2GGVB

Crystal structure of the west nile virus ns2b-ns3 protease, his51ala mutant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
169
structure length
169
Chain Sequence
PKEYKKGDTTTGVYRIMTRGLLGSYQAGAGVMVEGVFHTLWATTKGAALMSGEGRLDPYWGSVKEDRLCYGGPWQLQHKWNGQDEVQMIVVEPGRNVKNVQTKPGVFKTPEGEIGAVTLDFPTGTSGSPIVDKNGDVIGLYGNGVIMPNGSYISAIVQGERMDEPIPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords non-structural protein 2B
publication title Structural evidence for regulation and specificity of flaviviral proteases and evolution of the Flaviviridae fold.
pubmed doi rcsb
source organism West nile virus
total genus 30
structure length 169
sequence length 169
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00949 Peptidase_S7 Peptidase S7, Flavivirus NS3 serine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2ggvB02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2ggvB01
1GDNA 1LMWB 5JBAS 2GZ9A 3U8RH 5GNDA 2F91A 4LZ1H 1O2TA 1UCYK 4SGBE 4I8LA 2SNVA 3SJ9A 1KLJH 3MNBA 4FUJA 4YTAA 1GGDB 1W3CA 1SVPA 1UTJA 3M7TA 5B6OA 2XBYA 4H6SB 2EEKA 2BLVA 1G2MA 1CQQA 1VZQH 1SGIB 3T29A 4YM9A 2ZDNA 4KTUA 1XKAC 3LT3A 2J2UA 3AAVA 2HGTH 2ULLA 1JBUH 4X0WU 1GBAA 1L1JA 1Y5UT 1W13U 2W7SA 1C5WB 2ZFRH 1WXRA 1V2WT 2FI3E 2Z9IA 1GJ9B 2GKVE 3BIVH 3ZVEA 5F8TA 3V7TA 4ABAA 5HGGA 1OX1A 1CE5A 1AN1E 2XBWA 3P8NA 2FLRH 3V12A 4CRBA 1HIAA 4ZMAH 1ZR0A 1ZYOA 4OS4A 3MO6A 1YCPK 3SJ8A 3AW0A 2FMJA 5EG4A 1O3DA 2FEQH 2VJ1A 3O8DA 3SU3A 4H4FA 2RDLA 1VITF 4TPYA 2AS9A 5TCAA 3EDXB 1SQAA 2ZGHA 3QWCH 2B5TB 1KXBA 2RA3A 3H09A 2ZCKP 3UTUH 1F0UA 1BMMH 3MH4A 1BBRH 2OC0A 1Z7KA 1BT7A 9LPRA 1CT0E 6LPRA 1GPZA 4ABBA 4DGJA 3Q76A 5F8ZA 4MDSA 1G3CA 4IW4E 2JETB 5JPMH 1HDTH 3QO6A 3VB6A 3N7OA 1HRTH 5T1VA 1H9IE 3FAOA 2QCYA 1OWHA 1HAYB 3HKJB 3PLPA 2V6NA 4TY7A 1UJ1A 2QGRA 1ZJKA 1P04A 2AYWA 3HKIB 1YPKH 4WMEA 3LC3A 3RC6A 2W3KA 1S6FA 2HRVA 5A0AE 3MH7A 3RU4T 2Y5HA 3RXBA 5EXMA 1WSSH 2GDEH 4BTTB 2VWNA 2QXHA 4AFQA 2CF8H 5JDUB 1ZSLA 2F3CE 4KKDA 3SNBA 1KYNA 4AG2A 2FO9A 1AWFH 5GPIB 4E7NA 6ESTA 3LDXH 1B7XB 3O8CA 1DITH 1T4UH 4X2VA 1ZGVA 3T28A 1SLWB 4RN6A 1XVOA 1ABJH 2Y81A 2O8UA 1TLDA 1QIXB 1SQOA 3BTFE 8LPRA 4Q7ZA 3SU1A 2CXVA 2AGGX 4Y8ZA 1BIOA 1NM6A 5FHTA 1C2IA 3PMJA 4BOHA 1W8BH 1FAKH 1J14A 1U6QA 1B5GH 3RDZA 1SGCA 5G4BA 3UUZA 3UR9A 1CVWH 1ZJDA 4NZQA 2THFB 3ZZAA 3T2NA 4Y76A 2FTLE 1O2YA 2ZHDA 4WY3A 1BTYA 1TGNA 1S85A 1Y3VA 3TGIE 3KNXA 1BOQA 2Z7FE 3UWJH 5IDKA 4GCHF 2GT7A 1UHBB 1O5AB 1FV9A 1Y3WA 1K2I1 1DLKB 3RMMH 4A6LA 3QGNB 1C2DA 1XUKA 3ZVDA 1TNKA 6GCHG 2O8MA 3TJNA 1NRPH 3RXDA 5A0CA 1ZHPA 1NFXA 1QL8A 1XM1A 2H2ZA 2JKHA 2NWNA 1Z1IA 3BTTE 4MQAA 2FX6A 3ZZBA 3TNSA 3FZDA 3HGNA 5C5OA 1H9LB 1O3BA 1KLIH 2BX4A 2OTVA 3MO3A 5F8XA 3BTQE 3A7ZA 3TLOA 2QN5T 1AUTC 1ARCA 1NRRH 2RCEA 1MTVA 2AGEX 4AX9H 1DWCH 5EODA 1J17T 1YPHC 4Q7YA 2FOAA 4NIXA 4AB8A 3LJJA 2BDHA 1GJBB 3LH1A 2ZZUH 1O3OA 1LHEH 4RI0A 5K7RA 2BM2A 1C2EA 1LKBA 2VWMA 3SU6A 1AZ8A 3GYMA 1MKXH 2WPHS 2TGTA 2J9NA 1WQVH 4Y7BA 3RXHA 1G2LA 2ZTZA 7GCHF 1FI8A 2ANYA 2KAIA 2H9HA 1IHTH 1LHGH 1IQLA 2FX4A 1S82A 1DLEA 3RU4D 1A7SA 1TB6H 3DA9B 2FOCA 1EAWA 3Q00A 1YPMH 1YPEH 2ZQ1A 1DX5M 1DUEA 1MU6B 2C90B 3GCHB 4WXIA 4WXVA 1TPSA 4K1EA 1P2QA 1SGPE 3A85A 1WAYB 3RXOA 1UO6A 4ZKSU 1PJPA 4YO9A 1O5GH 4A1VA 2I6SA 3OX7U 2A1DB 1BRAA 2W7UA 2PW8H 3GY4A 3P17H 4K5ZA 1TNJA 5FBEA 1CA0B 1H4WA 4I8KA 2F83A 1GJ5H 3IWMA 2C8WB 3F9FA 1AGJA 3KL6A 3KQDA 1AVXA 3R0FA 1V2OT 1EOJA 2ZNKH 2VIOA 1PYTC 3LH3A 3BTDE 3BTHE 4B76A 1ZSJA 1DSTA 1O38A 1P09A 2VIDA 1GJ8B 4E7RG 1INCA 3LU9B 3T26A 2ANKH 4Y11E 1EB1H 2RG3A 1O3PB 2ZFFH 1NTPA 1UTKA 1O3HA 1BJVA 1DFPA 1LHFH 5HM9A 3GY3A 2OQ5A 1GBJA 1K28D 2AMDA 1HIAB 5ETXA 4BAQB 2ZDVH 4ZKNU 1S81A 3PLKA 1OWEA 4B1TA 2UUFB 5GCHF 2XXLA 3RMNH 2ZIQH 3P8OA 1SGRE 2ZHQH 3RXUA 1YF4A 5BRRE 1LQDB 1O2ZA 3E0PB 3SU4A 2A4QA 1HAXB 3RXSA 3A86A 2WV9A 5L2YH 2FOGA 5E2PA 1T4VH 2ZPQA 4Y7AA 1VCQA 4B2CA 2P59A 4UDWH 1NFWA 5ABWA 1MTNC 1GI5A 1CA8B 1SLXB 1NRNH 1C5NH 2BX3A 3B9FH 4CRAA 3S0NA 2HVXA 1EATA 3I29A 2B9LA 1DM4B 3HK3B 2GCTC 2Y7XA 1G3BA 3GY8A 3S7KB 4X8SH 2ZFPH 2ZFQH 4NWKA 1EXFA 4B73A 5F6MA 1HAOH 1AUJA 1A5IA 3P70B 2OC1A 1FIZA 2ZO3H 1GCTB 1P0SH 1FY3A 3GDUA 2R3YA 1QJ6B 2VU8E 1DSUA 1NFUA 1P05A 2XCNA 2XC0A 2XWBI 3RUOA 1L0ZA 1QB9A 5FBIA 3TK6A 1ZMNA 1TX7A 2GP9B 4FUEA 3TGKE 1GHBF 2V3OH 3NK8A 5DP3A 3SV6A 2PV9B 3SYJA 2BY6X 4R8TB 1A1RA 3U1IB 5CMXH 1ABIH 1OPHB 1Y8TA 3MOCA 1O3GA 4DOQA 3EGKH 1BMNH 3MTYA 1O34A 3F68H 4LXBH 1HGTH 1K22H 3D62A 1MTNB 1O3CA 1SR5C 1K1NA 3I77A 1ZLRA 1XXDA 2OBQA 3ATKA 2BY8X 1KTSB 1O2IA 2D26C 3A84A 1XUHA 1C5VA 4B6FA 2J95A 2P8OB 3O8BA 2CF9H 3DUXH 1BMAA 2R0KA 2ZDLA 3SJOA 1ORFA 2TBSA 5J4QA 4YT6H 4A7IB 1G36A 1ZGIA 3PROA 3SNDA 1GI0A 3OTPA 1GVKB 1SSXA 4CBNA 3S69A 1CT2E 3PB1E 2BDAA 2ZG0H 4DT7B 3DHKH 2OLGA 1SFQB 3BG8A 3BTEE 3P95A 5JBBS 3FP7E 5H4IB 1H8IH 4Z6AH 1ZTJA 3JZ1B 3S9AA 2ZF0H 3KCGH 4MG3A 2TGAA 1W10U 3SV8A 1AE5A 2ZGBH 1SMFE 1S5SA 2P93A 1MQ5A 5EXNA 1QTFA 3M5MA 2NU2E 1MKWH 1V2RT 1P2MA 2AERH 3ODFA 5EW1H 1ETRH 1WTHD 2BD4A 1BQYA 1WV7H 3MO9A 2VB0A 3D23A 2G51A 2YOLA 5AVDA 1EJAA 3ATIA 3LOXA 5FPSA 3E90B 2FYRA 2HALA 1L1NA 1GBBA 1VGCC 3TITA 1RD3B 3A8DA 2BVRH 1QA7A 1TGBA 