2Z9GA

Complex structure of sars-cov 3c-like protease with pma
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Structural basis of mercury- and zinc-conjugated complexes as SARS-CoV 3C-like protease inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
total genus 83
structure length 306
sequence length 306
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2z9gA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2z9gA02
1SHYA 2GTBA 1VR1H 1ABJH 1YCPK 3LJOA 3L33A 3U8TH 4J2YB 4ISNA 2JETC 3TJVA 3Q3XA 1TIOA 4BANB 1Q2WA 2FOHA 1BRCE 2AYWA 3BTQE 1CHOG 1BHXF 1DPOA 3OSYA 1W2KH 3MYWA 1CA8B 2WV4A 4MNVA 1XUJA 2BY5X 1DX5M 4HFPB 4XDEA 1ZGIA 2JH6D 1WAYB 3KEEA 1GG6B 1O3MA 4GHTA 1KLIH 1QL8A 1GBBA 3RC5A 3RU4T 1VITH 1O31A 1D3QB 2V3OH 2K7XA 1GVZA 4DGJA 4B2AA 5ETXA 4YT6H 1P2NA 1CGJE 2QYIA 1JOUB 5EG4A 1PPCE 1H4WA 4H6TA 1ZTLA 1D9IA 1TALA 1C1OA 3RMMH 1TBZH 1A7SA 1HAPH 2CJIA 4MPXA 2BDAA 2BZ6H 3STJA 4BXWA 4AYVB 3A7TA 4CRBA 1HAOH 1BTZA 1GHBG 3MO9A 2BLOA 2VWNA 1BMMH 3L6PA 3A89A 1H9HE 2ZU1A 3A7VA 2A7CA 1F5LA 4AX9H 1UTQA 1K22H 5AFYH 4XFQA 1C5RA 1DWBH 4INHA 3TNTA 2PW8H 2C8YB 1GJBB 3BTFE 8GCHF 1GI9B 1C1NA 4HTCH 4FUHA 3UNSA 3PWCA 1EJMA 2TPIZ 1SFQB 5DP9A 4UD9H 4E7RG 1L1GA 5EXNA 1QL9A 2A5AA 4Z0KA 2H5CA 1YF4A 3PLKA 3OTJE 1Y3YA 5DKMA 4JZIA 2OP9A 2ZG0H 1ZMJA 2ZDAH 1QY6A 2RA3A 2ZGCA 4B74A 5BPEA 1GBTA 4Y79A 4ZMAH 4HGCA 2VIDA 3VB6A 1HAVB 1TOMH 4WVPE 1THSH 3F9GA 1IQJA 3T5FH 4A6LA 1OWDA 8KME2 1MU6B 5AVDA 5DP4A 5HGGA 1P57B 1O2WA 2P3TB 3SJKA 3SU4A 1SLWB 3BN9A 4TPIZ 3TK6A 4H42U 1B5GH 5ESBA 2BHGA 1FNIA 1Y3WA 3O8RA 1GJAB 1S84A 2FLRH 2VVVA 1O3NA 2FI3E 1WCZA 1SGNE 1HIAB 1GI5A 3BF6H 1O3EA 1IHSH 3D65E 5A8XA 2H2ZA 4IS5A 2AEIH 3A8AA 1JIMA 3JZ1B 3TJUA 4UFEH 2QXHA 3GDSA 1TGCA 4CRDA 3ATMA 2D1JA 3RXTA 4X1SU 1AFQB 1UTMA 1GDNA 4X6MA 4ZKOU 2C8WB 1K1IA 1V2LT 1C2JA 2C8ZB 3ZVEA 1SPJA 4FUFA 1TGTA 1GMCF 1AKSA 4QT8C 2XNIA 1XMNB 2ZGHA 4INLA 2HOBA 3MH6A 1P0SH 2V0BA 5C2ZA 1WV7H 2JETB 1S82A 4WY3A 4ABEA 1IQHA 1NPMA 4RN6A 3TU7H 3D49H 1P2OA 3NPSA 2NU2E 2OC1A 1UVUH 2HLCA 5TCAA 4UFFH 3RXOA 1O38A 4CRCA 4MNXA 5C5OA 1ELCA 1P2IA 5AFZH 4DOQA 1NN6A 2Z9KA 5DP5A 5E8EH 4DW2U 4ABAA 3VFEA 3V12A 3SJ9A 2BDYA 4FUCA 1S6HA 2FX6A 1DFPA 1GJ4H 1O37A 1XKAC 1P9SA 1JWTA 2ZA5A 2JH0D 4K8YA 3DHKH 1KDQA 3SUEA 1O5AB 2C8XB 1UHBB 1K28D 4ABFA 2Q1JA 4Y8ZA 1NRNH 1CBWC 3RXQA 1K1PA 1O2JA 5DP3A 2BX4A 3VB4A 1EX3A 1VGCC 1P3EA 1GBHA 1BTHH 3M61U 1CSOE 2ZPQA 1Z7KA 1FLEE 1IOEA 4X2VA 1DSTA 1O2TA 3CS7A 3U8OH 4I8GA 2V3HH 1PJPA 5FPTA 5GDSH 1ZPCA 8ESTE 3PLPA 1A0JA 3C1KA 1TNHA 2QGRA 4KP0A 1SVPA 3P70B 4ZH8A 3FZDA 1THRH 2W3IA 3LIWA 3A88A 3SBKA 2EI8A 5EW1H 1DOJA 4U32A 3OU0A 2G4TA 6GCHF 3TPIZ 2GD4B 1PYTD 2P3FH 5EXLA 1T8LA 1EJNA 3H7OA 2WV5A 4Y7BA 1C2DA 1PQ8A 3F68H 2I6SA 3A80A 2TRMA 4CREA 3GCTG 1A5HA 1C2HA 2ODQA 1HAGE 4OS2A 1EXFA 4BTTB 1ZSKA 1Z6EA 3ZZ8A 3GOVB 1GJDB 1TLDA 1AUJA 3SU0A 1GI2A 1HPGA 2F91A 1MH0A 3AAVA 5EW2H 5PTPA 5E2OA 1MD8A 1SI5H 1C5OH 1OSSA 2KAIA 1P05A 1A3EH 1ANCA 1D3TB 4FUGA 4OS6A 1FZZA 2QF0A 1CHOF 1UMAH 1ABIH 5A0AE 2G4UA 1ZTKA 1P11E 3M7TA 4Q7XA 2OUAA 3FZZA 4DVAU 4K69A 2BD2A 1WTHD 3R0FA 3ZVCA 3W94A 3QDZB 1FPCH 3TGJE 2EI7A 1G37A 2BMGB 1BBRE 1MKWK 2FZZA 2HNTE 2OQUA 3OY6U 3ITIA 5TJXA 1NRSH 1AMHA 4UE7H 2F83A 3HK6B 2BD7A 4WXIA 3SOSA 1Y5BT 3BTGE 1ELBA 3MU1A 4MNYA 1O3KA 4A5TS 3A81A 1ETTH 1SBWA 2HALA 2HRVA 4XOJA 5CE1A 2PUXB 1AD8H 5FCRA 4HZHA 3NZIA 1C5WB 1J15A 1OWJA 1QRZA 2FI4E 1LVBA 5LPRA 4PROA 2OCVB 4NFEA 1Q31A 1ELTA 3BTWE 1GPZA 1OOKB 1ZSLA 2ZFTA 5DK1A 3RMOH 1SGEE 3M37A 1TPOA 2IOTA 3MU0A 2Y5HA 1MKWH 1TRMA 3SV8A 3TH2H 4AFQA 1PPEE 4LOYH 1W0YH 1GI4A 4DURA 3K6YA 3VB3A 1GCDA 1W0ZU 5JB8S 1C2MA 1UK4A 2HGTH 1A4WH 2FOFA 2SGAA 1YGCH 2ZCKP 2ZFFH 5JYIA 5LH8A 1C1RA 1MUEB 1GBEA 4KELA 1HJAC 4ZUHA 4ZXYH 2G8TA 5DJ7A 1AN1E 1O2ZA 5GIBA 1UVSH 1QB1A 3I78A 2XRCA 2ESTE 3UTUH 3LGWA 1ZR0A 5E2PA 1BTPA 1GHYH 1KXCA 5HMAA 3URDA 3MH5A 4YM9A 3SQHE 3EBNA 1DDJA 5EODA 1ORFA 3F9HA 3AAUA 1S0RA 3B23B 3SV9A 5EQSA 5A0CA 3ODFA 2J9NA 4IW4E 1O34A 4ISHH 1C5MD 3UFAA 4IN1A 1G30B 1J17T 2QCYA 3AVZA 2BVRH 4IBLH 1CBWB 5FAHA 4CR5A 4AB9A 1VGCB 5F6MA 3FANA 1LVMA 1C5TA 4K1TA 3VXFH 1T32A 2BX3A 2D8WA 2BQ6B 1O2OA 3STIA 1MMJN 2BM2A 1Y59T 1JMOH 2Y82A 4E06H 3TJNA 1LHFH 4D9QA 1O2GH 1C1UH 1UK3A 4X1QU 1SQOA 5C3NA 3T2NA 2AMQA 1ESTA 4NA7A 2DE8A 3RXIA 4BAQB 2FODA 1CQQA 1W12U 1PFXC 1GBIA 4NIWA 4X1PU 1HAZB 1GBMA 1DWDH 2ZTZA 1KTTB 2C93B 4YESB 2FYRA 1NU9A 4I7YH 1EATA 4ABDA 3MFJA 1KXFA 4K2YA 2TGDA 5DPAA 4CHAC 2FXRA 1HAHH 2F3CE 2TGAA 3K6ZA 4TY7A 1KIGH 3RXPA 2ALVA 1C2FA 3F9FA 5LGOA 1VZQH 1QFKH 2ZCLP 1UTOA 5C67A 2EI6A 1BTWA 2BXUH 3SN8A 2PGBB 1XVOA 2ANKH 3UQOA 4XBDA 4KTSA 1O2VA 1WSSH 1EZUC 4JCNA 4FUJA 3E0NB 2F9NA 1O3OA 1UTJA 2AGEX 2VIQA 3QGNB 2AMPA 1B0FA 2GDEH 1EP6A 2ZIQH 2ZPRA 3P8FA 4TWYA 3Q3KA 2F9VA 3A84A 3UOPA 3VB5A 4YOIA 1QQUA 2GT8A 2ZDMA 3ZYDA 3FP7E 1YC0A 2FPZA 2HNTC 4M7GA 1OWIA 4MLFB 2PLXA 3U8RH 3B9FH 3PWBA 2J92A 1GHXH 1ZYOA 2O9QA 2CF8H 2XWAA 3ELAH 1C5QA 1ZGVA 1SC8U 2Z9GA 4B73A 1QJ1B 2A5KA 1ZSJA 5FCKA 4R0IA 1D3DB 1CGHA 4JK6A 3U9AH 2C3SA 1DSUA 1A46H 1C1QA 2VH0A 3ATWA 4FU8A 1WUNH 3S69A 2FYQA 5TCCA 