1BTZA

Episelection: novel ki ~nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Episelection: novel Ki approximately nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1995-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1btzA02
2XC5A 1HXFH 2GV6A 2Y5FA 3M61U 5EXNA 1C1WH 2I6QA 3OX7U 1N6XA 1O37A 1QJ7B 4MPWA 1J14A 4B2BA 4BTTB 3KEEA 1QRXA 3T62A 3VEQB 3MWIU 1V2ST 1P57B 1FQ3A 1O3HA 3LJJA 2BZAA 2TGPZ 2PKSC 3E0PB 1ABIH 4INLA 4I8KA 3TH3H 1BTPA 3SNEA 3S9CA 1IQJA 4ZUHA 3TJVA 1CA8B 1O5AB 2O8TA 1AQ7A 3WY8A 2FZZA 5JB9S 1P10A 1AVWA 1GBCA 1CBWB 1GJ6A 3QLPH 2EC9H 4Q7YA 1XXFA 1GDQA 1RTKA 5DGJA 2FEQH 2BD3A 3BG4B 1B0EA 1GBJA 4JYVH 1VGCC 3A7ZA 3NUMA 3VGCB 3GY4A 3HK3B 2UUFB 4OS2A 1WOFA 3ATLA 1DS2E 1LHFH 3ZZBA 2H9TH 5EOKA 1SG8B 5BRRE 4AFZA 1AIXH 3W95A 3ATIA 1VITF 1CT0E 3QUMP 3F9GA 1F5LA 4A6LA 2BDBA 4NA9H 5BPEA 5I25A 3NZIA 1GI3A 4LXBH 3MYWA 2P94A 1A61H 2BQWB 2STAE 2FOGA 1F0RA 2WPKS 4IN2A 2R0KA 1FV9A 2P59A 1EZSC 5J4SA 3SU5A 1ESBA 1NRSH 2GGVB 4ZAEA 2TIOA 1D3PB 1C5PA 1BJVA 1TNKA 2G00A 2ZDLA 1P09A 1F5KU 1UTMA 3I29A 2J4IA 1TAWA 2JETB 1FIWA 1K1MA 3QZRA 3V0XA 2SFAA 2CF9H 2ZHDA 1ETRH 2BLOA 2BLVA 3S9AA 4FVBA 1C4U2 2AFQB 1O5CB 1UTLM 1TMUH 1MBMA 3P8FA 1W13U 2ANWA 3N7OA 3URCA 3BN9A 3MNSA 1EX3A 1ZRKA 4F4OC 1GI6A 1ELDE 2O9QA 4MQAA 4H4FA 1K1JA 2ZFRH 1OWEA 3VB6A 1BMAA 3K6ZA 1FNIA 2G4TA 1QR3E 1RIWC 2BTCE 1T4VH 1VITH 4RKJB 2FOHA 1O2WA 2ZU4A 3L3TA 1KXEA 8GCHG 1C5VA 1KLIH 1O2XA 1TQ7B 3FZDA 3DFLA 2QY0B 1T31A 2Q6FA 3L6PA 1P03A 3F9EA 1V2WT 2HLCA 5EQSA 3M35A 3KQCA 3PM3A 1NM6A 4ISNA 5C1UA 1WCZA 1S82A 5TCCA 2NWNA 2FI3E 2WUBA 1CA0C 1AKSA 1TBRH 2UWPA 1DY9A 3IITA 1XKBC 3UQVA 1EB1H 1BB0B 1TGSZ 2P3TB 3RXEA 1E35B 3STIA 1P2JA 4E7NA 1DM4B 5K0HA 1AFQB 1C5LH 3PO1B 1NY22 4YLQH 1O3OA 3M36A 3HK6B 1UTJA 2FX4A 2IN2A 4D76A 3BEUA 2ZFSA 3K65B 1B5GH 1A5HA 1QGFA 2BD7A 1UTKA 1KTSB 3NKKA 5T6DA 1GCDA 4K8YA 2AYWA 1ZJKA 1BZXE 5FPTA 3SO3A 4YOJA 2RA0A 1BT7A 1D3QB 2UUKB 4HGCA 5E8EH 1SOZA 2CHAB 2M5TA 2XBXA 2BD4A 2BDYA 1V2JT 4U30A 4AB8A 1S5SA 1O3CA 2K1QA 3EQ0H 3LOXA 1OXGA 2ZKSA 4KGAA 3M7TA 1GBIA 2A31A 4AZ2B 2ZGXH 1FAKH 4KKDA 8GCHF 3FVFB 1AE8H 3A7TA 2AGIX 3ZVCA 2G55A 2BDCA 1DY8A 1O2PA 1ELTA 4X1NU 2VB0A 5L2ZH 3MU1A 1DITH 4YM9A 2A2XH 3TGJE 4GCHG 2FESH 1GG6B 1IQKA 3AW1A 4Q7ZA 2DE8A 4NFEA 2NU0E 3SN8A 2C8YB 1ARBA 3RXOA 1CGHA 4NSYA 1BRCE 1JRTA 3UQOA 2LPRA 5E0JA 1EOLA 1ZMJA 4MVNA 3RXIA 1ZYOA 1ZHPA 5F8XA 1IQEA 1MCTA 1K28D 1GJDB 1IHSH 2FWWA 3I78A 4LZ1H 1LQDB 4HI3A 3MO9A 1C2EA 1FN6A 1TOMH 4B71A 2J38A 4DCDA 1K1NA 5FX6A 4ZKSU 3RXQA 3VB4A 2FLRH 3UY9A 1KXFA 1UTQA 1GBFA 1BJUA 2ZCKP 1TB6H 1K1PA 3DFJA 2NU3E 1TGTA 4K5ZA 3E16B 3HATH 3M3SA 1E36B 1EXFA 4MNVA 4I8GA 3EYDA 3MTYA 2SGQE 1BTYA 2H5CA 1W3CA 4B1TA 4CR5A 1O3PB 3GYLB 6ESTA 2C93B 3EAJA 2PTNA 1SFQB 4KTCA 4BANB 2RDLA 4JK5A 4FUIA 3OY5U 2P3FH 2J94A 1WTHD 2QAAA 1O2LA 2Z3EA 3JZ1B 1NFXA 1O2YA 3SUFA 4ZMAH 3IG6B 2QA9E 3QGNB 4UFEH 4AFQA 2QCYA 1MD7A 1TRNA 4FUGA 1KSNA 1ZTKA 4ESTE 1CVWH 1HNEE 4GCHF 1GJAB 1C2GA 1NO9H 1PPGE 1AE5A 2HOBA 1BMLA 5DJ7A 3SHAH 5T6FA 2NU2E 1JWTA 2AMQA 4AGJA 1K1LA 1UHBA 4ASHA 2XBYA 3PWCA 1PPBH 4GHTA 3QDZB 4NFFA 2BDGA 2PKSB 1Z8GA 3E90B 2BLQA 3RMMH 3K9XB 4JZFH 3AAUA 5F8ZA 4PROA 3TIUA 5DP4A 4JZIA 3SI3H 2Y7ZA 1AN1E 1A0LA 1ZTLA 2F9NA 4Y79A 3U1IB 3ATMA 2GZ8A 3U1JB 4B75A 3SV8A 5JBBS 1BMMH 1HUTH 2GTBA 2C8XB 4NWKA 2JH0D 2QF3A 3TK9A 1K9OE 1GBDA 1ZPZA 1IQNA 1EQ9A 2C8WB 1C4Y2 1UHBB 4UONA 1O33A 1Z1IA 5C5OA 1O2VA 1V2VT 4AORA 1HJAC 1YCPH 2BD8A 1PPCE 3SU0A 3T5FH 1HDTH 1ELBA 5ETXA 4IC6A 5AFZH 4Z0KA 1FPHH 1EATA 4WF8A 2FI4E 5LPEA 4RSPA 3A82A 5E0HA 1WYKA 2F9UA 2XC0A 4SGBE 1A3BH 2SNVA 2GCHG 2BDHA 3QZQA 4X0WU 5L2YH 1SGEE 1CGIE 2BD5A 3VXFH 1K1OA 3TITA 2OQUA 1TMBH 3TK5A 4DW2U 3DT0H 1SI5H 1NN6A 5G4BA 5DP3A 1AB9C 3RXSA 3I77A 4O3TA 4I8JA 5CHAB 4CRAA 4K3JA 1YP9A 4WY3A 2WPMS 1QL8A 3TNSA 1JOUB 1EP6A 3UNRA 1P2IA 1PPFE 4NA7A 2PLXA 2B0FA 2F9VA 1FZZA 4X1SU 3SHCH 1HYLA 3PMBB 3RXLA 2F83A 2ZQ2A 2ZGBH 4AYVB 4Y8XA 5DKMA 5AVDA 4ABAA 3A80A 2CF8H 2A5IA 5JDUB 1V3XA 2P8OC 3RXFA 1YPMH 3LGUA 2Y81A 1EP5A 3E8LA 4MLFB 4NA8A 3ZVDA 3A7WA 1W0ZU 2WV4A 3LC3A 2J34A 1SLVB 3H7OA 4HTCH 2A45B 3SU1A 3T29A 3SQHE 1IHTH 3GY7A 3BF6H 4Y10E 2F9OA 2TPIZ 1NRNH 3SJ9A 3DD2H 1HAOH 3LGVA 3U8RH 5EQQA 2PHBA 4WVPE 4MNWA 3HKIB 1WQSA 2Z3DA 1BBRH 1OKXA 1E0FD 1EKBB 3MU0A 1P2OA 2ZU1A 5FCRA 1C1TA 1GI2A 3M5OA 3UOPA 3BTTE 2A4OA 2VIPA 4JZ1A 2W26A 4FU7A 2A32A 2FO9A 2BY7X 5LGOA 1TX8A 1Y3UA 1BRUP 1FMGA 2RA3A 2ZHEH 4GUXA 4Y0YE 1MKWH 1V2QT 4ISIH 4D9RA 3MU4A 3AW0A 1YKTA 4O3UA 1XUFA 5FBIA 3GCTG 3GY6A 2ZDAH 4BAMB 4AOQA 3MI4A 2ASUB 2ZHWH 1TNLA 3SU4A 3H7TA 4BXWA 2STBE 3RC6A 1EAWA 4JK6A 1P01A 2A5KA 3MH6A 5ESTE 2I6SA 1D6WA 1HGTH 4FU9A 1SGNE 1C2IA 1TNGA 4I32A 1ZPBA 1UK4A 2SGPE 3PV4A 4CRCA 3PTNA 2YOLA 4AFUA 1O5GH 1LVOA 1O3NA 5TCAA 1F7ZA 3M5NA 3P8GA 1IQIA 3D23A 4GAWA 3A88A 1DXPA 1MBQA 3PLKA 3UPEA 4GPGA 2O8WA 1SGFA 1MTUA 3SV7A 1Z8IB 4VGCB 1BRAA 1HCGA 1MTNB 2FXRA 1UCYK 4AFSA 1NROH 2YNAA 3P70B 2OC8A 1LHGH 1C2MA 1LKBA 2D26C 4Z6AH 1UVOA 1LMWB 1CQQA 1P2MA 4Y76A 3G01A 6LPRA 1TGBA 4BTIB 4X8SH 5F03A 2BVXH 3O8DA 1IQHA 2NU4E 