5DK1A 5JB8S 4BAHB 4KELA 2KAIB 1AWHB 3V0XA 1D6WA 1FN8A 1GJ6A 1TNIA 5C2ZA 2SGFE 1C5RA 2BB4A 4O3TA 4ABGA 2FZZA 1O5FH 5HXFA 2ZCLP 1EPTA 2GZ8A 1ELGA 4ZKRU 5SGAE 3NKKA 1RIWB 3RM2H 3PLBA 2PLXA 3TK9A 1AFQC 2HPPH 1DWEH 2M5TA 1TGSZ 3A7WA 1NZQH 1SGYE 2A0QB 4NG9H 3SORA 2HWLB 2J38A 1KY9A 5LPEA 3P8GA 1ZRBA 2ZQ2A 3ZVFA 1V2LT 1LVYA 1P8VC 3MU8A 2QF3A 2FWWA 4GSOA 2ZWLH 1L1GA 2QIQA 1QJ7B 4B6EA 1F92A 4OS7A 1VJAU 4NGAH 3QTOH 1C1OA 4J2YB 4NFEA 1TQ7B 4MPVA 2F9OA 3VXEH 2TPIZ 4D7GA 2DUCA 2A5AA 1V2ST 1O2KA 5FCKA 4X6OA 2OC8A 1H8DH 2ZFTA 1ESAA 3MHWU 1BBRK 1KIGH 1HLTH 3E16B 2EI6A 4IBLH 3SU0A 4ABDA 2OINA 1GHVH 1GGDC 1PQ7A 4SGAE 2BY9X 4WMFA 4FXGH 4AFUA 1CO7E 2STAE 4A92A 3H7OA 1A4WH 4TPIZ 1P03A 3U8OH 3PV5A 2ZFSA 1WBGB 2JH0D 4YT7H 1GMCF 2P3UB 1QBNA 5A8ZA 1C5TA 5HM2A 2XNIA 1MH0A 2ZP0H 5T6DA 1MMJN 3RM0H 1WCZA 1GL1A 2NU0E 2ZGXH 3BG4C 2D2DA 1W0YH 4TYDA 2AMPA 4GPGA 4O9VA 1CBWB 4ZHLU 1O0DH 1V3XA 1SOTA 4YESB 2GCHF 1BTHH 1J8AA 1O3LA 2VBCA 3EA9A 4FU9A 4X2YA 1FNIA 2FIRH 3W95A 1XUJA 1HNEE 4Q7XA 1SPJA 2A7JA 1KDQA 3ZVCA 4X8UH 3U69H 1QR3E 1E34B 3TJVA 5GDSH 2G4TA 4YOIA 3GCNA 4FVDA 2JETC 1C9TA 2PGBB 2VWLA 5DP5A 1QY6A 4JZFH 4X1SU 2FOEA 1G32B 1T8LA 2WPJS 2Z3CA 5EXLA 3F9HA 1D9IA 4ZAEA 1G3DA 1SGQE 2AIPA 3OY6U 4ZROA 4UONA 2FS9A 1D3TB 5GJ4B 5T6GA 1P01A 3A7VA 1DOJA 1E38B 3BG4B 4MNYA 1ELBA 1IQNA 2XYAA 2BYAX 2V0BA 3GDSA 4ZXXH 1T8OA 3UPEA 3VB4A 2Y7ZA 1TRYA 1FY5A 1MBQA 1O32A 1BMLA 3SHCH 2BZAA 3RMOH 3ZZCA 1OYQA 3NUMA 3K9XB 1C4V2 2IOTA 5DJ7A 2PR3A 1O3JA 1GHWH 1C2JA 3V3MA 4MNVA 1OP8A 4ABIA 4JZIA 3PMAB 3M35A 3SZEA 2VIQA 5DP4A 4AGJA 2WV5A 1O36A 4UEHH 3RXJA 2QXIA 1Q31A 3BTGE 3GCOA 2A4RA 1PQ8A 1HB0B 3K65B 3ZVBA 3F6UH 3LGTA 1DY8A 1Q3XA 2ZDAH 2NU3E 2WYGA 5GWZA 2Z6BD 3RP2A 4K60A 1T32A 1YKTA 1ZPBA 3MU1A 1NFYA 1P2KA 3ZZ4A 2BD7A 4ZH8A 1TALA 1MKXK 4BTIB 1O30A 1OP0A 3SGAE 1C5PA 1O2SA 1TNLA 2SFAA 1FZZA 3AAUA 4WWYA 3RXRA 4I8JA 1FN6A 4ASHA 3ZZ6A 2ASUB 1OXGA 1J15A 1Y3YA 2ZTYA 2BXUH 3TJOA 3BTWE 3OTJE 1GI3A 1LHDH 4ABFA 2BQWB 3NCLA 1RTKA 3QX5H 1DANH 1JRTA 4ABJA 3BF6H 3TJUA 4U01A 1ELTA 4PROA 4CHAB 2VGCB 2W5EA 2A7HA 3LGVA 2LPRA 5TCCA 4JZDH 3ELAH 3M36A 1ANCA 1FONA 2QA9E 1LO6A 3GCTF 1T31A 4I33A 3GY2A 4O03A 3SI3H 1CGJE 1GHAF 3WY8A 1IQIA 1ZOMA 5LH8A 2BLOA 1T8NA 3M37A 4OS1A 4AYYB 1AU8A 3GISB 1ELEE 3DFJA 5LGOA 1P3EA 1BHXF 3E6PH 1EJNA 1EOLA 1P9SA 3MNSA 1C5ZB 2ZDKA 4HZHA 5FCRA 1UCYH 4D7FA 1EPTB 2P3FH 3P6ZB 3A83A 2GV6A 2GV7A 2PTCE 3TK5A 4ISHH 1UMAH 4WH6A 1D6RA 1ETTH 2V35A 3RXKA 1GMDG 2HNTF 4ISIH 4ISOA 2QV1A 1LDTT 1GDUA 3G01A 1L4ZA 1ESBA 4BTUB 1ELFA 2IPHA 3B23B 4X2WA 1V2JT 1W2KH 4JK6A 1E0FD 3C1KA 2ZHFH 2ZGCA 4K8YA 3GCHC 2QY0B 3F1SB 3UY9A 3ZYDA 4FUHA 1EB2A 2EI8A 5FX6A 2ZU2A 1P2JA 2R3UA 1W14U 3QK1A 4O97A 1EZXC 2FESH 3ZV8A 3RXAA 1AB9B 3PV2A 1CA0C 1CHOG 1TPOA 3ATWA 4UFFH 2FOFA 1C5MD 3GY7A 1C5SA 3PWBA 3Q77A 4FUBA 5EQQA 4IN2A 1NY22 3SNEA 1YYY1 3UFAA 4OM9A 1HJAB 1LVOA 2A45B 1BRBE 2VIWA 1W0ZU 1ZSKA 1EP6A 1SLVB 1YM0A 3QTVH 1EASA 2WINI 1A46H 2NU1E 3F9GA 1V2PT 4WH8A 2TGPZ 1MD8A 1O37A 1A2CH 4INHA 4JMYA 4DW2U 1SOZA 4DIHH 1QURH 4XE4A 5E0HA 1YLCA 1S83A 5J4SA 1WTGH 2TRMA 4OGYA 1OSSA 2K1QA 3LJOA 4X8TH 3SUDA 1QRWA 5L30H 2HNTE 2G4UA 1O3KA 4B2BA 3SNCA 1TNHA 3R3GB 3SJKA 3TIUA 1FAXA 4IC6A 3U8TH 1GJDB 1GG6B 4YLQH 1O5EH 2OQUA 1EJMA 3HATH 1UK4A 1BDAA 1UTPA 1AD8H 4NA8A 1XUFA 2TGDA 1FIWA 1A0LA 1RS0A 1GI6A 5I25A 1C5OH 5JYIA 1KDQB 5DP7A 1LPGB 2OC7A 1THRH 1O3EA 4BNRA 2FS8A 2F9UA 1EAIA 1OKXA 2ODQA 1NN6A 4ABHA 1K1JA 1HPGA 2BDCA 1GVLA 4J1YA 1FY1A 2BLWA 1C4U2 3M3VA 2UWPA 1QL9A 2BDIA 4Q80A 4BAKB 5ESBA 1EAUA 4XSKU 1V2KT 1GVZA 4WF8A 1C1UH 5K0HA 3RXEA 1GCTC 3PV4A 2C8YB 1BTXA 2SGAA 1PQ5A 2BOKA 2TIOA 4UFEH 3RLWH 1V2NT 1MAYA 3QN7A 4B2AA 4BAOB 3TPIZ 4NWLA 4CBOA 6CHAB 2LNCA 1IQHA 1PFXC 1Z6EA 1TAWA 1ETSH 1DVAH 1ZTLA 1EZSC 1O2UA 3ZYEA 1MKWK 2CHAB 1IQMA 2Z9JA 4GHQA 4OS5A 2XCFA 1HV7A 2AIQA 3GYLB 2FOMB 3A7TA 1XMNB 3UNSA 3STIA 1PPCE 1KXAA 1HAVA 2BD2A 2VVUA 2Y6TA 2XBVA 3VPKA 2WUBA 4ISLA 7LPRA 1QFKH 2AMQA 2A7CA 1PPFE 3ZVAA 2P8OC 3EA8A 4AOQA 2GMTB 4FUGA 1W11U 2XWAA 4A1TA 1O2MA 1FPHH 5L2ZH 3RXTA 4CRDA 1K1PA 1XXFA 4HTCH 3L33A 1W12U 3RXIA 1C2FA 4NA9H 3I78A 5AF9H 2BD3A 1GBCA 1O5CB 4MLFB 3RXPA 1C1VH 4M7GA 1TX8A 1Z8GA 4IMQA 5JBCS 4AYVB 3SV9A 1ID5H 1HCGA 1DUAA 3OU0A 3ODDA 8GCHG 1IQJA 1P12E 2CJIA 2ZU1A 2FPZA 1Z1JA 4TWYA 2ZU4A 1LPZB 4UFGH 1Z8RA 2G5VA 2WPLS 2WPKS 3TH3H 3NZIA 4B71A 1ELCA 1P2OA 4NSVA 1KSNA 2ZTXA 4D8NA 2G8TA 4FU7A 1TGTA 4X6MA 1BZXE 4GHTA 1GHXH 1IOEA 5LPFA 1VCWA 3K6YA 4A1XA 1C2HA 2AH4X 4R0IA 2R9PA 1D3QB 4HI3A 1TFXA 1TONA 3RXVA 1A0JA 4X8VH 1Z6JH 3UREA 3UQVA 2VIPA 2ZPRA 4Y71A 1Y59T 1TMBH 1BJUA 4B74A 1GJ7B 2ANWA 3OSYA 2SGEE 3EE0B 5A8XA 1OWIA 1ZHMA 1DICA 4HFPB 4AN7A 5DO4H 1PPEE 5L6NH 1K9OE 2A31A 3VEQB 2HPQH 2R2MB 1BUIA 3CENA 3SW2B 4Y8YA 2XC4A 3MI4A 2J94A 3B8JA 4X1NU 3MMGA 3TNTA 5GXPA 1K21H 4MPUA 2QXGA 1RIWC 1DDJA 2Y82A 1MAXA 4XFQA 2SGQE 4E06H 1P9UA 3KQBA 4FUFA 4TWWA 5CE1A 5FXLA 4FU8A 1LPKB 2A5IA 3S9BA 1JWTA 4X6PA 2A4GA 1SGFG 3Q3KA 2OBOA 1SI5H 2OD3B 1OWKA 2QXJA 4NA7A 1IHSH 1UTMA 2Q6GA 4KP0A 3RC5A 3RXCA 2Q6DA 2ZU3A 1GBFA 1GI4A 1GBLA 2VH0A 4I31A 3MU4A 1LHCH 3RXMA 1ARBA 3VGCB 4ZKOU 3M61U 2GT8A 1A0HB 1B0FA 1HBTH 2IN2A 2IJD1 