 3RXTA 3UOPA 1SHYA 3ZZAA 6GCHG 3SU4A 2WV5A 1AB9C 2BD3A 4U30A 3BTFE 1BMNH 1IHTH 3A86A 5JBBS 4NG9H 1AVGH 1LPZB 1E35B 5EXLA 3GOVB 6GCHF 4ISNA 1NFWA 2LPRA 1NO9H 5K0HA 1KXCA 1TGBA 3QDZB 1KXFA 1N6XA 2Y7ZA 5F03A 4UD9H 1TGTA 1HYLA 3M7QA 1CBWB 3ZVAA 2WV4A 6CHAB 4NA9H 1QCPA 1UTKA 1RJXB 1HAHH 3CENA 2J34A 1ELCA 3UR6A 1ANDA 1S82A 3M3TA 4X0WU 1EASA 1W11U 1O3OA 1DM4B 1D6RA 3M5OA 4CHAB 5KEDA 3GISB 1ZSJA 2QF0A 1P2NA 1C1OA 4UFGH 1D6WA 3ODDA 2VWMA 3FZZA 3O8RA 3R0FA 3RMLH 2ZHQH 2J95A 1ELBA 4CRGA 3ZZCA 1F0UA 1EAWA 2J97A 4D7GA 5T1VA 1P09A 1W7GH 4KKDA 1S84A 4YXWD 3SJOA 3M3SA 2RG3A 1DWBH 1LHDH 1Y3XA 3MH4A 5I46H 1ZYOA 2VIQA 3NZIA 4X6MA 4TY7A 5EGMA 5FPSA 1NESE 3GYLB 1HIAB 4Y8YA 3F2GA 2BB4A 1DWEH 3ZZDA 4IS5A 1MTVA 4TYDA 1WTHD 3STJA 2A31A 1OWDA 1P3CA 1XXDA 4R8TB 3PV4A 1DSTA 4GAWA 1SGRE 2VVUA 4E7NA 5GXPA 2BX4A 1C9TA 1MBQA 3SJKA 1SGQE 3TGIE 4H6TA 1LTOA 1ZZZA 3W94A 3GICB 4WMFA 2P8OB 1ABIH 1LVMA 1CA0C 1Q31A 2ZC9H 1O2YA 1BRCE 1W10U 1CGHA 2C8ZB 1G3DA 4X6NA 2ZFPH 1DFPA 3BIVH 1HV7A 1W2KH 1EAXA 3BTDE 4FUIA 4OS1A 2YOLA 4AGKA 1OPHB 2A32A 2VIDA 3STIA 4ABDA 4MNVA 1GI3A 1D3DB 3GY7A 1WCZA 1Y3WA 3GY5A 2KCAA 4XBBA 4P02A 5B6OA 3RXAA 2UUJB 1QURH 3I78A 4X2XA 3U8RH 4AZ2B 1DOJA 1G30B 4FUGA 4NWLA 1SI5H 3AW1A 1XUJA 3MTYA 3P70B 4WJG2 2PGBB 2ZZUH 3PV2A 1O2QA 3ZZ3A 3TIUA 2CGAA 3MH7A 3BG4B 4DT7B 2GZ8A 2UUYA 5C3NA 1AWHB 2XWBI 4Y7BA 1ELDE 1DXPA 3U1JB 1AZZA 2GX4A 3RXFA 4B71A 5DP4A 3BG8A 1LHEH 1OWJA 3DT0H 3ESTA 1JXPA 3MFJA 1GBJA 3O8CA 4GCHG 3SU5A 2XC4A 3NK8A 1K1JA 5F8XA 1SB1H 1T8NA 3TH3H 2W7SA 3BSQA 2XCFA 1XUKA 2WPJS 3SUFA 1O32A 1BOQA 2D8WA 2H9EH 4GCHF 1G3BA 1O36A 3RXPA 2STBE 3M3VA 2HLCA 2PTNA 1ETRH 1GL0E 4QT8C 2BDYA 2J94A 2OC1A 3TLOA 1UVOA 4WH8A 1BHXF 2FP7B 1FY4A 4ACAA 1AU8A 3K6YA 1O2OA 1Y59T 3OFND 3SHAH 2ZGJA 3QX5H 2ZQ2A 2P16A 4MPXA 1IOEA 3B23B 2F9UA 2QCYA 3QTVH 3ATLA 2ZU2A 1Z1JA 2OLGA 4B74A 8ESTE 2BDHA 2C4FH 3PMBB 2PGQB 2BY5X 4X8SH 1NFYA 1SQOA 5DP8A 1G2LA 2PP6A 3VB3A 1EZXC 3EA7A 1GBEA 4BAMB 1ELTA 2PHBA 1TA6A 2G00A 2JH0D 2NU3E 2ZDMA 3M36A 2H5DA 1BMLA 3S0NA 4CR9A 3LJJA 3M5MA 1ELEE 1EB1H 5LPRA 3OEHD 5E8EH 2ZFFH 5C1XA 3V0XA 4X6PA 2FLBH 5DG6A 3VFEA 1MD7A 1NPMA 5FBIA 1MKXH 1A3BH 1TABE 5LPFA 3PO1C 2V6NA 2OQ5A 3GS9A 3S69A 3A7XA 2J5UA 1GJ8B 1EFRD 2SFAA 3SU6A 1CGJE 1IQMA 1MZDA 2UWOA 4YT7H 4OS6A 4E05H 1XX9A 2LP6A 3EYDA 3MU1A 