1QJ7B 1SLXB 3P8GA 3A7YA 5DP8A 1KYNA 1DS2E 3GCOA 2BTCE 2AGGX 1O3GA 3LOXA 2W7SA 3RXJA 2Z9IA 2A4RA 1YP9A 3KL6A 5GWZA 2UUKB 3ESTA 1OYTH 1YPMH 4IGDA 1YPHE 2Y80A 1CGIE 1QNJA 4DCDA 1HJAB 1IHTH 3SU6A 4NSYA 2ZGJA 1BQYA 3NCLA 1AE5A 3RXMA 1K21H 7KMEH 1GJ7B 4XSKU 2QN5T 2QIQA 1GBDA 3AW1A 1GHAF 5K7RA 3RXGA 1EZSC 1F0UA 2HPQH 2WYJA 4BXSA 1LHEH 1TQ7B 2BY8X 1T8NA 2F9BH 1P01A 2ZF0H 2GV6A 1MTVA 2VVCA 4WH8A 2SGDE 4AZ2B 2OXSA 3C27B 1MBQA 1MQ6A 3TH3H 4Y10E 1AB9B 1GBLA 4FU9A 2XC5A 5GCHF 4YTAA 2GV7A 2KAIB 2ZWLH 1IQNA 1C5PA 2THFB 4TY6A 2EEKA 2WUBA 1Y3UA 1FAXA 3BEUA 4H6SB 3P95A 3UOUA 3HATH 2FS9A 2TIOA 4X1RU 3S7KB 4RKOB 2ZFQH 3I77A 2ZDKA 3TGKE 1ZPBA 1S83A 1Z71A 1GL1A 1K1NA 1RFNA 2GCTC 1PPFE 1P2KA 1TYNA 1ANBA 5CMXH 1YPJH 1NRPH 2Z3EA 5B6OA 1SGCA 1WQVH 5T3HA 3MNCA 1H9IE 1TE0A 3SNCA 3GY2A 2DUCA 4X1NU 3OYPA 5FX6A 3A8DA 4CHAB 3AASA 5IYTA 1SGFG 1UCYE 1EZQA 2STAE 1C5LH 5I25A 5C1UA 1K1OA 1QL7A 1BMAA 3P92A 1EJAA 2B0FA 2JH5D 2VIPA 3GY3A 1O3BA 3ZV9A 1BJVA 1DVAH 3E16B 5EPYA 4WMFA 1C9TA 2FS8A 2ODYB 2ALPA 1UVOA 2R2MB 1DICA 1SSXA 2SGFE 2CF9H 1GBAA 1TNIA 2W26A 3S9BA 2CXVA 1HV7A 2BLQA 3FP8E 3MU8A 5G4BA 3QGJA 1NTPA 2VGCC 3GISB 1MCVA 4OS7A 2Q6FA 1UTLM 1LHCH 2O8TA 2GX4A 2W5EA 4RSPA 2A31A 3RXCA 3WY8A 1BTYA 1FUJA 3MO3A 3HKIB 1YKTA 1XXDA 2B8OH 2K1QA 5FX5A 2CMYA 1LKAA 2GCHG 2BXTH 2ZZUH 2A4GA 1ZMNA 3UR6A 2FO9A 1QA7A 2WINI 4D8NA 1MTUA 4BAMB 2RDLA 3ZVGA 2Z3DA 1DE7H 3SJOA 2GT7A 1RIWC 1BUIA 3A83A 1P09A 4JZEH 4U30A 2NU0E 2Y6TA 1C5XB 2F9UA 2FP7B 1O39A 1TONA 3MNXA 1WU1A 3ENSB 1QIXB 2A4OA 4GSOA 3BG8A 1IQGA 4AG1A 1E34B 1S6FA 1XUKA 3EYDA 2BQWB 1C2KA 3ZVDA 1YPLH 4ASHA 1RS0A 1RTFB 4AFZA 1HNEE 1WTGH 1GJ8B 2LNCA 1FAKH 1D4PB 2ZGBH 1F5KU 1EPTA 5L2YH 2SNWA 1EOJA 4GPGA 3SU3A 1YYY1 2W3KA 1C5NH 1BMLA 1KXDA 5LPFA 2PKAA 4Y71A 3PMAB 1YPHC 5F03A 3A8BA 4B1TA 3PMBB 2FDAA 1F7ZA 4Q7ZA 1EOLA 1LPKB 1FPHH 1IQIA 4JZ1A 1H8IH 1IQKA 1D6RA 4ZKSU 7GCHG 2J95A 1K1LA 3S7HB 1ARBA 1SOZA 4I8LA 4ZROA 1MKXK 1MZDA 1Z8JB 1CU1A 1O2LA 3SHCH 3LGVA 2A0QB 4NIYA 1XXFA 4MPUA 4FUDA 1O0DH 3DFLA 2BD3A 2VJ1A 3ODDA 4FVBA 1GJ6A 2B7DH 2O8UA 1W7GH 2XBVA 2M5TA 2ULLA 3GY7A 1QCPA 2PR3A 3ZZDA 1DLKB 3SV2H 3EAJA 1HJ8A 2B9LA 4A92A 1G3CA 3NKKA 1E35B 4NA9H 3SW2B 1VCWA 3GYLB 2BD8A 2BDBA 2J38A 3E1XB 2FOBA 3EQ0H 2BD5A 3QLPH 1KXBA 3BV9B 2BDGA 2J2UA 2QXIA 2GCTB 1OPHB 3RC4A 1C2LA 1HDTH 4YT7H 2FESH 1HB0B 1YPGH 4DY7B 1V2PT 2GDDA 3LGIA 4DJZB 5JBCS 2P8OC 1HRTH 4YOGA 1MKXH 2UUFB 1BRBE 1O3JA 1N6XA 2AH4X 3E90B 1TNGA 2H9EH 2VIVA 1MTNC 1EAWA 2G81E 2ZEBA 2SFAA 1VITF 1MU8B 3BG4C 4Q7YA 1OKXA 2FX4A 1AE8H 2AIQA 2I6QA 2SNVA 3HGNA 4AGKA 4B76A 1J9CH 2PGQB 1CT4E 2A1DB 1OP0A 2FOAA 2P94A 1EP5A 7LPRA 5E0JA 2G51A 4AORA 1SGDE 1C2EA 1TGSZ 3SNBA 3A85A 4GCHG 3Q76A 3RLYH 1LVOA 2UWPA 1FY3A 1TGNA 4X2XA 3PO1C 1SB1H 2VGCB 4BAKB 5EQRA 2H1UA 1NY22 1ZJKA 1GMDG 1S85A 5GJ4B 1T4UH 1ARCA 3SZNA 2EC9H 2PKSC 1S81A 4JZDH 1Z8IB 2P16A 2GKVE 4GVUA 1O2XA 2ZQ2A 3L3TA 2STBE 1LO6A 1XX9A 1AVWA 1O5FH 2R2WU 3GYMA 2ZHEH 4XE4A 1MQ5A 1PPZA 4AGJA 4JYVH 3E91A 3B8JA 4X6PA 2Y5GA 3MH7A 2G00A 1RIWB 2BB4A 6LPRA 1AGJA 4ABBA 3QZQA 1MAYA 1W3CA 1C4Y2 1V2OT 3KF2A 4ABIA 1CA0C 1IQEA 2ZGXH 3NUMA 4UDWH 1UVTH 4ZXXH 3PTNA 2O8MA 2OTVA 3O8BA 1L2EA 1AO5A 5DGJA 3QUMP 2ANWA 5EGMA 3SQEE 1JXPA 3NXPA 1THPB 3PROA 2RG3A 1H9LB 3Q00A 4WF8A 3M7UA 1GHZA 3S9CA 4DG4A 5DP7A 2SGQE 3DT0H 3KGPA 4BAOB 1OWEA 1TQ0B 3S0NA 1LHDH 2ZU4A 1XVMA 3R3GB 3ATKA 3RM2H 4I8HA 1LMWB 1SLVB 2VH6A 4HI3A 3GDUA 4AG2A 4H4FA 2G55A 1Z1JA 1FN6A 4CBNA 2ZFPH 1BB0B 4GLYA 5EQQA 1TBRH 1AHTH 1CHGA 1GI6A 2Y7ZA 1GHBF 4A7IB 3S9AA 4K1EA 4Y8XA 1O2RA 2XYAA 2IPHA 1FY4A 2FM2A 2AS9A 3SNAA 1H8DH 3LT3A 4NGAH 4X8TH 3RXVA 1W8BH 2BDCA 1TNLA 1ZLRA 1SGFA 2F9OA 4NA8A 1VJAU 1AQ7A 5T6FA 1KY9A 4I31A 2LPRA 1ZZZA 3RXLA 4BTUB 1NU7B 1TNJA 1BHXB 1FJSA 1GHVH 1JBUH 3PYHA 4FXGH 1QGFA 2FTMA 3GY4A 3VEQB 3UREA 4X6NA 2H9HA 4ISIH 3K65B 3UQVA 3U98H 3URCA 3M36A 4IMQA 1G2MA 1C1WH 1PYTC 2UUYA 1RD3B 1O5DH 4K8BA 5HM9A 2P8OB 1BRAA 1HAYB 1DUAA 3SJ8A 1KLJH 3RU4D 2Z9LA 2ZCHP 1MTNB 5CHAC 2VU8E 4KGAA 2BVXH 4MVNA 1FY8E 2ODPA 1AB9C 3BG4B 3QZRA 2TGTA 1V2MT 2ZU3A 1TOCB 1EAXA 4JK5A 4FU7A 2VWLA 2XBYA 3F9EA 2ZKSA 3Q77A 3U69H 3TK5A 1QHRB 3IG6B 5JBBS 4ABJA 2PSXA 1NRQH 3BEIB 2A5IA 1HJ9A 4BNRA 1DY9A 1O5GH 4CR9A 3PO1B 1C2IA 1UTPA 2G5VA 1HAVA 1Y8TA 1HCGA 4CH8B 8GCHG 5A8YA 1LPZB 4K60A 7GCHF 2CHAC 2PKSB 1O3HA 4JZFH 4Y8YA 3RXUA 2GMTB 1Y3XA 6CHAC 4K3JA 1J14A 1GBKA 1FDPA 2BD4A 3MU4A 1C1TA 4X2YA 2ZFRH 1V2WT 4I33A 5FPYA 3IITA 4D7FA 2G52A 5C5NA 4Y76A 1GVLA 2WPMS 4IC5A 1CA0B 5BRRE 4LK4A 1IAUA 2OBOA 3O8CA 5HXFA 3PMJA 1SOTA 4X8SH 1SGPE 4DIIH 2OINA 1AKSB 3QK1A 2H9TH 4XBBA 2QC2A 1Z1IA 1SGQE 1OXGA 2BVSH 3VPKA 1LPGB 1ZPZA 1HXEH 2ZU2A 1E37B 1GVKB 4MG3A 3P17H 2PSYA 4Y0YE 1QBOA 3RLWH 4ISLA 1L4ZA 1LQEA 4ZAEA 3ZZBA 3MNSA 2VWMA 2SGEE 1XUIA 4YOJA 1HXFH 2FIRH 4NZLA 2WYGA 2XXLA 1ZJDA 5AHGH 5T6DA 1GI7B 3P6ZB 1GCTC 1TBQH 3GY6A 3RXBA 5I46H 2QXGA 1ELVA 1C2GA 4D9RA 1ZHPA 2A32A 1BOQA 1DLEA 1QBNA 4GCHF 3ZZ6A 2Z9JA 1C9PA 4TPYA 3GICB 1O2SA 1FN8A 1KDQB 1PPGE 3M7QA 1O30A 2OLGA 2ANMH 2P3UB 3V3MA 1UHBA 3V13A 5A8ZA 3SNDA 1TX8A 1C5VA 2ZQ1A 4FUEA 5JB9S 1SGYE 3DD2H 