1A7SA 2BDAA 2FYRA 1J16A 1T8OA 2ZO3H 1P2KA 3GCTF 1YCPM 4OGXA 1DSTA 1LVMA 3Q77A 3MNCA 1ZOMA 2GD4B 4ABGA 4Q7XA 1GCTC 4DGJA 1TOCB 2GV7A 1GBEA 2CGAA 3OSYA 3CENA 1DLEA 1P9SA 4B2AA 1AD8H 3UR6A 1YGCH 4JYUH 1C1QA 1X7AC 3LJOA 4DVAU 3PROA 1DLKB 1ESAA 1CHGA 1PYTD 3V3MA 1FJSA 2ZDKA 5FAHA 4CRDA 1GBLA 1TPAE 1SGPE 3GCNA 1CU1A 1O36A 2GT7A 1B0FA 1B7XB 1UCYE 3RMLH 1OWKA 1YYY1 3V12A 1AVGH 5EPNA 4M7GA 1MZAA 3SV9A 1OP0A 1OS8A 3S9BA 4NIVA 1ZHMA 3VFEA 3RXDA 4OGYA 1MTWA 4MDSA 1C2LA 1SQAA 3BTDE 4I33A 1V2LT 1QJ6B 2QXJA 4IC5A 4YOIA 4YLUA 4FUHA 1HIAB 1AUJA 1FY8E 1SR5C 3M37A 1C5YB 3BTHE 5FXLA 1N1LA 5C67A 3TLOA 2F91A 4K1SA 5IYTA 3A85A 4BAHB 1GVKB 2WYJA 1AFEH 1Q3XA 4X8VH 7ESTE 1O5FH 1OWHA 1DOJA 1QQ4A 1YC0A 2AIQA 1MQ5A 1MD8A 1Q2WA 2GZ9A 1RS0A 3GDSA 2VIWA 1XX9A 3P17H 1DWBH 3RDZA 2VNTA 2GMTB 2OC0A 4YT7H 1H8IH 2V0BA 3P8OA 1XM1A 1TALA 5GJ4B 1L1GA 3BTFE 3SI4H 6CHAC 1ZTJA 4UDWH 4J2YB 2Z9GA 1O2IA 1W11U 3QO6A 1K21H 1UK2A 1KLTA 3P8NA 2OQ5A 2VWLA 4D7FA 2ZNKH 1JXPA 4R8TB 3ZVAA 1C5UA 4DOQA 2ZHFH 1H8DH 1HJAB 4Y71A 1VCPA 3GCHB 3F9FA 2WV5A 3LGYA 4X2VA 1KXAA 1L1NA 4CR9A 3F68H 3MH5A 1EJAA 2GCTB 1HRTH 2Z6BD 2PGQB 3BG8A 3EA9A 4Q80A 5HXFA 1FUJA 1O3BA 1C4V2 1SGCA 2DUCA 1OP2A 5ESBA 2JH6D 1T4UH 1Y3XA 1T8NA 1XUGA 5AFYH 4X6OA 5DP7A 5HYOA 3NCLA 1GDNA 1VCWA 1O32A 2VINA 2V3OH 1HAXB 2SGEE 1TABE 1XUHA 1ZGVA 1CHOG 2VWNA 1KIGH 1KY9A 1UTOA 3EGKH 1NRPH 3FP8E 3RMNH 7GCHG 1EPTB 4GVUA 1MMJN 1O0DH 2QIQA 1HFDA 2ZC9H 3ZVEA 3RU4D 2ZTYA 1EJMA 2WUCA 1SGDE 5GWZA 4ISLA 2PW8H 2C8ZB 2ESTE 1DANH 1AHTH 1A3EH 1TA2A 3SGAE 4U2WA 1MH0A 2W3KA 3T25A 2DE9A 1C5QA 1Y3VA 2OCVB 4DIHH 1GJ4H 1T8MA 3A81A 3TK6A 1MCVA 3AASA 5FX5A 4R0IA 2VIQA 1S0QA 1N6YA 1NESE 2FMJA 3LKWA 2O8MA 3ZZ6A 3T28A 3BTWE 4I8HA 4TPYA 5F6MA 2ZU3A 1C2HA 3A87A 2A1DB 3ELAH 2ZGHA 4X2WA 2QXIA 3M5MA 1GHAG 3RP2A 2ZU2A 3W94A 1HJ9A 2AS9A 4FU8A 1UMAH 1XUJA 4ABHA 4Q2KA 3KIDU 3CS7A 3SV2H 2B7DH 2R0LA 1JBUH 1O39A 4IW4E 4NGAH 1BA8B 3RM2H 2BHGA 1Z8JB 2ZWLH 1LCYA 1T32A 1THSH 2BOHB 2HWLB 8LPRA 1NC6A 2XW9A 3RXAA 1TA6A 1F5RA 2HALA 1CHOF 4WMDA 4ABFA 1ELVA 2ZDVH 2BY9X 2WINI 2WPIS 3KQBA 1O2JA 7GCHF 1XUIA 1OSSA 5GCHG 3GDUA 2HPPH 2TGTA 2VGCB 4KP0A 3FANA 3PYHA 5L30H 4CHAC 5SGAE 1UVUH 1GGDC 1C1OA 1C2JA 4JMYA 1SGRE 1LQEA 2A0QB 2PR3A 1THRH 2G51A 4TWYA 4ZKNU 2Z9JA 1C9TA 1YPEH 1KXDA 2BOKA 2XBVA 1MKXK 3V7TA 3GY2A 2ODPA 7LPRA 4FVDA 1SLXB 1DWDH 4IGDA 1Z1JA 2PUQH 2UWOA 1HV7A 4U01A 3GY8A 1GHYH 1GHAF 1GI7B 1S84A 2V3HH 3P92A 1O3KA 4BTUB 2KAIB 3SU2A 4DIIH 1XVMA 4IS5A 1O3LA 3TH4H 3NXPA 3M7UA 4X1RU 3SW2B 1BCUH 3KHVA 1XXDA 2A4RA 2IPHA 2FLBH 3BTME 3SNDA 2P16A 2ZTZA 4I7YH 1GI4A 2BY8X 2QV1A 1V2TT 4MNXA 5T6GA 2FODA 3SUDA 3A8BA 4RN6A 1SGYE 2VVUA 5C5NA 3MMGA 1IAUA 2AIPA 5ABWA 5DPAA 2ULLA 4UFFH 3T2NA 1GCTB 1W12U 1O3JA 5GCHF 1H9LB 1AVXA 3ENSB 1LPGB 2Y7XA 1N8OB 2XBWA 5EU8A 5JPMH 1P06A 1QY6A 2JH5D 3B23B 3NPSA 3F9HA 1FY5A 3ITIA 4ZXYH 3TJOA 4XE4A 1J15A 3TJNA 2GZ7A 1F0SA 3VB7A 1O2HA 5JBTA 1CBWC 1AU8A 2J92A 4A7IB 1HAGE 1G3BA 1GBTA 3QGJA 3M7QA 3SJ8A 2ZZUH 3BG4C 3BEFB 4Y8YA 5FPSA 2BQ7B 3RUOA 3ZVFA 5EXMA 3S7HB 2BYAX 4LK4A 3VGCC 4MG3A 3QX5H 1S0RA 1D4PB 1Y8TA 2BD9A 1IQGA 2BX4A 1P2NA 4RKOB 1SOTA 1O2GH 4IBLH 1QL9A 2A7JA 5J4QA 5A2MH 2ZFQH 3UFAA 4QT8C 3ZZDA 1GI8B 4FUDA 1VGCB 3QWCH 3P95A 2ZECA 4AGKA 4BAQB 3BIVH 5PTPA 3VB5A 4Y7BA 1DXWA 3S69A 2FPZA 2VH6A 1GHBG 1SFIA 5EQRA 1TE0A 1WUNH 1PYTC 1AI8H 1AZZA 3UIRA 2ZP0H 1P9UA 3PB1E 1Y3WA 2PUXB 5DG6A 1DVAH 1CO7E 1QB1A 4J1YA 3SNAA 3SOSA 4ISHH 2GKVE 2BY6X 1NFUA 1WSSH 1GMDG 1UVTH 3M3VA 3LGWA 3HGNA 3EA7A 1H9HE 2JETC 3E91A 1C2KA 1DICA 1SGQE 3QTVH 3UWJH 4NG9H 3TVJB 3MH4A 2CJIA 2IOTA 4UFGH 2AGGX 1LO6A 5C20A 3LPRA 2H2ZA 3RC4A 2W3IA 1WBGB 3OYPA 5CE1A 2CXVA 1PQ5A 1J8AA 3A84A 1TNJA 2ZPSA 3BTGE 5AHGH 1PJPA 1HXEH 3GICB 1SBWA 1BTUA 3GOVB 1DT2A 4YO9A 2HGTH 1F0UA 1MAXA 3LH1A 4XBBA 3CS0A 1EJNA 1ANDA 1Z7KA 2VJ1A 3EE0B 1PPHE 2FYQA 1MTSA 1NFWA 6GCHG 1EASA 2H1UA 1P2QA 1GL0E 3A7VA 4ISOA 1TQ0B 2FOBA 1QHRB 1OX1A 1F92A 5C3NA 1RIWB 3BTEE 3E6PH 1GJ7B 2VVVA 1DWCH 1O5DH 1QA7A 1UJ1A 2R9PA 3SQEE 1GHBF 2A5AA 1BTXA 2PSXA 3M5LA 1GJ8B 2A7HA 4XOJA 1C5WB 1D3TB 3RXRA 3DHKH 1Y5BT 5B6OA 1GBKA 3RU4E 1W7XH 3UUZA 3MFJA 4O97A 5DP6A 1AFQC 1IQFA 4I8LA 3JZ2B 1OWDA 1CA0B 1DPOA 2GCHF 3PO1C 1C1UH 1GMDF 1ZJDA 2Z7FE 2VH0A 1C5XB 1O30A 3TJUA 1FDPA 1NRRH 1K22H 2SGDE 2SGFE 2TBSA 3PWBA 3T26A 2VIOA 1TFXA 1A46H 2PKAA 1M9UA 2BZ6H 2ILNA 3KL6A 1GJCB 1V2UT 1OWJA 5JBCS 1BIOA 1XMNB 2ALVA 4ABBA 1AGJA 1O2NA 4NIXA 3K6YA 2CHAC 3RM0H 5A0BA 1O2OA 4CH2B 1GI9B 1W7GH 3LC5A 4K1TA 3A7XA 2FOCA 5LH8A 4YTAA 1BMNH 5GDSH 4JYTA 4XBDA 1TX6A 1UTNA 1TBQH 3M3TA 1AY6H 6GCHF 3RXCA 1PQ7A 1O3EA 3HPTB 5LPRA 2XWAA 3T27A 1GBBA 1C5SA 1HPGA 2PKAB 1QBOA 1NTPA 3B8JA 2P95A 4WH8A 1GBMA 3AAVA 1P3CA 3R3GB 1GJ5H 2SGAA 4AN7A 4OS4A 1RD3B 2A7CA 1GG6C 1SVPA 2G4UA 4XDEA 1SLWB 5K7RA 3FAOA 4IMZA 3PMJA 1V2KT 2Z9KA 1PPZA 1H4WA 2FOMB 2ZPRA 4X6PA 1EB2A 2VVCA 3UWIA 3GY3A 1C5ZB 1GJBB 1QTFA 2ZGJA 1G32B 2OINA 2ZQ1A 1O31A 3GYMA 2Z3CA 1LVYA 4BAOB 3KNXA 1BITA 1MAYA 2HPQH 2B9LA 2NU1E 3O8CA 1RJXB 2PFEA 1UCYH 1BTWA 3Q00A 5GXPA 4ABDA 5GIBA 2ANYA 2Q1JA 2QXHA 4E05H 2FX6A 