2Z9GA

Complex structure of sars-cov 3c-like protease with pma
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 83
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z9gA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9gA02
1O5EH 2QXHA 4YOIA 4UE7H 2FI5E 1D3QB 1GHBF 1GI8B 2ZFFH 2BVRH 4K1TA 4R8TB 2QF3A 1O3FA 1IQLA 1TGNA 5T3HA 1K21H 3F6UH 2TGDA 4XOJA 1K1PA 4H42U 1RJXB 3RLYH 2Y5FA 1EPTA 5LPRA 2BYAX 4X8VH 2FM2A 2VVVA 1OWIA 1AIXH 4UFEH 1O3HA 3BEFB 2ZQ1A 3LT3A 3TH3H 1WTGH 1THPB 3MMGA 4I31A 4AZ2B 1YPLH 3Q77A 1LHGH 1EATA 1UVOA 1HAGE 1NU9A 3UOPA 4BTUB 2BZ6H 3QTVH 3SQHE 5IYTA 1ELTA 2H1UA 2PLXA 3GICB 2IN2A 5JYIA 1F7ZA 2GZ7A 1AMHA 3MOCA 4NIWA 5DP7A 4ZAEA 4DIHH 1YYY1 3MFJA 1P04A 1QQ4A 5F8TA 1WAYB 3M5NA 1XUJA 1GHXH 1L1JA 1QL8A 5E0HA 2FOMB 3SGQE 1GMHF 1H9IE 1GL0E 2PWXA 1F5LA 1VJ9U 4ZHLU 1SLVB 3KHVA 1GBAA 3NZIA 1AVGH 1E36B 2P3UB 4IN2A 1O5CB 1T4VH 1L4DA 3P6ZB 1E37B 3RDZA 2OBOA 2EA3A 3EBNA 1HYLA 1T31A 2BXUH 3A88A 4YESB 5F03A 3A7ZA 1EOJA 1AY6H 3SZNA 1FY3A 1TPOA 3TNSA 1C2IA 1EAIA 1ETTH 1J16A 4B75A 4DW2U 3MNSA 4I8JA 4BAMB 3MU8A 2QIQA 3ZVCA 1OYTH 1QBVH 4OS6A 7GCHG 1C1VH 1O2MA 1O30A 3QLPH 1V2PT 1DT2A 5ETXA 2BLOA 1C5YB 2HNTF 1A2CH 1MAXA 4DURA 2D8WA 2FXRA 2TBSA 1KLJH 2VNTA 1GI3A 3TJVA 1YCPK 3SU5A 3B9FH 1AB9C 1C2HA 2GMTB 5L30H 1ZRBA 1U6QA 1C5NH 1P01A 1XVMA 2WV5A 1PQ8A 1T8MA 2R0KA 2B0FA 2F9NA 2HNTC 4ABDA 4CRCA 1C1NA 3B8JA 1HIAB 1YP9A 2JETB 2VIDA 2PHBA 1ORFA 1HXFH 1MZDA 4BAQB 4GHTA 4CH2B 5JBCS 5DO4H 1TBZH 2QYIA 1C5QA 1TPAE 1MTNC 3PMAB 2PUQH 1HAXB 5DP3A 1KXCA 5J4SA 1TX7A 2LNCA 2Q6DA 2B8OH 4TWYA 1ESAA 4INLA 1D3PB 1TB6H 1CVWH 4CR9A 5E0GA 1MQ5A 3RXDA 1EOLA 4IMZA 1BJVA 1EB1H 4FUGA 2Y7ZA 1C2JA 2QAAA 3N7OA 1O36A 1BZXE 4TPYA 1GJAB 3BTHE 3OX7U 1SQOA 1EJNA 1Q3XA 2ZZUH 1LKAA 4ESTE 1EAUA 1IQFA 1JRTA 2ZPQA 1WUNH 1MBMA 3P8GA 3S7KB 4ASHA 1IQEA 2FLRH 2HRVA 1KYNA 1AFQC 3UUZA 3RXQA 2LPRA 1OOKB 5TJXA 1L0ZA 3STJA 4U30A 2G00A 1C2LA 3LGUA 3SU2A 3TITA 1QA0A 2UUFB 3ATWA 2ZDKA 1TNJA 1XUHA 4MDSA 4GAWA 3SNBA 2VB0A 2VINA 1M9UA 4K60A 5FBEA 1IQNA 1DPOA 4MTBA 4F49A 1QBOA 8GCHF 1DE7H 1VCWA 1C5PA 2A5IA 4JYVH 1KIGH 8ESTE 1AD8H 1QA7A 3GCHB 4WXVA 1ZSLA 2F9UA 3SU1A 1SHHB 3K2UA 1F0UA 4NA7A 5AVDA 2PW8H 1TOCB 4Y10E 4HZHA 3ELAH 4B1TA 2QY0B 3PO1B 4WMEA 3KN2A 2NWNA 2HLCA 4YLQH 1LVOA 3LGTA 3VEQB 2TGTA 2BLQA 1GBEA 2O8WA 1CHOG 2BDGA 2AIQA 1TGCA 1GI2A 1K22H 2W7UA 1SGPE 4K5ZA 4HTCH 1DICA 4WWYA 2Z9LA 1Y3WA 1KXDA 1MD8A 2C4FH 2H5DA 1UHBB 5DP9A 4A1XA 1O2IA 3VB7A 4B76A 3GYLB 3LC5A 4UD9H 5HM2A 5JPMH 3D49H 2XC0A 5A09A 1V2NT 2ANWA 4X6MA 1HAOH 2G52A 1LHEH 1K1LA 1KTSB 2ZFQH 2P3TB 3HPTB 1DY9A 3QN7A 3U1IB 3EE0B 1SOZA 3KCGH 4ABEA 2O8TA 5T6GA 1P3EA 2ZFTA 3RXPA 1AZZA 2DE8A 4ISHH 3I29A 1RD3B 1OWKA 3KQDA 4DCDA 1W8BH 2P95A 5HGGA 2BOKA 1EZQA 1PQ5A 2Z7FE 1OS8A 1VJAU 4JZFH 4KKDA 1L2EA 3PYHA 2J92A 1OSSA 5EG4A 2Z6BD 1S83A 3UY9A 3RP2A 1DFPA 3LGWA 3SJKA 1NFXA 4GCHF 1SGDE 4BNRA 1TMTH 2FI3E 3BTME 1EP6A 4BTIB 2XC4A 4UDWH 2D26C 3U69H 1G30B 5E0JA 3UFAA 2Z9IA 2ZFPH 2WINI 4H4FA 4HGCA 2WPHS 5LGOA 2O8MA 3UNQA 3RXMA 2FOBA 3T29A 4X6OA 3RXTA 2ZO3H 1PPCE 2ANMH 2GTBA 1PYTD 1YLCA 4ABFA 1YLDA 3A83A 4YOGA 3S69A 1GMDG 2QCYA 1Y59T 2IOTA 1MH0A 2JH6D 1O5GH 3RUOA 3UR6A 4BAOB 4ZKSU 2BHGA 1O35A 5GCHG 1P3CA 4F4OC 1PPZA 1C9PA 2J94A 3QWCH 4XFQA 3BTQE 3I78A 1W7GH 2K1QA 1XUKA 1P57B 2BLVA 1MD7A 1V2LT 1HAYB 1EJAA 2GV7A 3FVFB 3A7VA 5LPFA 2XW9A 1F2SE 3NK8A 2AIPA 1HBTH 1TABE 8LPRA 1G2LA 1O3AA 2XNIA 2WPIS 3QGJA 3AAUA 4MNVA 3BEIB 1UCYE 2ZDMA 4BAHB 1Y8TA 4JCNA 2BY7X 3SU3A 4H6TA 1AO5A 1O2SA 3GY3A 2Z9KA 1CGJE 3C27B 3GCNA 5LH8A 1TWXB 3SV9A 2WPJS 1JXPA 1O37A 1AE8H 5EW2H 1DDJA 1NFYA 1KLIH 1S81A 2SGDE 5F8XA 2Z3CA 1ZHMA 1RRKA 3URDA 1T8LA 1P9SA 4ZROA 2BD3A 3BTDE 2A4RA 3KNXA 3BIVH 2FTLE 4FUDA 1AUJA 2YNBA 4LXBH 3BN9A 1VITH 2W5EA 5HMAA 2C8ZB 2TGPZ 1A7SA 3DD2H 2FOAA 2ZP0H 1MAYA 2R3YA 3MYWA 3EAJA 2HVXA 2R9PA 5E8EH 1SQTA 3RXEA 1QL9A 5AFYH 1HIAA 3SQEE 1OP2A 1C5XB 1SB1H 1NPMA 2Y6TA 1T32A 1FMGA 2GKVE 1ETRH 1GJ6A 2BVXH 3P8NA 1K1IA 3K65B 1EZXC 3MO3A 4ZHMU 1W10U 2GMTC 4FUFA 1SG8B 4I32A 5HM9A 2ZF0H 4NIXA 3UQOA 4AOQA 1O34A 1SLXB 9LPRA 2JETC 2PGBB 1Z1IA 1GGDB 3PV4A 3BIUH 1OKXA 1PFXC 2P8OC 1O3IA 5C1UA 1O2UA 1UTQA 3NUMA 1EXFA 4FXGH 1BIOA 1D3DB 3D23A 1O2TA 1CT4E 3A80A 1BBRK 1YKTA 2CMYA 1UK4A 2GZ8A 3BTFE 3MU4A 3TGIE 2BTCE 4LZ4B 3E1XB 4NA9H 1MTVA 1XMNB 1TFXA 2H9TH 1YPKH 1OWHA 1P2MA 1ANBA 1W3CA 3M5MA 2G81E 1Y5UT 3U9AH 2ZG0H 3NPSA 1YCPM 4CREA 9ESTA 3CS7A 1MBQA 1O5FH 2F83A 1BTXA 1SGIB 5DP8A 1CBWB 1IHSH 3PTNA 1V2QT 1QQUA 3SV2H 3SUGA 1AZ8A 4E05H 2VH6A 2ZTZA 1BT7A 5G4BA 3SNCA 2ZDLA 1UCYH 1W13U 2HNTE 4PROA 4WJG2 4AN7A 1E38B 1FIZA 1LHCH 2ZCHP 3EA9A 1LHFH 4YM9A 1P2IA 2FIRH 3ODDA 1ZHRA 1ZR0A 4NA8A 4X8UH 5FBIA 1TGBA 1FLEE 2P16A 2B7DH 1C5VA 2O8LA 1CGIE 2NU1E 3A7XA 3MH5A 3QZQA 4B73A 5DKMA 3RXHA 3SI3H 4UFDH 1E0FD 3PO1C 3FZZA 1G37A 2SGEE 1YGCH 4ABHA 1BOQA 1IQMA 1UHBA 4X1PU 2FESH 1C5UA 1PQ7A 5GJ4B 4AYVB 1QB9A 3C1KA 4CRBA 4ZKNU 2Z9JA 1A1RA 1TBQH 2RA0A 3MU1A 2BY6X 2BM2A 1ANCA 2SNWA 4CRAA 2OQ5A 3AW0A 1J15A 1DWCH 2F9OA 3S0NA 5EOKA 4X6PA 1C2MA 1ELEE 2ALVA 4HI3A 2H9EH 