1DWEH 3GCTF 4UFGH 3TK9A 3LGUA 3QX5H 3RXAA 5JPMH 2Y5FA 3RXFA 5FBIA 1QQ4A 1PPBH 1CT2E 2WUCA 1HAXB 1WYKA 2Y7XA 1C5ZB 1T8MA 1V3XA 1T31A 2R3UA 1O36A 4Y11E 5GPIB 2NWNA 2XCNA 1BJUA 1TABE 2ZDVH 3BTTE 3I29A 1AIXH 5IDKA 2BOKA 1FV9A 2BDHA 3NWUA 1BT7A 1GGDB 3EA7A 1AWHB 3QN7A 1S5SA 1BRUP 1QA0A 3SI4H 1J16A 1SL3A 3F1SB 2ZHFH 2Y81A 1NFYA 3E0PB 5CHAB 2A4QA 4UEHH 1RTKA 1NS3A 2AMDA 1BTXA 3ZV8A 1EAIA 2IN2A 2Q6GA 3E3TA 1YLCA 3T27A 1P03A 4I32A 1O3FA 4SGAE 3GDVA 3TH4H 3G01A 2JKHA 4GHQA 4F49A 1BMNH 3T26A 4ZKRU 1QR3E 5F8XA 1TFXA 5EXMA 1Z8RA 2J34A 4NWKA 1A1RA 4OGYA 3ZZ5A 2A7HA 1FY1A 4OS4A 2D2DA 1TA2A 3UUZA 1AVXA 1DUEA 1YPEH 2CN0H 4O3UA 2BOHB 1FONA 1C1MA 3KQDA 4K1SA 3Q3YA 3MNBA 1U6QA 1UK2A 2RCEA 3H7TA 5FXLA 2CHAB 2QY0B 1SG8B 1JRTA 1GI0A 3HPTB 1ID5H 1PQAA 3LU9B 3VXEH 1O2KA 2NU4E 1RTLA 6CHAB 1G2LA 1ETRH 1FI8A 1MZAA 4MNWA 4KTUA 3W95A 1V2TT 4NSVA 4R8TB 2WPKS 1P3CA 3SUGA 1ZOMA 1AWFH 1A5GH 1B0EA 3RMNH 1AY6H 1RXPA 2R0KA 3M3VA 1BZXE 2GGVB 1T4VH 1QRWA 3T29A 4INKA 1UTNA 4DT7B 2BLWA 3A7WA 1LDTT 5A2MH 5DG6A 2BQ7B 3A8CA 3NK8A 4ABHA 1Y3VA 4WMEA 4UONA 3RXHA 1GI8B 1V6DA 2ZTXA 1TNKA 4Y6DA 1ZHMA 2VNTA 1V2RT 1J8AA 1LVYA 1P04A 1K9OE 4I8JA 4X8UH 1KSNA 1P2QA 2YNAA 2YNBA 1TRNA 3LGYA 1C4U2 1E0FD 1V2KT 1YCPH 4CBOA 4JYTA 1FY5A 1ACBE 4JYUH 1Y5AT 1KXAA 3RMLH 1P8VC 2BYAX 1MTSA 1MTWA 1TA6A 1WOFA 5C1YA 2XC4A 1EKBB 1SR5C 3RXRA 1F5RA 3SUFA 2W7UA 2AFQB 3E6PH 4Y7AA 2GZ7A 4JMYA 1GCTB 3HKJB 5L2ZH 2VINA 3SGQE 1OP2A 5GXPA 1DT2A 1V2NT 2P95A 3ATIA 3MMGA 4U01A 4WWYA 3QO6A 1G32B 1O3CA 1FIWA 2BY9X 5EPNA 1A3BH 1TX7A 3MHWU 1O3IA 2Z3CA 1FXYA 1BBRK 3U1JB 4E7NA 2CGAA 1ELGA 2ZP0H 3SV7A 2SGPE 1O3AA 3MOCA 3KQCA 1G3EA 4YLQH 3EE0B 1UVPA 3TNSA 3ZZ4A 2A7JA 5H4IB 2TBSA 1SGIB 3BTHE 5DO4H 2Q6DA 3UY9A 1AU8A 1F0RA 1HYLA 2PFEA 2ZTYA 1AZ8A 1O3DA 1PQ5A 2XWBI 3LC5A 3RP2A 5L30H 1EB2A 3KHVA 4A1XA 5A09A 2UWOA 4NWLA 5FPSA 2QAAA 1DANH 2ZO3H 1UJ1A 2Z7FE 3BSQA 1HUTH 1XM1A 1IQMA 2ZHQH 2GVFA 1CO7E 1TMBH 1YM0A 1SMFE 2Z94A 4UFDH 4MDSA 2TGPZ 5ESTE 2V35A 3FP6E 3UWIA 4MQAA 1W14U 3MI4A 1BBRH 2P93A 3LC3A 2WPJS 1L1NA 3A86A 1GWAA 1GHWH 1L4DA 3T25A 1TGBA 4B2CA 4U2WA 1BA8B 5JBAS 3OY5U 1ELEE 1KLTA 2WPHS 1N8OC 1GMHG 3D23A 1O3PB 4NCYA 3PV4A 1O2QA 2C90B 1EZXC 1QJ6B 3SU2A 4A1VA 2XW9A 3P8OA 1F0SA 1BCUH 1OS8A 2ZHDA 4E05H 3UWJH 1NZQH 4AFUA 1HLTH 1F92A 4X0WU 3ZZAA 3ZVFA 3CENA 2ASUB 4VGCC 1GBFA 3KIDU 3PM3A 1CE5A 1P2JA 2R9PA 2VVUA 3VGCC 1VCPA 1ANEA 3KCGH 3PMHB 1A5IA 1O5BB 1YPKH 3O8DA 2J4IA 1INCA 1ESBA 3KQEA 3LGTA 3TIUA 2BZAA 1RGQA 1RJXB 3ZVAA 1NROH 1O2PA 1BIOA 1NC6A 4O97A 3JZ2B 4IN2A 3LPRA 3A7XA 1SLUB 4KTCA 3EGKH 4IC6A 4Y0ZE 4A1TA 4D7GA 1PQ7A 3RXKA 4CRAA 1GBCA 5LPEA 2LIZA 5J4SA 2OC0A 2AERH 1V2UT 1C4V2 1K1JA 1ZMLA 4WXVA 2FOCA 4YZUA 4FUIA 1TX6A 2AGIX 3KQBA 1GDUA 1O2UA 1GBJA 1VCQA 2O8WA 1C1PA 4X8VH 1Y5UT 2FMJA 1O5EH 3BEFB 5ABWA 1VJ9U 2BDIA 1IQFA 1DITH 3QWCH 4NG9H 2GZ9A 3RXSA 1HFDA 5HM2A 1OWKA 3K2UA 3DFJA 2XC0A 3T62A 4TWWA 4AFSA 4MTBA 2R3YA 1C5UA 3ATLA 3ZYEA 2NU1E 4ZHMU 4AB8A 1EPTC 2VIWA 1CVWH 3K9XB 2GMTC 1SFIA 2PTNA 3EA8A 4GAWA 1TMTH 1TPSA 2OC8A 3RC6A 1A61H 1SHHB 1TPAE 4ABGA 1MCTA 3UIRA 3UNRA 1ESAA 2A2XH 1Q3XA 3TJOA 3SHAH 1ELDE 5JBTA 1FIZA 1GL0E 2XBWA 3FVFB 2GP9B 1XUGA 4NZQA 1T8OA 5DP6A 1P10A 2AIPA 3TGIE 3UNQA 4YO9A 1NESE 4B71A 1BITA 1HGTH 1NRRH 2ZECA 4BAHB 3M5OA 1A0LA 4WH6A 1F0TA 5FBEA 1W11U 5HYOA 1TB6H 2ZPSA 4OS5A 3GCHC 1GDQA 4Q2KA 1DXPA 1HBTH 3ZZ9A 3SU1A 4AYYB 1A0HB 3LH3A 3FAOA 2J94A 3TVJB 1LKBA 1GHAG 2OD3B 4MPWA 1GJCB 2HWLB 2RA0A 3PLBA 1D3PB 4OGXA 1ETSH 3DUXH 1XUHA 1MD7A 1ZRBA 4LXBH 1V2VT 1DXWA 3E8LA 2NU3E 3TLOA 2ZDNA 3QTVH 1SQTA 4XBCA 1JIRA 2A2QH 3MU5A 1W13U 2Z6BD 3CP7A 3RU4E 4THNH 2XTTB 3BIVH 5GCHG 5SGAE 4ZKNU 5C1XA 1ELAA 3TITA 3PTBA 3SGAE 3V0XA 1AUTC 1T7CA 2HNTF 5E0GA 1C5SA 1LHGH 2F9PA 1N8OB 3F6UH 2ZU5A 1CT0E 3A7ZA 4D76A 1G36A 1OX1A 1O2IA 1QB6A 3LONA 1EB1H 2QA9E 4IMZA 3VB7A 1MAXA 3BIUH 4B75A 1C5YB 3RUOA 4O3TA 4VGCB 4BOHA 3ZVBA 3SORA 2GCHF 2XCFA 3BTEE 1G9IE 3VGCB 3LKWA 1OWHA 1XUFA 4AN7A 4SGBE 3EA9A 1QURH 1OP8A 4Q80A 2ZI2H 4NIXA 9ESTA 3MTYA 1W7XH 3GCNA 4X6OA 2PTCE 3HGPA 2ZFSA 1C1SA 1P2MA 1GGDC 7ESTE 1ELFA 2OQ5A 3M5NA 4MPVA 3RXEA 2O8LA 1D6WA 2H5DA 4LZ1H 2YOLA 1YCPM 1XKBC 1O33A 2BY6X 1ANDA 2ILNA 3MO6A 4RKJB 1H1BA 2FOEA 4CH2B 1TMUH 1AZZA 2ZDLA 4B2BA 2D26C 2V6NA 1HAIH 1PPHE 1ZTJA 4NIVA 4ZHLU 3QTOH 3UR9A 4FVDA 1NO9H 1LTOA 5JDUB 5C20A 4K5ZA 1P02A 1GJ5H 1WQSA 2G5NA 1G3DA 1GI3A 1TPPA 2VIOA 3SNEA 3V7TA 3SO3A 2GZ8A 3M3TA 2QF3A 1V2ST 4ESTE 4WJG2 2B5TB 2C4FH 2VWOA 1B7XB 1DM4B 1FMGA 1M9UA 1L1JA 1UCYK 3MH4A 1QB9A 1TRYA 1E38B 4FUBA 1EPTB 2OC7A 4ZHAA 5EU8A 1GMHF 2WPLS 3LJJA 1ZRKA 2PWXA 5EOKA 1LCYA 2BLVA 2P59A 3M5LA 2PKAB 1N1LA 3KNXA 4CRGA 1TAWA 3M5MA 1SQAA 5J4QA 1ZHRA 1HIAA 4WMDA 3KN2A 1A2CH 1LQDB 3A87A 5FHTA 4CRFA 1NFWA 1O3LA 2IJOB 1NFUA 1DWCH 2R0LA 1GG6C 2DE9A 1NT1A 1AVGH 2FI5E 1X7AC 1O2NA 4BTIB 1BTUA 1GI1A 3GY8A 3SUDA 3SV6A 3M3SA 1EASA 1RRKA 4J1YA 1O2MA 3GCHB 2WPIS 3EDXB 1S0QA 1WBGB 2FEQH 1P9UA 1NM6A 1UCYH 2FOGA 2HPPH 2FWWA 3CS0A 1EAUA 2PHBA 2PV9B 2FOMB 4LZ4B 2VB0A 3U1IB 4F4OC 1V2QT 1O5CB 3H5CB 3RM0H 4GUXA 1OYQA 2ZNKH 3A82A 1EUFA 3PB1E 5F8ZA 6ESTA 1AI8H 3IWMA 3RXDA 2ZHWH 2PUQH 1UO6A 2QV1A 3ZZ7A 2QXJA 3M35A 1GMCG 3T28A 2CV3A 1KXEA 1QBVH 4I8KA 3D62A 2UWLA 1O2HA 9LPRA 3BTDE 1GMDF 3SJIA 4TYDA 3SI3H 1F2SE 1K2I1 3BTME 3DA9B 4NFFA 5K0HA 2HVXA 1G3BA 3LH1A 2UUJB 3SU5A 3ZZ3A 2XBXA 5A0BA 2H6MA 1QTFA 8LPRA 3AW0A 2BY7X 2A45B 2OBQA 1DY8A 2BD9A 1N6YA 4O03A 2FTLE 3HK3B 1YLDA 1V2JT 1YBWA 1SGRE 4OS1A 1UTKA 4O9VA 1O2YA 3FFGA 5E0HA 3UPEA 4KKDA 3P8NA 5T6GA 1P06A 1K1MA 1O35A 1VITG 3MWIU 1GJ9B 1MBMA 5AF9H 4ISOA 4YLUA 1O32A 5F8TA 1TWXB 3N7OA 1KTSB 1E36B 2ANYA 2ZC9H 1P12E 1AFEH 1L0ZA 1IQLA 1JRSA 3LDXH 4AOQA 1Z8GA 1W10U 1QRXA 1BDAA 2FLBH 3OX7U 6GCHG 2EA3A 3GY5A 5L6NH 3RDZA 3ZZCA 1AFQC 4Z6AH 1SGTA 3SGBE 4X2WA 1FQ3A 1C1VH 4DIHH 1NFXA 1Z6JH 1EQ9A 3BTKE