3PTBA 1MCTA 4GLYA 3ZZ5A 4I7YH 2O9QA 1HJ9A 1UTLM 1CGHA 5PTPA 2Z3DA 3A8BA 4JYUH 3QZQA 2QF0A 4MPWA 1ANDA 2F9PA 3GDVA 3RXLA 1HAZB 3FFGA 3PYHA 1JIMA 2Y80A 1BHXB 1GJAB 1O2NA 3PM3A 3M3SA 2ZPSA 5EQRA 1LKAA 2BY7X 4K1TA 1NU7B 4KTCA 2WZQA 1A3BH 4DVAU 2OUAA 4CR9A 4FUCA 1OS8A 8ESTE 2EA3A 3ZZ7A 1SC8U 3E91A 1ANEA 2UUJB 2PUQH 4MNXA 3U9AH 1S0QA 3SHAH 1PPBH 5DKMA 3STJA 1QNJA 2WPIS 1DY9A 3M3TA 5TJXA 4XDEA 1HAGE 3PMHB 1F5LA 5T3HA 2Y5GA 1CBWC 1UHBA 1AVWA 1GMDF 3E3TA 5IYTA 3TU7H 3GICB 1AVGH 1O2OA 2AEIH 1F5KU 1SL3A 2WYJA 5C5NA 1O2WA 4AFZA 5DG6A 6GCHF 1HYLA 1G30B 1C2KA 1MQ6A 1L2EA 1YC0A 1O35A 2DE8A 4OGXA 5DP8A 1T7CA 3LIWA 1UCYE 1NC6A 2ODYB 4JYTA 3SUEA 5GCHG 2ZU5A 1F2SE 1BTWA 1MCVA 1QQ4A 4LZ4B 1FDPA 1GI7B 1HXFH 3HK6B 4VGCB 2H9TH 1DE7H 1C1NA 1C5LH 1GBKA 2PSYA 2P95A 2C3SA 2OXSA 1TGCA 1RRKA 1WQSA 1EX3A 4DIIH 1AFEH 5DP9A 3RU4E 1YBWA 1THPB 3URDA 2A2XH 1GI8B 1ELDE 3BTME 5AHGH 2UWOA 3MFJA 5EOKA 1GL0E 3LPRA 2VWOA 2NU4E 3U98H 2ILNA 1AHTH 3MH6A 1YPGH 1YPLH 2Z94A 2BXTH 2Y5FA 3RMLH 2FOHA 1YP9A 1ZHRA 4GAWA 2BTCE 1PPGE 4Y0YE 5C1YA 1GI2A 2PKAA 3NWUA 1O3AA 2UUKB 3BIUH 3UOPA 1RXPA 3FP8E 3MU0A 5E0GA 2BDYA 1A3EH 1YPHE 3RC4A 4K8BA 1EP5A 3PO1C 4CR5A 3GY5A 1QRXA 2BD8A 1UK3A 4FUDA 3RXFA 1O2HA 2H5CA 4I8HA 1F5RA 3NXPA 1J9CH 2Z9LA 1BB0B 1G9IE 1GHBG 1OYTH 4FUIA 5CHAB 1V2TT 1K1IA 1TBRH 1AQ7A 1GJ4H 3LKWA 5A2MH 2G00A 4E05H 3UNQA 1RTLA 1NRQH 3RXQA 1UTOA 1QB1A 2O8TA 4AZ2B 2PWXA 1AKSA 2PGQB 1NT1A 1MD7A 4I32A 3L6PA 2XW9A 3ITIA 4AORA 4IC5A 3SBKA 1TA2A 2BY5X 3UWIA 2XRCA 1E37B 2H9EH 3TVJB 1SB1H 1HFDA 5E8EH 4CHAC 4AB9A 2VGCC 1C5QA 4KGAA 3M5NA 3A81A 1V2UT 3F9EA 2QYIA 1O5BB 4YZUA 1NPMA 3ZZ8A 2V3HH 4WJG2 3PO1B 2OCVB 3AK5A 1V2VT 4Y79A 5FPYA 2VVCA 1QL7A 4BXWA 2H5DA 1DWBH 1TMUH 5C1UA 2XBXA 3T5FH 3EA7A 5JB9S 2QC2A 1BRUP 1J16A 4THNH 3KEEA 1EPTC 1P2IA 2BVSH 9ESTA 4M9FA 1KXCA 4Y8XA 1GBTA 1NROH 2GDDA 1C1RA 1MTUA 1AE8H 2C4FH 2BQ6B 4CRFA 4RKOB 1Z8IB 1GMHG 1F7ZA 3OY5U 5AFZH 1WYKA 4WMDA 3CS7A 1GBDA 2C8XB 4AGKA 1D3DB 4DG4A 4X1RU 3UQOA 7ESTE 3SN8A 1EAXA 1C2GA 3O8RA 1IAUA 1K1LA 1JIRA 4DJZB 1QCPA 1FJSA 2BMGB 4JK5A 1LVBA 2FODA 3A8AA 5DGJA 3SQEE 1CT4E 3IG6B 1THSH 2Q6FA 3ZV9A 1O33A 1MU8B 1P3CA 1S84A 1FPCH 2ZC9H 8GCHF 3KGPA 4K1SA 3ZZ3A 1QBOA 1AB9C 2B0FA 1UVOA 3QGJA 4D76A 2FYQA 2G5NA 5EQSA 4U32A 2H1UA 3E1XB 2F4LA 1BTUA 5A0BA 2WHXA 1KTTB 3QUMP 5HMAA 4GUXA 1MZDA 3BEUA 1HJAC 2OK5A 2H6MA 2PFEA 4H6TA 5DPAA 1ESTA 1B0EA 1O2LA 1UTNA 1DXPA 1FMGA 2VNTA 1K1MA 2YNAA 3KIDU 4K3JA 3Q3YA 3SU5A 1EKBB 5EGMA 4U30A 3M5LA 1K1OA 5E2OA 3DFLA 2R2WU 5I46H 1QGFA 3K2UA 3AVZA 1TABE 4NZLA 1RFNA 1WU1A 2ANMH 1DT2A 5HYOA 3ZZDA 1PPHE 4CRCA 1TOCB 3SJIA 1LVMA 1SG8B 5ESTE 1GG6C 3H5CB 2PHBA 3KQCA 4X6NA 1YCPH 2JH6D 1GDQA 3SZNA 3BTKE 3SQHE 1N6XA 1TMTH 2FOBA 1O31A 1AMHA 1HAHH 1AO5A 2EC9H 3LC5A 1FLEE 2GZ7A 3A82A 1CSOE 2C93B 2PTNA 5B6LA 3UOUA 4Z0KA 1G37A 2EI7A 3V13A 1MTWA 4ABEA 3LONA 4UE7H 2P16A 1TIOA 3EAJA 3GOVB 1L4DA 3NPSA 4HGCA 1GMCG 2HOBA 2W3IA 3UIRA 2BLQA 3P8FA 1SQTA 4OS6A 4NIYA 3BN9A 5EU8A 1PPZA 2FP7B 1P11E 3SV2H 1SFIA 3P92A 5C20A 3QLPH 2VH6A 4NSYA 4YOJA 3M7UA 1Z8JB 1C1PA 2DE9A 1P57B 2J4IA 4K69A 3SGBE 2BHGA 1A5HA 6CHAC 2GCHG 3L3TA 3M7QA 5LPRA 1BA8B 1V2QT 1TQ0B 1XUIA 2CHAC 5DP6A 2AGIX 3MNXA 2PKAB 1SGEE 3SGQE 1OWDA 1ZZZA 1YLDA 2PKSC 3VB3A 4GVUA 4XBCA 1SGNE 3TH4H 4FVBA 2ODPA 4X1QU 4X1PU 4INLA 1X7AC 2O8LA 3U1JB 1IQFA 1YPJH 2GMTC 1QBVH 1ELVA 1ZPCA 2ALPA 1AZZA 4RSPA 1QB6A 1C5XB 1DS2E 4NIWA 1SLUB 1EZQA 3BSQA 5EPNA 3GY6A 4F49A 1WOFA 1TA6A 4QT8C 1V2MT 2P3TB 2SGDE 2D1JA 3BV9B 4WVPE 1C1MA 1DXWA 5C67A 1RGQA 1C1SA 1JXPA 2BD5A 3MH5A 1C1QA 1XX9A 2G81E 4Y6DA 2FTMA 3RXGA 1AKSB 2FXRA 2GX4A 3ESTA 1VITG 2G52A 2SGPE 3A89A 4JZEH 3CP7A 4INKA 5C3NA 1YGCH 2P94A 3KF2A 3T25A 1UVSH 1QRZA 1D3PB 2CMYA 1GBEA 1DPOA 1TNGA 1T8MA 2Z9GA 4D9QA 1SGFA 1FQ3A 4KTSA 2FLBH 1ZPZA 2PKSB 2A4OA 3SO3A 1YCPM 3ATLA 3DT0H 4D9RA 3KQEA 1QJ1B 3EYDA 3T62A 3M5OA 3MU5A 5EPYA 3HPTB 5GIBA 4IN1A 1AIXH 1C9PA 2WPMS 3H7TA 1UTQA 1AI8H 2UUYA 3SV7A 3AASA 3UR6A 1VITH 1GBIA 1SGTA 1XKBC 1PYTD 2WV4A 2FI5E 3PTNA 3D65E 4CH8B 1N1LA 2IJOB 4JYVH 4DURA 1FXYA 5FAHA 2VIVA 1OP2A 1GCDA 3A88A 4NIVA 3A87A 1SHYA 1EUFA 4K2YA 1O2RA 3MYWA 1O2GH 3K6ZA 2GTBA 1NU9A 2FDAA 4ZXYH 1DWDH 1IQGA 1QA0A 3JZ2B 4LOYH 3ENSB 1V6DA 1FY8E 5C1XA 7KMEH 1ANBA 3T27A 1ACBE 2BVXH 1VR1H 3GCTG 3S9CA 1IQEA 2FI4E 1IQKA 1GHAG 2B7DH 2CN0H 1ZMLA 2Z9KA 4CREA 1N8OC 3LGYA 4DCDA 2BQ7B 2GVFA 1O2VA 3VXFH 1TPAE 2F9BH 4X2XA 2QAAA 1O5DH 2Z3EA 2ZGJA 1O2XA 3MWIU 4DY7B 2C8ZB 2A5KA 1UVUH 2BDGA 5FPTA 1XUGA 3VFEA 2YNBA 1KXFA 1C1TA 1C4Y2 1BTZA 2SNWA 3D49H 4ZHAA 1LQEA 5JBTA 1M9UA 2AFQB 1AY6H 1HAPH 1QHRB 1O3FA 1PQAA 1XVMA 1EQ9A 1S6HA 2D8WA 2ZDMA 4GCHG 3VGCC 4ESTE 2GCTB 3FP6E 2ZKSA 3QZRA 2W26A 5AFYH 1W7XH 4U2WA 1O3IA 4B75A 1GBHA 2VVVA 4AG1A 3SOSA 4MVNA 1JRSA 2CGAA 1O3MA 1TBZH 1KLTA 4IGDA 4ZUHA 1E35B 1CHGA 1GWAA 2G55A 3FZZA 3BEIB 2O8WA 2J92A 1Y3UA 1W7GH 1VJ9U 2RA0A 4AFSA 1CU1A 2PUXB 1EZUC 2OP9A 3SNAA 1KXDA 2FM2A 3LGUA 3E8LA 1N8OB 4IS5A 1SBWA 2HNTC 1FUJA 1UVPA 3ZVGA 2F9VA 2ESTE 5EW2H 3DD2H 4NFFA 4MNWA 2F9NA 3FANA 3S7HB 1Y5AT 1TBQH 4JZ1A 1Y5BT 1UVTH 4XBBA 5T6FA 3C27B 1N6YA 1NO9H 4IMZA 1O39A 3KN2A 4YLUA 3QDZB 1Z71A 1S0RA 3SUFA 5FX5A 