2C3SA 4ISOA 1UO6A 3F9FA 2YOLA 1O3NA 1BCUH 4M7GA 1S6HA 2OC7A 2AYWA 1TX8A 1X7AC 1VZQH 2C8YB 1O2WA 3ZVFA 1LHDH 1P2QA 3BSQA 3S9CA 2G4TA 1IQIA 1ELVA 2CF8H 1TBRH 1IHTH 1NU7B 1ETSH 5DP5A 4CR5A 2Z3DA 3SJ9A 1BHXB 4SGBE 5TCAA 2A1DB 3RXOA 2BD5A 4FUJA 4D8NA 3JZ1B 1K2I1 4X1SU 1W0ZU 1SC8U 1ZJKA 1GBFA 1XM1A 3KQEA 1FV9A 2ZU2A 2ZWLH 1ANDA 1MTWA 4CHAB 3TGJE 3SI4H 3ZYEA 1DX5M 1GMCG 3RMMH 3S7HB 1QJ7B 4X2XA 1DOJA 1FIWA 1HJ8A 2WYGA 4DG4A 1V2WT 1E34B 6GCHG 1CSOE 5EU8A 5F6MA 4WY3A 3QGNB 5GWZA 1FNIA 1DWEH 1HJAB 1O38A 2CXVA 1PYTC 3BEUA 2CN0H 2H6MA 1Z8JB 3W95A 1GBLA 2ULLA 1SSXA 4FUBA 6CHAB 1QNJA 3V7TA 1P09A 1S0RA 1YCPH 2GT8A 3SV7A 1THRH 2ILNA 4NIYA 1UJ1A 1MKWK 1MQ6A 1QHRB 3FZDA 2TGAA 1QRZA 8KME2 4IMQA 1P03A 1V2ST 1PPHE 2OBQA 1BTPA 1ABJH 4AFQA 3ZYDA 1ZMLA 3KF2A 1B7XB 4AGKA 2B9LA 1H4WA 2J38A 3PM3A 5JBBS 3MNCA 3HKJB 1JWTA 1CQQA 3RU4T 4X2WA 3D65E 1ZMJA 3UNSA 5C5OA 1BMNH 1ELAA 1O3KA 1GVLA 1KTTB 5J4QA 3RXVA 2ZU3A 1K1JA 2AGGX 3ZZ6A 1VCQA 1O2XA 3T28A 6ESTA 1KSNA 3ZZ4A 3PTBA 1CA0B 1V2JT 2UWLA 3EA8A 1QRXA 4WXIA 3TJOA 4NGAH 4IS5A 1C5SA 3M61U 2FS9A 2G4UA 1GBCA 2PKAB 1DXPA 3EGKH 3TLOA 1XKAC 3BF6H 3GY2A 2XXLA 1V2TT 2J34A 1RTKA 2M5TA 1GBMA 2ZPSA 3CENA 1N6XA 3SGBE 2ZTXA 2ANKH 2FP7B 4AFUA 3PMJA 1C2GA 4A5TS 1SL3A 1TQ0B 3Q3YA 1UVUH 2R3UA 2AH4X 1F5RA 3RXIA 3PWBA 1SGTA 3DFLA 3P8FA 2BD7A 5CE1A 1V2RT 3AVZA 3QZRA 1IAUA 3T62A 1O3PB 1CT0E 3T2NA 1HAVA 2BB4A 4CRFA 1BRUP 2BD8A 4DGJA 1KLTA 1AFEH 1C4U2 1CHGA 2BMGB 2P93A 1NRPH 3RU4D 2Y80A 4Y76A 1UTLM 4AGJA 1GPZA 2F9VA 4X6NA 1PQAA 1SGCA 1O3OA 3L6PA 1GBKA 2HWLB 1FY4A 1GGDC 5EQQA 2JH0D 4KGAA 2FOGA 1P2OA 3ZVBA 4D9RA 2J9NA 2WV4A 1EB2A 1JIRA 3S9BA 1MUEB 3K6ZA 1MCTA 1NO9H 1CE5A 1EP5A 3DT0H 3PLBA 1BJUA 1W14U 4Y0YE 1UTMA 1HLTH 2A32A 1MCVA 2FS8A 3DUXH 3ZZAA 1CU1A 3RU4E 1A5GH 1PPFE 3TK5A 1GBJA 1O2YA 2Y81A 2V6NA 2VIPA 1RTFB 3R0FA 4WMDA 3TJUA 1AHTH 2I6SA 2ZTYA 1CBWC 1N8OC 1ZTKA 2ZCKP 3GISB 3TH4H 2GD4B 2WUBA 5TCCA 3A84A 2OINA 2B5TB 2XBYA 3UPEA 3GY6A 4DY7B 1O2JA 5C1XA 4NSVA 3ATLA 4CRDA 2THFB 7GCHF 1HPGA 1BTZA 3SORA 1DANH 2GDDA 4WVPE 1G3EA 4B2CA 1BMAA 3UR9A 3VXFH 1UK2A 1O5BB 1VGCB 3SU6A 3HKIB 3EDXB 3Q3XA 1PPBH 1YPHC 3NWUA 1PJPA 4Y7BA 3OTJE 2FLBH 2G5NA 2FODA 5PTPA 1BB0B 3BG4B 2ZNKH 2J4IA 3SJOA 3E6PH 3LIWA 1UVTH 2ZKSA 3DA9B 1O2RA 1KXBA 1LVBA 1TNHA 2CJIA 2XYAA 4Q7XA 3V13A 1Z7KA 4X1QU 5DP4A 4INHA 1FY1A 3PWCA 4IBLH 1GJ5H 2FYQA 2GP9B 1YPGH 1A0HB 2STBE 1BBRE 4NFFA 3RMLH 3URCA 5K0HA 1G3DA 1NTPA 1LPZB 4MPWA 1TE0A 1Y3XA 1O2VA 1WCZA 3SNAA 3SUEA 1JOUB 4JZIA 4MPXA 1C1OA 2VGCB 1SOTA 4ISNA 2SGQE 1NS3A 1SGFG 2ZU1A 7KMEH 3GDSA 1EAWA 3UREA 1ZTJA 3MU5A 1HDTH 1HJ9A 5DGJA 5C1YA 4MQAA 1TRYA 1BITA 3IWMA 1BHXF 3IG6B 1HXEH 2ZIQH 3ITIA 2J95A 2CV3A 1NRRH 2A0QB 4MPUA 4Q80A 3MH6A 3RC4A 2R2MB 4YZUA 1BTUA 1XXDA 2FYRA 4CH8B 1GDNA 3KQBA 2BD4A 4Q7YA 2A4GA 3D62A 1C2KA 1GL1A 5EQSA 5DK1A 3STIA 5DPAA 5FPSA 1GG6B 2VWNA 3NKKA 3R3GB 1A3EH 1AU8A 3M7QA 4FVDA 4YTAA 4MNWA 2FTMA 1GI9B 4CHAC 1GCDA 3KGPA 4INKA 2H2ZA 2UWPA 1FPHH 1V2KT 2P94A 3MO9A 1QJ1B 3TNTA 3F9GA 1FN6A 3RXBA 3OSYA 1ESBA 2FPZA 4X1NU 5H4IB 1TAWA 3SJ8A 2QN5T 1UVSH 4GSOA 4ABIA 1HJAC 1WQVH 1IQKA 1QIXB 1CHOF 1TYNA 2XWAA 4UONA 3PMHB 4K1SA 1W0YH 2FX6A 1P06A 4D76A 3RXRA 5FX6A 1TA2A 1YPEH 4IC6A 2H9HA 3E0NB 4X8SH 1EZSC 5DG6A 6CHAC 1B5GH 1HB0B 2SGPE 1O32A 1NZQH 2BDHA 4NWLA 1QB1A 3O8CA 3NCLA 2GGVB 2ZHEH 1OX1A 3LGIA 3HK3B 4I7YH 2BQWB 3A81A 3QUMP 3UWJH 3WY8A 2BY5X 2GCHG 1EPTB 1EASA 1SFIA 2GX4A 2V3OH 4D9QA 4K3JA 1BBRH 2OQUA 4FU8A 1BRAA 1C1MA 5ESTE 2A2XH 1GHWH 2VWOA 2PKAA 3RXGA 3MTYA 1FUJA 1N1LA 4RKOB 4Y8XA 4AB9A 5JB8S 4O3TA 2VIVA 1WBGB 1Y5AT 1SGYE 4AORA 1JMOH 3KL6A 1P11E 1G32B 4HFPB 1CA0C 4ZHAA 3HGPA 4XDEA 1GHZA 3B23B 1Z6EA 4K8YA 1GHVH 1ESTA 3LPRA 1GHAG 2OCVB 4BXSA 1W7XH 5FHTA 3ESTA 1QCPA 1ZPCA 1A4WH 3T5FH 3MNBA 3ZVGA 1WOFA 1SI5H 2EEKA 3SV6A 1QFKH 3E16B 3HGNA 3A7WA 4VGCB 1ZOMA 1C1RA 4Z0KA 1ZPBA 1IQHA 2DE9A 1OYQA 3RC5A 4YOJA 1VITG 4ZKRU 4BTTB 1P0SH 4KP0A 2XBXA 2KAIB 2XWBI 3VGCB 3LH3A 1TONA 1GMDF 4JK6A 4A1TA 2TIOA 1K9OE 5CMXH 4J2YB 2D1JA 3A89A 3GDUA 5GCHF 2SGFE 1D9IA 1P2NA 4FUIA 2C8XB 4K2YA 3A8CA 1DY8A 1ZTLA 1FI8A 1PPGE 1S84A 1GJ8B 3ZZ3A 4A7IB 3BTTE 3PB1E 3AASA 3TVJB 5EPYA 2A7JA 1LTOA 2XBVA 2O9QA 1FJSA 3U8TH 3VB4A 2C93B 4E7RG 4AG1A 3P8OA 3OYPA 1TGSZ 1CT2E 1UMAH 2OC1A 5L2ZH 3KQCA 3M37A 1D6WA 1FXYA 3KEEA 1O3EA 1GI7B 2UWOA 1C5ZB 3M3VA 1V2OT 2PKSB 4XBCA 2BLWA 1MTNB 1XX9A 1C1UH 1MKXK 2WPKS 1JIMA 1O3BA 3A7TA 3RXUA 1F0SA 1TNLA 2LIZA 2ZA5A 3QTOH 4A92A 5JBTA 1GHAF 1DWBH 3QX5H 6LPRA 2BDBA 2F9BH 3LJOA 2IPHA 1O2PA 4DIIH 4YT7H 1A5HA 4ISIH 2ZGBH 1XUGA 1GJ9B 4J1YA 1SVPA 5HXFA 3E91A 1OP8A 2DUCA 2AERH 3A85A 1FAKH 1DITH 2ZPRA 1RXPA 2J2UA 4LZ1H 4AYYB 2Q6GA 1HNEE 1G36A 2ZCLP 1O3DA 3GCHC 5LPEA 2BOHB 2VVCA 1EQ9A 1O3CA 3BG4C 1F0RA 4KELA 1YC0A 3SHAH 3M35A 1NC6A 3RC6A 3FAOA 5A0CA 3UNRA 3GCTG 2QGRA 1GI6A 1O2GH 4RSPA 1GHBG 1ZSJA 3RXAA 1GWAA 4OS1A 1O39A 4ZH8A 1YPMH 1T4UH 3OY5U 2GCTB 1MKWH 3HK6B 1UTKA 1OWDA 2ZHWH 1ELBA 4U01A 1BTYA 3GY5A 1QURH 5EQRA 2H5CA 4X0WU 1KY9A 1WTHD 2VGCC 3LH1A 2ZFSA 3GY7A 2W3KA 4Y7AA 5IDKA 3PLPA 5A8YA 4K8BA 3OU0A 2Z9GA 