3SUEA 4AG2A 4ZHLU 2BB4A 2OUAA 2BX3A 1KLJH 3A7YA 3MNXA 2ZIQH 4A92A 1KTTB 4ABJA 2B5TB 1A2CH 4MTBA 2VWOA 1O3MA 4Y0ZE 1D9IA 2LNCA 5E0GA 4FUEA 1FN8A 1RRKA 1HIAA 1WU1A 1E34B 3ZZ5A 3SNBA 5EGMA 4AYYB 3RMOH 3A8AA 4ZHAA 2JKHA 1LVBA 1EAUA 1A5GH 1QIXB 1ZMNA 1SGFG 3TGIE 4DG4A 4BAKB 4FUCA 1EZQA 1OOKB 1LKAA 1MUEB 1V2NT 2EA3A 2GDEH 3NWUA 2Y80A 4SGAE 3ZV8A 2FIRH 2FOEA 2BVRH 1MQ6A 2Y6TA 1QBVH 1QFKH 1TPOA 3ZVGA 1TGCA 1YPKH 4OS6A 1A0JA 1QJ1B 4X1PU 4CREA 1V6DA 1BDAA 1O38A 5I46H 1TPSA 1Z6EA 5FCKA 1G36A 2XNIA 1W8BH 2CMYA 3VXEH 3TU7H 4X2YA 1RGQA 2BVSH 1HAIH 4IN1A 3BTKE 1IOEA 3D62A 1YBWA 1ZSLA 1Q31A 2R2MB 5TJXA 3URDA 3EA8A 5JYIA 1TLDA 1RXPA 1ORFA 3ATWA 3O8RA 3DA9B 3UNSA 1O2UA 3ZVBA 1TRMA 1J17T 1SPJA 5HGGA 1A5IA 2BMGB 4O9VA 4E7RG 4U32A 1BHXF 1O2QA 3GCOA 3SGBE 3LGIA 1NRQH 1AUTC 3U8TH 2W7SA 1CGJE 4GLYA 2F9PA 1EZXC 1AO5A 1RFNA 1LHDH 4GSOA 1L4DA 2YNBA 2A2QH 1AMHA 3E1XB 1O5EH 3TGKE 3LDXH 2FM2A 2CN0H 3SGQE 5LPFA 4CBNA 4HFPB 4DURA 2ZI2H 2OD3B 1EPTA 3KF2A 3BSQA 1O2KA 1SQTA 2Y82A 1KXCA 5L6NH 1DX5M 3U98H 1ARCA 1W2KH 1WTGH 5CHAC 1V2RT 4AB9A 5JB8S 4X6NA 4INHA 5DK1A 3SUGA 3U8OH 2BDIA 2OTVA 4NWLA 2TGAA 1O5BB 2UUYA 4DJZB 1DSUA 3RXGA 4X2XA 1AB9B 4ZXXH 3MU8A 1EAIA 2G5NA 1HBTH 1S81A 5A0AE 4Y11E 2PSYA 1T8LA 2ZU5A 3MU5A 3D49H 1ID5H 4JCNA 4H6TA 1PQ8A 4K1EA 1U6QA 3QTOH 3A83A 4OS7A 4X8TH 1C1RA 2D1JA 2PTCE 1GL1A 4X8UH 1FXYA 1ELAA 4D8NA 2PWXA 5AF9H 4Y8ZA 1HLTH 1G2MA 1ZRBA 4MPXA 5EXLA 3DUXH 1W0YH 2P8OB 2EI8A 9LPRA 1BTHH 1UTPA 3RU4T 2OC1A 2EI6A 3UNQA 3ZYEA 3A8CA 3SNCA 1G30B 1MU6B 2HNTF 2OBOA 1C5MD 1ETSH 1SQOA 4FUBA 2FTLE 8ESTE 3K2UA 2TGDA 3GDVA 2AERH 3S7KB 2BM2A 4X6MA 2UWLA 1IQLA 4AX9H 2UUJB 4JZEH 1NPMA 3SV6A 1Y5UT 1TPPA 1QA0A 4A1TA 1O3GA 2WPLS 2O8UA 2ZCLP 4UEHH 3U9AH 1INCA 2XCNA 1GI1A 1YPLH 3KN2A 3IWMA 1VCQA 1NFYA 4HZHA 1V2MT 1E38B 3E3TA 1QBNA 2OC7A 3RLWH 2G81E 2Z9IA 2GP9B 1C1SA 4IMQA 4NIWA 5CMXH 1DWEH 2WPHS 1ZMLA 3MOCA 5T3HA 1HAVA 1AKSB 1GVZA 2PV9B 1C1PA 4THNH 2ZTXA 1UVPA 2AH4X 3R0FA 4NCYA 4F49A 3TNTA 4YT6H 1LHEH 2VIVA 1L4ZA 2QYIA 1EZUC 2ODQA 2ZPQA 3PMHB 1QRZA 1P8VC 1J9CH 1DFPA 4VGCC 1MTNC 3LONA 1S83A 3A86A 1Z71A 4XSKU 4WWYA 4NSVA 1SB1H 4DT7B 1ZLRA 1UO6A 2KAIA 3LGTA 1FONA 3UR9A 1S85A 1CT2E 2W5EA 3BEIB 4UE7H 1G37A 1C9PA 1GBHA 1S6FA 1TMTH 1ZZZA 2PGBB 2BXTH 1QL7A 1LPZB 2R3YA 1KDQA 1P11E 1HAVB 1THPB 3STJA 1O2TA 1YF4A 1BUIA 1SMFE 2F3CE 1GHXH 2ZF0H 1ANBA 2BD2A 4CH8B 1OP8A 1YM0A 1FY4A 1WV7H 5EPYA 1TYNA 2ZEBA 3UREA 3SJIA 4GHQA 4WMEA 4CRGA 4DY7B 1NZQH 2AMDA 1GWAA 4TY7A 1O2RA 2IJOB 2QF0A 3H5CB 3ODDA 3FP6E 3OTJE 1YPHE 1BQYA 2FS8A 2XC4A 3LH3A 4OS5A 4LZ4B 1V2OT 1L0ZA 2CV3A 1G2LA 4B74A 4FUJA 3MO6A 2Q6DA 5JBAS 3EDXB 1ACBE 1O3FA 4FUFA 2HNTE 1KDQB 1C1NA 1K1IA 1PFXC 4CRBA 2ZG0H 3PLPA 2VWMA 3QK1A 1MKXH 3RXMA 2Q6GA 2C90B 3SZNA 3C27B 4BOHA 1GPZA 2ZFFH 2THFB 5A0CA 5A8ZA 4WXVA 4B2CA 1TX7A 2O8LA 1QURH 4XFQA 4YOGA 4H42U 3SORA 2D2DA 1KXBA 1Y3YA 1MZDA 5FBEA 1JRSA 4XBCA 4ZHMU 4KTSA 5H4IB 3U69H 3SU3A 2C3SA 4Y7AA 3TPIZ 4OS1A 4CBOA 4B73A 1TNIA 3RXHA 4ZROA 1HAYB 3SJOA 1P04A 1ZHRA 3Q3KA 4ZH8A 1AWFH 1LDTT 2XWBI 1HB0B 1YPHC 1P05A 2W7UA 4Y6DA 4A1XA 3ZZ3A 2GVFA 4TPIZ 1SHHB 1ZGIA 2FDAA 4MPUA 1FI8A 1QB9A 2HNTC 2OXSA 1OYTH 1TBZH 2FS9A 3O8BA 5A8YA 2ZHQH 3ZYDA 1IQMA 1GBAA 1S6HA 4TY6A 1ZSKA 4BNRA 2FP7B 1GHVH 1RTFB 1F2SE 2FTMA 4B76A 1SC8U 1SSXA 4A1VA 1HAPH 4I31A 1O3DA 2GT8A 1GVLA 1E37B 1YCPK 2BY5X 3F1SB 2ZFPH 3RXTA 3KGPA 1W10U 4K2YA 5EW1H 1YPJH 1ANEA 4WXIA 2GMTC 2XCFA 4K69A 2J9NA 2RG3A 1LPKB 2VU8E 2XXLA 4YESB 1BRBE 2G5VA 2ANMH 4KELA 1OYQA 5FPYA 5F8TA 5HMAA 3SU6A 4UD9H 3PMAB 2H9HA 1C2FA 1PQAA 1P3EA 2A4GA 1FLEE 1HJ8A 2ZCHP 3MO3A 2AEIH 5EG4A 1FPCH 1L2EA 3A89A 2FOFA 6CHAB 1SGTA 1VJ9U 3GCHC 3RXBA 1C5OH 2WPJS 2J2UA 2Z94A 3HKJB 1V2PT 3FZZA 1O34A 4WH6A 3E0NB 2GCTC 2XYAA 1D6RA 1GI0A 1Z6JH 2ODYB 3ZZ8A 4AG1A 3BTQE 1O2SA 1O3AA 1TRYA 4CRFA 2HRVA 1C1MA 1WAYB 1TGNA 3RXUA 1VJAU 4H6SB 1QCPA 1TIOA 1HAHH 1G3EA 1G3CA 4KTUA 1BOQA 1GHWH 1SHYA 3C1KA 1ZSJA 1ELCA 1MU8B 4A5TS 2GX4A 2QGRA 1QRWA 1O2ZA 7KMEH 1DUAA 1EPTC 1EAXA 2ANKH 2FI5E 4K8BA 2QN5T 4BXSA 1BBRK 3FP7E 1NS3A 3KQDA 3Q76A 1FY1A 2Z9LA 2XTTB 3ZZAA 2ZDNA 4YZUA 2VIDA 4NIYA 1DUEA 2Y5GA 3KQEA 2BXUH 2RCEA 1P02A 4D7GA 1CSOE 1ELFA 1YPGH 1Z8RA 1ZR0A 3UOUA 1QNJA 4D9QA 5C1XA 1GHZA 1MKWK 1D3DB 1XKAC 3BV9B 2HVXA 2A4QA 4TWWA 1MTVA 2D8WA 3GY5A 3SBKA 2ZFTA 2Y5HA 5DP8A 3ZZ4A 1A4WH 5C2ZA 1QQUA 4ABEA 2H9EH 2G52A 2ZGCA 2V35A 3ESTA 3RXPA 4ABIA 1JIRA 1GMHG 3ZZ9A 1K2I1 1EUFA 3GISB 1H9IE 1DE7H 3FFGA 1XVOA 3QN7A 4ZKOU 1F0TA 2GDDA 1FY3A 3LIWA 4O03A 2EEKA 4JZDH 3PLBA 5FHTA 5HM2A 3MNBA 2F9BH 2AMPA 1L1JA 4WJG2 1CT4E 1T7CA 1C1VH 1RTLA 1WQVH 5DP9A 2AGEX 2WYGA 1GI5A 4X1QU 2ZA5A 4MNYA 5E2OA 5EW2H 1OPHB 1ABJH 2BQ6B 3HGPA 3RC5A 1QB6A 3P6ZB 3CP7A 1ETTH 1O3IA 5DO4H 5A09A 2H5DA 4NZLA 1GMCG 2QC2A 2B8OH 1BBRE 3ZV9A 3KCGH 9ESTA 1O35A 2FOAA 1GDUA 1O2MA 5DP5A 2J95A 1ELEE 4MPVA 1EOJA 1TONA 2VGCC 3NK8A 3VB3A 3PTBA 1G3DA 1SGIB 1KYNA 3AVZA 1BTZA 1SLUB 1UK3A 2R3UA 3Q3YA 4LOYH 3OU0A 3D65E 4FXGH 2C4FH 2V6NA 3OY6U 1UVSH 3RXJA 1YLCA 2OLGA 1FAXA 3A8DA 3UTUH 3Q3XA 1ELGA 3MHWU 5A8XA 4CHAB 1NU7B 1C5RA 3SJKA 3ZZCA 2TRMA 1JIMA 1C5NH 1GGDB 1HAZB 3LT3A 3MH7A 2G8TA 1AZ8A 5HM9A 3S0NA 1CE5A 4K60A 1C5TA 1BHXB 1SL3A 5E2PA 3ZZ7A 2OP9A 1YLDA 2OBQA 2P93A 1VZQH 1XUKA 1Y59T 8KME2 2ALPA 1AWHB 4INKA 3VPKA 1GMHF 1W14U 1LHCH 2SNWA 2XRCA 1G9IE 1ANCA 1JMOH 1A0HB 3RXVA 1OWIA 1ESTA 2EI7A 1GJ9B 3LU9B 1PPEE 1NT1A 3RXKA 1A1RA 2ZDMA 1TNHA 5IDKA 3V13A 4WMFA 2P3UB 1C2DA 4UFDH 2H6MA 2R2WU 3BIUH 3F6UH 1TWXB 1P0SH 1ZPCA 3ATKA 1VITG 1FIZA 3RLYH 3TH2H 3ODFA 5EODA 2QXGA 5C1YA 4NZQA 1LTOA 3B9FH 1DDJA 5GPIB 4E06H 1P12E 2BLWA 1GMCF 1NU9A 1H1BA 3L33A 4TYDA 1Y5AT 4ZKRU 1N8OC 1VR1H
