1BTZA

Episelection: novel ki ~nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btzA02
2TGAA 2BLWA 4NZQA 4AFSA 4WXIA 3SHAH 3MH5A 1P10A 4YTAA 1O3LA 1IQMA 1ZYOA 1D4PB 3R3GB 2XNIA 1NESE 3PLPA 1DVAH 3RXVA 3AAUA 3MO6A 1TBQH 3NKKA 2WYJA 3BEUA 2BHGA 3MNBA 3OY6U 3TJVA 1P2IA 1DDJA 3LC3A 1LHDH 2PLXA 1TQ7B 2BDIA 2CF8H 3KF2A 2C4FH 3A89A 1O2UA 3ZVCA 1A5GH 3A7XA 3ZZCA 1C2KA 4GCHF 2FWWA 5G4BA 5H4IB 5C20A 4DGJA 1TB6H 2BD8A 3BTTE 5EQRA 4A1XA 1HAGE 3ATIA 1HJAB 2BB4A 2P3FH 5EPYA 2Z9JA 5TJXA 2VIVA 2O9QA 4JZIA 1MCVA 3K6ZA 1BTPA 1QA7A 1GMHG 2BY9X 3RXBA 1T8OA 3OX7U 3ZZDA 1WOFA 1P3CA 1ZMNA 2J4IA 1UVOA 2P3UB 5GDSH 2B9LA 1P2KA 1DXWA 1HAHH 3SJ9A 3HGPA 2ZDLA 4GSOA 4MTBA 3BTKE 1OWJA 4X8TH 3EAJA 1BHXF 4ZKSU 1OYTH 2Y5HA 2QCYA 1G2LA 1C1TA 1GMCF 2TBSA 4NFFA 2RG3A 4FUIA 2ZGXH 1EKBB 1NFWA 4OGYA 1AO5A 3RC4A 1V2RT 3SUDA 1C5SA 2QYIA 2Z9LA 3FP6E 4NCYA 2D2DA 3MU8A 1HAYB 1OWEA 3RU4D 2A32A 1TFXA 3RMOH 4K5ZA 1ARCA 2W7UA 1O2YA 3GYMA 9ESTA 1GJDB 2ZIQH 1N6YA 3FP8E 3EA8A 3MU5A 3K2UA 1C1OA 1DWCH 2Z3CA 2GCHG 2WPKS 1ANCA 3SI4H 1QBNA 1CHOG 1TRNA 1C1PA 1XVOA 4FU8A 4X8SH 1EB2A 3E0PB 4AX9H 1P2QA 2Y7ZA 2ZECA 1LVBA 2V35A 1L1JA 4ABHA 3KQDA 4MDSA 2OC1A 1C2FA 3RMNH 2VIOA 1GMDF 3Q3YA 4MPWA 1THSH 1AFQC 2W5EA 3FAOA 1OPHB 1H9HE 4Y8ZA 4AGJA 3RLWH 2G81E 1AWFH 1GI3A 5PTPA 1FY3A 1NU9A 3U69H 3F9HA 2Y80A 2Z3EA 7KMEH 1V2PT 3QGNB 1AZZA 2TGTA 1FN8A 4IMQA 5GCHG 2VIDA 5A2MH 1ELFA 1O2IA 1BTXA 1IQNA 1DM4B 1QB1A 1VZQH 1XUIA 5C2ZA 1VGCB 1K21H 1O2HA 2H5CA 1GBIA 1FDPA 1UTKA 2PUXB 1HYLA 1BQYA 1GBTA 3H5CB 4OS4A 1KIGH 3M35A 1GHZA 2FOEA 2YOLA 3SV2H 1FLEE 2FX6A 1XXDA 3UFAA 2YNAA 3PLKA 5E8EH 2BDCA 2OBQA 5L2ZH 2BM2A 1SGEE 1C5XB 3ENSB 4XBBA 1EZSC 2J38A 3TGIE 4I8JA 1Y3VA 1MQ5A 1ZMLA 1AB9B 1AVXA 1TX6A 1V2JT 1A3EH 1SC8U 1YLDA 1NRQH 1Y3WA 1YP9A 3A7YA 3PWBA 1DWDH 5JPMH 1RJXB 1GBLA 1UTPA 5EQQA 4CRBA 1ETTH 1L1GA 1EXFA 4NSVA 1FNIA 3PMHB 3QWCH 1GMCG 1AKSA 1O2WA 2F9OA 3PTBA 2QF3A 1NRNH 3P17H 1PPHE 1PPZA 3ZZBA 1E34B 2WINI 2ZP0H 1GBCA 2C8ZB 1GHAF 3ZVAA 3TNSA 4AGKA 4KP0A 1TRMA 1B7XB 2ZU3A 3LGUA 1ZJKA 2ZZUH 2C8WB 2ALPA 3M37A 1KTTB 3M7UA 2WV4A 3LDXH 2V6NA 1ELBA 1S84A 3UNRA 3EE0B 3EYDA 3SUEA 1HLTH 1TIOA 1GDNA 2RCEA 3MO9A 4I8GA 2GV7A 4O3TA 1UCYH 2VVVA 2ZI2H 3TGJE 4WH8A 1BIOA 2BD9A 1RTLA 4D9QA 2ZHDA 1Z7KA 3TJOA 1TONA 4AZ2B 1LVOA 1S6FA 2AIPA 2G52A 3KQEA 1SR5C 4RKJB 4B2BA 1GBAA 3QTOH 1OXGA 2G5VA 2ZNKH 3SJOA 4BANB 5HM2A 8ESTE 2C90B 1NS3A 1TYNA 1QCPA 3VXEH 1H8IH 5J4QA 2WYGA 2AMPA 1Z71A 3GCHC 1EAWA 4Y76A 3UY9A 3SW2B 1HIAA 1MZAA 1N1LA 3VB7A 3R0FA 7GCHG 3SV8A 4ISOA 1TA6A 1P3EA 2FMJA 4IN1A 1HXFH 4NIXA 2A4GA 1QJ1B 5CMXH 3A8CA 1GJ8B 2AYWA 5FXLA 3RXHA 2BX3A 1ELGA 1MBMA 1D3DB 3A7VA 2ODYB 1PPEE 3UUZA 4U30A 2BDAA 2Y6TA 3LPRA 3PYHA 5LGOA 4NA8A 4ABAA 1P8VC 1SGDE 1TNIA 1JIRA 5K0HA 1MTNB 4ABFA 1FY4A 5JB9S 1Z8GA 1EOLA 4Y71A 3MTYA 1E38B 1GBBA 3E91A 2GP9B 3UR6A 1Z8IB 4M7GA 1MUEB 1AE8H 2ZDVH 4D9RA 1O5FH 1O5CB 2OCVB 2EI8A 2V3HH 5DP6A 3RXFA 3S69A 1O3BA 3SJ8A 1VR1H 2FM2A 3A84A 3LJOA 1ID5H 1HFDA 3RXUA 1KLTA 1DWBH 3F9EA 2A2QH 4Y11E 3KEEA 2F83A 1AI8H 1GG6B 3RXDA 2GGVB 3RC5A 1RRKA 2QIQA 4D7GA 3FANA 4Q7YA 3ZZAA 1O32A 1TA2A 1AKSB 1Y5BT 2OXSA 1C5ZB 5AHGH 2I6QA 5HM9A 2AGIX 2BVSH 2SGFE 2QXIA 4ZKNU 3I29A 2F9NA 4LZ4B 1SLVB 2ODPA 1C1VH 1SQTA 3U8RH 2ZF0H 1MAYA 4MVNA 3VGCB 1O38A 5EXMA 1KLIH 2ZU4A 2PKSB 2QXHA 5F8XA 3TJNA 2ALVA 3MNCA 4LZ1H 1NO9H 1HJ9A 1IOEA 4NA9H 2HWLB 1G32B 5F6MA 3P8FA 1GMHF 1H4WA 2P8OB 1V2ST 3T28A 3URDA 4FXGH 5A09A 5I46H 1YPGH 1P2NA 2H6MA 2UWLA 1NU7B 2A2XH 1NRRH 9LPRA 1ZGIA 2G51A 2IJOB 5EOKA 3SGAE 2VH0A 2D1JA 1BTUA 1BTWA 1DS2E 3PB1E 1ABJH 1JXPA 4Q2KA 1HNEE 4BOHA 1EUFA 4B76A 5B6OA 1KY9A 1V2TT 1BJUA 4GHQA 2XWBI 1GJAB 5E2OA 1RGQA 3SU6A 1GI2A 3A80A 1OWDA 1QQUA 1EPTB 4JZEH 1F0SA 8GCHF 3CP7A 3RC6A 1VITF 3M5MA 4X2VA 2FTMA 4TPIZ 4NIVA 3UNQA 2SGAA 3STJA 3ZVGA 1EJNA 2SNWA 4J1YA 4DCDA 1XXFA 1NRSH 1ELVA 2OD3B 4AFUA 5BRRE 4A7IB 4ISIH 3D49H 3A83A 5GJ4B 4OS6A 1G30B 3LC5A 1GBDA 1CHOF 3ESTA 4F4OC 2FYQA 1TRYA 5BPEA 3U8TH 3GY4A 1Q2WA 1Y3XA 3MU0A 1PPBH 2A4OA 2ZFSA 3O8CA 1A4WH 3Q00A 4B1TA 3BF6H 3LKWA 3FVFB 2ZEBA 1KXCA 1BCUH 1CT4E 1RIWB 1GMDG 1ZSLA 5A0AE 5DJ7A 4ABDA 4FU7A 4YOIA 1EP6A 1BBRK 2GV6A 2VIPA 3OSYA 2VWOA 4AB8A 2ZO3H 3EQ0H 2Z9IA 4XSKU 1K1IA 2CHAC 4KTSA 1O3MA 1GGDC 4B74A 1SQAA 1HAOH 1E35B 1FPHH 2GCHF 3SORA 5A8ZA 3OY5U 4AYYB 3D23A 4ESTE 2CHAB 2XBWA 4CREA 1TPOA 4MNWA 4JK6A 1C2EA 4OS1A 1LCYA 1SHYA 2OBOA 3ZZ4A 1WQSA 2JETC 1CO7E 1E37B 1GVZA 2K1QA 1PYTC 2JKHA 2TPIZ 1EX3A 1TBRH 3HK6B 1YCPK 1O2GH 1L2EA 3LGTA 3SHCH 1TNJA 5HMAA 4D8NA 1IQFA 3SO3A 4DIIH 5LH8A 2W3KA 3VFEA 2PSXA 1K9OE 2BD5A 2ZPQA 1UHBA 1GI9B 1GVLA 1LHEH 1EP5A 3LOXA 3ZZ8A 2BQ6B 3F9GA 2BY7X 1UK4A 2A5IA 1NFYA 1O2MA 1A0LA 1CA8B 4GLYA 3NCLA 2NU1E 1EAIA 2ZFTA 4I32A 2O8MA 2Y7XA 2ZGHA 4XOJA 1A7SA 1FN6A 2WPHS 1DANH 1T4VH 5DG6A 1O5AB 3FP7E 3IG6B 4GCHG 1C2GA 1YF4A 3BIUH 2ZFQH 1DLKB 2FOHA 1O5BB 4NFEA 1BMAA 1UTMA 3UPEA 1W3CA 1EQ9A 1BMMH 1MKWH 3UQVA 1A0HB 2P3TB 1AQ7A 1BA8B 3RXIA 1XUFA 2Y5GA 4MG3A 1QFKH 2TIOA 1FV9A 1LPZB 2D8WA 2GVFA 3LGWA 3LH3A 8GCHG 5GPIB 2CGAA 5IDKA 2J92A 