1BTZA

Episelection: novel ki ~nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords BETA-TRYPSIN
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btzA02
1GHBG 2J2UA 3SNBA 1VZQH 1C2JA 1NN6A 3A82A 3K9XB 2UUJB 1KLJH 1F5LA 2ZP0H 2OQUA 4XOJA 2BY9X 1JBUH 1VITG 1FDPA 2HRVA 1P2NA 3U9AH 3ZZ4A 2YOLA 4JK6A 4ASHA 4FVBA 4X6MA 5C2ZA 2BQ6B 1MCVA 5EW1H 1A2CH 3RXPA 4ZXXH 1O2MA 3RXGA 3FFGA 3K65B 1PYTD 1NTPA 3URDA 3U1JB 5EQSA 2QF3A 2Z3EA 3A7VA 1O2IA 1MAXA 2BB4A 4IS5A 1V2QT 1W7XH 3OX7U 1NS3A 2QF0A 1S84A 1C5WB 2W5EA 1W13U 4X8VH 1P57B 4Y0ZE 3Q77A 1TOMH 4WJG2 2GT7A 4XE4A 5ETXA 1O30A 2GCHF 2FLBH 3TLOA 1GMDG 4MPUA 2PV9B 1IQJA 2UUFB 4AX9H 2XYAA 1E38B 1GMDF 4K1SA 4MNYA 1F92A 1MKXK 2RG3A 4DT7B 1DOJA 3BTKE 1BT7A 3TJNA 1TPSA 1EOJA 3GDVA 3PO1B 1N6XA 3TH3H 4ABDA 1UTLM 4UFDH 2ZFRH 2VVVA 4NA9H 2AH4X 3VPKA 3MNXA 3F9GA 2ZDKA 3Q3KA 1S6FA 2J9NA 3PLKA 3PTBA 1QB9A 1UTPA 5AF9H 3GOVB 3RXOA 1O2LA 3ZZ3A 1TB6H 1ESTA 1GBLA 2GV6A 1NRSH 2FODA 2HVXA 2BD4A 1W7GH 3SUEA 1P09A 5JYIA 1LO6A 4CH2B 2ESTE 1P3EA 1ZR0A 1KIGH 4DCDA 1MZDA 3OTJE 5EW2H 3O8RA 1SGNE 1C5YB 2XCFA 2ZDMA 3L3TA 4A1XA 1O2XA 3RC5A 1GHAF 1YKTA 1G2LA 5SGAE 3BTHE 1UTJA 4DOQA 1HJ9A 3GY7A 4F4OC 2G4UA 2GX4A 4GCHG 3ZVCA 5HXFA 2HGTH 5LH8A 1WAYB 1O2HA 3A85A 3EDXB 3LPRA 6GCHG 1EAIA 3GDSA 1V2JT 3LC3A 1G32B 1NRPH 5A0AE 3MH4A 4DIIH 2VH6A 1UTMA 2QA9E 1V2MT 5GJ4B 4B73A 4BAKB 2C8YB 4A92A 1A1RA 1YCPM 1N8OC 1GI2A 1OX1A 3ATWA 2P59A 2A32A 3TU7H 1P11E 4XDEA 1TMBH 3QDZB 1YPGH 3ENSB 1XXDA 3DFLA 3RXHA 4ABHA 2A4OA 2GVFA 2H9TH 1O2JA 1JRSA 1ZGVA 1H9LB 1TQ0B 3BTWE 1BTUA 4TPIZ 1AE8H 4X1QU 2VNTA 1OWKA 1G37A 3U98H 1HAYB 3UREA 1IHSH 5EODA 4I8JA 1HAOH 2XBVA 3UWIA 1MUEB 1Z6JH 3LONA 1ANBA 2ODPA 1BQYA 1ZZZA 1GDNA 5GPIB 1ELGA 2Z3DA 1HAVB 3HGNA 1QURH 1G3BA 3LKWA 4O9VA 2FIRH 1MMJN 1XX9A 2PTNA 1D3DB 4K1TA 3ELAH 2VIQA 3PM3A 1FY1A 1GHWH 1YLCA 5EOKA 4E7NA 5DP3A 1LKBA 3E91A 1ELFA 3SBKA 3BTGE 1DFPA 3DFJA 2Y5HA 1ABJH 1KXFA 5T6GA 1FY5A 2GCTC 2ZI2H 2A4GA 3KEEA 1LPKB 1MD7A 5F03A 2FOGA 4MLFB 4ZHMU 3F9EA 1LMWB 1MCTA 1LHEH 1UJ1A 5HYOA 1O3EA 1C1OA 1GBMA 1HJAC 1QBOA 3BEIB 1C1UH 1VCQA 1O5FH 2CHAC 5FX5A 3OY6U 1HRTH 3RXRA 2FZZA 2PGQB 4KTSA 2A1DB 3A8CA 1SGEE 4RSPA 2BOHB 1O3GA 1MU6B 1EOLA 1GBHA 2OC7A 3BIVH 4IMZA 4MVNA 3E0NB 4B2CA 1CT4E 1Y5AT 4FU9A 1BJVA 1V2TT 1K22H 2A4QA 3PV4A 4IC5A 5EGMA 4O3TA 3P17H 2FI5E 1G3DA 4ABEA 1QBNA 4SGAE 2ZGBH 2FESH 1BTXA 1AUJA 2G5NA 1HAPH 1BRAA 3LGUA 1O2VA 3MNBA 4H4FA 2BYAX 4X6PA 1V2KT 1OXGA 1GJ6A 3AASA 2QXIA 1OSSA 2NWNA 1C4Y2 3RC4A 1W0ZU 1GBTA 4Q2KA 1PQ8A 5BPEA 1EASA 1K1MA 1K1IA 1C2EA 2PUXB 1C4U2 2C4FH 2VVCA 2XXLA 1FLEE 1AQ7A 2QIQA 2FMJA 1CGIE 1DY8A 1TX8A 1GHYH 1N8OB 1CHGA 2QN5T 1NY22 1IHTH 3UNQA 3SV2H 1FY4A 1HAIH 2P16A 3RXTA 1O2UA 3ZZ8A 2BD3A 2LNCA 1HXFH 1QB1A 2Y5FA 4DIHH 2AIPA 1P04A 2AGGX 4AGJA 4X2VA 3UIRA 1TGBA 3PROA 4X8TH 1Y8TA 5LPFA 2Z7FE 3F68H 4DGJA 1GJ8B 4HGCA 2W3KA 2OUAA 1K1PA 3MO6A 1G36A 4JCNA 2XTTB 4NFFA 1SGRE 3SU3A 4FUBA 1GBEA 3QK1A 3UOUA 5TJXA 4A1TA 2ASUB 3A7ZA 1JMOH 1C5ZB 2WYJA 1ID5H 4MPWA 1S81A 3QN7A 2PWXA 1XUGA 2QC2A 3UTUH 1P02A 3LU9B 3STIA 2BY5X 1YGCH 2FTMA 5JBAS 4AFSA 2BTCE 4AN7A 1YPMH 3TVJB 2BXTH 2WPMS 1TMTH 4WH8A 2A5AA 1J8AA 1IQKA 2FYQA 1GVKB 1T7CA 1CBWC 4H42U 2K1QA 5TCCA 1O5BB 3ZZDA 2GCTB 3LGWA 1LTOA 4YT6H 1C5OH 1DSUA 1KXEA 5EXMA 2ZFPH 1B0EA 1O31A 1OP2A 1GBBA 3S7KB 1NZQH 1FXYA 1V2OT 1DX5M 1GI6A 4UFFH 1FIZA 1HJAB 1FAXA 2BZAA 3EA7A 2ZTYA 4DG4A 3D62A 1AU8A 4ISHH 1AFQC 5J4QA 2GP9B 1O5AB 2CHAB 2STAE 5LGOA 4I8KA 2ZU5A 4DVAU 4A7IB 1LVBA 2PGBB 1OWJA 5T6DA 4Y8YA 2C8XB 1ORFA 1SGFA 1SL3A 2A7CA 1SG8B 2XRCA 4I31A 3VGCC 3U1IB 3EE0B 4GPGA 3GY8A 2Z94A 1GVLA 3RU4D 4MQAA 2W7UA 2OTVA 2ZECA 2ZDLA 1GDQA 1OKXA 3VB3A 2SGFE 1Y5UT 3MOCA 3V13A 4HFPB 4CBOA 3MO9A 2Z6BD 5EG4A 3SU0A 1YPEH 3T26A 2F9OA 4YM9A 3RMNH 1V2LT 1TNGA 1S6HA 1FMGA 1NPMA 2G81E 4TWYA 3SGBE 1KDQA 5A2MH 3SUGA 1GHZA 1V2UT 4Y79A 3ZYEA 4FUCA 1E37B 2WINI 4ABAA 5FCRA 3GCTF 3LOXA 4WWYA 1O2YA 2BY6X 1C1NA 2TGPZ 2ZEBA 1ZSJA 4E06H 4Y8ZA 3A8DA 1EUFA 1OYTH 5J4SA 1P2JA 3SUFA 1A61H 2FOAA 1WYKA 2BVXH 3F6UH 3TNSA 4D7FA 5F6MA 4ZKOU 1CE5A 3A80A 5GDSH 3MHWU 3MWIU 4J1YA 3SU4A 2CF8H 1AZ8A 1A7SA 2FLRH 5EQRA 2ODYB 1ZHPA 4I8LA 5A09A 1AWHB 1FONA 3UWJH 4M7GA 1QL8A 1EZSC 2G55A 1QL7A 4BAQB 3KNXA 3ZVFA 2VVUA 1NRRH 1ZPBA 3VXFH 1O2ZA 1TALA 1K1NA 1OS8A 2QYIA 3HK3B 1QNJA 3A7XA 3SGAE 1NT1A 3R3GB 1O3AA 2AMQA 1MU8B 2YNAA 3PWCA 1TNHA 2OLGA 4ABBA 4FUDA 1KXDA 5EPNA 3RLYH 3RMMH 1F7ZA 1KY9A 1HDTH 1BTPA 2QXJA 1UMAH 3ZV9A 1CBWB 2FP7B 4THNH 3E16B 2AERH 3VB7A 1LPGB 2I6SA 5A0BA 2CN0H 2JH0D 5DP9A 1YPJH 1FN6A 2XWBI 1OWHA 3MNCA 5IDKA 2BD2A 3RXVA 1E0FD 4ZH8A 1BHXB 1D9IA 3A8AA 2HPPH 4YT7H 2BD8A 1C1QA 2A2QH 4UFGH 1AFEH 4RKJB 1K21H 1AFQB 1CA0C 3EGKH 2ZPSA 3AW0A 2HLCA 3E3TA 3RXJA 2A4RA 3SORA 3W94A 1ETSH 1V2WT 2ANKH 2BDYA 3DA9B 5E0JA 1HAZB 5GCHG 3A87A 4IW4E 3VGCB 3HPTB 2F9BH 2J94A 2ZCHP 4JYTA 1NFYA 4B76A 2Y82A 1O2SA 2VU8E 2HOBA 3ATLA 4LZ4B 3PMHB 3F9HA 2FOFA 2J95A 2O8LA 3LIWA 2R3YA 5FPYA 5E2OA 1O38A 3AVZA 3U69H 2BD7A 3JZ1B 1C1SA 1O3NA 4AYYB 1C2IA 3SUDA 1G9IE 3TJOA 2PFEA 4FUIA 2C3SA 4BAMB 3QZRA 