4ABJA 1FN6A 3DUXH 1UCYK 2XBVA 4Y0YE 2Y7XA 2W3KA 3HATH 1QA7A 3RXIA 4GHQA 5F8ZA 3TJVA 3PTBA 1N8OC 1TMBH 3Q3YA 5EW2H 1KLJH 4BTTB 4Z6AH 9LPRA 2H9TH 2WV9A 3RC4A 3MNCA 3G01A 3P8NA 4Y71A 3MNBA 2JH5D 3OYPA 4I8GA 4CH8B 1QJ6B 1C5TA 2KM0A 4INHA 3RXJA 3A7TA 2FZZA 1C1WH 2AIQA 3M7UA 3N7DA 3HGNA 3WWFA 1IQNA 1C1RA 1FAKH 4BTUB 2ULLA 1LVBA 3F68H 5CDFE 1UCYE 4B6FA 3ZVFA 3GCOA 1T8LA 2A5AA 4ASHA 1BTXA 2ZGXH 1TONA 1SGDE 1WV7H 1FPCH 2K1QA 3ATKA 2PKSC 2ANKH 1O2PA 4A92A 5BPEA 1GBHA 4BAKB 8GCHF 1L4ZA 1GI9B 3SHCH 3WW7A 2VBCA 4GUXA 1GMDF 5A0CA 2Z9IA 1DLEA 4YM9A 1ZPBA 4MNWA 3DSPA 3SI4H 2Z94A 2QY0B 1C5WB 4TWYA 9ESTA 2G8TA 1HAXB 1J15A 3D62A 1ZMNA 2ZFTA 3A8DA 4JZFH 2R0LA 1NBME 1YKTA 1HAVB 3LKWA 1C5NH 1ZRKA 2BQ6B 2JETC 1RIWC 3UWJH 4B76A 4ZMAH 1SKYE 1MMJN 1UTOA 1C1PA 1HJ9A 1DUAA 1JRSA 2KR7A 3OY6U 1T31A 5GNDA 1HRTH 1A7SA 1Y5UT 1SGYE 2ANYA 3TJOA 5HXFA 1YPJH 5EU8A 4NIYA 3F1SB 5EODA 2FESH 1HB0B 2ZFQH 1TFXA 1C2EA 4NIWA 3NUMA 5EPNA 2O8WA 2WSSD 2ZGBH 4ABIA 1KDQB 4MPWA 2GV7A 1JIMA 2VIPA 1P3EA 2Z3DA 4K60A 1ANBA 4F55A 1SHHB 1ID5H 1WYKA 1EJNA 2AYWA 3V7TA 1W14U 1A3EH 2XC5A 1H8DH 1RXPA 1F7ZA 4DOQA 2GT7A 1SQAA 1C4Y2 1Y3UA 1O2WA 1C1SA 2XYAA 3B9FH 1O2ZA 2ZHWH 1GI5A 1GMCG 4THNH 1QTFA 2QF5A 1FMGA 1BMMH 2HPQH 2PSYA 1GJ6A 1BRBE 4IN2A 1ZSLA 5JPMH 2SNWA 5FX6A 1HJ8A 5C94A 2CN0H 1YF4A 3UAIC 2ZO3H 1DE7H 1F2SE 5LPEA 4MQAA 1GHYH 2OBQA 3A83A 7GCHG 3TH2H 1KXBA 1O3NA 2NU1E 3U8OH 4Z1MD 1W0JD 2A2XH 3KCGH 2FO9A 2TIOA 3BTTE 4DT4A 1S0RA 1FONA 4WH6A 1MH0A 3KQEA 4UFEH 2SGAA 1HPGA 4ZKOU 1YLCA 3PV5A 1QL7A 5C67A 2JIZD 2F9BH 1BB0B 1YYY1 1Z71A 1GG6C 2IPHA 1O2MA 4X8UH 5AF9H 4A1XA 4GPGA 2ZHFH 1V3XA 3LGYA 2H2ZA 3ZZ4A 1P01A 1E38B 1BITA 3TK5A 1O37A 3ZIAD 3HKJB 5HM9A 3OTJE 1S85A 3SOSA 4DG4A 1O2NA 1CO7E 1W7XH 1V2NT 3ZZBA 1O3FA 1JMOH 2FOFA 2D2DA 1A4WH 1TAWA 1W8BH 3ITIA 1L4DA 2P3TB 2WUBA 3F6UH 1HAPH 1H8HD 4Y0ZE 1YLDA 2O8TA 3URDA 2O8MA 2P94A 1Z8IB 3S9AA 4E06H 2GGVB 2XBYA 1C2FA 4DGJA 3NRLA 1FI8A 4INLA 3F9HA 3E0NB 3A8BA 3TVJB 3K6ZA 4RKOB 4X8VH 1EQ9A 2ZTYA 3A89A 2OC0A 5T3HA 3ZYEA 1BMFD 4HFPB 3FN8A 2OUAA 5EJ1A 3FP6E 4H4FA 4OGYA 3SNCA 1O5EH 5AFZH 1UTNA 1TALA 3T29A 3Q3KA 4HI3A 4FUCA 1P05A 3LGTA 2W6JD 3BTWE 3P95A 2ZEBA 3MU4A 1BIOA 5JB8S 2GT8A 3LPRA 3OEED 2FMJA 5A0AE 1P11E 1T8MA 2YNBA 3TITA 2HALA 2VNTA 3H7TA 3DFLA 4MDSA 2ZCKP 4IC6A 2EI6A 1UK4A 