1H8DH 3GCNA 5EXNA 1SGFA 4CBNA 1IQGA 2HPPH 2GKVE 2AIQA 5DGJA 2AFQB 3GCTF 1ZRBA 4R0IA 2PGBB 3BV9B 3U9AH 3HKIB 1MTNC 7GCHF 3ODDA 1ZMJA 5HYOA 5L6NH 3ZYEA 1AUJA 2WV5A 4BTIB 2XTTB 1HRTH 2FO9A 1E0FD 1JBUH 4BXSA 5DO4H 1D3TB 2BMGB 4GHTA 4ZMAH 4Z0KA 1IQEA 3PLBA 3ZZ7A 3V0XA 2JH5D 5ETXA 1TNGA 4TY6A 1QURH 4X2XA 2CMYA 4O97A 4Y0YE 3V12A 5EW1H 1SLWB 1ELEE 1D9IA 1GI1A 1GPZA 3L6PA 1B5GH 2SNVA 2QN5T 1TMBH 5FX6A 1UCYK 2R0LA 4X1NU 1NM6A 1MKXH 1CHGA 1BZXE 4CRCA 5TCCA 1KXDA 2OC7A 1Y3YA 2WPLS 2BD3A 5J4SA 2ZDKA 2ODQA 1O3KA 1CQQA 3E8LA 1Q31A 4JYTA 1NRPH 1O3JA 1ZPZA 4Y7BA 4CRGA 2R9PA 3D62A 1O0DH 1FY5A 3PO1B 4WH6A 1K2I1 2PKAB 1TGNA 1MBQA 4JYUH 4CHAB 1KYNA 1CBWC 1AB9C 3ZZ6A 5JBTA 2A5AA 1EATA 1ZPBA 1FJSA 2DE8A 2G5NA 1ESTA 1VITH 1BRCE 5L30H 4OS5A 1CGIE 1XX9A 3LONA 4A92A 3M7TA 4YT6H 3LH1A 4I8HA 4Y7AA 1GL0E 4YLQH 3UOPA 5JDUB 3PO1C 1ZZZA 3BTFE 2OUAA 1FZZA 2ESTE 4B73A 1C1QA 1P03A 4LOYH 4UFFH 4FUCA 1F7ZA 4A1VA 4FVBA 1TMUH 2BXUH 2ZFFH 2FOFA 3M7QA 1EOJA 1WSSH 4Q7ZA 3HPTB 1LVYA 1J8AA 1HB0B 2BYAX 3OYPA 5HGGA 4WMEA 2GZ9A 1QRZA 4GAWA 1P02A 1LHFH 4SGAE 4GPGA 1MQ6A 1ZSJA 1BBRH 1K1JA 2H9HA 3SNEA 1GI5A 4Y79A 3UIRA 4YO9A 2FI5E 4GVUA 3GY5A 1LQEA 1TPAE 2RA3A 4O3UA 4X2WA 2FPZA 1FUJA 4E7RG 2VIQA 1PQ7A 1H1BA 3RXPA 1PFXC 5SGAE 1CA0B 1IQJA 1SG8B 2J2UA 4NZLA 1RS0A 2ANYA 4TY7A 1GBJA 4J2YB 2HGTH 1DFPA 1UVPA 1C9PA 2TGDA 1SGTA 4WF8A 1HBTH 2PSYA 2SGEE 1BRAA 5DP9A 2Y81A 2B8OH 1KXFA 1OP8A 2RA0A 2Y5FA 2HNTC 3AVZA 7ESTE 2EC9H 2R2WU 1C5MD 1PPFE 5FCRA 1EB1H 2PFEA 2PKSC 2UUJB 4FUHA 2Y82A 3T5FH 1DPOA 3P70B 3PROA 1YPJH 1P04A 2TGPZ 2OQUA 1EZXC 3RM2H 5FBEA 4K3JA 3BTWE 3LJJA 5DP3A 1MU8B 1N8OB 1FXYA 4Z6AH 3GICB 3K65B 3P8OA 3SV6A 1MMJN 3F6UH 1GHAG 1E36B 2FIRH 3I78A 4X1QU 1Z8JB 1MTWA 1UJ1A 3TH4H 3BSQA 2IPHA 2A7JA 2QAAA 4CR5A 5FAHA 1J15A 4H42U 1ETRH 2XCNA 3GY2A 4X6OA 3O8BA 3HATH 1K1PA 5CHAC 1ZSKA 1QJ7B 5AFZH 3T29A 1XUGA 1L4DA 2C3SA 4IC6A 1BTZA 2IOTA 1H9LB 2QV1A 3RU4E 2ZDNA 1Z6JH 1ANDA 1QA0A 3Q3XA 3TNTA 3KN2A 3F1SB 1FIZA 1WQVH 2PUQH 3MH4A 2ZHEH 1MTSA 3PMBB 1OP0A 2FOMB 1KLJH 1EZQA 1UTQA 1Y3UA 3NPSA 1OS8A 3M36A 3RXSA 2H5DA 1P05A 1S81A 1CBWB 2ZA5A 3RXKA 4YZUA 3ZVBA 2FS9A 2ILNA 2FS8A 2B0FA 1C5NH 4X6PA 1YC0A 5T6GA 1YPMH 4CRDA 2BDGA 2G8TA 4ASHA 2R2MB 8LPRA 1O2ZA 3MO3A 1TWXB 2THFB 2A7HA 3Q3KA 3MNSA 2XBXA 1BB0B 2BVXH 2FI3E 1TGCA 2UWOA 3SV7A 1PQ5A 1KDQB 5FBIA 1TOCB 3KQCA 1MD7A 3RUOA 1YLCA 1HUTH 1FAXA 1ESAA 1HAIH 1YPHC 1ANEA 5JBAS 2A1DB 1GCTB 1UTJA 1SOTA 2ZGBH 3MFJA 1V2LT 2EI6A 4UE7H 3P8NA 2AMDA 1IQLA 1AWHB 1A5HA 3DFJA 1VCPA 1UVTH 1O3HA 1P01A 4A1TA 3M61U 1CU1A 2BY5X 1KXBA 2XYAA 1YPLH 3V3MA 1S82A 2VU8E 2ZKSA 1FI8A 4CRFA 1ELAA 1QBVH 1A5IA 1ZRKA 2ZHWH 1GJBB 1F0UA 1LHCH 1ZJDA 2J9NA 2BDBA 1DY9A 1ELDE 3MNXA 2XBYA 3SU0A 1GHXH 1WTGH 3A85A 1WUNH 1K1NA 3A82A 3U1JB 3SV9A 4ABBA 4WJG2 1F5LA 6CHAC 3A7ZA 3LGIA 4UFDH 1O2QA 3U98H 1AD8H 3C1KA 1G3BA 5FPYA 3RXGA 2QY0B 4AYVB 1XVMA 1SGYE 3BG4C 2OQ5A 1DUEA 1GJCB 4YESB 3GCHB 1FAKH 1LKBA 3SQHE 4YT7H 3N7OA 3SJKA 3BTME 2ULLA 1OX1A 1TX8A 3EA9A 1BT7A 2ANWA 4KGAA 2HLCA 5E2PA 1OWKA 5JBCS 1ANBA 1GVKB 3AW0A 3O8RA 2VWNA 6ESTA 3E16B 1IHTH 2P8OC 3GISB 4DIHH 4CR9A 4DJZB 2FOBA 3BEIB 4DW2U 3TJUA 4BAOB 4BNRA 2SFAA 1J14A 1IQKA 1AUTC 1C5PA 1MKWK 4H6SB 2FOGA 1C2IA 2SGDE 4CH2B 1AZ8A 1SFQB 3LGVA 4CHAC 2DE9A 1GI4A 1UVSH 1ZHPA 5C1UA 3UREA 2NWNA 4YM9A 3QGJA 1BDAA 4NIWA 2A0QB 2QA9E 1DSTA 1QIXB 2WPMS 1BHXB 1O3PB 4K2YA 4NSYA 3RM0H 2UUYA 4HTCH 3ZV9A 1GG6C 3S0NA 2FOCA 1JWTA 1HIAB 2F9PA 4HGCA 1YGCH 1F2SE 3A81A 1V6DA 3ZVFA 5EQSA 1TGSZ 2P95A 3MI4A 1EAUA 4ZXXH 4FUDA 2NU0E 3B9FH 2H9TH 2Z9KA 4B75A 3E90B 4OS7A 4U01A 3MYWA 4WVPE 3RXTA 1O3GA 1GHBF 4NA7A 1BJVA 2AH4X 4ZAEA 1O2KA 1W0YH 1QJ6B 4RKOB 1SQOA 6GCHG 3GY3A 3OTJE 1ZGVA 3Q76A 1AHTH 5C1XA 1MAXA 2FLBH 1AU8A 3RDZA 3KIDU 1C2JA 1DXPA 2Q6FA 3ZVEA 4BAQB 2W3IA 1AE5A 1DLEA 2Z3DA 1OYQA 3VB3A 5EG4A 2BDHA 3TITA 4BTTB 2KAIA 1AY6H 1CGJE 1HV7A 1H9IE 4IN2A 4GUXA 1TLDA 1EZUC 5CHAB 4IBLH 4O9VA 1DOJA 1TQ0B 3ATMA 4ABEA 1N6XA 3TK9A 1SOZA 2M5TA 4MQAA 1O3DA 4IS5A 3JZ2B 1XUJA 1SVPA 4UFEH 2BXTH 4TYDA 2STBE 4ZXYH 2GZ7A 2RDLA 3SZNA 1C5VA 2DUCA 3PMJA 5FCKA 1PQAA 3ODFA 3LT3A 1TGTA 3UWJH 1MH0A 1NY22 2ZU5A 2FYRA 3VB4A 1EPTC 1C1SA 1EASA 1LQDB 2P93A 1C4V2 3GDSA 1GHYH 4UDWH 5C3NA 1C2LA 2QXGA 1TBZH 1S83A 4X6NA 1HJ8A 2QF0A 1WU1A 2BOKA 4D76A 5LPEA 1IAUA 1W7GH 1ESBA 1ABIH 3O8DA 1LO6A 4FUEA 1QL9A 4ABJA 1O37A 3ZZ5A 4TWYA 2VWMA 3PTNA 4B71A 4XE4A 2B5TB 3UR9A 1LDTT 5F8ZA 3B23B 2ANMH 3K6YA 3T26A 3A7TA 1ZR0A 2JETB 3GYLB 1RTKA 1F92A 2XC5A 4XBCA 2P59A 5DP5A 1NROH 3KQBA 3P92A 1KXEA 1JMOH 4X1SU 2I6SA 3DD2H 1ARBA 3C27B 1QTFA 1OKXA 2A5KA 1QHRB 1O5DH 1OOKB 2OLGA 2VH6A 1O2NA 2ZU2A 3LIWA 2ZG0H 4HZHA 1W0ZU 1C9TA 4X8VH 1C1RA 2ZDMA 2ZFPH 1UTNA 2BD7A 4BAHB 3TH2H 1AVWA 1P2MA 3KGPA 2Z94A 1ZOMA 4YLUA 5IYTA 4Q7XA 1P57B 3QO6A 1L4ZA 1C5YB 1SGFG 5GCHF 4B2CA 3Q77A 2ZHQH 1AIXH 1GDQA 1O3CA 1SB1H 1LMWB 5DK1A 1KDQA 1SGRE 2ZCHP 1C5LH 3VB5A 1QR3E 2R3YA 2FI4E 2ZCKP 2STAE 4WXVA 3QDZB 5T6FA 1UK2A 2WUCA 2QXJA 1XM1A 3RXEA 4Y10E 2ZC9H 2UUFB 3RXLA 4MNYA 2XXLA 3OU0A 2ZFRH 1HGTH 4IW4E 1J9CH 1V2MT 3BEFB 