1EZQA 4R8TB 2TPIZ 2FOHA 4ISIH 3SNEA 3SW2B 5A8YA 1P2QA 2ZFTA 2ZU2A 3MH6A 1MTNC 3FVFB 4X1SU 3NXPA 4JZFH 2QV1A 1C2KA 1WTHD 1ZHMA 1P2MA 2XBXA 1C9TA 4CRFA 2VWOA 4WVPE 1SC8U 2BZ6H 1IAUA 3AW1A 2ALPA 1X7AC 2D8WA 4INLA 5FHTA 3A7TA 4CH8B 1P9UA 3GY6A 3C1KA 1AO5A 2XC4A 2GD4B 3QZQA 1C1RA 3H7OA 4NSYA 1YYY1 2UWOA 1BDAA 1DWCH 1MTUA 4BOHA 2PHBA 2PKSC 3E90B 2JETC 3T5FH 1TNLA 2B5TB 3RLWH 3ZZCA 2PTCE 3GICB 1BBRE 1NFUA 1BIOA 1LDTT 2AGIX 2GT8A 1TQ7B 4FUEA 1FNIA 1QTFA 2BLQA 1XKBC 5PTPA 2ZU4A 1AZZA 3BEUA 5DKMA 3A8BA 4TWWA 1G3EA 1TOCB 3URCA 1DUAA 2GCHG 1XUHA 1HBTH 5T3HA 1GMCG 2Y6TA 4J2YB 4LZ1H 1ZOMA 1AN1E 1GMCF 2SGDE 2WPIS 1XMNB 2EEKA 1O3OA 3QUMP 5L6NH 3B9FH 1BJUA 3RXIA 2Y7ZA 1Y59T 1O39A 2C8ZB 1RFNA 2F3CE 1HUTH 2HNTC 1G2MA 3A81A 3T28A 3I77A 5FBIA 2R3UA 2V3HH 1WCZA 3LH1A 1IQIA 3RXCA 1PPHE 3PMBB 1VJAU 1C9PA 1CA0B 5HGGA 3M61U 1EZXC 1C2HA 1SFIA 1SLVB 3PLBA 3VB5A 3ZZBA 2G00A 5DJ7A 3FP6E 1TONA 2ZHEH 1IOEA 1YPLH 1YPKH 3HKIB 1YCPH 1MKWK 1L0ZA 2ZDAH 3ATMA 3S9CA 1TGCA 1HIAB 1GBIA 1RRKA 1AVWA 4U2WA 1GJCB 4DY7B 2HNTE 1LHCH 3MU1A 1GHAG 2Z9GA 3QTVH 1KSNA 2AGEX 2BM2A 1KDQB 4INKA 3RP2A 1EAUA 1TBZH 2ZTZA 4B75A 4ABFA 1D3TB 1SOTA 2F9NA 2QAAA 3BN9A 3KQCA 2TGAA 1GCDA 3UQOA 1W14U 3TK6A 2BHGA 1SI5H 1TWXB 1VJ9U 2ZQ1A 1TPPA 5ESTE 1K1LA 1TMUH 3MTYA 2QXHA 1MTNB 1NU7B 3NUMA 2PW8H 3U8RH 4DJZB 1O37A 4NG9H 4CBNA 1W3CA 2NU1E 2ZHWH 3T27A 3S9AA 1LCYA 4WMDA 1ELDE 1OP8A 1C5XB 1ZTKA 1CU1A 2P3FH 5DGJA 3U8TH 3HATH 1W11U 4NA7A 4CRAA 1GVZA 3TH4H 4WY3A 3VEQB 2A5KA 1BBRK 1UTOA 2PKSB 1EX3A 2JETB 2QXGA 3V12A 2FI4E 3TPIZ 1KYNA 1SMFE 3ODFA 3LGVA 2NU3E 3K6ZA 3NKKA 3FANA 1RD3B 1S5SA 3M5OA 1LVOA 1Z8JB 4AZ2B 1QIXB 1DUEA 5FPSA 3M3TA 3UNSA 1PQ5A 3P8OA 3V7TA 3PMAB 1C5NH 1QFKH 2VWNA 4NWKA 4CRGA 2A2XH 2ZHFH 2ZGJA 2ZPRA 5C1UA 1UVTH 4LOYH 4SGBE 1GHXH 3SQEE 3KN2A 3PB1E 4X6NA 1LQEA 3GCOA 8GCHG 3BTTE 4IN2A 3KCGH 4JK5A 1SB1H 4K5ZA 1VGCC 1SQAA 2EI6A 8GCHF 2FXRA 2F91A 1EP6A 3SU5A 5DO4H 1PYTC 4NCYA 4NZQA 3OU0A 3RM2H 3F9FA 4AFQA 1LVYA 4ISOA 1KXAA 2FOMB 3M5MA 3DT0H 1GGDB 3AAVA 4U01A 4FU8A 1WSSH 1PJPA 3RXMA 2V35A 1TX6A 4OS7A 1EAWA 3NCLA 1QRWA 3VXEH 1A5GH 2FOCA 2G4TA 4CRDA 1DPOA 4BTTB 3B8JA 3ZVEA 3A7WA 2ZFFH 1TPAE 3SHCH 5F8XA 3MU4A 1GI3A 2W26A 1WU1A 2Z3CA 1DDJA 3M3SA 1ZPCA 5DP6A 2BDAA 1SGIB 1MTVA 1A0JA 1BMMH 3ZZAA 1TBRH 5F8ZA 4GAWA 3A86A 5FXLA 1ZJKA 4TY7A 1QR3E 1ETRH 1ZHRA 2BOKA 1O3LA 2O8MA 4WMEA 1QJ7B 1CO7E 4Q7YA 3L6PA 5C67A 1L1NA 1D6WA 5DPAA 1J9CH 1Q3XA 2ZU3A 4AB9A 2WPHS 3UOPA 2OBQA 1INCA 5BRRE 2C8WB 2VINA 1P06A 2VGCC 1BRCE 1DVAH 2OQ5A 3PYHA 5FBEA 3D65E 1GI9B 3RXEA 1BOQA 5E2PA 4FXGH 3BTFE 4CREA 3R0FA 1Q2WA 1SGYE 1A5HA 1VITH 1YP9A 1EZUC 4AG2A 4DW2U 1XVMA 1PPEE 1O33A 1PQ7A 1AD8H 2XW9A 1MKXH 3TJUA 1ZJDA 4UEHH 4FUHA 1AI8H 4CHAC 4K60A 1UK4A 4YLQH 3LJOA 3QX5H 1DY9A 1TRNA 4Z6AH 1IQGA 1Z1JA 4ZKSU 1AWFH 1MZAA 3GYLB 1T4UH 1Y3YA 2RA3A 3MFJA 4ESTE 1E36B 3SJ8A 1IQHA 1GBKA 3LGYA 2BVSH 1UCYH 1GBAA 1SGTA 1AE5A 1AY6H 2D26C 1FJSA 5L2YH 2A31A 2SGAA 1BMNH 4Q7ZA 4K8YA 2JH5D 1C2DA 2Q1JA 2SNWA 1HAXB 1VGCB 1G30B 1ARCA 1AVXA 3MU5A 2OD3B 1O2QA 1A0HB 1O3FA 3HGPA 1JWTA 1TIOA 1IQEA 1D3QB 2EA3A 1UVPA 1NO9H 3LDXH 3CS0A 3GY3A 2P93A 2IPHA 4KGAA 4IMQA 2B9LA 1GBCA 3SNCA 1BTHH 4K1EA 4MNXA 1O3PB 4HTCH 4A6LA 3IG6B 3ATIA 1QBVH 1RGQA 3LH3A 3MYWA 3SJIA 4KKDA 6ESTA 5C20A 4UE7H 1JIMA 2IOTA 4YOGA 1ANDA 1O3BA 5FAHA 1AKSB 4X6OA 1SGCA 2JKHA 2Z9LA 3BTDE 2NU0E 4WF8A 2AS9A 3SU2A 3SU6A 2QY0B 4MPVA 1DITH 1V3XA 3ATKA 4NIVA 3NPSA 1P01A 1FPCH 5FX6A 1ELEE 4I8GA 4LK4A 3TIUA 2NU4E 1SLUB 4D7GA 1C1TA 3FZZA 3SV6A 4X1PU 4NA8A 4IN1A 1BMLA 1SHYA 1KXBA 1B0FA 1NRNH 3RXLA 1UHBB 4RN6A 4BNRA 1C2MA 1O3MA 3V0XA 1CVWH 1A3EH 1ELVA 2F83A 2ZF0H 3ESTA 3M35A 1HIAA 1ZLRA 4B2AA 5GXPA 1P2OA 4NIYA 3ZZ5A 4AGKA 3M7QA 1TE0A 4ZKNU 2GMTC 1BA8B 1J14A 1NRQH 4ZUHA 3GCTG 2GZ8A 1G3CA 1A46H 1C1WH 1NM6A 2GKVE 5JB8S 1IQNA 2CV3A 4GHQA 1H9HE 1GJ5H 1GJ9B 5A8XA 2FM2A 1PPBH 3ZVGA 2VGCB 1EPTC 3EQ0H 2ZQ2A 3ZVDA 2PKAA 1Z7KA 1O2TA 1EKBB 2JH6D 3E1XB 2H9HA 1GI0A 4GVUA 5DK1A 1T8NA 2G52A 3KQBA 2ZO3H 1HJ8A 1GJDB 2CMYA 1A4WH 1L4DA 5DP8A 3KHVA 1YF4A 3TK9A 1O0DH 3RXUA 1SOZA 1OOKB 5C1YA 1P12E 3TJVA 1LQDB 1TX7A 1ZTLA 3PTNA 3G01A 3JZ2B 1A5IA 2HWLB 1F5KU 4CHAB 1D6RA 1VCPA 2GDDA 1NC6A 4FUGA 1TLDA 2BDBA 3OY5U 1AIXH 4U32A 4X2XA 1BMAA 1L4ZA 4K3JA 2D2DA 4MG3A 3AAUA 5A8ZA 1S83A 2W7SA 4GSOA 2ZDVH 1HAGE 3UR6A 1ZRKA 1BZXE 1FQ3A 2IN2A 2TGTA 2WYGA 2SGEE 4ABIA 2EI8A 6CHAC 4F49A 1LKAA 1DE7H 5CE1A 5ABWA 1PPFE 4R0IA 2DUCA 2PR3A 4LXBH 1S85A 1CA8B 1CT0E 1TPOA 2SFAA 1SLWB 1EAXA 4VGCC 3ZZ7A 1C5SA 4IC6A 1O34A 3RXFA 3SO3A 1DS2E 4TY6A 1DLKB 3KIDU 2Z9JA 3D23A 1L1GA 4ZMAH 4AFUA 2ALVA 3Q76A 2GZ7A 1QA0A 4NIWA 4MTBA 1H9IE 5CHAC 3TH2H 1JIRA 1Z71A 1GJ7B 2ZCKP 1RJXB 3SU1A 5C3NA 1DT2A 1H4WA 1ABIH 1O2KA 4X0WU 2NU2E 2CJIA 3A84A 1BRBE 2V3OH 3RMOH 2R0KA 3NZIA 2BLWA 3S69A 5JB9S 1BITA 4UD9H 1ZMLA 3UFAA 1Z8RA 3BSQA 3VB4A 2A5IA 2VH0A 1O36A 2ZWLH 1BHXF 1LPZB 2BQWB 1Z1IA 4BAHB 4NZLA 2G8TA 2BDGA 5L30H 4I32A 2XWAA 1ESBA 1RTLA 1QRZA 1SHHB 2FS8A 2BVRH 2AYWA 1TFXA 2Q6GA 4NFEA 2BY7X 2ZA5A 1TBQH 2OBOA 1K2I1 4OGYA 5C1XA 5LPRA 1BRUP 3RXKA 