5C1YA 1OX1A 4AYVB 3Q77A 1TWXB 1O30A 2AFQB 3SNAA 1J17T 4F48B 4I7YH 3PRBA 2YMSB 1SGNE 2FX6A 4ZAEA 2G4TA 4MPVA 2NU0E 5F53A 1GI0A 1Y3YA 3VXEH 2W6ID 1GHWH 1WAYB 4YTAA 1Q3XA 3DD2H 1PPBH 4Q7ZA 1DSUA 2PKAB 4DIIH 3QWCH 4VGCB 4E7RG 3SORA 3OTPA 1O2HA 1ORFA 2FWWA 3U1IB 3SI3H 3FVFB 2FLRH 2VGCC 5F6MA 2ODYB 3ATIA 3L6PA 1A46H 1LPKB 3ZYDA 1DVAH 3MWIU 2GKVE 1TNLA 5EQSA 4YZUA 1HAYB 2BQWB 3SNBA 2FOAA 1O5GH 5E2PA 1BBRK 2PFEA 1C2JA 2BOKA 2BY7X 1NFXA 3MO3A 1AN1E 1S83A 1WOFA 5HYOA 3AAVA 4AB8A 5JBCS 4X8TH 5A09A 1SFQB 3SV8A 1GHAG 4O97A 3MI4A 1DDJA 1SGFA 4B6EA 1TGNA 4A6LA 1PPZA 2Y81A 2EA3A 4K69A 1SOTA 1W12U 2R2MB 4PROA 2QF3A 4X1RU 1ZGVA 2C8WB 1NN6A 1PQ7A 1K9OE 4GHTA 1ZGIA 1XKAC 1P2JA 4NIVA 5G4BA 1P2IA 2OXSA 3SV2H 1BBRE 1GJDB 2FEQH 4WXVA 4HGCA 5EQQA 3BF6H 2VINA 5LH8A 1UK3A 4J2YB 8KME2 5DP9A 3U9AH 3UFAA 3BN9A 1L1JA 1IQJA 3BEUA 1AUTC 3HKIB 1ESTA 1JOUB 1MAXA 1NS3A 3C1KA 2W3IA 4UONA 4LXBH 1MBMA 4CBOA 1ESAA 5ESBA 1GBKA 4Y6DA 3A7ZA 3SN8A 3OE7D 2RA3A 1C1NA 1AHTH 4H42U 2CF8H 2F9PA 4OS4A 2GVFA 4R0IA 2V35A 3M7TA 1O3AA 2EC9H 1TBRH 4OS7A 1F92A 1U6QA 3UWIA 4U32A 5FCKA 1P9UA 5C2ZA 1TB6H 1TIOA 2BLOA 2G52A 2ZECA 3DHKH 3P8FA 1O3JA 1OS8A 3GCHC 3NKKA 2ODQA 1WU1A 2Z9LA 1G37A 2WYJA 1ZTLA 1AFQC 1TNGA 2CHAC 1ZHRA 4BXWA 2F83A 1V2UT 2Q6FA 3VEQB 1G3EA 1P04A 2V3OH 1SR5C 2XCNA 1GBTA 1K1OA 2L74A 1TOCB 1ZPZA 2SGPE 1AQ7A 2H9HA 5GJ4B 1K1NA 5JBTA 1NFUA 3QGJA 1TX8A 2Y80A 1BT7A 5L2YH 1QNJA 2THFB 3N7EA 1QJ7B 3UPEA 3CS0A 4LOYH 5JB9S 1E0FD 2ANMH 1V2JT 1FIZA 1O39A 3PYHA 4JK5A 1UW7A 1E34B 1GBMA 3T27A 1QZ8A 1BQYA 2C3SA 2EQNA 2TGDA 1YPEH 4MLFB 3UQVA 2FXRA 2O8LA 2BY9X 3ZV8A 1O2TA 4I31A 1SGIB 1A0HB 1P06A 2AIPA 1GDQA 3JZ2B 4WXIA 5GPIB 2A5KA 2EEKA 3F3BA 2VH0A 4IMZA 4WWYA 1EOJA 1NRQH 2QXGA 3TGJE 3P17H 4GLYA 2HOBA 3U28C 4Q80A 1PPHE 4Y7AA 2VIOA 3VB6A 4DVAU 1K21H 2P59A 1ZHMA 1Z8GA 4JMYA 1TRMA 4BTIB 1TA2A 3A8CA 1MTNB 1C1VH 1N6YA 3FO8D 3AAUA 2XBXA 1F5RA 2FPZA 1W13U 4NA7A 3LC3A 1AKSB 5GCHG 1UCYH 3M37A 1GBBA 1FY1A 1NT1A 1V2WT 1A2CH 2NWNA 2RDEA 3MO6A 3RXRA 1BZXE 1ESBA 2A1DB 3MU8A 2KAIA 1A5IA 2LELA 2ZDAH 3ENSB 1KDQA 5GCHF 1EZQA 1NTPA 5L30H 2FX4A 4K8BA 2P3UB 2C8XB 4JZIA 2GMTC 1GBCA 1MTSA 2XTTB 1HJAC 2BX3A 3A80A 4NSYA 1GJAB 2BY6X 2ALVA 3LJOA 4AN7A 2Q6GA 1DXWA 1ZTJA 1CQQA 2BVRH 2OP9A 3LOXA 3NWUA 1G2MA 2FI4E 4FU8A 5FAHA 3URCA 1SLXB 1O5FH 3A88A 