chains in the Genus database with same CATH superfamily
2XC5A 1HXFH 2GV6A 2Y5FA 3M61U 5EXNA 1C1WH 4P02A 2I6QA 3OX7U 1N6XA 1O37A 1QJ7B 4MPWA 1J14A 4B2BA 4BTTB 3KEEA 1QRXA 3T62A 3VEQB 3MWIU 1V2ST 1P57B 1FQ3A 1O3HA 3LJJA 2BZAA 2TGPZ 2PKSC 3E0PB 1ABIH 4INLA 4I8KA 3FN8A 3TH3H 1BTPA 3SNEA 3S9CA 1IQJA 4ZUHA 3TJVA 1CA8B 1O5AB 2O8TA 1AQ7A 3WY8A 2FZZA 5JB9S 1P10A 2CK3D 1AVWA 1GBCA 1CBWB 1GJ6A 3QLPH 2EC9H 4Q7YA 1XXFA 1GDQA 1RTKA 5DGJA 2FEQH 2BD3A 3BG4B 1B0EA 1GBJA 4JYVH 1VGCC 3A7ZA 3NUMA 5B6LA 3VGCB 3GY4A 3HK3B 2UUFB 4OS2A 1WOFA 3ATLA 1DS2E 1LHFH 3ZZBA 2H9TH 5EOKA 1SG8B 5BRRE 4AFZA 1AIXH 3W95A 3ATIA 1FX0B 1VITF 1CT0E 3QUMP 5HKKD 3F9GA 1F5LA 4A6LA 2BDBA 4NA9H 5BPEA 5I25A 3NZIA 1GI3A 4LXBH 3MYWA 2P94A 1A61H 2BQWB 2STAE 2FOGA 1F0RA 2WPKS 4IN2A 5EJZA 2R0KA 1FV9A 2P59A 1EZSC 5J4SA 3SU5A 1ESBA 1NRSH 5DN6D 2GGVB 4ZAEA 2TIOA 5EJLA 1D3PB 1C5PA 1BJVA 1TNKA 2G00A 2ZDLA 1P09A 1F5KU 1UTMA 3I29A 2J4IA 1TAWA 2JETB 1FIWA 1K1MA 3QZRA 3V0XA 2SFAA 2CF9H 2ZHDA 1ETRH 2BLOA 3W1EA 2BLVA 3S9AA 4FVBA 1C4U2 2AFQB 1O5CB 1UTLM 1SQRA 1TMUH 1MBMA 3P8FA 1W13U 2ANWA 4FETA 3N7OA 3URCA 3BN9A 3MNSA 1EX3A 1ZRKA 4F4OC 1GI6A 1ELDE 2O9QA 4MQAA 4H4FA 1K1JA 2ZFRH 1OWEA 3VB6A 1BMAA 3K6ZA 1FNIA 2G4TA 1QR3E 1RIWC 2BTCE 1T4VH 1VITH 4RKJB 2FOHA 1O2WA 2ZU4A 3L3TA 1KXEA 8GCHG 1C5VA 1KLIH 1O2XA 3OTPA 1TQ7B 3FZDA 3DFLA 2QY0B 1T31A 2Q6FA 3L6PA 1P03A 3F9EA 1V2WT 2HLCA 5EQSA 3M35A 3KQCA 3PM3A 1NM6A 4ISNA 5C1UA 1WCZA 1S82A 5TCCA 2NWNA 2FI3E 2WUBA 1CA0C 1AKSA 1TBRH 2UWPA 1DY9A 3IITA 1XKBC 3UQVA 1EB1H 1BB0B 1TGSZ 2P3TB 3RXEA 1E35B 3STIA 1P2JA 4E7NA 1DM4B 5K0HA 2WSSD 1AFQB 4YXWD 1C5LH 3PO1B 1NY22 4YLQH 1O3OA 3M36A 3HK6B 1UTJA 2FX4A 2IN2A 4D76A 3BEUA 2ZFSA 3K65B 1B5GH 1A5HA 1QGFA 2BD7A 1UTKA 1KTSB 3NKKA 5T6DA 1GCDA 4K8YA 2AYWA 1ZJKA 1BZXE 5FPTA 3SO3A 4YOJA 4Q4LA 2RA0A 1BT7A 1D3QB 2UUKB 4HGCA 5E8EH 1SOZA 2CHAB 2M5TA 3F0PA 2XBXA 2BD4A 2BDYA 1V2JT 3DSOA 4U30A 5HIYA 4AB8A 1S5SA 1O3CA 3ZIAD 2K1QA 3EQ0H 3LOXA 1OXGA 2ZKSA 4KGAA 3M7TA 1GBIA 2A31A 4AZ2B 2ZGXH 1FAKH 4KKDA 8GCHF 3FVFB 1AE8H 3A7TA 3CNRA 2AGIX 3ZVCA 2G55A 2BDCA 1DY8A 1O2PA 1ELTA 4X1NU 2VB0A 5L2ZH 3MU1A 1DITH 4YM9A 2A2XH 3TGJE 4GCHG 2FESH 1GG6B 1IQKA 3AW1A 4Q7ZA 2DE8A 4NFEA 1MABB 2NU0E 3SN8A 2C8YB 4TSFD 1ARBA 3RXOA 1CGHA 4NSYA 1YLNA 1BRCE 1JRTA 3UQOA 2LPRA 5E0JA 1EOLA 2XOKD 5EIYA 2KCAA 1ZMJA 4MVNA 3RXIA 1E79D 1ZYOA 1ZHPA 5F8XA 1IQEA 1MCTA 1K28D 1GJDB 1IHSH 2FWWA 3I78A 4LZ1H 1LQDB 4HI3A 3MO9A 1C2EA 1FN6A 1TOMH 4B71A 2J38A 4DCDA 1K1NA 5FX6A 4ZKSU 3RXQA 3VB4A 2FLRH 2AHME 3UY9A 1KXFA 1UTQA 1GBFA 1BJUA 2ZCKP 2KR7A 1TB6H 1K1PA 3DFJA 2NU3E 1TGTA 4K5ZA 4I86A 3E16B 3HATH 3M3SA 1E36B 1EXFA 4MNVA 4I8GA 3EYDA 3MTYA 2SGQE 1BTYA 2H5CA 1W3CA 4B1TA 4CR5A 1O3PB 3GYLB 6ESTA 4B6FA 2C93B 3EAJA 2PTNA 1SFQB 4KTCA 4BANB 2RDLA 4JK5A 4FUIA 3OY5U 2P3FH 2J94A 1WTHD 2QAAA 1O2LA 1W0KD 2Z3EA 3JZ1B 1NFXA 1O2YA 3SUFA 5F53A 4ZMAH 3IG6B 2QA9E 3QGNB 4UFEH 4AFQA 2QCYA 1MD7A 1TRNA 4FUGA 1KSNA 1ZTKA 4ESTE 1CVWH 1HNEE 4GCHF 1GJAB 5GNDA 1C2GA 1NO9H 1PPGE 1AE5A 2HOBA 1BMLA 5DJ7A 3SHAH 5T6FA 2NU2E 1JWTA 2AMQA 4AGJA 1K1LA 1UHBA 4ASHA 2XBYA 3PWCA 1PPBH 4GHTA 3QDZB 4NFFA 2BDGA 2PKSB 1Z8GA 3E90B 2QE7D 2BLQA 3RMMH 3K9XB 4JZFH 3AAUA 5F8ZA 1H8ED 4PROA 3TIUA 5DP4A 4JZIA 3SI3H 2Y7ZA 1AN1E 1A0LA 1ZTLA 2F9NA 4Y79A 3U1IB 3ATMA 2GZ8A 3U1JB 4B75A 3SV8A 5JBBS 1BMMH 1HUTH 2GTBA 3FO8D 2C8XB 4NWKA 2JH0D 2QF3A 3TK9A 1K9OE 1GBDA 1ZPZA 1IQNA 1EQ9A 2C8WB 1C4Y2 1UHBB 4UONA 1O33A 1Z1IA 5C5OA 1O2VA 1V2VT 4AORA 1HJAC 1YCPH 2BD8A 1PPCE 3SU0A 3T5FH 1HDTH 1ELBA 5ETXA 4IC6A 5AFZH 5HIZA 4Z0KA 1FPHH 1EATA 4WF8A 2FI4E 5LPEA 4RSPA 3A82A 5E0HA 1WYKA 2F9UA 2XC0A 4SGBE 1A3BH 2SNVA 2GCHG 2BDHA 3QZQA 5CHBA 4X0WU 5L2YH 1SGEE 1CGIE 2BD5A 3VXFH 1K1OA 3TITA 2OQUA 1TMBH 3TK5A 4DW2U 3DT0H 1SI5H 1NN6A 5G4BA 5DP3A 1AB9C 3RXSA 3I77A 4O3TA 4I8JA 5CHAB 4CRAA 4K3JA 3UB0A 1YP9A 4WY3A 2WPMS 1QL8A 3TNSA 1JOUB 1EP6A 3UNRA 1P2IA 1PPFE 4NA7A 2PLXA 2B0FA 2F9VA 1FZZA 4X1SU 3SHCH 1HYLA 2LP6A 3PMBB 3RXLA 2F83A 2ZQ2A 2ZGBH 4AYVB 4Y8XA 5DKMA 5AVDA 4ABAA 3A80A 2CF8H 2A5IA 5JDUB 1V3XA 1E1RD 2P8OC 3RXFA 1YPMH 3LGUA 4ACBA 2Y81A 1EP5A 3E8LA 4MLFB 4NA8A 3ZVDA 3A7WA 1W0ZU 2WV4A 3LC3A 2J34A 1SLVB 3H7OA 4HTCH 2A45B 3SU1A 3T29A 3SQHE 1IHTH 3GY7A 3BF6H 4Y10E 2F9OA 2TPIZ 1NRNH 3SJ9A 3DD2H 1HAOH 3LGVA 3U8RH 5EQQA 2PHBA 4WVPE 4MNWA 3HKIB 1WQSA 2Z3DA 1BBRH 1OKXA 1E0FD 1EKBB 3MU0A 1P2OA 2ZU1A 5FCRA 1C1TA 1GI2A 3M5OA 3UOPA 3BTTE 1NBMD 2A4OA 2VIPA 4JZ1A 2W26A 4FU7A 2A32A 2FO9A 2BY7X 5LGOA 1TX8A 1Y3UA 