1S85A 3GY6A 6LPRA 1P9UA 3HGNA 4ZH8A 1UO6A 2GMTB 1UVUH 4KTUA 1A1RA 2JH6D 3NWUA 1BRBE 3S9CA 5E0JA 2ZHFH 3QLPH 4R8TB 4DOQA 1SGPE 5EW2H 4FUJA 3F68H 2BX4A 3ATWA 1TABE 3D65E 1FQ3A 1VJ9U 3G01A 3RXOA 4X6MA 2ZCLP 3DUXH 4Y8XA 3V7TA 1THRH 3M5LA 4FU9A 3TK6A 1YPKH 4ABGA 4ISNA 1T8LA 1V2UT 1BTHH 1YCPH 4KKDA 1SSXA 1D3PB 1P12E 2ZPRA 1UTLM 4XBDA 1IQHA 1KSNA 4Y6DA 3M3TA 4LXBH 1SGQE 3S9AA 1L0ZA 1SGIB 4Q80A 3K9XB 1JRSA 4U2WA 3FFGA 2GDEH 3M3VA 2G4UA 4KTCA 3SNBA 5ESTE 3CS7A 1O39A 1MTVA 1ZHMA 1W8BH 1GL1A 5FHTA 2C93B 3L3TA 1MU6B 2GT7A 3SNCA 2Q1JA 2F91A 3I77A 1A2CH 3QZRA 3MHWU 1C1WH 1NPMA 5E0GA 2XC4A 3TK5A 3E0NB 1GI8B 1HAXB 2YNBA 4K60A 1GJ5H 1JRTA 2BLOA 3BG8A 2XW9A 3QN7A 3TGKE 4WY3A 2AMQA 2A4RA 2UUKB 3TH3H 1SGCA 2HPQH 1QGFA 2VVUA 2J34A 2AGEX 1QL7A 1V2NT 2PHBA 1P09A 3A8DA 3A8AA 1C4U2 2GT8A 5C5OA 5LPRA 1QBOA 3GCOA 3RXCA 5DP4A 3SU1A 1ZTJA 3SU3A 1W14U 3TU7H 1S5SA 1ZPCA 1K1MA 5FPTA 3QTVH 3RXQA 2AEIH 1V2QT 1DSUA 1YYY1 2HNTE 1QB6A 3KCGH 1K28D 2FZZA 3SU2A 3E3TA 4UD9H 1T8NA 2OINA 3U8OH 1O2SA 1SPJA 4JZFH 4PROA 4FVDA 2Q6GA 3P95A 3ZVDA 3URCA 2GMTC 1C5TA 3EDXB 1CT2E 4AFZA 4JYVH 5JBBS 1T7CA 1WCZA 1ORFA 1RXPA 2OC0A 2PGQB 3DT0H 3E1XB 1D6RA 3SGBE 1J17T 1C5WB 1HPGA 1QNJA 2BD4A 3GOVB 4A5TS 3IITA 1BMLA 1Y5AT 3UQOA 5C1YA 4MLFB 3M5OA 1ZTKA 4NGAH 4VGCB 1OWHA 1FIWA 2NU2E 2SGPE 5EGMA 1YKTA 2V0BA 3E6PH 3TVJB 1TX7A 2W26A 1P2OA 1EJAA 2P16A 1T4UH 1YCPM 4JK5A 1F5RA 1NN6A 3VPKA 1ZTLA 1JOUB 1GBMA 1BOQA 1D6WA 2D26C 3A7WA 3MOCA 4BTUB 1AFQB 1Q3XA 3BN9A 2Z7FE 1PYTD 2XWAA 3M5NA 2VWLA 2WUBA 5FX5A 1C1NA 1TOMH 1GI7B 1MTUA 1O2XA 2G55A 3SI3H 3GY8A 1HCGA 3H7OA 1N8OC 5LPFA 4UEHH 4XFQA 1T8MA 2ZWLH 1BBRE 5GWZA 1O2PA 5AVDA 2F9VA 4H6TA 5A8XA 1RTFB 1A46H 1QRXA 1AMHA 3A87A 1TPPA 3F9FA 5JYIA 1BITA 1TNKA 4SGBE 1TNHA 3AW1A 1KXAA 1SLUB 1TMTH 2R0KA 3RMLH 3GDVA 2FX4A 4ISLA 8KME2 3W95A 1DT2A 4I8KA 4DURA 2GCTB 1G9IE 1HXEH 2GX4A 2H1UA 1MCTA 1O5GH 2WPJS 4K8YA 4ZROA 1V2OT 1F0TA 1ELTA 4ZHAA 4ZHMU 2PV9B 4I7YH 4X1RU 3MU1A 1Y5UT 3STIA 2FXRA 1J16A 4THNH 1Y8TA 3GY7A 4RSPA 3RMMH 3VXFH 1C2MA 4NWLA 3SUFA 4U32A 4UFGH 1ELCA 4XDEA 3MH7A 2CJIA 5C67A 3HK3B 2GCTC 1GBHA 1C2DA 1GJ6A 5GXPA 2F9BH 1P9SA 1GJ9B 4DVAU 1O31A 1P06A 1PQ8A 1HAVA 1O30A 4VGCC 2BVRH 5L2YH 1X7AC 1UTOA 1YPHE 6GCHF 1O35A 3SUGA 4I31A 2BLQA 1GWAA 5TCAA 1BMNH 3MU4A 3SNDA 2O8WA 1A0JA 1B0EA 1SHHB 3RXJA 1OWIA 2ZDAH 2BDYA 3SQEE 5E0HA 1LPGB 1GJ4H 4FUBA 2HNTF 4DY7B 4K1EA 1W10U 1K22H 2NU3E 1AFEH 1NFUA 4DT7B 2H9EH 1O2TA 2A4QA 4K1TA 4JZ1A 5FPSA 1Z1JA 3T62A 1O3AA 1IHSH 3IWMA 1UCYE 2OC8A 3T27A 1O36A 4WWYA 1C1UH 1FY8E 1A3BH 1DICA 1GBKA 2AGGX 3T2NA 1WV7H 1TAWA 4CBOA 1RD3B 4E05H 4CH8B 5AF9H 4RN6A 1HJAC 1ACBE 1O5EH 1F5KU 1C5OH 1CVWH 1U6QA 1UK3A 2VGCB 1FONA 3NUMA 1CGHA 1P0SH 2EEKA 1PPCE 2FESH 2PR3A 3UWIA 2PTCE 2OP9A 2ZGJA 3UOUA 4LK4A 1HAPH 4BAMB 3AAVA 4INHA 5DKMA 2O8UA 3H7TA 4MPVA 2FLRH 2XC0A 1LKAA 5T3HA 3LGYA 1O34A 4AOQA 1BTYA 5C5NA 4ZUHA 2OTVA 1C5UA 1WBGB 1S6HA 2XBVA 1SMFE 1LHGH 1P2JA 2AS9A 3NXPA 2PWXA 4FUGA 5ESBA 1W11U 2J95A 1S0RA 1SLXB 1TNLA 1B0FA 3QX5H 3GDUA 1GHWH 3ELAH 3ATKA 3FZDA 5AFYH 3SOSA 1G37A 3GCTG 4A6LA 1EJMA 2C8YB 4I33A 3BTDE 2HVXA 1O2LA 2Z9GA 2QGRA 2VB0A 1GI0A 1UHBB 2TRMA 4Y0ZE 1Y59T 2R3UA 1BUIA 5EODA 1NFXA 4INKA 6CHAB 1THPB 2ANKH 1G3DA 2O8LA 2ZU1A 1V2VT 1EPTA 1DE7H 1FPCH 2P94A 4AFQA 1O2RA 2ZGCA 1K1OA 5CE1A 2HALA 1GCDA 4E7NA 2VIWA 3ZYDA 1VCWA 4AORA 2CN0H 1FMGA 1NTPA 4KELA 1JIMA 1DY8A 3HKJB 1SFIA 2CXVA 2G4TA 1P11E 2GDDA 5JB8S 4ISHH 1O2OA 1W7XH 1XMNB 1LVMA 1T31A 2FODA 4AB9A 1ZLRA 4IC5A 1VJAU 1CT0E 1XKBC 3A8BA 3SGQE 2Z6BD 2GZ8A 3TIUA 2FOAA 3B8JA 2VVCA 1T32A 1NZQH 3BTGE 1BRUP 1GBEA 2VJ1A 2BY8X 1GCTC 1SGNE 5DPAA 1C2HA 2LNCA 2BY6X 3S9BA 1SL3A 4AG2A 1FY1A 4X0WU 4NWKA 3DA9B 2H2ZA 2A7CA 3P6ZB 1DX5M 3RLYH 1UMAH 1A61H 1WAYB 4MPXA 1G3EA 1K1LA 1G36A 1TE0A 1CE5A 4X1PU 4JCNA 1F0RA 3MMGA 3SBKA 5EPNA 1MKXK 1LPKB 1S0QA 3UTUH 4YOJA 4JMYA 2BQ7B 2NU4E 2AERH 1AVGH 1GGDB 3RXAA 1W13U 3MWIU 4OGXA 2F3CE 4HI3A 2W7SA 3SU4A 2BQWB 2A45B 1IQIA 1GDUA 2JH0D 3QK1A 3MH6A 2ZQ1A 4NIYA 3M3SA 1DWEH 3BTHE 1DUAA 1Z6EA 2PTNA 2HOBA 2FP7B 1DITH 4D7FA 4MPUA 3S7HB 2PKAA 2VGCC 2ZTXA 1QRWA 4ZKRU 1Z8RA 4WMFA 1W2KH 4ZKOU 2LPRA 1NT1A 1TALA 1HAVB 2GTBA 4BAKB 1OP2A 2PW8H 3TLOA 1M9UA 2G00A 7LPRA 3FZZA 2FDAA 4MNVA 3VEQB 2HRVA 3KHVA 3SJIA 1TGBA 1O3EA 2A31A 5ABWA 1CA0C 2FEQH 3DFLA 3JZ1B 1G2MA 2BTCE 4BXWA 1YBWA 3VB6A 2EI7A 1YPEH 4WMDA 1MD8A 1MZDA 5EXLA 1QY6A 2ZPSA 1V2KT 4CRAA 4YOGA 2B7DH 3CENA 1RIWC 1LTOA 3WY8A 3PV4A 3ZZ3A 2ZQ2A 4JZDH 2BZ6H 3RU4T 2KAIB 1VITG 4INLA 5HXFA 1INCA 1PJPA 1L1NA 2V3OH 4TPYA 3LU9B 1O2VA 2WPIS 3L33A 4AN7A 2VINA 1VGCC 5EU8A 3BTQE 1HDTH 2ZTYA 1GHBG 2BZAA 1AN1E 4K8BA 1O3NA 1W12U 1GI6A 1GHVH 3U1IB 2O8TA 3NZIA 3ATLA 5DP8A 1TPSA 1C4Y2 4NG9H 1RFNA 3EA7A 4IMZA 1XUHA 3PMAB 3PWCA 4AG1A 4FUFA 3SU5A 5A8YA 5A0BA 4UONA 1G3CA 4HFPB 1KTSB 1XKAC 4K1SA 1WYKA 4X2YA 5K7RA 2XRCA 1XUKA 2SGQE 1O3IA 3ZV8A 3BTEE 1D3QB 1Z1IA 1SBWA 2IN2A 3RP2A 1O3FA 4H4FA 3BIVH 1AGJA 1GBFA 1O2JA 2J94A 3W94A 2VNTA 1SI5H 4E06H 3NK8A 1V3XA 3T25A 4MNXA 3PM3A 3QZQA 4F49A 2QC2A 4TWWA 5DP7A 3V13A 1QQ4A 3SNAA 3P8GA 3A86A 2EA3A 1C5RA 3BG4B 1GJ7B 4I8LA 2BD2A 1WTHD 4O03A 3RXRA 5A0CA 1EAXA 2UWPA 1ETSH 3DHKH 4DG4A 3ITIA 1NC6A 1OSSA 3VGCC 2C8XB 1YM0A 4OS2A 2FTLE 1CSOE 3ZZ9A 2CF9H 1C1MA 2GD4B 2Q6DA 4IGDA 2ZTZA 5F8TA 2ASUB 4Y8YA 5F03A 1O33A 5GIBA 3A88A 1C5QA 3UNSA 1O3OA 4X8UH 1PPGE 3TPIZ 3S7KB 3CS0A 3RXMA 5T6DA 3SN8A 1ZHRA 4K69A 3AASA 3KNXA 4ABIA 3EGKH 2XCFA 1QL8A 4B2AA 4ZHLU 1VCQA 3QUMP 4QT8C 2CV3A 2BOHB 1HAZB 1V2WT 3KL6A 2F9UA 2BLVA 5I25A 1QB9A
