2GGVB

Crystal structure of the west nile virus ns2b-ns3 protease, his51ala mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
169
structure length
169
Chain Sequence
PKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWATTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
molecule tags Hydrolase
molecule keywords non-structural protein 2B
total genus 30
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ggvB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ggvB01
4BAOB 1E0FD 2G52A 1GG6B 4Y0YE 4X1RU 1AFQB 1NFWA 2ZDMA 4GCHF 1LHGH 3KEEA 3GDUA 1V2QT 4AGKA 5A8YA 4AG2A 1ZRKA 2A0QB 3PLBA 2XCNA 3OYPA 3ZYDA 1FUJA 2ODQA 1TBQH 1TALA 4Y6DA 1YPMH 4WVPE 3RP2A 2GCTC 1G2MA 1SGFA 5LH8A 1QA7A 1O2SA 4NZLA 3FP8E 5FHTA 2OP9A 3RXEA 1SGFG 1G9IE 2ZDNA 2VIVA 5H4IB 5A2MH 2AIPA 2TGPZ 3RXJA 2HPQH 1MU6B 1O5GH 3PTBA 4JYUH 1EQ9A 1V2ST 1EJNA 4OGYA 3UNQA 1DDJA 3ZVBA 3U1JB 1P8VC 1LKAA 1Y3XA 1KXAA 4I8KA 4ZXXH 3L33A 1HV7A 1XMNB 1G3BA 3JZ1B 4XSKU 3PMAB 4INKA 5DG6A 3SNBA 1MKXH 3PO1B 2ZKSA 1KLIH 1O5CB 1MTUA 3MI4A 2GZ8A 1C1VH 1K1JA 1C1NA 1NFUA 1NRNH 5TJXA 2VWMA 1O5DH 2BLOA 2EI7A 1HAYB 1O5FH 4TYDA 2QYIA 4Y10E 1EASA 1TNHA 4JZEH 3GDSA 1IQEA 3RDZA 1WBGB 2Z94A 1FNIA 1SSXA 5GXPA 3NWUA 1O36A 3BG8A 4OS2A 4K2YA 5CMXH 3HGPA 2ZPQA 4NIYA 1Y59T 1K1PA 1G3CA 4D76A 1VCPA 3G01A 1GMCF 1V2VT 1SB1H 5LGOA 3GISB 2FYQA 3BTQE 4NWKA 1Z8RA 3SW2B 1ELCA 2GP9B 3QGJA 3RMNH 3U9AH 1FXYA 4K8BA 5PTPA 4ABIA 4ABEA 1OKXA 3A7TA 2BQ6B 4FUHA 3LKWA 5GWZA 5A0AE 1EAWA 1JBUH 2H9TH 4AN7A 1LPZB 1AVXA 4IN1A 1GJ6A 1O3FA 4HTCH 2QGRA 1O33A 5T6FA 1GBBA 1RTLA 3RMLH 1P02A 4M9FA 2TGAA 3RXSA 4AYVB 3RXKA 2RA0A 3MTYA 1GI0A 1IAUA 1LVYA 4YTAA 1T8OA 1ELAA 2AIQA 1OP8A 1QTFA 3T29A 2EA3A 1B7XB 4B2CA 2THFB 3QDZB 5GCHF 1EOLA 1P06A 1C2FA 3ATLA 5GDSH 4TY7A 2BDBA 1V2OT 2FI3E 4BNRA 1XVMA 1WU1A 3A7YA 4INHA 4FUEA 2BB4A 2GDDA 2OBQA 1E36B 2OQUA 1C2KA 2PSYA 1K1MA 1O2QA 3BV9B 1BCUH 6GCHG 1XUGA 4BTTB 3PV4A 1QCPA 3A7WA 4F49A 4LK4A 3BG4C 2UUJB 1D6WA 1O2VA 1DY8A 1A5GH 4DT7B 2B0FA 4J2YB 1C5YB 4FU7A 1P2JA 3URDA 1BB0B 1DUAA 2FS8A 1Z8GA 5EXMA 9ESTA 1NFYA 3E90B 5A8ZA 1W0ZU 5JBAS 2P3FH 2ZIQH 2PKAB 1A0LA 4WF8A 3MWIU 1BQYA 1V2LT 5JBCS 1KY9A 2ZZUH 1OSSA 3ZVAA 1ZPBA 3UWIA 1O37A 1IQHA 2CJIA 5FPTA 2IOTA 4ZAEA 3ZZ9A 2JH6D 2BXUH 2AGIX 2Y5FA 3M7QA 1OWIA 2I6QA 2C90B 5EG4A 5ABWA 4IC6A 5FBEA 1O2WA 4YESB 2V6NA 5GNDA 1MAYA 2GZ7A 2FZZA 1DLKB 3GCHC 4X6NA 1GMHF 1QIXB 5EXLA 2R2WU 1ZZZA 1V2TT 1UVUH 1GJ7B 1GHAG 4O03A 1W3CA 2O8LA 8GCHG 2PUXB 1BTUA 1BTWA 1IQMA 6CHAC 4FUIA 4XFQA 3F6UH 3OY6U 1SGQE 1TMUH 3T25A 1AZZA 1CGJE 2ANYA 3NZIA 1MTNC 1ELEE 1UTLM 4ZHLU 1P0SH 2BY9X 4YLUA 3RU4T 1F0RA 1BBRH 1ARBA 3HKJB 2OINA 1UJ1A 1XUJA 1ELGA 2AERH 2XC5A 1HB0B 1GCTC 1GJAB 3TVJB 1Y3VA 5T6GA 1G36A 2Z9KA 2XCFA 5EU8A 2ANMH 2FOFA 1YF4A 3SU6A 3KF2A 3MH6A 1JXPA 5IDKA 3SQHE 3RXHA 2PKAA 4QT8C 3E91A 1CA0C 2Q1JA 2J9NA 4D7GA 3P92A 3UR9A 4AYYB 2FP7B 3BIVH 4A5TS 1NRPH 3QN7A 4ABDA 2CGAA 2FESH 1HLTH 4D8NA 1QY6A 2PKSC 1TBZH 2ZHEH 4XDEA 2Y6TA 3SI4H 1C5RA 2EI6A 3RMOH 1GGDB 4U2WA 1P11E 2WINI 2PR3A 3DUXH 3UNRA 2O9QA 4FUCA 3PV2A 2BX4A 5DP6A 3BTEE 6GCHF 5J4SA 2VBCA 3SNCA 1C1OA 3SN8A 1O32A 4KTCA 3V12A 2BDIA 1P3EA 2SGDE 1HAPH 2GDEH 1P2KA 4UDWH 3QGNB 1O2JA 4HI3A 5DKMA 2GKVE 1GBLA 2OD3B 2RDLA 1TE0A 1GJCB 4K60A 3RUOA 3MU1A 2BQWB 4FUGA 2IPHA 1LCYA 1FPCH 1DFPA 1YPEH 1O3EA 3MFJA 4FUDA 1O2OA 1HJ9A 1UK3A 1WQVH 1KXDA 2TRMA 5T1VA 1DE7H 3RXGA 2W7UA 1PPFE 4CRCA 5JBBS 1OYTH 2VGCC 1HIAB 3OY5U 2FEQH 1TGCA 1VJAU 1L2EA 2FWWA 1LHCH 3ATWA 1B0EA 2JH5D 1EZXC 3ZZ5A 1GMDG 2ZFPH 3RXQA 3EAJA 1CT0E 1TRYA 3BEFB 3SHAH 2UUFB 3MNBA 5DO4H 1O3LA 4ABJA 2BD8A 3D49H 2Z9IA 4MLFB 1C4U2 1MD7A 4DVAU 1SOTA 1QQUA 3A88A 3BEUA 4Y76A 5L6NH 5DGJA 2BDGA 3ZV8A 1QJ6B 4E7RG 5EODA 2HNTF 3E6PH 4YT7H 5EPYA 5DP7A 1TMBH 4B73A 5FX5A 4JK5A 3PWBA 1GDNA 1P03A 1DWBH 2W3IA 4I8JA 2ZHFH 4KKDA 4ZMAH 1EAUA 8KME2 1AFQC 1AGJA 1NS3A 3PWCA 4WWYA 1RIWB 1P05A 3S9CA 1SVPA 4MPXA 1NRQH 1QR3E 4NGAH 3VB3A 3M3VA 2PUQH 3BTDE 3SJ9A 2R0KA 1GI5A 4B6EA 4NA8A 3M5LA 3RU4D 3U69H 3VB7A 1FV9A 1PQ7A 2OXSA 5DP5A 1YBWA 5TCCA 1TABE 1L4ZA 2AMPA 1S6HA 1TNKA 3MYWA 1O31A 2G4UA 3KQDA 4I8HA 4CRFA 3A7VA 1TPAE 1GVZA 1Q2WA 2GTBA 3LGIA 3BTME 3DFLA 2F9VA 2BVRH 2OCVB 3ZVEA 5F6MA 2XC4A 5EPNA 1FN8A 5C1UA 1UVPA 2CHAC 2CV3A 5LPFA 2Z9JA 2ZECA 1W2KH 2AYWA 1DITH 1DXPA 2CXVA 5LPRA 2A5AA 3MH7A 1ZR0A 1HGTH 1DUEA 3M36A 3MU0A 1F5KU 1LTOA 4OS4A 1HNEE 4LZ1H 1SHYA 1O38A 4H6SB 1G3DA 3TGIE 2GGVB 5JB9S 1MCVA 4CH8B 2B5TB 3A83A 2P8OB 2D26C 1GBTA 1YPKH 1GHXH 2B9LA 1S83A 2F83A 4AFUA 2UWOA 3TH3H 3S0NA 5HMAA 5FAHA 3BTWE 3TNTA 1F5RA 4KGAA 1HAXB 3EQ0H 1AUTC 3U8TH 4XOJA 4I31A 5T3HA 2NU1E 3SUDA 2XWBI 3RC4A 4TWWA 1LQDB 1CHOG 3DHKH 2TGDA 5FPYA 1GCDA 2H9EH 1DICA 1EKBB 2B7DH 2BD7A 1H8DH 3E0NB 1C5WB 1HIAA 4J1YA 2WPKS 2ZHDA 2AGGX 4B6FA 4B74A 2ZG0H 3TGJE 1QJ7B 3NPSA 5FCKA 3V13A 2ZP0H 3E1XB 4Y0ZE 2H9HA 3QO6A 1P9UA 1YP9A 5L30H 2ZDVH 3ZVCA 1FI8A 1Y8TA 1UK4A 3LGUA 2Z3CA 1HJ8A 1MQ5A 1W12U 2FI5E 2O8UA 5T6DA 3PLPA 4KELA 1W13U 5C1YA 2PFEA 1LHEH 5E0HA 1FY1A 1JIRA 1AFEH 3GY6A 2XNIA 1LQEA 2EC9H 3SJIA 3ZVFA 4NA7A 2M5TA 5GJ4B 2XBYA 3B23B 3M3TA 