7GCHG 1C2MA 3A8CA 4Y10E 1P06A 4ZHMU 3AW1A 2BOHB 1GMHF 1CGIE 1MUEB 1A61H 4BANB 2PSXA 1GJCB 1NRSH 1GBMA 1HJ8A 3VB7A 1BRCE 1BBRE 4I8GA 1E36B 4H42U 4TY6A 1TPPA 2XC5A 1OWJA 1GHYH 1O2QA 1ZMJA 2B8OH 3SU2A 4UD9H 2UWLA 1TWXB 1HAIH 1KXEA 3LGWA 1P02A 1O3NA 1OOKB 1H1BA 1F0SA 3OYPA 1BCUH 4VGCC 2JH5D 5A8YA 2Q1JA 1GI9B 1Y3XA 1H9HE 2ZCHP 1NS3A 2BZ6H 5F03A 4RKJB 3TGJE 1VCPA 2ZHEH 3PMBB 4MPXA 3ATMA 2BD9A 3ZZ9A 3CS0A 4XBDA 3VB5A 4XOJA 3UNRA 1GI1A 2ZHWH 3RLYH 2BDBA 2XTTB 1LTOA 1C2LA 1LCYA 3A80A 3E0NB 1TRMA 5E0JA 1ZTKA 4UFDH 2J34A 3Q3XA 1ZRKA 3EQ0H 1MTSA 4CH2B 1TX6A 1Q2WA 1GHZA 4OS2A 2GGVB 2ZEBA 4Q2KA 1C5UA 3PWCA 1G3EA 2HLCA 3W94A 1P10A 3LGIA 1C5YB 1D4PB 1JOUB 1O2JA 1SGDE 1TYNA 1VGCB 2I6QA 4A5TS 5A09A 1NESE 4LK4A 1ELAA 1TE0A 3KHVA 3A7YA 3HGPA 8KME2 3SI4H 2CV3A 2WUCA 4YOGA 1P2NA 4ISNA 4JCNA 1BITA 5CHAC 1HUTH 2ZA5A 3A7XA 1TOMH 1A5GH 4BAMB 2ZECA 1CHOF 1MZAA 1UK2A 1WUNH 4O3UA 4Y0ZE 1O2PA 1HAVB 3URCA 5BPEA 2ALVA 2VINA 2STBE 3SUGA 1AFQB 1F0RA 2GD4B 3TH2H 1F0TA 2R0LA 1TRNA 3IITA 1JMOH 4BXSA 4MTBA 1RTFB 1FY4A 3MNCA 1SHHB 2A32A 2ZI2H 3BEFB 1MBMA 3FVFB 4NCYA 1RJXB 4F4OC 4CRGA 1QQUA 1HXEH 1C1WH 1BTPA 2A2QH
chains in the Genus database with same CATH superfamily
1GDNA 1LMWB 5JBAS 2GZ9A 3U8RH 3N7EA 5GNDA 2F91A 4LZ1H 1O2TA 1UCYK 4SGBE 4I8LA 2SNVA 3SJ9A 1KLJH 3MNBA 4FUJA 4YTAA 1GGDB 1W3CA 1SVPA 1UTJA 3M7TA 5B6OA 2XBYA 4H6SB 2EEKA 2BLVA 1G2MA 1CQQA 1VZQH 1SGIB 1QZ8A 3OFND 2ZDNA 3T29A 4YM9A 4KTUA 1XKAC 3LT3A 5C94A 2J2UA 3AAVA 2HGTH 2ULLA 1JBUH 4X0WU 1GBAA 1L1JA 1Y5UT 1W13U 2W7SA 1C5WB 2ZFRH 1WXRA 5C17A 1V2WT 2FI3E 2Z9IA 1GJ9B 2GKVE 3BIVH 3ZVEA 5F8TA 3V7TA 4ABAA 5HGGA 1OX1A 1CE5A 1AN1E 2XBWA 3P8NA 2FLRH 3V12A 4CRBA 1HIAA 4ZMAH 1ZR0A 1ZYOA 4OS4A 3MO6A 1YCPK 3SJ8A 3AW0A 2FMJA 5EG4A 1O3DA 2FEQH 2JJ2D 2VJ1A 3O8DA 3SU3A 4H4FA 2RDLA 1VITF 4TPYA 2AS9A 5TCAA 3EDXB 1NBMD 1SQAA 4Z1MD 2ZGHA 3QWCH 2B5TB 1KXBA 2RA3A 3H09A 2ZCKP 5KECA 3UTUH 1F0UA 1BMMH 3MH4A 1BBRH 2HLDD 2OC0A 1Z7KA 1BT7A 9LPRA 1CT0E 6LPRA 1GPZA 4XD7D 4ABBA 4DGJA 3Q76A 5F8ZA 4MDSA 1G3CA 4IW4E 2JETB 5JPMH 1HDTH 3QO6A 1FX0B 4FOUC 3VB6A 3N7OA 1HRTH 5T1VA 1H9IE 3FAOA 2QCYA 1OWHA 1HAYB 3HKJB 3PLPA 2V6NA 4TY7A 1UJ1A 2QGRA 1ZJKA 1P04A 2AYWA 3HKIB 1YPKH 4WMEA 3LC3A 3RC6A 2W3KA 1S6FA 2HRVA 5A0AE 3MH7A 3RU4T 2Y5HA 3RXBA 5EXMA 1WSSH 2GDEH 4BTTB 2VWNA 2QXHA 4AFQA 2CF8H 5JDUB 2PP6A 1ZSLA 2F3CE 4KKDA 3F2GA 3SNBA 1KYNA 4AG2A 2FO9A 1AWFH 5GPIB 4E7NA 6ESTA 3LDXH 1B7XB 3O8CA 1DITH 1T4UH 4X2VA 1ZGVA 3T28A 3U28C 1SLWB 4RN6A 1XVOA 1ABJH 2Y81A 2O8UA 1TLDA 1QIXB 1SQOA 3BTFE 8LPRA 4Q7ZA 3SU1A 2CXVA 2AGGX 4Y8ZA 1BIOA 5KEDA 1NM6A 5FHTA 1C2IA 3PMJA 4BOHA 1W8BH 1FAKH 1J14A 1U6QA 1B5GH 3RDZA 1SGCA 5G4BA 3UUZA 3UR9A 1CVWH 1ZJDA 4NZQA 2THFB 3ZZAA 3T2NA 4Y76A 2FTLE 1O2YA 2ZHDA 4WY3A 1BTYA 1TGNA 1S85A 1Y3VA 3TGIE 3KNXA 1BOQA 2Z7FE 3UWJH 5IDKA 4GCHF 2GT7A 1UHBB 1O5AB 1FV9A 1Y3WA 1K2I1 3WWBA 1DLKB 3RMMH 4A6LA 3QGNB 1C2DA 1XUKA 3ZVDA 1TNKA 6GCHG 2O8MA 3TJNA 1NRPH 3RXDA 3GS9A 5A0CA 1ZHPA 1NFXA 1QL8A 1XM1A 2H2ZA 2JKHA 2NWNA 1Z1IA 3BTTE 4MQAA 2FX6A 3ZZBA 3TNSA 3FZDA 3HGNA 5C5OA 1H9LB 1O3BA 1KLIH 2BX4A 2OTVA 3MO3A 5F8XA 3BTQE 3A7ZA 3TLOA 2QN5T 1AUTC 1ARCA 1NRRH 2RCEA 1MTVA 2AGEX 4AX9H 1DWCH 5EODA 1J17T 1YPHC 4Q7YA 2FOAA 4NIXA 4AB8A 5EJ1A 3LJJA 2BDHA 1GJBB 3LH1A 2ZZUH 1O3OA 1LHEH 4RI0A 5K7RA 1BMFD 2BM2A 1C2EA 1LKBA 2VWMA 3SU6A 1AZ8A 3GYMA 1MKXH 2WPHS 2TGTA 2J9NA 1MABB 1WQVH 4Y7BA 3RXHA 1G2LA 2ZTZA 7GCHF 1FI8A 2ANYA 2YMSB 2KAIA 2H9HA 1IHTH 2YMSD 1LHGH 1IQLA 2FX4A 1S82A 1DLEA 3OE7D 3RU4D 1A7SA 1TB6H 3DA9B 2FOCA 1W0KD 1EAWA 3Q00A 1YPMH 1YPEH 2ZQ1A 1DX5M 1DUEA 1MU6B 2C90B 3GCHB 4WXIA 4WXVA 1TPSA 4K1EA 1P2QA 1SGPE 3A85A 1WAYB 3RXOA 1UO6A 4ZKSU 1PJPA 4YO9A 1O5GH 4A1VA 2I6SA 3OX7U 2A1DB 1BRAA 2W7UA 2PW8H 3GY4A 3P17H 4K5ZA 1TNJA 2HVYB 5FBEA 1CA0B 1H4WA 4I8KA 2F83A 1GJ5H 3IWMA 2C8WB 3F9FA 1AGJA 3KL6A 3KQDA 1AVXA 3R0FA 1V2OT 1EOJA 2L6OA 2ZNKH 2VIOA 1PYTC 3LH3A 3BTDE 3BTHE 4B76A 1ZSJA 1DSTA 1O38A 1P09A 2VIDA 1GJ8B 4E7RG 1INCA 3LU9B 3T26A 2ANKH 4Y11E 1EB1H 2RG3A 1O3PB 2ZFFH 1NTPA 1UTKA 1O3HA 1BJVA 1DFPA 1LHFH 5HM9A 3GY3A 2OQ5A 1GBJA 1K28D 2AMDA 1HIAB 5ETXA 4BAQB 2ZDVH 4ZKNU 1KMHB 1S81A 3PLKA 1OWEA 4B1TA 2UUFB 5GCHF 2XXLA 3RMNH 2ZIQH 3P8OA 1SGRE 2ZHQH 3RXUA 1YF4A 5BRRE 1LQDB 1O2ZA 3E0PB 3SU4A 2A4QA 1HAXB 3RXSA 3A86A 2WV9A 5L2YH 2FOGA 5E2PA 1T4VH 2ZPQA 4Y7AA 1EFRD 1VCQA 4B2CA 2P59A 4UDWH 1NFWA 5ABWA 1SKYE 1MTNC 1GI5A 1CA8B 1SLXB 1NRNH 1C5NH 2BX3A 3B9FH 4CRAA 3S0NA 2HVXA 1EATA 3I29A 2B9LA 1DM4B 3HK3B 2GCTC 2Y7XA 1G3BA 3GY8A 3S7KB 4X8SH 2ZFPH 2ZFQH 4NWKA 1EXFA 4B73A 5F6MA 1HAOH 1AUJA 1A5IA 3P70B 2OC1A 1FIZA 2ZO3H 1GCTB 1P0SH 1FY3A 3GDUA 2R3YA 1QJ6B 2VU8E 1DSUA 1NFUA 1P05A 2XCNA 2XC0A 2XWBI 3RUOA 1L0ZA 1QB9A 5FBIA 3TK6A 1ZMNA 1TX7A 2GP9B 4FUEA 3TGKE 1GHBF 2V3OH 3NK8A 5DP3A 3SYJA 2PV9B 3SV6A 2BY6X 4R8TB 1A1RA 3U1IB 5CMXH 1ABIH 1OPHB 1Y8TA 3MOCA 1O3GA 4DOQA 3EGKH 1BMNH 3MTYA 1O34A 3F68H 4LXBH 1HGTH 1K22H 3D62A 1MTNB 1O3CA 1SR5C 1K1NA 3I77A 1ZLRA 1XXDA 2OBQA 3ATKA 2BY8X 1KTSB 1O2IA 2D26C 3A84A 1XUHA 1C5VA 4ACAA 4B6FA 2J95A 2P8OB 3O8BA 2CF9H 3DUXH 1BMAA 2R0KA 2ZDLA 3SJOA 1ORFA 2TBSA 5J4QA 4YT6H 4A7IB 1G36A 1ZGIA 3PROA 