chains in the Genus database with same CATH superfamily
2TGAA 2BLWA 3KYGA 4NZQA 4AFSA 4WXIA 3ZIAD 3SHAH 3MH5A 1P10A 4YTAA 1O3LA 1IQMA 1ZYOA 3CNRA 1D4PB 3R3GB 2XNIA 1NESE 3PLPA 1DVAH 2J97A 3RXVA 3AAUA 2KFWA 3MO6A 1QZ8A 1TBQH 4I86A 3NKKA 2WYJA 3BEUA 2BHGA 3MNBA 3OY6U 3TJVA 1P2IA 1DDJA 5IK2D 3LC3A 2KCPA 1LHDH 2PLXA 1TQ7B 2BDIA 2CF8H 3KF2A 2C4FH 3A89A 1O2UA 3ZVCA 1A5GH 3A7XA 3ZZCA 1C2KA 4GCHF 2FWWA 5G4BA 5H4IB 5C20A 4DGJA 1COWD 1TB6H 2BD8A 3BTTE 5EQRA 4A1XA 1HAGE 3ATIA 1HJAB 2BB4A 2P3FH 5EPYA 2Z9JA 5TJXA 2VIVA 2O9QA 4JZIA 1MCVA 3K6ZA 1BTPA 1QA7A 1GMHG 2BY9X 3RXBA 5EIYA 1T8OA 3OX7U 3ZZDA 1WOFA 1P3CA 1ZMNA 2J4IA 1UVOA 2P3UB 5GDSH 2B9LA 1P2KA 1DXWA 1HAHH 3SJ9A 3HGPA 2ZDLA 1W0JD 4GSOA 4MTBA 3BTKE 1OWJA 4X8TH 3EAJA 1BHXF 4ZKSU 1OYTH 2Y5HA 2QCYA 1G2LA 1C1TA 1GMCF 2TBSA 4NFFA 2RG3A 4FUIA 2ZGXH 1EKBB 1NFWA 4OGYA 1AO5A 3RC4A 1V2RT 3SUDA 1C5SA 2QYIA 2Z9LA 3FP6E 4NCYA 2D2DA 3MU8A 1HAYB 1OWEA 3RU4D 2A32A 1TFXA 3RMOH 4K5ZA 1ARCA 2W7UA 1O2YA 4FETA 3GYMA 9ESTA 1GJDB 2ZIQH 1N6YA 3FP8E 3EA8A 3MU5A 3K2UA 1C1OA 1DWCH 2Z3CA 1NBME 2GCHG 2WPKS 1ANCA 3SI4H 1QBNA 1CHOG 1TRNA 1C1PA 1XVOA 4FU8A 4X8SH 1EB2A 3E0PB 4ACBA 4AX9H 1P2QA 2Y7ZA 2ZECA 1LVBA 2V35A 1L1JA 4ABHA 3KQDA 4MDSA 2OC1A 1C2FA 3RMNH 2VIOA 1GMDF 3Q3YA 4MPWA 1THSH 1AFQC 2W5EA 3FAOA 1OPHB 1H9HE 4Y8ZA 4AGJA 3RLWH 2G81E 1AWFH 2W6JD 1GI3A 5PTPA 1FY3A 1NU9A 3U69H 3F9HA 2Y80A 2Z3EA 7KMEH 1V2PT 3QGNB 1AZZA 2TGTA 1FN8A 2JDID 4IMQA 5GCHG 2VIDA 5A2MH 1ELFA 1O2IA 1BTXA 1IQNA 1DM4B 1QB1A 1VZQH 1XUIA 5C2ZA 1VGCB 1K21H 1O2HA 2H5CA 1GBIA 1FDPA 1UTKA 2PUXB 1HYLA 1BQYA 1GBTA 1MABB 3H5CB 1KIGH 4OS4A 3M35A 1GHZA 3GS9A 2FOEA 2YOLA 3SV2H 1FLEE 2FX6A 1XXDA 3UFAA 2YNAA 3PLKA 3N7EA 2OBQA 2BDCA 2J98B 5E8EH 2BM2A 5L2ZH 1SGEE 1C5XB 3ENSB 4XBBA 1EZSC 2J38A 3TGIE 4I8JA 1Y3VA 1MQ5A 1ZMLA 1AB9B 1AVXA 1TX6A 1V2JT 1A3EH 1SC8U 1YLDA 1NRQH 1Y3WA 1YP9A 3A7YA 3PWBA 1DWDH 5JPMH 1RJXB 1GBLA 3OEED 1UTPA 1SKYE 5EQQA 4CRBA 1ETTH 1L1GA 1EXFA 4NSVA 1FNIA 3PMHB 3QWCH 1GMCG 1AKSA 1O2WA 2F9OA 3PTBA 2QF3A 1NRNH 3P17H 1PPHE 1PPZA 1YWUA 3ZZBA 1E34B 2WINI 2ZP0H 1GBCA 2C8ZB 1GHAF 3ZVAA 3TNSA 4AGKA 4M9FA 4KP0A 1TRMA 1B7XB 2ZU3A 3LGUA 1ZJKA 2ZZUH 3OEHD 2C8WB 2ALPA 3M37A 1KTTB 3M7UA 2WV4A 3LDXH 2V6NA 1ELBA 1S84A 3UNRA 3EE0B 3EYDA 3F2GA 3SUEA 1HLTH 1TIOA 1GDNA 2RCEA 3MO9A 4I8GA 2GV7A 4OM9A 4O3TA 1UCYH 2VVVA 2ZI2H 3TGJE 4WH8A 1BIOA 2BD9A 1RTLA 4D9QA 2ZHDA 1Z7KA 3TJOA 4ASUD 1TONA 4AZ2B 1LVOA 1S6FA 2AIPA 2G52A 3KQEA 1SR5C 4RKJB 4B2BA 1GBAA 3QTOH 1OXGA 2G5VA 1E1RD 2ZNKH 3F3BA 3SJOA 4BANB 5HM2A 8ESTE 2C90B 1NS3A 1TYNA 1QCPA 3VXEH 1H8IH 5J4QA 2WYGA 2AMPA 1Z71A 3GCHC 1EAWA 1FX0B 4Y76A 3UY9A 3SW2B 1HIAA 1MZAA 1N1LA 3VB7A 3R0FA 7GCHG 3SV8A 4ISOA 1TA6A 1P3EA 2FMJA 4IN1A 1HXFH 4NIXA 2A4GA 1QJ1B 5CMXH 3A8CA 1GJ8B 2AYWA 5FXLA 3RXHA 2BX3A 1ELGA 1MBMA 1D3DB 3A7VA 2ODYB 1PPEE 3FN8A 3UUZA 4U30A 2BDAA 2Y6TA 3LPRA 3PYHA 5LGOA 4NA8A 4ABAA 1P8VC 1SGDE 1TNIA 1JIRA 5K0HA 1MTNB 4ABFA 1FY4A 5JB9S 1Z8GA 1EOLA 4Y71A 5DSFA 3MTYA 1E38B 1GBBA 3E91A 5HIZA 2GP9B 3UR6A 1Z8IB 4M7GA 1MUEB 1AE8H 2ZDVH 4D9RA 1O5FH 1O5CB 2OCVB 2EI8A 2V3HH 5DP6A 3RXFA 3S69A 1O3BA 3SJ8A 1VR1H 2FM2A 3A84A 3LJOA 1ID5H 1HFDA 3RXUA 1KLTA 1DWBH 3F9EA 2A2QH 4Y11E 3KEEA 2F83A 1AI8H 1GG6B 3RXDA 2GGVB 3RC5A 1RRKA 2QIQA 4D7GA 3FANA 4Q7YA 3ZZAA 1O32A 1TA2A 1AKSB 1Y5BT 2OXSA 1C5ZB 2YMSC 1WDIA 2I6QA 5AHGH 5HM9A 2AGIX 2BVSH 2SGFE 2QXIA 4ZKNU 1H8HD 3I29A 2F9NA 4LZ4B 1SLVB 2ODPA 1C1VH 1SQTA 3U8RH 2ZF0H 1MAYA 4MVNA 3VGCB 1O38A 5EXMA 1KLIH 2ZU4A 4TT3D 2PKSB 2QXHA 5F8XA 3TJNA 2ALVA 3MNCA 4LZ1H 1NO9H 1HJ9A 1IOEA 4HG6A 4NA9H 2HWLB 1G32B 5F6MA 3P8FA 1GMHF 1H4WA 2P8OB 1V2ST 3T28A 3URDA 4FXGH 5A09A 5I46H 1YPGH 1P2NA 2H6MA 2UWLA 3VG8A 1EFRD 1NU7B 2A2XH 1NRRH 9LPRA 1ZGIA 2G51A 2IJOB 5EOKA 3SGAE 2VH0A 2D1JA 1BTUA 1BTWA 1DS2E 3PB1E 1ABJH 1JXPA 4Q2KA 1UW7A 1HNEE 4BOHA 1EUFA 4B76A 5B6OA 2WV9A 1KY9A 1V2TT 1BJUA 4GHQA 2XWBI 1GJAB 5E2OA 1RGQA 2VBCA 3SU6A 1GI2A 3A80A 1OWDA 1QQUA 1EPTB 4JZEH 2RFKC 1F0SA 8GCHF 3CP7A 3RC6A 1VITF 3M5MA 4X2VA 2FTMA 4TPIZ 4NIVA 5C0UA 3UNQA 2SGAA 3STJA 3ZVGA 1EJNA 2SNWA 4J1YA 4DCDA 1XXFA 1NRSH 1ELVA 2OD3B 4AFUA 5BRRE 4A7IB 4ISIH 3D49H 3A83A 5GJ4B 4OS6A 1G30B 3LC5A 1GBDA 1CHOF 3ESTA 4F4OC 2FYQA 1TRYA 5BPEA 3U8TH 3GY4A 1Q2WA 1Y3XA 5HKKD 3MU0A 1PPBH 2A4OA 2ZFSA 5EJ1A 3O8CA 1A4WH 3Q00A 4B1TA 3BF6H 3LKWA 2PP6A 3FVFB 2ZEBA 1KXCA 1BCUH 1CT4E 1RIWB 1GMDG 1ZSLA 5A0AE 5DJ7A 4ABDA 4FU7A 4YOIA 1EP6A 1BBRK 2GV6A 2VIPA 3OSYA 2VWOA 4AB8A 2ZO3H 3EQ0H 2Z9IA 4XSKU 1K1IA 2CHAC 4KTSA 1O3MA 1GGDC 4B74A 1SQAA 1HAOH 1E35B 1FPHH 2GCHF 3SORA 5A8ZA 