1BRUP 1FMGA 2RA3A 2ZHEH 4GUXA 4Y0YE 1MKWH 1V2QT 4ISIH 4D9RA 3MU4A 3AW0A 1YKTA 4O3UA 1XUFA 5FBIA 3DSGA 3GCTG 3GY6A 2ZDAH 4BAMB 4AOQA 3MI4A 5FL7D 2ASUB 2ZHWH 1TNLA 3SU4A 3H7TA 4BXWA 2STBE 3RC6A 1EAWA 4JK6A 1P01A 2A5KA 3MH6A 5ESTE 2I6SA 1D6WA 1HGTH 4FU9A 1SGNE 1C2IA 1TNGA 4I32A 1ZPBA 1UK4A 2SGPE 3PV4A 4CRCA 3PTNA 2YOLA 4AFUA 1O5GH 1LVOA 1O3NA 5TCAA 1F7ZA 3M5NA 3P8GA 1IQIA 3EE7A 3D23A 4GAWA 3A88A 1DXPA 1MBQA 3PLKA 3UPEA 4GPGA 2O8WA 1SGFA 3KYFA 1MTUA 3SV7A 1Z8IB 4VGCB 1BRAA 1HCGA 1MTNB 2FXRA 1UCYK 4AFSA 1NROH 2YNAA 3P70B 2OC8A 1LHGH 1C2MA 1LKBA 2D26C 4Z6AH 1UVOA 1LMWB 1CQQA 1P2MA 4Y76A 3G01A 6LPRA 1TGBA 4BTIB 4X8SH 5F03A 4P00A 4XD7D 2BVXH 3O8DA 1IQHA 2NU4E 1A7SA 2BDAA 2FYRA 1J16A 1T8OA 2ZO3H 1P2KA 3GCTF 1YCPM 4OGXA 3PV5A 1DSTA 1LVMA 3Q77A 2V7QD 3MNCA 1ZOMA 2GD4B 3DSPA 4ABGA 4Q7XA 1GCTC 4DGJA 1TOCB 2GV7A 1GBEA 2CGAA 3OSYA 3CENA 1DLEA 1P9SA 4B2AA 1AD8H 3UR6A 1YGCH 4JYUH 1C1QA 1X7AC 3LJOA 4DVAU 3PROA 2KCPA 1DLKB 1ESAA 1CHGA 1PYTD 3V3MA 1FJSA 3AVZA 2ZDKA 5FAHA 4CRDA 1GBLA 1TPAE 1SGPE 3GCNA 1CU1A 1O36A 2GT7A 5EJ1A 1B0FA 1B7XB 1UCYE 3RMLH 1OWKA 1YYY1 3V12A 1AVGH 5EPNA 4M7GA 1MZAA 3SV9A 1OP0A 1OS8A 3KYGA 3OEHD 3S9BA 4NIVA 1ZHMA 3VFEA 3RXDA 4OGYA 1MTWA 4MDSA 1C2LA 1SQAA 4ASUD 3OE7D 3BTDE 4I33A 1V2LT 1QJ6B 2QXJA 4IC5A 4YOIA 4YLUA 4FUHA 1HIAB 1AUJA 1FY8E 1SR5C 3M37A 1C5YB 3BTHE 5FXLA 1N1LA 5C67A 3TLOA 2F91A 4K1SA 2KFWA 2KZ4A 5IYTA 3A85A 2WV9A 2EQNA 4BAHB 1GVKB 2WYJA 1AFEH 1Q3XA 4X8VH 7ESTE 1O5FH 1OWHA 1DOJA 1QQ4A 1YC0A 2AIQA 1MQ5A 1MD8A 1Q2WA 2GZ9A 1RS0A 2V3MA 3GDSA 2VIWA 1XX9A 3P17H 1DWBH 3RDZA 2VNTA 2GMTB 2OC0A 4YT7H 1H8IH 5IK2D 2V0BA 3P8OA 1XM1A 1TALA 5GJ4B 1L1GA 3BTFE 3SI4H 6CHAC 1ZTJA 4UDWH 4J2YB 2Z9GA 1O2IA 5C0UA 1W11U 3QO6A 1K21H 1UK2A 1KLTA 2M2AA 3P8NA 2OQ5A 2VWLA 4D7FA 2ZNKH 5T1VA 4Z1MD 1JXPA 4R8TB 3ZVAA 1C5UA 4DOQA 2ZHFH 1H8DH 1HJAB 4Y71A 1VCPA 3GCHB 3F9FA 3N99A 2WV5A 3LGYA 4X2VA 1KXAA 1L1NA 4CR9A 3F68H 3MH5A 1EJAA 2GCTB 1HRTH 2F43B 2Z6BD 2PGQB 3BG8A 3EA9A 4Q80A 5HXFA 1FUJA 1O3BA 1C4V2 1SGCA 2DUCA 1OP2A 5ESBA 2JH6D 1T4UH 1Y3XA 1T8NA 1XUGA 5AFYH 4X6OA 5DP7A 5HYOA 3NCLA 1GDNA 1VCWA 1O32A 2VINA 2V3OH 1HAXB 2KM0A 2SGEE 1TABE 1XUHA 1ZGVA 1CHOG 2VWNA 1KIGH 1KY9A 1UTOA 3EGKH 1NRPH 3FP8E 3RMNH 7GCHG 1EPTB 4GVUA 1MMJN 1O0DH 2QIQA 1HFDA 2ZC9H 3ZVEA 3RU4D 4F48B 2ZTYA 1EJMA 2WUCA 1SGDE 5GWZA 4ISLA 2PW8H 2C8ZB 1EFRD 2ESTE 1DANH 1AHTH 1A3EH 1TA2A 3SGAE 4U2WA 1MH0A 1QZ8A 2W3KA 3T25A 2DE9A 1C5QA 1Y3VA 2OCVB 4DIHH 1GJ4H 1T8MA 3A81A 3TK6A 1MCVA 3AASA 5FX5A 4R0IA 2VIQA 1S0QA 1N6YA 3GS9A 1NESE 2FMJA 3LKWA 2O8MA 3ZZ6A 3T28A 3BTWE 4I8HA 4TPYA 5F6MA 2ZU3A 1C2HA 3A87A 2A1DB 3ELAH 2ZGHA 3SZEA 4X2WA 3PRDA 2QXIA 3M5MA 1GHAG 3RP2A 2ZU2A 3W94A 1HJ9A 2AS9A 4FU8A 1UMAH 1XUJA 4ABHA 4Q2KA 3KIDU 3CS7A 3SV2H 2B7DH 2R0LA 1JBUH 1O39A 4IW4E 4NGAH 1BA8B 3RM2H 2BHGA 1Z8JB 2ZWLH 1LCYA 1T32A 1THSH 2BOHB 2HWLB 8LPRA 1NC6A 2XW9A 3RXAA 1TA6A 1F5RA 2HALA 1CHOF 4WMDA 4ABFA 1ELVA 2ZDVH 2YMSC 2BY9X 2WINI 2WPIS 3KQBA 1O2JA 7GCHF 1XUIA 1OSSA 5GCHG 3GDUA 2HPPH 2TGTA 2VGCB 4KP0A 3FANA 3PYHA 5L30H 4CHAC 5SGAE 1UVUH 1GGDC 1C1OA 1C2JA 4JMYA 1SGRE 1LQEA 2A0QB 2PR3A 1THRH 2G51A 4TWYA 4ZKNU 2Z9JA 1OHHD 1C9TA 1YPEH 2KCYA 3N7DA 1KXDA 2BOKA 2XBVA 1MKXK 3V7TA 3GY2A 2ODPA 7LPRA 4FVDA 1SLXB 1VKYA 1DWDH 4IGDA 1Z1JA 2PUQH 2UWOA 1HV7A 4U01A 3GY8A 1GHYH 1GHAF 1GI7B 1S84A 2V3HH 3P92A 1O3KA 4BTUB 2KAIB 3SU2A 4DIIH 1XVMA 4IS5A 1O3LA 3TH4H 3NXPA 3M7UA 4HG6A 4X1RU 3SW2B 1BCUH 3KHVA 3MQKC 1XXDA 2A4RA 2IPHA 2FLBH 3BTME 3SNDA 2P16A 2ZTZA 4I7YH 1GI4A 2BY8X 2QV1A 1V2TT 4MNXA 5T6GA 2FODA 2KCOA 3SUDA 3A8BA 4RN6A 1SGYE 2VVUA 5C5NA 3MMGA 1IAUA 2AIPA 5ABWA 5DPAA 2ULLA 4UFFH 3T2NA 1GCTB 1W12U 1O3JA 5GCHF 1H9LB 1AVXA 3ENSB 1LPGB 2Y7XA 1N8OB 2XBWA 5EU8A 5JPMH 4F55A 1P06A 1QY6A 2JH5D 3B23B 3NPSA 3F9HA 1FY5A 3ITIA 4ZXYH 2KX4A 4XE4A 1J15A 3TJOA 3TJNA 2GZ7A 1F0SA 3VB7A 1O2HA 5JBTA 1CBWC 1AU8A 2J92A 4A7IB 1HAGE 1G3BA 1GBTA 3QGJA 3M7QA 3SJ8A 2ZZUH 3BG4C 3BEFB 4Y8YA 5FPSA 2BQ7B 3RUOA 3ZVFA 5EXMA 3S7HB 2BYAX 4LK4A 3VGCC 4M9FA 4MG3A 3QX5H 1S0RA 1D4PB 1Y8TA 2BD9A 1IQGA 2BX4A 1P2NA 4RKOB 1SOTA 1O2GH 4IBLH 1QL9A 2A7JA 5J4QA 5A2MH 2ZFQH 3UFAA 4QT8C 3ZZDA 1GI8B 4FUDA 4XRNA 1VGCB 3QWCH 3P95A 2ZECA 4AGKA 4BAQB 3BIVH 5PTPA 3VB5A 4RT1A 4Y7BA 1DXWA 3S69A 2FPZA 2VH6A 1GHBG 5C17A 1SFIA 4RT0A 5EQRA 1TE0A 1WUNH 1PYTC 1AI8H 1AZZA 3UIRA 2ZP0H 1P9UA 3PB1E 1Y3WA 2PUXB 5DG6A 1DVAH 1CO7E 1QB1A 4J1YA 3SNAA 3SOSA 2RFKC 4ISHH 2GKVE 2BY6X 1NFUA 1WSSH 1E1QD 1GMDG 1WDIA 1UVTH 3M3VA 3LGWA 3HGNA 2WPDD 3EA7A 1H9HE 2JETC 3E91A 1C2KA 3FOAA 1DICA 1SGQE 3QTVH 3UWJH 4NG9H 3TVJB 3MH4A 2CJIA 2IOTA 4UFGH 2AGGX 1LO6A 5C20A 3LPRA 2H2ZA 3RC4A 2W3IA 1WBGB 3OYPA 5CE1A 2CXVA 1PQ5A 1J8AA 3A84A 1TNJA 2ZPSA 3BTGE 5AHGH 1PJPA 1HXEH 3GICB 1SBWA 1BTUA 3GOVB 2JDID 1DT2A 4YO9A 2HGTH 1F0UA 1MAXA 3LH1A 4XBBA 3CS0A 1EJNA 1ANDA 1Z7KA 2VJ1A 3EE0B 1PPHE 2FYQA 1MTSA 1NFWA 6GCHG 1EASA 2H1UA 1P2QA 1GL0E 3A7VA 4ISOA 1TQ0B 2FOBA 1QHRB 1OX1A 1F92A 5C3NA 1RIWB 3BTEE 3F3BA 3E6PH 4AC9A 3OEED 1GJ7B 2VVVA 1DWCH 1O5DH 1QA7A 1UJ1A 2R9PA 3SQEE 3F2HA 1GHBF 2A5AA 1BTXA 