1F0UA 1C2GA 1GL0E 4B74A 5FPTA 4Q7XA 2GMTB 1XUIA 1Y3WA 1O2NA 3QWCH 1DWBH 2VWLA 3BTQE 3ITIA 3QO6A 4ISLA 5AFZH 1OWEA 1TNKA 1GJAB 1CHOF 2ZG0H 1DLEA 4XBBA 2F9VA 1TGSZ 3UPEA 2P8OC 3O8BA 3MI4A 1NFXA 2AIQA 2Y80A 4JZDH 1EPTB 4U30A 4BANB 4XSKU 4PROA 3I78A 3N7OA 2DE8A 5EQQA 7GCHG 2BD5A 1MH0A 2H9EH 2Y5GA 1J17T 1V2RT 1SSXA 4CR9A 7GCHF 1W12U 1O32A 6LPRA 1UTKA 1K28D 4WH6A 4H6TA 4BXSA 2BLVA 2OINA 1ELCA 4JYUH 4CR5A 3RU4E 3RXBA 4XBCA 3QGNB 4Y7BA 1GHBF 1QQ4A 1BTZA 3BG4C 3U8OH 4MNWA 1F0SA 4MNVA 1GJ4H 1VCWA 3TK5A 1VITF 2TGDA 2FEQH 2XBYA 2FWWA 4JZIA 6CHAB 1JOUB 2O8TA 1FAKH 1TNIA 1GG6C 2C90B 2BDHA 3B23B 3DUXH 7KMEH 2ODQA 3HKJB 4NIXA 2ZHDA 4KELA 3EA8A 4FVDA 1QHRB 4K8BA 1NU9A 3QGJA 9ESTA 1ZMNA 1T4VH 3SZNA 4Y6DA 4BTIB 4VGCB 1H1BA 2UUYA 4YTAA 1UK3A 1HCGA 1B5GH 3K6YA 1FUJA 4D8NA 1WOFA 5F8TA 4E05H 1Q31A 3VB6A 1GGDC 9LPRA 1KLIH 1K1JA 2XBWA 1P2IA 2IJOB 4AYVB 4X8UH 4Y71A 5CHAB 3T2NA 1C5LH 1T8MA 4QT8C 1C5MD 2VIDA 4KTCA 1O3KA 3STJA 3F1SB 3EYDA 5I25A 1QGFA 4Y7AA 1A0LA 1ETTH 1RTKA 2B7DH 2RDLA 1CSOE 3DD2H 1P10A 1P3CA 2BDIA 1EQ9A 3MMGA 1DICA 2B8OH 2R2MB 3P8FA 3T29A 2OP9A 3PLPA 2QCYA 1XUKA 2BD9A 1AKSA 1O5GH 2KAIA 1SGFG 4AOQA 3NWUA 5E8EH 4ZKRU 2F9PA 1MQ6A 1UCYK 1UTNA 1DSTA 3MNSA 3O8DA 3M37A 4TYDA 1FPHH 2A45B 4ISNA 1O2RA 4H6SB 1GJBB 1DANH 1T31A 1UHBA 1GI5A 4YO9A 1JXPA 2H1UA 4AORA 1QJ1B 1N1LA 1WBGB 3QLPH 1O3DA 2OXSA 2FOEA 1LVMA 1ZMJA 2PKAB 1DWEH 3GY4A 1S82A 1W8BH 1C4V2 2P8OB 2J38A 1KXCA 4Z0KA 2EC9H 1GI4A 1O5CB 1WV7H 4OS4A 3LT3A 4D76A 4GHTA 1GI8B 2OC0A 8KME2 3KGPA 1HYLA 4GCHF 1SQOA 1EP5A 3S7HB 4IBLH 3E8LA 4DURA 5DP5A 1V2PT 1XM1A 4WXIA 3LGIA 1ZSLA 2CGAA 6GCHF 1EB2A 2GV7A 3SHAH 4O97A 2VIVA 1P2KA 2Z9KA 1FY3A 1V2ST 1O5EH 1TA2A 2AFQB 2GTBA 5EPYA 1PPCE 2BXUH 2ZZUH 3W95A 1D4PB 4TPYA 3EA9A 1TGTA 1SR5C 1THSH 3MH5A 2C93B 2V6NA 2Q6DA 3ZYDA 2O8WA 5AVDA 4MPXA 1ZTJA 1YPHC 2M5TA 2WUCA 3BG4B 1ZYOA 1YBWA 2XNIA 5A0CA 2ZDNA 5E0GA 4A5TS 1O2OA 1HB0B 1KTTB 5JBBS 2THFB 3TGKE 3V3MA 4K2YA 3SJOA 4Y0YE 1H8DH 1CT2E 3IITA 3SN8A 3RU4T 3SI3H 3H5CB 3WY8A 2PLXA 1GG6B 1V2NT 2ZFSA 1SPJA 1XXFA 1BUIA 3HK6B 3M7UA 1AMHA 4GUXA 5K7RA 3OSYA 2ZPQA 5C5NA 1AHTH 1WTGH 3Q00A 2BQ7B 4INHA 1YM0A 1CGHA 1F2SE 5EU8A 1YPHE 2CXVA 1GBJA 3SNAA 1DM4B 2RCEA 5GWZA 1HXEH 3P8NA 3LC5A 5H4IB 5I46H 1HAHH 2O9QA 2FO9A 2ZKSA 1IQMA 2Y81A 2G51A 4YOJA 3S9BA 1EJNA 2UWPA 3GCNA 4BXWA 1P03A 5DG6A 1MAYA 3SOSA 5HMAA 3UR9A 1E35B 3BF6H 2UWLA 4OS6A 2R9PA 3GY2A 2HNTF 3H7TA 3CENA 1HGTH 1QCPA 1S0RA 2WPLS 2WPJS 1ELAA 1YLDA 2XC5A 4I7YH 1QRXA 1THRH 3GCHC 2AEIH 1RTFB 1T32A 4HZHA 3SV8A 4UONA 3P6ZB 1SBWA 3ZZ6A 1UVUH 1FZZA 2FPZA 3FAOA 1QY6A 4JYVH 3RXDA 4X1RU 2TIOA 2G5VA 4A1VA 3CS7A 3LJJA 1O5DH 4KTUA 2FYRA 1W10U 8LPRA 1FN8A 2J34A 1QJ6B 3ZZ9A 4IGDA 1OP0A 4Y8XA 3SQHE 1B7XB 1GBDA 5FCKA 5EXLA 1P9SA 3PWBA 1AUTC 1GMHG 4X8SH 3P92A 1GDUA 1P05A 1SLXB 1GMHF 2ZC9H 1SFQB 2WV5A 1ELTA 4AB8A 1QA7A 1HV7A 2BMGB 1D3PB 1ARBA 3KQDA 4BTUB 2ANYA 1AGJA 1NESE 5HM2A 3MU0A 1GWAA 3FP8E 1EPTA 3TITA 2LPRA 1N6YA 3Q3XA 1SQTA 1F0RA 1QL9A 3L33A 4ZROA 1Y3XA 1GBFA 2XC0A 1JRTA 1KLTA 2BLOA 1TABE 2ILNA 4NSVA 5K0HA 1OPHB 2SGPE 4YLUA 4X2WA 1XVOA 3SJKA 1WQSA 1K9OE 2I6QA 1O3HA 1O35A 2CF9H 4D9QA 3GISB 3E0PB 3SV7A 1GCTC 4WMFA 4JZ1A 1F5RA 1C5UA 4YOIA 2R2WU 5TCAA 5HM9A 1ZSKA 1UTQA 1C1MA 5JDUB 3S0NA 2EI7A 1QQUA 2A7HA 1EJAA 1PPGE 2FS9A 4NWLA 3RXQA 2QGRA 1H8IH 3M3VA 4ZXYH 1LHDH 1QB6A 4JMYA 2VIWA 2HALA 1MKWH 1O2GH 2FDAA 1C2FA 1Y3VA 2V0BA 3PMJA 4FU7A 5AHGH 3NK8A 4AFZA 1T8OA 1Z8IB 2ZNKH 1UK2A 1EJMA 1DXWA 1ANEA 4MDSA 3RXAA 3A88A 3M5NA 3O8CA 4OGXA 1O2WA 3CP7A 1AB9C 1F0TA 5JPMH 2P94A 1SGQE 2RA0A 2VWMA 3SNDA 1IQLA 2AMDA 1SGPE 3KQEA 1OYQA 3DHKH 2J4IA 1U6QA 2KAIB 4OS5A 1M9UA 2ANMH 1C1VH 3M7TA 3SGQE 4Y10E 2VB0A 2GGVB 1E34B 3T62A 3M36A 1NFWA 2ZU1A 1BTYA 1MTWA 5JBTA 1GI7B 4B71A 1ZPZA 1SVPA 1PFXC 3GCHB 3GYMA 5DP4A 3MO3A 2PUQH 3UQVA 2Y7XA 1Y3UA 1FY8E 2YNBA 4Q80A 5T6FA 1CQQA 2WV4A 1L2EA 3A7YA 4NGAH 5CMXH 4I8HA 2PSYA 1MD8A 1OWIA 1EB1H 5L2ZH 5DP7A 5LPEA 1HPGA 2VJ1A 4UFEH 2P95A 3C27B 1J16A 3VFEA 3E6PH 7ESTE 1BBRH 1TNJA 1C5PA 1ESAA 5EXNA 2DE9A 3T25A 2FTLE 1Y5BT 1LHGH 1RIWC 3MU8A 1A3BH 1BCUH 1S0QA 2HPQH 2TRMA 2FI3E 3UUZA 1C2LA 1ELBA 3D49H 1BB0B 2OC8A 1TRMA 2D1JA 3FZDA 1GI1A 4K69A 2FX4A 1NROH 2A7JA 5JBCS 1TRYA 1PQAA 3M5LA 4X2YA 4YZUA 2ZCLP 1YCPK 1P0SH 3EAJA 4XFQA 1J15A 5AFYH 2STBE 1XKAC 3RUOA 2BX4A 2Z9IA 4HI3A 1YC0A 3MH7A 1V2VT 3KF2A 1O3CA 2ZFQH 2ZGXH 5IYTA 3RC6A 3ZVBA 2AMPA 1O2PA 1CGJE 1SGDE 1C1PA 3A83A 1Z6EA 1FV9A 1GHVH 1WUNH 4ZAEA 1GCTB 3BV9B 1W0YH 2B0FA 2ULLA 2GZ9A 2GDEH 2R0LA 4CRBA 4GLYA 1ZGIA 4WXVA 8ESTE 1T8LA 4OS2A 2H5CA 2OCVB 2BX3A 1ANCA 4I33A 1EXFA 4X1NU 3RDZA 5GIBA 3P95A 4BAOB 2ANWA 4JZEH 1KTSB 1C5RA 2XCNA 4B1TA 2H6MA 1OWDA 2P3TB 3SI4H 3QTOH 1RXPA 1HNEE 5C5OA 5ESBA 1O3JA 4O03A 1UVSH 1W2KH 3P70B 3Q3YA 4D9RA 4YESB 2SNVA 2ZGCA 4Y11E 1O3IA 3FP7E 3UNRA 2PSXA 2P3UB 3K2UA 2ZGHA 1HAVA 1AB9B 1HLTH 1UO6A 1DXPA 3TNTA 1TYNA 3GDUA 4CRCA 1C5TA 1MBMA 2BDCA 1UVOA 1MTSA 1GPZA 2BY8X 4B2BA 3PO1C 2VIOA 4XBDA 2ZTXA 4ZHLU 3BG8A 2H2ZA 2W3IA 1P8VC 4ZHAA 3BTME 1THPB 2TBSA 2FX6A 1HFDA 3BIUH 5B6OA 1VR1H 2WPKS 3TGJE 1EATA 3RM0H 1TA6A 1Z8GA 1MBQA 1TAWA 1LHFH 4ABJA 1FIWA 3RMLH 1UCYE 3A89A 1XUJA 2WUBA 3ODDA 3IWMA 1L1JA 2O8UA 1AVGH 5GCHF 1K1OA 1BTWA 1CHOG 2VIPA 3ZVAA 3UY9A 4FUJA 1DWDH 3KL6A 3P8GA 1IQFA 1C5QA 1ZRBA 3ZV8A 4AG1A 7LPRA 3I29A 1XUFA 3SV9A 1RIWB 3BTEE 2F9UA 2J92A 5G4BA 3BEFB 4FUFA 3SJ9A 3TGIE 1WQVH 3RXSA 4E7RG 2ZIQH 4UDWH 4Y76A 4O3UA 1ACBE 4KP0A 3OYPA 2A0QB 2ZHQH 2H5DA 2Q6FA 3GY5A 2UUKB 1V6DA 2OC1A 4RKOB 2SGQE 1C5VA 1FI8A 4OS1A 1MQ5A 1RS0A 3LGTA 5E0HA 2FOBA 1TGNA 1GL1A 4ABGA 1PPZA