chains in the Genus database with same CATH superfamily
1SHYA 2GTBA 3OE7D 1VR1H 1ABJH 1YCPK 3LJOA 3L33A 3U8TH 4J2YB 4ISNA 2JETC 3TJVA 3Q3XA 1TIOA 4BANB 1Q2WA 2FOHA 1BRCE 2AYWA 3BTQE 1CHOG 1BHXF 1DPOA 3OSYA 1W2KH 3MYWA 1MABB 1CA8B 2WV4A 4MNVA 1XUJA 2BY5X 1DX5M 2JJ1D 4HFPB 4XDEA 1ZGIA 2JH6D 1WAYB 3KEEA 1H8HD 1GG6B 1O3MA 4GHTA 1KLIH 1QL8A 1GBBA 3RC5A 3RU4T 1VITH 1O31A 1D3QB 2V3OH 2K7XA 1GVZA 4DGJA 4B2AA 5ETXA 4YT6H 1P2NA 1CGJE 2QYIA 1JOUB 5EG4A 1PPCE 1H4WA 4H6TA 1ZTLA 1D9IA 1TALA 1C1OA 3RMMH 2JJ2D 1TBZH 2IPQX 1A7SA 1HAPH 2CJIA 4MPXA 2BDAA 2BZ6H 3STJA 4BXWA 4AYVB 2KCPA 3A7TA 4CRBA 1HAOH 1BTZA 1GHBG 3MO9A 2BLOA 2VWNA 1BMMH 3L6PA 3A89A 1H9HE 2ZU1A 3A7VA 2A7CA 1F5LA 4AX9H 1UTQA 1K22H 5AFYH 4XFQA 1C5RA 1DWBH 4INHA 3TNTA 2PW8H 2C8YB 1GJBB 3BTFE 4ACAA 8GCHF 1GI9B 1C1NA 4HTCH 4FUHA 3UNSA 3PWCA 1EJMA 2TPIZ 1SFQB 2M2AA 5DP9A 4UD9H 4E7RG 1L1GA 5EXNA 3FO8D 1QL9A 2A5AA 4Z0KA 2H5CA 1YF4A 3PLKA 3OTJE 1Y3YA 5DKMA 4JZIA 2OP9A 2ZG0H 1ZMJA 2ZDAH 1QY6A 2RA3A 2ZGCA 4B74A 5BPEA 1GBTA 4Y79A 4ZMAH 4HGCA 2VIDA 3VB6A 2QF4A 1HAVB 1TOMH 4WVPE 1THSH 3F9GA 1IQJA 3T5FH 4A6LA 1OWDA 8KME2 1MU6B 5AVDA 5DP4A 5HGGA 1P57B 1O2WA 2P3TB 3SJKA 3SU4A 1SLWB 3BN9A 4TPIZ 3TK6A 4H42U 1B5GH 5ESBA 2BHGA 1FNIA 1Y3WA 3O8RA 1GJAB 1S84A 2FLRH 2VVVA 1O3NA 2FI3E 1WCZA 1SGNE 1HIAB 1GI5A 3BF6H 1O3EA 1IHSH 3D65E 5A8XA 2H2ZA 4IS5A 2AEIH 3A8AA 3FOAA 1JIMA 3JZ1B 3TJUA 4UFEH 2QXHA 3GDSA 1TGCA 4CRDA 3ATMA 2D1JA 3RXTA 4X1SU 1AFQB 1UTMA 1GDNA 4X6MA 4ZKOU 2C8WB 1K1IA 1V2LT 1C2JA 2C8ZB 3ZVEA 1SPJA 4FUFA 1TGTA 1GMCF 1AKSA 4QT8C 2XNIA 1XMNB 2ZGHA 4INLA 2HOBA 2J97A 1P0SH 2V0BA 3MH6A 5C2ZA 1WV7H 2JETB 1S82A 4WY3A 4ABEA 1IQHA 1NPMA 4RN6A 3TU7H 3D49H 1P2OA 3NPSA 2NU2E 2OC1A 1UVUH 2HLCA 5TCAA 4UFFH 3RXOA 1O38A 4CRCA 4MNXA 5C5OA 1ELCA 1P2IA 5AFZH 4DOQA 1NN6A 2Z9KA 5DP5A 5E8EH 4DW2U 4ABAA 3VFEA 3V12A 3SJ9A 1VKYA 2BDYA 4FUCA 1S6HA 2FX6A 1DFPA 1GJ4H 1O37A 1XKAC 1P9SA 1JWTA 2ZA5A 2JH0D 4K8YA 3DHKH 1KDQA 3SUEA 1O5AB 2C8XB 1UHBB 1K28D 5T1VA 4ABFA 2Q1JA 4Y8ZA 1NRNH 1CBWC 3RXQA 1K1PA 1O2JA 5DP3A 2BX4A 3VB4A 1EX3A 1VGCC 1P3EA 1GBHA 1BTHH 3M61U 1CSOE 2ZPQA 1Z7KA 1FLEE 1IOEA 4X2VA 1DSTA 1O2TA 3CS7A 3U8OH 3VG8A 4I8GA 2V3HH 1PJPA 5FPTA 5GDSH 1ZPCA 8ESTE 3PLPA 1A0JA 2J98B 3C1KA 1TNHA 2QGRA 4KP0A 1SVPA 3P70B 4ZH8A 3FZDA 1THRH 2W3IA 3LIWA 3A88A 3SBKA 2EI8A 5EW1H 1DOJA 4U32A 4OM9A 3OU0A 2G4TA 2GJGA 6GCHF 3TPIZ 2GD4B 1PYTD 2P3FH 5EXLA 1T8LA 1EJNA 3H7OA 2WV5A 4Y7BA 1C2DA 1PQ8A 3F68H 2I6SA 3A80A 2TRMA 4CREA 3GCTG 1A5HA 1C2HA 2ODQA 1HAGE 4OS2A 1EXFA 4BTTB 4RT0A 1ZSKA 1Z6EA 3ZZ8A 3GOVB 1GJDB 1TLDA 1AUJA 3SU0A 1GI2A 1HPGA 4ZCNA 2F91A 1MH0A 3AAVA 5EW2H 5PTPA 5E2OA 1MD8A 1SI5H 1C5OH 1OSSA 2KAIA 1P05A 1A3EH 1ANCA 1D3TB 4FUGA 4OS6A 1FZZA 2QF0A 1CHOF 1UMAH 1ABIH 5A0AE 2G4UA 2F43B 1ZTKA 1P11E 3M7TA 4Q7XA 2OUAA 3FZZA 4DVAU 2WPDD 4K69A 2BD2A 1WTHD 3R0FA 3ZVCA 3W94A 3QDZB 1FPCH 3TGJE 2EI7A 5CHBA 1G37A 3EE7A 2BMGB 1BBRE 1MKWK 2FZZA 2HNTE 2OQUA 3OY6U 3ITIA 5TJXA 1NRSH 5EJZA 1AMHA 4UE7H 2F83A 3HK6B 2BD7A 4WXIA 3SOSA 1Y5BT 3BTGE 1ELBA 4ASUD 3MU1A 4MNYA 1O3KA 4A5TS 3A81A 1ETTH 1SBWA 2HALA 5KEDA 2HRVA 4XOJA 5CE1A 2PUXB 1AD8H 5FCRA 4HZHA 3NZIA 1C5WB 1J15A 1OWJA 1QRZA 2FI4E 1LVBA 5LPRA 4PROA 2OCVB 4NFEA 1Q31A 1ELTA 3BTWE 1GPZA 1OOKB 1ZSLA 2ZFTA 5DK1A 3RMOH 3PV2A 1SGEE 3M37A 1TPOA 2IOTA 3MU0A 2Y5HA 1MKWH 1TRMA 3SV8A 3OTPA 3TH2H 4AFQA 1PPEE 4LOYH 1W0YH 1GI4A 4DURA 3K6YA 3VB3A 1GCDA 1W0ZU 5JB8S 1C2MA 1UK4A 2HGTH 1A4WH 2FOFA 2SGAA 1YGCH 2ZCKP 2ZFFH 5JYIA 5LH8A 1C1RA 1MUEB 1GBEA 4KELA 1HJAC 4ZUHA 4ZXYH 2G8TA 5DJ7A 1AN1E 1O2ZA 5GIBA 1UVSH 1QB1A 3I78A 2XRCA 2ESTE 3UTUH 3LGWA 1ZR0A 5E2PA 1BTPA 1GHYH 1KXCA 5HMAA 3URDA 3MH5A 4YM9A 3SQHE 3EBNA 1DDJA 5EODA 1ORFA 3F9HA 3AAUA 1S0RA 3B23B 3SV9A 5EQSA 5A0CA 3ODFA 2J9NA 4IW4E 1O34A 4ISHH 1C5MD 3UFAA 4IN1A 1G30B 1J17T 4AC9A 2QCYA 3AVZA 2BVRH 4IBLH 1CBWB 5FAHA 4CR5A 4AB9A 1VGCB 5F6MA 3FANA 1LVMA 1C5TA 4K1TA 1H8ED 3VXFH 1T32A 2BX3A 2D8WA 5C94A 1K0HA 2BQ6B 1O2OA 3STIA 1MMJN 2BM2A 1Y59T 1JMOH 2Y82A 4E06H 3TJNA 1LHFH 4D9QA 1O2GH 1C1UH 1UK3A 4X1QU 1SQOA 5C3NA 3T2NA 2AMQA 1ESTA 4NA7A 2DE8A 3RXIA 4BAQB 2FODA 1CQQA 1W12U 1PFXC 1GBIA 4NIWA 4X1PU 1HAZB 1GBMA 1DWDH 2ZTZA 1KTTB 2C93B 4YESB 2FYRA 4XRNA 1NU9A 4I7YH 1EATA 2QE7D 4ABDA 3MFJA 1KXFA 4K2YA 2TGDA 5DPAA 4CHAC 2FXRA 1HAHH 2F3CE 2TGAA 3K6ZA 4TY7A 1KIGH 3RXPA 2ALVA 1C2FA 3F9FA 5LGOA 1VZQH 