1A61H 2PTCE 1C2FA 1SHYA 1S85A 1FAXA 1ZJDA 5FCRA 4X2YA 2FDAA 1P8VC 1YF4A 3TIUA 1BTWA 2P59A 2GZ9A 1B0FA 2QXIA 2ZHQH 1LQDB 3RXCA 4O03A 1C2EA 4I8GA 4Y0ZE 5FAHA 1J17T 1T8NA 1XUFA 5ABWA 1W2KH 4IN1A 1GI0A 2W7SA 1V6DA 3RMNH 1C5WB 2VIOA 4JZEH 1A46H 3F9EA 1MTUA 2Q1JA 3SOSA 1GG6C 3ZV8A 1ELDE 3W94A 4ABJA 2QF0A 1GMHG 1O3JA 2BDIA 5T6DA 3SUDA 3PLKA 2AMPA 1T7CA 1O3MA 1GBBA 3K9XB 5F8ZA 5C2ZA 4Y6DA 3FP6E 1DLKB 3M7UA 4Q2KA 4XBBA 1ZSKA 2VWLA 1LVYA 3P92A 5C5NA 3P70B 2HGTH 1C4V2 3CP7A 4RKJB 1V3XA 3GCTF 2ODYB 3SJIA 2TPIZ 3U1JB 1O2NA 1XVOA 4WF8A 3M36A 4LOYH 2VJ1A 1HGTH 3U98H 7LPRA 2PV9B 5K7RA 1GI1A 4D7FA 1OP0A 2AGEX 3GOVB 4A6LA 1C1PA 1K28D 2VIQA 1V2UT 1QBNA 3T25A 1GJDB 2FOEA 2FWWA 2BD9A 1LDTT 4NWKA 2SGAA 3E8LA 1D3TB 4FU7A 4I8HA 1QGFA 4I33A 3O8DA 1KXAA 2F9PA 2ZQ2A 3E90B 5EXNA 1EPTC 3JZ2B 3F1SB 2EI6A 4OS4A 1RIWB 1NRSH 3SO3A 5A0BA 5A8XA 3MH7A 4MVNA 3FP8E 1TRNA 5JB9S 2BXTH 1J14A 3EYDA 2ANYA 3SNDA 2PTNA 3QK1A 1TX6A 2Z3EA 1MZAA 1IQJA 1GJBB 3ZV9A 4FUEA 2HOBA 3IITA 4JMYA 1LCYA 1TA6A 4AFZA 2PR3A 3ZZ7A 2W3IA 1LO6A 1F0TA 1O31A 1C5MD 3TU7H 3VFEA 2FMJA 1F5KU 4GPGA 4THNH 3V3MA 1LKBA 3RM0H 1GMCF 3BTGE 1UTPA 3U8OH 4KTSA 2ZEBA 6GCHF 3I77A 2HALA 2KAIA 3M5LA 1OWJA 2V0BA 4B2BA 1ZYOA 3H5CB 1P9UA 2FOHA 4VGCC 4WH6A 2A45B 2A5AA 1QY6A 1ARCA 5FPTA 2Z94A 1W11U 1FDPA 5CHAB 1DUEA 1S5SA 2I6QA 4U2WA 3V0XA 3LGYA 1J9CH 4BANB 3VGCC 3Q00A 2AEIH 4BXWA 1H9LB 1NT1A 1ARBA 1ZGIA 2BX4A 1L1NA 4YT6H 5GDSH 4K1EA 8GCHG 1A0LA 3TJNA 1DUAA 2A4QA 1GBDA 3RLWH 3M3SA 1EX3A 2F91A 3O8BA 4B2AA 1GCTB 2UUJB 5DJ7A 3HATH 1Z1JA 1TMBH 1XXFA 2BD2A 2G8TA 4LK4A 2A31A 1TALA 3GY8A 4NCYA 1B0EA 4TPIZ 2CHAB 3LOXA 3RXJA 3LONA 1ZZZA 1C5LH 1THSH 4OGXA 2P8OB 2PKSC 4OGYA 3SUFA 2VWMA 3ZZ9A 3RXKA 3ATIA 3MU0A 1KDQB 3VB3A 3ZVEA 1GJ4H 2BVSH 5C67A 1BRBE 5A0AE 1SMFE 4JZDH 4ZKOU 1DM4B 4U32A 4Y8ZA 1AUTC 4JZ1A 1DVAH 1FQ3A 1EJMA 2OLGA 2ZDAH 3GDVA 2PGQB 3RMOH 1AE5A 2FOFA 1ELFA 3A82A 2G5VA 4SGAE 3BTWE 4AX9H 4YLUA 5EODA 4MNYA 3RXSA 1HRTH 3QDZB 2AMDA 1QJ6B 1Q31A 5EXLA 1ELCA 4NZQA 1GJ7B 1C1TA 4KTUA 5E2OA 4NIVA 1GVZA 2VIWA 1HAHH 1BUIA 2FZZA 3A7YA 7ESTE 4B74A 1ACBE 2PSYA 3EA7A 1G9IE 1UTOA 1AGJA 2XCFA 2R2WU 1ELGA 3E3TA 5FX5A 1LMWB 1S0QA 5A8ZA 1AWFH 1QB6A 2IJOB 1O5AB 1O3LA 4ZXXH 4XBDA 2BQ6B 1AVXA 2VU8E 1PPEE 3BTEE 4Y8YA 4AFSA 4FUCA 2XRCA 4GCHG 2OTVA 1H9HE 2AS9A 1SGQE 1EZUC 2C90B 1AI8H 3SU4A 2GCTC 3BV9B 1QRWA 1GBHA 2BY9X 4OS7A 2JKHA 4QT8C 2AMQA 1ZRKA 2WUCA 1O2QA 1C2DA 5C3NA 5JDUB 4X2VA 2P3FH 1INCA 5FPYA 1Z8GA 3PROA 2ZDVH 5EPNA 4NZLA 5L6NH 2OC8A 1G3CA 4E06H 3ZVAA 1OWEA 1VCPA 2AGIX 1Z8RA 1BMMH 2XC5A 4CBNA 2OD3B 2HPQH 3Q3KA 3MNXA 1FN8A 2PFEA 1QR3E 2GVFA 4WMFA 3PMBB 3L3TA 1EUFA 1D4PB 2A5KA 1J8AA 1Y3UA 5BPEA 1Y5BT 4WH8A 1IOEA 3SBKA 1DXWA 1TNIA 2ZI2H 1LPGB 1NRQH 1Y3YA 1W12U 2PSXA 1TLDA 1WV7H 4MNXA 4K69A 2BQ7B 2ZGXH 2D2DA 2QC2A 1SQAA 3ZZ5A 1QTFA 1FONA 1WU1A 2OXSA 3KIDU 1DSTA 3ZZDA 1JBUH 2QXGA 3ATMA 3V12A 1UTNA 4B71A 1O2HA 1NESE 1V2VT 1ID5H 1OXGA 5HYOA 4GLYA 4ZUHA 1YPJH 1H8IH 1O2KA 3MHWU 4ZXYH 1ZGVA 1AKSB 1C5TA 3LDXH 2ODPA 1MTSA 4I8KA 3ODFA 1G2MA 2ZHFH 3ENSB 1NRNH 3AW1A 2OC0A 1TNKA 4NG9H 1S82A 4TWWA 1EKBB 2BDAA 3H7TA 4CBOA 4R0IA 2XBWA 3ZZ8A 1SGFA 1P2JA 1TMUH 4CRGA 1UVPA 3TPIZ 1Q2WA 3ZZBA 3LU9B 4ABGA 3TK9A 2ESTE 2VH0A 5B6OA 1BDAA 2OUAA 5FCKA 1WYKA 1TPPA 2ZC9H 2ZGHA 4UEHH 3VPKA 2NU4E 3F9HA 1SLUB 4D7GA 1TRMA 1HAZB 1RIWC 1C9TA 2RA3A 5A2MH 2ALPA 1SR5C 3T27A 2WPLS 4O3UA 3SHCH 3DFJA 1HCGA 1HAIH 3MI4A 1GI5A 4DT7B 4FVBA 3QO6A 4XE4A 3ZVDA 1MKXH 2CF9H 1RTLA 1K1NA 2HPPH 1SLWB 4Q7ZA 1GDUA 1D6RA 1MU6B 4BAKB 1SGEE 1MU8B 1A5IA 1GJCB 1DS2E 2QA9E 1GI4A 1AQ7A 5SGAE 1Y3VA 3A8DA 2FX4A 1RGQA 1CA8B 4TY7A 5JBAS 1HV7A 3TGKE 4A1VA 1DSUA 2EC9H 1NM6A 4IW4E 1NN6A 1A3BH 3AAVA 2JH5D 2ZECA 1RS0A 1CO7E 1NROH 1CGHA 2A7CA 2A7HA 1AN1E 4NFEA 2WYJA 1LQEA 1T8OA 1WQSA 1ZLRA 3UIRA 5AHGH 1A0JA 1O33A 2Y7XA 2FO9A 1ABIH 2SNVA 1FY8E 3LJJA 1XUIA 5CHAC 2K7XA 1TQ7B 3DHKH 5GIBA 3LC3A 1P02A 1MMJN 1UTJA 5C20A 4UFGH 1TOMH 3CS0A 1SFQB 2Y5GA 1ZPZA 2R0LA 4DVAU 4I8LA 4MPVA 2ZHDA 3A8AA 1AB9B 4TY6A 1HAPH 2GCHF 3BTKE 4MLFB 4X8TH 1P12E 3GY4A 1WSSH 4E7NA 1YM0A 1SGNE 1GCTC 1KDQA 1DWDH 1SBWA 2A2QH 1C1QA 2XTTB 5DP6A 1C4Y2 2FEQH 4ISLA 2CHAC 1O2OA 3M3TA 2STAE 3TK6A 1O5DH 2C8WB 3NXPA 3SU0A 5GPIB 2FOCA 1HAVB 1TPSA 1FZZA 1HFDA 2ODQA 3U8RH 4X1RU 5GXPA 2YNAA 4Y79A 1BTHH 1GBIA 4OS5A 4ABBA 1EAXA 4ZMAH 2XCNA 1L1GA 1KXEA 1TIOA 2ZGCA 4MG3A 3RXLA 1KXFA 2BDYA 2V35A 3MO6A 2WPMS 4IC5A 3T26A 2ZFRH 1TGTA 3UWIA 1O3GA 3FANA 2EI7A 2ZGJA 1C1WH 3A87A 2GV6A 3Q76A 1G3BA 3BG8A 5AFZH 3ZZCA 1F92A 5E2PA 2NU2E 1C5OH 3P17H 1LVMA 3TH2H 4FU9A 1ZMNA 1C5RA 1N8OB 1AFQB 2G55A 2NU0E 1RFNA 1K1OA 3A8BA 4GUXA 1VGCC 1E35B 1VITF 1BA8B 1TNGA 3SW2B 5BRRE 4DJZB 1OPHB 3RXFA 3OY6U 3LKWA 1XKBC 3SGAE 1C1SA 3RM2H 2Y82A 4GVUA 5I46H 4H6SB 1K1MA 3MWIU 3O8RA 3SN8A 3P95A 5FXLA 4UFFH 2OP9A 4RN6A 4AG2A 4JYUH 1H1BA 1NFWA 5T6FA 1VR1H 1P2KA 1HUTH 1GHYH 3A86A 2CGAA 2GT7A 2ASUB 1V2MT 4BOHA 1LPKB 4DOQA 4Z6AH 1FY5A 1JRSA 4Y11E 3L33A 1SPJA 4XSKU 2SFAA 5ESBA 4ABAA 3SNEA 1ANEA 2QV1A 2UUKB 1BMLA 2ZU4A 3FP7E 2PUXB 1GVKB 1S6FA 5L2YH 1UK3A 2ZU5A 3VXEH 4TYDA 1AVWA 2W26A 3K6YA 1O0DH 2BX3A 1SGRE 4NSYA 2V3HH 4Y71A 1Z71A 3M5OA 1DLEA 5EW1H 3VB5A 3SV8A 3H7OA 4O9VA 2BDCA 2RDLA 1YBWA 1GDQA 3E0PB 3MH4A 3UQVA 3LGVA 1YPHE 2EI8A 4JK5A 2UUYA 2FI4E 1GBTA 2RCEA 3F68H 1O2ZA 4O97A 1H8DH 5EGMA 1P05A 3GYMA 2VVUA 1L4ZA 2NU3E 2A4OA 1NY22 1BRCE 2QXJA 4IGDA 2BZAA 1Z6JH 4AB8A 2Y5HA 5I25A 1P10A 3FFGA 2GDEH 5AF9H 5EXMA 1FPCH 3UOUA 1IQGA 2Q6FA 3GCOA 1ZHPA 4YO9A 3S9AA 1N6YA 1QL7A 4OS2A 2F3CE 3UTUH 1O2LA 1UCYK 3G01A 2AFQB 1AKSA 2BY8X 2O8UA 1BQYA 2G51A 2TRMA 3VB6A 3ATKA 1AWHB 3M7TA 4GHQA 2ZDNA 1Z8IB 4JYTA 4FUHA 1NFUA 3EQ0H 4KTCA 2RG3A