chains in the Genus database with same CATH superfamily
1GHBG 2J2UA 3SNBA 1VZQH 1C2JA 1NN6A 3A82A 3K9XB 2UUJB 1KLJH 1F5LA 2ZP0H 2OQUA 4XOJA 4B6EA 2BY9X 1JBUH 1VITG 1FDPA 1YLNA 2HRVA 1P2NA 3U9AH 3ZZ4A 2YOLA 4JK6A 4ASHA 3F2HA 4FVBA 4X6MA 5C2ZA 2BQ6B 1MCVA 5EW1H 1A2CH 3RXPA 4ZXXH 1O2MA 3RXGA 3FFGA 3K65B 1PYTD 1NTPA 3URDA 3U1JB 5EQSA 2QF3A 2Z3EA 3A7VA 1O2IA 1MAXA 2BB4A 4IS5A 1V2QT 1W7XH 3OX7U 1NS3A 2QF0A 1S84A 1C5WB 2W5EA 1W13U 4P02A 4X8VH 1P57B 4Y0ZE 3Q77A 1TOMH 4WJG2 2GT7A 4XE4A 5ETXA 1O30A 2GCHF 2FLBH 3TLOA 1GMDG 4MPUA 2PV9B 1IQJA 2UUFB 4AX9H 2XYAA 1E38B 1GMDF 4K1SA 4MNYA 1F92A 5KGOA 1MKXK 2RG3A 4DT7B 3MQKC 1DOJA 3VG8A 3BTKE 1BT7A 3TJNA 1TPSA 1EOJA 3GDVA 3PO1B 1N6XA 3TH3H 4ABDA 1UTLM 4UFDH 4Z1MD 2ZFRH 2J98A 2VVVA 3U28C 4NA9H 2AH4X 3VPKA 3MNXA 3F9GA 2ZDKA 3Q3KA 1S6FA 2J9NA 3PLKA 3PTBA 1QB9A 1UTPA 5AF9H 4Q4LA 3GOVB 3RXOA 1O2LA 3ZZ3A 1K0HA 1TB6H 1ESTA 1GBLA 2GV6A 1NRSH 2FODA 2HVXA 1VKYA 2BD4A 1W7GH 3SUEA 1P09A 5JYIA 1LO6A 4CH2B 2ESTE 1P3EA 1ZR0A 1KIGH 4DCDA 1MZDA 3OTJE 5EW2H 3O8RA 1SGNE 1C5YB 2XCFA 2ZDMA 3L3TA 4A1XA 1O2XA 1WDIA 3RC5A 1GHAF 1YKTA 1G2LA 5SGAE 3BTHE 1UTJA 4DOQA 1HJ9A 3GY7A 3ZIAD 4F4OC 2G4UA 2GX4A 4GCHG 3ZVCA 5HXFA 2HGTH 5LH8A 1WAYB 1O2HA 3A85A 3EDXB 3LPRA 6GCHG 1EAIA 3GDSA 1V2JT 2WV9A 3LC3A 1EFRD 1G32B 1NRPH 5A0AE 3MH4A 4DIIH 2WHXA 2VH6A 1UTMA 2QA9E 1V2MT 5GJ4B 4B73A 4BAKB 2C8YB 4A92A 1A1RA 1YCPM 1N8OC 1GI2A 1OX1A 3ATWA 2P59A 2A32A 3TU7H 1P11E 3OEED 1TMBH 4XDEA 3KYGA 1YPGH 3ENSB 3QDZB 1XXDA 3DFLA 3RXHA 4ABHA 2A4OA 2GVFA 2H9TH 1O2JA 1W0JD 1JRSA 1ZGVA 1H9LB 1TQ0B 4B6FA 3BTWE 1BTUA 5C17A 4TPIZ 1AE8H 4X1QU 2VNTA 3UB0A 1OWKA 1G37A 3U98H 1HAYB 3UREA 1IHSH 5EODA 4I8JA 1HAOH 2XBVA 3UWIA 1MUEB 1Z6JH 3LONA 1ANBA 2ODPA 1BQYA 1ZZZA 1GDNA 5GPIB 1ELGA 2Z3DA 1HAVB 3HGNA 1QURH 1G3BA 3LKWA 4O9VA 2FIRH 1MMJN 1XX9A 2PTNA 1D3DB 4K1TA 3ELAH 2VIQA 3PM3A 1FY1A 1GHWH 1YLCA 5EOKA 4E7NA 5DP3A 1LKBA 3E91A 1ELFA 3SBKA 3BTGE 1DFPA 3DFJA 2Y5HA 1ABJH 1KXFA 2M2AA 5T6GA 1FY5A 2GCTC 2ZI2H 2A4GA 3KEEA 1LPKB 1MD7A 5F03A 2FOGA 4MLFB 4ZHMU 3F9EA 1LMWB 1MCTA 3N7DA 1LHEH 1UJ1A 5HYOA 1O3EA 1C1OA 1GBMA 1HJAC 1QBOA 3BEIB 1C1UH 1VCQA 1O5FH 2JJ2D 2CHAC 2RDEA 5FX5A 3DSOA 1YY3A 3OY6U 1HRTH 3RXRA 2FZZA 2PGQB 4KTSA 2A1DB 3A8CA 1SGEE 4RSPA 2BOHB 1O3GA 1MU6B 1EOLA 1GBHA 2OC7A 3BIVH 4IMZA 4MVNA 3E0NB 4B2CA 1CT4E 1Y5AT 4FU9A 2JIZD 1BJVA 1V2TT 1K22H 2A4QA 3PV4A 4IC5A 5EGMA 4O3TA 3P17H 2FI5E 4FETA 1G3DA 4ABEA 1QBNA 4SGAE 2ZGBH 2FESH 1BTXA 1AUJA 2G5NA 1HAPH 1BRAA 3LGUA 1O2VA 3MNBA 4H4FA 2BYAX 4FOUC 4X6PA 1V2KT 1OXGA 1GJ6A 3AASA 2QXIA 1OSSA 2NWNA 1C4Y2 3RC4A 2K8IA 1W0ZU 5KEDA 1GBTA 4Q2KA 1PQ8A 5BPEA 1EASA 3OFND 1K1MA 1K1IA 1C2EA 2PUXB 1C4U2 2C4FH 2VVCA 2XXLA 1FLEE 1AQ7A 2QIQA 2FMJA 1CGIE 1DY8A 1TX8A 1GHYH 5DSFA 2QE7D 1N8OB 1CHGA 2QN5T 1NY22 1IHTH 3UNQA 3SV2H 1FY4A 1HAIH 2P16A 3RXTA 3SZEA 1O2UA 3ZZ8A 5F53A 2BD3A 2LNCA 1HXFH 1QB1A 2Y5FA 3F0OA 4DIHH 2AIPA 1P04A 2AGGX 4AGJA 4X2VA 3UIRA 1TGBA 3PROA 4X8TH 1Y8TA 5LPFA 2Z7FE 3F68H 4DGJA 1GJ8B 4HGCA 2W3KA 2OUAA 1K1PA 3N7EA 3MO6A 1G36A 4JCNA 2XTTB 4NFFA 1SGRE 3SU3A 4FUBA 5FL7D 2W6ID 2KFWA 1GBEA 3QK1A 3UOUA 5TJXA 4A1TA 2ASUB 3A7ZA 1JMOH 1C5ZB 2WYJA 1ID5H 4MPWA 1S81A 2EY4C 3QN7A 2PWXA 1XUGA 2QC2A 3UTUH 1P02A 3LU9B 3STIA 2BY5X 1YGCH 2FTMA 5JBAS 4AFSA 2BTCE 4AN7A 1YPMH 3TVJB 2BXTH 2WPMS 1TMTH 4WH8A 2A5AA 1J8AA 1IQKA 2FYQA 3F3BA 1GVKB 1T7CA 1CBWC 4H42U 3EE7A 2K1QA 5TCCA 1O5BB 3ZZDA 2GCTB 3LGWA 1LTOA 4YT6H 1C5OH 1DSUA 1KXEA 3KYFA 5EXMA 2ZFPH 1B0EA 1O31A 1OP2A 1GBBA 3S7KB 1NZQH 1FXYA 1V2OT 1DX5M 1GI6A 4UFFH 1FIZA 1HJAB 2PP6A 1FAXA 2BZAA 3EA7A 2ZTYA 4DG4A 1NBME 3D62A 1AU8A 4ISHH 1AFQC 5J4QA 2GP9B 1O5AB 2CHAB 2STAE 5LGOA 4I8KA 2ZU5A 4DVAU 4A7IB 1LVBA 2PGBB 1OWJA 5T6DA 4Y8YA 2C8XB 1ORFA 1SGFA 1SL3A 2A7CA 1SG8B 2XRCA 4I31A 3VGCC 3U1IB 3EE0B 4GPGA 3GY8A 2Z94A 1GVLA 3RU4D 4MQAA 2W7UA 2OTVA 2ZECA 2ZDLA 1GDQA 1OKXA 3VB3A 2SGFE 1Y5UT 3MOCA 3V13A 4HFPB 4CBOA 3MO9A 2Z6BD 5EG4A 3SU0A 1YPEH 3T26A 2F9OA 4YM9A 3RMNH 1V2LT 1TNGA 1S6HA 5CHBA 2YMSC 1FMGA 1NPMA 2G81E 4TWYA 3SGBE 1KDQA 5A2MH 3DSGA 3SUGA 2KR7A 1GHZA 1V2UT 5HIZA 4Y79A 3ZYEA 4FUCA 2QF4A 1E37B 2KCAA 2WINI 4ABAA 5FCRA 3GCTF 3LOXA 4WWYA 1O2YA 2BY6X 1C1NA 2TGPZ 2ZEBA 1ZSJA 4E06H 4Y8ZA 3A8DA 1EUFA 2CK3D 1OYTH 5J4SA 1P2JA 3SUFA 1A61H 2FOAA 1WYKA 2BVXH 3F6UH 3TNSA 4D7FA 5F6MA 4ZKOU 1CE5A 3A80A 5GDSH 3MHWU 3MWIU 4J1YA 3SU4A 2CF8H 1AZ8A 1A7SA 2FLRH 4F48B 5EQRA 2ODYB 1ZHPA 4I8LA 3FN8A 5A09A 1AWHB 1FONA 3UWJH 4M7GA 1QL8A 1EZSC 2G55A 1QL7A 4BAQB 3KNXA 3ZVFA 2VVUA 1NRRH 1ZPBA 4DT4A 