1BTZA

Episelection: novel ki ~nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords BETA-TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btzA02
1IQFA 3QUMP 3QO6A 5L6NH 3MU4A 5DGJA 1Z8RA 5A0BA 3Q00A 2ZEBA 3RMOH 4Q7YA 3SI3H 4RN6A 3SU6A 1UVPA 3BG8A 2GT7A 2SGPE 1TGCA 3L6PA 4TPIZ 4Y71A 1H8IH 2BDAA 1QB1A 1G30B 2IPHA 4WMFA 2H6MA 4B74A 4NGAH 1XUHA 1P2QA 3RC5A 5LPEA 2PUXB 1EB1H 3MH6A 2AMDA 1PQ8A 1LCYA 1PYTD 1V6DA 4AG2A 3WY8A 2P94A 4U32A 1SC8U 1AFEH 2R9PA 2QAAA 2PSXA 3BTME 4CRFA 4CH8B 2UWPA 4YT7H 1SPJA 1NN6A 5JB8S 5J4QA 1HJ8A 3SU0A 4ABGA 3LDXH 5ESBA 1DICA 1CGIE 1GHWH 3MNSA 3ZVGA 2VGCC 1ELVA 1OWEA 1BTYA 3HGPA 1A46H 1HB0B 1E0FD 1GBMA 2FM2A 1A7SA 3RLYH 3MU8A 5EQSA 1MKWH 5IDKA 1PJPA 2GKVE 5HXFA 1LQDB 5DP9A 3MHWU 1XUJA 2R3UA 2B0FA 4ESTE 1ESBA 2FOAA 1O3PB 9ESTA 4H4FA 1VJ9U 3BF6H 1EZQA 1Q3XA 2O8LA 2BXUH 4K69A 2BDYA 1RTKA 3T26A 1V2KT 4INLA 3FP7E 1ELFA 2FOBA 4QT8C 2OC1A 5JBBS 2GDDA 4K3JA 1INCA 1F0UA 1BZXE 2Y82A 2QF3A 1LO6A 4K1SA 3PLBA 1GG6C 1RJXB 1C2HA 1C5XB 1A4WH 4I8LA 4B2BA 4IC5A 1C2EA 3A8BA 3RLWH 1F0TA 1OKXA 3B9FH 4K8YA 4D9RA 1BMLA 3LGIA 3SV2H 3NUMA 4GSOA 3EDXB 2FTMA 3O8RA 1BITA 4UFEH 1GBHA 1W2KH 1OPHB 3PO1C 2FI4E 1HYLA 1JRSA 5C1XA 2LNCA 3NWUA 1GL1A 2ZU3A 2ZFQH 5FX6A 3M5MA 1FY5A 1EZXC 1SBWA 1C1PA 1MH0A 1PPGE 3A81A 1HIAA 1JBUH 5DO4H 1BMMH 1O2UA 2OINA 3TJUA 2B8OH 1MZDA 1KXAA 2ANWA 2G8TA 3BTTE 1IQKA 1EKBB 2VIOA 2WPIS 3DFJA 3HPTB 1B5GH 3LPRA 2D26C 4XBBA 5T6DA 5E2OA 3P92A 1Z71A 3TVJB 1AWFH 1YPHC 4WF8A 1ZMJA 1D3PB 2STAE 4X8TH 4WVPE 5GXPA 1JRTA 1UTOA 3MMGA 2A1DB 4GVUA 3VEQB 2ZTXA 5DP7A 3T28A 2WPJS 4NIXA 4DG4A 1GCDA 1SGPE 4ABBA 1C9TA 1L1JA 4CR5A 1O2VA 3RXKA 1JIRA 3A7ZA 3SJOA 2BDCA 1AKSB 2J9NA 5LPRA 3LGVA 1WAYB 1TQ0B 4WH8A 1IHTH 4XDEA 2PKSB 1TWXB 3H7TA 1EB2A 3U1IB 4MVNA 2G4TA 2ZKSA 5I46H 5L2YH 4KTCA 1NESE 1MBMA 3VXFH 5F8TA 1RIWB 1P05A 1GI8B 1C5QA 3RXEA 5FCRA 1A2CH 3A7WA 1QB6A 3BIVH 1LHEH 4OS6A 2A4RA 3E8LA 5L2ZH 5A09A 6GCHG 3OYPA 1CE5A 4D7FA 2H2ZA 5T6FA 2BD9A 2NWNA 4AORA 1O2PA 3JZ2B 1T31A 3EQ0H 4ZHMU 3QZRA 2BVXH 4NA7A 2ZHWH 1F0SA 1LHCH 5DKMA 3RU4T 2Z9JA 4BTUB 1DSUA 1HAVB 2A5KA 2XBYA 2A7JA 5EODA 3NPSA 2OC7A 1ZMLA 2VIQA 3M7UA 1G36A 4Y11E 1DY8A 2XYAA 1ZZZA 2PW8H 2BOKA 3ZVFA 3SJIA 2VVUA 4YOGA 4DJZB 3SZNA 4FUGA 3RMLH 3ZZBA 1EX3A 4X1RU 2QCYA 1HRTH 5LPFA 1AZZA 1TAWA 1TX6A 1LKAA 1NM6A 3UNRA 2XTTB 2QY0B 1H4WA 1SQAA 3QN7A 2SGQE 3HGNA 4ABEA 2FESH 1JWTA 2ZHDA 1GPZA 4ABAA 1EQ9A 3TJVA 4MTBA 2CGAA 4I8KA 1NFUA 5FCKA 3EA7A 1CA8B 1HFDA 2BDBA 3F9FA 4ISNA 5EG4A 1QQUA 3LC5A 1N6XA 1THSH 2B9LA 2GCHF 1SHHB 1WTHD 2THFB 1H8DH 3FANA 4FUFA 3T25A 1GWAA 4K8BA 1Z8JB 1O2XA 2ZU1A 5EQRA 1P3CA 1LTOA 1Y8TA 3Q3XA 2P95A 3PYHA 2R0KA 5HM2A 4IBLH 4MPVA 3LJOA 2PSYA 3VPKA 4ABDA 1P2OA 4AYVB 3S0NA 1H9LB 3RXUA 1Q31A 4Y6DA 3E1XB 1GHZA 1A0HB 4NSVA 2FO9A 1P11E 2VH0A 1O2ZA 4CRGA 1TYNA 1TQ7B 2A4GA 3A7YA 1K1OA 3GY7A 3ZVAA 1DM4B 1C2DA 2K1QA 1MCVA 3PLKA 3KN2A 5C67A 3EE0B 4UFGH 3SORA 5SGAE 2VVVA 2C90B 3KIDU 2BD2A 5EPYA 1DUEA 3JZ1B 4ISHH 2Z3CA 1BOQA 3RMNH 5JBTA 2G55A 1TPOA 1Y3WA 1YP9A 2EEKA 1HXEH 3BEUA 1GJ8B 1BDAA 1BIOA 1C2LA 4X2YA 1QY6A 1V2NT 3RXVA 1HAYB 1HAIH 2PFEA 2Y7ZA 1O3FA 3DFLA 1GVLA 1KIGH 3ATLA 4YLQH 1GL0E 1PPCE 2PGBB 8GCHF 1EUFA 1GDUA 4Q7ZA 1QGFA 1KSNA 1L1NA 2O8TA 3RXBA 2I6SA 4X1NU 2WINI 3QX5H 4ZKSU 2R3YA 1A61H 1LPGB 1BTHH 1K1IA 3M7TA 1ARCA 1LVMA 4RSPA 2WPLS 5FXLA 1CT4E 5TCCA 1TMUH 4CRBA 1Y3XA 1K9OE 1VITH 1SHYA 1CHOG 3VFEA 1G3BA 1QL9A 1UHBB 3CENA 3TH4H 1KLIH 1IQGA 3PV4A 5T3HA 4B2AA 1P2NA 1AI8H 3EYDA 1AN1E 2BB4A 9LPRA 5HM9A 3A8DA 2ZG0H 4KGAA 2QGRA 3ZV9A 3MNCA 1FLEE 5I25A 5DJ7A 1W12U 1S6HA 2J94A 2VINA 3V0XA 2FX4A 1GHVH 3FP8E 1HCGA 5A0CA 1BRUP 2A45B 5LGOA 2OQ5A 3PMBB 4YTAA 1D4PB 1HIAB 1BBRK 2KAIA 4O9VA 1P3EA 1L0ZA 1GI2A 1LHGH 1T4VH 4JYUH 1V2JT 2H5DA 3BTKE 8ESTE 5F6MA 1K28D 1EAIA 2PKAA 1YPJH 1AY6H 4U2WA 3SV8A 1TGSZ 2FI3E 2TRMA 2P3TB 2RA3A 3NCLA 1MTVA 5FHTA 4BTIB 3ZYEA 3BSQA 1A5IA 4HTCH 1GBJA 1V2VT 1UCYK 3MH5A 1AHTH 3FAOA 2SGAA 1MMJN 1QCPA 3U98H 4NWKA 1GMHF 1EAXA 5EXNA 1S82A 1O2YA 1WV7H 1ZGIA 2C8ZB 2UUJB 4UONA 1KTSB 3MNXA 4K1TA 1Z1IA 4YLUA 5CHAC 1C1UH 1QQ4A 2AIQA 3GOVB 2WV4A 3BTGE 2DUCA 3FZDA 1AUJA 4NZLA 3UUZA 1T4UH 1TB6H 3RP2A 4RKJB 3MYWA 3A7TA 2V35A 2GT8A 2F9PA 2FXRA 1ZPZA 2ZPRA 1TMBH 1KLTA 4K1EA 1ZR0A 4A1TA 1UTJA 1G9IE 3A7XA 5AFYH 1L4ZA 3PMJA 1UK2A 2VWOA 4NSYA 1O34A 1C5WB 2QN5T 5GIBA 1SLVB 1SOTA 1P02A 1N6YA 2AGGX 1GJBB 1ZTKA 2QF0A 1AB9C 1C2GA 2FOFA 4YO9A 4MPUA 3K9XB 1TOMH 2DE9A 1Y5AT 2B7DH 2HRVA 3KQCA 1QJ7B 3LGUA 4X2WA 2P93A 4CRCA 1WSSH 3TNSA 1ESTA 3SO3A 1ZGVA 3BTWE 3BTHE 1QURH 2H5CA 5CE1A 1O2GH 3NKKA 4ABIA 1O3MA 1THPB 1ZOMA 2J4IA 4I33A 3QZQA 2ZU5A 3IITA 2BLQA 4CRDA 3I78A 3MI4A 1C1NA 1BBRH 1OYQA 7KMEH 1SVPA 1OYTH 2P59A 1OP8A 1AE5A 2Z3DA 1SQTA 1XXFA 1K1PA 1XX9A 4X8VH 3GDSA 5E8EH 5C2ZA 1EPTC 1Y5BT 2FMJA 2ANMH 4HGCA 3RC4A 3UWIA 2LPRA 1KXFA 1Y5UT 2IN2A 4KP0A 1MCTA 4NIVA 4X6PA 2GCTB 1XUGA 3ZVDA 5CHAB 2A2QH 3V13A 1QBOA 2ZECA 3RM0H 2HNTC 3HK6B 3UREA 3UTUH 2HOBA 1QBVH 3D62A 4AX9H 1CHOF 1TNJA 3A7VA 2C8WB 4X2VA 3STJA 4X1QU 1BHXF 1TGNA 3TK6A 1NFWA 1TNHA 2C93B 