chains in the Genus database with same CATH superfamily
1O5EH 2QXHA 4YOIA 4UE7H 2FI5E 1D3QB 1GHBF 1GI8B 2ZFFH 2BVRH 4K1TA 4R8TB 2QF3A 1O3FA 1IQLA 1TGNA 5T3HA 1K21H 3F6UH 2TGDA 4XOJA 1K1PA 4H42U 1RJXB 3RLYH 2Y5FA 1EPTA 5LPRA 2BYAX 4X8VH 2FM2A 2VVVA 1WDIA 1OWIA 1AIXH 4UFEH 1O3HA 3BEFB 2ZQ1A 3LT3A 3TH3H 2L74A 1WTGH 1THPB 3MMGA 4I31A 4AZ2B 1YPLH 3Q77A 2QE7D 1LHGH 2KCPA 1EATA 1UVOA 1HAGE 1NU9A 3UOPA 4BTUB 2BZ6H 3W1EA 3QTVH 3SQHE 5IYTA 1ELTA 1YLNA 2H1UA 2PLXA 3GICB 2IN2A 5JYIA 1F7ZA 2GZ7A 1AMHA 3MOCA 2F43B 4NIWA 5DP7A 4ZAEA 4DIHH 1YYY1 3MFJA 1P04A 1QQ4A 5F8TA 1WAYB 3M5NA 1XUJA 1GHXH 1L1JA 1QL8A 5E0HA 2FOMB 3SGQE 1GMHF 1H9IE 1GL0E 2PWXA 1F5LA 1VJ9U 4ZHLU 1SLVB 3KHVA 1GBAA 3NZIA 2CK3D 1AVGH 1E36B 2P3UB 4IN2A 1O5CB 1T4VH 1L4DA 3P6ZB 1E37B 3RDZA 2OBOA 2EA3A 3EBNA 1HYLA 1T31A 2BXUH 3A88A 4YESB 5F03A 3A7ZA 1EOJA 3KYGA 1AY6H 3SZNA 1FY3A 1TPOA 3TNSA 1C2IA 1EAIA 1ETTH 1J16A 4B75A 4DW2U 3MNSA 4I8JA 4BAMB 3MU8A 2QIQA 3ZVCA 1OYTH 1QBVH 4OS6A 1H8HD 7GCHG 1C1VH 1O2MA 1O30A 3QLPH 1V2PT 1DT2A 5ETXA 2BLOA 1C5YB 2HNTF 1A2CH 1MAXA 4DURA 2D8WA 2FXRA 2TBSA 1KLJH 2VNTA 1GI3A 3TJVA 1YCPK 3SU5A 3B9FH 1AB9C 1C2HA 2GMTB 5L30H 1ZRBA 1U6QA 1C5NH 1P01A 1XVMA 2WV5A 1PQ8A 1T8MA 2R0KA 2B0FA 2F9NA 2HNTC 4ABDA 4CRCA 1C1NA 3B8JA 4HG6A 1HIAB 1YP9A 2JETB 2VIDA 2PHBA 1ORFA 1HXFH 1MZDA 4BAQB 4GHTA 4CH2B 5JBCS 5DO4H 1TBZH 2QYIA 1C5QA 1TPAE 1MTNC 3PMAB 2PUQH 1HAXB 5DP3A 2RFKC 1KXCA 5J4SA 1TX7A 2LNCA 2Q6DA 2B8OH 4TWYA 1ESAA 4INLA 1D3PB 1TB6H 1CVWH 4CR9A 5E0GA 1MQ5A 3RXDA 1EOLA 4IMZA 5IK2D 1BJVA 1EB1H 4FUGA 2Y7ZA 1C2JA 2QAAA 3N7OA 1O36A 1BZXE 4TPYA 1GJAB 1YY3A 3BTHE 3OX7U 1SQOA 1EJNA 3GS9A 1Q3XA 2ZZUH 1LKAA 4ESTE 1EAUA 1IQFA 1JRTA 2ZPQA 1WUNH 1MBMA 3P8GA 3S7KB 4ASHA 1IQEA 2FLRH 2HRVA 1KYNA 1AFQC 3UUZA 3RXQA 2LPRA 1OOKB 5TJXA 1L0ZA 3STJA 4U30A 2G00A 1C2LA 3LGUA 4TT3D 3TITA 3SU2A 1QA0A 2UUFB 3ATWA 2ZDKA 1TNJA 1XUHA 4MDSA 4GAWA 3SNBA 2VB0A 2VINA 1M9UA 4K60A 5FBEA 1IQNA 1DPOA 4MTBA 4F49A 1QBOA 8GCHF 1DE7H 1VCWA 1C5PA 2A5IA 4JYVH 1KIGH 8ESTE 1AD8H 1QA7A 3GCHB 3OEED 1ZSLA 4WXVA 2F9UA 3SU1A 1SHHB 3K2UA 1F0UA 4NA7A 5AVDA 2PW8H 1TOCB 4Y10E 4HZHA 3ELAH 4B1TA 2QY0B 3PO1B 5C0UA 4WMEA 3KN2A 2NWNA 2HLCA 4YLQH 1LVOA 3LGTA 3VEQB 2TGTA 2BLQA 1GBEA 2O8WA 1CHOG 2BDGA 2AIQA 1TGCA 4ZCNA 1GI2A 1K22H 2W7UA 1SGPE 4K5ZA 4HTCH 1DICA 4WWYA 3WWBA 2Z9LA 1Y3WA 1KXDA 1MD8A 2C4FH 2H5DA 1UHBB 5DP9A 4A1XA 3F2FA 1O2IA 1BMFD 3VB7A 4B76A 3GYLB 3LC5A 4UD9H 5HM2A 2YMSC 5JPMH 3D49H 2XC0A 5A09A 1V2NT 2ANWA 4X6MA 1HAOH 1KMHB 2G52A 1LHEH 1K1LA 1KTSB 2ZFQH 2JJ1D 2P3TB 5GNDA 3HPTB 1DY9A 3QN7A 3U1IB 3EE0B 1SOZA 3KCGH 4ABEA 2O8TA 5T6GA 1P3EA 2ZFTA 3RXPA 1AZZA 2DE8A 4ISHH 3I29A 1RD3B 1OWKA 3KQDA 2WHXA 4DCDA 1W8BH 2P95A 5HGGA 2BOKA 1EZQA 1PQ5A 2Z7FE 5FL7D 1OS8A 1VJAU 4JZFH 4KKDA 1L2EA 3PYHA 4RT0A 2J92A 1OSSA 5EG4A 2Z6BD 1S83A 3UY9A 3RP2A 1DFPA 3LGWA 3SJKA 4B6EA 1NFXA 4GCHF 1SGDE 4BNRA 1TMTH 2FI3E 3BTME 1EP6A 4BTIB 2XC4A 4UDWH 2D26C 3U69H 1G30B 5E0JA 2KCOA 2Z9IA 2K0QA 3UFAA 2ZFPH 2WINI 4H4FA 4HGCA 2WPHS 5LGOA 2O8MA 3UNQA 3RXMA 2FOBA 3T29A 4X6OA 3RXTA 2ZO3H 1PPCE 2ANMH 2GTBA 1PYTD 1YLCA 2LELA 4ABFA 1YLDA 3A83A 4YOGA 3S69A 1GMDG 2QCYA 1Y59T 3N7DA 2IOTA 1MH0A 2JH6D 1O5GH 3RUOA 3UR6A 4BAOB 4F55A 4ZKSU 2BHGA 1O35A 5GCHG 2HVYB 1P3CA 4F4OC 1PPZA 1C9PA 2J94A 3QWCH 4Z1MD 4XFQA 3BTQE 3I78A 1W7GH 2K1QA 1XUKA 1P57B 2BLVA 1MD7A 1V2LT 1HAYB 1EJAA 2GV7A 3FVFB 3A7VA 1EFRD 5LPFA 2XW9A 1F2SE 3NK8A 2AIPA 1HBTH 1TABE 1E1QD 8LPRA 1G2LA 1O3AA 2XNIA 2WPIS 3QGJA 3AAUA 4MNVA 3BEIB 1UCYE 2ZDMA 4BAHB 1Y8TA 4JCNA 2BY7X 3SU3A 4H6TA 1AO5A 1O2SA 3GY3A 2Z9KA 1CGJE 3C27B 3GCNA 5LH8A 1TWXB 3SV9A 3NRLA 2WPJS 1JXPA 1O37A 1AE8H 5EW2H 1DDJA 1NFYA 1KLIH 1S81A 2SGDE 5F8XA 2Z3CA 1ZHMA 1RRKA 3URDA 1T8LA 1P9SA 4ZROA 2BD3A 3BTDE 1VKYA 2A4RA 3KNXA 3BIVH 3DSOA 2FTLE 4FUDA 1AUJA 2YNBA 4LXBH 3BN9A 1VITH 2W5EA 5HMAA 2C8ZB 2J98B 4P00A 2TGPZ 3SYJA 1A7SA 3DD2H 2FOAA 2ZP0H 1MAYA 2R3YA 3MYWA 3EAJA 2EY4C 2HVXA 2R9PA 5E8EH 1SQTA 3RXEA 1QL9A 5AFYH 1HIAA 3SQEE 1OP2A 1C5XB 1SB1H 1NPMA 2Y6TA 1T32A 1FMGA 2GKVE 2EQNA 1ETRH 1GJ6A 2BVXH 3P8NA 1K1IA 2V7QD 3K65B 1EZXC 3MO3A 4ZHMU 1W10U 2GMTC 4FUFA 1SG8B 4I32A 5HM9A 2ZF0H 4NIXA 3UQOA 4AOQA 1O34A 3F3BA 1SLXB 9LPRA 2JETC 2PGBB 1Z1IA 1GGDB 3PV4A 3BIUH 1OKXA 1PFXC 2P8OC 1O3IA 5C1UA 1O2UA 1UTQA 3NUMA 1EXFA 4FXGH 1BIOA 1D3DB 3D23A 1O2TA 1CT4E 3A80A 1BBRK 1YKTA 2CMYA 1UK4A 2GZ8A 3BTFE 3MU4A 3PRBA 3TGIE 2BTCE 4LZ4B 3E1XB 4NA9H 4AC9A 1MTVA 1XMNB 1TFXA 2H9TH 1YPKH 