3VXFH 1O2ZA 1TALA 1K1NA 5KECA 1OS8A 2QYIA 3HK3B 1QNJA 3A7XA 3SGAE 1NT1A 3R3GB 1O3AA 2AMQA 1MU8B 2YNAA 3PWCA 1TNHA 2OLGA 4ABBA 4FUDA 1KXDA 5EPNA 3RLYH 3RMMH 1F7ZA 1KY9A 1HDTH 1BTPA 2QXJA 1UMAH 3ZV9A 1CBWB 2FP7B 4THNH 3E16B 2AERH 3VB7A 1LPGB 2I6SA 2OK5A 5A0BA 2CN0H 3PRBA 2JH0D 2HLDD 5DP9A 1YPJH 1FN6A 2XWBI 1OWHA 3MNCA 5IDKA 2BD2A 3RXVA 1E0FD 4ZH8A 1BHXB 1D9IA 2XNDD 3A8AA 2HPPH 4YT7H 2BD8A 1C1QA 2A2QH 4UFGH 1AFEH 4RKJB 1K21H 1AFQB 1CA0C 3EGKH 2ZPSA 3AW0A 2HLCA 3E3TA 3RXJA 2A4RA 3SORA 3W94A 1ETSH 1H8HD 1V2WT 2ANKH 2BDYA 3DA9B 5E0JA 1HAZB 5GCHG 3A87A 2K0QA 4IW4E 3VGCB 3HPTB 2F9BH 3F2FA 2J94A 2ZCHP 1E1QD 1NFYA 4JYTA 2Y82A 4B76A 1O2SA 2VU8E 2HOBA 3ATLA 2LELA 3PMHB 3F9HA 4LZ4B 2FOFA 2J95A 2O8LA 3LIWA 2R3YA 5FPYA 5E2OA 1O38A 3AVZA 3U69H 2BD7A 3JZ1B 1C1SA 1O3NA 2F4LA 4AYYB 1C2IA 3SUDA 1G9IE 2YMSB 3TJOA 2PFEA 1H8ED 4FUIA 2C3SA 4BAMB 3QZRA 1EZQA 4R8TB 4RI0A 2TPIZ 2FOHA 4ISIH 3SNEA 3SW2B 5A8YA 1P2QA 2ZFTA 2ZU2A 3MH6A 1MTNC 3FVFB 4X1SU 3NXPA 4JZFH 2QV1A 1C2KA 1WTHD 1ZHMA 1P2MA 2XBXA 1C9TA 4CRFA 2VWOA 4WVPE 1SC8U 2BZ6H 5IK2D 1IAUA 2LP6A 3AW1A 2ALPA 1X7AC 2D8WA 4INLA 5FHTA 3A7TA 4CH8B 1P9UA 1MABB 3GY6A 3C1KA 1YWUA 5C0UA 1AO5A 2XC4A 2GD4B 3QZQA 1E1RD 5B6LA 1C1RA 3H7OA 4NSYA 1YYY1 2UWOA 1BDAA 1DWCH 1MTUA 4BOHA 2PHBA 2PKSC 3KQ5A 3E90B 2JETC 4ACBA 3T5FH 1TNLA 2B5TB 3RLWH 3ZZCA 2PTCE 3GICB 1BBRE 1NFUA 1BIOA 1LDTT 2AGIX 2GT8A 1TQ7B 4FUEA 1FNIA 1QTFA 2BLQA 4Q63A 1XKBC 5PTPA 4HG6A 2ZU4A 1AZZA 3BEUA 5DKMA 3A8BA 4TWWA 1G3EA 1TOCB 3URCA 1DUAA 2GCHG 1XUHA 1HBTH 5T3HA 1GMCG 2Y6TA 4J2YB 4LZ1H 1ZOMA 2J97A 1AN1E 1GMCF 2SGDE 2WPIS 1XMNB 2EEKA 1O3OA 2KCPA 3QUMP 5L6NH 3B9FH 1BJUA 3RXIA 2Y7ZA 1Y59T 1O39A 2C8ZB 1RFNA 2F3CE 1HUTH 2HNTC 1G2MA 3A81A 3T28A 3I77A 5FBIA 2R3UA 2V3HH 1WCZA 3LH1A 1IQIA 3RXCA 1PPHE 3PMBB 1VJAU 1C9PA 1CA0B 5HGGA 3M61U 1EZXC 1C2HA 3DSPA 1SFIA 1SLVB 3PLBA 3VB5A 3ZZBA 2G00A 5DJ7A 3FP6E 1TONA 2ZHEH 1IOEA 1YPLH 2KZ4A 4F55A 1YPKH 3HKIB 1YCPH 1MKWK 1SKYE 1L0ZA 2ZDAH 3ATMA 3S9CA 1TGCA 1HIAB 1GBIA 1RRKA 1AVWA 4U2WA 1GJCB 4DY7B 2HNTE 1LHCH 3MU1A 1GHAG 2Z9GA 3QTVH 1KSNA 2AGEX 2BM2A 1KDQB 4INKA 3RP2A 1EAUA 1TBZH 2ZTZA 5T1VA 4B75A 4OM9A 4ABFA 1D3TB 1SOTA 2F9NA 2QAAA 3BN9A 3KQCA 2TGAA 1GCDA 3UQOA 1W14U 3TK6A 2BHGA 1SI5H 1TWXB 1VJ9U 2ZQ1A 1TPPA 5ESTE 1K1LA 1TMUH 3MTYA 2QXHA 1MTNB 1NU7B 3NUMA 2PW8H 3U8RH 4DJZB 1O37A 4NG9H 4CBNA 1W3CA 2IJD1 2NU1E 2ZHWH 3W1EA 3T27A 3S9AA 1LCYA 4WMDA 1ELDE 1OP8A 1C5XB 1ZTKA 1CU1A 2P3FH 5DGJA 3U8TH 3HATH 1W11U 4NA7A 4CRAA 1GVZA 3TH4H 4WY3A 3VEQB 2A5KA 1BBRK 1UTOA 2PKSB 1EX3A 2KX4A 2JETB 5EJ1A 2QXGA 3V12A 2FI4E 3TPIZ 1KYNA 1SMFE 3ODFA 3LGVA 2NU3E 3K6ZA 3NKKA 3FANA 3SYJA 1RD3B 1S5SA 3M5OA 1LVOA 1Z8JB 4AZ2B 1QIXB 1DUEA 5FPSA 2J5UA 3M3TA 3UNSA 1PQ5A 3P8OA 3V7TA 3PMAB 1C5NH 1QFKH 2VWNA 4NWKA 4CRGA 2A2XH 2ZHFH 2ZGJA 2ZPRA 5C1UA 1UVTH 4LOYH 4SGBE 1GHXH 3SQEE 3KN2A 3PB1E 4X6NA 1LQEA 3GCOA 8GCHG 2JJ1D 3BTTE 2L6OA 4IN2A 3KCGH 4JK5A 1SB1H 4K5ZA 1VGCC 1SQAA 2EI6A 8GCHF 2FXRA 2F91A 1EP6A 3SU5A 5DO4H 1PYTC 4NCYA 4NZQA 3OU0A 3RM2H 3F9FA 4AFQA 1LVYA 4ISOA 1KXAA 2FOMB 3M5MA 3DT0H 1GGDB 3AAVA 4U01A 4FU8A 1WSSH 1PJPA 3RXMA 2V35A 1TX6A 4OS7A 1EAWA 3NCLA 1QRWA 3VXEH 1A5GH 2FOCA 2G4TA 4CRDA 1DPOA 4BTTB 3B8JA 3ZVEA 3A7WA 2ZFFH 1TPAE 3SHCH 5DN6D 5F8XA 3MU4A 1GI3A 2W26A 3F0PA 1WU1A 2Z3CA 1DDJA 3M3SA 2YMSD 1ZPCA 5DP6A 2BDAA 1SGIB 1MTVA 1A0JA 1BMMH 3ZZAA 1TBRH 5F8ZA 4GAWA 3A86A 5FXLA 1ZJKA 4TY7A 1QR3E 1ETRH 1ZHRA 2BOKA 1O3LA 2O8MA 4WMEA 5HKKD 1QJ7B 1CO7E 4Q7YA 3L6PA 5C67A 1L1NA 1D6WA 5DPAA 1J9CH 1Q3XA 2ZU3A 4AB9A 2WPHS 3UOPA 2OBQA 1INCA 5BRRE 5EIYA 2C8WB 2VINA 1P06A 2VGCC 1BRCE 1DVAH 2OQ5A 1SQRA 3PYHA 5FBEA 3D65E 1GI9B 3RXEA 1BOQA 5E2PA 4FXGH 3BTFE 4CREA 3R0FA 1Q2WA 1SGYE 1A5HA 1VITH 1YP9A 4XD7D 1EZUC 4AG2A 4DW2U 1XVMA 1PPEE 1O33A 1PQ7A 1AD8H 4TT3D 1KMHB 2XW9A 1MKXH 3TJUA 1ZJDA 4UEHH 4FUHA 1AI8H 4CHAC 4K60A 1UK4A 4YLQH 3LJOA 3QX5H 2KCYA 1DY9A 1TRNA 4Z6AH 1IQGA 1Z1JA 4ZKSU 1AWFH 1MZAA 3GYLB 1T4UH 1Y3YA 2RA3A 3MFJA 4ESTE 1E36B 3SJ8A 1IQHA 1GBKA 3LGYA 2BVSH 1UCYH 1GBAA 1SGTA 1AE5A 1AY6H 2D26C 1FJSA 5L2YH 2A31A 2SGAA 1BMNH 4Q7ZA 2V3MA 2JH5D 1C2DA 4K8YA 2Q1JA 2SNWA 1HAXB 1VGCB 1OHHD 1G30B 1ARCA 1AVXA 3MU5A 2OD3B 1O2QA 1A0HB 1O3FA 3HGPA 1JWTA 1TIOA 1IQEA 1D3QB 2EA3A 1UVPA 1NO9H 3LDXH 3CS0A 3GY3A 2P93A 2IPHA 2F43B 4KGAA 4IMQA 2B9LA 1GBCA 3SNCA 1BTHH 4K1EA 4MNXA 1O3PB 4HTCH 4A6LA 3IG6B 3ATIA 1QBVH 1RGQA 3LH3A 3MYWA 3SJIA 4KKDA 6ESTA 5C20A 4UE7H 1JIMA 2IOTA 4YOGA 1ANDA 1O3BA 5FAHA 1AKSB 4X6OA 1SGCA 2JKHA 2W6JD 2Z9LA 3BTDE 2NU0E 4WF8A 2AS9A 3SU2A 3SU6A 2QY0B 4MPVA 1DITH 1V3XA 3ATKA 4NIVA 3NPSA 1P01A 1FPCH 5FX6A 1ELEE 4I8GA 4LK4A 3TIUA 2NU4E 1SLUB 4D7GA 1C1TA 3FZZA 3SV6A 4X1PU 4NA8A 4IN1A 1BMLA 1SHYA 1KXBA 1B0FA 1NRNH 3RXLA 1UHBB 4RN6A 4BNRA 1C2MA 1O3MA 3V0XA 1CVWH 1A3EH 1ELVA 2F83A 2ZF0H 3ESTA 3M35A 1HIAA 1ZLRA 4B2AA 5GXPA 1P2OA 4NIYA 3ZZ5A 4AGKA 3M7QA 1TE0A 4ZKNU 2GMTC 1BA8B 1J14A 1NRQH 4ZUHA 3GCTG 2GZ8A 1G3CA 1A46H 1C1WH 1NM6A 2GKVE 5JB8S 1IQNA 2CV3A 4GHQA 1H9HE 1GJ5H 1GJ9B 5A8XA 2FM2A 1PPBH 3ZVGA 2VGCB 1EPTC 3EQ0H 2ZQ2A 