3OY5U 4AYYB 3D23A 4B6EA 4ESTE 2CHAB 1E1QD 2V3MA 2XBWA 4CREA 1TPOA 4MNWA 4JK6A 1C2EA 4OS1A 1LCYA 3DSPA 1SHYA 2OBOA 3PRBA 3ZZ4A 1WQSA 2JETC 1CO7E 1E37B 1GVZA 2K1QA 1PYTC 2JKHA 2TPIZ 1EX3A 1TBRH 3HK6B 1YCPK 1O2GH 1L2EA 1SQRA 2HVYB 3LGTA 3SHCH 1TNJA 5HMAA 4D8NA 1IQFA 3SO3A 4DIIH 5LH8A 2W3KA 3VFEA 2PSXA 1K9OE 2BD5A 2ZPQA 1UHBA 1GI9B 1GVLA 1LHEH 1EP5A 3LOXA 3ZZ8A 2BQ6B 3F9GA 2BY7X 1UK4A 2A5IA 1NFYA 1O2MA 1A0LA 1CA8B 4GLYA 3NCLA 2NU1E 1EAIA 5DN6D 2ZFTA 4I32A 2O8MA 2Y7XA 2ZGHA 4XOJA 1A7SA 1FN6A 2WPHS 1DANH 1T4VH 5DG6A 5C0TA 1O5AB 3FP7E 3IG6B 4GCHG 1C2GA 2W6ID 1YF4A 3BIUH 2ZFQH 4RI0A 1DLKB 2FOHA 1O5BB 4NFEA 1BMAA 1UTMA 3UPEA 1W3CA 1EQ9A 1BMMH 1MKWH 3UQVA 1A0HB 2P3TB 1AQ7A 1BA8B 3RXIA 1XUFA 2Y5GA 4MG3A 1QFKH 2TIOA 1FV9A 1LPZB 2D8WA 2GVFA 3LGWA 3LH3A 8GCHG 5GPIB 2CGAA 5IDKA 2J92A 1H8DH 3GCNA 5EXNA 1SGFA 4CBNA 1IQGA 2HPPH 2GKVE 2AIQA 5DGJA 2AFQB 3GCTF 1ZRBA 4R0IA 2PGBB 3BV9B 3U9AH 3HKIB 1MTNC 4DT4A 3ODDA 7GCHF 1ZMJA 5HYOA 5L6NH 3ZYEA 1AUJA 2WV5A 4BTIB 2XTTB 1HRTH 2FO9A 1E0FD 1JBUH 4BXSA 5DO4H 1D3TB 2BMGB 4GHTA 4ZMAH 4Z0KA 1IQEA 3PLBA 3ZZ7A 3V0XA 2JH5D 5ETXA 1TNGA 4TY6A 1QURH 4X2XA 2CMYA 4O97A 4Y0YE 3V12A 5EW1H 1SLWB 1ELEE 1D9IA 1GI1A 1GPZA 3L6PA 1B5GH 2SNVA 2QN5T 1TMBH 5FX6A 1UCYK 2R0LA 4X1NU 1NM6A 4ZCNA 1MKXH 1CHGA 1BZXE 4CRCA 5TCCA 1KXDA 2OC7A 1Y3YA 2WPLS 2BD3A 5J4SA 2ZDKA 2ODQA 1O3KA 1CQQA 3E8LA 1Q31A 4JYTA 1NRPH 1O3JA 1ZPZA 4Y7BA 4CRGA 2R9PA 4XRNA 3D62A 1O0DH 1FY5A 3PO1B 4WH6A 1K2I1 2PKAB 1TGNA 1MBQA 4JYUH 4CHAB 1KYNA 1CBWC 1AB9C 3ZZ6A 5JBTA 2A5AA 1EATA 1ZPBA 1FJSA 2DE8A 2G5NA 1ESTA 1VITH 1BRCE 3F2HA 5L30H 4OS5A 1CGIE 1XX9A 3LONA 4A92A 3M7TA 4YT6H 3LH1A 4I8HA 4Y7AA 1GL0E 4YLQH 3UOPA 3WWBA 5JDUB 3PO1C 1ZZZA 3BTFE 2OUAA 1FZZA 2ESTE 4B73A 1C1QA 1P03A 4LOYH 4UFFH 4FUCA 1F7ZA 5EJZA 4A1VA 1VKYA 4FVBA 1TMUH 2BXUH 2ZFFH 2FOFA 3M7QA 1EOJA 1WSSH 4Q7ZA 3HPTB 1LVYA 2M2AA 1J8AA 1HB0B 2BYAX 3OYPA 5HGGA 4WMEA 2GZ9A 1QRZA 4GAWA 1P02A 1LHFH 4SGAE 4GPGA 1MQ6A 1ZSJA 1BBRH 1K1JA 2H9HA 3SNEA 4F48B 1GI5A 4Y79A 3UIRA 3N99A 4YO9A 2FI5E 4GVUA 3GY5A 1LQEA 1TPAE 2RA3A 4O3UA 4X2WA 2FPZA 3PRDA 1FUJA 4E7RG 2VIQA 3MQKC 1PQ7A 1H1BA 3RXPA 1PFXC 5SGAE 1CA0B 2F4LA 2F43B 1IQJA 1SG8B 2J2UA 4NZLA 1RS0A 2ANYA 4TY7A 1GBJA 4J2YB 2HGTH 1DFPA 1UVPA 1C9PA 2TGDA 1SGTA 4WF8A 1HBTH 2PSYA 2SGEE 1BRAA 5DP9A 3AK5A 2Y81A 2B8OH 1KXFA 2EQNA 1OP8A 2RA0A 2Y5FA 2HNTC 3NRLA 3AVZA 7ESTE 2EC9H 2R2WU 1C5MD 1PPFE 3PV5A 5FCRA 1EB1H 2PFEA 2PKSC 2UUJB 4FUHA 2Y82A 3T5FH 1DPOA 3P70B 3PROA 1YPJH 1P04A 2TGPZ 2OQUA 1EZXC 3RM2H 5FBEA 4K3JA 3BTWE 3LJJA 5DP3A 1MU8B 1N8OB 1FXYA 4Z6AH 3GICB 3K65B 3P8OA 3SV6A 1MMJN 3F6UH 1GHAG 1E36B 2FIRH 3I78A 4X1QU 1Z8JB 1MTWA 1UJ1A 3TH4H 3BSQA 2IPHA 2A7JA 2QAAA 4CR5A 5FAHA 1J15A 4H42U 1ETRH 2XCNA 3GY2A 4X6OA 2CK3D 3O8BA 2WSSD 3HATH 1K1PA 5CHAC 1ZSKA 1QJ7B 5AFZH 3T29A 1XUGA 1L4DA 2C3SA 4IC6A 1BTZA 2IOTA 1H9LB 2QV1A 3RU4E 2ZDNA 1Z6JH 1ANDA 1QA0A 1E79D 3Q3XA 3TNTA 3KN2A 3F1SB 1FIZA 1WQVH 2PUQH 3MH4A 2ZHEH 1MTSA 3PMBB 1OP0A 2FOMB 1KLJH 1EZQA 1UTQA 1Y3UA 3NPSA 1OS8A 3M36A 3RXSA 3PV2A 2H5DA 1P05A 1S81A 1CBWB 1KMHB 2ZA5A 3RXKA 3FKSD 4YZUA 3ZVBA 2AHME 2FS9A 2ILNA 2FS8A 2B0FA 1C5NH 4X6PA 1YC0A 5T6GA 1YPMH 4CRDA 2BDGA 2G8TA 4ASHA 2R2MB 8LPRA 1O2ZA 3MO3A 1TWXB 2THFB 2A7HA 3Q3KA 3MNSA 1BB0B 2XBXA 1YLNA 2BVXH 1TGCA 2FI3E 2UWOA 3SV7A 1PQ5A 1KDQB 5FBIA 2OK5A 1TOCB 3KQCA 1MD7A 3RUOA 1YLCA 1HUTH 1FAXA 1ESAA 1HAIH 1YPHC 1ANEA 5JBAS 2A1DB 1GCTB 1UTJA 1SOTA 2ZGBH 3MFJA 1WXRA 1V2LT 2EI6A 4UE7H 3P8NA 2AMDA 1IQLA 1AWHB 1A5HA 3DFJA 1VCPA 1UVTH 1O3HA 3DSOA 1P01A 4A1TA 3SYJA 3M61U 1CU1A 2BY5X 1KXBA 2XYAA 1YPLH 3V3MA 1S82A 2VU8E 2ZKSA 1NBMD 1FI8A 4CRFA 1ELAA 1QBVH 1A5IA 1ZRKA 2ZHWH 1GJBB 1F0UA 1LHCH 1ZJDA 2J9NA 2BDBA 1DY9A 1ELDE 3MNXA 2XBYA 3SU0A 1GHXH 1WTGH 3A85A 1WUNH 1K1NA 3A82A 3U1JB 3SV9A 4ABBA 4WJG2 1F5LA 6CHAC 3A7ZA 3LGIA 4UFDH 1O2QA 3U98H 1AD8H 3C1KA 1G3BA 5FPYA 3RXGA 2QY0B 4AYVB 1XVMA 1SGYE 3BG4C 2OQ5A 1DUEA 1GJCB 2KR7A 4YESB 3GCHB 1FAKH 1LKBA 3SQHE 4YT7H 3N7OA 3SJKA 3BTME 3WWFA 2ULLA 1OX1A 1TX8A 3EA9A 1BT7A 2ANWA 4KGAA 2HLCA 5E2PA 4B6FA 1OWKA 5JBCS 1ANBA 1GVKB 3EE7A 3AW0A 3O8RA 2VWNA 6ESTA 3E16B 1IHTH 2P8OC 3GISB 4DIHH 5C94A 4CR9A 4DJZB 2FOBA 3BEIB 4DW2U 3TJUA 4BAOB 4BNRA 2SFAA 1J14A 1IQKA 1AUTC 1C5PA 1MKWK 4H6SB 2FOGA 1C2IA 2SGDE 4CH2B 2RDEA 1AZ8A 1SFQB 3LGVA 4CHAC 2DE9A 5F53A 1GI4A 1UVSH 1ZHPA 5C1UA 3UREA 2NWNA 4YM9A 3QGJA 1BDAA 4NIWA 2YMSB 2A0QB 2QA9E 1DSTA 1QIXB 2WPMS 1BHXB 1O3PB 4K2YA 4NSYA 3RM0H 2UUYA 4HTCH 3ZV9A 2KX4A 1GG6C 3S0NA 2FOCA 1JWTA 1HIAB 2F9PA 4HGCA 1YGCH 1F2SE 3A81A 1V6DA 3ZVFA 5EQSA 1TGSZ 2JIZD 2P95A 3MI4A 1EAUA 4ZXXH 4FUDA 2NU0E 3B9FH 2H9TH 2Z9KA 4B75A 3E90B 4OS7A 4U01A 3MYWA 4WVPE 4F55A 3RXTA 1O3GA 1GHBF 4NA7A 2JJ1D 1BJVA 2AH4X 4ZAEA 1O2KA 1W0YH 1YY3A 1QJ6B 4RKOB 1SQOA 5FL7D 6GCHG 3GY3A 3OTJE 1ZGVA 3Q76A 1AHTH 5C1XA 1MAXA 2FLBH 1AU8A 3RDZA 3KIDU 1C2JA 1DXPA 2Q6FA 3ZVEA 4BAQB 2W3IA 1AE5A 1DLEA 2Z3DA 1OYQA 3VB3A 5EG4A 2BDHA 3TITA 2J98A 4BTTB 2KAIA 1AY6H 1CGJE 1HV7A 3FOAA 1H9IE 4IN2A 4GUXA 1TLDA 1EZUC 5CHAB 4IBLH 4O9VA 1DOJA 