1OWHA 1P2MA 1ANBA 1W3CA 3M5MA 2G81E 1Y5UT 3U9AH 2ZG0H 3NPSA 1YCPM 4CREA 9ESTA 3CS7A 1MBQA 1O5FH 2F83A 1BTXA 1SGIB 5DP8A 1CBWB 1IHSH 3PTNA 1V2QT 4DT4A 1QQUA 3SV2H 3SUGA 1AZ8A 4E05H 2VH6A 2ZTZA 1BT7A 5G4BA 3SNCA 2ZDLA 1UCYH 3F0OA 1W13U 2HNTE 4PROA 4WJG2 4AN7A 1E38B 1FIZA 1LHCH 2ZCHP 3EA9A 1LHFH 4YM9A 1P2IA 2FIRH 3ODDA 1ZHRA 1ZR0A 4NA8A 4X8UH 5FBIA 1TGBA 1FLEE 2P16A 2B7DH 1C5VA 2O8LA 1CGIE 2NU1E 3A7XA 3MH5A 3QZQA 4B73A 5DKMA 3RXHA 3SI3H 4UFDH 1E0FD 3PO1C 3FZZA 1G37A 2SGEE 1YGCH 4ABHA 1BOQA 1IQMA 1UHBA 4X1PU 2FESH 2WSSD 1C5UA 1PQ7A 5GJ4B 4AYVB 1QB9A 3C1KA 4CRBA 4ZKNU 2Z9JA 1A1RA 1TBQH 2RA0A 3MU1A 2BY6X 2BM2A 1ANCA 2SNWA 2KM0A 4CRAA 2OQ5A 3AW0A 1J15A 1DWCH 2F9OA 5B6LA 3S0NA 5EOKA 4X6PA 1C2MA 1ELEE 2ALVA 4HI3A 2H9EH 2C3SA 4ISOA 1UO6A 4RI0A 3F9FA 2GJGA 2YOLA 1O3NA 1BCUH 4M7GA 1S6HA 2OC7A 2AYWA 1TX8A 1X7AC 1VZQH 2C8YB 1O2WA 3ZVFA 1LHDH 1P2QA 5C94A 1W0KD 3BSQA 3S9CA 2G4TA 1IQIA 1ELVA 2CF8H 1TBRH 1IHTH 1NU7B 1ETSH 5DP5A 4CR5A 2Z3DA 2W6ID 3SJ9A 1BHXB 3OEHD 4SGBE 5TCAA 2A1DB 3RXOA 2BD5A 4FUJA 4YXWD 4D8NA 3JZ1B 1K2I1 4X1SU 1W0ZU 1SC8U 1ZJKA 1GBFA 1XM1A 3KQEA 1FV9A 2ZU2A 1E1RD 2ZWLH 1ANDA 1MTWA 4CHAB 3TGJE 3SI4H 3ZYEA 1DX5M 1GMCG 3N99A 3RMMH 3S7HB 1QJ7B 4X2XA 1DOJA 1FIWA 1HJ8A 2WYGA 4DG4A 1V2WT 1E34B 3CNRA 6GCHG 1CSOE 5EU8A 5F6MA 4WY3A 3QGNB 5GWZA 1FNIA 1DWEH 1HJAB 1O38A 2CXVA 1PYTC 3BEUA 2CN0H 2H6MA 1Z8JB 3W95A 1GBLA 2ULLA 1SSXA 4FUBA 6CHAB 1QNJA 3V7TA 1P09A 1S0RA 1YCPH 2GT8A 3SV7A 1THRH 2ILNA 4NIYA 1UJ1A 1MKWK 1MQ6A 1QHRB 3FZDA 2TGAA 1QRZA 8KME2 4IMQA 1P03A 1V2ST 1PPHE 2OBQA 1BTPA 1ABJH 4AFQA 3ZYDA 1ZMLA 5C0TA 3KF2A 1B7XB 4AGKA 2B9LA 1H4WA 2J38A 3PM3A 5JBBS 3MNCA 3HKJB 1JWTA 1CQQA 3RU4T 4X2WA 3D65E 1ZMJA 3UNSA 5C5OA 1BMNH 1ELAA 1O3KA 1GVLA 1KTTB 5J4QA 5CDFE 4Q4LA 3RXVA 3F2GA 2ZU3A 1K1JA 2AGGX 3ZZ6A 1VCQA 1O2XA 3T28A 6ESTA 2OK5A 1KSNA 3ZZ4A 3OAAD 3PTBA 5EIYA 1CA0B 1V2JT 2KCYA 3EA8A 1QRXA 2UWLA 4WXIA 3TJOA 4NGAH 4IS5A 1C5SA 3M61U 2J98A 2FS9A 2G4UA 1GBCA 2PKAB 1DXPA 3EGKH 3TLOA 1XKAC 3BF6H 3GY2A 2XXLA 1V2TT 2J34A 1RTKA 2M5TA 1GBMA 2ZPSA 3CENA 1N6XA 3SGBE 2ZTXA 2ANKH 2FP7B 4AFUA 3PMJA 1C2GA 4A5TS 1SL3A 1TQ0B 1W0JD 3Q3YA 1UVUH 2R3UA 2AH4X 1F5RA 3F2HA 2JJ2D 3RXIA 3PWBA 1SGTA 3DFLA 3P8FA 2BD7A 5CE1A 1V2RT 3AVZA 3QZRA 1IAUA 3T62A 1O3PB 1CT0E 3DCLA 3T2NA 1HAVA 2BB4A 1COWD 4CRFA 1BRUP 2BD8A 4DGJA 1KLTA 1AFEH 1C4U2 1CHGA 2BMGB 2P93A 1NRPH 3RU4D 2Y80A 4Y76A 1UTLM 4AGJA 1GPZA 2F9VA 4X6NA 1PQAA 1SGCA 1O3OA 3L6PA 1GBKA 2HWLB 1FY4A 1GGDC 5EQQA 2JH0D 4KGAA 2FOGA 1P2OA 3ZVBA 4D9RA 2J9NA 2WV4A 1EB2A 1JIRA 3S9BA 1MUEB 3K6ZA 1MCTA 1NO9H 1CE5A 1EP5A 3DT0H 3PLBA 1BJUA 1W14U 4Y0YE 1UTMA 4XD7D 1HLTH 2A32A 1MCVA 2FS8A 3DUXH 3ZZAA 1CU1A 3RU4E 1A5GH 1PPFE 3TK5A 1GBJA 1O2YA 2Y81A 2V6NA 2VIPA 1RTFB 3R0FA 4WMDA 3TJUA 4B6FA 1AHTH 2I6SA 2ZTYA 1CBWC 1N8OC 1ZTKA 2ZCKP 3GISB 3TH4H 2GD4B 2WUBA 5TCCA 3A84A 2OINA 2B5TB 2XBYA 3UPEA 3GY6A 4DY7B 1O2JA 5C1XA 4NSVA 3ATLA 4CRDA 2THFB 5KECA 7GCHF 1HPGA 1BTZA 3SORA 1DANH 2GDDA 4WVPE 2M2AA 1G3EA 4B2CA 1BMAA 3UR9A 3VXFH 1UK2A 1O5BB 1VGCB 3SU6A 3HKIB 3EDXB 3Q3XA 1PPBH 1WXRA 1YPHC 3NWUA 1PJPA 4Y7BA 3OTJE 2FLBH 2G5NA 2FODA 5PTPA 1BB0B 3BG4B 2ZNKH 2J4IA 3SJOA 3E6PH 3LIWA 1UVTH 2ZKSA 3DA9B 1O2RA 2J5UA 1KXBA 1LVBA 1TNHA 2CJIA 2XYAA 4Q7XA 3V13A 1Z7KA 4X1QU 5DP4A 4INHA 2IPQX 1FY1A 3PWCA 4IBLH 1GJ5H 2FYQA 2GP9B 1YPGH 1A0HB 2STBE 1BBRE 4NFFA 3RMLH 3URCA 5K0HA 1G3DA 1NTPA 1LPZB 4MPWA 1TE0A 5HKKD 1Y3XA 1O2VA 1WCZA 3SNAA 3SUEA 1K0HA 1JOUB 4JZIA 4MPXA 1C1OA 2VGCB 1SOTA 4ISNA 2SGQE 1NS3A 1SGFG 2ZU1A 1S6LA 7KMEH 3GDSA 1EAWA 3UREA 1ZTJA 3MU5A 1HDTH 1HJ9A 5DGJA 5C1YA 4MQAA 1TRYA 1BITA 3F0PA 3IWMA 1BHXF 3IG6B 1HXEH 2ZIQH 3ITIA 2J95A 2CV3A 1NRRH 2A0QB 4MPUA 4Q80A 3MH6A 3RC4A 2R2MB 4YZUA 1BTUA 1XXDA 2FYRA 4CH8B 1GDNA 4ACAA 3KQBA 2BD4A 4Q7YA 2A4GA 3D62A 1C2KA 1GL1A 5EQSA 5DK1A 3STIA 5DPAA 5FPSA 1GG6B 2VWNA 3NKKA 3R3GB 4TSFD 1A3EH 1AU8A 3M7QA 4FVDA 4YTAA 4MNWA 2FTMA 1GI9B 2KR7A 4CHAC 2WZQA 1GCDA 3KGPA 3DSGA 4INKA 2H2ZA 2UWPA 1FPHH 1V2KT 2P94A 3MO9A 1QJ1B 3TNTA 2QF4A 3F9GA 1FN6A 3RXBA 3OSYA 1ESBA 2FPZA 4X1NU 5H4IB 1TAWA 3SJ8A 2QN5T 1UVSH 4GSOA 4ABIA 1HJAC 1WQVH 1IQKA 1QIXB 1CHOF 1TYNA 2XWAA 4UONA 3PMHB 4K1SA 1W0YH 2FX6A 1P06A 4D76A 3RXRA 5FX6A 1TA2A 1YPEH 4IC6A 2H9HA 3E0NB 4X8SH 1EZSC 5DG6A 6CHAC 1B5GH 1HB0B 2PP6A 2SGPE 1O32A 2KFWA 1NZQH 2BDHA 4NWLA 1QB1A 3O8CA 3NCLA 2GGVB 2ZHEH 1OX1A 3LGIA 3HK3B 4I7YH 2BQWB 3A81A 3QUMP 3UWJH 2AHME 3WY8A 2BY5X 2GCHG 3VG8A 3PRDA 1EPTB 1EASA 1E79D 1SFIA 2GX4A 2V3OH 4D9QA 4K3JA 1BBRH 2OQUA 4FU8A 1BRAA 1C1MA 5ESTE 2A2XH 1GHWH 1QZ8A 2VWOA 2PKAA 2XOKD 3RXGA 3MTYA 1FUJA 1N1LA 3N7EA 4RKOB 4Y8XA 5T1VA 4O3TA 4AB9A 2VIVA 5JB8S 1WBGB 1Y5AT 1SGYE 4AORA 1JMOH 3KL6A 1P11E 1G32B 4HFPB 1CA0C 4ZHAA 3HGPA 1NBMD 4XDEA 3FKSD 1GHZA 3B23B 1Z6EA 4K8YA 1GHVH 1ESTA 3LPRA 1GHAG 2OCVB 1SKYE 4BXSA 1W7XH 5FHTA 3ESTA 1QCPA 1ZPCA 1A4WH 3T5FH 3MNBA 3ZVGA 1WOFA 1SI5H 2EEKA 4ASUD 3SV6A 1QFKH 3E16B 3HGNA 3A7WA 4VGCB 1ZOMA 1C1RA 4Z0KA 1ZPBA 1IQHA 2DE9A 1OYQA 3RC5A 4YOJA 1VITG 4ZKRU 4BTTB 1P0SH 4KP0A 2XBXA 2KAIB 2XWBI 1NBME 3VGCB 3LH3A 