4BNRA 4B76A 2TGTA 4U30A 2ULLA 3LGWA 2A5IA 1BHXB 3ZVCA 1NU9A 2ZTZA 3KL6A 4JK6A 4ABJA 2Z9GA 4XOJA 3SU2A 4ISIH 1AVXA 4YM9A 4A1VA 3SU5A 3M3SA 3A84A 2UUFB 1GDNA 4WMEA 3UR6A 3DHKH 2ZO3H 2ZQ1A 3PMAB 1QRWA 1FXYA 1SGIB 2VB0A 4MNWA 1A5HA 4BAHB 4X1PU 2VIDA 1CBWC 1ELTA 3PM3A 2HWLB 1RGQA 1WQSA 2ZDAH 1GBTA 3UPEA 4YOIA 4X2XA 1FDPA 5JYIA 3A89A 1E35B 1GBAA 3TGKE 2SNWA 1C2JA 1KXBA 1UTKA 2Z9KA 1YLCA 3SNAA 3LGTA 3UNQA 1TNLA 5L30H 1KY9A 6ESTA 2ZF0H 3LH3A 3VB3A 4GHQA 1BQYA 1TALA 1BTWA 1QA7A 1GHYH 5EW2H 2A7HA 3URCA 1X7AC 2A2XH 1MBQA 1HV7A 2F91A 5CMXH 3STIA 1P2MA 1FNIA 1PYTC 2PLXA 1O3HA 5C20A 1MAXA 3TGIE 1WUNH 4MG3A 3ZZCA 2H9EH 2TGDA 1C4V2 5FX5A 5FPSA 2VGCB 1DX5M 4FUBA 4DIIH 2Y80A 5HGGA 1TBRH 3V12A 4WXVA 3TGJE 3KQDA 1A0LA 2A31A 2FX6A 3P17H 3AW0A 4FUIA 3MH7A 3BTQE 1K2I1 1YBWA 2BY9X 2Q1JA 3H7OA 4O3TA 4XFQA 2ALVA 4NA9H 1FONA 3LOXA 1ZHRA 2F9UA 1ZJKA 1TRNA 4ZHLU 4Y0YE 3R3GB 2O8WA 1LHDH 4JZFH 4AFQA 3M36A 5E0HA 4MNXA 2STBE 4YOJA 3UQVA 3KQEA 2FS8A 4X6OA 1EXFA 3TK9A 2QXHA 1V2QT 4OS1A 3RXTA 4MPXA 1PPZA 3RC6A 4LZ4B 1KYNA 2GP9B 2PKAB 1SGEE 3SNEA 3E0NB 1G32B 1O36A 2ZDVH 1GHAG 1UJ1A 4I31A 1W0ZU 1ANCA 1NFXA 2QIQA 1LHFH 4ZKNU 1EAUA 2Z7FE 3RXCA 1V2LT 2NU1E 1VCPA 2ILNA 3GY5A 1AQ7A 1GCTC 2FODA 5J4SA 3SV9A 1WCZA 4ISLA 2F83A 2Z6BD 6LPRA 1YYY1 3ZZ7A 4BAKB 3GY8A 2ZHFH 4HFPB 4Z0KA 1LPZB 1CQQA 3RXAA 4A7IB 2F9OA 1FIZA 2SGDE 1O2NA 2ZCKP 1HUTH 3I29A 2ZZUH 5AFZH 1Q2WA 2BD7A 1O2WA 3DT0H 1DXPA 1NRNH 5H4IB 2C3SA 1CA0C 1CU1A 2FEQH 2HLCA 2WUBA 3NK8A 1FUJA 1V2MT 2ODPA 3SHCH 5DG6A 4CBOA 4YT6H 3GYLB 3SUGA 4Y7AA 1NRSH 1C1TA 5DP5A 1C5UA 4WJG2 1P8VC 2GZ8A 2ZHQH 1GBIA 1UVTH 2BQ7B 1K21H 1OWJA 2AERH 4FUJA 3K2UA 4B75A 5A8XA 1AGJA 3N7OA 4D7GA 1XUFA 2OUAA 2ZCHP 1SGQE 1DANH 5AVDA 2PHBA 2PWXA 1J15A 1SLWB 2UWOA 4I7YH 1GDQA 1RIWC 1C5VA 3F9HA 4LXBH 1GHAF 3SQEE 1LVYA 1CGHA 1NY22 1NRPH 4AGKA 3ZZ4A 1P0SH 4NIWA 1SGFA 4E06H 3A82A 3VB5A 1FAXA 1O3CA 4AFUA 2GZ7A 1SB1H 1C2IA 1K22H 1KXDA 1MTNC 3MU5A 1JMOH 1W11U 3MNBA 1CGJE 3GY4A 2GTBA 1K1JA 1C5TA 3UNSA 4CHAB 2Z9LA 1YM0A 3U8RH 2WPHS 2BD5A 1GHBF 2A7CA 1A5GH 1NO9H 2ZFPH 2J38A 4IC6A 3HKJB 1YF4A 2P8OB 5FBIA 3GDUA 2BD3A 1GHBG 4IMQA 1C5NH 4BAQB 3QGJA 2EA3A 2R2MB 1C5PA 1D6RA 1O3EA 1T8LA 4ABFA 4ZXYH 4H6SB 2UWLA 1ETRH 1O2LA 5K7RA 1PPFE 2HNTF 2ZFSA 3EAJA 1MKXK 1DY9A 3GISB 3MO9A 1N1LA 3L33A 4Y8XA 3ENSB 1L4DA 1QL8A 1F92A 2TGAA 4ABHA 1TBQH 1TMTH 4Y76A 3BG4B 3SUFA 1N8OC 2JKHA 4UFDH 1E38B 1FI8A 3O8DA 4KELA 3K65B 3VXEH 2WPMS 3U8OH 1YPKH 3A88A 1GJAB 3GDVA 3TITA 4FUHA 4INKA 5AHGH 3LT3A 2BHGA 1HJ9A 2FOEA 3SI4H 3VGCC 1P12E 1TGBA 5A2MH 2A5AA 1O5EH 7LPRA 1HNEE 4ZHAA 1LPKB 1SMFE 1FN8A 2G52A 1S0QA 1E37B 1GVKB 1C1OA 4KTUA 4OS4A 3SQHE 4WWYA 3ITIA 1J9CH 1T32A 1IQIA 1YPEH 3ODFA 5C3NA 1L2EA 2XBWA 2O8UA 1SFQB 3T2NA 1S83A 1G2LA 1BB0B 1GCTB 1BUIA 1BTUA 2ZGXH 1GJDB 1GMDG 1EZUC 3PWBA 5HMAA 2NU0E 2PTCE 1SOZA 2FLRH 3E3TA 4R0IA 3IG6B 1TA6A 3KQBA 1BTXA 1Z7KA 3RXRA 4BOHA 5JDUB 2SFAA 3I77A 2P3FH 3ZVEA 1DWCH 1GI4A 1HAPH 3ZZ9A 2PGQB 3ZVBA 3KGPA 3P8GA 1CA0B 2XBVA 1O2RA 3NZIA 3GCNA 3VB4A 2FP7B 3RXLA 2VIPA 1XXDA 4TWWA 1MTWA 1WU1A 1GJ9B 1AFQC 1IQEA 3B8JA 2OD3B 5EW1H 1O30A 3T62A 4K2YA 4HZHA 5G4BA 4WMDA 1KLJH 2AMQA 1GHXH 1O32A 1SGFG 1C5OH 3SN8A 2ODYB 2CMYA 1HAHH 2FWWA 2H9TH 4JZEH 2FTLE 3HATH 4DT7B 1YCPM 4WY3A 1HPGA 3OX7U 2OXSA 1AE8H 4UDWH 2HNTE 1DFPA 2WYJA 1UVUH 4ASHA 1EOJA 2ZGHA 3GY3A 4ZH8A 1YCPK 1XUKA 2XBXA 2XCFA 4CBNA 3U8TH 3SUDA 2GZ9A 2ZFRH 1DPOA 1F5LA 1UVSH 4TYDA 3K6YA 4Y7BA 8KME2 3Q3YA 1AMHA 2ZA5A 3LU9B 1ETSH 1NRRH 1PQ5A 4LK4A 1SLXB 1ZSLA 1A3BH 5JBCS 4MQAA 1HBTH 5GWZA 3T29A 4BAMB 1BBRE 1MTNB 6CHAC 1QL7A 3PMHB 1ELAA 1NZQH 1QA0A 1UK3A 4OS5A 3TH2H 4IN2A 3A85A 2AH4X 3UOUA 3K6ZA 8LPRA 1NC6A 2ZPQA 1AUTC 4SGBE 4VGCC 1FIWA 1YPHE 2CHAC 3MTYA 3RXMA 2BX3A 1O3LA 2ZTYA 1SLUB 3ATKA 3T27A 2Y5FA 2P8OC 4ZKRU 2ZNKH 1CHGA 4AFSA 4BANB 3OSYA 5DK1A 2BD4A 4JYTA 3AW1A 1GMCF 2W3KA 3P95A 3BTFE 2H9HA 5EOKA 1YKTA 1AO5A 1BCUH 1O39A 1JOUB 2VH6A 3NXPA 4ZUHA 1C5YB 2WPKS 8GCHG 2P16A 1PPBH 1MKXH 1MD8A 4XBCA 4CH2B 1T8MA 1ZJDA 4M7GA 1ID5H 4OGXA 1OOKB 1KDQA 1ZLRA 3RM2H 5DPAA 1BRAA 2YNBA 1YLDA 4BXSA 1DITH 3MU0A 1OWHA 4DY7B 1GMHG 3M5OA 2OQUA 4A92A 2Y5HA 3TLOA 1C1QA 3SGBE 5C1YA 4AG1A 3U69H 5B6OA 1AKSA 3MU1A 1GG6B 2BTCE 1ANDA 4A1XA 2HALA 1F7ZA 3T5FH 1HAGE 3UIRA 2BY8X 3PWCA 1C2KA 2BXTH 2CN0H 4E05H 1ZMNA 1MTSA 3SU3A 2ZCLP 4TPYA 3A83A 4AB8A 2ASUB 1EASA 1A3EH 1IQMA 4J2YB 4YESB 1TX8A 5JPMH 1VCQA 1XM1A 2QV1A 1DOJA 2BVSH 1F2SE 5FAHA 3OTJE 2FZZA 1DXWA 2GCHG 3ZYDA 1CO7E 3R0FA 1TBZH 1V2UT 1TABE 2OP9A 3D49H 5ETXA 1C5ZB 3FP6E 3M35A 4Y8ZA 4MDSA 3URDA 4VGCB 5JBAS 1ELDE 2ODQA 4JCNA 2SGFE 1O2OA 2AEIH 1HAZB 1GJ7B 1XKAC 4F49A 5EXLA 4Q7XA 4KTSA 3SU4A 2CJIA 4CREA 1DLKB 1CT2E 1C4Y2 2G00A 4AYYB 5DP3A 1O2IA 2UUKB 2DE8A 1MD7A 4F4OC 4O97A 3BN9A 1S0RA 4I32A 5BRRE 5ESTE 4IW4E 3ZV8A 1SI5H 1W13U 1SFIA 2FOHA 5DP6A 1WOFA 2A4OA 1ARBA 2C4FH 3ZZ6A 4UFFH 2XW9A 2G51A 1O0DH 5DP4A 4AZ2B 2BVRH 1MUEB 4I8GA 4BTTB 1P9UA 2NU4E 2PKSC 2PTNA 2Z9IA 1GJ5H 4X6NA 1O5GH 2Y5GA 5F8ZA 1T7CA 2ZIQH 1O3AA 1VCWA 3QK1A 1W8BH 3SV7A 1C5LH 1BRCE 2XWBI 1C5MD 2SGEE 