3ZVDA 2PKAA 1Z7KA 1O2TA 1EKBB 2JH6D 3E1XB 2H9HA 1GI0A 4GVUA 5DK1A 1T8NA 2G52A 3KQBA 2ZO3H 1HJ8A 1GJDB 2CMYA 1A4WH 1L4DA 5DP8A 3KHVA 1YF4A 3TK9A 1O0DH 3PV2A 3WW7A 3RXUA 1SOZA 1OOKB 5C1YA 1P12E 3WWFA 3TJVA 1LQDB 1TX7A 1ZTLA 3PTNA 3G01A 3JZ2B 1A5IA 2HWLB 1F5KU 4CHAB 1D6RA 1VCPA 2GDDA 1NC6A 4FUGA 1TLDA 2BDBA 3OY5U 1AIXH 4U32A 4X2XA 1BMAA 1L4ZA 4K3JA 2D2DA 4MG3A 3AAUA 5A8ZA 1S83A 2W7SA 4GSOA 2ZDVH 1HAGE 3UR6A 1ZRKA 1BZXE 1FQ3A 2IN2A 2TGTA 2WYGA 2SGEE 4ABIA 2EI8A 6CHAC 4F49A 1LKAA 1DE7H 5CE1A 5ABWA 1PPFE 2QF5A 4R0IA 2DUCA 2PR3A 4LXBH 1S85A 1CA8B 1CT0E 1TPOA 2SFAA 1SLWB 1EAXA 4VGCC 3ZZ7A 1C5SA 4IC6A 1O34A 3RXFA 3SO3A 1DS2E 4TY6A 1DLKB 3KIDU 2Z9JA 3D23A 3OAAD 1L1GA 4ZMAH 4AFUA 2ALVA 3Q76A 2GZ7A 4TSFD 1QA0A 4NIWA 4MTBA 1H9IE 5CHAC 3TH2H 4AC9A 1JIRA 4M9FA 1Z71A 1GJ7B 2ZCKP 1RJXB 3SU1A 5C3NA 1DT2A 1H4WA 1ABIH 1O2KA 4X0WU 2NU2E 2CJIA 3A84A 1BRBE 2V3OH 3RMOH 2R0KA 3NZIA 2BLWA 3S69A 5JB9S 1BITA 4UD9H 1ZMLA 3UFAA 1Z8RA 3BSQA 3VB4A 2A5IA 1COWD 3PRDA 2VH0A 1O36A 2ZWLH 1BHXF 1LPZB 2BQWB 1Z1IA 4BAHB 4NZLA 2G8TA 2BDGA 5L30H 2AHME 4I32A 2XWAA 1ESBA 1RTLA 1QRZA 1SHHB 2FS8A 2BVRH 2AYWA 4ZCNA 1TFXA 2Q6GA 4NFEA 2BY7X 3DCLA 2ZA5A 1TBQH 2OBOA 1K2I1 4OGYA 5C1XA 5LPRA 1BRUP 3RXKA 1F0UA 1C2GA 1GL0E 4B74A 5FPTA 4Q7XA 2GMTB 1XUIA 4RT0A 1Y3WA 1O2NA 3QWCH 1DWBH 2VWLA 3BTQE 3ITIA 3QO6A 4ISLA 5AFZH 1OWEA 1TNKA 1GJAB 1CHOF 2ZG0H 1DLEA 4XBBA 2F9VA 1TGSZ 3UPEA 2P8OC 3O8BA 3MI4A 1NFXA 2AIQA 2Y80A 4JZDH 1EPTB 1BMFD 3FOAA 4U30A 4BANB 4XSKU 4PROA 3I78A 3N7OA 2GJGA 2DE8A 5EQQA 2EQNA 7GCHG 2BD5A 1MH0A 2H9EH 2Y5GA 1J17T 1V2RT 3WWBA 1SSXA 4CR9A 2HVYB 7GCHF 1W12U 1O32A 6LPRA 1UTKA 1K28D 4WH6A 5C94A 4H6TA 4BXSA 2BLVA 2OINA 1ELCA 4JYUH 4CR5A 3RU4E 4ASUD 3RXBA 4XBCA 3QGNB 5EJLA 4Y7BA 1GHBF 1QQ4A 1BTZA 3BG4C 3U8OH 4MNWA 3OTPA 1F0SA 4MNVA 1GJ4H 1VCWA 3TK5A 1VITF 2TGDA 2FEQH 2XBYA 2FWWA 4JZIA 6CHAB 1JOUB 2O8TA 1FAKH 1TNIA 1GG6C 2C90B 2BDHA 3B23B 3DUXH 7KMEH 2ODQA 3HKJB 4NIXA 2XOKD 2ZHDA 4KELA 3EA8A 4FVDA 1QHRB 4K8BA 1NU9A 3QGJA 9ESTA 1ZMNA 1T4VH 3SZNA 4Y6DA 4BTIB 4VGCB 1H1BA 2UUYA 4YTAA 1UK3A 1HCGA 3OE7D 2IPQX 1B5GH 3K6YA 1FUJA 4D8NA 1WOFA 5F8TA 5CDFE 4E05H 1Q31A 3VB6A 1GGDC 9LPRA 1KLIH 1K1JA 2XBWA 1P2IA 2IJOB 4AYVB 4X8UH 4Y71A 5CHAB 3T2NA 1C5LH 1T8MA 4QT8C 1C5MD 2VIDA 4KTCA 1O3KA 3STJA 3F1SB 3EYDA 5I25A 1QGFA 4Y7AA 1A0LA 1ETTH 1RTKA 2B7DH 2RDLA 1CSOE 3DD2H 1P10A 1P3CA 2BDIA 1EQ9A 3MMGA 1DICA 2L74A 2B8OH 2R2MB 3P8FA 3T29A 2OP9A 3PLPA 2QCYA 1XUKA 2BD9A 1AKSA 1O5GH 2KAIA 1SGFG 4AOQA 3NWUA 5E8EH 4ZKRU 2F9PA 1MQ6A 1UCYK 2RFKC 1UTNA 1DSTA 3MNSA 3O8DA 3M37A 4TYDA 1FPHH 2A45B 4ISNA 1O2RA 4H6SB 1GJBB 1DANH 1T31A 1UHBA 1GI5A 4YO9A 1JXPA 2H1UA 4AORA 1QJ1B 1N1LA 1WBGB 3QLPH 1O3DA 2OXSA 2FOEA 1LVMA 1ZMJA 2PKAB 1DWEH 3GY4A 1S82A 1W8BH 1C4V2 2P8OB 2J38A 1KXCA 4Z0KA 2EC9H 1GI4A 1O5CB 1WV7H 4OS4A 3LT3A 1S6LA 4D76A 4GHTA 1GI8B 2OC0A 8KME2 3KGPA 1HYLA 4GCHF 1SQOA 1EP5A 3S7HB 4IBLH 3E8LA 4DURA 5DP5A 1V2PT 1XM1A 4WXIA 3LGIA 1ZSLA 2CGAA 6GCHF 1EB2A 2GV7A 3SHAH 4O97A 2VIVA 1P2KA 2Z9KA 1FY3A 1V2ST 1O5EH 1WXRA 1TA2A 2AFQB 2GTBA 5EPYA 1PPCE 2BXUH 2ZZUH 5HIYA 1D4PB 3W95A 4TPYA 3EA9A 1TGTA 1SR5C 1THSH 3MH5A 2C93B 2V6NA 2Q6DA 3ZYDA 2O8WA 5AVDA 4MPXA 1ZTJA 1YPHC 2M5TA 2WUCA 1NBMD 3BG4B 1ZYOA 1YBWA 2XNIA 5A0CA 2ZDNA 5E0GA 4A5TS 1O2OA 1HB0B 1KTTB 5JBBS 2THFB 3TGKE 3V3MA 4K2YA 1UW7A 3SJOA 4Y0YE 1H8DH 1CT2E 3IITA 3SN8A 3RU4T 3SI3H 3H5CB 3WY8A 2PLXA 1GG6B 1V2NT 2ZFSA 1SPJA 1XXFA 1BUIA 3HK6B 3M7UA 1AMHA 4GUXA 5K7RA 3OSYA 2ZPQA 5C0TA 5C5NA 1AHTH 1W0KD 1WTGH 2BQ7B 3Q00A 4INHA 1YM0A 1CGHA 1F2SE 5EU8A 1YPHE 2CXVA 1GBJA 3SNAA 1DM4B 2KM0A 2RCEA 5GWZA 1HXEH 3OEHD 3P8NA 3LC5A 5H4IB 5I46H 1HAHH 2O9QA 2FO9A 2ZKSA 1IQMA 2Y81A 2G51A 2VBCA 4YOJA 1EJNA 2UWPA 3S9BA 3GCNA 4BXWA 1P03A 5DG6A 1MAYA 3SOSA 5HMAA 3UR9A 1E35B 3BF6H 2UWLA 4OS6A 2R9PA 3GY2A 2HNTF 3H7TA 3CENA 1HGTH 1QCPA 1S0RA 2WPLS 2WPJS 1ELAA 1YLDA 2XC5A 4I7YH 1QRXA 1THRH 3GCHC 2AEIH 1RTFB 1T32A 4HZHA 3SV8A 4UONA 3P6ZB 1SBWA 3ZZ6A 1UVUH 1FZZA 2FPZA 3FAOA 1QY6A 4JYVH 3RXDA 4X1RU 2TIOA 2G5VA 4A1VA 3CS7A 3LJJA 1O5DH 4KTUA 2FYRA 1W10U 8LPRA 1FN8A 2J34A 1QJ6B 3ZZ9A 4IGDA 1OP0A 4Y8XA 3SQHE 1B7XB 1E79D 1GBDA 5FCKA 5EXLA 1P9SA 3PWBA 1AUTC 1GMHG 4X8SH 3P92A 1GDUA 1P05A 1SLXB 1GMHF 2ZC9H 1SFQB 2WV5A 1ELTA 4AB8A 1QA7A 3N99A 3PV5A 1HV7A 2BMGB 1D3PB 1ARBA 3KQDA 4BTUB 2ANYA 1AGJA 1NESE 5HM2A 3MU0A 1GWAA 3FP8E 2WSSD 1EPTA 3TITA 2LPRA 1N6YA 3Q3XA 1SQTA 1F0RA 1QL9A 3L33A 4ZROA 1Y3XA 1GBFA 2XC0A 1JRTA 1KLTA 2BLOA 1TABE 2ILNA 4NSVA 2V7QD 3GS9A 5K0HA 1OPHB 3UAIC 2SGPE 4YLUA 4X2WA 1QZ8A 1XVOA 3SJKA 1WQSA 1K9OE 2I6QA 1O3HA 1O35A 2CF9H 4D9QA 3GISB 3E0PB 3SV7A 1GCTC 4WMFA 4JZ1A 1F5RA 1C5UA 4YOIA 2R2WU 5TCAA 4XRNA 5HM9A 1ZSKA 3AK5A 1UTQA 1C1MA 5JDUB 3S0NA 5GNDA 5EJZA 2EI7A 1QQUA 2A7HA 1EJAA 1PPGE 2FS9A 4NWLA 3RXQA 2QGRA 1H8IH 3M3VA 3F2GA 4ZXYH 1LHDH 1QB6A 4JMYA 2VIWA 2HALA 1MKWH 1O2GH 2WPDD 2FDAA 1C2FA 1Y3VA 2V0BA 3PMJA 4FU7A 5AHGH 3NK8A 4AFZA 1T8OA 1Z8IB 2ZNKH 1UK2A 1EJMA 1DXWA 1ANEA 4MDSA 3RXAA 3A88A 3M5NA 3O8CA 4OGXA 1O2WA 3CP7A 1AB9C 1F0TA 2J98B 4ACAA 