1TONA 1GMDF 4JK6A 4A1TA 2TIOA 1K9OE 4XRNA 5CMXH 4J2YB 2D1JA 3A89A 3GDUA 5GCHF 2SGFE 1D9IA 1P2NA 4FUIA 2C8XB 4K2YA 3A8CA 1DY8A 1ZTLA 1FI8A 1PPGE 1S84A 1GJ8B 3ZZ3A 4A7IB 3BTTE 3PB1E 3AASA 3TVJB 5EPYA 2A7JA 1LTOA 2XBVA 2O9QA 1FJSA 3U8TH 3VB4A 2C93B 4E7RG 3PV2A 4AG1A 3FN8A 3P8OA 3OYPA 1TGSZ 1CT2E 1UMAH 2OC1A 5L2ZH 3KQCA 3M37A 1D6WA 1FXYA 3KEEA 1O3EA 1GI7B 2UWOA 1C5ZB 3M3VA 1V2OT 2PKSB 4XBCA 2BLWA 1MTNB 1XX9A 1C1UH 1MKXK 2WPKS 1JIMA 1O3BA 4ACBA 3A7TA 3RXUA 1F0SA 1TNLA 2LIZA 2ZA5A 3QTOH 4A92A 5JBTA 1GHAF 1DWBH 3QX5H 6LPRA 2JIZD 2BDBA 2F9BH 3LJOA 2IPHA 1O2PA 4DIIH 4YT7H 1A5HA 4ISIH 2ZGBH 1XUGA 1GJ9B 2K8IA 4J1YA 1SVPA 5HXFA 3E91A 1OP8A 2DUCA 2AERH 3A85A 3KQ5A 1FAKH 1DITH 2ZPRA 1RXPA 3PV5A 2J2UA 4LZ1H 4AYYB 2Q6GA 1HNEE 1G36A 2ZCLP 1O3DA 3GCHC 5LPEA 2RDEA 2BOHB 2VVCA 1EQ9A 1O3CA 3BG4C 1F0RA 4KELA 1YC0A 3SHAH 1OHHD 1NC6A 3M35A 3RC6A 3FAOA 5A0CA 3UNRA 3GCTG 2QGRA 1GI6A 1O2GH 4RSPA 1GHBG 1ZSJA 3RXAA 1GWAA 4OS1A 3H09A 1O39A 4ZH8A 1YPMH 1T4UH 3OY5U 2GCTB 1MKWH 3HK6B 1UTKA 1OWDA 2ZHWH 1ELBA 4U01A 1BTYA 3GY5A 1FX0B 1QURH 5EQRA 2H5CA 4X0WU 1KY9A 1WTHD 2VGCC 3LH1A 2ZFSA 3GY7A 2W3KA 4Y7AA 5IDKA 2F4LA 3PLPA 5A8YA 4K8BA 3OU0A 2Z9GA 1A61H 2PTCE 1C2FA 1SHYA 1S85A 1FAXA 1ZJDA 5FCRA 4X2YA 2FDAA 1P8VC 2YMSB 1YF4A 3TIUA 1BTWA 2P59A 2GZ9A 1B0FA 2QXIA 5C17A 2ZHQH 1LQDB 3RXCA 4O03A 1C2EA 4I8GA 4Y0ZE 5FAHA 1J17T 1T8NA 1XUFA 5ABWA 1W2KH 3OTPA 4IN1A 2YMSD 1GI0A 2W7SA 1V6DA 3RMNH 1C5WB 2VIOA 5DN6D 4JZEH 1A46H 3F9EA 1MTUA 2Q1JA 3SOSA 1GG6C 3ZV8A 1ELDE 3W94A 4ABJA 2QF0A 1GMHG 1O3JA 2BDIA 3SZEA 5T6DA 3SUDA 3PLKA 2AMPA 1T7CA 1O3MA 1GBBA 3K9XB 5F8ZA 5C2ZA 4Y6DA 3FP6E 1DLKB 3M7UA 4Q2KA 4XBBA 1ZSKA 2VWLA 1LVYA 3P92A 4F48B 5C5NA 3P70B 2HGTH 1C4V2 3CP7A 4RKJB 1V3XA 3GCTF 2ODYB 3SJIA 2TPIZ 3U1JB 1O2NA 1XVOA 4WF8A 2J97A 3M36A 3AK5A 4LOYH 2VJ1A 1HGTH 3U98H 7LPRA 2PV9B 5K7RA 1GI1A 4D7FA 1OP0A 2AGEX 3GOVB 4A6LA 1C1PA 1K28D 2VIQA 3UB0A 1V2UT 1QBNA 3T25A 1GJDB 2FOEA 2FWWA 2BD9A 1LDTT 4FETA 4I86A 4NWKA 3DSPA 2SGAA 3E8LA 1D3TB 4FU7A 2JDID 4I8HA 1QGFA 4I33A 3O8DA 1KXAA 2F9PA 2ZQ2A 3E90B 5EXNA 1EPTC 3JZ2B 3F1SB 2EI6A 4OS4A 1RIWB 1NRSH 3SO3A 3KYFA 5A0BA 5A8XA 3MH7A 4MVNA 3FP8E 1TRNA 5JB9S 2BXTH 1J14A 3EYDA 2ANYA 3SNDA 2PTNA 3QK1A 1TX6A 2Z3EA 1MZAA 1IQJA 1GJBB 3ZV9A 4FUEA 2HOBA 3IITA 4JMYA 1LCYA 1TA6A 4AFZA 2PR3A 3ZZ7A 2W3IA 1LO6A 1F0TA 1O31A 1C5MD 3TU7H 3VFEA 2FMJA 1F5KU 4GPGA 4THNH 3V3MA 1LKBA 3RM0H 1GMCF 3BTGE 1UTPA 3U8OH 4KTSA 2ZEBA 6GCHF 3OFND 2KZ4A 3I77A 2HALA 2KAIA 3M5LA 1OWJA 2V0BA 4B2BA 2LP6A 1ZYOA 5CHBA 3H5CB 1P9UA 2FOHA 4VGCC 4WH6A 2A45B 2A5AA 1QY6A 1ARCA 5FPTA 2Z94A 1W11U 1FDPA 5CHAB 1DUEA 1S5SA 2I6QA 4U2WA 3V0XA 3LGYA 1J9CH 4BANB 3VGCC 3Q00A 2AEIH 4BXWA 1H9LB 1NT1A 1ARBA 1ZGIA 2BX4A 3WW7A 1L1NA 4YT6H 5GDSH 4K1EA 8GCHG 1A0LA 3U28C 3TJNA 1DUAA 2A4QA 1GBDA 3RLWH 3M3SA 1EX3A 2F91A 3O8BA 4B2AA 1GCTB 2UUJB 5DJ7A 3HATH 1Z1JA 1TMBH 1XXFA 2BD2A 2G8TA 4LK4A 5EJ1A 2A31A 1TALA 3GY8A 4NCYA 1B0EA 4TPIZ 2CHAB 2KX4A 3LOXA 3RXJA 3LONA 1ZZZA 1C5LH 1THSH 4OGXA 2P8OB 2PKSC 4OGYA 3SUFA 2VWMA 3ZZ9A 3RXKA 3ATIA 3MU0A 2IJD1 1KDQB 3VB3A 3ZVEA 1GJ4H 2BVSH 5C67A 1BRBE 5A0AE 1SMFE 1H8ED 4JZDH 4ZKOU 1DM4B 4U32A 4Y8ZA 1AUTC 4JZ1A 1DVAH 1FQ3A 1EJMA 2OLGA 2ZDAH 3GDVA 2PGQB 3RMOH 1AE5A 2FOFA 1ELFA 3A82A 2G5VA 4SGAE 3BTWE 4AX9H 4YLUA 5EODA 4MNYA 3RXSA 1HRTH 3QDZB 2AMDA 1QJ6B 1Q31A 5EXLA 1ELCA 4NZQA 1GJ7B 1C1TA 4KTUA 5E2OA 4NIVA 1GVZA 2VIWA 1HAHH 1BUIA 2FZZA 3A7YA 7ESTE 4M9FA 4B74A 1ACBE 2PSYA 3EA7A 1G9IE 1UTOA 1AGJA 2XCFA 2R2WU 1ELGA 3E3TA 5FX5A 1LMWB 1S0QA 5A8ZA 2KCAA 1AWFH 1QB6A 2IJOB 1O5AB 1O3LA 4ZXXH 4XBDA 2BQ6B 1AVXA 2VU8E 2VBCA 1PPEE 3BTEE 4Y8YA 4AFSA 4FUCA 2XRCA 3OE7D 4GCHG 2OTVA 1H9HE 2AS9A 1SGQE 1EZUC 4Q63A 2C90B 1AI8H 3SU4A 3EE7A 2GCTC 3BV9B 1QRWA 1GBHA 2BY9X 4OS7A 2JKHA 2XNDD 4QT8C 2AMQA 1ZRKA 2WUCA 1O2QA 1C2DA 5C3NA 5JDUB 4X2VA 2P3FH 1INCA 5FPYA 5HIZA 1Z8GA 5HIYA 3PROA 2ZDVH 5EPNA 4NZLA 5L6NH 2OC8A 1G3CA 4E06H 3ZVAA 1OWEA 1VCPA 2AGIX 1Z8RA 1BMMH 2XC5A 4CBNA 2OD3B 2HPQH 3Q3KA 3MNXA 1FN8A 2PFEA 1QR3E 2GVFA 4WMFA 3PMBB 5DSFA 3L3TA 1EUFA 1D4PB 2A5KA 1J8AA 1Y3UA 5BPEA 1Y5BT 4WH8A 1IOEA 3SBKA 1DXWA 1TNIA 2ZI2H 1LPGB 1NRQH 1Y3YA 1W12U 2PSXA 1TLDA 1WV7H 4MNXA 4K69A 2BQ7B 2ZGXH 2D2DA 2QC2A 1SQAA 3UAIC 3ZZ5A 1QTFA 1FONA 1WU1A 2OXSA 3KIDU 1DSTA 3ZZDA 1JBUH 2QXGA 3ATMA 3V12A 1UTNA 4B71A 1O2HA 1NESE 1V2VT 1ID5H 1OXGA 5EJZA 5HYOA 4GLYA 4ZUHA 1YPJH 1H8IH 1O2KA 3MHWU 4ZXYH 1ZGVA 2WV9A 1AKSB 1C5TA 3LDXH 2HLDD 2ODPA 1MTSA 4I8KA 3ODFA 1G2MA 2ZHFH 3ENSB 1NRNH 3AW1A 2OC0A 1TNKA 4NG9H 1S82A 4TWWA 1EKBB 2BDAA 3H7TA 4CBOA 4R0IA 2XBWA 3ZZ8A 1SGFA 1P2JA 1TMUH 4CRGA 1UVPA 3TPIZ 1Q2WA 3ZZBA 3LU9B 4ABGA 3TK9A 2ESTE 3FOAA 2VH0A 5B6OA 1BDAA 2OUAA 5FCKA 1WYKA 2WPDD 1TPPA 2ZC9H 2ZGHA 4UEHH 3VPKA 2NU4E 3F9HA 1SLUB 4D7GA 1TRMA 1HAZB 1RIWC 1C9TA 2RA3A 5A2MH 2ALPA 1SR5C 3T27A 2WPLS 4O3UA 3SHCH 3DFJA 1HCGA 1HAIH 3MI4A 1GI5A 4DT7B 4FVBA 3QO6A 4XE4A 3ZVDA 1MKXH 2CF9H 1RTLA 1K1NA 2HPPH 1SLWB 4Q7ZA 1GDUA 1D6RA 4RT1A 1MU6B 4BAKB 1SGEE 1MU8B 1YWUA 1A5IA 1GJCB 1DS2E 2QA9E 1GI4A 1AQ7A 5SGAE 5KEDA 1Y3VA 