1QFKH 2ZCLP 1UTOA 3MQKC 5C67A 2EI6A 1BTWA 2BXUH 3SN8A 2PGBB 1XVOA 2ANKH 3UQOA 4XBDA 4KTSA 1O2VA 1WSSH 1EZUC 3SZEA 4JCNA 4FUJA 3E0NB 2F9NA 1O3OA 1UTJA 2AGEX 2VIQA 3QGNB 2AMPA 1B0FA 2GDEH 1EP6A 2ZIQH 2ZPRA 3P8FA 4TWYA 3Q3KA 2F9VA 2WV9A 3A84A 3UOPA 3VB5A 4YOIA 1QQUA 2GT8A 2ZDMA 3ZYDA 3FP7E 1YC0A 2FPZA 2JIZD 2HNTC 4M7GA 1OWIA 4MLFB 2PLXA 3U8RH 3B9FH 3PWBA 2J92A 1GHXH 1ZYOA 2O9QA 2CF8H 2XWAA 3ELAH 1C5QA 1ZGVA 1SC8U 2Z9GA 4B73A 1QJ1B 2A5KA 1ZSJA 5FCKA 4R0IA 1D3DB 1CGHA 4JK6A 3U9AH 2C3SA 1DSUA 2LP6A 1A46H 1C1QA 2VH0A 3ATWA 2V3MA 4FU8A 1WUNH 3S69A 2FYQA 5TCCA 1UW7A 1QJ7B 1SLXB 3P8GA 3A7YA 3CNRA 5DP8A 1KYNA 1DS2E 3GCOA 2BTCE 2AGGX 1O3GA 2QF5A 3LOXA 2W7SA 2Z9IA 3RXJA 2A4RA 1YP9A 3KL6A 5GWZA 2UUKB 3ESTA 1OYTH 1YPMH 4IGDA 1YPHE 2Y80A 1CGIE 1QNJA 4DCDA 1HJAB 1IHTH 3SU6A 4NSYA 2ZGJA 1BQYA 3NCLA 1AE5A 3RXMA 1K21H 7KMEH 3KYGA 1GJ7B 4XSKU 2QN5T 2QIQA 1GBDA 3AW1A 1GHAF 5K7RA 2RDEA 3RXGA 1EZSC 1F0UA 2HPQH 2WYJA 4BXSA 1LHEH 1TQ7B 2RFKC 2BY8X 3GS9A 1T8NA 2F9BH 1P01A 2ZF0H 2GV6A 1MTVA 2VVCA 4WH8A 2SGDE 4AZ2B 2OXSA 3C27B 1MBQA 1MQ6A 3TH3H 4Y10E 1AB9B 1GBLA 4FU9A 2XC5A 2XNDD 5GCHF 4YTAA 2GV7A 2KAIB 2ZWLH 1IQNA 2KCYA 1C5PA 2THFB 4TY6A 2EEKA 2WUBA 1Y3UA 1FAXA 3BEUA 4M9FA 4H6SB 3P95A 1S6LA 4RI0A 3UOUA 3HATH 2FS9A 2TIOA 4X1RU 3S7KB 4RKOB 2ZFQH 3KQ5A 3I77A 2ZDKA 3TGKE 1ZPBA 1S83A 1Z71A 1GL1A 1K1NA 1RFNA 2GCTC 1PPFE 1P2KA 1TYNA 1ANBA 2J5UA 5CMXH 1YPJH 1NRPH 2Z3EA 5B6OA 1SGCA 1WQVH 5T3HA 3MNCA 1H9IE 1TE0A 3SNCA 3GY2A 2DUCA 4X1NU 3OYPA 5FX6A 3A8DA 4CHAB 3AASA 5IYTA 1SGFG 1UCYE 1EZQA 2STAE 1C5LH 5I25A 5C1UA 1K1OA 1QL7A 1BMAA 3P92A 1EJAA 2B0FA 2JH5D 2VIPA 3GY3A 1O3BA 3ZV9A 1BJVA 1DVAH 3E16B 5EPYA 4WMFA 1C9TA 4ACBA 2FS8A 2ODYB 2ALPA 1UVOA 3DSPA 2R2MB 1DICA 1SSXA 2SGFE 2CF9H 4DT4A 1GBAA 1TNIA 2W26A 2L74A 3S9BA 2CXVA 1HV7A 2BLQA 3FP8E 3MU8A 5G4BA 3QGJA 1NTPA 2VGCC 3GISB 1MCVA 4OS7A 2Q6FA 1UTLM 1LHCH 2O8TA 2GX4A 2W5EA 4RSPA 2A31A 3RXCA 3WY8A 4XD7D 1BTYA 1FUJA 4P02A 3MO3A 3HKIB 3F2HA 1YKTA 1XXDA 2B8OH 2K1QA 5FX5A 2CMYA 1LKAA 2GCHG 2BXTH 2ZZUH 2A4GA 1ZMNA 3UR6A 2FO9A 1QA7A 2WINI 4D8NA 1MTUA 4BAMB 2RDLA 3ZVGA 2Z3DA 1DE7H 3SJOA 2GT7A 1RIWC 1BUIA 3A83A 1P09A 4JZEH 4U30A 2NU0E 2Y6TA 1C5XB 3FKSD 2F9UA 2FP7B 1O39A 1TONA 3MNXA 1WU1A 3ENSB 1QIXB 2A4OA 4GSOA 3BG8A 1IQGA 4AG1A 1E34B 1S6FA 1XUKA 3EYDA 3OEHD 2BQWB 1C2KA 3ZVDA 1YPLH 4ASHA 1RS0A 1RTFB 4AFZA 1HNEE 1WTGH 1GJ8B 2LNCA 1FAKH 1D4PB 2ZGBH 1F5KU 2CK3D 1EPTA 5L2YH 5FL7D 2SNWA 1EOJA 5IK2D 4GPGA 3SU3A 1YYY1 2W3KA 1C5NH 1BMLA 1KXDA 5LPFA 2PKAA 4Y71A 3PMAB 1YPHC 5F03A 3A8BA 4B1TA 3PMBB 2FDAA 1F7ZA 4Q7ZA 1EOLA 1LPKB 2EY4C 1FPHH 1IQIA 4JZ1A 1H8IH 1IQKA 4I86A 1D6RA 4ZKSU 7GCHG 2J95A 1K1LA 3S7HB 1ARBA 1SOZA 4I8LA 4ZROA 1MKXK 1MZDA 1Z8JB 1CU1A 1O2LA 3SHCH 3LGVA 2A0QB 4NIYA 1XXFA 4MPUA 4FUDA 1O0DH 3DFLA 2BD3A 2VJ1A 3ODDA 4FVBA 1GJ6A 2B7DH 2O8UA 1W7GH 2XBVA 2M5TA 2ULLA 3GY7A 1QCPA 2PR3A 3ZZDA 1DLKB 3SV2H 3EAJA 1HJ8A 2B9LA 4A92A 1G3CA 3NKKA 1E35B 4NA9H 3SW2B 1VCWA 3GYLB 2BD8A 2BDBA 2J38A 3E1XB 2FOBA 3EQ0H 2BD5A 3QLPH 1KXBA 3BV9B 2BDGA 2J2UA 2QXIA 2GCTB 1OPHB 3RC4A 1C2LA 4FOUC 1HDTH 4YT7H 2FESH 1COWD 1HB0B 1YPGH 3DCLA 4DY7B 1V2PT 2GDDA 3LGIA 4DJZB 5JBCS 2P8OC 1HRTH 4YOGA 1MKXH 2UUFB 1BRBE 3F2GA 1O3JA 1N6XA 2AH4X 3E90B 1TNGA 2H9EH 2VIVA 1MTNC 1EAWA 2G81E 2ZEBA 2SFAA 1VITF 1MU8B 3BG4C 4Q7YA 1OKXA 2FX4A 1AE8H 2AIQA 3KYFA 2I6QA 2SNVA 3SYJA 3HGNA 4AGKA 4B76A 1J9CH 2PGQB 1CT4E 2A1DB 1OP0A 2FOAA 2P94A 1EP5A 7LPRA 5E0JA 2G51A 4AORA 1SGDE 1C2EA 1TGSZ 3SNBA 3A85A 4GCHG 3Q76A 3RLYH 1LVOA 2UWPA 1FY3A 1TGNA 4X2XA 3PO1C 1SB1H 2VGCB 4BAKB 5EQRA 2H1UA 1NY22 1ZJKA 1GMDG 1S85A 5GJ4B 1T4UH 1ARCA 3SZNA 2EC9H 2PKSC 1S81A 4JZDH 1Z8IB 2P16A 2GKVE 4GVUA 1O2XA 2YMSD 2ZQ2A 3L3TA 2STBE 1LO6A 1XX9A 1AVWA 1O5FH 2R2WU 3GYMA 2ZHEH 5HIZA 4XE4A 1MQ5A 1PPZA 4AGJA 4JYVH 3E91A 3B8JA 4X6PA 2Y5GA 3MH7A 2G00A 1RIWB 2BB4A 6LPRA 1AGJA 4ABBA 3QZQA 2XOKD 1MAYA 1W3CA 1C4Y2 1V2OT 3KF2A 3ZIAD 4ABIA 1QZ8A 1CA0C 1IQEA 2ZGXH 3NUMA 4UDWH 1UVTH 4ZXXH 3PTNA 2O8MA 2OTVA 3O8BA 1L2EA 1AO5A 2KCOA 5DGJA 3QUMP 2ANWA 5EGMA 3SQEE 1JXPA 3NXPA 1THPB 3PROA 2RG3A 1H9LB 3Q00A 4WF8A 3M7UA 1GHZA 3S9CA 4DG4A 5B6LA 5DP7A 3F0PA 2V7QD 2SGQE 3DT0H 3KGPA 4BAOB 3F3BA 1OWEA 1TQ0B 3S0NA 1LHDH 2ZU4A 3DSGA 1XVMA 3R3GB 3ATKA 3RM2H 4I8HA 3WW7A 1LMWB 1SLVB 2VH6A 4HI3A 3GDUA 3UB0A 4AG2A 4H4FA 2G55A 1Z1JA 1FN6A 4CBNA 2ZFPH 1BB0B 4GLYA 5EQQA 1TBRH 1AHTH 1CHGA 1GI6A 2Y7ZA 1GHBF 4A7IB 3S9AA 4K1EA 1FX0B 4Y8XA 1O2RA 2XYAA 2IPHA 1FY4A 2FM2A 2AS9A 3SNAA 1H8DH 3LT3A 4NGAH 4X8TH 3RXVA 1W8BH 3PV5A 2BDCA 1TNLA 1ZLRA 1SGFA 2F9OA 4NA8A 1VJAU 1AQ7A 5T6FA 1KY9A 4I31A 2LPRA 1ZZZA 3RXLA 4BTUB 1NU7B 1TNJA 1BHXB 1FJSA 1GHVH 1JBUH 3PYHA 4FXGH 1QGFA 2FTMA 3GY4A 3VEQB 3UREA 4X6NA 2H9HA 4ISIH 3K65B 3UQVA 3U98H 3URCA 3M36A 1WXRA 4IMQA 1G2MA 1C1WH 1PYTC 2UUYA 1RD3B 1O5DH 4K8BA 5HM9A 2P8OB 1BRAA 1HAYB 1W0JD 1DUAA 3SJ8A 1KLJH 3RU4D 5C0UA 2YMSC 2Z9LA 2ZCHP 1MTNB 5CHAC 2VU8E 4KGAA 1BMFD 2BVXH 4MVNA 1FY8E 2ODPA 1AB9C 3BG4B 3QZRA 2TGTA 1V2MT 2ZU3A 1TOCB 1EAXA 4JK5A 4FU7A 2VWLA 2XBYA 3F9EA 2ZKSA 3Q77A 3U69H 3OFND 3TK5A 1QHRB 3IG6B 5JBBS 