1TQ0B 3ATMA 4ABEA 1N6XA 3TK9A 1SOZA 2M5TA 4MQAA 1O3DA 4IS5A 3JZ2B 1XUJA 1SVPA 4UFEH 2BXTH 4TYDA 2STBE 4ZXYH 2GZ7A 2RDLA 3SZNA 1C5VA 2DUCA 3PMJA 5FCKA 1PQAA 3ODFA 3LT3A 1TGTA 3UWJH 1MH0A 1NY22 2ZU5A 2FYRA 3VB4A 1EPTC 1C1SA 1EASA 1LQDB 2P93A 1C4V2 3GDSA 1GHYH 4UDWH 5C3NA 1C2LA 2QXGA 1TBZH 1S83A 2GJGA 4X6NA 1HJ8A 2QF0A 1WU1A 2BOKA 4D76A 5LPEA 1IAUA 1W7GH 1ESBA 1ABIH 3O8DA 1LO6A 4FUEA 1QL9A 4ABJA 1O37A 3ZZ5A 4TWYA 2VWMA 3PTNA 4B71A 4XE4A 2B5TB 3UR9A 1LDTT 5F8ZA 3B23B 3KYFA 2ANMH 3K6YA 3T26A 3A7TA 1ZR0A 2JETB 3GYLB 1RTKA 1F92A 2XC5A 4XBCA 3WW7A 2P59A 5DP5A 1NROH 3KQBA 3P92A 1KXEA 1JMOH 4X1SU 2I6SA 3DD2H 1ARBA 3C27B 1QTFA 1OKXA 2A5KA 1QHRB 1O5DH 1OOKB 2OLGA 2VH6A 1O2NA 2ZU2A 3LIWA 2ZG0H 4HZHA 1W0ZU 1C9TA 4X8VH 1C1RA 2ZDMA 2ZFPH 1UTNA 2BD7A 4BAHB 3TH2H 1AVWA 1P2MA 3KGPA 2Z94A 1ZOMA 4YLUA 5IYTA 4Q7XA 1P57B 3QO6A 4YXWD 1L4ZA 1C5YB 1SGFG 5GCHF 4B2CA 3Q77A 2ZHQH 1AIXH 1GDQA 1O3CA 1SB1H 1LMWB 5DK1A 1KDQA 1SGRE 2ZCHP 1C5LH 3VB5A 1QR3E 2R3YA 2FI4E 2ZCKP 2STAE 4WXVA 3QDZB 4XD7D 5T6FA 1UK2A 2WUCA 2QXJA 1XM1A 3RXEA 4Y10E 2ZC9H 2UUFB 3RXLA 4MNYA 2XXLA 3OU0A 2ZFRH 1HGTH 4IW4E 1J9CH 3OFND 1V2MT 3BEFB 1S85A 3GY6A 6LPRA 1P9UA 3HGNA 4ZH8A 1UO6A 2GMTB 1UVUH 4KTUA 1A1RA 2JH6D 3NWUA 1BRBE 3S9CA 5E0JA 2ZHFH 3QLPH 4R8TB 4DOQA 1SGPE 5EW2H 2IJD1 4FUJA 3F68H 2BX4A 3ATWA 1TABE 3D65E 1W0KD 1FQ3A 1VJ9U 3G01A 3RXOA 2JJ2D 4X6MA 2ZCLP 3DUXH 3N7DA 4Y8XA 3V7TA 1THRH 3M5LA 4FU9A 3TK6A 1YPKH 4ABGA 4ISNA 1T8LA 4Q63A 1V2UT 1BTHH 1YCPH 4KKDA 1SSXA 1D3PB 1P12E 4TSFD 2ZPRA 1UTLM 4XBDA 1IQHA 1KSNA 4Y6DA 3M3TA 4LXBH 1SGQE 3S9AA 1L0ZA 1SGIB 4Q80A 3K9XB 1JRSA 4U2WA 3FFGA 2GDEH 3M3VA 2G4UA 4KTCA 3SNBA 5ESTE 3CS7A 1O39A 1MTVA 1ZHMA 1W8BH 1GL1A 5FHTA 2C93B 3L3TA 1MU6B 2GT7A 3SNCA 2Q1JA 2F91A 3I77A 1A2CH 1H8ED 3QZRA 5KEDA 3MHWU 1C1WH 1NPMA 5E0GA 2XC4A 3TK5A 3E0NB 1GI8B 1HAXB 2YNBA 4K60A 1GJ5H 1JRTA 2KCOA 2BLOA 3BG8A 2XW9A 3QN7A 3TGKE 4WY3A 2AMQA 1K0HA 2A4RA 2UUKB 3TH3H 1SGCA 2HPQH 1QGFA 2VVUA 2J34A 2AGEX 1QL7A 1V2NT 2PHBA 1P09A 3A8DA 3A8AA 1C4U2 2GT8A 5C5OA 5LPRA 1QBOA 3GCOA 3RXCA 5DP4A 3SU1A 1ZTJA 3SU3A 1W14U 3TU7H 1S5SA 1ZPCA 1K1MA 5FPTA 3QTVH 3RXQA 2AEIH 1V2QT 3OAAD 1DSUA 1YYY1 2HNTE 1QB6A 3KCGH 1K28D 2FZZA 3SU2A 3E3TA 4UD9H 1T8NA 2OINA 3U8OH 1O2SA 1SPJA 4JZFH 4PROA 4FVDA 2Q6GA 3P95A 3ZVDA 3URCA 2GMTC 1C5TA 3EDXB 1CT2E 4AFZA 3FO8D 4JYVH 5JBBS 1T7CA 1WCZA 1ORFA 1RXPA 2OC0A 2PGQB 3DT0H 3E1XB 1D6RA 3SGBE 1J17T 1C5WB 1HPGA 1QNJA 2BD4A 3GOVB 4A5TS 3IITA 1BMLA 1Y5AT 3DSGA 3UQOA 5C1YA 4MLFB 3M5OA 1ZTKA 4NGAH 4VGCB 1OWHA 1FIWA 2NU2E 2SGPE 5EGMA 1YKTA 2V0BA 3E6PH 3TVJB 1TX7A 2W26A 1P2OA 1EJAA 2P16A 1T4UH 1YCPM 4JK5A 1F5RA 1NN6A 3VPKA 1ZTLA 1JOUB 3DCLA 1GBMA 1BOQA 1D6WA 2D26C 3A7WA 3MOCA 4BTUB 1AFQB 1Q3XA 2QF4A 3BN9A 2Z7FE 1PYTD 4RT0A 2XWAA 3M5NA 2XOKD 2VWLA 2WUBA 5FX5A 1C1NA 1TOMH 5C17A 1GI7B 1MTUA 5KECA 1O2XA 2G55A 3SI3H 2XNDD 3GY8A 1HCGA 3H7OA 1N8OC 5LPFA 4UEHH 4XFQA 1T8MA 2ZWLH 1BBRE 5GWZA 1O2PA 5AVDA 2F9VA 4H6TA 5A8XA 1RTFB 1A46H 1QRXA 1AMHA 3A87A 1TPPA 3F9FA 4AC9A 5JYIA 1BITA 1TNKA 4SGBE 1TNHA 3AW1A 1KXAA 1SLUB 1TMTH 2R0KA 3RMLH 3GDVA 2FX4A 4P02A 4ISLA 8KME2 3W95A 1DT2A 4I8KA 4DURA 2GCTB 1G9IE 1HXEH 2GX4A 2H1UA 5GNDA 1MCTA 1O5GH 2WPJS 4K8YA 4ZROA 1S6LA 1V2OT 4FOUC 1F0TA 1ELTA 4ZHAA 4ZHMU 2PV9B 4I7YH 4X1RU 3MU1A 1Y5UT 3STIA 2FXRA 2WPDD 1J16A 4THNH 1Y8TA 3GY7A 4RSPA 3RMMH 3VXFH 1C2MA 4NWLA 3SUFA 4U32A 4UFGH 1ELCA 4XDEA 3MH7A 2CJIA 5C67A 3HK3B 2GCTC 1GBHA 1C2DA 1GJ6A 5GXPA 2F9BH 1P9SA 1GJ9B 2LELA 4DVAU 1O31A 1P06A 1PQ8A 1HAVA 1O30A 4VGCC 2BVRH 5L2YH 1X7AC 1UTOA 1YPHE 6GCHF 1O35A 3SUGA 4I31A 2BLQA 1GWAA 5TCAA 1BMNH 3MU4A 3SNDA 2O8WA 1A0JA 1B0EA 1SHHB 3RXJA 1OWIA 2ZDAH 2BDYA 3SQEE 5E0HA 1LPGB 1GJ4H 4FUBA 2HNTF 4DY7B 2EY4C 4K1EA 1W10U 1K22H 2NU3E 2KCYA 2KCAA 1AFEH 1NFUA 4DT7B 2H9EH 1O2TA 2A4QA 4K1TA 4JZ1A 5FPSA 1Z1JA 3T62A 1O3AA 1IHSH 3IWMA 1UCYE 2OC8A 3T27A 1O36A 4WWYA 1C1UH 1FY8E 1A3BH 1DICA 1GBKA 2AGGX 3T2NA 1WV7H 1TAWA 4RT1A 4CBOA 5CDFE 1RD3B 4E05H 4CH8B 5AF9H 4RN6A 1HJAC 1ACBE 1O5EH 1F5KU 2L6OA 2HLDD 1C5OH 1CVWH 1U6QA 1UK3A 2VGCB 1FONA 3NUMA 1CGHA 1P0SH 2EEKA 1PPCE 2FESH 5EJLA 2PR3A 4ACAA 2KM0A 3UWIA 2PTCE 2OP9A 2ZGJA 3UOUA 4LK4A 2KZ4A 5T1VA 1HAPH 1BMFD 4BAMB 3AAVA 4INHA 5DKMA 2O8UA 3H7TA 4MPVA 2FLRH 2XC0A 1LKAA 5T3HA 3LGYA 1O34A 4AOQA 1BTYA 5C5NA 4ZUHA 2OTVA 1C5UA 1WBGB 1S6HA 2XBVA 1SMFE 1LHGH 1P2JA 2AS9A 3NXPA 2PWXA 4FUGA 5ESBA 1W11U 2J95A 1S0RA 1SLXB 3OTPA 1TNLA 1B0FA 3QX5H 3GDUA 1GHWH 3ELAH 3ATKA 3FZDA 5AFYH 3SOSA 1G37A 3GCTG 4A6LA 1EJMA 2C8YB 3UB0A 4I33A 1OHHD 3BTDE 2HVXA 1O2LA 2Z9GA 2QGRA 2VB0A 1GI0A 1UHBB 2TRMA 4Y0ZE 1Y59T 3W1EA 2R3UA 2J5UA 1BUIA 5EODA 5KGOA 1NFXA 4INKA 2WZQA 6CHAB 1THPB 2ANKH 1G3DA 2O8LA 2ZU1A 1V2VT 1EPTA 1DE7H 1FPCH 2P94A 4AFQA 1O2RA 2ZGCA 1K1OA 5CE1A 2HALA 1GCDA 4E7NA 2VIWA 3ZYDA 1VCWA 4AORA 2CN0H 1FMGA 1NTPA 4KELA 1JIMA 1DY8A 3HKJB 1SFIA 2CXVA 2G4TA 1P11E 2GDDA 5JB8S 4ISHH 2QE7D 1O2OA 1W7XH 1XMNB 1LVMA 1T31A 2FODA 4AB9A 1ZLRA 4IC5A 1VJAU 1CT0E 1XKBC 3A8BA 3SGQE 2Z6BD 2GZ8A 3TIUA 2FOAA 3B8JA 2VVCA 1T32A 1NZQH 