5TJXA 3QLPH 2W7UA 4FVDA 3SJ8A 1T8OA 1MU8B 2FOMB 4D9QA 1O35A 2ESTE 3IWMA 3MFJA 2FYRA 5IYTA 1ZHPA 4NG9H 2H1UA 3S9CA 1P03A 1HGTH 1RRKA 1GBBA 4IN1A 2A4QA 6CHAB 2RCEA 1DS2E 7ESTE 2Y6TA 3E91A 1GBDA 1GI0A 3SNDA 2R2WU 3PLPA 3M37A 1WYKA 1GBCA 2Q6GA 3M3TA 1WTGH 2CHAB 2ZI2H 3M61U 1O5BB 4FUDA 1O3JA 3RUOA 3RXIA 4AN7A 1O2QA 2ANYA 4WH6A 1DSTA 5FBEA 3SBKA 1O5DH 2NU3E 3A8CA 3SOSA 1Y59T 3LGYA 5HYOA 3A87A 2FDAA 1IOEA 4PROA 1XMNB 1D9IA 1UCYH 2XXLA 2ZDLA 1BRBE 4TY6A 3TIUA 4MNVA 2VVCA 1FZZA 3A86A 2OBQA 4KKDA 4MNYA 4YZUA 3DUXH 3E6PH 3DA9B 4LOYH 1G3EA 1BMAA 3SHAH 1VZQH 4DIHH 5GPIB 1GI1A 2ZPSA 3UY9A 3RXHA 3RXPA 1FY1A 1LVOA 2BY6X 2O8MA 4ZKOU 3GICB 5EXMA 3Q3KA 1B0FA 5T6GA 1GBFA 1O3KA 3RXQA 2FIRH 1DWBH 3RU4D 1Y3YA 1O3BA 2YNAA 3QWCH 1ZRKA 2FOGA 4FXGH 2ZQ2A 4FUCA 3LKWA 4ZROA 1KXEA 1DVAH 3GCHB 3GYMA 2AIPA 5EPNA 5GCHF 1TONA 6GCHF 5JB9S 5E0GA 1FPCH 3UWJH 1TLDA 1QTFA 2G81E 1P2JA 3M7QA 3Q76A 1NROH 3A80A 3GCTF 4R8TB 2Z3EA 3MO6A 1UK4A 1XVMA 4UE7H 2QA9E 1ABIH 1V2OT 1C5RA 1Z6JH 2VWMA 2PR3A 1UVOA 1EP6A 2BD8A 2ZWLH 1ZPCA 3OY5U 1QRZA 2HPQH 1DLEA 5E0JA 3GY2A 3TPIZ 4B1TA 3TK5A 1GJCB 1DDJA 3G01A 1GBEA 4X6MA 1W10U 1KDQB 1YCPH 1IQJA 1P10A 4GLYA 5GDSH 2VIWA 3ELAH 1PQAA 2NU2E 4H6TA 4MPWA 1BA8B 1HXFH 1TPSA 3C1KA 2HGTH 1O2HA 3EA8A 1T8NA 1IQNA 1TPAE 1DWEH 4Y0ZE 1SQOA 5C1UA 2FYQA 1ETTH 1RTLA 1P9SA 2J95A 4Z6AH 4D76A 1UTNA 2ZU2A 1SL3A 1FY8E 3L3TA 2EI8A 4IS5A 1GBKA 1KXCA 1D3TB 2CF9H 1DE7H 1SG8B 5C5NA 4NWLA 1BT7A 1YC0A 2XNIA 1J17T 2BQWB 1TNKA 4OS2A 2J2UA 3E16B 4X0WU 4WXIA 1G3CA 1SGDE 3QGNB 3SW2B 3RXGA 1L1GA 1AB9B 1P06A 3P70B 1ZSKA 1Z8GA 4AFZA 4H42U 1AD8H 4DURA 1O31A 3GCHC 4JZIA 3GCOA 2KAIB 1SGYE 1ZHMA 3GY6A 4B2CA 4ISOA 3F68H 1C9PA 2JH6D 2BDHA 2BX4A 3KNXA 4IGDA 3HK3B 3PTNA 1O3DA 1OP0A 3KEEA 1MKWK 1D3QB 1HLTH 2OCVB 3TU7H 4GUXA 2XWAA 1QJ1B 2J92A 3SJKA 2XRCA 2V0BA 4O3UA 3F9GA 3O8BA 2Y81A 2AGIX 5EU8A 1OWKA 1CSOE 1SGCA 1MQ5A 1JXPA 2FPZA 1QR3E 1VITG 2JETB 3PROA 2IJOB 2AMPA 1AVGH 5F8XA 3AAVA 2EI7A 4NFEA 2GDEH 2BY7X 3S69A 4XSKU 3E90B 1ZPBA 1FY4A 2QXIA 1PPHE 1C1WH 3ESTA 1UHBA 1XUIA 2CXVA 1P2KA 1IHSH 1TFXA 1ZRBA 4A5TS 4FVBA 1GI9B 1CVWH 1O3NA 4Q80A 1SR5C 1NU7B 4JZ1A 2Y7XA 2F3CE 1OP2A 3LONA 1QHRB 2G5NA 1B0EA 2GMTB 2AFQB 1O2MA 2WYGA 2QYIA 3TNTA 2J34A 2W26A 4GAWA 1GI7B 1O5FH 1FPHH 1S85A 1O3OA 2Q6DA 1QRXA 1P01A 2A0QB 2BDGA 1RFNA 1UTPA 1FAKH 4UD9H 1EATA 1ZTJA 3BV9B 5C5OA 2ZDKA 1P57B 4BAOB 3RXOA 1N8OB 1MTUA 2RA0A 3F1SB 3SNCA 3U1JB 1LMWB 4JK5A 3UOPA 4OGYA 1OWIA 3ATWA 3ZZDA 1O3IA 1GJ4H 1SGRE 1IAUA 1F5KU 1NT1A 3RXSA 1O5AB 2O9QA 1MAYA 4NFFA 2TGPZ 1GVZA 4JMYA 3LIWA 1EP5A 2G5VA 4FU9A 2BY5X 1S5SA 1H9IE 1Z1JA 1VJAU 1TA2A 3MH4A 3Q77A 4NCYA 1ABJH 4X8UH 4UEHH 3M5NA 4B71A 1RXPA 2GGVB 1RD3B 3UR9A 1BTPA 4TWYA 4U01A 1C1SA 2ANKH 1O3GA 3VB6A 3W94A 4Y10E 1QFKH 3SU1A 1EPTA 5FPYA 1QIXB 1ELBA 2OTVA 1O2JA 3SNBA 3HKIB 4GCHF 4E7RG 3LJJA 1F5RA 4JZDH 2C8XB 1BMNH 1ELCA 2C8YB 2ZU4A 4TY7A 3O8CA 1YPLH 5TCAA 2V3OH 3AVZA 1FJSA 3BIUH 1H1BA 3ZZ3A 3E0PB 1UTLM 2BOHB 3V3MA 2FLBH 1G37A 1J14A 2GMTC 4GCHG 1GBLA 2AYWA 2W7SA 1UO6A 2G4UA 7GCHG 2BM2A 1NPMA 3OU0A 2D2DA 3KCGH 4INHA 1MU6B 1TRYA 2P3UB 4K60A 1EJNA 3RU4E 1J8AA 1PQ7A 2VU8E 1HAXB 2ZDMA 3CP7A 1NRQH 1DT2A 1P04A 1VR1H 1ZTLA 1SSXA 2ALPA 1BJVA 2Z94A 1UTQA 3QDZB 4D8NA 4MLFB 1K1MA 1CBWB 2Q6FA 4JYVH 4NIYA 5BPEA 3TH3H 1V2ST 3H5CB 3D65E 1C5SA 4A6LA 3CS0A 3RXJA 4GHTA 3OY6U 1C1MA 1TIOA 1XVOA 2AGEX 1QNJA 3RMMH 1P09A 2TBSA 4NZQA 3RXFA 3W95A 1W7GH 4FUEA 1W3CA 5GJ4B 2GVFA 3F6UH 2JETC 3GCTG 3TJNA 3F9EA 1XKBC 1S6FA 4CRAA 1NTPA 1AVWA 1THRH 5ABWA 2VWNA 1O2KA 2HPPH 1HJAC 1OSSA 4GPGA 1S84A 2TIOA 3FZZA 3AAUA 2QXGA 4ZXXH 2YOLA 3FFGA 1C1RA 2EI6A 1A1RA 3ATIA 1QBNA 1O5CB 1LDTT 5A0AE 1ACBE 3RXDA 2BZAA 3SUEA 4NA8A 5LH8A 1YPMH 4K5ZA 1C4U2 1S81A 3S9BA 3D23A 1C1VH 2V6NA 2GV7A 2PV9B 3P8FA 1C2MA 2OC8A 1Y3VA 2ZGJA 1O2TA 4XBDA 4LZ1H 5K0HA 2QXJA 3A8AA 4Y8YA 1VGCB 1YGCH 3P6ZB 4THNH 3V7TA 5F03A 3B23B 2ZFTA 5EGMA 1LKBA 2I6QA 4I8JA 1FV9A 2QC2A 1V2PT 1VITF 4O03A 3TJOA 2PUQH 1ZYOA 2D1JA 1FN6A 1OXGA 3BEIB 1TRMA 1EJAA 3EA9A 3ZZAA 4Y79A 1GI3A 1RTFB 4E7NA 2CV3A 3SGAE 1DUAA 2SNVA 4B73A 1TNGA 5FPTA 1AU8A 4X1SU 1PFXC 1J16A 2ZC9H 1LQEA 1B7XB 2BLVA 1AWHB 3BEFB 2HVXA 3LH1A 1HAOH 2XCNA 1V2TT 1TX7A 3BTDE 3AASA 1NFYA 1GGDC 4HI3A 3C27B 1NS3A 1FMGA 4ZMAH 2ZDNA 2BLOA 1O37A 2JH5D 2M5TA 4Q2KA 1IQHA 4OS7A 3U9AH 4AOQA 1GMDF 3M3VA 3P8NA 3S7HB 4FU7A 2V3HH 2OC0A 5DP8A 2W3IA 1FQ3A 1O2SA 2B5TB 1Z6EA 3S7KB 1SGTA 1Z8IB 1ORFA 1HJAB 2BDIA 1MZAA 1Y3UA 4DGJA 1AZ8A 2ZGBH 3CS7A 4CHAC 2F9BH 2GD4B 3ZZ5A 2FS9A 2JH0D 2RDLA 4J1YA 2BZ6H 4DCDA 2VWLA 3M5LA 1C2FA 1EZSC 2AS9A 2ZP0H 1W0YH 1OX1A 1LVBA 5E2PA 1HDTH 2EC9H 1TE0A 2OLGA 3QTOH 1EAWA 2BMGB 3FVFB 1G2MA 2W5EA 2UUYA 4XE4A 1KTTB 3ZZ8A 1BTZA 2WUCA 1GMCG 1TNIA 2IOTA 1G3DA 1D3DB 2XC5A 2R0LA 2BYAX 1WBGB 1EOLA 1RS0A 1PPEE 1TGTA 4X8SH 1H9HE 1V2RT 4DW2U 3SGQE 1D6WA 4AGJA 1F0RA 3MOCA 1ESAA 5EQQA 3LC3A 1BJUA 1GI6A 2ZHEH 3VGCB 1ANEA 1K1LA 4FU8A 1E36B 1U6QA 2VNTA 4ZAEA 1TOCB 2BLWA 1EJMA 1JIMA 2D8WA 3P8OA 1WQVH 3ODDA 5PTPA 5AF9H 1OS8A 1ELEE 1P2IA 1YPGH 2A32A 1GGDB 2GX4A 3RDZA 5GCHG 5A8YA 2FOCA 3PO1B 3S9AA 3MO3A 1GJ6A 1SGNE 2GV6A 4BXWA 4IMZA 1W14U 1EPTB 1DWDH 3BTEE 4DVAU 1CT0E 2XC0A 1UMAH 2OBOA 1E34B 2FI5E 2VJ1A 1V2WT 2GCTC 2F9NA 2ZFFH 3PTBA 3DD2H 3UQOA 1O38A 1ZSJA 2BQ6B 4AB9A 2XC4A 1UCYE 7GCHF 1ELGA 5A8ZA 3UFAA 2VIVA 1QB9A 1A0JA 1OWDA 1M9UA 3SV6A 1HAVA 1V3XA 3ATMA 3KF2A 2TPIZ 3QTVH 2WV5A 3EGKH 1TPPA 1W7XH 1GI5A 2CF8H 1O33A 3PB1E 1AFQB 4DOQA 1AIXH 2ZGCA 1ANBA 1K1NA 3VB7A 2F9VA 1IQLA 1UTMA 1VGCC 1MQ6A 1QJ6B 4RKOB 4CR9A 3KHVA 3MWIU 4I8HA 1FY3A 2RG3A 3BG4C 3SJ9A 4SGAE