4ABJA 2PSXA 1NRQH 3BEIB 2A5IA 3N99A 1HJ9A 4BNRA 1E1RD 1DY9A 1O5GH 4CR9A 3PO1B 1C2IA 1UTPA 4HG6A 2G5VA 1HAVA 1Y8TA 1HCGA 4CH8B 8GCHG 5A8YA 1LPZB 4K60A 7GCHF 2CHAC 2PKSB 1O3HA 4JZFH 4Y8YA 3RXUA 2GMTB 1Y3XA 6CHAC 4K3JA 1J14A 1GBKA 1FDPA 2BD4A 3MU4A 1C1TA 4X2YA 2ZFRH 1V2WT 4I33A 5FPYA 3IITA 1YWUA 4D7FA 2G52A 5C5NA 1SKYE 4Y76A 1GVLA 2WPMS 4IC5A 1CA0B 5BRRE 4LK4A 1IAUA 2OBOA 3O8CA 5HXFA 3PMJA 1SOTA 4X8SH 5KGOA 1SGPE 4DIIH 2OINA 5C0TA 1AKSB 5C17A 3QK1A 2H9TH 3N7DA 4XBBA 2QC2A 1Z1IA 1SGQE 2K0QA 1OXGA 2BVSH 3VPKA 1LPGB 1ZPZA 1HXEH 2ZU2A 1E37B 1GVKB 4MG3A 3P17H 2PSYA 4Y0YE 1QBOA 3RLWH 4ISLA 1L4ZA 1LQEA 4ZAEA 3ZZBA 3MNSA 2VWMA 3DSOA 2SGEE 1XUIA 4YOJA 1HXFH 2FIRH 4NZLA 2WYGA 3FN8A 2XXLA 1ZJDA 5AHGH 5T6DA 1GI7B 3P6ZB 1GCTC 1TBQH 3GY6A 3RXBA 5I46H 2QXGA 1ELVA 1C2GA 4D9RA 1ZHPA 2A32A 1BOQA 1DLEA 1QBNA 4GCHF 3ZZ6A 2Z9JA 1C9PA 4TPYA 3GICB 1O2SA 1FN8A 1KDQB 1PPGE 3M7QA 1O30A 2OLGA 2ANMH 2P3UB 3V3MA 1UHBA 3V13A 5A8ZA 3SNDA 1TX8A 1C5VA 2ZQ1A 4FUEA 5JB9S 1SGYE 3DD2H 3UAIC 1DWEH 3GCTF 4UFGH 3TK9A 3LGUA 3QX5H 3RXAA 5JPMH 2Y5FA 3RXFA 5FBIA 1QQ4A 1PPBH 1CT2E 3NRLA 2WUCA 1HAXB 1WYKA 2Y7XA 3PRDA 1C5ZB 1T8MA 1V3XA 1T31A 2R3UA 1O36A 4Y11E 5GPIB 5EJLA 2NWNA 2XCNA 2W6ID 1BJUA 1TABE 2ZDVH 3BTTE 3I29A 1AIXH 5IDKA 2BOKA 1FV9A 2BDHA 3NWUA 1BT7A 1GGDB 3EA7A 1AWHB 3QN7A 1S5SA 1BRUP 1QA0A 3SI4H 1J16A 1SL3A 3F1SB 2ZHFH 2Y81A 1NFYA 2YMSB 3E0PB 5CHAB 2A4QA 4UEHH 1RTKA 1NS3A 2AMDA 5F53A 1BTXA 3ZV8A 1EAIA 2IN2A 2Q6GA 3E3TA 1YLCA 3T27A 1P03A 4I32A 1O3FA 4SGAE 3GDVA 3TH4H 3G01A 2JKHA 4GHQA 4F49A 1BMNH 3T26A 4ZKRU 1QR3E 5F8XA 1TFXA 5EXMA 1Z8RA 2J34A 4NWKA 1A1RA 4OGYA 3ZZ5A 2A7HA 1FY1A 4OS4A 4P00A 2D2DA 1TA2A 3UUZA 1AVXA 1DUEA 1YPEH 2CN0H 4O3UA 2BOHB 1FONA 1C1MA 3KQDA 4K1SA 3Q3YA 3MNBA 1U6QA 1UK2A 2RCEA 3H7TA 2IJD1 5FXLA 2CHAB 2QY0B 1SG8B 1JRTA 1GI0A 3HPTB 1ID5H 1PQAA 1YLNA 4TSFD 3LU9B 3VXEH 1O2KA 2NU4E 1RTLA 6CHAB 1G2LA 1ETRH 1FI8A 1MZAA 4MNWA 4KTUA 3W95A 1E1QD 1V2TT 4NSVA 4R8TB 2WPKS 1P3CA 3SUGA 1ZOMA 1AWFH 1A5GH 1B0EA 3RMNH 1AY6H 1RXPA 2R0KA 2WHXA 3M3VA 1BZXE 2GGVB 1T4VH 1QRWA 3T29A 4INKA 1UTNA 4DT7B 2BLWA 3A7WA 1LDTT 5A2MH 5DG6A 2BQ7B 3A8CA 3NK8A 4ABHA 1Y3VA 4WMEA 4UONA 5EJ1A 3RXHA 1GI8B 1V6DA 2ZTXA 1TNKA 4Y6DA 1ZHMA 2VNTA 1V2RT 1J8AA 1LVYA 1P04A 1K9OE 4I8JA 4X8UH 1KSNA 1P2QA 2YNAA 2YNBA 1TRNA 3LGYA 1C4U2 1E0FD 1V2KT 1YCPH 5CDFE 4CBOA 4JYTA 1FY5A 4F55A 1ACBE 4F48B 4JYUH 1Y5AT 1KXAA 1NBME 3RMLH 1P8VC 2BYAX 1MTSA 1MTWA 1TA6A 1WOFA 5C1YA 2XC4A 1EKBB 1SR5C 3RXRA 1F5RA 2WZQA 2W7UA 3SUFA 2AFQB 3E6PH 4Y7AA 2GZ7A 4JMYA 5DN6D 1GCTB 3HKJB 5L2ZH 2VINA 3SGQE 1OP2A 5GXPA 1DT2A 1V2NT 2P95A 3ATIA 3MMGA 4U01A 4WWYA 3QO6A 1G32B 1O3CA 1FIWA 2BY9X 5EPNA 1A3BH 1TX7A 3MHWU 1O3IA 2Z3CA 1FXYA 1BBRK 3U1JB 4E7NA 2CGAA 1ELGA 2ZP0H 3SV7A 2SGPE 1O3AA 3MOCA 3KQCA 1G3EA 4YLQH 3EE0B 1UVPA 3TNSA 3ZZ4A 2A7JA 5H4IB 2TBSA 1SGIB 3WWFA 3BTHE 5DO4H 2Q6DA 3UY9A 1AU8A 1F0RA 1HYLA 2PFEA 2ZTYA 1AZ8A 1O3DA 1PQ5A 2XWBI 3LC5A 3RP2A 3U28C 5L30H 1EB2A 3KHVA 4A1XA 5A09A 2UWOA 4NWLA 5FPSA 2QAAA 1DANH 2K8IA 2ZO3H 2KM0A 1UJ1A 2Z7FE 3BSQA 5KECA 1HUTH 1NBMD 1XM1A 1IQMA 2ZHQH 2GVFA 1CO7E 5DSFA 1TMBH 1YM0A 1SMFE 2Z94A 4UFDH 4MDSA 2TGPZ 5ESTE 2V35A 3FP6E 3UWIA 4MQAA 1W14U 3MI4A 1BBRH 2P93A 3LC3A 2WPJS 1L1NA 3A86A 1GWAA 1GHWH 1L4DA 3T25A 1TGBA 4B2CA 4U2WA 1BA8B 5JBAS 3OY5U 1ELEE 1KLTA 3N7EA 2WPHS 1N8OC 1GMHG 3D23A 1O3PB 4NCYA 5HIYA 3PV4A 1O2QA 2C90B 1EZXC 1QJ6B 3SU2A 4A1VA 2XW9A 3P8OA 1F0SA 1BCUH 1OS8A 2ZHDA 3H09A 4E05H 3UWJH 1NZQH 4AFUA 1HLTH 4Q63A 1F92A 4X0WU 3ZZAA 3ZVFA 3CENA 2ASUB 4VGCC 1GBFA 3KIDU 3PM3A 1CE5A 1P2JA 2R9PA 2VVUA 3VGCC 1VCPA 1ANEA 5EIYA 3KCGH 3PMHB 1A5IA 1O5BB 1YPKH 3O8DA 2J4IA 1INCA 1ESBA 3KQEA 3LGTA 3TIUA 1E79D 1EFRD 2BZAA 1RGQA 1RJXB 3ZVAA 1NROH 1O2PA 1BIOA 1NC6A 4O97A 3W1EA 1SQRA 3JZ2B 4IN2A 3LPRA 3A7XA 1SLUB 2F4LA 4KTCA 3EGKH 4IC6A 4Y0ZE 4A1TA 2VBCA 4D7GA 1PQ7A 3RXKA 4CRAA 1GBCA 5LPEA 3F0OA 5HKKD 2LIZA 5J4SA 2OC0A 2AERH 2OK5A 1V2UT 1C4V2 1K1JA 1ZMLA 4WXVA 2FOCA 4YZUA 4FUIA 1TX6A 2AGIX 3KQBA 1GDUA 1O2UA 1GBJA 1VCQA 2O8WA 1C1PA 4X8VH 2AHME 1Y5UT 2FMJA 1O5EH 3BEFB 5ABWA 1VJ9U 2BDIA 1IQFA 1DITH 3QWCH 4NG9H 2GZ9A 3RXSA 1HFDA 5HM2A 1OWKA 3K2UA 3DFJA 2XC0A 3WWBA 3T62A 2KR7A 4TWWA 4AFSA 4MTBA 2R3YA 1C5UA 3ATLA 3ZYEA 2NU1E 4ZHMU 4AB8A 1EPTC 2VIWA 1CVWH 3K9XB 2GMTC 1SFIA 2PTNA 3EA8A 4GAWA 1TMTH 1TPSA 2OC8A 3RC6A 1A61H 1SHHB 2KFWA 1TPAE 4ABGA 1MCTA 3UIRA 3UNRA 1ESAA 2A2XH 1Q3XA 3TJOA 3SHAH 1ELDE 5JBTA 1FIZA 1GL0E 2XBWA 3FVFB 2GP9B 1XUGA 4NZQA 1T8OA 5DP6A 1P10A 2AIPA 3TGIE 3UNQA 4YO9A 1NESE 4B71A 1BITA 1HGTH 1NRRH 2ZECA 4BAHB 3M5OA 1A0LA 4WH6A 1F0TA 5FBEA 1W11U 5GNDA 5HYOA 1TB6H 2ZPSA 4OS5A 3GCHC 1GDQA 2EQNA 4Q2KA 1DXPA 1HBTH 3ZZ9A 1WDIA 3SU1A 4AYYB 1A0HB 3LH3A 3FAOA 2J94A 3TVJB 1LKBA 1GHAG 2OD3B 4MPWA 1GJCB 2HWLB 2RA0A 3PLBA 1D3PB 4OGXA 1ETSH 3DUXH 1XUHA 1MD7A 1ZRBA 4LXBH 1V2VT 4FETA 1DXWA 3E8LA 2NU3E 3TLOA 2ZDNA 3QTVH 1SQTA 4XBCA 1JIRA 2A2QH 3MU5A 1W13U 2Z6BD 3CP7A 3RU4E 4THNH 2XTTB 3BIVH 5GCHG 5SGAE 4ZKNU 5C1XA 1ELAA 3TITA 3PTBA 3SGAE 3V0XA 1AUTC 1T7CA 2HNTF 5E0GA 1C5SA 1LHGH 2F9PA 1N8OB 3F6UH 2ZU5A 1CT0E 