4U01A 4ZHAA 5LPEA 2BLQA 3BTGE 8LPRA 4YOJA 2WPHS 5DP4A 1PQ5A 3GY8A 1O0DH 1XVOA 2ALPA 2F3CE 2ZCLP 5CHAB 3LC5A 5E0GA 1TIOA 3F9HA 2PKSB 2WUBA 4NWLA 2O8WA 2TBSA 1NESE 1QQ4A 1C1SA 2FLBH 1UHBB 2QXJA 1EJMA 1MU8B 1ESBA 3QTVH 3EE0B 5E2OA 2BVXH 4X0WU 1V6DA 1BRAA 3LIWA 3UPEA 1C2IA 2FS9A 3T5FH 1EPTA 4X8SH 1P01A 1A3EH 2GX4A 1GHZA 1ZTJA 2P59A 4WMEA 4FVDA 1K22H 1HDTH 3TK5A 1F0SA 1YKTA 3TU7H 3P8OA 3UREA 4Z0KA 1ZHMA 1GHYH 1ZSKA 3B8JA 4YM9A 2A1DB 1B0FA 1CHGA 1ANDA 1GMHG 1GI4A 4CRAA 1O2XA 2XBVA 2QIQA 4K1EA 2Z9GA 3KHVA 1J15A 3ZZ8A 1HFDA 1GDQA 1XXFA 1Y3YA 2VWLA 1TOCB 1F0UA 3A82A 3SZNA 1BUIA 1VCWA 3UTUH 2Y5HA 1ZRBA 1XXDA 2ZDLA 1J8AA 1C5QA 5E8EH 2ZCKP 1C2JA 4GHQA 1FAXA 1K1NA 6ESTA 1BA8B 1TMTH 2QAAA 3SO3A 1JOUB 3RM0H 1G30B 1OWDA 2GVFA 3PMBB 2FDAA 1RD3B 3Q3YA 4MVNA 4ISOA 1W0YH 2I6SA 1C5ZB 5AVDA 1AVGH 2GT8A 1WUNH 1GJ9B 2SGPE 2BD2A 2DE8A 2R0LA 1YCPH 3W95A 3RXTA 2LNCA 4JMYA 5B6LA 2GV6A 2NU3E 2RCEA 3UOUA 2A4RA 1GBHA 2J92A 4LXBH 3RLWH 2UWLA 2HPPH 2QF0A 3S69A 4AZ2B 1UCYK 1SR5C 1FIWA 1MD8A 1MTVA 4KTSA 2G81E 2BQ7B 1AWHB 1IQLA 1AKSA 1CT4E 1WV7H 3BG4B 5FX6A 1GI8B 1EP5A 1FPHH 1C5SA 1SQOA 1WSSH 2FOMB 1FDPA 1MTNB 1P2MA 3TNSA 1S0RA 2GT7A 1P57B 4K3JA 2PGBB 1TAWA 3NXPA 2WPJS 4Y7AA 3TK9A 1VR1H 2VWNA 4TPYA 1O3DA 3TJVA 3MNCA 2ZTXA 1GI3A 2NU4E 1GJ4H 2VVVA 1Z7KA 1TA2A 4VGCB 2BLVA 1ZYOA 1MAXA 1C5TA 5EXNA 1BMMH 2G5NA 3VXFH 1TNJA 1GBIA 2WPLS 1ACBE 5A09A 3AASA 4B2BA 2FO9A 3O8RA 1GL0E 1T4UH 1H9HE 1WOFA 3UY9A 4HFPB 2BY8X 3M5OA 1D3QB 1GJDB 3AW0A 3AK5A 1UMAH 1TQ7B 2ZI2H 3EA7A 3H09A 4O3UA 3SZEA 2A5IA 4AFZA 4CRBA 3F9FA 3CP7A 3QLPH 4DJZB 1ZPCA 2ZWLH 1MBQA 2Q6FA 1ELBA 2WYJA 1O3GA 3MNXA 3MO9A 1MTSA 2VH6A 3JZ2B 1YPHE 3BEIB 2ZFFH 3RM2H 3S7KB 3T62A 3AVZA 1FY8E 3RXCA 1NRSH 1V2UT 1MZAA 2VB0A 3SORA 3S7HB 1BJVA 1GBJA 4NFFA 1BTPA 1PJPA 2QXIA 1P09A 3IG6B 3UQOA 1LPKB 3LJOA 1EPTB 1V2KT 1O2RA 2WHXA 3W94A 4UONA 2NU2E 5G4BA 2QY0B 1PPZA 1KLTA 2EEKA 4DIHH 1HAGE 4ABAA 1MZDA 1THSH 1YCPM 2FOCA 2GCTB 1SQTA 2ZDKA 1UO6A 1GBDA 5HYOA 1O5EH 2HALA 3EA8A 4B2AA 5EW2H 4JZFH 2B8OH 1ZHPA 4AB8A 3M3SA 1IQNA 3ESTA 4KP0A 1DY9A 2FYRA 1XUKA 2BYAX 5A0CA 2BOHB 2BM2A 1GHBG 1O34A 4I33A 5JBTA 4B71A 1BBRE 1SOZA 1QBVH 2BVSH 2PTCE 2ZGHA 2P3UB 7GCHF 3KL6A 5FXLA 1EZUC 1GHVH 1MBMA 2IJD1 1O3AA 5GIBA 1TPSA 4CR9A 2OC0A 1ZLRA 1N8OC 1Q3XA 4LZ4B 2F9OA 1MKWK 4WH6A 2BD9A 2SGEE 1VITF 3PTNA 1AY6H 1YYY1 1C2DA 3SV8A 2CF8H 4MNXA 1K1LA 5DP9A 1FIZA 5DJ7A 3RU4E 1W7GH 1K21H 1BHXB 1SGTA 3F1SB 1HAZB 3ZZ6A 4ABFA 1AE8H 1THPB 3VXEH 1W10U 1ORFA 1T4VH 3OX7U 1SHHB 4X8VH 4NSYA 4ISIH 1TOMH 1A0JA 1ETSH 1CGIE 2XYAA 1MCTA 2P3TB 5K0HA 3R0FA 2P16A 4AFQA 3F9EA 2BD4A 4PROA 3LGTA 2ZGJA 5TCAA 1OS8A 1CHOF 4GPGA 3ZYEA 2IJOB 1CU1A 1A7SA 1PFXC 2FOGA 3LPRA 2HGTH 2Y5GA 2FTLE 1NO9H 2VWOA 1HXFH 2CMYA 2P95A 3L3TA 1GWAA 4X8UH 4XBDA 4D9RA 2F9UA 3ATKA 3H7OA 1GBFA 2FM2A 2J2UA 1QGFA 1AO5A 5ESTE 1KXFA 2HOBA 3GCTF 2WV4A 2PWXA 2BTCE 1O2GH 4YOGA 5JYIA 1ZGIA 2FI4E 1YCPK 1NROH 1BMNH 2BD5A 4RSPA 2VVCA 1F5LA 4DGJA 1HAHH 1GCTB 1LPGB 4IMQA 2C8ZB 4NIVA 1FLEE 7ESTE 3A85A 1DX5M 2V3HH 2G00A 3U8OH 3UOPA 1MQ6A 4KTUA 3A8AA 2QA9E 3QZQA 3RXAA 3RC6A 1L1NA 3M5MA 1WTGH 2ZU3A 4ZH8A 2PW8H 1HUTH 4ZXYH 2C8YB 1NU7B 1OPHB 3UFAA 1C2EA 3I29A 1BTZA 4K5ZA 1DS2E 1GMDF 1XUHA 2BY7X 4YT6H 4K69A 1BRUP 3SV6A 3UIRA 4AG1A 2V0BA 3GCNA 3ZZAA 2O8TA 2Q6DA 2Z7FE 1VCQA 1FZZA 4I8GA 1QL8A 1AI8H 1H1BA 1LDTT 1T8LA 1VGCB 1IQFA 1VGCC 4Y8XA 3BTKE 1IHTH 3DFJA 4FUFA 1GG6C 1C9PA 1QA0A 1EAIA 3NK8A 3MH4A 3P8GA 2ZCHP 3KN2A 4MNVA 1AUJA 5C1XA 1G37A 2AS9A 4I7YH 1A0HB 3D65E 3FANA 3IITA 4UFEH 1ABJH 2PGQB 3V7TA 1S0QA 5L2YH 4UFGH 1RXPA 1UVTH 2G51A 3OTJE 2ESTE 4H4FA 3BIUH 2AFQB 4THNH 1MKWH 1V3XA 1O3BA 1H9IE 1KDQA 5JDUB 1EP6A 1ZMJA 1P12E 4E7NA 1SI5H 1AE5A 1SLXB 2ZEBA 3FFGA 1QB9A 2UUYA 3SU3A 5L2ZH 2JETB 3RXVA 1YM0A 3QZRA 4F4OC 4MDSA 1LMWB 1ABIH 1UHBA 2CN0H 1NTPA 1V2PT 3SI3H 2C3SA 1GJBB 2HWLB 3SOSA 1AZ8A 4CH2B 1C1WH 1BZXE 2WV5A 5DP3A 2Z3EA 4DOQA 3HK6B 3E8LA 1YGCH 4WXVA 2OC7A 4ISNA 2A7HA 1BDAA 1HAOH 3ATIA 4FU8A 3ZZBA 1RS0A 4X1QU 4GUXA 1EOJA 2QC2A 1LVBA 4TPIZ 2C4FH 2QV1A 2V3OH 1FJSA 2C8WB 5E2PA 3GY2A 1A3BH 4IS5A 3I77A 3LU9B 4ZKNU 3PM3A 3LT3A 1C5OH 2KAIA 2ZDAH 3NCLA 2HNTE 1SLWB 1D3DB 3K65B 3QX5H 4X1PU 3SUGA 3M61U 4RN6A 1YPGH 4CBNA 1H4WA 5ESBA 4OS5A 1NRRH 1S5SA 1W8BH 1IQIA 1P10A 2NU0E 3F9GA 3QK1A 2A32A 7LPRA 1O2IA 1O2NA 1BTYA 3MU8A 1U6QA 4IMZA 3C1KA 1GI2A 1T31A 1IQKA 3C27B 4MNYA 1GJ5H 1RTKA 2VH0A 1EAXA 3PV5A 5J4QA 2AH4X 4NCYA 1XM1A 1ZMNA 2GV7A 1G2LA 3V0XA 5HGGA 3SNDA 3LGWA 1QBNA 5E0JA 4IW4E 2ZC9H 2HLCA 1IOEA 2FOEA 2Y80A 4MQAA 3DT0H 3RXIA 1AN1E 4A1XA 1SLVB 5DK1A 1RTFB 3T27A 1O5BB 5K7RA 3R3GB 2WPIS 2FXRA 3GDVA 5EGMA 1P2OA 2ODYB 4OM9A 3EDXB 3BSQA 2ANWA 3MO6A 1KSNA 3UR6A 3FZDA 4GVUA 4JCNA 1KTSB 1RJXB 1D4PB 3M35A 1W7XH 2PHBA 1NY22 1YPLH 2BMGB 1MKXK 1EPTC 1S81A 4O3TA 2QF3A 4Y11E 1F2SE 2HRVA 1KDQB 2R2MB 2SNVA 3TLOA 1A46H 4ZKSU 3A87A 5EQRA 3URCA 1Y3WA 1GPZA 2AMDA 4K8YA 3A8BA 3MMGA 3GICB 1GI7B 1KTTB 3TH4H 1CQQA 4BAMB 1UTMA 2FIRH 1A61H 2VIWA 2FOHA 3MH5A 3GCOA 3LGVA 1VITG 3LDXH 3A84A 3U98H 3TK6A 2GCHF 5IYTA 1NPMA 1RIWC 4SGBE 1Q31A 3PYHA 1HAVB 1RFNA 1K1IA 4XBBA 