3A8DA 2FX4A 1RGQA 1CA8B 4TY7A 5JBAS 1HV7A 3TGKE 4A1VA 1DSUA 2EC9H 1NM6A 4IW4E 1NN6A 1A3BH 3AAVA 2JH5D 2ZECA 1RS0A 1CO7E 1NROH 1CGHA 2A7CA 2A7HA 1AN1E 4NFEA 2WYJA 1LQEA 1T8OA 1WQSA 1ZLRA 3UIRA 5AHGH 1A0JA 1O33A 2Y7XA 2FO9A 1ABIH 2SNVA 1FY8E 3LJJA 1XUIA 5CHAC 2K7XA 1TQ7B 3DHKH 5GIBA 3LC3A 1SQRA 2V3MA 1P02A 1MMJN 1UTJA 5C20A 4UFGH 1TOMH 3FO8D 3CS0A 1SFQB 2Y5GA 1ZPZA 2R0LA 4DVAU 4I8LA 4MPVA 2ZHDA 3A8AA 1AB9B 4TY6A 1HAPH 2GCHF 3BTKE 1UW7A 4MLFB 4X8TH 1P12E 3GY4A 1WSSH 4E7NA 1YM0A 1SGNE 4FOUC 1GCTC 1KDQA 1DWDH 1SBWA 2A2QH 4P02A 1C1QA 2XTTB 5DP6A 1C4Y2 2FEQH 4ISLA 2CHAC 1O2OA 3M3TA 2STAE 3TK6A 1O5DH 2C8WB 3NXPA 3SU0A 5GPIB 2FOCA 1HAVB 1TPSA 1FZZA 3ZIAD 1HFDA 2ODQA 3U8RH 2W6JD 4X1RU 5GXPA 2YNAA 4OM9A 4Y79A 1BTHH 1GBIA 4OS5A 4ABBA 1EAXA 4ZMAH 2XCNA 1L1GA 1KXEA 1TIOA 2ZGCA 4MG3A 3RXLA 1KXFA 2BDYA 2V35A 3MO6A 2WPMS 4IC5A 3T26A 2ZFRH 1TGTA 3UWIA 1O3GA 3FANA 2EI7A 2ZGJA 1C1WH 3A87A 2GV6A 3Q76A 1G3BA 3BG8A 5AFZH 3ZZCA 1F92A 5E2PA 2NU2E 1C5OH 3P17H 1LVMA 3TH2H 4FU9A 1MABB 1ZMNA 1C5RA 1N8OB 1AFQB 2G55A 2NU0E 1RFNA 1K1OA 3A8BA 4GUXA 1VGCC 1E35B 1VITF 1BA8B 1TNGA 3SW2B 5BRRE 4DJZB 5F53A 1OPHB 3RXFA 3OY6U 3LKWA 1XKBC 3SGAE 1C1SA 3RM2H 2Y82A 4GVUA 5I46H 4H6SB 1K1MA 3MWIU 5KGOA 3O8RA 3MQKC 3SN8A 3P95A 5FXLA 4UFFH 2OP9A 4RN6A 4AG2A 4JYUH 1H1BA 1NFWA 5T6FA 1VR1H 1P2KA 1HUTH 1GHYH 3A86A 2CGAA 2GT7A 2ASUB 1V2MT 4BOHA 1LPKB 4DOQA 4Z6AH 1FY5A 1JRSA 4Y11E 3L33A 1SPJA 4XSKU 2SFAA 5ESBA 4ABAA 3SNEA 1ANEA 2QV1A 2UUKB 1BMLA 2ZU4A 3FP7E 2PUXB 1GVKB 1S6FA 5L2YH 1UK3A 2ZU5A 3VXEH 4TYDA 1AVWA 2W26A 3K6YA 1O0DH 2BX3A 1SGRE 4NSYA 2V3HH 4Y71A 1Z71A 3M5OA 1DLEA 5EW1H 3VB5A 3SV8A 3H7OA 4O9VA 2BDCA 2RDLA 1YBWA 1GDQA 3E0PB 3MH4A 3UQVA 3LGVA 1YPHE 2EI8A 2QF5A 4JK5A 2UUYA 2FI4E 1GBTA 2RCEA 3F68H 1O2ZA 4O97A 1H8DH 5EGMA 1P05A 3GYMA 2VVUA 1L4ZA 2NU3E 2A4OA 1NY22 1BRCE 2QXJA 4IGDA 2BZAA 1Z6JH 4AB8A 2Y5HA 5I25A 1P10A 3FFGA 2GDEH 5AF9H 5EXMA 1FPCH 3UOUA 1IQGA 2Q6FA 3GCOA 1ZHPA 4YO9A 3S9AA 1N6YA 1QL7A 4OS2A 2F3CE 3UTUH 1O2LA 1UCYK 3G01A 5EJLA 2AFQB 1AKSA 2BY8X 2O8UA 1BQYA 2G51A 2TRMA 3WWFA 3VB6A 3ATKA 1AWHB 3M7TA 4GHQA 2ZDNA 1Z8IB 4JYTA 4FUHA 1NFUA 3EQ0H 4KTCA 2L6OA 2RG3A
chains in the Genus database with same CATH topology
1O5EH 2QXHA 4YOIA 4UE7H 2FI5E 1D3QB 1GHBF 1GI8B 2ZFFH 2BVRH 4K1TA 4R8TB 2QF3A 1O3FA 1IQLA 1TGNA 5T3HA 1K21H 3F6UH 2TGDA 4XOJA 1K1PA 4H42U 1RJXB 3RLYH 2Y5FA 1EPTA 5LPRA 2BYAX 4X8VH 2FM2A 2VVVA 1OWIA 1AIXH 4UFEH 1O3HA 3BEFB 2ZQ1A 3LT3A 3TH3H 1WTGH 1THPB 3MMGA 4I31A 4AZ2B 1YPLH 3Q77A 1LHGH 1EATA 1UVOA 1HAGE 1NU9A 3UOPA 4BTUB 2BZ6H 3QTVH 3SQHE 5IYTA 1ELTA 2H1UA 2PLXA 3GICB 2IN2A 5JYIA 1F7ZA 2GZ7A 1AMHA 3MOCA 4NIWA 5DP7A 4ZAEA 4DIHH 1YYY1 3MFJA 1P04A 1QQ4A 5F8TA 1WAYB 3M5NA 1XUJA 1GHXH 1L1JA 1QL8A 5E0HA 2FOMB 3SGQE 1GMHF 1H9IE 1GL0E 2PWXA 1F5LA 1VJ9U 4ZHLU 1SLVB 3KHVA 1GBAA 3NZIA 1AVGH 1E36B 2P3UB 4IN2A 1O5CB 1T4VH 1L4DA 3P6ZB 1E37B 3RDZA 2OBOA 2EA3A 3EBNA 1HYLA 1T31A 2BXUH 3A88A 4YESB 5F03A 3A7ZA 1EOJA 1AY6H 3SZNA 1FY3A 1TPOA 3TNSA 1C2IA 1EAIA 1ETTH 1J16A 4B75A 4DW2U 3MNSA 4I8JA 4BAMB 3MU8A 2QIQA 3ZVCA 1OYTH 1QBVH 4OS6A 7GCHG 1C1VH 1O2MA 1O30A 3QLPH 1V2PT 1DT2A 5ETXA 2BLOA 1C5YB 2HNTF 1A2CH 1MAXA 4DURA 2D8WA 2FXRA 2TBSA 1KLJH 2VNTA 1GI3A 3TJVA 1YCPK 3SU5A 3B9FH 1AB9C 1C2HA 2GMTB 5L30H 1ZRBA 1U6QA 1C5NH 1P01A 1XVMA 2WV5A 1PQ8A 1T8MA 2R0KA 2B0FA 2F9NA 2HNTC 4ABDA 4CRCA 1C1NA 3B8JA 1HIAB 1YP9A 2JETB 2VIDA 2PHBA 1ORFA 1HXFH 1MZDA 4BAQB 4GHTA 4CH2B 5JBCS 5DO4H 1TBZH 2QYIA 1C5QA 1TPAE 1MTNC 3PMAB 2PUQH 1HAXB 5DP3A 1KXCA 5J4SA 1TX7A 2LNCA 2Q6DA 2B8OH 4TWYA 1ESAA 4INLA 1D3PB 1TB6H 1CVWH 4CR9A 5E0GA 1MQ5A 3RXDA 1EOLA 4IMZA 1BJVA 1EB1H 4FUGA 2Y7ZA 1C2JA 2QAAA 3N7OA 1O36A 1BZXE 4TPYA 1GJAB 3BTHE 3OX7U 1SQOA 1EJNA 1Q3XA 2ZZUH 1LKAA 4ESTE 1EAUA 1IQFA 1JRTA 2ZPQA 1WUNH 1MBMA 3P8GA 3S7KB 4ASHA 1IQEA 2FLRH 2HRVA 1KYNA 1AFQC 3UUZA 3RXQA 2LPRA 1OOKB 5TJXA 1L0ZA 3STJA 4U30A 2G00A 1C2LA 3LGUA 3SU2A 3TITA 1QA0A 2UUFB 3ATWA 2ZDKA 1TNJA 1XUHA 4MDSA 4GAWA 3SNBA 2VB0A 2VINA 1M9UA 4K60A 5FBEA 1IQNA 1DPOA 4MTBA 4F49A 1QBOA 8GCHF 1DE7H 1VCWA 1C5PA 2A5IA 4JYVH 1KIGH 8ESTE 1AD8H 1QA7A 3GCHB 4WXVA 1ZSLA 2F9UA 3SU1A 1SHHB 3K2UA 1F0UA 4NA7A 5AVDA 2PW8H 1TOCB 4Y10E 4HZHA 3ELAH 4B1TA 2QY0B 3PO1B 4WMEA 3KN2A 2NWNA 2HLCA 4YLQH 1LVOA 3LGTA 3VEQB 2TGTA 2BLQA 1GBEA 2O8WA 1CHOG 2BDGA 2AIQA 1TGCA 1GI2A 1K22H 2W7UA 1SGPE 4K5ZA 4HTCH 1DICA 4WWYA 2Z9LA 1Y3WA 1KXDA 1MD8A 2C4FH 2H5DA 1UHBB 5DP9A 4A1XA 1O2IA 3VB7A 4B76A 3GYLB 3LC5A 4UD9H 5HM2A 5JPMH 3D49H 2XC0A 5A09A 1V2NT 2ANWA 4X6MA 1HAOH 2G52A 1LHEH 1K1LA 1KTSB 2ZFQH 2P3TB 3HPTB 1DY9A 3QN7A 3U1IB 3EE0B 1SOZA 3KCGH 4ABEA 2O8TA 5T6GA 1P3EA 2ZFTA 3RXPA 1AZZA 2DE8A 4ISHH 3I29A 1RD3B 1OWKA 3KQDA 4DCDA 1W8BH 2P95A 5HGGA 2BOKA 1EZQA 1PQ5A 2Z7FE 1OS8A 1VJAU 4JZFH 4KKDA 1L2EA 3PYHA 2J92A 1OSSA 5EG4A 2Z6BD 1S83A 3UY9A 3RP2A 1DFPA 3LGWA 3SJKA 1NFXA 4GCHF 1SGDE 4BNRA 1TMTH 2FI3E 3BTME 1EP6A 4BTIB 2XC4A 4UDWH 2D26C 3U69H 1G30B 5E0JA 3UFAA 2Z9IA 2ZFPH 2WINI 4H4FA 4HGCA 2WPHS 5LGOA 2O8MA 3UNQA 3RXMA 2FOBA 3T29A 4X6OA 3RXTA 2ZO3H 1PPCE 2ANMH 