2PSXA 3M5LA 1GJ8B 2A7HA 4XOJA 1C5WB 1D3TB 3RXRA 3DHKH 1Y5BT 5B6OA 1GBKA 5DSFA 3RU4E 1W7XH 3UUZA 3MFJA 4O97A 5DP6A 1AFQC 1IQFA 4I8LA 3JZ2B 1OWDA 1CA0B 1DPOA 2GCHF 3PO1C 1C1UH 1GMDF 1ZJDA 2Z7FE 2VH0A 1C5XB 1O30A 3TJUA 1FDPA 1NRRH 2JJ1D 1K22H 2SGDE 2SGFE 2TBSA 3PWBA 3T26A 2VIOA 1TFXA 1A46H 2PKAA 1M9UA 2BZ6H 2ILNA 3KL6A 1GJCB 1V2UT 1OWJA 5JBCS 1BIOA 1XMNB 2ALVA 4ABBA 1AGJA 1O2NA 4NIXA 3K6YA 2CHAC 3RM0H 5A0BA 1O2OA 4CH2B 1GI9B 5C0TA 1W7GH 3LC5A 4K1TA 3A7XA 2FOCA 5LH8A 4YTAA 1BMNH 5GDSH 4JYTA 4XBDA 1TX6A 1UTNA 1TBQH 3WW7A 3M3TA 1AY6H 6GCHF 3RXCA 1PQ7A 1O3EA 3HPTB 5LPRA 2XWAA 3T27A 1GBBA 1C5SA 1HPGA 2PKAB 1QBOA 1NTPA 3B8JA 2P95A 4WH8A 1GBMA 3AAVA 1P3CA 3R3GB 1GJ5H 2SGAA 4AN7A 4OS4A 1RD3B 2A7CA 1GG6C 1SVPA 2G4UA 4XDEA 1SLWB 5K7RA 3FAOA 4IMZA 4FOUC 3PMJA 1V2KT 2Z9KA 1PPZA 1H4WA 2FOMB 2ZPRA 4X6PA 1EB2A 2VVCA 2EY4C 3UWIA 3GY3A 1C5ZB 1GJBB 1QTFA 2ZGJA 1G32B 2OINA 2ZQ1A 2IJD1 3NRLA 1O31A 3GYMA 2Z3CA 1LVYA 4BAOB 3KNXA 2L6OA 1BITA 1MAYA 2HPQH 2B9LA 2NU1E 3O8CA 1RJXB 2PFEA 1UCYH 1BTWA 2IPQX 3Q00A 5GXPA 4ABDA 5GIBA 2ANYA 2Q1JA 2QXHA 4E05H 2FX6A 3SUEA 4AG2A 4ZHLU 2BB4A 2LELA 2OUAA 2BX3A 1KLJH 3A7YA 3FKSD 3MNXA 2ZIQH 4A92A 1KTTB 2J98A 4ABJA 2B5TB 1A2CH 4MTBA 2VWOA 1O3MA 4Y0ZE 1D9IA 2LNCA 5E0GA 4FUEA 1FN8A 4ZCNA 1RRKA 1HIAA 1WU1A 1E34B 3ZZ5A 3SNBA 5EGMA 4AYYB 3RMOH 3A8AA 4ZHAA 2JKHA 3U28C 1LVBA 1EAUA 1A5GH 1QIXB 1ZMNA 1SGFG 3TGIE 4DG4A 4BAKB 4FUCA 1EZQA 1OOKB 1LKAA 1MUEB 1V2NT 2EA3A 2GDEH 3NWUA 2Y80A 4SGAE 3ZV8A 2J98B 2FIRH 2FOEA 2BVRH 1MQ6A 2Y6TA 1QBVH 1QFKH 1TPOA 3ZVGA 1TGCA 1YPKH 4OS6A 1A0JA 1QJ1B 4X1PU 4CREA 1V6DA 1BDAA 1O38A 5I46H 1TPSA 1Z6EA 5FCKA 1G36A 2XNIA 1W8BH 2CMYA 3VXEH 3TU7H 4X2YA 1RGQA 2BVSH 1HAIH 4IN1A 3BTKE 1IOEA 3D62A 1YBWA 1ZSLA 1Q31A 2R2MB 5TJXA 3URDA 2F4LA 3EA8A 5JYIA 1TLDA 1RXPA 1ORFA 2GJGA 3ATWA 3O8RA 3DA9B 3UNSA 1O2UA 3ZVBA 1TRMA 2PP6A 1J17T 1SPJA 5HGGA 1A5IA 2BMGB 4O9VA 4E7RG 4U32A 1BHXF 1O2QA 3GCOA 3SGBE 3LGIA 1NRQH 1AUTC 3U8TH 2W7SA 1CGJE 4GLYA 2F9PA 1EZXC 1AO5A 3VG8A 1RFNA 1LHDH 4GSOA 1L4DA 2YNBA 2A2QH 1AMHA 3E1XB 1O5EH 3TGKE 3LDXH 2FM2A 2CN0H 3SGQE 5LPFA 4CBNA 4HFPB 4DURA 2ZI2H 2OD3B 1EPTA 3KF2A 3BSQA 1O2KA 1SQTA 2Y82A 1KXCA 5L6NH 1DX5M 3U98H 1ARCA 1W2KH 1WTGH 5CHAC 1V2RT 2WZQA 4AB9A 5JB8S 4X6NA 4INHA 5DK1A 3SUGA 3U8OH 2BDIA 2OTVA 4NWLA 2TGAA 1W0JD 1O5BB 2UUYA 4DJZB 1DSUA 3RXGA 4X2XA 1AB9B 4ZXXH 3MU8A 3PRBA 1EAIA 2G5NA 1HBTH 1S81A 5A0AE 4Y11E 2PSYA 1T8LA 2ZU5A 3MU5A 3D49H 1ID5H 4JCNA 4H6TA 1PQ8A 4K1EA 1U6QA 3QTOH 3A83A 4OS7A 4X8TH 1C1RA 2D1JA 2PTCE 1GL1A 4X8UH 1FXYA 1ELAA 4D8NA 2PWXA 5AF9H 4Y8ZA 1HLTH 1G2MA 1ZRBA 4MPXA 5EXLA 5KEDA 3DUXH 1W0YH 2P8OB 2EI8A 4TT3D 9LPRA 1BTHH 1UTPA 3RU4T 2OC1A 2EI6A 3UNQA 3ZYEA 3A8CA 3SNCA 1G30B 1MU6B 2HNTF 2OBOA 1C5MD 1ETSH 1SQOA 4FUBA 2FTLE 8ESTE 3K2UA 2TGDA 3GDVA 2AERH 3S7KB 2BM2A 4X6MA 2UWLA 1IQLA 4AX9H 2UUJB 4JZEH 1NPMA 1NBME 3SV6A 1Y5UT 1TPPA 1QA0A 2J97A 4A1TA 3OAAD 1O3GA 2WPLS 2O8UA 2ZCLP 4UEHH 3U9AH 1INCA 2XCNA 1GI1A 1YPLH 3KN2A 3IWMA 1VCQA 1NFYA 4HZHA 1V2MT 1E38B 3E3TA 1QBNA 2OC7A 3RLWH 2G81E 2Z9IA 2GP9B 3SYJA 1C1SA 4IMQA 4NIWA 5CMXH 1DWEH 2WPHS 1ZMLA 3MOCA 5T3HA 1HAVA 1AKSB 1GVZA 2PV9B 1C1PA 4THNH 2ZTXA 1UVPA 2AH4X 3R0FA 4NCYA 3OFND 4F49A 3TNTA 4YT6H 1LHEH 2VIVA 1L4ZA 2QYIA 1EZUC 2ODQA 2ZPQA 3PMHB 1QRZA 1P8VC 1J9CH 1DFPA 2J5UA 1MTNC 3LONA 1S83A 3A86A 4VGCC 1Z71A 4XSKU 4WWYA 4NSVA 1SB1H 4DT7B 1ZLRA 1UO6A 2KAIA 3LGTA 1FONA 3UR9A 1S85A 1CT2E 2W5EA 3BEIB 4UE7H 1G37A 1C9PA 1GBHA 1S6FA 1TMTH 1ZZZA 2PGBB 2BXTH 1QL7A 1LPZB 2R3YA 1KDQA 1P11E 1HAVB 1THPB 3STJA 1O2TA 1YF4A 1BUIA 1SMFE 2F3CE 1GHXH 3F0OA 2ZF0H 1ANBA 2BD2A 4CH8B 1OP8A 1YM0A 2HVYB 1FY4A 1WV7H 5EPYA 2W6JD 1TYNA 2ZEBA 3UREA 3SJIA 4GHQA 4WMEA 4CRGA 4DY7B 1NZQH 2AMDA 2RDEA 1GWAA 1KMHB 4TY7A 1O2RA 2IJOB 2QF0A 3H5CB 3ODDA 3FP6E 3OTJE 1YPHE 1BQYA 2FS8A 2XC4A 3LH3A 4OS5A 5CDFE 4LZ4B 1V2OT 1L0ZA 2CV3A 1G2LA 4B74A 4FUJA 3MO6A 2Q6DA 5JBAS 3EDXB 1ACBE 1O3FA 4FUFA 2HNTE 4B6EA 1KDQB 3WWFA 1C1NA 1K1IA 1PFXC 4CRBA 2ZG0H 3PLPA 2VWMA 3QK1A 1MKXH 3RXMA 2Q6GA 2C90B 3SZNA 3C27B 3F2GA 4BOHA 1GPZA 1COWD 2THFB 2ZFFH 5A0CA 5A8ZA 4WXVA 4B2CA 1TX7A 2O8LA 1QURH 4XFQA 4YOGA 4H42U 3SORA 2D2DA 1KXBA 1Y3YA 1MZDA 5FBEA 1JRSA 4XBCA 4ZHMU 4KTSA 5H4IB 3U69H 3SU3A 2C3SA 2W6ID 4Y7AA 3TPIZ 4OS1A 1K0HA 4CBOA 4B73A 1TNIA 3RXHA 4ZROA 1HAYB 3SJOA 1P04A 1YWUA 1ZHRA 3Q3KA 4ZH8A 4Q63A 1AWFH 1LDTT 2XWBI 4ACAA 1HB0B 1YPHC 1P05A 2W7UA 4Y6DA 4A1XA 3ZZ3A 2GVFA 4TPIZ 3KQ5A 1SHHB 1ZGIA 2FDAA 4MPUA 1FI8A 1QB9A 2HNTC 2OXSA 1OYTH 1TBZH 2FS9A 3O8BA 5A8YA 2ZHQH 3ZYDA 1IQMA 1GBAA 1S6HA 4TY6A 1ZSKA 4BNRA 2FP7B 1GHVH 1RTFB 1F2SE 2FTMA 4B76A 1SC8U 1SSXA 4A1VA 1HAPH 4I31A 1O3DA 2GT8A 1GVLA 1YY3A 1E37B 1YCPK 2BY5X 3F1SB 2ZFPH 3RXTA 3KGPA 1W10U 4K2YA 5EW1H 1YPJH 1ANEA 4WXIA 2GMTC 2XCFA 4K69A 2J9NA 2RG3A 1LPKB 2VU8E 2XXLA 4YESB 1BRBE 2G5VA 2ANMH 2K8IA 1OYQA 4KELA 5FPYA 5F8TA 5HMAA 3SU6A 1BMFD 4UD9H 3PMAB 2H9HA 1C2FA 1PQAA 5KGOA 1P3EA 2A4GA 1FLEE 1HJ8A 2ZCHP 3MO3A 5KECA 2AEIH 5EG4A 5C94A 1FPCH 1L2EA 2XNDD 3A89A 2FOFA 6CHAB 1SGTA 1VJ9U 3GCHC 3RXBA 1C5OH 2WPJS 