1DWCH 3Q77A 2A45B 5SGAE 3Q3KA 3T26A 4Y8YA 4RKOB 3K6ZA 3SQEE 4ESTE 3OTPA 2A4GA 3ODDA 3KQBA 4TWYA 3LC3A 1FQ3A 3E0PB 2BD3A 3TJNA 3PMHB 4K1TA 2K1QA 2WYGA 2F9PA 1DSTA 1GJ8B 1ZJKA 2VJ1A 4X2XA 1EUFA 3AW1A 1C1PA 1HJAC 1CE5A 1QBOA 1TGTA 2ZF0H 1C1TA 2ODPA 1KIGH 1UTQA 4WXIA 1TYNA 3VPKA 5C5NA 3GYMA 4H42U 1HXEH 1P9SA 1IHSH 8ESTE 3VB4A 1UVSH 2JETC 3N7OA 3OU0A 1EZQA 2BZAA 4AB9A 2FLRH 3AAVA 3UUZA 1Z6EA 1AMHA 4OGXA 1CA0B 2A7CA 2XXLA 2ZGBH 1K9OE 5AHGH 3SYJA 4MPUA 4Y71A 3PROA 2ANKH 3TGKE 1N1LA 1QURH 3SGBE 1PQAA 1ZJDA 2H2ZA 1FY5A 4B1TA 2ILNA 1TQ0B 1F0TA 3RXMA 5GCHG 1O2LA 5JB8S 4ZKRU 3HGNA 5CHAC 1C2MA 1H8IH 4JZ1A 3O8CA 3MU5A 1SMFE 3VGCC 3M7UA 1GVKB 3QWCH 1DXWA 1GBAA 1YLCA 2ZU1A 3M7TA 1C2HA 3RXBA 4WMFA 1GI6A 4X2VA 2DE9A 1J14A 1C5MD 2ZU2A 3A80A 1GDUA 3HATH 2J4IA 1E35B 5JPMH 1TFXA 4BAQB 1C1UH 2OBOA 3ZVGA 3Q3XA 2PTNA 4NZQA 3EGKH 3RXRA 1QL9A 2A4QA 3FP7E 3GOVB 1ZTKA 2HVXA 5F8XA 3QUMP 1YLDA 1Z6JH 1Z1IA 3PMJA 1CA8B 3M5NA 2XBWA 3AAUA 4Y79A 4A7IB 3ATMA 1ZTLA 1D9IA 1ZHRA 1SLUB 1ZOMA 1PPGE 1QFKH 1GBEA 3PO1C 2ZPSA 3ODFA 1AVWA 3SNEA 1QJ1B 3NUMA 3SGQE 4NFEA 2ZFTA 2GCHG 3ZZ7A 1LKBA 1SL3A 2SGFE 1OP2A 1NM6A 4JK6A 1OOKB 1A1RA 5HM9A 3TH2H 2A31A 2CHAB 2RG3A 4X6MA 3ITIA 4U32A 1K2I1 1XUFA 3MU4A 4IN2A 1G32B 5C5OA 5CE1A 1ID5H 3H5CB 1TRMA 1TB6H 2TPIZ 2XW9A 5DPAA 3SJOA 1HBTH 2R3UA 1O3IA 4WJG2 3GYLB 1EZSC 1YPHC 1K1OA 3SJKA 4FVBA 2FX6A 1BMLA 1BTHH 1HCGA 1P2QA 4NA9H 1Y5BT 4X1SU 1SPJA 3O8BA 2JKHA 4ISHH 2SGQE 2BDCA 3LOXA 1NZQH 2Y82A 1S84A 2GMTC 4ABBA 5I46H 4CHAC 4IGDA 1V2JT 1SGPE 1QL7A 2FOAA 3A7XA 2AMQA 4NIWA 4LOYH 1B5GH 1MMJN 1OXGA 1SGNE 1QHRB 1L4DA 1OWHA 2VIOA 1PYTD 3PLKA 2YOLA 3S9AA 4OS1A 3FZZA 3UNSA 1J17T 4E06H 5EQSA 3FP6E 2J94A 5EQQA 1C5PA 1LVOA 3RC5A 3STIA 1ESTA 5A0BA 1NU9A 1BTXA 7GCHG 4BTIB 2XTTB 1M9UA 3ZZ3A 2FX4A 1D3PB 1UK2A 3BF6H 1C2LA 4BAHB 3KGPA 2ZGCA 1A5IA 4WMDA 4RI0A 1Z8IB 1O3MA 3M37A 1Y5UT 3SU2A 4INLA 4XBCA 1QRZA 1P2NA 1KXCA 4CHAB 1BRBE 1EB2A 1GBKA 1O3KA 1PPEE 4X8TH 1SGEE 2FMJA 4NSVA 1TBRH 1V2WT 2ZQ2A 1FY4A 3PB1E 2SNWA 1TLDA 1CGHA 3GY7A 5I25A 1N6YA 3MOCA 2VIDA 1A2CH 4FUJA 1PPHE 4XE4A 1PQ8A 3EA9A 5FCRA 1MUEB 2D8WA 3ZZCA 1UTOA 1SG8B 1ZGVA 1QRXA 2VU8E 3SU5A 4A92A 2AGEX 1ZPZA 3SUEA 3KQEA 5GPIB 3STJA 3RMMH 4IBLH 2V35A 1P2IA 2WPMS 1J16A 1JIMA 3ENSB 3Q76A 1T8MA 4MPVA 4AFSA 4MNWA 1GBMA 1AD8H 4AOQA 1QB1A 2VIPA 2OC1A 4ZKOU 2BDAA 4UD9H 4YOIA 9LPRA 4O9VA 1GI9B 3SU1A 1BITA 1O5AB 2D2DA 1L1JA 3UQVA 2ZFRH 4U30A 1PPCE 4BANB 4O97A 4UFFH 3RXFA 4Q2KA 3P6ZB 2EI8A 3ZZDA 2XC0A 4BAKB 3BTFE 1WAYB 5F8TA 2ULLA 1MH0A 2BHGA 4FU9A 2ZHQH 1WCZA 3GCHB 4ABGA 2A2QH 1N6XA 1L0ZA 4OS7A 1C9TA 2PSXA 5BPEA 1S82A 2F9BH 3VGCB 1OWJA 4VGCC 4DW2U 1F92A 1E37B 1S6FA 2XWAA 1O35A 3EYDA 3OSYA 1SGCA 1CBWB 1LHFH 3BTTE 1TGSZ 5C3NA 1TNIA 1C1RA 1O2TA 5C20A 2C8XB 3SU0A 2ZGXH 2OTVA 4R8TB 1XX9A 3ZVDA 5AF9H 4X1NU 1HAIH 2P8OC 1P3CA 1C4V2 2VINA 2LPRA 1EATA 3GY5A 1TONA 5F03A 4Y8ZA 4M7GA 1BBRK 1J9CH 1OX1A 1WXRA 1HAVA 1C2GA 3LONA 1ELVA 1NN6A 1WYKA 4DG4A 2UUKB 2Y81A 1SGDE 2A7JA 4MPWA 4Y7BA 4AORA 2PV9B 4D7FA 1DWEH 1F7ZA 1QRWA 1KLJH 3D62A 1DANH 2QCYA 5HXFA 1C5XB 2G8TA 1CBWC 3HPTB 4IC5A 1OP0A 1GVLA 3ELAH 1XUIA 1RGQA 2ZU4A 1D6RA 4I32A 1UCYH 3RXPA 2XRCA 4Q80A 1ZMLA 2GMTB 2W5EA 2J38A 3HKIB 4GCHG 1ARCA 1C1QA 4Z6AH 1ANEA 1JWTA 2YNAA 1SGIB 2J95A 2P94A 1O2PA 2QN5T 1AWFH 4E05H 2D1JA 1CO7E 2VVUA 2G4TA 2BY6X 3U1IB 1VJ9U 1V2RT 4OS6A 4WY3A 3B9FH 1GL1A 3BN9A 2AEIH 1V2NT 2H6MA 2OQ5A 2GD4B 2G5VA 4RKJB 2WZQA 4ZROA 1G3EA 1OWKA 1BRCE 2BDHA 4H6TA 3H7TA 2F9NA 3MO3A 4BXSA 2BY5X 1VITH 1LVMA 2BX3A 3P17H 1EJAA 5DP8A 3U8RH 3LH3A 1UTJA 3P8NA 4NG9H 1O2MA 4BTUB 1GHBF 1O39A 2ASUB 1UCYE 3GY4A 1T7CA 1SBWA 1DOJA 2KAIB 4A6LA 3RXOA 1O30A 3K2UA 1E38B 1IQGA 6LPRA 3SV9A 4YZUA 1UTNA 1N8OB 1GI1A 1UVOA 2ZA5A 2VGCB 3IWMA 2ZPRA 1A5HA 1S85A 3DD2H 3FAOA 3E3TA 2ZFSA 2Z9LA 2VNTA 4FXGH 4FUBA 1SQAA 1DVAH 1XKAC 2OUAA 1JRTA 1O2UA 1BT7A 1AIXH 2H5DA 2FPZA 4CRGA 1CT2E 3WY8A 4DURA 4MTBA 2ZTYA 1C5LH 1CVWH 4DIIH 3SHCH 1DWDH 3TJOA 1SGYE 3L6PA 2VIQA 3I78A 1ZSLA 3LJJA 3DA9B 5AFYH 3TITA 1FAKH 2ZO3H 2Y7ZA 3RLYH 1OYQA 4X6PA 2DUCA 2FOBA 4AX9H 1SGRE 1CSOE 2R3YA 1Z71A 4A1VA 4X2WA 1GGDC 1AU8A 3LGYA 5EW1H 4JYTA 3SJ8A 4R0IA 1THRH 4JZIA 3VFEA 3A81A 3GCTG 1O3PB 4Q7XA 2PLXA 1LHDH 3K9XB 2R9PA 1AB9B 1O3JA 1V2MT 1OWEA 1DLEA 1QB6A 3HK3B 2A4OA 2BDYA 3D23A 2J34A 1Z8JB 2TIOA 5HM2A 3Q00A 5A8XA 2WV9A 1TRNA 3TPIZ 2QXHA 3BTHE 1X7AC 4UFDH 3KIDU 2W26A 1C1MA 4CREA 3P70B 1NFXA 3FVFB 2JH0D 3ZZ4A 1E34B 1H9LB 2STAE 1AQ7A 1WQSA 1D3TB 2O8MA 1KYNA 2XBXA 4MG3A 3VB6A 1PYTC 4DCDA 1INCA 1BJUA 1C5UA 2OC8A 3CENA 3MHWU 6CHAB 4NIXA 1DT2A 2F91A 5FPSA 1BMAA 4B76A 1BHXF 1ELFA 1TX8A 1ZSJA 5C2ZA 1KXEA 1LO6A 2BOKA 3T28A 1GHAF 5F8ZA 1C5VA 1FONA 3O8DA 1O2YA 4GAWA 1YPJH 4YLQH 8GCHF 2OK5A 3A89A 4HZHA 4ABHA 2SGAA 1EXFA 2W3KA 3P8FA 4ZHMU 1TA6A 1TGBA 3VB5A 5B6OA 3E16B 1TNGA 2WUCA 2A5KA 2NWNA 1KXBA 2RA3A 4HGCA 4SGAE 1EX3A 1T8NA 1A4WH 4A1TA 1TX6A 3CS0A 2YNBA 3P95A 4UEHH 1FN6A 1EB1H 3UWJH 1HRTH 1W11U 2FTMA 1YC0A 1O2HA 4TY6A 2BZ6H 5AFZH 2F4LA 3ZV9A 1ETTH 1BOQA 3SV2H 4JYVH 3A8DA 1NC6A 1TNLA 5BRRE 3F68H 1ELTA 1FY3A 1O2KA 3SUFA 1ELDE 1GHWH 3K6YA 2Z6BD 