chains in the Genus database with same CATH superfamily
1IQFA 3QUMP 3QO6A 5L6NH 3MU4A 5DGJA 1Z8RA 5A0BA 2L74A 3Q00A 2ZEBA 3RMOH 4Q7YA 3SI3H 4ZCNA 4RN6A 3SU6A 1UVPA 3BG8A 2GT7A 2SGPE 1TGCA 3L6PA 4TPIZ 4Y71A 1H8IH 2BDAA 1QB1A 1G30B 2IPHA 4WMFA 2H6MA 2J97A 4B74A 4NGAH 1XUHA 1P2QA 3RC5A 4B6EA 5LPEA 2PUXB 1EB1H 3MH6A 2AMDA 2KX4A 1PQ8A 1LCYA 1PYTD 1V6DA 4AG2A 3WY8A 2QF4A 2P94A 4U32A 1SC8U 1AFEH 2R9PA 2QAAA 2PSXA 3BTME 3FKSD 4CRFA 4CH8B 2UWPA 4YT7H 1SPJA 1NN6A 5JB8S 4ACBA 5J4QA 1HJ8A 3SU0A 4ABGA 3LDXH 5ESBA 1DICA 1CGIE 1GHWH 3MNSA 3ZVGA 2VGCC 3FN8A 1ELVA 1OWEA 1BTYA 3HGPA 1A46H 3ZIAD 1HB0B 1E0FD 1GBMA 2FM2A 1A7SA 3RLYH 3MU8A 3SZEA 5EQSA 1MKWH 2IJD1 5IDKA 1PJPA 2L6OA 2GKVE 5HXFA 1LQDB 5DP9A 3MHWU 1XUJA 2R3UA 2B0FA 4ESTE 1ESBA 2FOAA 1O3PB 9ESTA 4H4FA 1VJ9U 3BF6H 1EZQA 1Q3XA 2O8LA 2BXUH 4K69A 2BDYA 3FOAA 1RTKA 3T26A 1V2KT 4INLA 3FP7E 1ELFA 3FO8D 2FOBA 4QT8C 2OC1A 5JBBS 2GDDA 4K3JA 1INCA 1F0UA 1BZXE 2Y82A 2QF3A 1LO6A 4K1SA 3PLBA 1GG6C 1RJXB 1C2HA 1C5XB 1A4WH 4I8LA 2WZQA 4B2BA 4IC5A 1C2EA 3A8BA 3RLWH 4XRNA 1F0TA 1OKXA 3B9FH 4K8YA 4D9RA 1BMLA 3LGIA 3SV2H 3NUMA 4GSOA 3EDXB 2FTMA 3O8RA 1BITA 4UFEH 2AHME 1GBHA 1E1QD 1W2KH 1OPHB 3PO1C 2FI4E 1HYLA 1JRSA 5C1XA 2V7QD 2LNCA 3NWUA 1GL1A 2ZU3A 2ZFQH 5FX6A 3M5MA 3CNRA 1FY5A 1EZXC 1SBWA 1C1PA 1MH0A 1PPGE 3A81A 1HIAA 1JBUH 5DO4H 1BMMH 1O2UA 2OINA 3TJUA 2J5UA 2B8OH 1MZDA 1KXAA 2ANWA 2G8TA 3BTTE 1IQKA 1EKBB 2VIOA 2WPIS 3DFJA 4AC9A 3HPTB 1B5GH 3LPRA 2D26C 4XBBA 3EE7A 5DSFA 5T6DA 5E2OA 4RI0A 3P92A 1Z71A 3TVJB 1AWFH 1YPHC 4WF8A 3N99A 1ZMJA 1D3PB 2STAE 4X8TH 4WVPE 4P00A 5GXPA 1JRTA 1UTOA 3MMGA 2A1DB 4GVUA 3VEQB 2ZTXA 5DP7A 3T28A 2WPJS 4NIXA 4DG4A 3DSPA 1GCDA 1SGPE 4ABBA 1C9TA 1L1JA 4CR5A 1K0HA 1O2VA 3RXKA 1JIRA 3A7ZA 3SJOA 2BDCA 1AKSB 2J9NA 5LPRA 3LGVA 1WAYB 1TQ0B 4WH8A 1IHTH 4XDEA 2PKSB 1TWXB 3H7TA 1EB2A 4HG6A 4MVNA 3U1IB 2G4TA 2ZKSA 3KQ5A 5I46H 5L2YH 4KTCA 1NESE 2F4LA 1MBMA 3VXFH 5F8TA 1RIWB 1P05A 1GI8B 1C5QA 3RXEA 4XD7D 1A2CH 3A7WA 1QB6A 5FCRA 3BIVH 1LHEH 4OS6A 2A4RA 3E8LA 5L2ZH 5A09A 6GCHG 3OYPA 1CE5A 4D7FA 2H2ZA 5DN6D 5T6FA 2BD9A 2NWNA 4AORA 1O2PA 3JZ2B 1T31A 3EQ0H 4ZHMU 3QZRA 2VBCA 2BVXH 4NA7A 2ZHWH 1F0SA 1LHCH 5DKMA 4YXWD 3RU4T 2Z9JA 4BTUB 1DSUA 1HAVB 2A5KA 2XBYA 2A7JA 5EODA 3NPSA 2OC7A 1ZMLA 2VIQA 3M7UA 1G36A 4Y11E 1DY8A 2XYAA 1ZZZA 2PW8H 2BOKA 3ZVFA 3SJIA 2VVUA 4YOGA 4DJZB 3SZNA 4FUGA 3RMLH 3ZZBA 1EX3A 1YY3A 2QCYA 4X1RU 1HRTH 5LPFA 1AZZA 1TAWA 1TX6A 1LKAA 1NM6A 3UNRA 2XTTB 3DCLA 2QY0B 1H4WA 4F55A 1SQAA 3QN7A 2SGQE 3HGNA 4ABEA 2FESH 1JWTA 2ZHDA 1GPZA 4ABAA 1EQ9A 3TJVA 4MTBA 2CGAA 4I8KA 1NFUA 5FCKA 3EA7A 1CA8B 1HFDA 2BDBA 3F9FA 3H09A 4ISNA 5EG4A 1QQUA 3KYFA 3LC5A 1N6XA 3NRLA 1THSH 2B9LA 2GCHF 1SHHB 1WTHD 2THFB 1H8DH 2QE7D 3FANA 4FUFA 3T25A 1GWAA 4K8BA 1Z8JB 1O2XA 2ZU1A 5EQRA 1P3CA 1LTOA 1Y8TA 3Q3XA 2P95A 3PYHA 2R0KA 4Z1MD 5HM2A 4IBLH 4MPVA 3LJOA 2PSYA 3VPKA 4ABDA 1P2OA 4AYVB 3S0NA 1H9LB 3RXUA 1Q31A 4Y6DA 3E1XB 1GHZA 1A0HB 4NSVA 2FO9A 1P11E 2VH0A 1O2ZA 4CRGA 1TYNA 1TQ7B 2A4GA 3A7YA 1K1OA 3GY7A 3ZVAA 1DM4B 1C2DA 2K1QA 1MCVA 3PLKA 3KN2A 5C67A 3EE0B 4UFGH 3SORA 5SGAE 2VVVA 2C90B 2WPDD 3KIDU 2BD2A 5EPYA 1DUEA 3JZ1B 4ISHH 1MABB 2Z3CA 1BOQA 3RMNH 5JBTA 2G55A 1TPOA 1Y3WA 1YP9A 2EEKA 1HXEH 3BEUA 1GJ8B 1BDAA 1BIOA 1C2LA 4X2YA 1QY6A 1V2NT 3RXVA 1HAYB 1HAIH 2PFEA 2Y7ZA 1O3FA 3DFLA 1GVLA 1KIGH 3ATLA 3F2GA 4YLQH 1GL0E 1PPCE 2PGBB 8GCHF 1EUFA 1GDUA 4Q7ZA 1QGFA 1KSNA 1L1NA 2O8TA 3RXBA 2I6SA 4X1NU 2WINI 3QX5H 4ZKSU 2R3YA 1A61H 2RFKC 1LPGB 1BTHH 1K1IA 3M7TA 1ARCA 1LVMA 4RSPA 2WPLS 5FXLA 1BMFD 1CT4E 5TCCA 1TMUH 1NBME 4CRBA 1Y3XA 1K9OE 1VITH 1SHYA 1CHOG 3VFEA 1G3BA 1QL9A 1UHBB 3CENA 3TH4H 1KLIH 1IQGA 3PV4A 5T3HA 4B2AA 1P2NA 1AI8H 3EYDA 1AN1E 2BB4A 9LPRA 5HM9A 3A8DA 2ZG0H 4KGAA 2QGRA 3ZV9A 3MNCA 1FLEE 5I25A 5DJ7A 1W12U 1S6HA 2J94A 2VINA 3V0XA 2FX4A 1GHVH 3FP8E 1HCGA 5A0CA 1BRUP 2A45B 5LGOA 2OQ5A 3PMBB 4YTAA 1D4PB 1HIAB 1BBRK 2KAIA 4O9VA 1P3EA 1L0ZA 1GI2A 1LHGH 1T4VH 4JYUH 2H5DA 1V2JT 3BTKE 8ESTE 5F6MA 1K28D 1EAIA 2PKAA 1YPJH 1AY6H 4U2WA 3SV8A 1TGSZ 2FI3E 2TRMA 2P3TB 2RA3A 3NCLA 1MTVA 5FHTA 4BTIB 3ZYEA 3BSQA 1A5IA 4HTCH 1GBJA 1V2VT 1UCYK 3MH5A 1AHTH 3FAOA 2SGAA 1MMJN 2QF5A 1QCPA 3U98H 4NWKA 1GMHF 1EAXA 5EXNA 1S82A 1O2YA 1WV7H 1ZGIA 2C8ZB 2UUJB 4UONA 1KTSB 3MNXA 4K1TA 1Z1IA 4YLUA 5CHAC 1C1UH 1QQ4A 2AIQA 3GOVB 2WV4A 3BTGE 2DUCA 3FZDA 1AUJA 4NZLA 3UUZA 1T4UH 1TB6H 3RP2A 4RKJB 3MYWA 2OK5A 3A7TA 2V35A 2GT8A 2F9PA 2FXRA 1ZPZA 2ZPRA 1TMBH 1KLTA 4K1EA 1ZR0A 4A1TA 1UTJA 1G9IE 3A7XA 5AFYH 1L4ZA 3PMJA 1UK2A 2VWOA 