2BD2A 4TWWA 3BEFB 5AVDA 2GV6A 2G55A 4ZH8A 3FP7E 3BTGE 5JYIA 1O2SA 1C4V2 3SYJA 3UNQA 5F8TA 1H9HE 1KMHB 5E0JA 1UVSH 4O9VA 1K28D 1NU7B 1TX7A 1ZJDA 3D49H 2STAE 2ZU4A 3A8AA 4CRBA 1ELFA 1IQIA 2B8OH 3IG6B 4IW4E 1ZJKA 4XBCA 2LNCA 1SL3A 2BD5A 3IWMA 4A5TS 2QXJA 4XDEA 1K0HA 1A1RA 4AFQA 1GBFA 5JDUB 1AD8H 3M35A 1AY6H 3UTUH 4AFZA 1K22H 2PSXA 1J9CH 2FI3E 3PMHB 1C2LA 1T4VH 2WYGA 3RXQA 4D9RA 1W0YH 4ZROA 3UQOA 1P2QA 2ZQ1A 3DFJA 1PFXC 1A0LA 2F9VA 4ZHLU 1XVOA 3RU4E 2OK5A 3E0PB 1XUGA 4RT1A 1W0ZU 1GCTC 3KYGA 1ZRBA 2GCTB 1ARCA 2WPKS 3SV7A 4P00A 5EG4A 1LPGB 1C5OH 3F0PA 2AGEX 3RU4D 1GMHG 2G51A 2FOCA 1PJPA 1CHOF 3S7HB 2ANWA 1YWUA 1CU1A 1P2MA 4Y10E 4AOQA 1AGJA 1WSSH 1O3BA 2VB0A 2BDCA 4D8NA 1GMHF 2R0KA 1CA8B 3KN2A 4MG3A 2ZHEH 1CBWC 1KTTB 1FZZA 1HDTH 2OD3B 2ZFRH 1TGCA 5HMAA 1LKBA 1O3DA 5C1UA 3MYWA 5CMXH 1XUFA 2HWLB 2PTCE 2GJGA 1F5KU 1H8ED 1IAUA 3BTHE 1E37B 4CHAC 4XD7D 1OP8A 3ZZ6A 1SLUB 2PLXA 1EXFA 1DANH 1GI4A 1MUEB 1C5RA 1K2I1 1OYTH 2Z6BD 4YT6H 1LQEA 4FU9A 3TH4H 1P9SA 1AIXH 2GP9B 3LGVA 1C1QA 2ZIQH 1XM1A 1FXYA 2FOHA 1G9IE 1C5LH 3QUMP 4K3JA 4I86A 2FM2A 1RRKA 4FUBA 4H6SB 2HVXA 4YESB 4AFUA 1W3CA 5J4QA 3EE7A 3V3MA 5GDSH 2BDGA 1S6HA 1ETSH 1QB6A 1UHBA 2PKAA 1UTLM 1OWKA 3VG8A 2ESTE 4NFFA 8GCHG 2ZU3A 1BMAA 2C93B 1O5BB 3TJNA 4X2YA 1S0QA 2BLVA 1QL8A 4ZXYH 1GMDG 2G81E 2OC7A 3M5LA 4Q63A 3SUDA 4MTBA 3UR9A 4HG6A 1IQHA 1YBWA 2P8OC 1VITF 5FCRA 5GIBA 2V7QD 5EIYA 4K8YA 3SNDA 1C9PA 1O2LA 2ZDVH 2XXLA 4O3UA 1C5PA 1THPB 1EP5A 1IQEA 2GCHF 5FX5A 1AE5A 1M9UA 4M7GA 5T6DA 1AUJA 1WTGH 2ZP0H 1TE0A 2ODPA 1LHGH 4TT3D 2BD9A 3RLWH 1FJSA 1EPTB 4AG2A 2Z9GA 1B7XB 1TBZH 1SPJA 2R2WU 1SSXA 1D3TB 1LKAA 1QIXB 1XVMA 2Z9KA 4B2BA 4D76A 5LGOA 2IJD1 3BTEE 1C5YB 5DP3A 1EZUC 3BG4C 3LGIA 1LVOA 2I6SA 2VWOA 1NRRH 3PWBA 3FFGA 1IQFA 1JWTA 1BTWA 2UUKB 1RTFB 3TPIZ 1YP9A 4ZHAA 2VIWA 2B7DH 4X2WA 1MCTA 4BXSA 1AZ8A 4TPIZ 2O8UA 3ZV9A 3ODFA 3QLPH 2NU4E 2A2QH 2WUCA 1MU8B 3OU0A 2VWLA 2H1UA 4Y76A 1Z1IA 3O8DA 1GHVH 1MZAA 3SU1A 3HPTB 3UIRA 3LH3A 2D1JA 1S5SA 5BRRE 1VGCB 2KCPA 1YPKH 1GGDB 3GCNA 2P3FH 1MTWA 4BOHA 1TNJA 1V2KT 3QTOH 5K7RA 3PMJA 1YCPK 3HK3B 5TCAA 1NRSH 1BBRH 3MU0A 1YY3A 3RXHA 1H8IH 3BTME 3VXFH 2SGEE 2P93A 4NSVA 2BZ6H 1H9LB 2F3CE 2BXUH 2R3YA 1AMHA 2WPHS 3A87A 1Z6JH 2FTMA 1JBUH 1L1GA 3QZQA 4JZDH 1TRYA 5C17A 3SZEA 1AB9B 3GY8A 3M5NA 2QA9E 1AFEH 