3SU4A 2P93A 1W14U 1TPOA 1JMOH 1TGNA 1TWXB 2BXTH 2SFAA 1ESAA 3SV7A 1MTWA 2ALVA 5EOKA 2W7SA 1JRSA 2UWPA 3SGAE 1UTPA 2C93B 3NKKA 3SBKA 2Q6GA 1HYLA 3RXLA 1NT1A 3TJUA 1SC8U 4AGJA 4DY7B 3MNSA 1O3CA 3A7ZA 1GBCA 5FBIA 1ETRH 2FODA 3QTOH 3S9BA 4K1SA 3GY3A 2STBE 1FMGA 3VEQB 2GZ9A 1AKSB 1QNJA 2ZU5A 1UTKA 1TX7A 2HNTC 4X2YA 4X6OA 1AHTH 1DPOA 3RXDA 4D9QA 2H1UA 1PPBH 3CS7A 2Z3DA 1DSUA 1C4Y2 1TPPA 2BLWA 2G55A 4CRDA 1SFIA 1Y3UA 4ISLA 2H5CA 2ZNKH 3A8CA 4GLYA 3LH1A 1BIOA 4GHTA 1O2ZA 4CBOA 7KMEH 1O3HA 4BXWA 1Y5AT 5ETXA 1RRKA 4ASHA 4Q7ZA 1AB9C 1GMCG 1T32A 1XKBC 4GSOA 4WH8A 1HJAB 2A2XH 2ZTZA 1C5NH 4YO9A 4I8LA 2ZFQH 4JZDH 3RXUA 1IQJA 4CR5A 2Y7XA 5C67A 4ZUHA 1O3OA 1P04A 1ANCA 1Z1JA 4B75A 3KQCA 1VZQH 4Q7YA 2QXGA 1K28D 3T2NA 3TIUA 1O3NA 1L1GA 4BOHA 4UE7H 1WTHD 2ZHWH 3KNXA 2CF9H 2ZQ1A 3SNAA 3KCGH 2OLGA 2IN2A 1DM4B 2TGTA 1ANBA 3A86A 1HPGA 3V3MA 1SFQB
chains in the Genus database with same CATH superfamily
4BAOB 1E0FD 2G52A 1GG6B 4Y0YE 4X1RU 1AFQB 1NFWA 2ZDMA 4GCHF 1LHGH 3KEEA 3GDUA 1V2QT 4AGKA 5A8YA 4AG2A 1ZRKA 2A0QB 3PLBA 2XCNA 3OYPA 3ZYDA 1FUJA 2ODQA 1TBQH 1TALA 4Y6DA 1YPMH 4WVPE 3RP2A 2GCTC 1G2MA 1SGFA 5LH8A 1QA7A 1O2SA 4NZLA 3FP8E 5FHTA 2OP9A 3RXEA 1SGFG 1G9IE 2ZDNA 2VIVA 5H4IB 5A2MH 2AIPA 2TGPZ 3RXJA 2HPQH 1MU6B 1O5GH 3PTBA 4JYUH 1EQ9A 1V2ST 3U28C 1EJNA 4OGYA 3UNQA 1DDJA 3ZVBA 3U1JB 1P8VC 1LKAA 1Y3XA 1KXAA 2L74A 4I8KA 4ZXXH 3L33A 1HV7A 1XMNB 1G3BA 3JZ1B 4XSKU 3PMAB 4INKA 5DG6A 3SNBA 1MKXH 3PO1B 2ZKSA 1KLIH 1O5CB 1MTUA 3MI4A 2GZ8A 1C1VH 1K1JA 1C1NA 1NFUA 1NRNH 5TJXA 2VWMA 2YMSC 1O5DH 2BLOA 2EI7A 1HAYB 1O5FH 4TYDA 2QYIA 4Y10E 1EASA 1TNHA 4JZEH 3GDSA 1IQEA 3RDZA 1WBGB 2Z94A 3F2GA 1FNIA 1SSXA 5GXPA 3NWUA 1O36A 3BG8A 4OS2A 4K2YA 5CMXH 3HGPA 2ZPQA 4NIYA 1Y59T 1K1PA 1G3CA 4D76A 2KCYA 1VCPA 3G01A 1GMCF 1V2VT 1SB1H 5LGOA 3GISB 5KEDA 2FYQA 3BTQE 4NWKA 1Z8RA 3SW2B 1ELCA 2GP9B 3QGJA 3RMNH 3U9AH 1FXYA 4K8BA 5PTPA 4ABIA 4ABEA 1OKXA 2LELA 3A7TA 2BQ6B 4FUHA 3LKWA 5GWZA 5A0AE 1EAWA 1JBUH 2H9TH 4AN7A 1LPZB 1AVXA 4IN1A 1GJ6A 1O3FA 4HTCH 2QGRA 1O33A 5T6FA 1GBBA 1RTLA 3RMLH 1P02A 4M9FA 2TGAA 3RXSA 4AYVB 3RXKA 2RA0A 3MTYA 1GI0A 1IAUA 1LVYA 4YTAA 1T8OA 1ELAA 2AIQA 1OP8A 1QTFA 3T29A 2EA3A 2YMSB 1B7XB 4B2CA 4ASUD 2THFB 3QDZB 5GCHF 1EOLA 1P06A 1C2FA 3ATLA 5GDSH 4TY7A 2BDBA 1V2OT 2FI3E 4BNRA 1XVMA 1WU1A 1NBME 3A7YA 4INHA 4FUEA 2BB4A 2GDDA 2OBQA 1E36B 2OQUA 1C2KA 2PSYA 1K1MA 1O2QA 3BV9B 1BCUH 6GCHG 1XUGA 5C17A 4BTTB 3PV4A 1QCPA 3A7WA 4F49A 4LK4A 3BG4C 2UUJB 1D6WA 1O2VA 1DY8A 1A5GH 4DT7B 2B0FA 4J2YB 1C5YB 1W0KD 4FU7A 1P2JA 3URDA 1BB0B 1DUAA 2FS8A 1Z8GA 5EXMA 9ESTA 1NFYA 3KQ5A 3E90B 5A8ZA 1W0ZU 5JBAS 2P3FH 2ZIQH 2L6OA 2PKAB 1A0LA 4WF8A 3MWIU 1BQYA 1V2LT 5JBCS 1KY9A 2ZZUH 1OSSA 3ZVAA 1UW7A 1ZPBA 3UWIA 1O37A 1IQHA 2CJIA 5FPTA 2IOTA 4ZAEA 3ZZ9A 2JH6D 1SKYE 2BXUH 2AGIX 2Y5FA 3M7QA 1OWIA 2I6QA 2C90B 5EG4A 5ABWA 4IC6A 5FBEA 2J98A 1O2WA 4YESB 2V6NA 5GNDA 1MAYA 2GZ7A 2FZZA 1DLKB 3GCHC 4X6NA 1GMHF 1QIXB 5EXLA 2R2WU 1ZZZA 1V2TT 1UVUH 1GJ7B 1GHAG 4O03A 1W3CA 2O8LA 8GCHG 2PUXB 1BTUA 1BTWA 1IQMA 6CHAC 4FUIA 4XFQA 3F6UH 3OY6U 1SGQE 1TMUH 3T25A 1AZZA 1CGJE 2ANYA 3NZIA 1MTNC 1ELEE 1UTLM 4ZHLU 1P0SH 2BY9X 4YLUA 3RU4T 1F0RA 1BBRH 2V3MA 1ARBA 3HKJB 2OINA 1UJ1A 1XUJA 1ELGA 2AERH 2XC5A 1HB0B 1GCTC 1GJAB 3TVJB 1Y3VA 5T6GA 1G36A 2Z9KA 3WWBA 2XCFA 5EU8A 2ANMH 2FOFA 1YF4A 3SU6A 3KF2A 3MH6A 1JXPA 5IDKA 3SQHE 3RXHA 1E1QD 2PKAA 4QT8C 3E91A 1CA0C 2Q1JA 2J9NA 4D7GA 3P92A 3UR9A 4AYYB 2FP7B 3BIVH 4A5TS 1NRPH 3QN7A 4ABDA 2CGAA 2FESH 1HLTH 4D8NA 1QY6A 2PKSC 3DSPA 1TBZH 2ZHEH 4XDEA 2Y6TA 3SI4H 1C5RA 2EI6A 3RMOH 1GGDB 4U2WA 1P11E 2WINI 2PR3A 3DUXH 3UNRA 2O9QA 4FUCA 4ZCNA 3PV2A 2BX4A 5DP6A 3BTEE 6GCHF 5J4SA 2VBCA 3SNCA 1C1OA 3SN8A 1O32A 4KTCA 3V12A 2GJGA 1YWUA 2BDIA 1P3EA 5DSFA 2SGDE 1HAPH 2GDEH 1P2KA 4UDWH 3QGNB 1O2JA 4HI3A 5DKMA 2GKVE 1GBLA 2OD3B 2RDLA 1TE0A 1GJCB 4K60A 3RUOA 3MU1A 2BQWB 4FUGA 2IPHA 1LCYA 1FPCH 3WWFA 1DFPA 1YPEH 2EY4C 1O3EA 3MFJA 4FUDA 4FOUC 5IK2D 1O2OA 1HJ9A 1UK3A 1WQVH 1KXDA 2TRMA 3OE7D 1DE7H 5T1VA 3RXGA 2W7UA 1PPFE 4CRCA 5JBBS 1OYTH 2VGCC 1HIAB 3OY5U 2FEQH 1TGCA 1VJAU 1L2EA 2FWWA 1LHCH 3ATWA 1B0EA 2JH5D 1EZXC 3ZZ5A 1GMDG 2ZFPH 3RXQA 3EAJA 1CT0E 1TRYA 3BEFB 3SHAH 2UUFB 3MNBA 5DO4H 1O3LA 4ABJA 2BD8A 3D49H 2Z9IA 4MLFB 1C4U2 1MD7A 2XOKD 4DVAU 1SOTA 1QQUA 3A88A 3BEUA 4Y76A 5L6NH 2F43B 5DGJA 2BDGA 3ZV8A 1QJ6B 4E7RG 5EODA 2HNTF 3E6PH 4YT7H 3N99A 5EPYA 5DP7A 1TMBH 4B73A 5FX5A 4JK5A 3PWBA 1GDNA 1P03A 1DWBH 2W3IA 4I8JA 3UAIC 2ZHFH 4KKDA 4ZMAH 1EAUA 8KME2 1AFQC 1AGJA 1NS3A 3PWCA 4WWYA 1RIWB 1P05A 3S9CA 1SVPA 4MPXA 1NRQH 1QR3E 4NGAH 3VB3A 3M3VA 2PUQH 3BTDE 3SJ9A 2R0KA 1GI5A 4B6EA 4NA8A 3M5LA 3RU4D 3U69H 3VB7A 1FV9A 1PQ7A 2OXSA 5DP5A 1YBWA 5TCCA 1TABE 1L4ZA 2AMPA 1S6HA 1TNKA 3MYWA 1O31A 2G4UA 3KQDA 4I8HA 4CRFA 3A7VA 1TPAE 1GVZA 3F0PA 1Q2WA 2GTBA 3LGIA 3BTME 3DFLA 1COWD 2F9VA 2BVRH 2OCVB 3ZVEA 5F6MA 2XC4A 5EPNA 1FN8A 5C1UA 1UVPA 2CHAC 2CV3A 5LPFA 2Z9JA 2ZECA 1W2KH 2AYWA 1DITH 1DXPA 2CXVA 5LPRA 2A5AA 3MH7A 1ZR0A 1HGTH 1DUEA 3M36A 3MU0A 1F5KU 1LTOA 4OS4A 1HNEE 4LZ1H 1SHYA 1O38A 4H6SB 1G3DA 3TGIE 2GGVB 5JB9S 