2J2UA 2Z94A 3HKJB 2QF5A 1V2PT 3FZZA 1O34A 4WH6A 3E0NB 2GCTC 2XYAA 2OK5A 1D6RA 1GI0A 1Z6JH 2ODYB 3ZZ8A 4AG1A 3BTQE 1O2SA 1O3AA 1TRYA 4CRFA 2HRVA 1C1MA 1WAYB 1TGNA 2K0QA 3RXUA 1VJAU 4H6SB 1QCPA 1TIOA 1HAHH 1G3EA 1G3CA 1WXRA 4KTUA 1BOQA 1GHWH 1SHYA 3C1KA 1ZSJA 1ELCA 1MU8B 4A5TS 2GX4A 2QGRA 1QRWA 1O2ZA 7KMEH 1DUAA 1EPTC 1EAXA 3N7EA 2ANKH 2FI5E 4K8BA 2QN5T 4BXSA 1BBRK 3FP7E 1NS3A 3KQDA 3Q76A 1FY1A 2Z9LA 2XTTB 3ZZAA 2ZDNA 3H09A 4YZUA 2VIDA 4NIYA 1DUEA 2Y5GA 2WHXA 3KQEA 2BXUH 2RCEA 1P02A 4D7GA 1CSOE 1ELFA 1YPGH 1Z8RA 1ZR0A 3UOUA 1QNJA 4D9QA 5C1XA 1GHZA 1MKWK 1D3DB 1XKAC 3BV9B 2HVXA 2YMSD 1S6LA 2A4QA 4TWWA 1MTVA 2D8WA 3GY5A 3SBKA 2ZFTA 2Y5HA 3PV2A 5DP8A 3ZZ4A 1A4WH 5C2ZA 1QQUA 2L74A 4ABEA 2JIZD 2H9EH 2G52A 2ZGCA 2V35A 3DCLA 3ESTA 3RXPA 4ABIA 1JIRA 3WWBA 1GMHG 3ZZ9A 1K2I1 1EUFA 3GISB 1H9IE 1DE7H 3F2FA 1XVOA 3FFGA 3QN7A 4ZKOU 1F0TA 2GDDA 1FY3A 3LIWA 4RI0A 4O03A 4DT4A 2EEKA 4JZDH 3PLBA 5FHTA 5HM2A 3MNBA 2F9BH 2AMPA 1L1JA 3UAIC 4WJG2 1CT4E 1T7CA 1C1VH 1RTLA 1WQVH 1UW7A 5DP9A 2AGEX 2WYGA 1GI5A 4X1QU 2ZA5A 4MNYA 5E2OA 5EW2H 1OPHB 1ABJH 2BQ6B 3HGPA 3RC5A 1QB6A 3P6ZB 3CP7A 1ETTH 1O3IA 5DO4H 5A09A 2H5DA 4NZLA 1GMCG 2QC2A 2B8OH 1BBRE 3ZV9A 3KCGH 9ESTA 1O35A 2FOAA 1GDUA 1O2MA 5DP5A 2J95A 1ELEE 4MPVA 1EOJA 1TONA 2VGCC 3NK8A 3VB3A 3PTBA 1G3DA 1SGIB 1KYNA 1SKYE 1BTZA 1SLUB 1UK3A 2QF4A 2R3UA 2YMSB 3Q3YA 4LOYH 3OU0A 3D65E 4FXGH 2C4FH 2V6NA 4OM9A 3OY6U 1UVSH 3RXJA 1YLCA 2OLGA 1FAXA 3A8DA 3UTUH 3Q3XA 1ELGA 3MHWU 5A8XA 4CHAB 1NU7B 1C5RA 3SJKA 3ZZCA 2TRMA 1JIMA 1C5NH 1GGDB 1HAZB 3LT3A 3MH7A 2G8TA 1AZ8A 5HM9A 3S0NA 1CE5A 4K60A 1C5TA 1BHXB 1SL3A 5E2PA 3ZZ7A 2OP9A 1YLDA 2OBQA 2P93A 1VZQH 1XUKA 1Y59T 8KME2 2ALPA 1AWHB 4INKA 3VPKA 1GMHF 1W14U 1LHCH 2SNWA 2XRCA 1G9IE 1ANCA 1JMOH 1A0HB 3RXVA 1OWIA 2JJ2D 1ESTA 2EI7A 1GJ9B 3LU9B 1PPEE 1NT1A 3RXKA 1A1RA 2ZDMA 1TNHA 5IDKA 3V13A 4WMFA 2P3UB 1C2DA 4UFDH 2H6MA 2R2WU 3BIUH 3F6UH 1TWXB 1P0SH 1ZPCA 3ATKA 2HLDD 1VITG 1FIZA 3RLYH 3TH2H 1H8HD 3ODFA 5EODA 2QXGA 2VBCA 5C1YA 4NZQA 3AK5A 1LTOA 3B9FH 1DDJA 5GPIB 4E06H 1P12E 2BLWA 1GMCF 1NU9A 1H1BA 3L33A 4TYDA 1Y5AT 4ZKRU 1N8OC 1VR1H
chains in the Genus database with same CATH topology
2XC5A 1HXFH 2GV6A 2Y5FA 3M61U 5EXNA 1C1WH 2I6QA 3OX7U 1N6XA 1O37A 1QJ7B 4MPWA 1J14A 4B2BA 4BTTB 3KEEA 1QRXA 3T62A 3VEQB 3MWIU 1V2ST 1P57B 1FQ3A 1O3HA 3LJJA 2BZAA 2TGPZ 2PKSC 3E0PB 1ABIH 4INLA 4I8KA 3TH3H 1BTPA 3SNEA 3S9CA 1IQJA 4ZUHA 3TJVA 1CA8B 1O5AB 2O8TA 1AQ7A 3WY8A 2FZZA 5JB9S 1P10A 1AVWA 1GBCA 1CBWB 1GJ6A 3QLPH 2EC9H 4Q7YA 1XXFA 1GDQA 1RTKA 5DGJA 2FEQH 2BD3A 3BG4B 1B0EA 1GBJA 4JYVH 1VGCC 3A7ZA 3NUMA 3VGCB 3GY4A 3HK3B 2UUFB 4OS2A 1WOFA 3ATLA 1DS2E 1LHFH 3ZZBA 2H9TH 5EOKA 1SG8B 5BRRE 4AFZA 1AIXH 3W95A 3ATIA 1VITF 1CT0E 3QUMP 3F9GA 1F5LA 4A6LA 2BDBA 4NA9H 5BPEA 5I25A 3NZIA 1GI3A 4LXBH 3MYWA 2P94A 1A61H 2BQWB 2STAE 2FOGA 1F0RA 2WPKS 4IN2A 2R0KA 1FV9A 2P59A 1EZSC 5J4SA 3SU5A 1ESBA 1NRSH 2GGVB 4ZAEA 2TIOA 1D3PB 1C5PA 1BJVA 1TNKA 2G00A 2ZDLA 1P09A 1F5KU 1UTMA 3I29A 2J4IA 1TAWA 2JETB 1FIWA 1K1MA 3QZRA 3V0XA 2SFAA 2CF9H 2ZHDA 1ETRH 2BLOA 2BLVA 3S9AA 4FVBA 1C4U2 2AFQB 1O5CB 1UTLM 1TMUH 1MBMA 3P8FA 1W13U 2ANWA 3N7OA 3URCA 3BN9A 3MNSA 1EX3A 1ZRKA 4F4OC 1GI6A 1ELDE 2O9QA 4MQAA 4H4FA 1K1JA 2ZFRH 1OWEA 3VB6A 1BMAA 3K6ZA 1FNIA 2G4TA 1QR3E 1RIWC 2BTCE 1T4VH 1VITH 4RKJB 2FOHA 1O2WA 2ZU4A 3L3TA 1KXEA 8GCHG 1C5VA 1KLIH 1O2XA 1TQ7B 3FZDA 3DFLA 2QY0B 1T31A 2Q6FA 3L6PA 1P03A 3F9EA 1V2WT 2HLCA 5EQSA 3M35A 3KQCA 3PM3A 1NM6A 4ISNA 5C1UA 1WCZA 1S82A 5TCCA 2NWNA 2FI3E 2WUBA 1CA0C 1AKSA 1TBRH 2UWPA 1DY9A 3IITA 1XKBC 3UQVA 1EB1H 1BB0B 1TGSZ 2P3TB 3RXEA 1E35B 3STIA 1P2JA 4E7NA 1DM4B 5K0HA 1AFQB 1C5LH 3PO1B 1NY22 4YLQH 1O3OA 3M36A 3HK6B 1UTJA 2FX4A 2IN2A 4D76A 3BEUA 2ZFSA 3K65B 1B5GH 1A5HA 1QGFA 2BD7A 1UTKA 1KTSB 3NKKA 5T6DA 1GCDA 4K8YA 2AYWA 1ZJKA 1BZXE 5FPTA 3SO3A 4YOJA 2RA0A 1BT7A 1D3QB 2UUKB 4HGCA 5E8EH 1SOZA 2CHAB 2M5TA 2XBXA 2BD4A 2BDYA 1V2JT 4U30A 4AB8A 1S5SA 1O3CA 2K1QA 3EQ0H 3LOXA 1OXGA 2ZKSA 4KGAA 3M7TA 1GBIA 2A31A 4AZ2B 2ZGXH 1FAKH 4KKDA 8GCHF 3FVFB 1AE8H 3A7TA 2AGIX 3ZVCA 2G55A 2BDCA 1DY8A 1O2PA 1ELTA 4X1NU 2VB0A 5L2ZH 3MU1A 1DITH 4YM9A 2A2XH 3TGJE 4GCHG 2FESH 1GG6B 1IQKA 3AW1A 4Q7ZA 2DE8A 4NFEA 2NU0E 3SN8A 2C8YB 1ARBA 3RXOA 1CGHA 4NSYA 1BRCE 1JRTA 3UQOA 2LPRA 5E0JA 1EOLA 1ZMJA 4MVNA 3RXIA 1ZYOA 1ZHPA 5F8XA 1IQEA 1MCTA 1K28D 1GJDB 1IHSH 2FWWA 3I78A 4LZ1H 1LQDB 4HI3A 3MO9A 1C2EA 1FN6A 1TOMH 4B71A 2J38A 4DCDA 1K1NA 5FX6A 4ZKSU 3RXQA 3VB4A 2FLRH 3UY9A 1KXFA 1UTQA 1GBFA 1BJUA 2ZCKP 1TB6H 1K1PA 3DFJA 2NU3E 1TGTA 4K5ZA 3E16B 3HATH 3M3SA 1E36B 1EXFA 4MNVA 4I8GA 3EYDA 3MTYA 2SGQE 1BTYA 2H5CA 1W3CA 4B1TA 4CR5A 1O3PB 3GYLB 6ESTA 2C93B 3EAJA 2PTNA 1SFQB 4KTCA 4BANB 2RDLA 4JK5A 4FUIA 3OY5U 2P3FH 2J94A 1WTHD 2QAAA 1O2LA 2Z3EA 3JZ1B 1NFXA 1O2YA 3SUFA 4ZMAH 3IG6B 2QA9E 3QGNB 4UFEH 4AFQA 2QCYA 1MD7A 1TRNA 4FUGA 1KSNA 1ZTKA 4ESTE 1CVWH 1HNEE 4GCHF 1GJAB 1C2GA 1NO9H 1PPGE 1AE5A 2HOBA 1BMLA 5DJ7A 3SHAH 5T6FA 2NU2E 1JWTA 2AMQA 4AGJA 1K1LA 1UHBA 4ASHA 2XBYA 3PWCA 1PPBH 4GHTA 3QDZB 4NFFA 2BDGA 2PKSB 1Z8GA 