4NSYA 1O34A 5F53A 1C5WB 2QN5T 5GIBA 1SLVB 1SOTA 1P02A 1N6YA 2AGGX 1GJBB 1ZTKA 2QF0A 1AB9C 1C2GA 2FOFA 4YO9A 4MPUA 3K9XB 1TOMH 2DE9A 1Y5AT 2B7DH 2HRVA 3KQCA 1QJ7B 3LGUA 4X2WA 2P93A 4CRCA 1WSSH 3TNSA 1ESTA 3SO3A 1ZGVA 3BTWE 3BTHE 1QURH 2H5CA 5CE1A 1O2GH 3NKKA 4Q63A 4ABIA 1O3MA 1THPB 1ZOMA 2J4IA 4I33A 3QZQA 5EJLA 2ZU5A 3IITA 2BLQA 2EQNA 4CRDA 3I78A 3MI4A 1NBMD 1C1NA 1BBRH 1OYQA 7KMEH 1SVPA 1OYTH 2P59A 1OP8A 1AE5A 2Z3DA 1SQTA 1XXFA 1K1PA 1XX9A 4X8VH 3GDSA 5E8EH 5C2ZA 1EPTC 1Y5BT 2FMJA 2ANMH 4HGCA 5T1VA 3RC4A 2LPRA 3UWIA 1KXFA 1Y5UT 2IN2A 4KP0A 1MCTA 4NIVA 4X6PA 2GCTB 1XUGA 3ZVDA 5CHAB 2A2QH 3V13A 1QBOA 2ZECA 3RM0H 2HNTC 3HK6B 3UREA 3UTUH 2HOBA 5C94A 4I86A 1QBVH 3D62A 4AX9H 1CHOF 1TNJA 3A7VA 2C8WB 4X2VA 3STJA 4X1QU 1BHXF 1TGNA 3TK6A 1NFWA 1TNHA 2C93B 4BNRA 4B76A 2TGTA 4U30A 5C0UA 2ULLA 3LGWA 2A5IA 3VG8A 1BHXB 3ZVCA 1NU9A 2ZTZA 3KL6A 4JK6A 4ABJA 2Z9GA 4XOJA 3SU2A 4ISIH 1AVXA 4YM9A 4A1VA 3SU5A 3M3SA 3A84A 2UUFB 1GDNA 4WMEA 3UR6A 3DHKH 2ZO3H 2ZQ1A 3PMAB 1QRWA 1FXYA 1SGIB 1YWUA 2VB0A 4MNWA 1A5HA 4BAHB 4X1PU 2VIDA 1CBWC 1ELTA 3PM3A 2HWLB 1KMHB 1RGQA 1WQSA 2ZDAH 1GBTA 3UPEA 4YOIA 4X2XA 1FDPA 5JYIA 3A89A 1E35B 1GBAA 4OM9A 3TGKE 2SNWA 1C2JA 1KXBA 1UTKA 2Z9KA 1YLCA 3SNAA 3LGTA 3UNQA 1TNLA 5L30H 1KY9A 6ESTA 2ZF0H 3LH3A 3VB3A 2J98A 4GHQA 1BQYA 1TALA 1BTWA 1QA7A 1GHYH 5EW2H 2A7HA 3URCA 1X7AC 1WXRA 2A2XH 1MBQA 1HV7A 2F91A 2JDID 5CMXH 3STIA 1P2MA 1FNIA 2GJGA 1PYTC 2PLXA 1O3HA 5C20A 1FX0B 1MAXA 3TGIE 1WUNH 4MG3A 5KECA 3ZZCA 2H9EH 2TGDA 1C4V2 5FX5A 5FPSA 2VGCB 1DX5M 4FUBA 4DIIH 2Y80A 5HGGA 1TBRH 3V12A 4WXVA 3TGJE 3KQDA 1A0LA 2A31A 2FX6A 3P17H 3AW0A 4FUIA 3MH7A 3BTQE 1K2I1 1YBWA 2BY9X 2Q1JA 3H7OA 4O3TA 4XFQA 2ALVA 4NA9H 1FONA 3LOXA 5C17A 1ZHRA 2F9UA 1ZJKA 1TRNA 4ZHLU 4Y0YE 3R3GB 2O8WA 1LHDH 4JZFH 4AFQA 3M36A 5E0HA 4MNXA 2STBE 4YOJA 3UQVA 3KQEA 2FS8A 4X6OA 1EXFA 3TK9A 2QXHA 1V2QT 4OS1A 3RXTA 4MPXA 1PPZA 3RC6A 4LZ4B 1KYNA 2GP9B 2PKAB 1SGEE 3SNEA 3E0NB 1G32B 1O36A 2ZDVH 1GHAG 1UJ1A 4I31A 1W0ZU 1ANCA 1NFXA 2QIQA 1LHFH 2KR7A 4ZKNU 1EAUA 1E79D 2Z7FE 3RXCA 1V2LT 2NU1E 1VCPA 2ILNA 3GY5A 1W0KD 1AQ7A 1GCTC 2FODA 5J4SA 3SV9A 1WCZA 4ISLA 2F83A 2Z6BD 6LPRA 1YYY1 3ZZ7A 4BAKB 3GY8A 2ZHFH 4HFPB 4Z0KA 1LPZB 1CQQA 3RXAA 4A7IB 2F9OA 1FIZA 2SGDE 5EIYA 1O2NA 2ZCKP 4F48B 1HUTH 3I29A 2ZZUH 5AFZH 1Q2WA 2BD7A 1O2WA 2JJ1D 3DT0H 1DXPA 1NRNH 5H4IB 2PP6A 2C3SA 1CA0C 1CU1A 2FEQH 2HLCA 2WUBA 3NK8A 1FUJA 1V2MT 2ODPA 3SHCH 5DG6A 4CBOA 4YT6H 3GYLB 3SUGA 4Y7AA 1NRSH 1C1TA 5DP5A 1C5UA 4WJG2 1P8VC 2GZ8A 2ZHQH 1GBIA 1UVTH 2BQ7B 1K21H 1OWJA 3OTPA 2AERH 4FUJA 3K2UA 4B75A 5A8XA 1AGJA 3N7OA 4D7GA 1XUFA 2OUAA 2ZCHP 1SGQE 3DSOA 1DANH 5AVDA 2PHBA 2PWXA 1J15A 1VKYA 1SLWB 2UWOA 4I7YH 1GDQA 1RIWC 1C5VA 3F9HA 4LXBH 1GHAF 3SQEE 1LVYA 1CGHA 1NY22 1NRPH 4AGKA 3ZZ4A 1P0SH 4NIWA 1SGFA 4E06H 3A82A 3VB5A 1FAXA 1O3CA 4AFUA 2GZ7A 1SB1H 1C2IA 1K22H 1KXDA 1MTNC 3MU5A 5HKKD 1JMOH 1W11U 3MNBA 1CGJE 3GY4A 2GTBA 1K1JA 1C5TA 3UNSA 4CHAB 2Z9LA 1YM0A 3U8RH 2WPHS 2BD5A 1GHBF 2A7CA 1A5GH 1NO9H 2ZFPH 2J38A 4IC6A 3HKJB 1YF4A 2P8OB 5FBIA 3GDUA 2BD3A 1GHBG 4IMQA 1C5NH 4BAQB 3QGJA 2EA3A 2R2MB 1C5PA 1D6RA 1O3EA 1T8LA 4ABFA 4ZXYH 4H6SB 2UWLA 1ETRH 2KCOA 3WWFA 1O2LA 5K7RA 1PPFE 2HNTF 3N7DA 5HIYA 2ZFSA 3EAJA 1MKXK 4RT0A 1DY9A 3GISB 3MO9A 1N1LA 3L33A 4Y8XA 3ENSB 1L4DA 1QL8A 1F92A 2TGAA 4ABHA 1TBQH 1TMTH 4Y76A 3BG4B 3SUFA 1N8OC 2JKHA 4UFDH 1E38B 1FI8A 3O8DA 2XNDD 4KELA 3K65B 3VXEH 2WPMS 3U8OH 1YPKH 3A88A 1GJAB 3GDVA 2KCAA 3TITA 4FUHA 4INKA 5AHGH 3LT3A 2BHGA 1HJ9A 2FOEA 3SI4H 3VGCC 1P12E 1TGBA 5A2MH 2A5AA 1O5EH 7LPRA 1HNEE 4ZHAA 1LPKB 1SMFE 1FN8A 2G52A 1S0QA 1E37B 1GVKB 1C1OA 4KTUA 4OS4A 3SQHE 4WWYA 3ITIA 1J9CH 1T32A 1IQIA 1YPEH 3ODFA 5C3NA 1L2EA 2XBWA 2O8UA 1SFQB 3T2NA 1S83A 4FETA 1G2LA 2LELA 5KEDA 1BB0B 1GCTB 1BUIA 1BTUA 2ZGXH 1GJDB 1SKYE 1GMDG 1EZUC 3PWBA 5HMAA 2NU0E 2PTCE 1SOZA 2FLRH 3E3TA 4R0IA 3IG6B 3UAIC 1TA6A 3KQBA 1BTXA 1Z7KA 3RXRA 4BOHA 5JDUB 5C0TA 2SFAA 3I77A 2P3FH 3ZVEA 1DWCH 1GI4A 1HAPH 3ZZ9A 2PGQB 3ZVBA 3KGPA 3P8GA 1CA0B 2XBVA 1O2RA 3NZIA 3GCNA 3VB4A 2FP7B 3F0PA 3RXLA 2VIPA 1XXDA 4TWWA 1MTWA 1WU1A 1GJ9B 1AFQC 1IQEA 3B8JA 2OD3B 5EW1H 1O30A 3T62A 4K2YA 2JJ2D 4HZHA 5G4BA 4WMDA 1KLJH 2AMQA 1GHXH 1O32A 1SGFG 1C5OH 3SN8A 2ODYB 2CMYA 1HAHH 1QZ8A 2FWWA 2H9TH 4JZEH 1COWD 2FTLE 3HATH 4DT7B 1YCPM 4WY3A 1HPGA 3OX7U 2OXSA 1AE8H 4UDWH 2HNTE 1DFPA 2WYJA 1UVUH 4ASHA 1EOJA 2ZGHA 3GY3A 4ZH8A 1YCPK 1XUKA 2XBXA 2XCFA 4CBNA 3U8TH 3SUDA 2GZ9A 2EY4C 5HIZA 2ZFRH 2W6JD 1DPOA 1F5LA 1UVSH 4TYDA 3K6YA 4Y7BA 8KME2 3Q3YA 1AMHA 2ZA5A 3LU9B 1ETSH 1NRRH 1PQ5A 4LK4A 1SLXB 1ZSLA 1A3BH 5JBCS 4MQAA 1HBTH 5GWZA 3T29A 4BAMB 1BBRE 2HVYB 1MTNB 6CHAC 1QL7A 3PMHB 1ELAA 1NZQH 1QA0A 1UK3A 1S6LA 4OS5A 3TH2H 4IN2A 3A85A 2AH4X 3UOUA 3K6ZA 8LPRA 1NC6A 2ZPQA 1AUTC 4SGBE 4VGCC 4TSFD 1FIWA 3DSGA 1YPHE 2CHAC 2KZ4A 3MTYA 3RXMA 2BX3A 1O3LA 2ZTYA 1SLUB 2CK3D 3ATKA 3T27A 2Y5FA 2P8OC 4ZKRU 2ZNKH 1CHGA 4AFSA 4BANB 3OSYA 5DK1A 2BD4A 4JYTA 3AW1A 1GMCF 2W3KA 3P95A 3BTFE 2H9HA 5EOKA 1YKTA 1AO5A 1BCUH 1O39A 1JOUB 2M2AA 2VH6A 3NXPA 4ZUHA 