1MCVA 4CH8B 2B5TB 3A83A 2P8OB 2D26C 1GBTA 1YPKH 1GHXH 2B9LA 1S83A 2F83A 4AFUA 2UWOA 3TH3H 3S0NA 5HMAA 4F55A 5FAHA 3BTWE 3TNTA 1F5RA 4KGAA 2KCAA 1HAXB 3EQ0H 1AUTC 3U8TH 4XOJA 4I31A 5T3HA 2NU1E 3SUDA 2XWBI 3RC4A 1YY3A 5EJ1A 4TWWA 1LQDB 1CHOG 3DHKH 2TGDA 5FPYA 1GCDA 3VG8A 2H9EH 1DICA 1EKBB 2B7DH 2BD7A 1H8DH 3E0NB 1C5WB 1HIAA 4J1YA 2WPKS 2ZHDA 2AGGX 4B6FA 4B74A 2ZG0H 3TGJE 1QJ7B 3NPSA 5FCKA 3V13A 2ZP0H 3E1XB 4Y0ZE 2H9HA 3QO6A 1P9UA 1YP9A 5L30H 2ZDVH 3ZVCA 1FI8A 1Y8TA 1UK4A 3LGUA 2Z3CA 1HJ8A 1MQ5A 1W12U 2FI5E 2O8UA 5T6DA 3PLPA 4KELA 1W13U 5C1YA 2PFEA 1LHEH 5E0HA 1FY1A 1JIRA 1AFEH 3GY6A 2XNIA 1LQEA 2EC9H 3SJIA 3ZVFA 1VKYA 2M5TA 4NA7A 5GJ4B 2XBYA 3B23B 3M3TA 4U01A 4ZHAA 2WPDD 2BLQA 3BTGE 5LPEA 8LPRA 4YOJA 2WPHS 1H8HD 5DP4A 1PQ5A 3GY8A 1O0DH 1XVOA 2ALPA 2F3CE 2ZCLP 5CHAB 3LC5A 5E0GA 1TIOA 3F9HA 2PKSB 2WUBA 4NWLA 2O8WA 2TBSA 1NESE 1QQ4A 1C1SA 3F3BA 1S6LA 2FLBH 1UHBB 2QXJA 1EJMA 1MU8B 1ESBA 3QTVH 3EE0B 5E2OA 2BVXH 4X0WU 1V6DA 1BRAA 3LIWA 3UPEA 1C2IA 2FS9A 3T5FH 1EPTA 4P02A 4X8SH 1P01A 1A3EH 2GX4A 1GHZA 1ZTJA 2P59A 4WMEA 2IPQX 4FVDA 1K22H 1HDTH 3TK5A 1F0SA 1YKTA 3TU7H 3P8OA 3UREA 4Z0KA 1ZHMA 1GHYH 1ZSKA 3B8JA 4YM9A 2A1DB 1B0FA 1CHGA 1ANDA 1GMHG 3KYGA 1GI4A 4CRAA 1O2XA 2XBVA 2QIQA 4K1EA 2Z9GA 3KHVA 1J15A 3ZZ8A 1HFDA 1GDQA 1XXFA 1Y3YA 2VWLA 1TOCB 1F0UA 3A82A 3SZNA 1BUIA 1VCWA 3UTUH 1ZRBA 2Y5HA 1XXDA 2ZDLA 1J8AA 1C5QA 5E8EH 2ZCKP 1C2JA 4GHQA 1FAXA 1K1NA 6ESTA 1BA8B 1TMTH 2QAAA 3SO3A 1JOUB 3RM0H 1G30B 1OWDA 2GVFA 3PMBB 2FDAA 1RD3B 3Q3YA 2PP6A 4MVNA 4ISOA 1W0YH 2I6SA 1C5ZB 5AVDA 1AVGH 2GT8A 1WUNH 1GJ9B 2SGPE 3DSOA 2BD2A 2DE8A 2R0LA 1YCPH 3W95A 5KGOA 3RXTA 3OEED 2LNCA 4JMYA 5B6LA 2GV6A 2NU3E 2RCEA 3UOUA 2A4RA 1GBHA 2J92A 4LXBH 3RLWH 2UWLA 2HPPH 2QF0A 3S69A 4AZ2B 1UCYK 1SR5C 1FIWA 1MD8A 1MTVA 4KTSA 2G81E 2BQ7B 1AWHB 1IQLA 1AKSA 1CT4E 1WV7H 3BG4B 5FX6A 1GI8B 1EP5A 1FPHH 1C5SA 1SQOA 1WSSH 2FOMB 1FDPA 1MTNB 1P2MA 3TNSA 1S0RA 2GT7A 5EJLA 1P57B 4K3JA 2PGBB 1TAWA 3NXPA 2WPJS 4Y7AA 3TK9A 1VR1H 2VWNA 4TPYA 1O3DA 3TJVA 3MNCA 2ZTXA 1GI3A 2NU4E 1GJ4H 2VVVA 1Z7KA 1TA2A 4VGCB 2BLVA 1ZYOA 1MAXA 1C5TA 5EXNA 1BMMH 2G5NA 3VXFH 1TNJA 1GBIA 2WPLS 1ACBE 5A09A 3AASA 4B2BA 2FO9A 3O8RA 1GL0E 1T4UH 1H9HE 1WOFA 3UY9A 4HFPB 2BY8X 3M5OA 1D3QB 1GJDB 3AW0A 3AK5A 1UMAH 1TQ7B 2ZI2H 3EA7A 3H09A 4O3UA 3SZEA 2A5IA 4AFZA 4CRBA 3F9FA 3CP7A 3QLPH 4DJZB 1ZPCA 2ZWLH 3F0OA 1MBQA 2Q6FA 1ELBA 2WYJA 1O3GA 3MNXA 3MO9A 1MTSA 2VH6A 3JZ2B 1YPHE 3BEIB 2ZFFH 3RM2H 3S7KB 3T62A 3AVZA 1FY8E 3RXCA 1NRSH 1V2UT 1MZAA 2VB0A 3SORA 3S7HB 1BJVA 1GBJA 4NFFA 1BTPA 1PJPA 2QXIA 1P09A 3F2HA 3IG6B 3UQOA 1LPKB 3LJOA 1EPTB 1V2KT 1O2RA 2WHXA 3W94A 4UONA 2NU2E 5G4BA 2QY0B 1PPZA 1KLTA 2EEKA 4DIHH 3N7DA 1HAGE 4ABAA 1MZDA 1THSH 1YCPM 2FOCA 2GCTB 1SQTA 2ZDKA 1UO6A 1GBDA 5HYOA 1O5EH 2HALA 2QF4A 3EA8A 4B2AA 4RT0A 5EW2H 2K0QA 4JZFH 2B8OH 1ZHPA 4AB8A 3M3SA 1IQNA 3ESTA 4KP0A 1DY9A 2FYRA 1XUKA 2BYAX 5A0CA 2BOHB 2BM2A 1GHBG 1O34A 4I33A 5JBTA 2EQNA 3KYFA 4B71A 1BBRE 1SOZA 1QBVH 2BVSH 2PTCE 2ZGHA 2P3UB 7GCHF 3KL6A 5FXLA 1EZUC 1GHVH 1MBMA 2IJD1 1O3AA 5GIBA 1TPSA 2WSSD 4CR9A 2OC0A 1ZLRA 1N8OC 1Q3XA 4LZ4B 2F9OA 1MKWK 4WH6A 2BD9A 2SGEE 1VITF 3PTNA 1AY6H 4TSFD 1YYY1 1C2DA 3SV8A 2CF8H 4MNXA 1K1LA 5DP9A 1FIZA 1FX0B 4XD7D 5DJ7A 3RU4E 1W7GH 1K21H 1BHXB 1SGTA 3F1SB 1HAZB 3ZZ6A 4ABFA 1AE8H 1THPB 3VXEH 1W10U 1ORFA 1T4VH 3OX7U 1SHHB 4X8VH 4NSYA 4ISIH 3FO8D 1TOMH 1A0JA 1ETSH 2XNDD 1CGIE 2XYAA 1MCTA 2P3TB 5K0HA 3R0FA 2P16A 4AFQA 3F9EA 2BD4A 4PROA 3LGTA 2ZGJA 5TCAA 1OS8A 1CHOF 4GPGA 2AHME 3ZYEA 2IJOB 1CU1A 1A7SA 1PFXC 2FOGA 3LPRA 2HGTH 2Y5GA 2FTLE 1NO9H 2VWOA 1HXFH 2CMYA 2P95A 3L3TA 1GWAA 4X8UH 4XBDA 4D9RA 2F9UA 3ATKA 3H7OA 1GBFA 2FM2A 2J2UA 1QGFA 1AO5A 5ESTE 1KXFA 2HOBA 3GCTF 2WV4A 2PWXA 2BTCE 1O2GH 4YOGA 5JYIA 4YXWD 1ZGIA 2FI4E 1YCPK 1NROH 1BMNH 2BD5A 4RSPA 2VVCA 1F5LA 4DGJA 1HAHH 1GCTB 1LPGB 4IMQA 2C8ZB 4NIVA 1FLEE 7ESTE 3A85A 1DX5M 2V3HH 2G00A 3U8OH 3UOPA 1MQ6A 1H8ED 4KTUA 3A8AA 2QA9E 3QZQA 3RXAA 3RC6A 1L1NA 3M5MA 1WTGH 2ZU3A 4ZH8A 2PW8H 1HUTH 4ZXYH 5F53A 2C8YB 1NU7B 1OPHB 3UFAA 1C2EA 3I29A 1BTZA 4K5ZA 1DS2E 1GMDF 1XUHA 2BY7X 4YT6H 4K69A 1BRUP 3SV6A 3UIRA 4AG1A 2V0BA 3GCNA 3ZZAA 2O8TA 2Q6DA 2Z7FE 1VCQA 1FZZA 4I8GA 1QL8A 1AI8H 1H1BA 1LDTT 1T8LA 1VGCB 1IQFA 1VGCC 4Y8XA 3BTKE 1IHTH 3DFJA 4FUFA 1GG6C 1C9PA 1QA0A 1EAIA 3NK8A 3MH4A 3P8GA 2ZCHP 3KN2A 4MNVA 2W6ID 1AUJA 5C1XA 1G37A 2AS9A 4I7YH 1A0HB 3D65E 3FANA 3IITA 4UFEH 1ABJH 2PGQB 3V7TA 1S0QA 5L2YH 4UFGH 1RXPA 1UVTH 2G51A 3OTJE 2ESTE 4H4FA 3BIUH 2AFQB 4THNH 1MKWH 1V3XA 1O3BA 1H9IE 1KDQA 5JDUB 1EP6A 1ZMJA 1P12E 4E7NA 1SI5H 1AE5A 1SLXB 2ZEBA 3FFGA 3FOAA 1K0HA 1QB9A 2UUYA 5EJZA 3SU3A 5L2ZH 2JETB 3RXVA 1YM0A 3QZRA 4F4OC 4MDSA 1LMWB 1ABIH 1UHBA 2CN0H 1NTPA 1V2PT 3SI3H 2C3SA 1GJBB 2HWLB 3SOSA 1AZ8A 4CH2B 1C1WH 2W6JD 1BZXE 2WV5A 5DP3A 2Z3EA 4DOQA 2KR7A 3HK6B 3E8LA 1YGCH 4WXVA 2OC7A 3W1EA 4ISNA 2A7HA 1BDAA 1HAOH 3ATIA 4FU8A 3ZZBA 1RS0A 4X1QU 4GUXA 1EOJA 2QC2A 1LVBA 4TPIZ 2C4FH 2QV1A 2V3OH 1FJSA 2C8WB 5E2PA 3GY2A 1A3BH 4IS5A 3I77A 3LU9B 4ZKNU 3PM3A 3LT3A 1C5OH 2KAIA 2KFWA 2ZDAH 3NCLA 2HNTE 1SLWB 