2P94A 5JPMH 1SGQE 2RA0A 2VWMA 3SNDA 1IQLA 2AMDA 1SGPE 3KQEA 1OYQA 3DHKH 2J4IA 1U6QA 2KAIB 4OS5A 1M9UA 2ANMH 1C1VH 3M7TA 3SGQE 4Y10E 2VB0A 2GGVB 1E34B 3T62A 3M36A 1NFWA 2ZU1A 1BTYA 1MTWA 5JBTA 1GI7B 4B71A 1ZPZA 1SVPA 1PFXC 3GCHB 3GYMA 5DP4A 3MO3A 2PUQH 3UQVA 2Y7XA 1Y3UA 1FY8E 2YNBA 3FO8D 4Q80A 5T6FA 1CQQA 2WV4A 1L2EA 3A7YA 4NGAH 5CMXH 4I8HA 2PSYA 1MD8A 1OWIA 1EB1H 5L2ZH 5DP7A 5LPEA 1HPGA 2VJ1A 4RT1A 4UFEH 2P95A 3C27B 1J16A 3VFEA 3E6PH 3NRLA 7ESTE 1BBRH 1TNJA 1C5PA 1ESAA 5EXNA 2WZQA 4YXWD 2DE9A 3T25A 2FTLE 1Y5BT 1LHGH 1RIWC 3MU8A 1A3BH 1BCUH 1S0QA 2HPQH 2TRMA 2FI3E 3UUZA 1C2LA 1ELBA 3D49H 1BB0B 2OC8A 1TRMA 2D1JA 3FZDA 1GI1A 4K69A 2FX4A 1NROH 2A7JA 5JBCS 1TRYA 1PQAA 3M5LA 4X2YA 4YZUA 2ZCLP 1YCPK 1P0SH 3EAJA 4XFQA 1J15A 5AFYH 3FKSD 2STBE 1XKAC 3RUOA 2BX4A 2Z9IA 4HI3A 1YC0A 3MH7A 1V2VT 3KF2A 1O3CA 2ZFQH 2ZGXH 5IYTA 3RC6A 3ZVBA 2AMPA 1O2PA 1CGJE 1SGDE 1C1PA 3A83A 1Z6EA 1FV9A 1GHVH 1WUNH 4ZAEA 1GCTB 3BV9B 1W0YH 1FX0B 2B0FA 2ULLA 2GZ9A 2GDEH 2R0LA 4CRBA 4GLYA 1ZGIA 4WXVA 8ESTE 1T8LA 4OS2A 2H5CA 2OCVB 2BX3A 1ANCA 4I33A 1EXFA 4X1NU 3RDZA 5GIBA 3P95A 4BAOB 2ANWA 4JZEH 1KTSB 1C5RA 4I86A 2XCNA 4B1TA 2H6MA 1OWDA 2P3TB 3SI4H 3QTOH 1RXPA 1HNEE 5C5OA 5ESBA 1O3JA 4O03A 1UVSH 1W2KH 3P70B 3Q3YA 4D9RA 4YESB 2SNVA 2ZGCA 4Y11E 1O3IA 3FP7E 3UNRA 2PSXA 2P3UB 3K2UA 2ZGHA 1HAVA 1AB9B 1HLTH 1UO6A 1DXPA 3TNTA 1TYNA 3GDUA 4CRCA 1C5TA 1MBMA 2JDID 2BDCA 1UVOA 1MTSA 1GPZA 2BY8X 4B2BA 3PO1C 2VIOA 4XBDA 2ZTXA 4ZHLU 3BG8A 2H2ZA 2W3IA 1P8VC 4ZHAA 3CNRA 3BTME 1THPB 2TBSA 2FX6A 1HFDA 3BIUH 5B6OA 1VR1H 2WPKS 3H09A 3TGJE 1EATA 3RM0H 1TA6A 1Z8GA 1MBQA 1TAWA 1LHFH 4ABJA 1FIWA 3RMLH 1UCYE 3A89A 1XUJA 2WUBA 3ODDA 3IWMA 1L1JA 2KCOA 2O8UA 1AVGH 5GCHF 1K1OA 1BTWA 1CHOG 2VIPA 3ZVAA 3UY9A 4FUJA 1DWDH 3KL6A 3P8GA 1IQFA 1C5QA 1ZRBA 3ZV8A 4AG1A 7LPRA 3I29A 1XUFA 3SV9A 1RIWB 3BTEE 2F9UA 2J92A 5G4BA 3BEFB 4FUFA 3SJ9A 3TGIE 1WQVH 3RXSA 4E7RG 2ZIQH 4UDWH 4Y76A 4O3UA 1ACBE 4KP0A 3OYPA 2A0QB 2ZHQH 2H5DA 2Q6FA 3GY5A 2UUKB 1V6DA 2OC1A 4RKOB 2SGQE 1C5VA 1FI8A 4OS1A 1MQ5A 1RS0A 4P00A 3LGTA 5E0HA 2FOBA 1TGNA 1GL1A 4ABGA 1PPZA
chains in the Genus database with same CATH topology
1GHBG 2J2UA 3SNBA 1VZQH 1C2JA 1NN6A 3A82A 3K9XB 2UUJB 1KLJH 1F5LA 2ZP0H 2OQUA 4XOJA 2BY9X 1JBUH 1VITG 1FDPA 2HRVA 1P2NA 3U9AH 3ZZ4A 2YOLA 4JK6A 4ASHA 4FVBA 4X6MA 5C2ZA 2BQ6B 1MCVA 5EW1H 1A2CH 3RXPA 4ZXXH 1O2MA 3RXGA 3FFGA 3K65B 1PYTD 1NTPA 3URDA 3U1JB 5EQSA 2QF3A 2Z3EA 3A7VA 1O2IA 1MAXA 2BB4A 4IS5A 1V2QT 1W7XH 3OX7U 1NS3A 2QF0A 1S84A 1C5WB 2W5EA 1W13U 4X8VH 1P57B 4Y0ZE 3Q77A 1TOMH 4WJG2 2GT7A 4XE4A 5ETXA 1O30A 2GCHF 2FLBH 3TLOA 1GMDG 4MPUA 2PV9B 1IQJA 2UUFB 4AX9H 2XYAA 1E38B 1GMDF 4K1SA 4MNYA 1F92A 1MKXK 2RG3A 4DT7B 1DOJA 3BTKE 1BT7A 3TJNA 1TPSA 1EOJA 3GDVA 3PO1B 1N6XA 3TH3H 4ABDA 1UTLM 4UFDH 2ZFRH 2VVVA 4NA9H 2AH4X 3VPKA 3MNXA 3F9GA 2ZDKA 3Q3KA 1S6FA 2J9NA 3PLKA 3PTBA 1QB9A 1UTPA 5AF9H 3GOVB 3RXOA 1O2LA 3ZZ3A 1TB6H 1ESTA 1GBLA 2GV6A 1NRSH 2FODA 2HVXA 2BD4A 1W7GH 3SUEA 1P09A 5JYIA 1LO6A 4CH2B 2ESTE 1P3EA 1ZR0A 1KIGH 4DCDA 1MZDA 3OTJE 5EW2H 3O8RA 1SGNE 1C5YB 2XCFA 2ZDMA 3L3TA 4A1XA 1O2XA 3RC5A 1GHAF 1YKTA 1G2LA 5SGAE 3BTHE 1UTJA 4DOQA 1HJ9A 3GY7A 4F4OC 2G4UA 2GX4A 4GCHG 3ZVCA 5HXFA 2HGTH 5LH8A 1WAYB 1O2HA 3A85A 3EDXB 3LPRA 6GCHG 1EAIA 3GDSA 1V2JT 3LC3A 1G32B 1NRPH 5A0AE 3MH4A 4DIIH 2VH6A 1UTMA 2QA9E 1V2MT 5GJ4B 4B73A 4BAKB 2C8YB 4A92A 1A1RA 1YCPM 1N8OC 1GI2A 1OX1A 3ATWA 2P59A 2A32A 3TU7H 1P11E 4XDEA 1TMBH 3QDZB 1YPGH 3ENSB 1XXDA 3DFLA 3RXHA 4ABHA 2A4OA 2GVFA 2H9TH 1O2JA 1JRSA 1ZGVA 1H9LB 1TQ0B 3BTWE 1BTUA 4TPIZ 1AE8H 4X1QU 2VNTA 1OWKA 1G37A 3U98H 1HAYB 3UREA 1IHSH 5EODA 4I8JA 1HAOH 2XBVA 3UWIA 1MUEB 1Z6JH 3LONA 1ANBA 2ODPA 1BQYA 1ZZZA 1GDNA 5GPIB 1ELGA 2Z3DA 1HAVB 3HGNA 1QURH 1G3BA 3LKWA 4O9VA 2FIRH 1MMJN 1XX9A 2PTNA 1D3DB 4K1TA 3ELAH 2VIQA 3PM3A 1FY1A 1GHWH 1YLCA 5EOKA 4E7NA 5DP3A 1LKBA 3E91A 1ELFA 3SBKA 3BTGE 1DFPA 3DFJA 2Y5HA 1ABJH 1KXFA 5T6GA 1FY5A 2GCTC 2ZI2H 2A4GA 3KEEA 1LPKB 1MD7A 5F03A 2FOGA 4MLFB 4ZHMU 3F9EA 1LMWB 1MCTA 1LHEH 1UJ1A 5HYOA 1O3EA 1C1OA 1GBMA 1HJAC 1QBOA 3BEIB 1C1UH 1VCQA 1O5FH 2CHAC 5FX5A 3OY6U 1HRTH 3RXRA 2FZZA 2PGQB 4KTSA 2A1DB 3A8CA 1SGEE 4RSPA 2BOHB 1O3GA 1MU6B 1EOLA 1GBHA 2OC7A 3BIVH 4IMZA 4MVNA 3E0NB 4B2CA 1CT4E 1Y5AT 4FU9A 1BJVA 1V2TT 1K22H 2A4QA 3PV4A 4IC5A 5EGMA 4O3TA 3P17H 2FI5E 1G3DA 4ABEA 1QBNA 4SGAE 2ZGBH 2FESH 1BTXA 1AUJA 2G5NA 1HAPH 1BRAA 3LGUA 1O2VA 3MNBA 4H4FA 2BYAX 4X6PA 1V2KT 1OXGA 1GJ6A 3AASA 2QXIA 1OSSA 2NWNA 1C4Y2 3RC4A 1W0ZU 1GBTA 4Q2KA 1PQ8A 5BPEA 1EASA 1K1MA 1K1IA 1C2EA 2PUXB 1C4U2 2C4FH 2VVCA 2XXLA 1FLEE 1AQ7A 2QIQA 2FMJA 1CGIE 1DY8A 1TX8A 1GHYH 1N8OB 1CHGA 2QN5T 1NY22 1IHTH 3UNQA 3SV2H 1FY4A 1HAIH 2P16A 3RXTA 1O2UA 3ZZ8A 2BD3A 2LNCA 1HXFH 1QB1A 2Y5FA 4DIHH 2AIPA 1P04A 2AGGX 4AGJA 4X2VA 3UIRA 1TGBA 3PROA 4X8TH 1Y8TA 5LPFA 2Z7FE 3F68H 4DGJA 1GJ8B 4HGCA 2W3KA 2OUAA 1K1PA 3MO6A 1G36A 4JCNA 2XTTB 4NFFA 1SGRE 3SU3A 4FUBA 1GBEA 3QK1A 3UOUA 5TJXA 4A1TA 2ASUB 3A7ZA 1JMOH 1C5ZB 2WYJA 1ID5H 4MPWA 1S81A 3QN7A 2PWXA 1XUGA 2QC2A 3UTUH 1P02A 