3A7ZA 4D76A 1G36A 1OX1A 1O2IA 1QB6A 3LONA 1EB1H 2QA9E 4IMZA 3VB7A 1MAXA 3BIUH 4B75A 1C5YB 3RUOA 4O3TA 4YXWD 4VGCB 4BOHA 3ZVBA 3SORA 2GCHF 2XCFA 3BTEE 1G9IE 3VGCB 3LKWA 1OWHA 1XUFA 4AN7A 2PP6A 4Q4LA 4SGBE 3EA9A 1QURH 1OP8A 4Q80A 2ZI2H 4NIXA 9ESTA 3MTYA 1W7XH 3GCNA 2KX4A 4X6OA 2PTCE 2WSSD 3HGPA 2ZFSA 1C1SA 1P2MA 1GGDC 7ESTE 1ELFA 2OQ5A 3M5NA 4MPVA 3RXEA 2O8LA 1D6WA 2H5DA 4LZ1H 2YOLA 1YCPM 1XKBC 1O33A 2BY6X 1ANDA 2ILNA 3MO6A 4RKJB 4TT3D 1H1BA 2FOEA 4CH2B 1TMUH 1AZZA 2ZDLA 4B2BA 2D26C 2V6NA 1HAIH 1OHHD 3PRBA 1PPHE 1ZTJA 4NIVA 4ZHLU 3QTOH 3UR9A 4FVDA 1KMHB 1NO9H 1LTOA 5JDUB 5C20A 4K5ZA 1P02A 1GJ5H 1WQSA 2G5NA 1G3DA 1GI3A 1TPPA 2VIOA 3SNEA 3V7TA 3SO3A 2GZ8A 3M3TA 2QF3A 1V2ST 4ESTE 4WJG2 2B5TB 2C4FH 2VWOA 1B7XB 1DM4B 1FMGA 1M9UA 1L1JA 1UCYK 3MH4A 1QB9A 1TRYA 1E38B 4FUBA 1EPTB 2OC7A 4ZHAA 5EU8A 1GMHF 2WPLS 3LJJA 2HLDD 1ZRKA 2PWXA 5EOKA 1LCYA 2BLVA 2P59A 3M5LA 2PKAB 1N1LA 3KNXA 4CRGA 1TAWA 3M5MA 1SQAA 5J4QA 1ZHRA 1HIAA 4WMDA 3KN2A 1A2CH 1LQDB 3A87A 5FHTA 4CRFA 1NFWA 1O3LA 2IJOB 1NFUA 1DWCH 2R0LA 1GG6C 2DE9A 1NT1A 1AVGH 2FI5E 1X7AC 1O2NA 4BTIB 4B6FA 1BTUA 1GI1A 3GY8A 3SUDA 3SV6A 3M3SA 1EASA 4RT1A 1RRKA 4J1YA 1O2MA 3GCHB 2WPIS 3EDXB 1S0QA 1WBGB 2FEQH 1P9UA 1NM6A 1UCYH 1W0KD 4Z1MD 2FOGA 2HPPH 2FWWA 3CS0A 1EAUA 2PHBA 2PV9B 2FOMB 4LZ4B 2VB0A 2JDID 3U1IB 4F4OC 1V2QT 1O5CB 3H5CB 3RM0H 4GUXA 1OYQA 2ZNKH 3A82A 1EUFA 3PB1E 5F8ZA 6ESTA 1AI8H 3IWMA 3RXDA 2ZHWH 2PUQH 1UO6A 2QV1A 3ZZ7A 2QXJA 3M35A 1GMCG 3T28A 2CV3A 1KXEA 3OAAD 1QBVH 4I8KA 3D62A 2UWLA 1O2HA 9LPRA 3BTDE 1GMDF 3SJIA 4TYDA 3SI3H 1F2SE 1K2I1 3BTME 3DA9B 4NFFA 5K0HA 2HVXA 1G3BA 3LH1A 2UUJB 3SU5A 3ZZ3A 2XBXA 5A0BA 2H6MA 1QTFA 8LPRA 3AW0A 2BY7X 2A45B 2OBQA 2J98A 1DY8A 2L6OA 2BD9A 4B6EA 1N6YA 4O03A 2FTLE 3HK3B 1YLDA 1V2JT 1YBWA 1SGRE 4OS1A 1UTKA 4O9VA 1O2YA 2W6JD 3FFGA 5E0HA 3UPEA 4KKDA 3P8NA 5T6GA 1P06A 2LELA 1K1MA 1O35A 1VITG 3MWIU 1GJ9B 1MBMA 5AF9H 4ISOA 4YLUA 1O32A 3F2FA 5F8TA 1TWXB 3OEED 3N7OA 1KTSB 1E36B 2ANYA 2ZC9H 1P12E 1AFEH 2HVYB 1L0ZA 1IQLA 1JRSA 3LDXH 4AOQA 1Z8GA 1W10U 1QRXA 1BDAA 2FLBH 3OX7U 6GCHG 2EA3A 3GY5A 5L6NH 1YY3A 2KCAA 3AK5A 3RDZA 3ZZCA 1AFQC 4Z6AH 1SGTA 3SGBE 4X2WA 1FQ3A 1C1VH 4DIHH 1NFXA 1Z6JH 2KZ4A 1EQ9A 3BTKE
chains in the Genus database with same CATH topology
1SHYA 2GTBA 1VR1H 1ABJH 1YCPK 3LJOA 3L33A 3U8TH 4J2YB 4ISNA 2JETC 3TJVA 3Q3XA 1TIOA 4BANB 1Q2WA 2FOHA 1BRCE 2AYWA 3BTQE 1CHOG 1BHXF 1DPOA 3OSYA 1W2KH 3MYWA 1CA8B 2WV4A 4MNVA 1XUJA 2BY5X 1DX5M 4HFPB 4XDEA 1ZGIA 2JH6D 1WAYB 3KEEA 1GG6B 1O3MA 4GHTA 1KLIH 1QL8A 1GBBA 3RC5A 3RU4T 1VITH 1O31A 1D3QB 2V3OH 2K7XA 1GVZA 4DGJA 4B2AA 5ETXA 4YT6H 1P2NA 1CGJE 2QYIA 1JOUB 5EG4A 1PPCE 1H4WA 4H6TA 1ZTLA 1D9IA 1TALA 1C1OA 3RMMH 1TBZH 1A7SA 1HAPH 2CJIA 4MPXA 2BDAA 2BZ6H 3STJA 4BXWA 4AYVB 3A7TA 4CRBA 1HAOH 1BTZA 1GHBG 3MO9A 2BLOA 2VWNA 1BMMH 3L6PA 3A89A 1H9HE 2ZU1A 3A7VA 2A7CA 1F5LA 4AX9H 1UTQA 1K22H 5AFYH 4XFQA 1C5RA 1DWBH 4INHA 3TNTA 2PW8H 2C8YB 1GJBB 3BTFE 8GCHF 1GI9B 1C1NA 4HTCH 4FUHA 3UNSA 3PWCA 1EJMA 2TPIZ 1SFQB 5DP9A 4UD9H 4E7RG 1L1GA 5EXNA 1QL9A 2A5AA 4Z0KA 2H5CA 1YF4A 3PLKA 3OTJE 1Y3YA 5DKMA 4JZIA 2OP9A 2ZG0H 1ZMJA 2ZDAH 1QY6A 2RA3A 2ZGCA 4B74A 5BPEA 1GBTA 4Y79A 4ZMAH 4HGCA 2VIDA 3VB6A 1HAVB 1TOMH 4WVPE 1THSH 3F9GA 1IQJA 3T5FH 4A6LA 1OWDA 8KME2 1MU6B 5AVDA 5DP4A 5HGGA 1P57B 1O2WA 2P3TB 3SJKA 3SU4A 1SLWB 3BN9A 4TPIZ 3TK6A 4H42U 1B5GH 5ESBA 2BHGA 1FNIA 1Y3WA 3O8RA 1GJAB 1S84A 2FLRH 2VVVA 1O3NA 2FI3E 1WCZA 1SGNE 1HIAB 1GI5A 3BF6H 1O3EA 1IHSH 3D65E 5A8XA 2H2ZA 4IS5A 2AEIH 3A8AA 1JIMA 3JZ1B 3TJUA 4UFEH 2QXHA 3GDSA 1TGCA 4CRDA 3ATMA 2D1JA 3RXTA 4X1SU 1AFQB 1UTMA 1GDNA 4X6MA 4ZKOU 2C8WB 1K1IA 1V2LT 1C2JA 2C8ZB 3ZVEA 1SPJA 4FUFA 1TGTA 1GMCF 1AKSA 4QT8C 2XNIA 1XMNB 2ZGHA 4INLA 2HOBA 3MH6A 1P0SH 2V0BA 5C2ZA 1WV7H 2JETB 1S82A 4WY3A 4ABEA 1IQHA 1NPMA 4RN6A 3TU7H 3D49H 1P2OA 3NPSA 2NU2E 2OC1A 1UVUH 2HLCA 5TCAA 4UFFH 3RXOA 1O38A 4CRCA 4MNXA 5C5OA 1ELCA 1P2IA 5AFZH 4DOQA 1NN6A 2Z9KA 5DP5A 5E8EH 4DW2U 4ABAA 3VFEA 3V12A 3SJ9A 2BDYA 4FUCA 1S6HA 2FX6A 1DFPA 1GJ4H 1O37A 1XKAC 1P9SA 1JWTA 2ZA5A 2JH0D 4K8YA 3DHKH 1KDQA 3SUEA 1O5AB 2C8XB 1UHBB 1K28D 4ABFA 2Q1JA 4Y8ZA 1NRNH 1CBWC 3RXQA 1K1PA 1O2JA 5DP3A 2BX4A 3VB4A 1EX3A 1VGCC 1P3EA 1GBHA 1BTHH 3M61U 1CSOE 2ZPQA 1Z7KA 1FLEE 1IOEA 4X2VA 1DSTA 1O2TA 3CS7A 3U8OH 4I8GA 2V3HH 1PJPA 5FPTA 5GDSH 1ZPCA 8ESTE 3PLPA 1A0JA 3C1KA 1TNHA 2QGRA 4KP0A 1SVPA 3P70B 4ZH8A 3FZDA 1THRH 2W3IA 3LIWA 3A88A 3SBKA 2EI8A 5EW1H 1DOJA 4U32A 3OU0A 2G4TA 6GCHF 3TPIZ 2GD4B 1PYTD 2P3FH 5EXLA 1T8LA 1EJNA 3H7OA 2WV5A 4Y7BA 1C2DA 1PQ8A 3F68H 2I6SA 3A80A 2TRMA 4CREA 3GCTG 1A5HA 1C2HA 2ODQA 1HAGE 4OS2A 1EXFA 4BTTB 1ZSKA 1Z6EA 3ZZ8A 3GOVB 1GJDB 1TLDA 1AUJA 3SU0A 1GI2A 1HPGA 2F91A 1MH0A 3AAVA 5EW2H 5PTPA 5E2OA 1MD8A 1SI5H 1C5OH 1OSSA 2KAIA 1P05A 1A3EH 1ANCA 1D3TB 4FUGA 4OS6A 1FZZA 2QF0A 1CHOF 1UMAH 1ABIH 5A0AE 2G4UA 1ZTKA 1P11E 3M7TA 4Q7XA 2OUAA 3FZZA 4DVAU 4K69A 2BD2A 1WTHD 3R0FA 3ZVCA 3W94A 3QDZB 1FPCH 3TGJE 2EI7A 1G37A 2BMGB 1BBRE 1MKWK 2FZZA 2HNTE 2OQUA 3OY6U 3ITIA 5TJXA 1NRSH 1AMHA 4UE7H 2F83A 3HK6B 2BD7A 4WXIA 3SOSA 