1D3DB 3K65B 3QX5H 4X1PU 3SUGA 3M61U 4RN6A 1YPGH 4CBNA 1H4WA 5ESBA 4OS5A 1NRRH 1S5SA 1W8BH 1IQIA 1P10A 2NU0E 3F9GA 3QK1A 2A32A 7LPRA 1O2IA 1O2NA 4ACAA 2J5UA 1BTYA 3MU8A 1U6QA 4IMZA 3C1KA 1GI2A 1BMFD 2RDEA 1T31A 1IQKA 3C27B 4MNYA 1GJ5H 1RTKA 2VH0A 3F2FA 1EAXA 3PV5A 5J4QA 2AH4X 4NCYA 1XM1A 1ZMNA 2GV7A 1G2LA 3V0XA 5HGGA 3SNDA 3LGWA 1QBNA 5E0JA 4IW4E 2ZC9H 2HLCA 1IOEA 2FOEA 1NBMD 2Y80A 4MQAA 3DT0H 3RXIA 1AN1E 4A1XA 1SLVB 5DK1A 1RTFB 3T27A 1O5BB 5K7RA 3R3GB 2WPIS 2FXRA 3GDVA 2QE7D 5EGMA 1P2OA 2ODYB 4OM9A 3EDXB 3BSQA 2ANWA 3MO6A 1KSNA 3UR6A 5KECA 3FZDA 4GVUA 4JCNA 1KTSB 1RJXB 1D4PB 3M35A 1W7XH 2PHBA 1NY22 1YPLH 2BMGB 1MKXK 1EPTC 4DT4A 1S81A 4O3TA 2QF3A 4Y11E 1F2SE 2HRVA 1KDQB 2R2MB 2SNVA 3TLOA 1A46H 4ZKSU 3GS9A 3A87A 5EQRA 3URCA 2KM0A 1Y3WA 1GPZA 2AMDA 4K8YA 3A8BA 3MMGA 5C94A 3GICB 1GI7B 1KTTB 3TH4H 1CQQA 4BAMB 1UTMA 2FIRH 1A61H 2VIWA 2V7QD 2FOHA 3MH5A 5CDFE 3GCOA 3LGVA 1VITG 3LDXH 3A84A 3U98H 3TK6A 2GCHF 5IYTA 1NPMA 1RIWC 4SGBE 1Q31A 3PYHA 2LP6A 1HAVB 1RFNA 1K1IA 4XBBA 1DWCH 3Q77A 2A45B 5SGAE 3Q3KA 3T26A 4Y8YA 4RKOB 3K6ZA 3SQEE 4ESTE 3OTPA 2A4GA 3ODDA 3KQBA 4TWYA 3OFND 3LC3A 1FQ3A 3E0PB 2BD3A 3TJNA 3PMHB 4K1TA 2K1QA 2WYGA 2F9PA 1DSTA 1GJ8B 2RFKC 1ZJKA 5EIYA 2VJ1A 4X2XA 1EUFA 3AW1A 1C1PA 1HJAC 1CE5A 1QBOA 1TGTA 4FETA 4RT1A 2ZF0H 1C1TA 2ODPA 1KIGH 1UTQA 4WXIA 1TYNA 3VPKA 5C5NA 3GYMA 4H42U 1HXEH 1P9SA 4AC9A 1IHSH 8ESTE 3VB4A 1UVSH 2JETC 3N7OA 3OU0A 1EZQA 2BZAA 4AB9A 2KCOA 2FLRH 3AAVA 3UUZA 1Z6EA 1AMHA 4OGXA 1CA0B 2A7CA 2XXLA 5HKKD 2ZGBH 1K9OE 5AHGH 2KX4A 3SYJA 4MPUA 4Y71A 3PROA 2ANKH 3TGKE 1N1LA 1QURH 4Q4LA 3SGBE 1PQAA 1ZJDA 2H2ZA 1FY5A 4B1TA 2ILNA 1TQ0B 1F0TA 3RXMA 5GCHG 1O2LA 5JB8S 4ZKRU 3HGNA 5CHAC 1C2MA 1H8IH 4JZ1A 5A8XA 3O8CA 3MU5A 1SMFE 3VGCC 3M7UA 1GVKB 3QWCH 2JDID 1DXWA 1GBAA 1YLCA 2ZU1A 3M7TA 1C2HA 3RXBA 4WMFA 1GI6A 4X2VA 2DE9A 1J14A 1C5MD 2ZU2A 3A80A 1GDUA 3HATH 2J4IA 1E35B 3EE7A 5JPMH 1TFXA 4BAQB 1C1UH 2OBOA 3ZVGA 3Q3XA 2PTNA 4NZQA 3EGKH 3RXRA 1QL9A 2A4QA 3FP7E 3GOVB 1ZTKA 2HVXA 5F8XA 3QUMP 1YLDA 1Z6JH 1Z1IA 3PMJA 1CA8B 3M5NA 2XBWA 3AAUA 4Y79A 4A7IB 3ATMA 1ZTLA 1D9IA 1ZHRA 1SLUB 1ZOMA 1PPGE 1QFKH 1GBEA 3PO1C 2ZPSA 3ODFA 1AVWA 3SNEA 1KMHB 1QJ1B 3NUMA 3SGQE 4NFEA 2ZFTA 2GCHG 3ZZ7A 1LKBA 2SGFE 1SL3A 1OP2A 1NM6A 4JK6A 1OOKB 1A1RA 5HM9A 3TH2H 2A31A 2CHAB 2RG3A 4TT3D 4X6MA 3ITIA 4U32A 1K2I1 1XUFA 3MU4A 4IN2A 1G32B 5C5OA 5CE1A 1ID5H 3H5CB 1TRMA 1TB6H 3DCLA 2TPIZ 2XW9A 5DPAA 3SJOA 1HBTH 2R3UA 3PRBA 1O3IA 4WJG2 3GYLB 1EZSC 1YPHC 1K1OA 3SJKA 4FVBA 2FX6A 4Z1MD 3FN8A 1SQRA 1BMLA 1BTHH 1HCGA 1P2QA 4NA9H 1Y5BT 4X1SU 1SPJA 3O8BA 2JKHA 4ISHH 2SGQE 2BDCA 3LOXA 1NZQH 2Y82A 1S84A 2GMTC 4ABBA 5I46H 4CHAC 4IGDA 1V2JT 1SGPE 1QL7A 2FOAA 3A7XA 2AMQA 4NIWA 4LOYH 3FKSD 1B5GH 1MMJN 1OXGA 1SGNE 1QHRB 1L4DA 1OWHA 2VIOA 1PYTD 3PLKA 2YOLA 3S9AA 4OS1A 3FZZA 3UNSA 1J17T 4E06H 5EQSA 3FP6E 2J94A 5EQQA 1C5PA 1LVOA 3RC5A 3STIA 1ESTA 5A0BA 1NU9A 1BTXA 2HVYB 7GCHG 4BTIB 2XTTB 1M9UA 3ZZ3A 2FX4A 1D3PB 1UK2A 3BF6H 1C2LA 4BAHB 3KGPA 2ZGCA 1A5IA 4WMDA 4RI0A 1Z8IB 1O3MA 3M37A 1Y5UT 1W0JD 3SU2A 4INLA 4XBCA 1QRZA 1P2NA 1KXCA 4CHAB 1BRBE 1EB2A 1GBKA 1O3KA 1PPEE 4X8TH 1SGEE 2FMJA 4NSVA 1TBRH 1V2WT 2ZQ2A 1FY4A 3PB1E 2SNWA 1TLDA 2QF5A 1CGHA 3GY7A 4ACBA 5I25A 1N6YA 3ZIAD 3MOCA 5HIYA 2VIDA 1A2CH 4FUJA 1PPHE 4XE4A 1PQ8A 3EA9A 5FCRA 1MUEB 2D8WA 3ZZCA 1UTOA 4I86A 1SG8B 1ZGVA 1EFRD 1QRXA 2VU8E 3SU5A 4A92A 2AGEX 1ZPZA 3SUEA 3KQEA 2KCPA 5GPIB 3STJA 3RMMH 4IBLH 2K8IA 2V35A 1P2IA 2WPMS 1J16A 1JIMA 3ENSB 3Q76A 1T8MA 4MPVA 4AFSA 4MNWA 1GBMA 1AD8H 4AOQA 1QB1A 2VIPA 2OC1A 4ZKOU 2BDAA 4UD9H 4YOIA 9LPRA 4O9VA 3OEHD 1GI9B 3SU1A 2JIZD 1BITA 1O5AB 2D2DA 1L1JA 3WW7A 3UQVA 2ZFRH 4U30A 1PPCE 4BANB 4O97A 4UFFH 3RXFA 4Q2KA 3P6ZB 2EI8A 3ZZDA 2XC0A 4BAKB 3BTFE 1WAYB 5F8TA 2ULLA 1MH0A 2BHGA 4FU9A 2ZHQH 1WCZA 3GCHB 5FL7D 4ABGA 2A2QH 1N6XA 1L0ZA 4OS7A 1C9TA 2PSXA 5BPEA 1S82A 2F9BH 3VGCB 1OWJA 4VGCC 4DW2U 1F92A 1E37B 1S6FA 2XWAA 1O35A 3EYDA 3OSYA 1SGCA 1CBWB 1LHFH 3BTTE 1TGSZ 5C3NA 1TNIA 1C1RA 1O2TA 5C20A 2C8XB 3SU0A 2ZGXH 2OTVA 4R8TB 1XX9A 2CK3D 3ZVDA 5AF9H 4X1NU 1HAIH 2P8OC 1P3CA 1C4V2 2VINA 2LPRA 1EATA 3GY5A 1TONA 5F03A 4Y8ZA 4M7GA 1BBRK 1J9CH 1OX1A 1WXRA 1HAVA 1C2GA 3LONA 1ELVA 1NN6A 1WYKA 4DG4A 2UUKB 2Y81A 1SGDE 2A7JA 4MPWA 4Y7BA 4AORA 2PV9B 4D7FA 1DWEH 1F7ZA 1QRWA 1KLJH 3D62A 1DANH 2QCYA 5HXFA 1C5XB 2G8TA 1CBWC 1WDIA 3HPTB 4IC5A 1OP0A 1GVLA 3ELAH 1XUIA 1RGQA 2ZU4A 1D6RA 4I32A 1UCYH 3RXPA 2XRCA 4Q80A 1ZMLA 2GMTB 2W5EA 2J38A 3HKIB 4GCHG 1ARCA 1C1QA 4Z6AH 1ANEA 1JWTA 5CHBA 2YNAA 1SGIB 2J97A 2J95A 2P94A 1O2PA 2QN5T 1AWFH 4E05H 2D1JA 1OHHD 1CO7E 2VVUA 2G4TA 2BY6X 3U1IB 1VJ9U 1V2RT 4OS6A 4P00A 4WY3A 3B9FH 1GL1A 3BN9A 2AEIH 1V2NT 2H6MA 2JJ1D 2GD4B 2G5VA 2OQ5A 4RKJB 2WZQA 4ZROA 1G3EA 1OWKA 1BRCE 2BDHA 4H6TA 3H7TA 2F9NA 3MO3A 4BXSA 2BY5X 1VITH 1LVMA 2BX3A 3P17H 1EJAA 5DP8A 3U8RH 5DN6D 3LH3A 1UTJA 2YMSD 3P8NA 4NG9H 1O2MA 4BTUB 1GHBF 1O39A 2ASUB 1UCYE 3GY4A 1T7CA 1SBWA 1DOJA 2KAIB 4A6LA 3RXOA 3PRDA 1O30A 3K2UA 1E38B 1IQGA 6LPRA 3SV9A 4YZUA 1UTNA 1N8OB 1GI1A 1UVOA 2ZA5A 2VGCB 3IWMA 2ZPRA 1A5HA 1S85A 3DD2H 