3ZZ9A 2ZPSA 4FUDA 3SU0A 1EJMA 4GSOA 5CHBA 5L2ZH 1O3LA 5ESTE 1QFKH 1P2KA 2V3MA 1QRZA 3FANA 4F49A 4IBLH 1SOZA 1L1NA 3A7VA 1HIAA 3VPKA 4CBNA 1O3KA 2TBSA 1O3GA 3F9GA 4WMEA 4Y8ZA 1O5DH 4ISOA 1C5XB 3ATMA 3RM2H 4ABEA 1DICA 1GHBF 1DITH 1WQSA 4FVBA 3PTNA 1QB9A 4ZXXH 1FDPA 1ZLRA 1T32A 5HM2A 1C5SA 1RTLA 3I77A 2A7JA 1C5UA 1DY8A 3IITA 3BIUH 1EJAA 1LVYA 2H6MA 2FS8A 5C20A 3N7OA 3A82A 4RI0A 5PTPA 2ZGCA 3VGCC 1EATA 1GJ5H 4AG1A 1ANEA 1X7AC 1FAXA 1AKSA 1TNHA 4K1EA 1P2OA 1V2ST 1GBIA 3OX7U 1AE8H 3U98H 2TGPZ 1A61H 2K0QA 1G36A 1C2DA 2ZG0H 2ZDKA 3UREA 3QZRA 2AERH 2Z7FE 3RM0H 2BMGB 3RXGA 3D65E 3F9FA 1F0SA 3CP7A 1O2RA 3GY2A 1OWEA 1PYTC 1TQ0B 5FHTA 1LO6A 4YLQH 5KECA 2UWLA 3A81A 1CT4E 3ZZ7A 3SBKA 1NROH 4ZKRU 2AMQA 2AMPA 2A4QA 3ZZ8A 2GTBA 3PLKA 3KQDA 1HLTH 2ZCLP 4HZHA 5EPYA 1TLDA 3OAAD 1AWFH 1H1BA 3O8BA 3MH5A 3T62A 1CA0B 1O2JA 3ZVDA 1ANCA 1O2KA 2JJ2D 2SGQE 1T4UH 2W5EA 3EGKH 4BNRA 4TPYA 1QRXA 4IGDA 2AMDA 1VCPA 1GI1A 3FAOA 1SGCA 1GI6A 2BOHB 3RMMH 5B6LA 4I33A 2Q1JA 2IOTA 2ZGHA 1H4WA 4XSKU 2JKHA 2QXHA 1QB1A 2O9QA 1BJUA 3GDVA 5ETXA 5CHAC 1NC6A 1E1RD 2ALPA 2A45B 1SLVB 3LC5A 4BAQB 4CREA 1AVXA 4XFQA 1BA8B 4X1SU 1GHXH 4ASUD 1TYNA 1EUFA 5AHGH 1QA0A 2G4UA 4RN6A 2BDIA 2F4LA 3KQ5A 3DCLA 4X1QU 3C27B 2FOEA 4LZ4B 5C5OA 1UTPA 3KIDU 3RXDA 2HNTF 2FODA 1KTSB 2C90B 5IYTA 4BAOB 3MNXA 1BRAA 2OTVA 1Y8TA 4O3TA 3RU4T 5EJLA 2XWAA 1YCPM 3P8OA 1EOLA 4K2YA 3RXUA 3SQEE 1YGCH 1JRTA 2Q6DA 4Q7YA 3RUOA 2WHXA 4NIXA
chains in the Genus database with same CATH topology
1HBTH 2G5VA 1HFDA 3GYMA 1AO5A 1FPHH 2BY8X 2Y5FA 2ZTZA 1TX6A 1VCQA 2HNTC 3RP2A 1B0EA 3P8GA 2CJIA 1J14A 1KLTA 3H7OA 1GBLA 4CRDA 1YPHC 5FXLA 4Q4LA 1V2OT 2Z3CA 1TPOA 2FTLE 3AASA 5SGAE 4OGXA 1INCA 4K1SA 1PPFE 5TJXA 1TNKA 1ZR0A 2KCYA 1O3CA 1ZHPA 3KNXA 3JZ1B 1A5HA 5EXMA 2ASUB 1CT2E 1VJ9U 4CRCA 1BHXB 1Y5AT 1GI2A 3LU9B 2Y5GA 2R9PA 1RS0A 2BHGA 2VVVA 2A4RA 1O34A 3DSOA 2GZ7A 1MKWK 1IHSH 3QK1A 4MNXA 2WPIS 1Y5BT 2HGTH 4B2CA 1O3HA 3Q00A 3VB4A 3RXOA 1FY5A 1UMAH 2QXIA 1QHRB 1NU9A 1PQ5A 4I8LA 2VJ1A 1DT2A 3V12A 1TQ7B 1GVZA 1UJ1A 3PO1B 5T6GA 3SGBE 2QN5T 1FQ3A 4OM9A 1BDAA 1EAUA 1XXFA 4KTSA 1CHGA 1UVPA 1EKBB 5A8ZA 3SU2A 2AEIH 3AVZA 4RKJB 3WY8A 3SW2B 2B5TB 4JYTA 4ZHMU 3RC6A 1GBDA 1Z8JB 2C8YB 2FS9A 2JJ1D 2FDAA 1ETTH 1DX5M 2BZAA 5DKMA 5FL7D 4WF8A 5C5NA 4MPUA 1C2IA 1FNIA 2ZDLA 4CRAA 