3BTGE 3H09A 1BRUP 1GBEA 2VJ1A 2BY8X 1GCTC 1SGNE 5DPAA 1C2HA 2LNCA 2BY6X 3S9BA 1SL3A 4AG2A 1FY1A 4X0WU 4NWKA 3DA9B 2H2ZA 2A7CA 3P6ZB 1DX5M 3RLYH 1UMAH 1A61H 1WAYB 4MPXA 1G3EA 1K1LA 1G36A 1TE0A 1CE5A 4X1PU 4JCNA 1F0RA 3MMGA 3SBKA 5EPNA 1MKXK 1LPKB 1S0QA 3UTUH 4YOJA 4JMYA 2BQ7B 2NU4E 2AERH 1AVGH 1GGDB 3RXAA 1W13U 3MWIU 4OGXA 2F3CE 4HI3A 2W7SA 3SU4A 2BQWB 2A45B 1IQIA 1GDUA 2JH0D 3QK1A 3MH6A 2ZQ1A 4NIYA 3M3SA 1DWEH 3BTHE 1DUAA 1Z6EA 2PTNA 2QF5A 2HOBA 2FP7B 3OE7D 1DITH 4D7FA 4MPUA 3S7HB 2YMSD 5CHBA 2PKAA 2VGCC 2ZTXA 1QRWA 4ZKRU 1Z8RA 4Q4LA 4WMFA 1W2KH 4ZKOU 2LPRA 2K0QA 1NT1A 1TALA 1HAVB 2GTBA 4BAKB 1OP2A 2PW8H 3TLOA 1M9UA 2G00A 3KQ5A 7LPRA 3FZZA 2FDAA 4MNVA 3VEQB 2HRVA 2V7QD 3KHVA 3SJIA 1TGBA 1O3EA 2A31A 3F0PA 5ABWA 1CA0C 2FEQH 3DFLA 3JZ1B 1G2MA 2BTCE 4BXWA 1YBWA 3VB6A 2EI7A 1YPEH 4WMDA 1MD8A 1MZDA 2IPQX 5EXLA 1QY6A 2ZPSA 1V2KT 4CRAA 4YOGA 2B7DH 3CENA 2LP6A 1RIWC 1LTOA 3WY8A 3PV4A 3ZZ3A 5HIYA 2ZQ2A 4JZDH 2BZ6H 3RU4T 2KAIB 1VITG 4INLA 5HXFA 1INCA 1PJPA 1L1NA 2V3OH 4TPYA 3LU9B 1O2VA 2WPIS 3L33A 4AN7A 2VINA 1VGCC 5EU8A 4Z1MD 3BTQE 1HDTH 2ZTYA 1GHBG 2BZAA 1AN1E 4K8BA 1O3NA 1W12U 1GI6A 1GHVH 2K8IA 3U1IB 2O8TA 3NZIA 3ATLA 5DP8A 1TPSA 1C4Y2 4NG9H 5B6LA 1RFNA 3EA7A 4IMZA 1XUHA 3PMAB 3PWCA 4AG1A 4FUFA 3SU5A 5A8YA 5A0BA 4UONA 1G3CA 4HFPB 1KTSB 1XKAC 4K1SA 1WYKA 4X2YA 5K7RA 2XRCA 1XUKA 2SGQE 1O3IA 3ZV8A 3BTEE 1D3QB 1Z1IA 1SBWA 2IN2A 4P00A 3RP2A 1O3FA 4H4FA 3BIVH 1AGJA 1GBFA 1O2JA 2J94A 3W94A 1SI5H 2VNTA 4E06H 3NK8A 1V3XA 3T25A 4MNXA 3PM3A 3QZQA 4F49A 2QC2A 4TWWA 5DP7A 3V13A 1QQ4A 3SNAA 3P8GA 3SZEA 3A86A 2EA3A 1C5RA 3BG4B 1GJ7B 4I8LA 2BD2A 1WTHD 4O03A 3RXRA 5A0CA 1EAXA 2UWPA 1ETSH 3DHKH 4DG4A 3ITIA 3F2FA 1NC6A 1OSSA 3VGCC 2C8XB 1YM0A 4OS2A 2FTLE 1CSOE 2L74A 3ZZ9A 2CF9H 1C1MA 2GD4B 2Q6DA 4IGDA 2ZTZA 5F8TA 2ASUB 4Y8YA 2WHXA 1O33A 5F03A 3UAIC 5GIBA 3A88A 1C5QA 3UNSA 1O3OA 4X8UH 1PPGE 3TPIZ 3S7KB 3CS0A 3RXMA 5T6DA 3SN8A 1ZHRA 4K69A 3AASA 3KNXA 4ABIA 3EGKH 2XCFA 1QL8A 4B2AA 4ZHLU 3F0OA 1VCQA 3QUMP 4QT8C 3U28C 2CV3A 2BOHB 1HAZB 1V2WT 3KL6A 2F9UA 2BLVA 5I25A 1QB9A
chains in the Genus database with same CATH topology
2TGAA 2BLWA 4NZQA 4AFSA 4WXIA 3SHAH 3MH5A 1P10A 4YTAA 1O3LA 1IQMA 1ZYOA 1D4PB 3R3GB 2XNIA 1NESE 3PLPA 1DVAH 3RXVA 3AAUA 3MO6A 1TBQH 3NKKA 2WYJA 3BEUA 2BHGA 3MNBA 3OY6U 3TJVA 1P2IA 1DDJA 3LC3A 1LHDH 2PLXA 1TQ7B 2BDIA 2CF8H 3KF2A 2C4FH 3A89A 1O2UA 3ZVCA 1A5GH 3A7XA 3ZZCA 1C2KA 4GCHF 2FWWA 5G4BA 5H4IB 5C20A 4DGJA 1TB6H 2BD8A 3BTTE 5EQRA 4A1XA 1HAGE 3ATIA 1HJAB 2BB4A 2P3FH 5EPYA 2Z9JA 5TJXA 2VIVA 2O9QA 4JZIA 1MCVA 3K6ZA 1BTPA 1QA7A 1GMHG 2BY9X 3RXBA 1T8OA 3OX7U 3ZZDA 1WOFA 1P3CA 1ZMNA 2J4IA 1UVOA 2P3UB 5GDSH 2B9LA 1P2KA 1DXWA 1HAHH 3SJ9A 3HGPA 2ZDLA 4GSOA 4MTBA 3BTKE 1OWJA 4X8TH 3EAJA 1BHXF 4ZKSU 1OYTH 2Y5HA 2QCYA 1G2LA 1C1TA 1GMCF 2TBSA 4NFFA 2RG3A 4FUIA 2ZGXH 1EKBB 1NFWA 4OGYA 1AO5A 3RC4A 1V2RT 3SUDA 1C5SA 2QYIA 2Z9LA 3FP6E 4NCYA 2D2DA 3MU8A 1HAYB 1OWEA 3RU4D 2A32A 1TFXA 3RMOH 4K5ZA 1ARCA 2W7UA 1O2YA 3GYMA 9ESTA 1GJDB 2ZIQH 1N6YA 3FP8E 3EA8A 3MU5A 3K2UA 1C1OA 1DWCH 2Z3CA 2GCHG 2WPKS 1ANCA 3SI4H 1QBNA 1CHOG 1TRNA 1C1PA 1XVOA 4FU8A 4X8SH 1EB2A 3E0PB 4AX9H 1P2QA 2Y7ZA 2ZECA 1LVBA 2V35A 1L1JA 4ABHA 3KQDA 4MDSA 2OC1A 1C2FA 3RMNH 2VIOA 1GMDF 3Q3YA 4MPWA 1THSH 1AFQC 2W5EA 3FAOA 1OPHB 1H9HE 4Y8ZA 4AGJA 3RLWH 2G81E 1AWFH 1GI3A 5PTPA 1FY3A 1NU9A 3U69H 3F9HA 2Y80A 2Z3EA 7KMEH 1V2PT 3QGNB 1AZZA 2TGTA 1FN8A 4IMQA 5GCHG 2VIDA 5A2MH 1ELFA 1O2IA 1BTXA 1IQNA 1DM4B 1QB1A 1VZQH 1XUIA 5C2ZA 1VGCB 1K21H 1O2HA 2H5CA 1GBIA 1FDPA 1UTKA 2PUXB 1HYLA 1BQYA 1GBTA 3H5CB 4OS4A 1KIGH 3M35A 1GHZA 2FOEA 2YOLA 3SV2H 1FLEE 2FX6A 1XXDA 3UFAA 2YNAA 3PLKA 5E8EH 2BDCA 2OBQA 5L2ZH 2BM2A 1SGEE 1C5XB 3ENSB 4XBBA 1EZSC 2J38A 3TGIE 4I8JA 1Y3VA 1MQ5A 1ZMLA 1AB9B 1AVXA 1TX6A 1V2JT 1A3EH 1SC8U 1YLDA 1NRQH 1Y3WA 1YP9A 3A7YA 3PWBA 1DWDH 5JPMH 1RJXB 1GBLA 1UTPA 5EQQA 4CRBA 1ETTH 1L1GA 1EXFA 4NSVA 1FNIA 3PMHB 3QWCH 1GMCG 1AKSA 1O2WA 2F9OA 3PTBA 2QF3A 1NRNH 3P17H 1PPHE 1PPZA 3ZZBA 1E34B 2WINI 2ZP0H 1GBCA 2C8ZB 1GHAF 3ZVAA 3TNSA 4AGKA 4KP0A 1TRMA 1B7XB 2ZU3A 3LGUA 1ZJKA 2ZZUH 2C8WB 2ALPA 3M37A 1KTTB 3M7UA 2WV4A 3LDXH 2V6NA 1ELBA 1S84A 3UNRA 3EE0B 3EYDA 3SUEA 1HLTH 1TIOA 1GDNA 2RCEA 3MO9A 4I8GA 2GV7A 4O3TA 1UCYH 2VVVA 2ZI2H 3TGJE 4WH8A 1BIOA 2BD9A 1RTLA 4D9QA 2ZHDA 1Z7KA 3TJOA 1TONA 4AZ2B 1LVOA 1S6FA 2AIPA 2G52A 3KQEA 1SR5C 4RKJB 4B2BA 1GBAA 3QTOH 1OXGA 2G5VA 2ZNKH 3SJOA 4BANB 5HM2A 8ESTE 2C90B 1NS3A 1TYNA 1QCPA 3VXEH 1H8IH 5J4QA 2WYGA 2AMPA 1Z71A 3GCHC 1EAWA 4Y76A 3UY9A 3SW2B 1HIAA 1MZAA 1N1LA 3VB7A 3R0FA 7GCHG 3SV8A 4ISOA 1TA6A 1P3EA 2FMJA 4IN1A 1HXFH 4NIXA 2A4GA 1QJ1B 5CMXH 3A8CA 1GJ8B 2AYWA 5FXLA 3RXHA 2BX3A 1ELGA 1MBMA 1D3DB 3A7VA 2ODYB 1PPEE 3UUZA 4U30A 2BDAA 2Y6TA 3LPRA 3PYHA 5LGOA 4NA8A 4ABAA 1P8VC 1SGDE 1TNIA 1JIRA 5K0HA 1MTNB 4ABFA 1FY4A 5JB9S 1Z8GA 1EOLA 4Y71A 3MTYA 1E38B 1GBBA 3E91A 2GP9B 3UR6A 1Z8IB 4M7GA 1MUEB 1AE8H 2ZDVH 4D9RA 1O5FH 1O5CB 2OCVB 2EI8A 2V3HH 5DP6A 3RXFA 3S69A 1O3BA 3SJ8A 1VR1H 2FM2A 3A84A 3LJOA 1ID5H 1HFDA 3RXUA 