3FAOA 3E3TA 2ZFSA 2Z9LA 2VNTA 4FXGH 4FUBA 1SQAA 1DVAH 1XKAC 2OUAA 1JRTA 1O2UA 1BT7A 1AIXH 2H5DA 2JJ2D 2FPZA 4CRGA 1CT2E 3WY8A 4DURA 4MTBA 2ZTYA 1C5LH 1CVWH 4DIIH 3SHCH 1DWDH 3TJOA 1SGYE 3L6PA 2VIQA 3I78A 1ZSLA 3LJJA 3DA9B 5AFYH 3TITA 1FAKH 2ZO3H 2Y7ZA 3RLYH 1OYQA 4X6PA 2DUCA 2FOBA 4AX9H 1SGRE 2J98B 1CSOE 2R3YA 1Z71A 4A1VA 4X2WA 1GGDC 1AU8A 3LGYA 5EW1H 4JYTA 3SJ8A 4R0IA 1THRH 4JZIA 3VFEA 3A81A 3GCTG 1O3PB 4Q7XA 2PLXA 1LHDH 3K9XB 2R9PA 1AB9B 1O3JA 1V2MT 1OWEA 5HIZA 1DLEA 1QB6A 3HK3B 2A4OA 1E79D 2BDYA 2J34A 1Z8JB 2TIOA 2WV9A 3D23A 3Q00A 5HM2A 1TRNA 3TPIZ 2QXHA 3BTHE 1MABB 1X7AC 4UFDH 3KIDU 2W26A 1C1MA 4CREA 3P70B 1NFXA 3FVFB 3CNRA 2JH0D 3ZZ4A 1E34B 1H9LB 2STAE 3UB0A 1AQ7A 1WQSA 1D3TB 2O8MA 1KYNA 2XBXA 4MG3A 3VB6A 1PYTC 4DCDA 1INCA 1BJUA 1C5UA 2OC8A 3CENA 3MHWU 6CHAB 4NIXA 1DT2A 2F91A 5FPSA 1BMAA 4B76A 1BHXF 1ELFA 1TX8A 1ZSJA 5C2ZA 1KXEA 1LO6A 2BOKA 3T28A 1GHAF 5F8ZA 1C5VA 2M2AA 1FONA 3O8DA 1O2YA 1YLNA 4GAWA 1YPJH 4YLQH 2OK5A 8GCHF 3A89A 4HZHA 4ABHA 2SGAA 1EXFA 2W3KA 3P8FA 4ZHMU 1TA6A 1TGBA 3DSGA 3VB5A 5B6OA 3E16B 1TNGA 2WUCA 2A5KA 2NWNA 1KXBA 2RA3A 4HGCA 4SGAE 1EX3A 1T8NA 1A4WH 4A1TA 1TX6A 3CS0A 2YNBA 3NRLA 2HLDD 3MQKC 3P95A 4UEHH 3OAAD 1FN6A 1EB1H 2KZ4A 3UWJH 1HRTH 1W11U 2FTMA 1YC0A 1O2HA 4TY6A 2BZ6H 2F4LA 5AFZH 3ZV9A 1ETTH 1BOQA 4XRNA 3SV2H 4JYVH 3A8DA 1NC6A 1E1RD 1TNLA 5BRRE 1QZ8A 3F68H 1ELTA 1FY3A 1O2KA 4Q63A 3SUFA 1ELDE 1GHWH 3K6YA 2Z6BD 3SU4A 2P93A 1W14U 1TPOA 1JMOH 1TGNA 1TWXB 2BXTH 2SFAA 1ESAA 3SV7A 1MTWA 2ALVA 5EOKA 2W7SA 1JRSA 2UWPA 3SGAE 1UTPA 2C93B 3NKKA 3SBKA 2Q6GA 1HYLA 3RXLA 1NT1A 3TJUA 1SC8U 4AGJA 4DY7B 3MNSA 1O3CA 3A7ZA 1GBCA 5FBIA 1ETRH 2FODA 3QTOH 3S9BA 4K1SA 3N7EA 3GY3A 2STBE 1FMGA 5C0TA 3VEQB 2GZ9A 1AKSB 1QNJA 2ZU5A 1UTKA 1TX7A 2HNTC 4X2YA 4X6OA 1AHTH 1DPOA 3RXDA 4D9QA 2H1UA 1PPBH 3CS7A 2Z3DA 1DSUA 1C4Y2 1TPPA 2BLWA 2G55A 4CRDA 1SFIA 1Y3UA 4ISLA 2H5CA 2ZNKH 3A8CA 4GLYA 3LH1A 1BIOA 4GHTA 1O2ZA 4HG6A 4CBOA 7KMEH 1O3HA 4BXWA 1Y5AT 5ETXA 1RRKA 4ASHA 4Q7ZA 1AB9C 1GMCG 1T32A 1XKBC 4GSOA 4WH8A 1HJAB 2A2XH 2ZTZA 1C5NH 4YO9A 4F48B 4I8LA 2ZFQH 4JZDH 3RXUA 1IQJA 4CR5A 2Y7XA 5C67A 4ZUHA 1O3OA 1P04A 1ANCA 1Z1JA 4B75A 3KQCA 1VZQH 4Q7YA 2QXGA 1K28D 3T2NA 3TIUA 1O3NA 1L1GA 4BOHA 4UE7H 1WTHD 2ZHWH 3KNXA 2CF9H 2ZQ1A 3SNAA 5C0UA 3KCGH 2OLGA 2IN2A 1DM4B 2TGTA 1ANBA 3A86A 1HPGA 3V3MA 1SFQB
chains in the Genus database with same CATH topology
4BAOB 1E0FD 2G52A 1GG6B 4Y0YE 4X1RU 1AFQB 1NFWA 2ZDMA 4GCHF 1LHGH 3KEEA 3GDUA 1V2QT 4AGKA 5A8YA 4AG2A 1ZRKA 2A0QB 3PLBA 2XCNA 3OYPA 3ZYDA 1FUJA 2ODQA 1TBQH 1TALA 4Y6DA 1YPMH 4WVPE 3RP2A 2GCTC 1G2MA 1SGFA 5LH8A 1QA7A 1O2SA 4NZLA 3FP8E 5FHTA 2OP9A 3RXEA 1SGFG 1G9IE 2ZDNA 2VIVA 5H4IB 5A2MH 2AIPA 2TGPZ 3RXJA 2HPQH 1MU6B 1O5GH 3PTBA 4JYUH 1EQ9A 1V2ST 1EJNA 4OGYA 3UNQA 1DDJA 3ZVBA 3U1JB 1P8VC 1LKAA 1Y3XA 1KXAA 4I8KA 4ZXXH 3L33A 1HV7A 1XMNB 1G3BA 3JZ1B 4XSKU 3PMAB 4INKA 5DG6A 3SNBA 1MKXH 3PO1B 2ZKSA 1KLIH 1O5CB 1MTUA 3MI4A 2GZ8A 1C1VH 1K1JA 1C1NA 1NFUA 1NRNH 5TJXA 2VWMA 2YMSC 1O5DH 2BLOA 2EI7A 1HAYB 1O5FH 4TYDA 2QYIA 4Y10E 1EASA 1TNHA 4JZEH 3GDSA 1IQEA 3RDZA 1WBGB 2Z94A 3F2GA 1FNIA 1SSXA 5GXPA 3NWUA 1O36A 3BG8A 4OS2A 4K2YA 5CMXH 3HGPA 2ZPQA 4NIYA 1Y59T 1K1PA 1G3CA 4D76A 2KCYA 1VCPA 3G01A 1GMCF 1V2VT 1SB1H 5LGOA 3GISB 2FYQA 3BTQE 4NWKA 1Z8RA 3SW2B 1ELCA 2GP9B 3QGJA 3RMNH 3U9AH 1FXYA 4K8BA 5PTPA 4ABIA 4ABEA 1OKXA 3A7TA 2LELA 2BQ6B 4FUHA 3LKWA 5GWZA 5A0AE 1EAWA 1JBUH 2H9TH 4AN7A 1LPZB 1AVXA 4IN1A 1GJ6A 1O3FA 4HTCH 2QGRA 1O33A 5T6FA 1GBBA 1RTLA 3RMLH 1P02A 4M9FA 2TGAA 3RXSA 4AYVB 3RXKA 2RA0A 3MTYA 1GI0A 1IAUA 1LVYA 4YTAA 1T8OA 1ELAA 2AIQA 1OP8A 1QTFA 3T29A 2EA3A 2YMSB 1B7XB 4B2CA 4ASUD 2THFB 3QDZB 5GCHF 1EOLA 1P06A 1C2FA 3ATLA 5GDSH 4TY7A 2BDBA 1V2OT 2FI3E 4BNRA 1XVMA 1WU1A 1NBME 3A7YA 4INHA 4FUEA 2BB4A 2GDDA 2OBQA 1E36B 2OQUA 1C2KA 2PSYA 1K1MA 1O2QA 3BV9B 1BCUH 6GCHG 1XUGA 5C17A 4BTTB 3PV4A 1QCPA 3A7WA 4F49A 4LK4A 3BG4C 2UUJB 1D6WA 1O2VA 1DY8A 1A5GH 4DT7B 2B0FA 4J2YB 1C5YB 1W0KD 4FU7A 1P2JA 3URDA 1BB0B 1DUAA 2FS8A 1Z8GA 5EXMA 9ESTA 1NFYA 3E90B 5A8ZA 1W0ZU 5JBAS 2P3FH 2ZIQH 2L6OA 2PKAB 1A0LA 4WF8A 3MWIU 1BQYA 1V2LT 5JBCS 1KY9A 2ZZUH 1OSSA 3ZVAA 1ZPBA 3UWIA 1O37A 1IQHA 2CJIA 5FPTA 2IOTA 4ZAEA 3ZZ9A 2JH6D 1SKYE 2BXUH 2AGIX 2Y5FA 3M7QA 1OWIA 2I6QA 2C90B 5EG4A 5ABWA 4IC6A 5FBEA 1O2WA 4YESB 2V6NA 5GNDA 1MAYA 2GZ7A 2FZZA 1DLKB 3GCHC 4X6NA 1GMHF 1QIXB 5EXLA 2R2WU 1ZZZA 1V2TT 1UVUH 1GJ7B 1GHAG 4O03A 1W3CA 2O8LA 8GCHG 2PUXB 1BTUA 1BTWA 1IQMA 6CHAC 4FUIA 4XFQA 3F6UH 3OY6U 1SGQE 1TMUH 3T25A 1AZZA 1CGJE 2ANYA 3NZIA 1MTNC 1ELEE 1UTLM 4ZHLU 1P0SH 2BY9X 4YLUA 3RU4T 1F0RA 1BBRH 1ARBA 3HKJB 2OINA 1UJ1A 1XUJA 1ELGA 2AERH 2XC5A 1HB0B 1GCTC 1GJAB 3TVJB 1Y3VA 5T6GA 1G36A 2Z9KA 3WWBA 2XCFA 5EU8A 2ANMH 2FOFA 1YF4A 3SU6A 3KF2A 3MH6A 1JXPA 5IDKA 3SQHE 3RXHA 1E1QD 2PKAA 4QT8C 3E91A 1CA0C 2Q1JA 2J9NA 4D7GA 3P92A 3UR9A 4AYYB 2FP7B 3BIVH 4A5TS 1NRPH 3QN7A 4ABDA 2CGAA 2FESH 1HLTH 4D8NA 1QY6A 2PKSC 3DSPA 1TBZH 2ZHEH 4XDEA 2Y6TA 3SI4H 1C5RA 2EI6A 3RMOH 1GGDB 4U2WA 1P11E 2WINI 2PR3A 3DUXH 3UNRA 2O9QA 4FUCA 4ZCNA 3PV2A 2BX4A 5DP6A 3BTEE 