5L6NH 1KYNA 3E16B 2PW8H 4NZQA 1N8OB 1S6FA 2IJOB 2PV9B 1O3MA 3Q3XA 5HKKD 2CK3D 5EQRA 4FUFA 4NGAH 2OCVB 3TNSA 2A0QB 2XRCA 3TNTA 3H09A 1HAVA 2KZ4A 3S9CA 1CSOE 5DGJA 3A85A 5EW1H 1QL9A 1TNIA 4KTCA 5DSFA 1EPTA 1K1LA 1TPPA 7KMEH 4NZLA 1AI8H 2DE8A 4JCNA 2K8IA 1FY3A 4ZKSU 1SFIA 3TU7H 4U2WA 5CE1A 2ZU5A 7LPRA 4SGAE 5IDKA 7ESTE 1E1QD 3UOUA 1XUIA 3ZZ5A 2FYQA 3PLPA 2PKSB 2YMSC 3SO3A 2CMYA 3OSYA 5AFYH 2M5TA 1SG8B 1D4PB 1ELVA 3NCLA 2ZPQA 4ZKNU 3T28A 2J38A 2XNDD 1ZSKA 2BLWA 4VGCC 1P03A 2XNIA 4ISLA 1O31A 5A0BA 5C0UA 3SV9A 1UK2A 1GI7B 4ESTE 2CXVA 2SGDE 3GY4A 4AGJA 4M9FA 1FIWA 1GBAA 2ZWLH 3LGWA 2BLQA 2XW9A 3MH6A 2JDID 4A1TA 1EZSC 4NWKA 2JETB 1RIWB 2BM2A 1SC8U 1JIRA 3KHVA 1O2VA 1XMNB 1P02A 3UB0A 3SJIA 3F9EA 3MU5A 1YM0A 5DP7A 1HGTH 2B0FA 3A84A 2J2UA 2AS9A 2BVSH 2TGAA 3SJ9A 1BTZA 1GDUA 1MCVA 1OHHD 3RXSA 1TRNA 4I8JA 3VB5A 3BEIB 1PQ8A 3S9BA 3MOCA 3H5CB 2OBOA 3KGPA 3UNRA 4JYVH 4AX9H 1BJVA 1BRUP 1K1IA 1WUNH 2FOBA 4ABBA 1NZQH 4XBDA 3HK6B 1QGFA 3KF2A 5EXNA 1EX3A 3EDXB 2A7HA 1HNEE 2EI7A 1IQGA 1ZMJA 4AFSA 3BTKE 1OP0A 1DLKB 1MD8A 1B0FA 1CHOG 3K2UA 2CV3A 1O2UA 2WHXA 1OWHA 3S7KB 4MNYA 1C2HA 2VH6A 4I8HA 1C4U2 4AYYB 1O2GH 2ZPRA 1YC0A 4DJZB 4J1YA 1UVTH 1YPMH 2B9LA 3E91A 1L2EA 1O38A 1OYQA 4RSPA 1UO6A 1C1TA 5DPAA 1LHFH 3A7WA 5GWZA 3GY3A 2FOGA 1HAIH 4TSFD 2QE7D 2ZF0H 4NCYA 5FPTA 1V2MT 2M2AA 1S6LA 4IN1A 4CRFA 6CHAC 3LONA 4X1PU 1V2QT 1ARBA 4ZCNA 3RXVA 3TK6A 1OP2A 4JYUH 4FVDA 4Y8XA 1FN8A 4B2AA 1GG6B 2SGFE 3SGAE 1GDNA 4FUHA 1NM6A 1GJCB 1RD3B 4NA8A 3MHWU 3MNSA 3VB7A 4ABFA 1J16A 4KTUA 2Y6TA 1FY8E 3F0OA 5IK2D 4D9QA 1RTKA 1KXAA 2YNAA 2FIRH 2ZHDA 3RXBA 2WINI 1GI8B 1MTUA 2ZKSA 3EQ0H 1O2XA 4WVPE 2ILNA 1YPLH 1WBGB 1A5GH 1N1LA 2A5IA 1YCPH 1K1PA 1A0JA 4XOJA 1S81A 1SLWB 1VJAU 1WQVH 3KEEA 1V2VT 4TY6A 2OC8A 1BTYA 4ISHH 2QC2A 3AW0A 3SUGA 2RCEA 2FI5E 3ATWA 4IC5A 1T7CA 3BV9B 1RGQA 3SNEA 3PRDA 3QO6A 3N99A 3PLBA 5DP6A 1THSH 1ZTKA 1P12E 1SGEE 5ABWA 1FV9A 4JZEH 3VGCB 4DCDA 1MABB 6ESTA 3WWBA 1O3EA 1C1MA 5DP5A 1VITG 3LT3A 3ZVCA 4X2VA 2PUXB 1PQAA 4LZ1H 1KY9A 2FOMB 2XC0A 3Q76A 1NY22 2G5NA 3SGQE 2GCHG 1QJ1B 4YLUA 3W1EA 1DUEA 1MTNC 2A4GA 4ZUHA 1L0ZA 2UWPA 4WY3A 5TCCA 2WPLS 1SVPA 4MVNA 3FZDA 3E8LA 4Q2KA 3RMOH 1OKXA 2SNVA 1TGSZ 1HCGA 2WPMS 5A8YA 1B5GH 3P92A 1V2PT 4JK6A 1C5VA 2VIVA 5T6FA 1PYTD 4OS5A 3E6PH 1DWDH 3SZNA 3W95A 