3E90B 2BLQA 3RMMH 3K9XB 4JZFH 3AAUA 5F8ZA 4PROA 3TIUA 5DP4A 4JZIA 3SI3H 2Y7ZA 1AN1E 1A0LA 1ZTLA 2F9NA 4Y79A 3U1IB 3ATMA 2GZ8A 3U1JB 4B75A 3SV8A 5JBBS 1BMMH 1HUTH 2GTBA 2C8XB 4NWKA 2JH0D 2QF3A 3TK9A 1K9OE 1GBDA 1ZPZA 1IQNA 1EQ9A 2C8WB 1C4Y2 1UHBB 4UONA 1O33A 1Z1IA 5C5OA 1O2VA 1V2VT 4AORA 1HJAC 1YCPH 2BD8A 1PPCE 3SU0A 3T5FH 1HDTH 1ELBA 5ETXA 4IC6A 5AFZH 4Z0KA 1FPHH 1EATA 4WF8A 2FI4E 5LPEA 4RSPA 3A82A 5E0HA 1WYKA 2F9UA 2XC0A 4SGBE 1A3BH 2SNVA 2GCHG 2BDHA 3QZQA 4X0WU 5L2YH 1SGEE 1CGIE 2BD5A 3VXFH 1K1OA 3TITA 2OQUA 1TMBH 3TK5A 4DW2U 3DT0H 1SI5H 1NN6A 5G4BA 5DP3A 1AB9C 3RXSA 3I77A 4O3TA 4I8JA 5CHAB 4CRAA 4K3JA 1YP9A 4WY3A 2WPMS 1QL8A 3TNSA 1JOUB 1EP6A 3UNRA 1P2IA 1PPFE 4NA7A 2PLXA 2B0FA 2F9VA 1FZZA 4X1SU 3SHCH 1HYLA 3PMBB 3RXLA 2F83A 2ZQ2A 2ZGBH 4AYVB 4Y8XA 5DKMA 5AVDA 4ABAA 3A80A 2CF8H 2A5IA 5JDUB 1V3XA 2P8OC 3RXFA 1YPMH 3LGUA 2Y81A 1EP5A 3E8LA 4MLFB 4NA8A 3ZVDA 3A7WA 1W0ZU 2WV4A 3LC3A 2J34A 1SLVB 3H7OA 4HTCH 2A45B 3SU1A 3T29A 3SQHE 1IHTH 3GY7A 3BF6H 4Y10E 2F9OA 2TPIZ 1NRNH 3SJ9A 3DD2H 1HAOH 3LGVA 3U8RH 5EQQA 2PHBA 4WVPE 4MNWA 3HKIB 1WQSA 2Z3DA 1BBRH 1OKXA 1E0FD 1EKBB 3MU0A 1P2OA 2ZU1A 5FCRA 1C1TA 1GI2A 3M5OA 3UOPA 3BTTE 2A4OA 2VIPA 4JZ1A 2W26A 4FU7A 2A32A 2FO9A 2BY7X 5LGOA 1TX8A 1Y3UA 1BRUP 1FMGA 2RA3A 2ZHEH 4GUXA 4Y0YE 1MKWH 1V2QT 4ISIH 4D9RA 3MU4A 3AW0A 1YKTA 4O3UA 1XUFA 5FBIA 3GCTG 3GY6A 2ZDAH 4BAMB 4AOQA 3MI4A 2ASUB 2ZHWH 1TNLA 3SU4A 3H7TA 4BXWA 2STBE 3RC6A 1EAWA 4JK6A 1P01A 2A5KA 3MH6A 5ESTE 2I6SA 1D6WA 1HGTH 4FU9A 1SGNE 1C2IA 1TNGA 4I32A 1ZPBA 1UK4A 2SGPE 3PV4A 4CRCA 3PTNA 2YOLA 4AFUA 1O5GH 1LVOA 1O3NA 5TCAA 1F7ZA 3M5NA 3P8GA 1IQIA 3D23A 4GAWA 3A88A 1DXPA 1MBQA 3PLKA 3UPEA 4GPGA 2O8WA 1SGFA 1MTUA 3SV7A 1Z8IB 4VGCB 1BRAA 1HCGA 1MTNB 2FXRA 1UCYK 4AFSA 1NROH 2YNAA 3P70B 2OC8A 1LHGH 1C2MA 1LKBA 2D26C 4Z6AH 1UVOA 1LMWB 1CQQA 1P2MA 4Y76A 3G01A 6LPRA 1TGBA 4BTIB 4X8SH 5F03A 2BVXH 3O8DA 1IQHA 2NU4E 1A7SA 2BDAA 2FYRA 1J16A 1T8OA 2ZO3H 1P2KA 3GCTF 1YCPM 4OGXA 1DSTA 1LVMA 3Q77A 3MNCA 1ZOMA 2GD4B 4ABGA 4Q7XA 1GCTC 4DGJA 1TOCB 2GV7A 1GBEA 2CGAA 3OSYA 3CENA 1DLEA 1P9SA 4B2AA 1AD8H 3UR6A 1YGCH 4JYUH 1C1QA 1X7AC 3LJOA 4DVAU 3PROA 1DLKB 1ESAA 1CHGA 1PYTD 3V3MA 1FJSA 2ZDKA 5FAHA 4CRDA 1GBLA 1TPAE 1SGPE 3GCNA 1CU1A 1O36A 2GT7A 1B0FA 1B7XB 1UCYE 3RMLH 1OWKA 1YYY1 3V12A 1AVGH 5EPNA 4M7GA 1MZAA 3SV9A 1OP0A 1OS8A 3S9BA 4NIVA 1ZHMA 3VFEA 3RXDA 4OGYA 1MTWA 4MDSA 1C2LA 1SQAA 3BTDE 4I33A 1V2LT 1QJ6B 2QXJA 4IC5A 4YOIA 4YLUA 4FUHA 1HIAB 1AUJA 1FY8E 1SR5C 3M37A 1C5YB 3BTHE 5FXLA 1N1LA 5C67A 3TLOA 2F91A 4K1SA 5IYTA 3A85A 4BAHB 1GVKB 2WYJA 1AFEH 1Q3XA 4X8VH 7ESTE 1O5FH 1OWHA 1DOJA 1QQ4A 1YC0A 2AIQA 1MQ5A 1MD8A 1Q2WA 2GZ9A 1RS0A 3GDSA 2VIWA 1XX9A 3P17H 1DWBH 3RDZA 2VNTA 2GMTB 2OC0A 4YT7H 1H8IH 2V0BA 3P8OA 1XM1A 1TALA 5GJ4B 1L1GA 3BTFE 3SI4H 6CHAC 1ZTJA 4UDWH 4J2YB 2Z9GA 1O2IA 1W11U 3QO6A 1K21H 1UK2A 1KLTA 3P8NA 2OQ5A 2VWLA 4D7FA 2ZNKH 1JXPA 4R8TB 3ZVAA 1C5UA 4DOQA 2ZHFH 1H8DH 1HJAB 4Y71A 1VCPA 3GCHB 3F9FA 2WV5A 3LGYA 4X2VA 1KXAA 1L1NA 4CR9A 3F68H 3MH5A 1EJAA 2GCTB 1HRTH 2Z6BD 2PGQB 3BG8A 3EA9A 4Q80A 5HXFA 1FUJA 1O3BA 1C4V2 1SGCA 2DUCA 1OP2A 5ESBA 2JH6D 1T4UH 1Y3XA 1T8NA 1XUGA 5AFYH 4X6OA 5DP7A 5HYOA 3NCLA 1GDNA 1VCWA 1O32A 2VINA 2V3OH 1HAXB 2SGEE 1TABE 1XUHA 1ZGVA 1CHOG 2VWNA 1KIGH 1KY9A 1UTOA 3EGKH 1NRPH 3FP8E 3RMNH 7GCHG 1EPTB 4GVUA 1MMJN 1O0DH 2QIQA 1HFDA 2ZC9H 3ZVEA 3RU4D 2ZTYA 1EJMA 2WUCA 1SGDE 5GWZA 4ISLA 2PW8H 2C8ZB 2ESTE 1DANH 1AHTH 1A3EH 1TA2A 3SGAE 4U2WA 1MH0A 2W3KA 3T25A 2DE9A 1C5QA 1Y3VA 2OCVB 4DIHH 1GJ4H 1T8MA 3A81A 3TK6A 1MCVA 3AASA 5FX5A 4R0IA 2VIQA 1S0QA 1N6YA 1NESE 2FMJA 3LKWA 2O8MA 3ZZ6A 3T28A 3BTWE 4I8HA 4TPYA 5F6MA 2ZU3A 1C2HA 3A87A 2A1DB 3ELAH 2ZGHA 4X2WA 2QXIA 3M5MA 1GHAG 3RP2A 2ZU2A 3W94A 1HJ9A 2AS9A 4FU8A 1UMAH 1XUJA 4ABHA 4Q2KA 3KIDU 3CS7A 3SV2H 2B7DH 2R0LA 1JBUH 1O39A 4IW4E 4NGAH 1BA8B 3RM2H 2BHGA 1Z8JB 2ZWLH 1LCYA 1T32A 1THSH 2BOHB 2HWLB 8LPRA 1NC6A 2XW9A 3RXAA 1TA6A 1F5RA 2HALA 1CHOF 4WMDA 4ABFA 1ELVA 2ZDVH 2BY9X 2WINI 2WPIS 3KQBA 1O2JA 7GCHF 1XUIA 1OSSA 5GCHG 3GDUA 2HPPH 2TGTA 2VGCB 4KP0A 3FANA 3PYHA 5L30H 4CHAC 5SGAE 1UVUH 1GGDC 1C1OA 1C2JA 4JMYA 1SGRE 1LQEA 2A0QB 2PR3A 1THRH 2G51A 4TWYA 4ZKNU 2Z9JA 1C9TA 1YPEH 1KXDA 2BOKA 2XBVA 1MKXK 3V7TA 3GY2A 2ODPA 7LPRA 4FVDA 1SLXB 1DWDH 4IGDA 1Z1JA 2PUQH 2UWOA 1HV7A 4U01A 3GY8A 1GHYH 1GHAF 1GI7B 1S84A 2V3HH 3P92A 1O3KA 4BTUB 2KAIB 3SU2A 4DIIH 1XVMA 4IS5A 1O3LA 3TH4H 3NXPA 3M7UA 4X1RU 3SW2B 1BCUH 3KHVA 1XXDA 2A4RA 2IPHA 2FLBH 3BTME 3SNDA 2P16A 2ZTZA 4I7YH 1GI4A 2BY8X 2QV1A 1V2TT 4MNXA 5T6GA 2FODA 3SUDA 3A8BA 4RN6A 1SGYE 2VVUA 5C5NA 3MMGA 1IAUA 2AIPA 5ABWA 5DPAA 2ULLA 4UFFH 3T2NA 1GCTB 1W12U 1O3JA 5GCHF 1H9LB 1AVXA 3ENSB 1LPGB 2Y7XA 1N8OB 2XBWA 5EU8A 5JPMH 1P06A 1QY6A 2JH5D 3B23B 3NPSA 3F9HA 1FY5A 3ITIA 4ZXYH 3TJOA 4XE4A 1J15A 3TJNA 2GZ7A 1F0SA 3VB7A 1O2HA 5JBTA 1CBWC 1AU8A 2J92A 4A7IB 1HAGE 1G3BA 1GBTA 3QGJA 3M7QA 3SJ8A 2ZZUH 3BG4C 3BEFB 4Y8YA 5FPSA 2BQ7B 3RUOA 3ZVFA 5EXMA 3S7HB 2BYAX 4LK4A 3VGCC 4MG3A 3QX5H 1S0RA 1D4PB 1Y8TA 2BD9A 1IQGA 2BX4A 1P2NA 4RKOB 1SOTA<