3LU9B 3STIA 2BY5X 1YGCH 2FTMA 5JBAS 4AFSA 2BTCE 4AN7A 1YPMH 3TVJB 2BXTH 2WPMS 1TMTH 4WH8A 2A5AA 1J8AA 1IQKA 2FYQA 1GVKB 1T7CA 1CBWC 4H42U 2K1QA 5TCCA 1O5BB 3ZZDA 2GCTB 3LGWA 1LTOA 4YT6H 1C5OH 1DSUA 1KXEA 5EXMA 2ZFPH 1B0EA 1O31A 1OP2A 1GBBA 3S7KB 1NZQH 1FXYA 1V2OT 1DX5M 1GI6A 4UFFH 1FIZA 1HJAB 1FAXA 2BZAA 3EA7A 2ZTYA 4DG4A 3D62A 1AU8A 4ISHH 1AFQC 5J4QA 2GP9B 1O5AB 2CHAB 2STAE 5LGOA 4I8KA 2ZU5A 4DVAU 4A7IB 1LVBA 2PGBB 1OWJA 5T6DA 4Y8YA 2C8XB 1ORFA 1SGFA 1SL3A 2A7CA 1SG8B 2XRCA 4I31A 3VGCC 3U1IB 3EE0B 4GPGA 3GY8A 2Z94A 1GVLA 3RU4D 4MQAA 2W7UA 2OTVA 2ZECA 2ZDLA 1GDQA 1OKXA 3VB3A 2SGFE 1Y5UT 3MOCA 3V13A 4HFPB 4CBOA 3MO9A 2Z6BD 5EG4A 3SU0A 1YPEH 3T26A 2F9OA 4YM9A 3RMNH 1V2LT 1TNGA 1S6HA 1FMGA 1NPMA 2G81E 4TWYA 3SGBE 1KDQA 5A2MH 3SUGA 1GHZA 1V2UT 4Y79A 3ZYEA 4FUCA 1E37B 2WINI 4ABAA 5FCRA 3GCTF 3LOXA 4WWYA 1O2YA 2BY6X 1C1NA 2TGPZ 2ZEBA 1ZSJA 4E06H 4Y8ZA 3A8DA 1EUFA 1OYTH 5J4SA 1P2JA 3SUFA 1A61H 2FOAA 1WYKA 2BVXH 3F6UH 3TNSA 4D7FA 5F6MA 4ZKOU 1CE5A 3A80A 5GDSH 3MHWU 3MWIU 4J1YA 3SU4A 2CF8H 1AZ8A 1A7SA 2FLRH 5EQRA 2ODYB 1ZHPA 4I8LA 5A09A 1AWHB 1FONA 3UWJH 4M7GA 1QL8A 1EZSC 2G55A 1QL7A 4BAQB 3KNXA 3ZVFA 2VVUA 1NRRH 1ZPBA 3VXFH 1O2ZA 1TALA 1K1NA 1OS8A 2QYIA 3HK3B 1QNJA 3A7XA 3SGAE 1NT1A 3R3GB 1O3AA 2AMQA 1MU8B 2YNAA 3PWCA 1TNHA 2OLGA 4ABBA 4FUDA 1KXDA 5EPNA 3RLYH 3RMMH 1F7ZA 1KY9A 1HDTH 1BTPA 2QXJA 1UMAH 3ZV9A 1CBWB 2FP7B 4THNH 3E16B 2AERH 3VB7A 1LPGB 2I6SA 5A0BA 2CN0H 2JH0D 5DP9A 1YPJH 1FN6A 2XWBI 1OWHA 3MNCA 5IDKA 2BD2A 3RXVA 1E0FD 4ZH8A 1BHXB 1D9IA 3A8AA 2HPPH 4YT7H 2BD8A 1C1QA 2A2QH 4UFGH 1AFEH 4RKJB 1K21H 1AFQB 1CA0C 3EGKH 2ZPSA 3AW0A 2HLCA 3E3TA 3RXJA 2A4RA 3SORA 3W94A 1ETSH 1V2WT 2ANKH 2BDYA 3DA9B 5E0JA 1HAZB 5GCHG 3A87A 4IW4E 3VGCB 3HPTB 2F9BH 2J94A 2ZCHP 4JYTA 1NFYA 4B76A 2Y82A 1O2SA 2VU8E 2HOBA 3ATLA 4LZ4B 3PMHB 3F9HA 2FOFA 2J95A 2O8LA 3LIWA 2R3YA 5FPYA 5E2OA 1O38A 3AVZA 3U69H 2BD7A 3JZ1B 1C1SA 1O3NA 4AYYB 1C2IA 3SUDA 1G9IE 3TJOA 2PFEA 4FUIA 2C3SA 4BAMB 3QZRA 1EZQA 4R8TB 2TPIZ 2FOHA 4ISIH 3SNEA 3SW2B 5A8YA 1P2QA 2ZFTA 2ZU2A 3MH6A 1MTNC 3FVFB 4X1SU 3NXPA 4JZFH 2QV1A 1C2KA 1WTHD 1ZHMA 1P2MA 2XBXA 1C9TA 4CRFA 2VWOA 4WVPE 1SC8U 2BZ6H 1IAUA 3AW1A 2ALPA 1X7AC 2D8WA 4INLA 5FHTA 3A7TA 4CH8B 1P9UA 3GY6A 3C1KA 1AO5A 2XC4A 2GD4B 3QZQA 1C1RA 3H7OA 4NSYA 1YYY1 2UWOA 1BDAA 1DWCH 1MTUA 4BOHA 2PHBA 2PKSC 3E90B 2JETC 3T5FH 1TNLA 2B5TB 3RLWH 3ZZCA 2PTCE 3GICB 1BBRE 1NFUA 1BIOA 1LDTT 2AGIX 2GT8A 1TQ7B 4FUEA 1FNIA 1QTFA 2BLQA 1XKBC 5PTPA 2ZU4A 1AZZA 3BEUA 5DKMA 3A8BA 4TWWA 1G3EA 1TOCB 3URCA 1DUAA 2GCHG 1XUHA 1HBTH 5T3HA 1GMCG 2Y6TA 4J2YB 4LZ1H 1ZOMA 1AN1E 1GMCF 2SGDE 2WPIS 1XMNB 2EEKA 1O3OA 3QUMP 5L6NH 3B9FH 1BJUA 3RXIA 2Y7ZA 1Y59T 1O39A 2C8ZB 1RFNA 2F3CE 1HUTH 2HNTC 1G2MA 3A81A 3T28A 3I77A 5FBIA 2R3UA 2V3HH 1WCZA 3LH1A 1IQIA 3RXCA 1PPHE 3PMBB 1VJAU 1C9PA 1CA0B 5HGGA 3M61U 1EZXC 1C2HA 1SFIA 1SLVB 3PLBA 3VB5A 3ZZBA 2G00A 5DJ7A 3FP6E 1TONA 2ZHEH 1IOEA 1YPLH 1YPKH 3HKIB 1YCPH 1MKWK 1L0ZA 2ZDAH 3ATMA 3S9CA 1TGCA 1HIAB 1GBIA 1RRKA 1AVWA 4U2WA 1GJCB 4DY7B 2HNTE 1LHCH 3MU1A 1GHAG 2Z9GA 3QTVH 1KSNA 2AGEX 2BM2A 1KDQB 4INKA 3RP2A 1EAUA 1TBZH 2ZTZA 4B75A 4ABFA 1D3TB 1SOTA 2F9NA 2QAAA 3BN9A 3KQCA 2TGAA 1GCDA 3UQOA 1W14U 3TK6A 2BHGA 1SI5H 1TWXB 1VJ9U 2ZQ1A 1TPPA 5ESTE 1K1LA 1TMUH 3MTYA 2QXHA 1MTNB 1NU7B 3NUMA 2PW8H 3U8RH 4DJZB 1O37A 4NG9H 4CBNA 1W3CA 2NU1E 2ZHWH 3T27A 3S9AA 1LCYA 4WMDA 1ELDE 1OP8A 1C5XB 1ZTKA 1CU1A 2P3FH 5DGJA 3U8TH 3HATH 1W11U 4NA7A 4CRAA 1GVZA 3TH4H 4WY3A 3VEQB 2A5KA 1BBRK 1UTOA 2PKSB 1EX3A 2JETB 2QXGA 3V12A 2FI4E 3TPIZ 1KYNA 1SMFE 3ODFA 3LGVA 2NU3E 3K6ZA 3NKKA 3FANA 1RD3B 1S5SA 3M5OA 1LVOA 1Z8JB 4AZ2B 1QIXB 1DUEA 5FPSA 3M3TA 3UNSA 1PQ5A 3P8OA 3V7TA 3PMAB 1C5NH 1QFKH 2VWNA 4NWKA 4CRGA 2A2XH 2ZHFH 2ZGJA 2ZPRA 5C1UA 1UVTH 4LOYH 4SGBE 1GHXH 3SQEE 3KN2A 3PB1E 4X6NA 1LQEA 3GCOA 8GCHG 3BTTE 4IN2A 3KCGH 4JK5A 1SB1H 4K5ZA 1VGCC 1SQAA 2EI6A 8GCHF 2FXRA 2F91A 1EP6A 3SU5A 5DO4H 1PYTC 4NCYA 4NZQA 3OU0A 3RM2H 3F9FA 4AFQA 1LVYA 4ISOA 1KXAA 2FOMB 3M5MA 3DT0H 1GGDB 3AAVA 4U01A 4FU8A 1WSSH 1PJPA 3RXMA 2V35A 1TX6A 4OS7A 1EAWA 3NCLA 1QRWA 3VXEH 1A5GH 2FOCA 2G4TA 4CRDA 1DPOA 4BTTB 3B8JA 3ZVEA 3A7WA 2ZFFH 1TPAE 3SHCH 5F8XA 3MU4A 1GI3A 2W26A 1WU1A 2Z3CA 1DDJA 3M3SA 1ZPCA 5DP6A 2BDAA 1SGIB 1MTVA 1A0JA 1BMMH 3ZZAA 1TBRH 5F8ZA 4GAWA 3A86A 5FXLA 1ZJKA 4TY7A 1QR3E 1ETRH 1ZHRA 2BOKA 1O3LA 2O8MA 4WMEA 1QJ7B 1CO7E 4Q7YA 3L6PA 5C67A 1L1NA 1D6WA 5DPAA 1J9CH 1Q3XA 2ZU3A 4AB9A 2WPHS 3UOPA 2OBQA 1INCA 5BRRE 2C8WB 2VINA 1P06A 2VGCC 1BRCE 1DVAH 2OQ5A 3PYHA 5FBEA 3D65E 1GI9B 3RXEA 1BOQA 5E2PA 4FXGH 3BTFE 4CREA 3R0FA 1Q2WA 1SGYE 1A5HA 1VITH 1YP9A 1EZUC 4AG2A 4DW2U 1XVMA 1PPEE 1O33A 1PQ7A 1AD8H 2XW9A 1MKXH 3TJUA 1ZJDA 4UEHH 4FUHA 1AI8H 4CHAC 4K60A 1UK4A 4YLQH 3LJOA 3QX5H 1DY9A 1TRNA 4Z6AH 1IQGA 1Z1JA 4ZKSU 1AWFH 1MZAA 3GYLB 1T4UH 1Y3YA 2RA3A 3MFJA 4ESTE 1E36B 3SJ8A 1IQHA 1GBKA 3LGYA 2BVSH 1UCYH 1GBAA 1SGTA 1AE5A 1AY6H 2D26C 1FJSA 5L2YH 2A31A 2SGAA 1BMNH 4Q7ZA 4K8YA 2JH5D 1C2DA 2Q1JA 2SNWA 1HAXB 1VGCB 1G30B 1ARCA 1AVXA 3MU5A 2OD3B 1O2QA 1A0HB <