1KLTA 1DWBH 3F9EA 2A2QH 4Y11E 3KEEA 2F83A 1AI8H 1GG6B 3RXDA 2GGVB 3RC5A 1RRKA 2QIQA 4D7GA 3FANA 4Q7YA 3ZZAA 1O32A 1TA2A 1AKSB 1Y5BT 2OXSA 1C5ZB 5AHGH 2I6QA 5HM9A 2AGIX 2BVSH 2SGFE 2QXIA 4ZKNU 3I29A 2F9NA 4LZ4B 1SLVB 2ODPA 1C1VH 1SQTA 3U8RH 2ZF0H 1MAYA 4MVNA 3VGCB 1O38A 5EXMA 1KLIH 2ZU4A 2PKSB 2QXHA 5F8XA 3TJNA 2ALVA 3MNCA 4LZ1H 1NO9H 1HJ9A 1IOEA 4NA9H 2HWLB 1G32B 5F6MA 3P8FA 1GMHF 1H4WA 2P8OB 1V2ST 3T28A 3URDA 4FXGH 5A09A 5I46H 1YPGH 1P2NA 2H6MA 2UWLA 1NU7B 2A2XH 1NRRH 9LPRA 1ZGIA 2G51A 2IJOB 5EOKA 3SGAE 2VH0A 2D1JA 1BTUA 1BTWA 1DS2E 3PB1E 1ABJH 1JXPA 4Q2KA 1HNEE 4BOHA 1EUFA 4B76A 5B6OA 1KY9A 1V2TT 1BJUA 4GHQA 2XWBI 1GJAB 5E2OA 1RGQA 3SU6A 1GI2A 3A80A 1OWDA 1QQUA 1EPTB 4JZEH 1F0SA 8GCHF 3CP7A 3RC6A 1VITF 3M5MA 4X2VA 2FTMA 4TPIZ 4NIVA 3UNQA 2SGAA 3STJA 3ZVGA 1EJNA 2SNWA 4J1YA 4DCDA 1XXFA 1NRSH 1ELVA 2OD3B 4AFUA 5BRRE 4A7IB 4ISIH 3D49H 3A83A 5GJ4B 4OS6A 1G30B 3LC5A 1GBDA 1CHOF 3ESTA 4F4OC 2FYQA 1TRYA 5BPEA 3U8TH 3GY4A 1Q2WA 1Y3XA 3MU0A 1PPBH 2A4OA 2ZFSA 3O8CA 1A4WH 3Q00A 4B1TA 3BF6H 3LKWA 3FVFB 2ZEBA 1KXCA 1BCUH 1CT4E 1RIWB 1GMDG 1ZSLA 5A0AE 5DJ7A 4ABDA 4FU7A 4YOIA 1EP6A 1BBRK 2GV6A 2VIPA 3OSYA 2VWOA 4AB8A 2ZO3H 3EQ0H 2Z9IA 4XSKU 1K1IA 2CHAC 4KTSA 1O3MA 1GGDC 4B74A 1SQAA 1HAOH 1E35B 1FPHH 2GCHF 3SORA 5A8ZA 3OY5U 4AYYB 3D23A 4ESTE 2CHAB 2XBWA 4CREA 1TPOA 4MNWA 4JK6A 1C2EA 4OS1A 1LCYA 1SHYA 2OBOA 3ZZ4A 1WQSA 2JETC 1CO7E 1E37B 1GVZA 2K1QA 1PYTC 2JKHA 2TPIZ 1EX3A 1TBRH 3HK6B 1YCPK 1O2GH 1L2EA 3LGTA 3SHCH 1TNJA 5HMAA 4D8NA 1IQFA 3SO3A 4DIIH 5LH8A 2W3KA 3VFEA 2PSXA 1K9OE 2BD5A 2ZPQA 1UHBA 1GI9B 1GVLA 1LHEH 1EP5A 3LOXA 3ZZ8A 2BQ6B 3F9GA 2BY7X 1UK4A 2A5IA 1NFYA 1O2MA 1A0LA 1CA8B 4GLYA 3NCLA 2NU1E 1EAIA 2ZFTA 4I32A 2O8MA 2Y7XA 2ZGHA 4XOJA 1A7SA 1FN6A 2WPHS 1DANH 1T4VH 5DG6A 1O5AB 3FP7E 3IG6B 4GCHG 1C2GA 1YF4A 3BIUH 2ZFQH 1DLKB 2FOHA 1O5BB 4NFEA 1BMAA 1UTMA 3UPEA 1W3CA 1EQ9A 1BMMH 1MKWH 3UQVA 1A0HB 2P3TB 1AQ7A 1BA8B 3RXIA 1XUFA 2Y5GA 4MG3A 1QFKH 2TIOA 1FV9A 1LPZB 2D8WA 2GVFA 3LGWA 3LH3A 8GCHG 5GPIB 2CGAA 5IDKA 2J92A 1H8DH 3GCNA 5EXNA 1SGFA 4CBNA 1IQGA 2HPPH 2GKVE 2AIQA 5DGJA 2AFQB 3GCTF 1ZRBA 4R0IA 2PGBB 3BV9B 3U9AH 3HKIB 1MTNC 7GCHF 3ODDA 1ZMJA 5HYOA 5L6NH 3ZYEA 1AUJA 2WV5A 4BTIB 2XTTB 1HRTH 2FO9A 1E0FD 1JBUH 4BXSA 5DO4H 1D3TB 2BMGB 4GHTA 4ZMAH 4Z0KA 1IQEA 3PLBA 3ZZ7A 3V0XA 2JH5D 5ETXA 1TNGA 4TY6A 1QURH 4X2XA 2CMYA 4O97A 4Y0YE 3V12A 5EW1H 1SLWB 1ELEE 1D9IA 1GI1A 1GPZA 3L6PA 1B5GH 2SNVA 2QN5T 1TMBH 5FX6A 1UCYK 2R0LA 4X1NU 1NM6A 1MKXH 1CHGA 1BZXE 4CRCA 5TCCA 1KXDA 2OC7A 1Y3YA 2WPLS 2BD3A 5J4SA 2ZDKA 2ODQA 1O3KA 1CQQA 3E8LA 1Q31A 4JYTA 1NRPH 1O3JA 1ZPZA 4Y7BA 4CRGA 2R9PA 3D62A 1O0DH 1FY5A 3PO1B 4WH6A 1K2I1 2PKAB 1TGNA 1MBQA 4JYUH 4CHAB 1KYNA 1CBWC 1AB9C 3ZZ6A 5JBTA 2A5AA 1EATA 1ZPBA 1FJSA 2DE8A 2G5NA 1ESTA 1VITH 1BRCE 5L30H 4OS5A 1CGIE 1XX9A 3LONA 4A92A 3M7TA 4YT6H 3LH1A 4I8HA 4Y7AA 1GL0E 4YLQH 3UOPA 5JDUB 3PO1C 1ZZZA 3BTFE 2OUAA 1FZZA 2ESTE 4B73A 1C1QA 1P03A 4LOYH 4UFFH 4FUCA 1F7ZA 4A1VA 4FVBA 1TMUH 2BXUH 2ZFFH 2FOFA 3M7QA 1EOJA 1WSSH 4Q7ZA 3HPTB 1LVYA 1J8AA 1HB0B 2BYAX 3OYPA 5HGGA 4WMEA 2GZ9A 1QRZA 4GAWA 1P02A 1LHFH 4SGAE 4GPGA 1MQ6A 1ZSJA 1BBRH 1K1JA 2H9HA 3SNEA 1GI5A 4Y79A 3UIRA 4YO9A 2FI5E 4GVUA 3GY5A 1LQEA 1TPAE 2RA3A 4O3UA 4X2WA 2FPZA 1FUJA 4E7RG 2VIQA 1PQ7A 1H1BA 3RXPA 1PFXC 5SGAE 1CA0B 1IQJA 1SG8B 2J2UA 4NZLA 1RS0A 2ANYA 4TY7A 1GBJA 4J2YB 2HGTH 1DFPA 1UVPA 1C9PA 2TGDA 1SGTA 4WF8A 1HBTH 2PSYA 2SGEE 1BRAA 5DP9A 2Y81A 2B8OH 1KXFA 1OP8A 2RA0A 2Y5FA 2HNTC 3AVZA 7ESTE 2EC9H 2R2WU 1C5MD 1PPFE 5FCRA 1EB1H 2PFEA 2PKSC 2UUJB 4FUHA 2Y82A 3T5FH 1DPOA 3P70B 3PROA 1YPJH 1P04A 2TGPZ 2OQUA 1EZXC 3RM2H 5FBEA 4K3JA 3BTWE 3LJJA 5DP3A 1MU8B 1N8OB 1FXYA 4Z6AH 3GICB 3K65B 3P8OA 3SV6A 1MMJN 3F6UH 1GHAG 1E36B 2FIRH 3I78A 4X1QU 1Z8JB 1MTWA 1UJ1A 3TH4H 3BSQA 2IPHA 2A7JA 2QAAA 4CR5A 5FAHA 1J15A 4H42U 1ETRH 2XCNA 3GY2A 4X6OA 3O8BA 3HATH 1K1PA 5CHAC 1ZSKA 1QJ7B 5AFZH 3T29A 1XUGA 1L4DA 2C3SA 4IC6A 1BTZA 2IOTA 1H9LB 2QV1A 3RU4E 2ZDNA 1Z6JH 1ANDA 1QA0A 3Q3XA 3TNTA 3KN2A 3F1SB 1FIZA 1WQVH 2PUQH 3MH4A 2ZHEH 1MTSA 3PMBB 1OP0A 2FOMB 1KLJH 1EZQA 1UTQA 1Y3UA 3NPSA 1OS8A 3M36A 3RXSA 2H5DA 1P05A 1S81A 1CBWB 2ZA5A 3RXKA 4YZUA 3ZVBA 2FS9A 2ILNA 2FS8A 2B0FA 1C5NH 4X6PA 1YC0A 5T6GA 1YPMH 4CRDA 2BDGA 2G8TA 4ASHA 2R2MB 8LPRA 1O2ZA 3MO3A 1TWXB 2THFB 2A7HA 3Q3KA 3MNSA 2XBXA 1BB0B 2BVXH 2FI3E 1TGCA 2UWOA 3SV7A 1PQ5A 1KDQB 5FBIA 1TOCB 3KQCA 1MD7A 3RUOA 1YLCA 1HUTH 1FAXA 1ESAA 1HAIH 1YPHC 1ANEA 5JBAS 2A1DB 1GCTB 1UTJA 1SOTA 2ZGBH 3MFJA 1V2LT 2EI6A 4UE7H 3P8NA 2AMDA 1IQLA 1AWHB 1A5HA 3DFJA 1VCPA 1UVTH 1O3HA 1P01A 4A1TA 3M61U 1CU1A 2BY5X 1KXBA 2XYAA 1YPLH 3V3MA 1S82A 2VU8E 2ZKSA 1FI8A 4CRFA 1ELAA 1QBVH 1A5IA 1ZRKA 2ZHWH 1GJBB 1F0UA 1LHCH 1ZJDA 2J9NA 2BDBA 1DY9A 1ELDE 3MNXA 2XBYA 3SU0A 1GHXH 1WTGH 3A85A 1WUNH 1K1NA 3A82A 3U1JB 3SV9A 4ABBA 4WJG2 1F5LA 6CHAC 3A7ZA 3LGIA 4UFDH 1O2QA 3U98H 1AD8H 3C1KA 1G3BA 5FPYA 3RXGA 2QY0B 4AYVB 1XVMA 1SGYE 3BG4C 2OQ5A 1DUEA 1GJCB 4YESB 3GCHB 1FAKH 1LKBA 3SQHE 4YT7H 3N7OA 3SJKA 3BTME 2ULLA 1OX1A 1TX8A 3EA9A