1Y5BT 3BTGE 1ELBA 3MU1A 4MNYA 1O3KA 4A5TS 3A81A 1ETTH 1SBWA 2HALA 2HRVA 4XOJA 5CE1A 2PUXB 1AD8H 5FCRA 4HZHA 3NZIA 1C5WB 1J15A 1OWJA 1QRZA 2FI4E 1LVBA 5LPRA 4PROA 2OCVB 4NFEA 1Q31A 1ELTA 3BTWE 1GPZA 1OOKB 1ZSLA 2ZFTA 5DK1A 3RMOH 1SGEE 3M37A 1TPOA 2IOTA 3MU0A 2Y5HA 1MKWH 1TRMA 3SV8A 3TH2H 4AFQA 1PPEE 4LOYH 1W0YH 1GI4A 4DURA 3K6YA 3VB3A 1GCDA 1W0ZU 5JB8S 1C2MA 1UK4A 2HGTH 1A4WH 2FOFA 2SGAA 1YGCH 2ZCKP 2ZFFH 5JYIA 5LH8A 1C1RA 1MUEB 1GBEA 4KELA 1HJAC 4ZUHA 4ZXYH 2G8TA 5DJ7A 1AN1E 1O2ZA 5GIBA 1UVSH 1QB1A 3I78A 2XRCA 2ESTE 3UTUH 3LGWA 1ZR0A 5E2PA 1BTPA 1GHYH 1KXCA 5HMAA 3URDA 3MH5A 4YM9A 3SQHE 3EBNA 1DDJA 5EODA 1ORFA 3F9HA 3AAUA 1S0RA 3B23B 3SV9A 5EQSA 5A0CA 3ODFA 2J9NA 4IW4E 1O34A 4ISHH 1C5MD 3UFAA 4IN1A 1G30B 1J17T 2QCYA 3AVZA 2BVRH 4IBLH 1CBWB 5FAHA 4CR5A 4AB9A 1VGCB 5F6MA 3FANA 1LVMA 1C5TA 4K1TA 3VXFH 1T32A 2BX3A 2D8WA 2BQ6B 1O2OA 3STIA 1MMJN 2BM2A 1Y59T 1JMOH 2Y82A 4E06H 3TJNA 1LHFH 4D9QA 1O2GH 1C1UH 1UK3A 4X1QU 1SQOA 5C3NA 3T2NA 2AMQA 1ESTA 4NA7A 2DE8A 3RXIA 4BAQB 2FODA 1CQQA 1W12U 1PFXC 1GBIA 4NIWA 4X1PU 1HAZB 1GBMA 1DWDH 2ZTZA 1KTTB 2C93B 4YESB 2FYRA 1NU9A 4I7YH 1EATA 4ABDA 3MFJA 1KXFA 4K2YA 2TGDA 5DPAA 4CHAC 2FXRA 1HAHH 2F3CE 2TGAA 3K6ZA 4TY7A 1KIGH 3RXPA 2ALVA 1C2FA 3F9FA 5LGOA 1VZQH 1QFKH 2ZCLP 1UTOA 5C67A 2EI6A 1BTWA 2BXUH 3SN8A 2PGBB 1XVOA 2ANKH 3UQOA 4XBDA 4KTSA 1O2VA 1WSSH 1EZUC 4JCNA 4FUJA 3E0NB 2F9NA 1O3OA 1UTJA 2AGEX 2VIQA 3QGNB 2AMPA 1B0FA 2GDEH 1EP6A 2ZIQH 2ZPRA 3P8FA 4TWYA 3Q3KA 2F9VA 3A84A 3UOPA 3VB5A 4YOIA 1QQUA 2GT8A 2ZDMA 3ZYDA 3FP7E 1YC0A 2FPZA 2HNTC 4M7GA 1OWIA 4MLFB 2PLXA 3U8RH 3B9FH 3PWBA 2J92A 1GHXH 1ZYOA 2O9QA 2CF8H 2XWAA 3ELAH 1C5QA 1ZGVA 1SC8U 2Z9GA 4B73A 1QJ1B 2A5KA 1ZSJA 5FCKA 4R0IA 1D3DB 1CGHA 4JK6A 3U9AH 2C3SA 1DSUA 1A46H 1C1QA 2VH0A 3ATWA 4FU8A 1WUNH 3S69A 2FYQA 5TCCA 1QJ7B 1SLXB 3P8GA 3A7YA 5DP8A 1KYNA 1DS2E 3GCOA 2BTCE 2AGGX 1O3GA 3LOXA 2W7SA 3RXJA 2Z9IA 2A4RA 1YP9A 3KL6A 5GWZA 2UUKB 3ESTA 1OYTH 1YPMH 4IGDA 1YPHE 2Y80A 1CGIE 1QNJA 4DCDA 1HJAB 1IHTH 3SU6A 4NSYA 2ZGJA 1BQYA 3NCLA 1AE5A 3RXMA 1K21H 7KMEH 1GJ7B 4XSKU 2QN5T 2QIQA 1GBDA 3AW1A 1GHAF 5K7RA 3RXGA 1EZSC 1F0UA 2HPQH 2WYJA 4BXSA 1LHEH 1TQ7B 2BY8X 1T8NA 2F9BH 1P01A 2ZF0H 2GV6A 1MTVA 2VVCA 4WH8A 2SGDE 4AZ2B 2OXSA 3C27B 1MBQA 1MQ6A 3TH3H 4Y10E 1AB9B 1GBLA 4FU9A 2XC5A 5GCHF 4YTAA 2GV7A 2KAIB 2ZWLH 1IQNA 1C5PA 2THFB 4TY6A 2EEKA 2WUBA 1Y3UA 1FAXA 3BEUA 4H6SB 3P95A 3UOUA 3HATH 2FS9A 2TIOA 4X1RU 3S7KB 4RKOB 2ZFQH 3I77A 2ZDKA 3TGKE 1ZPBA 1S83A 1Z71A 1GL1A 1K1NA 1RFNA 2GCTC 1PPFE 1P2KA 1TYNA 1ANBA 5CMXH 1YPJH 1NRPH 2Z3EA 5B6OA 1SGCA 1WQVH 5T3HA 3MNCA 1H9IE 1TE0A 3SNCA 3GY2A 2DUCA 4X1NU 3OYPA 5FX6A 3A8DA 4CHAB 3AASA 5IYTA 1SGFG 1UCYE 1EZQA 2STAE 1C5LH 5I25A 5C1UA 1K1OA 1QL7A 1BMAA 3P92A 1EJAA 2B0FA 2JH5D 2VIPA 3GY3A 1O3BA 3ZV9A 1BJVA 1DVAH 3E16B 5EPYA 4WMFA 1C9TA 2FS8A 2ODYB 2ALPA 1UVOA 2R2MB 1DICA 1SSXA 2SGFE 2CF9H 1GBAA 1TNIA 2W26A 3S9BA 2CXVA 1HV7A 2BLQA 3FP8E 3MU8A 5G4BA 3QGJA 1NTPA 2VGCC 3GISB 1MCVA 4OS7A 2Q6FA 1UTLM 1LHCH 2O8TA 2GX4A 2W5EA 4RSPA 2A31A 3RXCA 3WY8A 1BTYA 1FUJA 3MO3A 3HKIB 1YKTA 1XXDA 2B8OH 2K1QA 5FX5A 2CMYA 1LKAA 2GCHG 2BXTH 2ZZUH 2A4GA 1ZMNA 3UR6A 2FO9A 1QA7A 2WINI 4D8NA 1MTUA 4BAMB 2RDLA 3ZVGA 2Z3DA 1DE7H 3SJOA 2GT7A 1RIWC 1BUIA 3A83A 1P09A 4JZEH 4U30A 2NU0E 2Y6TA 1C5XB 2F9UA 2FP7B 1O39A 1TONA 3MNXA 1WU1A 3ENSB 1QIXB 2A4OA 4GSOA 3BG8A 1IQGA 4AG1A 1E34B 1S6FA 1XUKA 3EYDA 2BQWB 1C2KA 3ZVDA 1YPLH 4ASHA 1RS0A 1RTFB 4AFZA 1HNEE 1WTGH 1GJ8B 2LNCA 1FAKH 1D4PB 2ZGBH 1F5KU 1EPTA 5L2YH 2SNWA 1EOJA 4GPGA 3SU3A 1YYY1 2W3KA 1C5NH 1BMLA 1KXDA 5LPFA 2PKAA 4Y71A 3PMAB 1YPHC 5F03A 3A8BA 4B1TA 3PMBB 2FDAA 1F7ZA 4Q7ZA 1EOLA 1LPKB 1FPHH 1IQIA 4JZ1A 1H8IH 1IQKA 1D6RA 4ZKSU 7GCHG 2J95A 1K1LA 3S7HB 1ARBA 1SOZA 4I8LA 4ZROA 1MKXK 1MZDA 1Z8JB 1CU1A 1O2LA 3SHCH 3LGVA 2A0QB 4NIYA 1XXFA 4MPUA 4FUDA 1O0DH 3DFLA 2BD3A 2VJ1A 3ODDA 4FVBA 1GJ6A 2B7DH 2O8UA 1W7GH 2XBVA 2M5TA 2ULLA 3GY7A 1QCPA 2PR3A 3ZZDA 1DLKB 3SV2H 3EAJA 1HJ8A 2B9LA 4A92A 1G3CA 3NKKA 1E35B 4NA9H 3SW2B 1VCWA 3GYLB 2BD8A 2BDBA 2J38A 3E1XB 2FOBA 3EQ0H 2BD5A 3QLPH 1KXBA 3BV9B 2BDGA 2J2UA 2QXIA 2GCTB 1OPHB 3RC4A 1C2LA 1HDTH 4YT7H 2FESH 1HB0B 1YPGH 4DY7B 1V2PT 2GDDA 3LGIA 4DJZB 5JBCS 2P8OC 1HRTH 4YOGA 1MKXH 2UUFB 1BRBE 1O3JA 1N6XA 2AH4X 3E90B 1TNGA 2H9EH 2VIVA 1MTNC 1EAWA 2G81E 2ZEBA 2SFAA 1VITF 1MU8B 3BG4C 4Q7YA 1OKXA 2FX4A 1AE8H 2AIQA 2I6QA 2SNVA 3HGNA 4AGKA 4B76A 1J9CH 2PGQB 1CT4E 2A1DB 1OP0A 2FOAA 2P94A 1EP5A 7LPRA 5E0JA 2G51A 4AORA 1SGDE 1C2EA 1TGSZ 3SNBA 3A85A 4GCHG 3Q76A 3RLYH 1LVOA 2UWPA 1FY3A 1TGNA 4X2XA 3PO1C 1SB1H 2VGCB 4BAKB 5EQRA 2H1UA 1NY22 1ZJKA 1GMDG 1S85A 5GJ4B 1T4UH 1ARCA 3SZNA 2EC9H 2PKSC 1S81A 4JZDH 1Z8IB 2P16A 2GKVE 4GVUA 1O2XA 2ZQ2A 3L3TA 2STBE 1LO6A 1XX9A 1AVWA 1O5FH 2R2WU 3GYMA 2ZHEH 4XE4A 1MQ5A 1PPZA 4AGJA 4JYVH 3E91A 3B8JA 4X6PA 2Y5GA 3MH7A 2G00A 1RIWB 2BB4A 6LPRA 1AGJA 4ABBA 3QZQA 1MAYA 1W3CA 1C4Y2 1V2OT 3KF2A 4ABIA 1CA0C 1IQEA 2ZGXH 3NUMA 4UDWH 1UVTH 4ZXXH 3PTNA 2O8MA 2OTVA 3O8BA 1L2EA 1AO5A 5DGJA 3QUMP 2ANWA 5EGMA 3SQEE 1JXPA 3NXPA 1THPB 3PROA 2RG3A 1H9LB 3Q00A 4WF8A