3SNDA 1GI0A 3OTPA 1GVKB 1SSXA 4CBNA 3S69A 1CT2E 3PB1E 2BDAA 2ZG0H 4DT7B 3DHKH 1SFQB 2OLGA 3BG8A 3BTEE 3P95A 5JBBS 3FP7E 5H4IB 1H8IH 4Z6AH 1ZTJA 3JZ1B 3S9AA 2ZF0H 3KCGH 4MG3A 2TGAA 1W10U 3SV8A 1AE5A 2ZGBH 1SMFE 1S5SA 2P93A 1MQ5A 5EXNA 1QTFA 3M5MA 2NU2E 1MKWH 1V2RT 1P2MA 2AERH 3ODFA 5EW1H 1ETRH 1WTHD 2BD4A 1BQYA 2W6ID 1WV7H 3MO9A 2VB0A 3D23A 2G51A 2YOLA 5AVDA 1EJAA 3ATIA 3LOXA 5FPSA 2KFWA 3E90B 2FYRA 2HALA 1L1NA 1GBBA 1VGCC 3TITA 1RD3B 3A8DA 2BVRH 1QA7A 1TGBA 5DK1A 5JB8S 4BAHB 4KELA 2KAIB 1AWHB 3V0XA 3OEHD 1D6WA 1FN8A 1GJ6A 1TNIA 5C2ZA 2SGFE 1C5RA 2BB4A 4O3TA 4ABGA 2FZZA 1O5FH 5HXFA 2ZCLP 5HIYA 1EPTA 2GZ8A 1ELGA 4ZKRU 5SGAE 3NKKA 1RIWB 3RM2H 3PLBA 3MQKC 2PLXA 3TK9A 1AFQC 2HPPH 1DWEH 2M5TA 1TGSZ 3A7WA 1NZQH 1SGYE 2A0QB 4NG9H 3SORA 2HWLB 2J38A 1KY9A 5LPEA 3P8GA 1ZRBA 2ZQ2A 3ZVFA 1V2LT 1LVYA 1P8VC 3MU8A 2QF3A 2FWWA 4GSOA 2ZWLH 1L1GA 2QIQA 1QJ7B 4B6EA 1F92A 4OS7A 1VJAU 4NGAH 3QTOH 1C1OA 4J2YB 4NFEA 1TQ7B 4MPVA 2F9OA 3VXEH 4AC9A 2TPIZ 4D7GA 2DUCA 2A5AA 1V2ST 3DSOA 1O2KA 5FCKA 4X6OA 2OC8A 1H8DH 2ZFTA 1ESAA 3MHWU 1BBRK 1KIGH 1HLTH 3OAAD 3E16B 2EI6A 4IBLH 3SU0A 4ABDA 2OINA 1GHVH 2J98A 1GGDC 1PQ7A 4SGAE 2BY9X 3EE7A 4WMFA 4FXGH 4AFUA 1CO7E 2STAE 4A92A 3H7OA 1A4WH 4TPIZ 1P03A 2F43B 3U8OH 3PV5A 2ZFSA 1WBGB 1COWD 2JH0D 4YT7H 1GMCF 2P3UB 1QBNA 5A8ZA 4RT0A 1C5TA 2KM0A 5HM2A 2XNIA 1MH0A 2ZP0H 5T6DA 1MMJN 2AHME 2V3MA 3RM0H 1WCZA 1GL1A 2NU0E 2ZGXH 3BG4C 2D2DA 1W0YH 4TYDA 2AMPA 2CK3D 2KCAA 4GPGA 4O9VA 5EIYA 1CBWB 4ZHLU 1O0DH 1V3XA 1SOTA 4YESB 2GCHF 1BTHH 1J8AA 1O3LA 2VBCA 3EA9A 4FU9A 4X2YA 1FNIA 2FIRH 3W95A 1XUJA 1HNEE 4Q7XA 1SPJA 2A7JA 1KDQA 3ZVCA 4X8UH 3U69H 1QR3E 1E34B 3TJVA 5GDSH 2G4TA 4YOIA 3GCNA 5IK2D 4FVDA 2JETC 1C9TA 2PGBB 2VWLA 4Q4LA 1QY6A 4JZFH 4X1SU 5DP5A 2FOEA 1G32B 1T8LA 2WPJS 2Z3CA 5EXLA 3F9HA 1D9IA 4ZAEA 1G3DA 1SGQE 2AIPA 3OY6U 4ZROA 3ZIAD 4UONA 2FS9A 1D3TB 5GJ4B 5T6GA 1P01A 3A7VA 1DOJA 1E38B 3BG4B 4MNYA 1ELBA 1IQNA 2XYAA 2BYAX 2L74A 2V0BA 3GDSA 4ZXXH 1T8OA 3UPEA 3VB4A 2Y7ZA 1TRYA 1FY5A 1MBQA 1O32A 1BMLA 3SHCH 2BZAA 3RMOH 3ZZCA 1OYQA 3NUMA 4HG6A 3K9XB 1C4V2 2IOTA 5DJ7A 2PR3A 1O3JA 1GHWH 1C2JA 3V3MA 4MNVA 1OP8A 4ABIA 4JZIA 3PMAB 3CNRA 3M35A 3SZEA 2VIQA 3DCLA 5DP4A 4AGJA 2WV5A 1O36A 4UEHH 3RXJA 2QXIA 1Q31A 3BTGE 3GCOA 2A4RA 1PQ8A 1HB0B 3K65B 3ZVBA 3F6UH 3LGTA 1DY8A 1Q3XA 2ZDAH 2NU3E 2WYGA 5GWZA 2Z6BD 3RP2A 4K60A 3FOAA 1T32A 1YKTA 1ZPBA 3MU1A 1NFYA 1P2KA 3ZZ4A 2BD7A 4ZH8A 1TALA 1MKXK 4BTIB 1O30A 1OP0A 3SGAE 1C5PA 1O2SA 1TNLA 2SFAA 2RFKC 1FZZA 3AAUA 5HKKD 4WWYA 3RXRA 4I8JA 1FN6A 4ASHA 3ZZ6A 2ASUB 1OXGA 1J15A 1Y3YA 2ZTYA 2BXUH 3TJOA 3BTWE 3OTJE 1GI3A 1LHDH 4ABFA 2BQWB 3NCLA 3F0OA 1RTKA 2KCYA 3QX5H 1DANH 1JRTA 3KYFA 4ABJA 3BF6H 3TJUA 4U01A 1ELTA 4PROA 2J5UA 4CHAB 2VGCB 2W5EA 2A7HA 3LGVA 2LPRA 5TCCA 4JZDH 3ELAH 3M36A 1ANCA 1FONA 2QA9E 1LO6A 3GCTF 1T31A 4I33A 3GY2A 4O03A 3SI3H 1CGJE 3F3BA 1GHAF 3WY8A 2WSSD 1IQIA 1ZOMA 5LH8A 2BLOA 1T8NA 3M37A 4OS1A 4AYYB 1AU8A 3GISB 1ELEE 4DT4A 3DFJA 3FKSD 5LGOA 1P3EA 1BHXF 3E6PH 1EJNA 1EOLA 1P9SA 3MNSA 1C5ZB 2ZDKA 4HZHA 5FCRA 1UCYH 4D7FA 1EPTB 2P3FH 3P6ZB 3A83A 3FO8D 2GV6A 2GV7A 2PTCE 3TK5A 4ISHH 1UMAH 4WH6A 1D6RA 1ETTH 2V35A 3RXKA 1GMDG 2HNTF 4ISIH 2YMSC 4ISOA 2QV1A 1LDTT 1GDUA 3G01A 1L4ZA 1ESBA 4BTUB 1ELFA 2IPHA 3B23B 4X2WA 1V2JT 1W2KH 4JK6A 1E0FD 3C1KA 2ZHFH 2ZGCA 4K8YA 3GCHC 2QY0B 3F1SB 3UY9A 3ZYDA 4FUHA 1EB2A 2EI8A 5FX6A 2ZU2A 1P2JA 2R3UA 1W14U 3QK1A 4O97A 1EZXC 2RDEA 2FESH 3ZV8A 3RXAA 2J98B 1AB9B 3PV2A 1CA0C 1CHOG 1TPOA 3ATWA 4UFFH 2FOFA 1C5MD 3GY7A 1C5SA 3PWBA 3Q77A 4FUBA 5EQQA 4IN2A 1NY22 3SNEA 1YYY1 3UFAA 4OM9A 1HJAB 1LVOA 2A45B 1BRBE 2VIWA 1W0ZU 1ZSKA 1EP6A 1SLVB 1YM0A 3QTVH 1EASA 2WINI 1A46H 1H8ED 3F0PA 2NU1E 3F9GA 1V2PT 4WH8A 2TGPZ 1MD8A 1O37A 1A2CH 4INHA 4JMYA 4DW2U 1SOZA 4DIHH 1QURH 4XE4A 5E0HA 1YLCA 1S83A 4ACBA 5J4SA 1VKYA 1WTGH 2TRMA 4OGYA 1OSSA 2K1QA 3LJOA 4X8TH 3SUDA 3KYGA 1QRWA 5L30H 2HNTE 2G4UA 1O3KA 4B2BA 3SNCA 1TNHA 3R3GB 3SJKA 3TIUA 1FAXA 4IC6A 3N7DA 3U8TH 1GJDB 1GG6B 4YLQH 1O5EH 2OQUA 1EJMA 3HATH 1UK4A 1BDAA 1UTPA 3FN8A 1AD8H 4NA8A 1XUFA 2TGDA 1FIWA 1A0LA 1RS0A 1GI6A 5I25A 1C5OH 5JYIA 1KDQB 5DP7A 1LPGB 2OC7A 1THRH 1O3EA 4BNRA 2FS8A 2F9UA 1EAIA 1OKXA 2ODQA 1NN6A 1W0JD 4ABHA 1K1JA 1HPGA 2BDCA 1GVLA 4J1YA 1FY1A 2BLWA 1C4U2 3M3VA 2UWPA 1QL9A 2BDIA 4Q80A 4BAKB 3UAIC 5ESBA 1EAUA 4XSKU 1V2KT 1GVZA 4WF8A 1C1UH 5K0HA 3RXEA 1GCTC 3PV4A 2C8YB 1BTXA 2SGAA 1PQ5A 2BOKA 2TIOA 4UFEH 3RLWH 1V2NT 1MAYA 3QN7A 4B2AA 4BAOB 3TPIZ 4NWLA 4TT3D 1OHHD 4CBOA 6CHAB 2LNCA 1IQHA 1PFXC 1Z6EA 1TAWA 3F2HA 1ETSH 1DVAH 1ZTLA 1EZSC 1O2UA 3ZYEA 1MKWK 2CHAB 1IQMA 2Z9JA 4GHQA 4OS5A 2XCFA 1HV7A 2AIQA 3GYLB 2FOMB 3A7TA 1XMNB 3UNSA 2XNDD 3STIA 1PPCE 2JIZD 1KXAA 1HAVA 2BD2A 2VVUA 2Y6TA 2XBVA 3VPKA 2WUBA 4ISLA 7LPRA 1QFKH 2AMQA 2A7CA 1PPFE 2KCPA 3ZVAA 2P8OC 3EA8A 4AOQA 2GMTB 4FUGA 1W11U 2XWAA 4A1TA 1O2MA 1FPHH 5L2ZH 3RXTA 4CRDA 1K1PA 1XXFA 4HTCH 3L33A 1W12U 3RXIA 1C2FA 4NA9H 3I78A 5AF9H 2BD3A 1GBCA 1O5CB 4MLFB 3RXPA 1C1VH 4M7GA 1TX8A 1Z8GA 4IMQA 5JBCS 4AYVB 3SV9A 1ID5H 1HCGA 1DUAA 3OU0A 3ODDA 8GCHG 1IQJA 1P12E 2CJIA 2ZU1A 2FPZA 1Z1JA 4TWYA 2ZU4A 1LPZB 1H8HD 4UFGH 1Z8RA 2G5VA 