6GCHF 5J4SA 2VBCA 3SNCA 1C1OA 3SN8A 1O32A 4KTCA 3V12A 2BDIA 1P3EA 5DSFA 2SGDE 1HAPH 2GDEH 1P2KA 4UDWH 3QGNB 1O2JA 4HI3A 5DKMA 2GKVE 1GBLA 2OD3B 2RDLA 1TE0A 1GJCB 4K60A 3RUOA 3MU1A 2BQWB 4FUGA 2IPHA 1LCYA 1FPCH 3WWFA 1DFPA 1YPEH 1O3EA 3MFJA 4FUDA 5IK2D 1O2OA 1HJ9A 1UK3A 1WQVH 1KXDA 2TRMA 3OE7D 1DE7H 5T1VA 3RXGA 2W7UA 1PPFE 4CRCA 5JBBS 1OYTH 2VGCC 1HIAB 3OY5U 2FEQH 1TGCA 1VJAU 1L2EA 2FWWA 1LHCH 3ATWA 1B0EA 2JH5D 1EZXC 3ZZ5A 1GMDG 2ZFPH 3RXQA 3EAJA 1CT0E 1TRYA 3BEFB 3SHAH 2UUFB 3MNBA 5DO4H 1O3LA 4ABJA 2BD8A 3D49H 2Z9IA 4MLFB 1C4U2 1MD7A 2XOKD 4DVAU 1SOTA 1QQUA 3A88A 3BEUA 4Y76A 5L6NH 2F43B 5DGJA 2BDGA 3ZV8A 1QJ6B 4E7RG 5EODA 2HNTF 3E6PH 4YT7H 3N99A 5EPYA 5DP7A 1TMBH 4B73A 5FX5A 4JK5A 3PWBA 1GDNA 1P03A 1DWBH 2W3IA 4I8JA 2ZHFH 4KKDA 4ZMAH 1EAUA 8KME2 1AFQC 1AGJA 1NS3A 3PWCA 4WWYA 1RIWB 1P05A 3S9CA 1SVPA 4MPXA 1NRQH 1QR3E 4NGAH 3VB3A 3M3VA 2PUQH 3BTDE 3SJ9A 2R0KA 1GI5A 4B6EA 4NA8A 3M5LA 3RU4D 3U69H 3VB7A 1FV9A 1PQ7A 2OXSA 5DP5A 1YBWA 5TCCA 1TABE 1L4ZA 2AMPA 1S6HA 1TNKA 3MYWA 1O31A 2G4UA 3KQDA 4I8HA 4CRFA 3A7VA 1TPAE 1GVZA 3F0PA 1Q2WA 2GTBA 3LGIA 3BTME 3DFLA 1COWD 2F9VA 2BVRH 2OCVB 3ZVEA 5F6MA 2XC4A 5EPNA 1FN8A 5C1UA 1UVPA 2CHAC 2CV3A 5LPFA 2Z9JA 2ZECA 1W2KH 2AYWA 1DITH 1DXPA 2CXVA 5LPRA 2A5AA 3MH7A 1ZR0A 1HGTH 1DUEA 3M36A 3MU0A 1F5KU 1LTOA 4OS4A 1HNEE 4LZ1H 1SHYA 1O38A 4H6SB 1G3DA 3TGIE 2GGVB 5JB9S 1MCVA 4CH8B 2B5TB 3A83A 2P8OB 2D26C 1GBTA 1YPKH 1GHXH 2B9LA 1S83A 2F83A 4AFUA 2UWOA 3TH3H 3S0NA 5HMAA 4F55A 5FAHA 3BTWE 3TNTA 1F5RA 4KGAA 2KCAA 1HAXB 3EQ0H 1AUTC 3U8TH 4XOJA 4I31A 5T3HA 2NU1E 3SUDA 2XWBI 3RC4A 4TWWA 1LQDB 1CHOG 3DHKH 2TGDA 5FPYA 1GCDA 3VG8A 2H9EH 1DICA 1EKBB 2B7DH 2BD7A 1H8DH 3E0NB 1C5WB 1HIAA 4J1YA 2WPKS 2ZHDA 2AGGX 4B6FA 4B74A 2ZG0H 3TGJE 1QJ7B 3NPSA 5FCKA 3V13A 2ZP0H 3E1XB 4Y0ZE 2H9HA 3QO6A 1P9UA 1YP9A 5L30H 2ZDVH 3ZVCA 1FI8A 1Y8TA 1UK4A 3LGUA 2Z3CA 1HJ8A 1MQ5A 1W12U 2FI5E 2O8UA 5T6DA 3PLPA 4KELA 1W13U 5C1YA 2PFEA 1LHEH 5E0HA 1FY1A 1JIRA 1AFEH 3GY6A 2XNIA 1LQEA 2EC9H 3SJIA 3ZVFA 4NA7A 2M5TA 5GJ4B 2XBYA 3B23B 3M3TA 4U01A 4ZHAA 5LPEA 2BLQA 3BTGE 2WPDD 8LPRA 4YOJA 2WPHS 1H8HD 5DP4A 1PQ5A 3GY8A 1O0DH 1XVOA 2ALPA 2F3CE 2ZCLP 5CHAB 3LC5A 5E0GA 1TIOA 3F9HA 2PKSB 2WUBA 4NWLA 2O8WA 2TBSA 1NESE 1QQ4A 1C1SA 3F3BA 1S6LA 2FLBH 1UHBB 2QXJA 1EJMA 1MU8B 1ESBA 3QTVH 3EE0B 5E2OA 2BVXH 4X0WU 1V6DA 1BRAA 3LIWA 3UPEA 1C2IA 2FS9A 3T5FH 1EPTA 4X8SH 1P01A 1A3EH 2GX4A 1GHZA 1ZTJA 2P59A 4WMEA 4FVDA 1K22H 1HDTH 3TK5A 1F0SA 1YKTA 3TU7H 3P8OA 3UREA 4Z0KA 1ZHMA 1GHYH 1ZSKA 3B8JA 4YM9A 2A1DB 1B0FA 1CHGA 1ANDA 1GMHG 1GI4A 4CRAA 1O2XA 2XBVA 2QIQA 4K1EA 2Z9GA 3KHVA 1J15A 3ZZ8A 1HFDA 1GDQA 1XXFA 1Y3YA 2VWLA 1TOCB 1F0UA 3A82A 3SZNA 1BUIA 1VCWA 3UTUH 2Y5HA 1ZRBA 1XXDA 2ZDLA 1J8AA 1C5QA 5E8EH 2ZCKP 1C2JA 4GHQA 1FAXA 1K1NA 6ESTA 1BA8B 1TMTH 2QAAA 3SO3A 1JOUB 3RM0H 1G30B 1OWDA 2GVFA 3PMBB 2FDAA 1RD3B 3Q3YA 4MVNA 4ISOA 1W0YH 2I6SA 1C5ZB 5AVDA 1AVGH 2GT8A 1WUNH 1GJ9B 2SGPE 3DSOA 2BD2A 2DE8A 2R0LA 1YCPH 3W95A 3RXTA 3OEED 2LNCA 4JMYA 5B6LA 2GV6A 2NU3E 2RCEA 3UOUA 2A4RA 1GBHA 2J92A 4LXBH 3RLWH 2UWLA 2HPPH 2QF0A 3S69A 4AZ2B 1UCYK 1SR5C 1FIWA 1MD8A 1MTVA 4KTSA 2G81E 2BQ7B 1AWHB 1IQLA 1AKSA 1CT4E 1WV7H 3BG4B 5FX6A 1GI8B 1EP5A 1FPHH 1C5SA 1SQOA 1WSSH 2FOMB 1FDPA 1MTNB 1P2MA 3TNSA 1S0RA 2GT7A 1P57B 4K3JA 2PGBB 1TAWA 3NXPA 2WPJS 4Y7AA 3TK9A 1VR1H 2VWNA 4TPYA 1O3DA 3TJVA 3MNCA 2ZTXA 1GI3A 2NU4E 1GJ4H 2VVVA 1Z7KA 1TA2A 4VGCB 2BLVA 1ZYOA 1MAXA 1C5TA 5EXNA 1BMMH 2G5NA 3VXFH 1TNJA 1GBIA 2WPLS 1ACBE 5A09A 3AASA 4B2BA 2FO9A 3O8RA 1GL0E 1T4UH 1H9HE 1WOFA 3UY9A 4HFPB 2BY8X 3M5OA 1D3QB 1GJDB 3AW0A 3AK5A 1UMAH 1TQ7B 2ZI2H 3EA7A 3H09A 4O3UA 3SZEA 2A5IA 4AFZA 4CRBA 3F9FA 3CP7A 3QLPH 4DJZB 1ZPCA 2ZWLH 3F0OA 1MBQA 2Q6FA 1ELBA 2WYJA 1O3GA 3MNXA 3MO9A 1MTSA 2VH6A 3JZ2B 1YPHE 3BEIB 2ZFFH 3RM2H 3S7KB 3T62A 3AVZA 1FY8E 3RXCA 1NRSH 1V2UT 1MZAA 2VB0A 3SORA 3S7HB 1BJVA 1GBJA 4NFFA 1BTPA 1PJPA 2QXIA 1P09A 3F2HA 3IG6B 3UQOA 1LPKB 3LJOA 1EPTB 1V2KT 1O2RA 2WHXA 3W94A 4UONA 2NU2E 5G4BA 2QY0B 1PPZA 1KLTA 2EEKA 4DIHH 3N7DA 1HAGE 4ABAA 1MZDA 1THSH 1YCPM 2FOCA 2GCTB 1SQTA 2ZDKA 1UO6A 1GBDA 5HYOA 1O5EH 2HALA 2QF4A 3EA8A 4B2AA 5EW2H 2K0QA 4JZFH 2B8OH 1ZHPA 4AB8A 3M3SA 1IQNA 3ESTA 4KP0A 1DY9A 2FYRA 1XUKA 2BYAX 5A0CA 2BOHB 2BM2A 1GHBG 1O34A 4I33A 5JBTA 4B71A 1BBRE 1SOZA 1QBVH 2BVSH 2PTCE 2ZGHA 2P3UB 7GCHF 3KL6A 5FXLA 1EZUC 1GHVH 1MBMA 2IJD1 1O3AA 5GIBA 1TPSA 4CR9A 2WSSD 2OC0A 1ZLRA 1N8OC 1Q3XA 4LZ4B 2F9OA 1MKWK 4WH6A 2BD9A 2SGEE 1VITF 3PTNA 1AY6H 4TSFD 1YYY1 1C2DA 3SV8A 2CF8H 4MNXA 1K1LA 5DP9A 1FIZA 1FX0B 4XD7D 5DJ7A 3RU4E 1W7GH 1K21H 1BHXB 1SGTA 3F1SB 1HAZB 3ZZ6A 4ABFA 1AE8H 1THPB 3VXEH 1W10U 1ORFA 1T4VH 3OX7U 1SHHB 4X8VH 4NSYA 4ISIH 3FO8D 1TOMH 1A0JA 1ETSH 2XNDD 1CGIE 2XYAA 1MCTA 2P3TB 5K0HA 3R0FA 2P16A 4AFQA 3F9EA 2BD4A 4PROA 3LGTA 2ZGJA 5TCAA 1OS8A 1CHOF 4GPGA 3ZYEA 2AHME 2IJOB 1CU1A 1A7SA 1PFXC 2FOGA 3LPRA 2HGTH 2Y5GA 2FTLE 1NO9H 2VWOA 1HXFH 2CMYA 2P95A 3L3TA 1GWAA 4X8UH 4XBDA 4D9RA 2F9UA 3ATKA 3H7OA 1GBFA 2FM2A 2J2UA 1QGFA 1AO5A 5ESTE 1KXFA 2HOBA 3GCTF 2WV4A 2PWXA 2BTCE 1O2GH 4YOGA 5JYIA 4YXWD 1Z