2TPIZ 2W26A 3SJ8A 4Y11E 5JBAS 2OQUA 3ZVEA 1P10A 4F4OC 1HXFH 2AH4X 3FOAA 1GVKB 4YOIA 4CH2B 2QF4A 2AGGX 4O03A 3D23A 2F9NA 4YOJA 2ZNKH 3EAJA 1TOMH 2VGCB 8LPRA 2J9NA 1LCYA 4BANB 2BD4A 2BQ7B 2A4OA 3SQHE 3GCTG 4ABGA 1G32B 5C0TA 3QGNB 5HGGA 3F2HA 2FYRA 3F2FA 1V2TT 1CE5A 4KGAA 5CHAB 1ELAA 1TBQH 2ZI2H 2BVXH 3RXMA 3T26A 3GCTF 3GDSA 1LMWB 1SGFG 1NBMD 1EAIA 3MMGA 3KL6A 3E90B 1P8VC 3RC5A 2PR3A 1V2RT 3GY6A 1QR3E 1QQUA 4K1TA 2BDBA 2AHME 1UTJA 2ZFSA 4FXGH 2KAIB 3FP8E 1PPGE 2W7UA 1O2IA 3PM3A 2I6QA 4FUEA 1O33A 1HAZB 1XKBC 3E3TA 3RXCA 1MKXK 1COWD 2J92A 5DO4H 3RXLA 1BUIA 1GJ4H 5FBEA 2GDDA 1Z8RA 3MO9A 3RXKA 1RFNA 4FUJA 1DY9A 1Y3VA 3PROA 3PWCA 1ABJH 3SV6A 3RDZA 2GCTC 4B75A 1WXRA 1LHCH 1IQKA 1SGPE 2HNTE 5FPYA 2Y5HA 1D3QB 2BD7A 2H5CA 2P95A 4X1NU 1TMUH 3LGUA 2KCOA 5I25A 1C2GA 1GMCF 3ZVBA 1UTQA 4AB9A 3KQCA 1YPHE 3L33A 1O5CB 5E2OA 4NFEA 3SU3A 1GWAA 1MAYA 3I29A 2BYAX 2F91A 1GHBG 1QQ4A 4Z0KA 7GCHF 2DUCA 1C2KA 3GCHB 1BCUH 1D3PB 4UFFH 2XOKD 1DWCH 1AFQB 4SGBE 2F9OA 3TJUA 2CHAB 2BDAA 4X6OA 3M61U 2PWXA 2ZCHP 1MQ6A 1GPZA 4XE4A 4FU7A 3RLYH 1THRH 4AORA 3RMNH 1CVWH 2F43B 2A7CA 4DW2U 4ABHA 5J4SA 3R3GB 1DS2E 3K9XB 2TGTA 1V6DA 5EOKA 4KELA 1O35A 1GHZA 4WMDA 1NRNH 2J4IA 1KXEA 2BXTH 2IN2A 1F5LA 2XBWA 2GDEH 1C5ZB 4ISIH 1C5MD 2NU2E 1HUTH 1SQTA 1GJ9B 5A2MH 1PPCE 3U8TH 2ZTXA 1MKWH 3RXEA 4K5ZA 1E79D 1MU6B 1QRWA 3P6ZB 2ZU1A 4UEHH 1F0RA 1SMFE 3CS7A 1EP6A 1VCWA 1FX0B 1HXEH 3ELAH 4UE7H 3UUZA 2WPDD 1GCDA 2UUFB 3EE0B 3EA8A 2WZQA 4OS2A 1OSSA 1YPGH 3A7YA 2V3HH 4YO9A 1UVUH 5E0HA 1ACBE 1TPAE 2VVCA 4JZ1A 1TMTH 4LK4A 4UDWH 3LIWA 3L3TA 3ZVGA 1LDTT 4INKA 1KXDA 3DA9B 1CGIE 3EA9A 1K1MA 1BTUA 2BD8A 1QBVH 1D9IA 1CT0E 1QBOA 4BAHB 1W0KD 2GD4B 3KQBA 1QBNA 1XUHA 1T8OA 1BTHH 1J8AA 2BTCE 2R3UA 4GVUA 2KFWA 3GDUA 3TGKE 1ZMLA 4A7IB 1O0DH 1IQLA 2ZDNA 1EPTC 1OWIA 3UY9A 1EB2A 4UFDH 2RDLA 2GMTB 2V0BA 1UHBB 1UTMA 1HJAB 1AVWA 5H4IB 1GVLA 2PUQH 2AGIX 1GL1A 2VWNA 3LH1A 5DN6D 1G3CA 3BTQE 1P57B 3B8JA 4Y79A 1VR1H 2QIQA 2YMSD 1O3PB 2QGRA 3NXPA 4FETA 4HTCH 4ABAA 4B1TA 1OOKB 3NPSA 4IMQA 2D26C 2QV1A 6LPRA 4DY7B 1O3IA 1C5QA 2DE9A 2EI8A 2OINA 3K65B 1ELGA 4CR5A 1FUJA 4U01A 1VITH 1OXGA 3OY5U 3T5FH 1Q2WA 3PB1E 1FLEE 4B73A 3QN7A 2RA0A 2TRMA 1PPEE 1DPOA 5DJ7A 1LQDB 3TK9A 1TPSA 1HAGE 3HGPA 1VZQH 2JH6D 4A1VA 2ZA5A 1GJBB 1Z7KA 3LDXH 5DK1A 3T2NA 1MQ5A 3FKSD 