1C5YB 2WPKS 8GCHG 2P16A 1PPBH 1MKXH 1MD8A 4XBCA 2LP6A 4CH2B 1T8MA 1ZJDA 4M7GA 1ID5H 4OGXA 1OOKB 1KDQA 1ZLRA 2V3MA 3RM2H 5DPAA 1BRAA 2YNBA 1YLDA 4BXSA 3OEHD 1DITH 3MU0A 1OWHA 4DY7B 1GMHG 3M5OA 2OQUA 4A92A 2Y5HA 3TLOA 1C1QA 3SGBE 5C1YA 4AG1A 3U69H 5B6OA 1AKSA 3MU1A 1GG6B 2BTCE 3OEED 1ANDA 4A1XA 2HALA 1F7ZA 3T5FH 1HAGE 3UIRA 2BY8X 3PWCA 1C2KA 2BXTH 2CN0H 4E05H 1ZMNA 1MTSA 3SU3A 2ZCLP 4TPYA 3A83A 4AB8A 2ASUB 1EASA 1A3EH 1IQMA 4J2YB 4YESB 1TX8A 5JPMH 1VCQA 1XM1A 2QV1A 1DOJA 2BVSH 1F2SE 3WWBA 5FAHA 3OTJE 2FZZA 1DXWA 3F0OA 2GCHG 3ZYDA 1CO7E 3R0FA 1TBZH 1V2UT 1TABE 2OP9A 3D49H 5ETXA 1C5ZB 3FP6E 3M35A 4Y8ZA 3F2FA 4MDSA 3URDA 4VGCB 5JBAS 1ELDE 2ODQA 4JCNA 2SGFE 1O2OA 2AEIH 1HAZB 1GJ7B 1XKAC 4F49A 5EXLA 4Q7XA 4KTSA 3SU4A 2CJIA 4CREA 1DLKB 1CT2E 1C4Y2 2G00A 4AYYB 5DP3A 1O2IA 2UUKB 2DE8A 1MD7A 4F4OC 4O97A 3BN9A 1S0RA 4I32A 4ACAA 5BRRE 5ESTE 4IW4E 3ZV8A 1SI5H 1W13U 1SFIA 2FOHA 5DP6A 1WOFA 2A4OA 1ARBA 2C4FH 2K0QA 3ZZ6A 4UFFH 2XW9A 2G51A 1O0DH 5DP4A 4AZ2B 2BVRH 1MUEB 4I8GA 4BTTB 1P9UA 2NU4E 3PV5A 2PKSC 2PTNA 2Z9IA 1GJ5H 4X6NA 1O5GH 2Y5GA 5F8ZA 1T7CA 2ZIQH 1O3AA 1VCWA 3QK1A 1W8BH 3SV7A 1C5LH 1BRCE 2XWBI 1C5MD 2SGEE 5TJXA 3QLPH 1H8ED 3OE7D 2W7UA 4FVDA 3SJ8A 1T8OA 1MU8B 2FOMB 4D9QA 1O35A 2ESTE 2YMSB 3IWMA 3MFJA 2FYRA 5IYTA 3UB0A 1ZHPA 4NG9H 2H1UA 3S9CA 1P03A 1HGTH 1RRKA 1GBBA 4IN1A 2A4QA 6CHAB 4TT3D 2RCEA 1DS2E 7ESTE 2Y6TA 3E91A 1GBDA 1GI0A 3SNDA 2R2WU 3PLPA 3M37A 1WYKA 1GBCA 2Q6GA 3M3TA 1WTGH 3MQKC 2CHAB 2ZI2H 3M61U 1O5BB 4FUDA 1O3JA 3RUOA 3RXIA 4AN7A 1O2QA 2ANYA 4WH6A 1DSTA 5FBEA 3SBKA 1O5DH 2NU3E 3A8CA 3SOSA 1Y59T 3LGYA 5HYOA 3A87A 3PRDA 2FDAA 1IOEA 4PROA 1XMNB 1D9IA 1UCYH 2XXLA 2ZDLA 1BRBE 4TY6A 3TIUA 4MNVA 2VVCA 1FZZA 3A86A 2OBQA 4KKDA 4MNYA 4YZUA 3DUXH 3E6PH 3DA9B 4LOYH 5KGOA 1G3EA 1BMAA 3SHAH 3GS9A 1VZQH 4DIHH 5GPIB 1GI1A 2ZPSA 3UY9A 3RXHA 3RXPA 1FY1A 1LVOA 2BY6X 2O8MA 4ZKOU 3GICB 5EXMA 3Q3KA 1B0FA 5T6GA 1GBFA 1O3KA 3RXQA 2FIRH 1DWBH 3RU4D 1Y3YA 1O3BA 2YNAA 3QWCH 1ZRKA 2FOGA 4FXGH 2ZQ2A 4FUCA 3LKWA 4ZROA 1KXEA 1DVAH 3GCHB 3GYMA 2AIPA 3N7EA 5EPNA 5GCHF 1TONA 6GCHF 5JB9S 5E0GA 1FPCH 3UWJH 1TLDA 1QTFA 2G81E 1P2JA 3M7QA 3Q76A 1NROH 3A80A 3GCTF 4R8TB 2Z3EA 3MO6A 1UK4A 1XVMA 4UE7H 2QA9E 1ABIH 1V2OT 1C5RA 1Z6JH 2VWMA 2PR3A 1UVOA 1EP6A 2BD8A 2ZWLH 1ZPCA 3OY5U 1QRZA 2HPQH 1DLEA 5E0JA 3GY2A 3TPIZ 4B1TA 3TK5A 1GJCB 1DDJA 3G01A 1GBEA 4X6MA 1W10U 1KDQB 1YCPH 1IQJA 1P10A 4GLYA 5GDSH 2VIWA 3ELAH 1PQAA 2NU2E 4H6TA 4MPWA 1BA8B 1HXFH 1TPSA 3C1KA 4ASUD 2HGTH 1O2HA 3EA8A 1T8NA 1IQNA 1TPAE 1DWEH 4Y0ZE 1SQOA 5C1UA 2FYQA 1ETTH 1RTLA 1P9SA 2J95A 4Z6AH 4D76A 1UTNA 2ZU2A 1SL3A 1OHHD 1FY8E 3L3TA 2EI8A 4IS5A 1GBKA 3PRBA 1KXCA 1D3TB 2CF9H 1DE7H 1SG8B 5C5NA 4NWLA 1BT7A 1YC0A 2XNIA 1J17T 2BQWB 1TNKA 4OS2A 2J2UA 3E16B 3F2HA 4X0WU 4WXIA 1G3CA 1SGDE 2YMSC 3QGNB 3SW2B 3RXGA 1L1GA 1AB9B 1P06A 3P70B 1ZSKA 1Z8GA 2KM0A 4AFZA 4H42U 1AD8H 4DURA 1O31A 3GCHC 4JZIA 3GCOA 2KAIB 1SGYE 1ZHMA 3GY6A 4B2CA 4ISOA 3F68H 1C9PA 2JH6D 2BDHA 2BX4A 3KNXA 4IGDA 3HK3B 3PTNA 1O3DA 1OP0A 3KEEA 1MKWK 3U28C 1D3QB 1HLTH 2OCVB 3TU7H 4GUXA 2XWAA 1QJ1B 2J92A 3SJKA 2XRCA 2V0BA 4O3UA 3F9GA 3O8BA 2Y81A 2AGIX 5EU8A 1OWKA 1CSOE 1SGCA 1MQ5A 3SYJA 1JXPA 2FPZA 1QR3E 1VITG 2JETB 3PROA 2IJOB 2AMPA 1AVGH 5F8XA 3AAVA 2EI7A 4NFEA 2GDEH 2BY7X 3S69A 4XSKU 3E90B 1ZPBA 5EJZA 1FY4A 2QXIA 1PPHE 1C1WH 3ESTA 1UHBA 1XUIA 2CXVA 1P2KA 3PV2A 1IHSH 1TFXA 5CDFE 1ZRBA 4A5TS 4FVBA 1GI9B 1CVWH 1O3NA 4Q80A 1SR5C 1NU7B 4JZ1A 2Y7XA 2F3CE 1OP2A 3LONA 1QHRB 2G5NA 1B0EA 2GMTB 2AFQB 1O2MA 2WYGA 2QYIA 3TNTA 2J34A 2W26A 4GAWA 1GI7B 1O5FH 1FPHH 1S85A 1O3OA 2Q6DA 1QRXA 1P01A 2A0QB 2BDGA 1RFNA 1UTPA 1FAKH 4UD9H 1EATA 1ZTJA 3BV9B 5C5OA 2ZDKA 1P57B 4BAOB 3RXOA 1N8OB 1MTUA 2RA0A 3F1SB 3SNCA 3U1JB 1LMWB 4JK5A 3UOPA 4OGYA 3OAAD 1OWIA 3ATWA 3ZZDA 1O3IA 1GJ4H 1SGRE 1IAUA 1F5KU 1NT1A 3RXSA 1O5AB 4RT1A 2O9QA 1MAYA 4NFFA 2TGPZ 1GVZA 4JMYA 3LIWA 1EP5A 2G5VA 4FU9A 2BY5X 1S5SA 1W0JD 1H9IE 1Z1JA 1VJAU 1TA2A 3MH4A 3Q77A 4NCYA 1ABJH 4X8UH 2KFWA 4UEHH 3M5NA 4B71A 1RXPA 2GGVB 1RD3B 3UR9A 2J98B 1BTPA 4TWYA 4U01A 1C1SA 2WV9A 2ANKH 1O3GA 3VB6A 3W94A 4Y10E 1QFKH 2K8IA 2YMSD 3SU1A 1EPTA 5FPYA 1QIXB 1ELBA 2OTVA 1O2JA 3SNBA 3HKIB 4GCHF 4E7RG 3LJJA 1F5RA 4JZDH 1E1RD 2C8XB 1BMNH 1ELCA 2C8YB 2ZU4A 4TY7A 3O8CA 1YPLH 5TCAA 2V3OH 3AVZA 1FJSA 3BIUH 1H1BA 3ZZ3A 3E0PB 1UTLM 2BOHB 3V3MA 2FLBH 1G37A 1J14A 2GMTC 4GCHG 1GBLA 2AYWA 2W7SA 1UO6A 2G4UA 7GCHG 2HLDD 2BM2A 2JIZD 1NPMA 3OU0A 2D2DA 3KCGH 4INHA 1MU6B 1TRYA 2P3UB 4K60A 4B6FA 1EJNA 3AK5A 3RU4E 1J8AA 1PQ7A 2VU8E 1HAXB 3W1EA 2ZDMA 3CP7A 1NRQH 1DT2A 1P04A 1VR1H 1ZTLA 1SSXA 2ALPA 1BJVA 2Z94A 1UTQA 3QDZB 4D8NA 4MLFB 1K1MA 1CBWB 2Q6FA 4JYVH 4NIYA 5BPEA 3TH3H 1V2ST 3H5CB 3D65E 1C5SA 4A6LA 3CS0A 3RXJA 4GHTA 3OY6U 1C1MA 1TIOA 1XVOA 2AGEX 1QNJA 3RMMH 1P09A 2TBSA 4NZQA 3RXFA 2WHXA 3W95A 1W7GH 4FUEA 1W3CA 5GJ4B 2GVFA 3F6UH 2JETC 3GCTG 3TJNA 3F9EA 1XKBC 1S6FA 4CRAA 1NTPA 1AVWA 1THRH 5ABWA 2VWNA 1O2KA 2HPPH 1HJAC 1OSSA 2RDEA 4GPGA 1S84A 2TIOA 3FZZA 5FL7D 3AAUA 2XOKD 2QXGA 4ZXXH 2YOLA 3FFGA 1C1RA 2EI6A 