2WPLS 2WPKS 3TH3H 3NZIA 4B71A 1ELCA 1P2OA 4NSVA 1KSNA 2ZTXA 4D8NA 2G8TA 2KR7A 4FU7A 1TGTA 4X6MA 1BZXE 4GHTA 1GHXH 1IOEA 5LPFA 1VCWA 3K6YA 4A1XA 1C2HA 2AH4X 4R0IA 2R9PA 1D3QB 4HI3A 1TFXA 1TONA 3RXVA 1A0JA 4X8VH 1Z6JH 3UREA 3UQVA 3W1EA 2VIPA 2ZPRA 4Y71A 1Y59T 1TMBH 1BJUA 4B74A 1GJ7B 2ANWA 3OSYA 2SGEE 3EE0B 5A8XA 1OWIA 1ZHMA 1DICA 4HFPB 4AN7A 5DO4H 1PPEE 5L6NH 1K9OE 2A31A 3VEQB 2HPQH 2R2MB 1BUIA 3CENA 3SW2B 4Y8YA 2XC4A 3MI4A 2J94A 3B8JA 4X1NU 3MMGA 3TNTA 5GXPA 1K21H 4MPUA 2QXGA 1RIWC 1DDJA 2Y82A 1MAXA 4XFQA 2SGQE 4E06H 1P9UA 3KQBA 4FUFA 4TWWA 5CE1A 5FXLA 4FU8A 1LPKB 2A5IA 3S9BA 1JWTA 4X6PA 2A4GA 1SGFG 3Q3KA 2OBOA 1SI5H 2OD3B 1OWKA 2QXJA 4NA7A 1IHSH 1UTMA 2Q6GA 4KP0A 3RC5A 3RXCA 2Q6DA 2ZU3A 1GBFA 1GI4A 1GBLA 2VH0A 4I31A 3MU4A 1LHCH 3RXMA 1ARBA 3VGCB 4ZKOU 3M61U 5HIZA 3WWFA 2GT8A 1A0HB 1B0FA 1E1QD 1HBTH 2IN2A 2IPQX 2IJD1 5C0TA 3PTBA 1MCTA 4GLYA 3ZZ5A 4I7YH 2O9QA 1HJ9A 1UTLM 1CGHA 5PTPA 2Z3DA 3A8BA 4JYUH 3QZQA 2QF0A 1S6LA 4MPWA 1ANDA 2F9PA 3GDVA 3RXLA 1HAZB 3FFGA 3PYHA 1JIMA 2Y80A 1BHXB 1GJAB 1O2NA 3PM3A 3M3SA 2ZPSA 4F55A 5EQRA 1LKAA 2BY7X 5EJLA 4K1TA 1NU7B 2JDID 2WZQA 4KTCA 1A3BH 4DVAU 2OUAA 4CR9A 4FUCA 1OS8A 8ESTE 2EA3A 3ZZ7A 1SC8U 3E91A 1ANEA 2UUJB 2PUQH 4MNXA 3U9AH 1S0QA 3SHAH 1PPBH 5DKMA 3STJA 1QNJA 2WPIS 1DY9A 3M3TA 5TJXA 4XDEA 1HAGE 3PMHB 1F5LA 5T3HA 2Y5GA 1CBWC 1UHBA 5EJZA 1AVWA 1GMDF 3E3TA 5IYTA 3TU7H 3GICB 1AVGH 1O2OA 2AEIH 1F5KU 1SL3A 2JJ1D 2WYJA 5C5NA 1O2WA 4AFZA 5DG6A 6GCHF 1HYLA 1G30B 1C2KA 1MQ6A 1L2EA 1YC0A 1O35A 1UW7A 2DE8A 4OGXA 5DP8A 1T7CA 3LIWA 1E1RD 1UCYE 1NC6A 2ODYB 4JYTA 3SUEA 5F53A 5GCHG 2ZU5A 1F2SE 1BTWA 1MCVA 1QQ4A 4LZ4B 1FDPA 1GI7B 1HXFH 3HK6B 2M2AA 4VGCB 2H9TH 1DE7H 1C1NA 1C5LH 1GBKA 2PSYA 2P95A 4XRNA 2C3SA 2OXSA 1TGCA 1RRKA 1WQSA 1EX3A 4DIIH 1AFEH 5DP9A 3RU4E 1YBWA 1THPB 3URDA 2A2XH 1GI8B 1ELDE 3BTME 5AHGH 2UWOA 3MFJA 5EOKA 1GL0E 3LPRA 2VWOA 2NU4E 3U98H 2ILNA 1AHTH 3MH6A 1YPGH 1YPLH 2Z94A 2BXTH 2Y5FA 3RMLH 2FOHA 1YP9A 1ZHRA 2K8IA 4GAWA 2BTCE 1PPGE 4Y0YE 1E79D 5C1YA 1GI2A 2PKAA 3NWUA 1O3AA 2UUKB 3BIUH 3UOPA 1RXPA 3FP8E 3MU0A 5E0GA 2BDYA 1A3EH 1YPHE 3RC4A 4K8BA 1EP5A 3PO1C 4CR5A 3GY5A 1QRXA 2BD8A 1UK3A 4FUDA 3RXFA 1O2HA 2H5CA 4I8HA 3UB0A 1F5RA 3NXPA 1J9CH 2Z9LA 1BB0B 1G9IE 1GHBG 1OYTH 4FUIA 5CHAB 1V2TT 1K1IA 1TBRH 1AQ7A 1GJ4H 3LKWA 5A2MH 2G00A 4E05H 3UNQA 1RTLA 4TSFD 1NRQH 3OEED 3RXQA 1UTOA 2LP6A 1QB1A 2W6JD 2O8TA 4AZ2B 2PWXA 1AKSA 2PGQB 1NT1A 1MD7A 4RT1A 4I32A 3L6PA 2XW9A 3ITIA 4AORA 4IC5A 3SBKA 1TA2A 2BY5X 3UWIA 2XRCA 1E37B 2H9EH 3TVJB 1SB1H 1HFDA 5E8EH 4CHAC 4AB9A 2VGCC 1C5QA 4KGAA 3M5NA 3A81A 1V2UT 3F9EA 2QYIA 1O5BB 4YZUA 1NPMA 3ZZ8A 2V3HH 4WJG2 3PO1B 2OCVB 3AK5A 1V2VT 4Y79A 5FPYA 2VVCA 1YWUA 1QL7A 4BXWA 2H5DA 1DWBH 1TMUH 5C1UA 2XBXA 3T5FH 3EA7A 5JB9S 2QC2A 1BRUP 2V7QD 1J16A 4THNH 1WDIA 3KEEA 1EPTC 1P2IA 5CHBA 2BVSH 9ESTA 4M9FA 1KXCA 5C0UA 4Y8XA 1GBTA 1NROH 2GDDA 1C1RA 1MTUA 1AE8H 2C4FH 2BQ6B 4CRFA 4RKOB 1Z8IB 1GMHG 1F7ZA 3OY5U 3PRDA 5AFZH 1WYKA 4WMDA 3CS7A 1GBDA 3NRLA 2C8XB 3VG8A 4AGKA 1D3DB 4DG4A 4X1RU 3UQOA 7ESTE 3SN8A 1EAXA 1C2GA 3O8RA 1IAUA 1K1LA 1JIRA 4DJZB 1QCPA 1FJSA 2BMGB 4JK5A 1LVBA 2FODA 3A8AA 5DGJA 3SQEE 1CT4E 4YXWD 3IG6B 1THSH 5FL7D 2WPDD 2Q6FA 3ZV9A 1O33A 1MU8B 1P3CA 1S84A 1FPCH 2ZC9H 8GCHF 3KGPA 4K1SA 3ZZ3A 1QBOA 1AB9C 2B0FA 1UVOA 3QGJA 4D76A 2FYQA 2G5NA 5EQSA 4U32A 2H1UA 2F4LA 3E1XB 1BTUA 5A0BA 2WHXA 1KTTB 3QUMP 5HMAA 4GUXA 1MZDA 3BEUA 1HJAC 2OK5A 2H6MA 2PFEA 4H6TA 5DPAA 1ESTA 1B0EA 1O2LA 1UTNA 1DXPA 1FMGA 2VNTA 1K1MA 2YNAA 3KIDU 4K3JA 3Q3YA 3SU5A 4Q63A 1EKBB 5EGMA 4U30A 3M5LA 1K1OA 5E2OA 5DSFA 3DFLA 2R2WU 5I46H 1QGFA 3K2UA 3AVZA 1TABE 3KQ5A 1RFNA 1WU1A 4NZLA 2ANMH 1DT2A 5HYOA 3ZZDA 1PPHE 4CRCA 1TOCB 3SJIA 1LVMA 1SG8B 5ESTE 1GG6C 3H5CB 3F2FA 2PHBA 3KQCA 4X6NA 1YCPH 2JH6D 1GDQA 3SZNA 3BTKE 3SQHE 1N6XA 1TMTH 2FOBA 1O31A 1AMHA 1HAHH 3N99A 1AO5A 2EC9H 4P02A 3LC5A 1FLEE 2GZ7A 3A82A 1CSOE 2C93B 2PTNA 5B6LA 3UOUA 4FETA 4Z0KA 1G37A 2EI7A 3V13A 1MTWA 4ABEA 3LONA 4UE7H 2P16A 1TIOA 3EAJA 3GOVB 1L4DA 3NPSA 4HGCA 1GMCG 2HOBA 2W3IA 3UIRA 2BLQA 3P8FA 1SQTA 4OS6A 4NIYA 3BN9A 5EU8A 1PPZA 2FP7B 1P11E 3SV2H 1YY3A 1SFIA 3P92A 5C20A 3QLPH 2VH6A 4NSYA 4YOJA 3M7UA 1Z8JB 1C1PA 2DE9A 1P57B 3PRBA 2J4IA 4K69A 3SGBE 2BHGA 1A5HA 6CHAC 2GCHG 3L3TA 3M7QA 5LPRA 1BA8B 1V2QT 1TQ0B 1XUIA 2CHAC 5DP6A 2AGIX 3MNXA 2PKAB 1SGEE 3SGQE 1OWDA 1ZZZA 1YLDA 3DSPA 2PKSC 3VB3A 4GVUA 2KX4A 4XBCA 1SGNE 3TH4H 4FVBA 2ODPA 4X1QU 4X1PU 4INLA 1X7AC 2O8LA 3U1JB 1IQFA 1YPJH 2GMTC 1QBVH 1ELVA 1ZPCA 2ALPA 1AZZA 4RSPA 1QB6A 1C5XB 1DS2E 4NIWA 1SLUB 1EZQA 3BSQA 5EPNA 3GY6A 4F49A 1WOFA 3WW7A 1TA6A 4QT8C 1V2MT 2P3TB 2SGDE 5CDFE 2D1JA 3BV9B 4WVPE 1C1MA 1DXWA 5C67A 1RGQA 1C1SA 1JXPA 2BD5A 3MH5A 1C1QA 1XX9A 2G81E 4Y6DA 2FTMA 3RXGA 1AKSB 2FXRA 2GX4A 3ESTA 1VITG 2G52A 2SGPE 3A89A 4JZEH 3CP7A 4INKA 5C3NA 1YGCH 2P94A 3KF2A 3T25A 2KZ4A 1UVSH 1QRZA 1D3PB 2CMYA 1GBEA 1DPOA 1TNGA 1T8MA 2Z9GA 4D9QA 1SGFA 1FQ3A 4KTSA 2FLBH 1ZPZA 2PKSB 2A4OA 3SO3A 1YCPM 3ATLA 3DT0H 4D9RA 3KQEA 1QJ1B 3EYDA 3T62A 3M5OA 3MU5A 5EPYA 3HPTB 5GIBA 4IN1A 1AIXH 1C9PA 2WPMS 3H7TA 1UTQA 1AI8H 2UUYA 3SV7A 3AASA 3UR6A 1VITH 1GBIA 2QF4A 1SGTA 