3AK5A 4I8KA 1ZPCA 1KSNA 1GHAF 2QAAA 1O5AB 1F0TA 1QY6A 1VGCC 1GGDC 4DURA 1C2MA 1H9IE 1V2LT 2CF9H 2HPPH 2VU8E 3PMAB 4Q7XA 1P0SH 1KLIH 3V13A 1HAOH 2Z3EA 1NRPH 3UNSA 1GJ7B 3E1XB 1ZOMA 2HLDD 2Z9JA 2Y82A 1E36B 1SGTA 2HRVA 2QYIA 4YOGA 2GZ9A 4D7FA 3T25A 5A8XA 1BTPA 1KIGH 1Z6EA 3U69H 1GCTB 4KP0A 3SUEA 4DIHH 1SBWA 2L6OA 1C1UH 4I32A 3RXTA 3UOPA 1SHYA 3ZZAA 6GCHG 3SU4A 2WV5A 1AB9C 2BD3A 4U30A 3BTFE 1BMNH 1IHTH 3A86A 5JBBS 4NG9H 1AVGH 1LPZB 1E35B 5EXLA 3GOVB 6GCHF 4ISNA 1NFWA 2LPRA 1NO9H 5K0HA 1KXCA 1TGBA 3QDZB 1KXFA 1N6XA 2Y7ZA 5F03A 4UD9H 1TGTA 1HYLA 3M7QA 1CBWB 3ZVAA 2WV4A 6CHAB 4NA9H 1QCPA 1UTKA 1RJXB 1HAHH 3CENA 2J34A 1ELCA 3UR6A 1ANDA 1S82A 3M3TA 4X0WU 1EASA 1W11U 1O3OA 1DM4B 1D6RA 3M5OA 4CHAB 3GISB 1ZSJA 2QF0A 1P2NA 1C1OA 4UFGH 1D6WA 3ODDA 2VWMA 3FZZA 3O8RA 3R0FA 3RMLH 2ZHQH 2J95A 1ELBA 4CRGA 3ZZCA 1F0UA 1EAWA 4D7GA 5T1VA 1P09A 1W7GH 4KKDA 1S84A 4YXWD 3SJOA 3M3SA 2RG3A 1DWBH 1LHDH 1Y3XA 3MH4A 5I46H 1ZYOA 2VIQA 3NZIA 4X6MA 4TY7A 5EGMA 5FPSA 1NESE 3GYLB 1HIAB 4Y8YA 3F2GA 2BB4A 1DWEH 3ZZDA 4IS5A 1MTVA 4TYDA 1WTHD 3STJA 2A31A 1OWDA 1P3CA 1XXDA 4R8TB 3PV4A 1DSTA 4GAWA 1SGRE 2VVUA 4E7NA 5GXPA 2BX4A 1C9TA 1MBQA 3SJKA 1SGQE 3TGIE 4H6TA 1LTOA 1ZZZA 3W94A 3GICB 4WMFA 2P8OB 1ABIH 1LVMA 1CA0C 1Q31A 2ZC9H 1O2YA 1BRCE 1W10U 1CGHA 2C8ZB 1G3DA 4X6NA 2ZFPH 1DFPA 3BIVH 1HV7A 1W2KH 1EAXA 3BTDE 4FUIA 4OS1A 2YOLA 4AGKA 1OPHB 2A32A 2VIDA 3STIA 4ABDA 4MNVA 1GI3A 1D3DB 3GY7A 1WCZA 1Y3WA 3GY5A 2KCAA 4XBBA 5B6OA 3RXAA 2UUJB 1QURH 3I78A 4X2XA 3U8RH 4AZ2B 1DOJA 1G30B 4FUGA 4NWLA 1SI5H 3AW1A 1XUJA 3MTYA 3P70B 4WJG2 2PGBB 2ZZUH 3PV2A 1O2QA 3ZZ3A 3TIUA 2CGAA 3MH7A 3BG4B 4DT7B 2GZ8A 2UUYA 5C3NA 1AWHB 2XWBI 4Y7BA 1ELDE 1DXPA 3U1JB 1AZZA 2GX4A 3RXFA 4B71A 5DP4A 3BG8A 1LHEH 1OWJA 3DT0H 3ESTA 1JXPA 3MFJA 1GBJA 3O8CA 4GCHG 3SU5A 2XC4A 3NK8A 1K1JA 5F8XA 1SB1H 1T8NA 3TH3H 2W7SA 3BSQA 2XCFA 1XUKA 2WPJS 3SUFA 1O32A 1BOQA 2D8WA 2H9EH 4GCHF 1G3BA 1O36A 3RXPA 2STBE 3M3VA 2HLCA 2PTNA 1ETRH 1GL0E 4QT8C 2BDYA 2J94A 2OC1A 3TLOA 1UVOA 4WH8A 1BHXF 2FP7B 1FY4A 1AU8A 3K6YA 1O2OA 1Y59T 3OFND 3SHAH 2ZGJA 3QX5H 2ZQ2A 2P16A 4MPXA 1IOEA 3B23B 2F9UA 2QCYA 3QTVH 3ATLA 2ZU2A 1Z1JA 2OLGA 4B74A 8ESTE 2BDHA 2C4FH 3PMBB 2PGQB 2BY5X 4X8SH 1NFYA 1SQOA 5DP8A 1G2LA 3VB3A 1EZXC 3EA7A 1GBEA 4BAMB 1ELTA 2PHBA 1TA6A 2G00A 2JH0D 2NU3E