1A1RA 3ATIA 1QBNA 1O5CB 1LDTT 5A0AE 1ACBE 3RXDA 2BZAA 3SUEA 4NA8A 5LH8A 1YPMH 4K5ZA 1C4U2 1S81A 3S9BA 3D23A 1C1VH 2V6NA 2GV7A 2PV9B 3P8FA 1C2MA 2OC8A 1Y3VA 2ZGJA 1O2TA 4XBDA 4LZ1H 5K0HA 2QXJA 3A8AA 4Y8YA 1VGCB 1YGCH 3P6ZB 4THNH 3V7TA 5F03A 3B23B 2ZFTA 5EGMA 1LKBA 2I6QA 4I8JA 1FV9A 5GNDA 2QC2A 1V2PT 1EFRD 1VITF 4O03A 3TJOA 2PUQH 1ZYOA 2D1JA 1FN6A 1OXGA 3BEIB 1TRMA 1EJAA 3EA9A 3ZZAA 4Y79A 1GI3A 1RTFB 4E7NA 2CV3A 3SGAE 1DUAA 2SNVA 4B73A 1TNGA 5FPTA 3WW7A 1AU8A 4X1SU 1PFXC 1J16A 2ZC9H 1LQEA 1B7XB 2BLVA 1AWHB 4M9FA 3BEFB 2HVXA 2KCPA 3LH1A 1HAOH 2XCNA 1V2TT 1TX7A 3BTDE 3AASA 1NFYA 1GGDC 4HI3A 3C27B 1NS3A 1FMGA 4ZMAH 2ZDNA 2BLOA 1O37A 2JH5D 2M5TA 4Q2KA 1IQHA 4OS7A 3U9AH 4AOQA 1GMDF 3M3VA 3P8NA 3S7HB 4FU7A 2V3HH 2OC0A 5DP8A 2W3IA 1FQ3A 1O2SA 2W6ID 2B5TB 1Z6EA 3S7KB 1SGTA 5CHBA 1Z8IB 1ORFA 1HJAB 2BDIA 1MZAA 1Y3UA 4DGJA 1AZ8A 2ZGBH 3CS7A 4CHAC 2F9BH 2GD4B 3ZZ5A 2FS9A 1YLNA 2JH0D 3OFND 1UW7A 2RDLA 5IK2D 4J1YA 2BZ6H 4DCDA 1H8HD 2VWLA 3M5LA 1C2FA 1EZSC 2AS9A 2ZP0H 1W0YH 1OX1A 1LVBA 5E2PA 1HDTH 2EC9H 1TE0A 2OLGA 3QTOH 1EAWA 2BMGB 3FVFB 1G2MA 2W5EA 5B6LA 2UUYA 4XE4A 1KTTB 3ZZ8A 1BTZA 2WUCA 1GMCG 1TNIA 2IOTA 1G3DA 1D3DB 2XC5A 2R0LA 2BYAX 1WBGB 3F3BA 1EOLA 1RS0A 1PPEE 1TGTA 4X8SH 1H9HE 1V2RT 4DW2U 3SGQE 1D6WA 4AGJA 1F0RA 3MOCA 1ESAA 5EQQA 3LC3A 1BJUA 1GI6A 2ZHEH 3VGCB 1ANEA 1K1LA 4FU8A 1E36B 1U6QA 2VNTA 4ZAEA 1TOCB 2BLWA 5EJ1A 1EJMA 1JIMA 2D8WA 3KYGA 3P8OA 1WDIA 1WQVH 3ODDA 5PTPA 5AF9H 1OS8A 1ELEE 1P2IA 1YPGH 2A32A 1GGDB 4P02A 2GX4A 4Q4LA 3RDZA 5GCHG 5A8YA 2FOCA 3PO1B 1SQRA 2WSSD 3S9AA 3MO3A 1GJ6A 1SGNE 2GV6A 4BXWA 4IMZA 1W14U 1EPTB 1DWDH 3BTEE 4DVAU 1CT0E 2XC0A 1UMAH 2IPQX 2OBOA 1E34B 2GCTC 1V2WT 2FI5E 2F43B 2F9NA 2VJ1A 2ZFFH 3PTBA 3DD2H 3UQOA 1O38A 1ZSJA 2BQ6B 4AB9A 2XC4A 1UCYE 7GCHF 2KCYA 1ELGA 5A8ZA 4FOUC 3UFAA 2VIVA 1QB9A 1A0JA 1OWDA 1M9UA 3SV6A 1HAVA 1V3XA 3ATMA 3KF2A 2TPIZ 3QTVH 2WV5A 3EGKH 1TPPA 1W7XH 1GI5A 2CF8H 1O33A 3PB1E 1AFQB 4DT4A 4DOQA 1AIXH 2ZGCA 1ANBA 1K1NA 3VB7A 2F9VA 1IQLA 1UTMA 1VGCC 1MQ6A 1QJ6B 4RKOB 4CR9A 3KHVA 3MWIU 4I8HA 1FY3A 2RG3A 3BG4C 3SJ9A 4SGAE
chains in the Genus database with same CATH topology
1IQFA 3QUMP 3QO6A 5L6NH 3MU4A 5DGJA 1Z8RA 5A0BA 3Q00A 2ZEBA 3RMOH 4Q7YA 3SI3H 4RN6A 3SU6A 1UVPA 3BG8A 2GT7A 2SGPE 1TGCA 3L6PA 4TPIZ 4Y71A 1H8IH 2BDAA 1QB1A 1G30B 2IPHA 4WMFA 2H6MA 4B74A 4NGAH 1XUHA 1P2QA 3RC5A 5LPEA 2PUXB 1EB1H 3MH6A 2AMDA 1PQ8A 1LCYA 1PYTD 1V6DA 4AG2A 3WY8A 2P94A 4U32A 1SC8U 1AFEH 2R9PA 2QAAA 2PSXA 3BTME 4CRFA 4CH8B 2UWPA 4YT7H 1SPJA 1NN6A 5JB8S 5J4QA 1HJ8A 3SU0A 4ABGA 3LDXH 5ESBA 1DICA 1CGIE 1GHWH 3MNSA 3ZVGA 2VGCC 1ELVA 1OWEA 1BTYA 3HGPA 1A46H 1HB0B 1E0FD 1GBMA 2FM2A 1A7SA 3RLYH 3MU8A 5EQSA 1MKWH 5IDKA 1PJPA 2GKVE 5HXFA 1LQDB 5DP9A 3MHWU 1XUJA 2R3UA 2B0FA 4ESTE 1ESBA 2FOAA 1O3PB 9ESTA 4H4FA 1VJ9U 3BF6H 1EZQA 1Q3XA 2O8LA 2BXUH 4K69A 2BDYA 1RTKA 3T26A 1V2KT 4INLA 3FP7E 1ELFA 2FOBA 4QT8C 2OC1A 5JBBS 2GDDA 4K3JA 1INCA 1F0UA 1BZXE 2Y82A 2QF3A 1LO6A 4K1SA 3PLBA 1GG6C 1RJXB 1C2HA 1C5XB 1A4WH 4I8LA 4B2BA 4IC5A 1C2EA 3A8BA 3RLWH 1F0TA 1OKXA 3B9FH 4K8YA 4D9RA 1BMLA 3LGIA 3SV2H 3NUMA 4GSOA 3EDXB 2FTMA 3O8RA 1BITA 4UFEH 1GBHA 1W2KH 1OPHB 3PO1C 2FI4E 1HYLA 1JRSA 5C1XA 2LNCA 3NWUA 1GL1A 2ZU3A 2ZFQH 5FX6A 3M5MA 1FY5A 1EZXC 1SBWA 1C1PA 1MH0A 1PPGE 3A81A 1HIAA 1JBUH 5DO4H 1BMMH 1O2UA 2OINA 3TJUA 2B8OH 1MZDA 1KXAA 2ANWA 2G8TA 3BTTE 1IQKA 1EKBB 2VIOA 2WPIS 3DFJA 3HPTB 1B5GH 3LPRA 2D26C 4XBBA 5T6DA 5E2OA 3P92A 1Z71A 3TVJB 1AWFH 1YPHC 4WF8A 1ZMJA 1D3PB 2STAE 4X8TH 4WVPE 5GXPA 1JRTA 1UTOA 3MMGA 2A1DB 4GVUA 3VEQB 2ZTXA 5DP7A 3T28A 2WPJS 4NIXA 4DG4A 1GCDA 1SGPE 4ABBA 1C9TA 1L1JA 4CR5A 1O2VA 3RXKA 1JIRA 3A7ZA 3SJOA 2BDCA 1AKSB 2J9NA 5LPRA 3LGVA 1WAYB 1TQ0B 4WH8A 1IHTH 4XDEA 2PKSB 1TWXB 3H7TA 1EB2A 3U1IB 4MVNA 2G4TA 2ZKSA 5I46H 5L2YH 4KTCA 1NESE 1MBMA 3VXFH 5F8TA 1RIWB 1P05A 1GI8B 1C5QA 3RXEA 5FCRA 1A2CH 3A7WA 1QB6A 3BIVH 1LHEH 4OS6A 2A4RA 3E8LA 5L2ZH 5A09A 6GCHG 3OYPA 1CE5A 4D7FA 2H2ZA 5T6FA 2BD9A 2NWNA 4AORA 1O2PA 3JZ2B 1T31A 3EQ0H 4ZHMU 3QZRA 2BVXH 4NA7A 2ZHWH 1F0SA 1LHCH 5DKMA 3RU4T 2Z9JA 4BTUB 1DSUA 1HAVB 2A5KA 2XBYA 2A7JA 5EODA 3NPSA 2OC7A 1ZMLA 2VIQA 3M7UA 1G36A 4Y11E 1DY8A 2XYAA 1ZZZA 2PW8H 2BOKA 3ZVFA 3SJIA 2VVUA 4YOGA 4DJZB 3SZNA 4FUGA 3RMLH 3ZZBA 1EX3A 4X1RU 2QCYA 1HRTH 5LPFA 1AZZA 1TAWA 1TX6A 1LKAA 1NM6A 3UNRA 2XTTB 2QY0B 1H4WA 1SQAA 3QN7A 2SGQE 3HGNA 4ABEA 2FESH 1JWTA 2ZHDA 1GPZA 4ABAA 1EQ9A 3TJVA 4MTBA 2CGAA 4I8KA 1NFUA 5FCKA 3EA7A 1CA8B 1HFDA 2BDBA 3F9FA 4ISNA 5EG4A 1QQUA 3LC5A 1N6XA 1THSH 2B9LA 2GCHF 1SHHB 1WTHD 2THFB 1H8DH 3FANA 4FUFA 3T25A 1GWAA 4K8BA 1Z8JB 1O2XA 2ZU1A 5EQRA 1P3CA 1LTOA 1Y8TA 3Q3XA 2P95A 3PYHA 2R0KA 5HM2A 4IBLH 4MPVA 3LJOA 2PSYA 3VPKA 4ABDA 1P2OA 4AYVB 3S0NA 1H9LB 3RXUA 1Q31A 4Y6DA 3E1XB 1GHZA 1A0HB 4NSVA 2FO9A 1P11E 2VH0A 1O2ZA 4CRGA 1TYNA 1TQ7B 2A4GA 3A7YA 1K1OA 3GY7A 3ZVAA 1DM4B 1C2DA 2K1QA 1MCVA 3PLKA 3KN2A 5C67A 3EE0B 4UFGH 3SORA 5SGAE 2VVVA 2C90B 3KIDU 2BD2A 5EPYA 1DUEA 3JZ1B 4ISHH 2Z3CA 1BOQA 3RMNH 5JBTA 2G55A 1TPOA 1Y3WA 1YP9A 2EEKA 1HXEH 3BEUA 