2GTBA 1PYTD 1YLCA 4ABFA 1YLDA 3A83A 4YOGA 3S69A 1GMDG 2QCYA 1Y59T 2IOTA 1MH0A 2JH6D 1O5GH 3RUOA 3UR6A 4BAOB 4ZKSU 2BHGA 1O35A 5GCHG 1P3CA 4F4OC 1PPZA 1C9PA 2J94A 3QWCH 4XFQA 3BTQE 3I78A 1W7GH 2K1QA 1XUKA 1P57B 2BLVA 1MD7A 1V2LT 1HAYB 1EJAA 2GV7A 3FVFB 3A7VA 5LPFA 2XW9A 1F2SE 3NK8A 2AIPA 1HBTH 1TABE 8LPRA 1G2LA 1O3AA 2XNIA 2WPIS 3QGJA 3AAUA 4MNVA 3BEIB 1UCYE 2ZDMA 4BAHB 1Y8TA 4JCNA 2BY7X 3SU3A 4H6TA 1AO5A 1O2SA 3GY3A 2Z9KA 1CGJE 3C27B 3GCNA 5LH8A 1TWXB 3SV9A 2WPJS 1JXPA 1O37A 1AE8H 5EW2H 1DDJA 1NFYA 1KLIH 1S81A 2SGDE 5F8XA 2Z3CA 1ZHMA 1RRKA 3URDA 1T8LA 1P9SA 4ZROA 2BD3A 3BTDE 2A4RA 3KNXA 3BIVH 2FTLE 4FUDA 1AUJA 2YNBA 4LXBH 3BN9A 1VITH 2W5EA 5HMAA 2C8ZB 2TGPZ 1A7SA 3DD2H 2FOAA 2ZP0H 1MAYA 2R3YA 3MYWA 3EAJA 2HVXA 2R9PA 5E8EH 1SQTA 3RXEA 1QL9A 5AFYH 1HIAA 3SQEE 1OP2A 1C5XB 1SB1H 1NPMA 2Y6TA 1T32A 1FMGA 2GKVE 1ETRH 1GJ6A 2BVXH 3P8NA 1K1IA 3K65B 1EZXC 3MO3A 4ZHMU 1W10U 2GMTC 4FUFA 1SG8B 4I32A 5HM9A 2ZF0H 4NIXA 3UQOA 4AOQA 1O34A 1SLXB 9LPRA 2JETC 2PGBB 1Z1IA 1GGDB 3PV4A 3BIUH 1OKXA 1PFXC 2P8OC 1O3IA 5C1UA 1O2UA 1UTQA 3NUMA 1EXFA 4FXGH 1BIOA 1D3DB 3D23A 1O2TA 1CT4E 3A80A 1BBRK 1YKTA 2CMYA 1UK4A 2GZ8A 3BTFE 3MU4A 3TGIE 2BTCE 4LZ4B 3E1XB 4NA9H 1MTVA 1XMNB 1TFXA 2H9TH 1YPKH 1OWHA 1P2MA 1ANBA 1W3CA 3M5MA 2G81E 1Y5UT 3U9AH 2ZG0H 3NPSA 1YCPM 4CREA 9ESTA 3CS7A 1MBQA 1O5FH 2F83A 1BTXA 1SGIB 5DP8A 1CBWB 1IHSH 3PTNA 1V2QT 1QQUA 3SV2H 3SUGA 1AZ8A 4E05H 2VH6A 2ZTZA 1BT7A 5G4BA 3SNCA 2ZDLA 1UCYH 1W13U 2HNTE 4PROA 4WJG2 4AN7A 1E38B 1FIZA 1LHCH 2ZCHP 3EA9A 1LHFH 4YM9A 1P2IA 2FIRH 3ODDA 1ZHRA 1ZR0A 4NA8A 4X8UH 5FBIA 1TGBA 1FLEE 2P16A 2B7DH 1C5VA 2O8LA 1CGIE 2NU1E 3A7XA 3MH5A 3QZQA 4B73A 5DKMA 3RXHA 3SI3H 4UFDH 1E0FD 3PO1C 3FZZA 1G37A 2SGEE 1YGCH 4ABHA 1BOQA 1IQMA 1UHBA 4X1PU 2FESH 1C5UA 1PQ7A 5GJ4B 4AYVB 1QB9A 3C1KA 4CRBA 4ZKNU 2Z9JA 1A1RA 1TBQH 2RA0A 3MU1A 2BY6X 2BM2A 1ANCA 2SNWA 4CRAA 2OQ5A 3AW0A 1J15A 1DWCH 2F9OA 3S0NA 5EOKA 4X6PA 1C2MA 1ELEE 2ALVA 4HI3A 2H9EH 2C3SA 4ISOA 1UO6A 3F9FA 2YOLA 1O3NA 1BCUH 4M7GA 1S6HA 2OC7A 2AYWA 1TX8A 1X7AC 1VZQH 2C8YB 1O2WA 3ZVFA 1LHDH 1P2QA 3BSQA 3S9CA 2G4TA 1IQIA 1ELVA 2CF8H 1TBRH 1IHTH 1NU7B 1ETSH 5DP5A 4CR5A 2Z3DA 3SJ9A 1BHXB 4SGBE 5TCAA 2A1DB 3RXOA 2BD5A 4FUJA 4D8NA 3JZ1B 1K2I1 4X1SU 1W0ZU 1SC8U 1ZJKA 1GBFA 1XM1A 3KQEA 1FV9A 2ZU2A 2ZWLH 1ANDA 1MTWA 4CHAB 3TGJE 3SI4H 3ZYEA 1DX5M 1GMCG 3RMMH 3S7HB 1QJ7B 4X2XA 1DOJA 1FIWA 1HJ8A 2WYGA 4DG4A 1V2WT 1E34B 6GCHG 1CSOE 5EU8A 5F6MA 4WY3A 3QGNB 5GWZA 1FNIA 1DWEH 1HJAB 1O38A 2CXVA 1PYTC 3BEUA 2CN0H 2H6MA 1Z8JB 3W95A 1GBLA 2ULLA 1SSXA 4FUBA 6CHAB 1QNJA 3V7TA 1P09A 1S0RA 1YCPH 2GT8A 3SV7A 1THRH 2ILNA 4NIYA 1UJ1A 1MKWK 1MQ6A 1QHRB 3FZDA 2TGAA 1QRZA 8KME2 4IMQA 1P03A 1V2ST 1PPHE 2OBQA 1BTPA 1ABJH 4AFQA 3ZYDA 1ZMLA 3KF2A 1B7XB 4AGKA 2B9LA 1H4WA 2J38A 3PM3A 5JBBS 3MNCA 3HKJB 1JWTA 1CQQA 3RU4T 4X2WA 3D65E 1ZMJA 3UNSA 5C5OA 1BMNH 1ELAA 1O3KA 1GVLA 1KTTB 5J4QA 3RXVA 2ZU3A 1K1JA 2AGGX 3ZZ6A 1VCQA 1O2XA 3T28A 6ESTA 1KSNA 3ZZ4A 3PTBA 1CA0B 1V2JT 2UWLA 3EA8A 1QRXA 4WXIA 3TJOA 4NGAH 4IS5A 1C5SA 3M61U 2FS9A 2G4UA 1GBCA 2PKAB 1DXPA 3EGKH 3TLOA 1XKAC 3BF6H 3GY2A 2XXLA 1V2TT 2J34A 1RTKA 2M5TA 1GBMA 2ZPSA 3CENA 1N6XA 3SGBE 2ZTXA 2ANKH 2FP7B 4AFUA 3PMJA 1C2GA 4A5TS 1SL3A 1TQ0B 3Q3YA 1UVUH 2R3UA 2AH4X 1F5RA 3RXIA 3PWBA 1SGTA 3DFLA 3P8FA 2BD7A 5CE1A 1V2RT 3AVZA 3QZRA 1IAUA 3T62A 1O3PB 1CT0E 3T2NA 1HAVA 2BB4A 4CRFA 1BRUP 2BD8A 4DGJA 1KLTA 1AFEH 1C4U2 1CHGA 2BMGB 2P93A 1NRPH 3RU4D 2Y80A 4Y76A 1UTLM 4AGJA 1GPZA 2F9VA 4X6NA 1PQAA 1SGCA 1O3OA 3L6PA 1GBKA 2HWLB 1FY4A 1GGDC 5EQQA 2JH0D 4KGAA 2FOGA 1P2OA 3ZVBA 4D9RA 2J9NA 2WV4A 1EB2A 1JIRA 3S9BA 1MUEB 3K6ZA 1MCTA 1NO9H 1CE5A 1EP5A 3DT0H 3PLBA 1BJUA 1W14U 4Y0YE 1UTMA 1HLTH 2A32A 1MCVA 2FS8A 3DUXH 3ZZAA 1CU1A 3RU4E 1A5GH 1PPFE 3TK5A 1GBJA 1O2YA 2Y81A 2V6NA 2VIPA 1RTFB 3R0FA 4WMDA 3TJUA 1AHTH 2I6SA 2ZTYA 1CBWC 1N8OC 1ZTKA 2ZCKP 3GISB 3TH4H 2GD4B 2WUBA 5TCCA 3A84A 2OINA 2B5TB 2XBYA 3UPEA 3GY6A 4DY7B 1O2JA 5C1XA 4NSVA 3ATLA 4CRDA 2THFB 7GCHF 1HPGA 1BTZA 3SORA 1DANH 2GDDA 4WVPE 1G3EA 4B2CA 1BMAA 3UR9A 3VXFH 1UK2A 1O5BB 1VGCB 3SU6A 3HKIB 3EDXB 3Q3XA 1PPBH 1YPHC 3NWUA 1PJPA 4Y7BA 3OTJE 2FLBH 2G5NA 2FODA 5PTPA 1BB0B 3BG4B 2ZNKH 2J4IA 3SJOA 3E6PH 3LIWA 1UVTH 2ZKSA 3DA9B 1O2RA 1KXBA 1LVBA 1TNHA 2CJIA 2XYAA 4Q7XA 3V13A 1Z7KA 4X1QU 5DP4A 4INHA 1FY1A 3PWCA 4IBLH 1GJ5H 2FYQA 2GP9B 1YPGH 1A0HB 2STBE 1BBRE 4NFFA 3RMLH 3URCA 5K0HA 1G3DA 1NTPA 1LPZB 4MPWA 1TE0A 1Y3XA 1O2VA 1WCZA 3SNAA 3SUEA 1JOUB 4JZIA 4MPXA 1C1OA 2VGCB 1SOTA 4ISNA 2SGQE 1NS3A 1SGFG 2ZU1A 7KMEH 3GDSA 1EAWA 3UREA 1ZTJA 3MU5A 1HDTH 1HJ9A 5DGJA 5C1YA 4MQAA 1TRYA 1BITA 3IWMA 1BHXF 3IG6B 1HXEH 2ZIQH 3ITIA 2J95A 2CV3A 1NRRH 2A0QB 4MPUA 4Q80A 3MH6A 3RC4A 2R2MB 4YZUA 1BTUA 1XXDA 2FYRA 4CH8B 1GDNA 3KQBA 2BD4A 4Q7YA 2A4GA 3D62A 1C2KA 1GL1A 5EQSA 5DK1A 3STIA 5DPAA 5FPSA 1GG6B 2VWNA 3NKKA 3R3GB 1A3EH 1AU8A 3M7QA 4FVDA 4YTAA 4MNWA 2FTMA 1GI9B 4CHAC 1GCDA 3KGPA 4INKA 2H2ZA 2UWPA 1FPHH 1V2KT 2P94A 3MO9A 1QJ1B 3TNTA 3F9GA 1FN6A 3RXBA 3OSYA 1ESBA 2FPZA 4X1NU 5H4IB 1TAWA 3SJ8A 2QN5T 1UVSH