1XKBC 1PYTD 2WV4A 2FI5E 3DSGA 3PTNA 3D65E 4CH8B 1N1LA 2IJOB 4JYVH 4DURA 1FXYA 5FAHA 2VIVA 1OP2A 1GCDA 3A88A 4NIVA 3A87A 1SHYA 1EUFA 4K2YA 1O2RA 3MYWA 1O2GH 3K6ZA 2GTBA 1NU9A 2FDAA 4ZXYH 1DWDH 1IQGA 2LELA 1QA0A 3JZ2B 4LOYH 3ENSB 1V6DA 1FY8E 5C1XA 7KMEH 1ANBA 3T27A 1ACBE 2BVXH 1VR1H 3GCTG 3S9CA 1IQEA 2FI4E 1IQKA 1GHAG 2B7DH 2CN0H 1SQRA 1ZMLA 2Z9KA 4CREA 1N8OC 3LGYA 4DCDA 2BQ7B 2GVFA 1O2VA 3VXFH 1TPAE 2F9BH 4X2XA 2QAAA 1O5DH 2Z3EA 2ZGJA 1O2XA 3MWIU 4DY7B 2C8ZB 2A5KA 1UVUH 2BDGA 5FPTA 1NBME 1XUGA 3VFEA 4P00A 2YNBA 1KXFA 1C1TA 1C4Y2 1BTZA 2SNWA 3D49H 4ZHAA 1LQEA 2QE7D 5JBTA 1M9UA 2AFQB 1AY6H 1HAPH 1QHRB 1O3FA 1PQAA 1XVMA 1EQ9A 1S6HA 2D8WA 2ZDMA 4GCHG 3VGCC 4ESTE 2GCTB 3FP6E 2ZKSA 3QZRA 2W26A 5AFYH 1W7XH 4U2WA 1O3IA 4B75A 1GBHA 2VVVA 4AG1A 3SOSA 4MVNA 1JRSA 2CGAA 1O3MA 1TBZH 1KLTA 4IGDA 4ZUHA 1E35B 1CHGA 4F48B 1GWAA 2G55A 3FZZA 3BEIB 2O8WA 2J92A 1Y3UA 1W7GH 1VJ9U 2RA0A 4AFSA 1CU1A 2PUXB 1EZUC 2OP9A 3SNAA 1KXDA 2FM2A 3LGUA 3E8LA 1N8OB 4IS5A 1SBWA 2HNTC 1FUJA 1UVPA 3ZVGA 2F9VA 2ESTE 5EW2H 3DD2H 4NFFA 4MNWA 2F9NA 3FANA 3S7HB 1Y5AT 1TBQH 4JZ1A 1Y5BT 1UVTH 4XBBA 5T6FA 3C27B 1N6YA 1NO9H 4IMZA 1O39A 3KN2A 4YLUA 3QDZB 1Z71A 1S0RA 3SUFA 5FX5A 7GCHG 1C2MA 3A8CA 4Y10E 1P06A 4ZHMU 2EQNA 3AW1A 2BOHB 1GMHF 1CGIE 2QF5A 1MUEB 1A61H 4BANB 2PSXA 1GJCB 1NRSH 4ZCNA 1GBMA 1HJ8A 3VB7A 1BRCE 1BBRE 4I8GA 1E36B 4H42U 4TY6A 1TPPA 2XC5A 1OWJA 1GHYH 1O2QA 1ZMJA 2B8OH 3SU2A 4UD9H 2UWLA 4I86A 1TWXB 1HAIH 1KXEA 3LGWA 1P02A 1O3NA 1OOKB 2J97A 1H1BA 1F0SA 3OYPA 1BCUH 4VGCC 2JH5D 5A8YA 2Q1JA 1GI9B 1Y3XA 1H9HE 2GJGA 2ZCHP 1NS3A 2BZ6H 5F03A 4RKJB 3TGJE 1VCPA 2ZHEH 5KGOA 3PMBB 4MPXA 2XOKD 3ATMA 2BD9A 3ZZ9A 5DN6D 3CS0A 4XBDA 3VB5A 4XOJA 3UNRA 1GI1A 2ZHWH 3RLYH 2BDBA 2XTTB 1LTOA 1C2LA 1LCYA 3A80A 3E0NB 1TRMA 5E0JA 1ZTKA 4UFDH 2J34A 3Q3XA 1ZRKA 3EQ0H 1MTSA 4CH2B 1TX6A 1Q2WA 1GHZA 4OS2A 2GGVB 2ZEBA 4Q2KA 1C5UA 3PWCA 1G3EA 2HLCA 3W94A 1P10A 3LGIA 2K0QA 1C5YB 1D4PB 1JOUB 1O2JA 1SGDE 1TYNA 1VGCB 2I6QA 4A5TS 2KCOA 5A09A 1NESE 4LK4A 1ELAA 1TE0A 3KHVA 3A7YA 3HGPA 8KME2 3SI4H 2CV3A 2WUCA 4YOGA 1P2NA 4ISNA 4JCNA 1BITA 2EY4C 5CHAC 1HUTH 2ZA5A 3A7XA 1TOMH 1A5GH 4BAMB 2ZECA 1CHOF 1K0HA 1MZAA 1UK2A 1WUNH 4O3UA 4Y0ZE 1YLNA 1O2PA 4ASUD 1HAVB 3URCA 5BPEA 2ALVA 2VINA 2STBE 3SUGA 1AFQB 1F0RA 2GD4B 3TH2H 1F0TA 2R0LA 1TRNA 3IITA 1JMOH 4BXSA 4MTBA 1RTFB 1FY4A 3MNCA 1SHHB 2A32A 2ZI2H 3BEFB 1MBMA 3FVFB 4NCYA 1RJXB 4F4OC 4CRGA 1QQUA 1HXEH 1C1WH 1BTPA 2A2QH
chains in the Genus database with same CATH topology
1GDNA 1LMWB 5JBAS 2GZ9A 3U8RH 3N7EA 5GNDA 2F91A 4LZ1H 1O2TA 1UCYK 4SGBE 4I8LA 2SNVA 3SJ9A 1KLJH 3MNBA 4FUJA 4YTAA 1GGDB 1W3CA 1SVPA 1UTJA 3M7TA 5B6OA 2XBYA 4H6SB 2EEKA 2BLVA 1G2MA 1CQQA 1VZQH 1SGIB 3T29A 4YM9A 2ZDNA 3OFND 4KTUA 1XKAC 3LT3A 2J2UA 3AAVA 2HGTH 2ULLA 1JBUH 4X0WU 1GBAA 1L1JA 1Y5UT 1W13U 2W7SA 1C5WB 2ZFRH 1WXRA 5C17A 1V2WT 2FI3E 2Z9IA 1GJ9B 2GKVE 3BIVH 3ZVEA 5F8TA 3V7TA 4ABAA 5HGGA 1OX1A 1CE5A 1AN1E 2XBWA 3P8NA 2FLRH 3V12A 4CRBA 1HIAA 4ZMAH 1ZR0A 1ZYOA 4OS4A 3MO6A 1YCPK 3SJ8A 3AW0A 2FMJA 5EG4A 1O3DA 2FEQH 2JJ2D 2VJ1A 3O8DA 3SU3A 4H4FA 2RDLA 1VITF 4TPYA 2AS9A 5TCAA 3EDXB 1NBMD 1SQAA 4Z1MD 2ZGHA 3QWCH 2B5TB 1KXBA 2RA3A 3H09A 2ZCKP 3UTUH 1F0UA 1BMMH 3MH4A 1BBRH 2OC0A 2HLDD 1Z7KA 1BT7A 9LPRA 1CT0E 6LPRA 1GPZA 4XD7D 4ABBA 4DGJA 3Q76A 5F8ZA 4MDSA 1G3CA 4IW4E 2JETB 5JPMH 1HDTH 3QO6A 1FX0B 3VB6A 3N7OA 1HRTH 5T1VA 1H9IE 3FAOA 2QCYA 1OWHA 1HAYB 3HKJB 3PLPA 2V6NA 4TY7A 1UJ1A 2QGRA 1ZJKA 1P04A 2AYWA 3HKIB 1YPKH 4WMEA 3LC3A 3RC6A 2W3KA 1S6FA 2HRVA 5A0AE 3MH7A 3RU4T 2Y5HA 3RXBA 5EXMA 1WSSH 2GDEH 4BTTB 2VWNA 2QXHA 4AFQA 2CF8H 5JDUB 1ZSLA 2F3CE 4KKDA 3SNBA 3F2GA 1KYNA 4AG2A 2FO9A 1AWFH 5GPIB 4E7NA 6ESTA 3LDXH 1B7XB 3O8CA 1DITH 1T4UH 4X2VA 1ZGVA 3T28A 1SLWB 4RN6A 1XVOA 1ABJH 2Y81A 2O8UA 1TLDA 1QIXB 1SQOA 3BTFE 8LPRA 4Q7ZA 3SU1A 2CXVA 2AGGX 4Y8ZA 1BIOA 1NM6A 5FHTA 1C2IA 3PMJA 4BOHA 1W8BH 1FAKH 1J14A 1U6QA 1B5GH 3RDZA 1SGCA 5G4BA 3UUZA 3UR9A 1CVWH 1ZJDA 4NZQA 2THFB 3ZZAA 3T2NA 4Y76A 2FTLE 1O2YA 2ZHDA 4WY3A 1BTYA 1TGNA 1S85A 1Y3VA 3TGIE 3KNXA 1BOQA 2Z7FE 3UWJH 5IDKA 4GCHF 2GT7A 1UHBB 1O5AB 1FV9A 1Y3WA 1K2I1 3WWBA 1DLKB 3RMMH 4A6LA 3QGNB 1C2DA 1XUKA 3ZVDA 1TNKA 6GCHG 2O8MA 3TJNA 1NRPH 3RXDA 5A0CA 3GS9A 1ZHPA 1NFXA 1QL8A 1XM1A 2H2ZA 2JKHA 2NWNA 1Z1IA 3BTTE 4MQAA 2FX6A 3ZZBA 3TNSA 3FZDA 3HGNA 5C5OA 1H9LB 1O3BA 1KLIH 2BX4A 2OTVA 3MO3A 5F8XA 3BTQE 3A7ZA 3TLOA 2QN5T 1AUTC 1ARCA 1NRRH 2RCEA 1MTVA 2AGEX 4AX9H 1DWCH 5EODA 1J17T 1YPHC 4Q7YA 2FOAA 4NIXA 4AB8A 3LJJA 2BDHA 1GJBB 3LH1A 2ZZUH 1O3OA 1LHEH 4RI0A 5K7RA 2BM2A 1BMFD 1C2EA 1LKBA 2VWMA 3SU6A 1AZ8A 3GYMA 1MKXH 2WPHS 2TGTA 2J9NA 1MABB 1WQVH 4Y7BA 3RXHA 1G2LA 2ZTZA 7GCHF 1FI8A 2ANYA 2YMSB 2KAIA 2H9HA 1IHTH 2YMSD 1LHGH 1IQLA 2FX4A 1S82A 1DLEA 3OE7D 3RU4D 1A7SA 1TB6H 3DA9B 2FOCA 1W0KD 1EAWA 3Q00A 1YPMH 1YPEH 2ZQ1A 1DX5M 1DUEA 1MU6B 2C90B 3GCHB 4WXIA 4WXVA 1TPSA 4K1EA 1P2QA 1SGPE 3A85A 1WAYB 3RXOA 1UO6A 4ZKSU 1PJPA 4YO9A 1O5GH 4A1VA 2I6SA 3OX7U 2A1DB 1BRAA 2W7UA 2PW8H 3GY4A 3P17H 4K5ZA 1TNJA 5FBEA 1CA0B 1H4WA 4I8KA 2F83A 1GJ5H 3IWMA 2C8WB 3F9FA 1AGJA 3KL6A 3KQDA 1AVXA 3R0FA 1V2OT 1EOJA 2L6OA 2ZNKH 2VIOA 1PYTC 