1GJ8B 1BDAA 1BIOA 1C2LA 4X2YA 1QY6A 1V2NT 3RXVA 1HAYB 1HAIH 2PFEA 2Y7ZA 1O3FA 3DFLA 1GVLA 1KIGH 3ATLA 4YLQH 1GL0E 1PPCE 2PGBB 8GCHF 1EUFA 1GDUA 4Q7ZA 1QGFA 1KSNA 1L1NA 2O8TA 3RXBA 2I6SA 4X1NU 2WINI 3QX5H 4ZKSU 2R3YA 1A61H 1LPGB 1BTHH 1K1IA 3M7TA 1ARCA 1LVMA 4RSPA 2WPLS 5FXLA 1CT4E 5TCCA 1TMUH 4CRBA 1Y3XA 1K9OE 1VITH 1SHYA 1CHOG 3VFEA 1G3BA 1QL9A 1UHBB 3CENA 3TH4H 1KLIH 1IQGA 3PV4A 5T3HA 4B2AA 1P2NA 1AI8H 3EYDA 1AN1E 2BB4A 9LPRA 5HM9A 3A8DA 2ZG0H 4KGAA 2QGRA 3ZV9A 3MNCA 1FLEE 5I25A 5DJ7A 1W12U 1S6HA 2J94A 2VINA 3V0XA 2FX4A 1GHVH 3FP8E 1HCGA 5A0CA 1BRUP 2A45B 5LGOA 2OQ5A 3PMBB 4YTAA 1D4PB 1HIAB 1BBRK 2KAIA 4O9VA 1P3EA 1L0ZA 1GI2A 1LHGH 1T4VH 4JYUH 1V2JT 2H5DA 3BTKE 8ESTE 5F6MA 1K28D 1EAIA 2PKAA 1YPJH 1AY6H 4U2WA 3SV8A 1TGSZ 2FI3E 2TRMA 2P3TB 2RA3A 3NCLA 1MTVA 5FHTA 4BTIB 3ZYEA 3BSQA 1A5IA 4HTCH 1GBJA 1V2VT 1UCYK 3MH5A 1AHTH 3FAOA 2SGAA 1MMJN 1QCPA 3U98H 4NWKA 1GMHF 1EAXA 5EXNA 1S82A 1O2YA 1WV7H 1ZGIA 2C8ZB 2UUJB 4UONA 1KTSB 3MNXA 4K1TA 1Z1IA 4YLUA 5CHAC 1C1UH 1QQ4A 2AIQA 3GOVB 2WV4A 3BTGE 2DUCA 3FZDA 1AUJA 4NZLA 3UUZA 1T4UH 1TB6H 3RP2A 4RKJB 3MYWA 3A7TA 2V35A 2GT8A 2F9PA 2FXRA 1ZPZA 2ZPRA 1TMBH 1KLTA 4K1EA 1ZR0A 4A1TA 1UTJA 1G9IE 3A7XA 5AFYH 1L4ZA 3PMJA 1UK2A 2VWOA 4NSYA 1O34A 1C5WB 2QN5T 5GIBA 1SLVB 1SOTA 1P02A 1N6YA 2AGGX 1GJBB 1ZTKA 2QF0A 1AB9C 1C2GA 2FOFA 4YO9A 4MPUA 3K9XB 1TOMH 2DE9A 1Y5AT 2B7DH 2HRVA 3KQCA 1QJ7B 3LGUA 4X2WA 2P93A 4CRCA 1WSSH 3TNSA 1ESTA 3SO3A 1ZGVA 3BTWE 3BTHE 1QURH 2H5CA 5CE1A 1O2GH 3NKKA 4ABIA 1O3MA 1THPB 1ZOMA 2J4IA 4I33A 3QZQA 2ZU5A 3IITA 2BLQA 4CRDA 3I78A 3MI4A 1C1NA 1BBRH 1OYQA 7KMEH 1SVPA 1OYTH 2P59A 1OP8A 1AE5A 2Z3DA 1SQTA 1XXFA 1K1PA 1XX9A 4X8VH 3GDSA 5E8EH 5C2ZA 1EPTC 1Y5BT 2FMJA 2ANMH 4HGCA 3RC4A 3UWIA 2LPRA 1KXFA 1Y5UT 2IN2A 4KP0A 1MCTA 4NIVA 4X6PA 2GCTB 1XUGA 3ZVDA 5CHAB 2A2QH 3V13A 1QBOA 2ZECA 3RM0H 2HNTC 3HK6B 3UREA 3UTUH 2HOBA 1QBVH 3D62A 4AX9H 1CHOF 1TNJA 3A7VA 2C8WB 4X2VA 3STJA 4X1QU 1BHXF 1TGNA 3TK6A 1NFWA 1TNHA 2C93B 4BNRA 4B76A 2TGTA 4U30A 2ULLA 3LGWA 2A5IA 1BHXB 3ZVCA 1NU9A 2ZTZA 3KL6A 4JK6A 4ABJA 2Z9GA 4XOJA 3SU2A 4ISIH 1AVXA 4YM9A 4A1VA 3SU5A 3M3SA 3A84A 2UUFB 1GDNA 4WMEA 3UR6A 3DHKH 2ZO3H 2ZQ1A 3PMAB 1QRWA 1FXYA 1SGIB 2VB0A 4MNWA 1A5HA 4BAHB 4X1PU 2VIDA 1CBWC 1ELTA 3PM3A 2HWLB 1RGQA 1WQSA 2ZDAH 1GBTA 3UPEA 4YOIA 4X2XA 1FDPA 5JYIA 3A89A 1E35B 1GBAA 3TGKE 2SNWA 1C2JA 1KXBA 1UTKA 2Z9KA 1YLCA 3SNAA 3LGTA 3UNQA 1TNLA 5L30H 1KY9A 6ESTA 2ZF0H 3LH3A 3VB3A 4GHQA 1BQYA 1TALA 1BTWA 1QA7A 1GHYH 5EW2H 2A7HA 3URCA 1X7AC 2A2XH 1MBQA 1HV7A 2F91A 5CMXH 3STIA 1P2MA 1FNIA 1PYTC 2PLXA 1O3HA 5C20A 1MAXA 3TGIE 1WUNH 4MG3A 3ZZCA 2H9EH 2TGDA 1C4V2 5FX5A 5FPSA 2VGCB 1DX5M 4FUBA 4DIIH 2Y80A 5HGGA 1TBRH 3V12A 4WXVA 3TGJE 3KQDA 1A0LA 2A31A 2FX6A 3P17H 3AW0A 4FUIA 3MH7A 3BTQE 1K2I1 1YBWA 2BY9X 2Q1JA 3H7OA 4O3TA 4XFQA 2ALVA 4NA9H 1FONA 3LOXA 1ZHRA 2F9UA 1ZJKA 1TRNA 4ZHLU 4Y0YE 3R3GB 2O8WA 1LHDH 4JZFH 4AFQA 3M36A 5E0HA 4MNXA 2STBE 4YOJA 3UQVA 3KQEA 2FS8A 4X6OA 1EXFA 3TK9A 2QXHA 1V2QT 4OS1A 3RXTA 4MPXA 1PPZA 3RC6A 4LZ4B 1KYNA 2GP9B 2PKAB 1SGEE 3SNEA 3E0NB 1G32B 1O36A 2ZDVH 1GHAG 1UJ1A 4I31A 1W0ZU 1ANCA 1NFXA 2QIQA 1LHFH 4ZKNU 1EAUA 2Z7FE 3RXCA 1V2LT 2NU1E 1VCPA 2ILNA 3GY5A 1AQ7A 1GCTC 2FODA 5J4SA 3SV9A 1WCZA 4ISLA 2F83A 2Z6BD 6LPRA 1YYY1 3ZZ7A 4BAKB 3GY8A 2ZHFH 4HFPB 4Z0KA 1LPZB 1CQQA 3RXAA 4A7IB 2F9OA 1FIZA 2SGDE 1O2NA 2ZCKP 1HUTH 3I29A 2ZZUH 5AFZH 1Q2WA 2BD7A 1O2WA 3DT0H 1DXPA 1NRNH 5H4IB 2C3SA 1CA0C 1CU1A 2FEQH 2HLCA 2WUBA 3NK8A 1FUJA 1V2MT 2ODPA 3SHCH 5DG6A 4CBOA 4YT6H 3GYLB 3SUGA 4Y7AA 1NRSH 1C1TA 5DP5A 1C5UA 4WJG2 1P8VC 2GZ8A 2ZHQH 1GBIA 1UVTH 2BQ7B 1K21H 1OWJA 2AERH 4FUJA 3K2UA 4B75A 5A8XA 1AGJA 3N7OA 4D7GA 1XUFA 2OUAA 2ZCHP 1SGQE 1DANH 5AVDA 2PHBA 2PWXA 1J15A 1SLWB 2UWOA 4I7YH 1GDQA 1RIWC 1C5VA 3F9HA 4LXBH 1GHAF 3SQEE 1LVYA 1CGHA 1NY22 1NRPH 4AGKA 3ZZ4A 1P0SH 4NIWA 1SGFA 4E06H 3A82A 3VB5A 1FAXA 1O3CA 4AFUA 2GZ7A 1SB1H 1C2IA 1K22H 1KXDA 1MTNC 3MU5A 1JMOH 1W11U 3MNBA 1CGJE 3GY4A 2GTBA 1K1JA 1C5TA 3UNSA 4CHAB 2Z9LA 1YM0A 3U8RH 2WPHS 2BD5A 1GHBF 2A7CA 1A5GH 1NO9H 2ZFPH 2J38A 4IC6A 3HKJB 1YF4A 2P8OB 5FBIA 3GDUA 2BD3A 1GHBG 4IMQA 1C5NH 4BAQB 3QGJA 2EA3A 2R2MB 1C5PA 1D6RA 1O3EA 1T8LA 4ABFA 4ZXYH 4H6SB 2UWLA 1ETRH 1O2LA 5K7RA 1PPFE 2HNTF 2ZFSA 3EAJA 1MKXK 1DY9A 3GISB 3MO9A 1N1LA 3L33A 4Y8XA 3ENSB 1L4DA 1QL8A 1F92A 2TGAA 4ABHA 1TBQH 1TMTH 4Y76A 3BG4B 3SUFA 1N8OC 2JKHA 4UFDH 1E38B 1FI8A 3O8DA 4KELA 3K65B 3VXEH 2WPMS 3U8OH 1YPKH 3A88A 1GJAB 3GDVA 3TITA 4FUHA 4INKA 5AHGH 3LT3A 2BHGA 1HJ9A 2FOEA 3SI4H 3VGCC 1P12E 1TGBA 5A2MH 2A5AA 1O5EH 7LPRA 1HNEE 4ZHAA 1LPKB 1SMFE 1FN8A 2G52A 1S0QA 1E37B 1GVKB 1C1OA 4KTUA 4OS4A 3SQHE 4WWYA 3ITIA 1J9CH 1T32A 1IQIA 1YPEH 3ODFA 5C3NA 1L2EA 2XBWA 2O8UA 1SFQB 3T2NA 1S83A 1G2LA 1BB0B 1GCTB 1BUIA 1BTUA 2ZGXH 1GJDB 1GMDG 1EZUC 3PWBA 5HMAA 2NU0E 2PTCE 1SOZA 2FLRH 3E3TA 4R0IA 3IG6B 1TA6A 3KQBA 1BTXA 1Z7KA 3RXRA 4BOHA 5JDUB 2SFAA 3I77A 2P3FH 3ZVEA 1DWCH 1GI4A 1HAPH 3ZZ9A 2PGQB 3ZVBA 3KGPA 3P8GA 1CA0B 2XBVA 1O2RA 3NZIA 3GCNA 3VB4A 2FP7B 3RXLA 2VIPA 1XXDA