3LH3A 3BTDE 3BTHE 4B76A 1ZSJA 1DSTA 1O38A 1P09A 2VIDA 1GJ8B 4E7RG 1INCA 3LU9B 3T26A 2ANKH 4Y11E 1EB1H 2RG3A 1O3PB 2ZFFH 1NTPA 1UTKA 1O3HA 1BJVA 1DFPA 1LHFH 5HM9A 3GY3A 2OQ5A 1GBJA 1K28D 2AMDA 1HIAB 5ETXA 4BAQB 2ZDVH 4ZKNU 1S81A 1KMHB 3PLKA 1OWEA 4B1TA 2UUFB 5GCHF 2XXLA 3RMNH 2ZIQH 3P8OA 1SGRE 2ZHQH 3RXUA 1YF4A 5BRRE 1LQDB 1O2ZA 3E0PB 3SU4A 2A4QA 1HAXB 3RXSA 3A86A 2WV9A 5L2YH 2FOGA 5E2PA 1T4VH 2ZPQA 4Y7AA 1VCQA 4B2CA 1EFRD 2P59A 4UDWH 1NFWA 5ABWA 1SKYE 1MTNC 1GI5A 1CA8B 1SLXB 1NRNH 1C5NH 2BX3A 3B9FH 4CRAA 3S0NA 2HVXA 1EATA 3I29A 2B9LA 1DM4B 3HK3B 2GCTC 2Y7XA 1G3BA 3GY8A 3S7KB 4X8SH 2ZFPH 2ZFQH 4NWKA 1EXFA 4B73A 5F6MA 1HAOH 1AUJA 1A5IA 3P70B 2OC1A 1FIZA 2ZO3H 1GCTB 1P0SH 1FY3A 3GDUA 2R3YA 1QJ6B 2VU8E 1DSUA 1NFUA 1P05A 2XCNA 2XC0A 2XWBI 3RUOA 1L0ZA 1QB9A 5FBIA 3TK6A 1ZMNA 1TX7A 2GP9B 4FUEA 3TGKE 1GHBF 2V3OH 3NK8A 5DP3A 3SV6A 2PV9B 3SYJA 2BY6X 4R8TB 1A1RA 3U1IB 5CMXH 1ABIH 1OPHB 1Y8TA 3MOCA 1O3GA 4DOQA 3EGKH 1BMNH 3MTYA 1O34A 3F68H 4LXBH 1HGTH 1K22H 3D62A 1MTNB 1O3CA 1SR5C 1K1NA 3I77A 1ZLRA 1XXDA 2OBQA 3ATKA 2BY8X 1KTSB 1O2IA 2D26C 3A84A 1XUHA 1C5VA 4B6FA 2J95A 2P8OB 3O8BA 2CF9H 3DUXH 1BMAA 2R0KA 2ZDLA 3SJOA 1ORFA 2TBSA 5J4QA 4YT6H 4A7IB 1G36A 1ZGIA 3PROA 3SNDA 1GI0A 3OTPA 1GVKB 1SSXA 4CBNA 3S69A 1CT2E 3PB1E 2BDAA 2ZG0H 4DT7B 3DHKH 2OLGA 1SFQB 3BG8A 3BTEE 3P95A 5JBBS 3FP7E 5H4IB 1H8IH 4Z6AH 1ZTJA 3JZ1B 3S9AA 2ZF0H 3KCGH 4MG3A 2TGAA 1W10U 3SV8A 1AE5A 2ZGBH 1SMFE 1S5SA 2P93A 1MQ5A 5EXNA 1QTFA 3M5MA 2NU2E 1MKWH 1V2RT 1P2MA 2AERH 3ODFA 5EW1H 1ETRH 1WTHD 2BD4A 1BQYA 2W6ID 1WV7H 3MO9A 2VB0A 3D23A 2G51A 2YOLA 5AVDA 1EJAA 3ATIA 3LOXA 5FPSA 2KFWA 3E90B 2FYRA 2HALA 1L1NA 1GBBA 1VGCC 3TITA 1RD3B 3A8DA 2BVRH 1QA7A 1TGBA 5DK1A 5JB8S 4BAHB 4KELA 2KAIB 1AWHB 3V0XA 3OEHD 1D6WA 1FN8A 1GJ6A 1TNIA 5C2ZA 2SGFE 1C5RA 2BB4A 4O3TA 4ABGA 2FZZA 1O5FH 5HXFA 2ZCLP 1EPTA 2GZ8A 1ELGA 4ZKRU 5SGAE 3NKKA 1RIWB 3RM2H 3PLBA 2PLXA 3TK9A 1AFQC 2HPPH 1DWEH 2M5TA 1TGSZ 3A7WA 1NZQH 1SGYE 2A0QB 4NG9H 3SORA 2HWLB 2J38A 1KY9A 5LPEA 3P8GA 1ZRBA 2ZQ2A 3ZVFA 1V2LT 1LVYA 1P8VC 3MU8A 2QF3A 2FWWA 4GSOA 2ZWLH 1L1GA 2QIQA 1QJ7B 4B6EA 1F92A 4OS7A 1VJAU 4NGAH 3QTOH 1C1OA 4J2YB 4NFEA 1TQ7B 4MPVA 2F9OA 3VXEH 2TPIZ 4D7GA 2DUCA 2A5AA 1V2ST 3DSOA 1O2KA 5FCKA 4X6OA 2OC8A 1H8DH 2ZFTA 1ESAA 3MHWU 1BBRK 1KIGH 1HLTH 3OAAD 3E16B 2EI6A 4IBLH 3SU0A 4ABDA 2OINA 1GHVH 1GGDC 1PQ7A 4SGAE 2BY9X 4WMFA 4FXGH 4AFUA 1CO7E 2STAE 4A92A 3H7OA 1A4WH 4TPIZ 1P03A 3U8OH 2F43B 3PV5A 2ZFSA 1WBGB 1COWD 2JH0D 4YT7H 1GMCF 2P3UB 1QBNA 5A8ZA 1C5TA 2KM0A 5HM2A 2XNIA 1MH0A 2ZP0H 5T6DA 1MMJN 2AHME 3RM0H 1WCZA 1GL1A 2NU0E 2ZGXH 3BG4C 2D2DA 1W0YH 4TYDA 2AMPA 2CK3D 2KCAA 4GPGA 4O9VA 1CBWB 4ZHLU 1O0DH 1V3XA 1SOTA 4YESB 2GCHF 1BTHH 1J8AA 1O3LA 2VBCA 3EA9A 4FU9A 4X2YA 1FNIA 2FIRH 3W95A 1XUJA 1HNEE 4Q7XA 1SPJA 2A7JA 1KDQA 3ZVCA 4X8UH 3U69H 1QR3E 1E34B 3TJVA 5GDSH 2G4TA 4YOIA 3GCNA 5IK2D 4FVDA 2JETC 1C9TA 2PGBB 2VWLA 5DP5A 1QY6A 4JZFH 4X1SU 4Q4LA 2FOEA 1G32B 1T8LA 2WPJS 2Z3CA 5EXLA 3F9HA 1D9IA 4ZAEA 1G3DA 1SGQE 2AIPA 3OY6U 4ZROA 4UONA 3ZIAD 2FS9A 1D3TB 5GJ4B 5T6GA 1P01A 3A7VA 1DOJA 1E38B 3BG4B 4MNYA 1ELBA 1IQNA 2XYAA 2BYAX 2V0BA 3GDSA 4ZXXH 1T8OA 3UPEA 3VB4A 2Y7ZA 1TRYA 1FY5A 1MBQA 1O32A 1BMLA 3SHCH 2BZAA 3RMOH 3ZZCA 1OYQA 3NUMA 3K9XB 1C4V2 2IOTA 5DJ7A 2PR3A 1O3JA 1GHWH 1C2JA 3V3MA 4MNVA 1OP8A 4ABIA 4JZIA 3PMAB 3M35A 3SZEA 2VIQA 3DCLA 5DP4A 4AGJA 2WV5A 1O36A 4UEHH 3RXJA 2QXIA 1Q31A 3BTGE 3GCOA 2A4RA 1PQ8A 1HB0B 3K65B 3ZVBA 3F6UH 3LGTA 1DY8A 1Q3XA 2ZDAH 2NU3E 2WYGA 5GWZA 2Z6BD 3RP2A 4K60A 3FOAA 1T32A 1YKTA 1ZPBA 3MU1A 1NFYA 1P2KA 3ZZ4A 2BD7A 4ZH8A 1TALA 1MKXK 4BTIB 1O30A 1OP0A 3SGAE 1C5PA 1O2SA 1TNLA 2SFAA 1FZZA 3AAUA 5HKKD 4WWYA 3RXRA 4I8JA 1FN6A 4ASHA 3ZZ6A 2ASUB 1OXGA 1J15A 1Y3YA 2ZTYA 2BXUH 3TJOA 3BTWE 3OTJE 1GI3A 1LHDH 4ABFA 2BQWB 3NCLA 3F0OA 1RTKA 3QX5H 2KCYA 1DANH 1JRTA 4ABJA 3BF6H 3TJUA 4U01A 1ELTA 4PROA 2J5UA 4CHAB 2VGCB 2W5EA 2A7HA 3LGVA 2LPRA 5TCCA 4JZDH 3ELAH 3M36A 1ANCA 1FONA 2QA9E 1LO6A 3GCTF 1T31A 4I33A 3GY2A 4O03A 3SI3H 1CGJE 3F3BA 1GHAF 3WY8A 2WSSD 1IQIA 1ZOMA 5LH8A 2BLOA 1T8NA 3M37A 4OS1A 4AYYB 1AU8A 3GISB 1ELEE 4DT4A 3DFJA 3FKSD 5LGOA 1P3EA 1BHXF 3E6PH 1EJNA 1EOLA 1P9SA 3MNSA 1C5ZB 2ZDKA 4HZHA 5FCRA 1UCYH 4D7FA 1EPTB 2P3FH 3P6ZB 3A83A 3FO8D 2GV6A 2GV7A 2PTCE 3TK5A 4ISHH 1UMAH 4WH6A 1D6RA 1ETTH 2V35A 3RXKA 1GMDG 2HNTF 4ISIH 2YMSC 4ISOA 2QV1A 1LDTT 1GDUA 3G01A 1L4ZA 1ESBA 4BTUB 1ELFA 2IPHA 3B23B 4X2WA 1V2JT 1W2KH 4JK6A 1E0FD 3C1KA 2ZHFH 2ZGCA 4K8YA 3GCHC 2QY0B 3F1SB 3UY9A 3ZYDA 4FUHA 1EB2A 2EI8A 5FX6A 2ZU2A 1P2JA 2R3UA 1W14U 3QK1A 4O97A 1EZXC 2FESH 3ZV8A 3RXAA 1AB9B 3PV2A 1CA0C 1CHOG 1TPOA 3ATWA 4UFFH 2FOFA 1C5MD 3GY7A 1C5SA 3PWBA 3Q77A 4FUBA 5EQQA 4IN2A 1NY22 3SNEA 1YYY1 3UFAA 4OM9A 1HJAB 1LVOA 2A45B 1BRBE 2VIWA 1W0ZU 1ZSKA 1EP6A 1SLVB 1YM0A 3QTVH 1EASA 2WINI 1A46H 1H8ED 3F0PA 2NU1E 3F9GA 1V2PT 4WH8A 2TGPZ 1MD8A 1O37A 1A2CH 4INHA 4JMYA 4DW2U 1SOZA 4DIHH 1QURH 4XE4A 5E0HA 1YLCA 1S83A 5J4SA 1WTGH 2TRMA 4OGYA 1OSSA 2K1QA 3LJOA 4X8TH 3SUDA 1QRWA 5L30H 2HNTE 2G4UA 1O3KA 4B2BA 3SNCA 1TNHA 3R3GB 3SJKA 3TIUA 1FAXA 4IC6A 3U8TH 3N7DA 1GJDB 1GG6B 4YLQH 1O5EH 2OQUA 1EJMA