1SGFG

Crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
237
structure length
232
Chain Sequence
IVGGFKCEKNSQPWHVAVYRYTQYLCGGVLLDPNWVLTAAHCYDDNYKVWLGKNNLFKDEPSAQHRFVSKAIPHPGFNMSLMFLEYDYSNDLMLLRLSKPADITDTVKPITLPTEEPKLGSTCLASGWGSITPTKFQFTDDLYCVNLKLLPNEDCAKAHIEKVTDAMLCAGEMDGGKDTCKGDSGGPLICDGVLQGITSWGHTPCGEPDMPGVYTKLNKFTSWIKDTMAKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor
molecule keywords NERVE GROWTH FACTOR
publication title Structure of mouse 7S NGF: a complex of nerve growth factor with four binding proteins.
pubmed doi rcsb
total genus 49
structure length 232
sequence length 237
chains with identical sequence Z
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfG02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1sgfG01
3ZYDA 5AFZH 1BIOA 1GHAF 1MKXH 4NCYA 1PPFE 4XFQA 1SLXB 1J16A 4YT6H 2RA3A 1LHEH 3OY5U 1F7ZA 3SGQE 1UTOA 4I8LA 1XXDA 1AGJA 1EASA 1DITH 1P57B 2KAIA 3ZZCA 2NU3E 1C9TA 2ULLA 3M5OA 2C4FH 3ELAH 4DCDA 1HGTH 1SC8U 1NU7B 2XYAA 3DUXH 1O3CA 2BXUH 1EOJA 3OX7U 1O3JA 3M3SA 4U2WA 3SU2A 4FUCA 3P8OA 1A3EH 4TPIZ 2Q6FA 2WUCA 2O8UA 2ZQ1A 2B7DH 2C93B 4YESB 3TVJB 1TWXB 4B75A 3KF2A 1NPMA 1ELFA 1C1RA 1C5VA 3M7TA 1P02A 1J9CH 3SU3A 1PQ7A 1FY3A 1ZTJA 2J2UA 1DWBH 2PKSC 4DG4A 4A92A 1BJUA 5TCCA 1P11E 2G5VA 2G00A 3LIWA 1Z8RA 1GDNA 1MTSA 3RMMH 3PMHB 1TRMA 1GBLA 1QURH 3LPRA 2HPPH 1O36A 3ZVGA 3TH2H 1INCA 2FOFA 4I8GA 2Y82A 1T7CA 1H4WA 1TNJA 2B8OH 3A82A 3TNSA 2RCEA 4UONA 3BF6H 4ISIH 1AHTH 3ZZ6A 4NZLA 3BV9B 1SQAA 1C1UH 4RN6A 2FIRH 1PQ5A 3GY3A 3OSYA 5EODA 5HM2A 4I31A 5FX5A 2EI6A 2A5IA 3O8CA 2HNTE 2A2XH 2STAE 1TABE 3F9HA 3UNSA 4UE7H 2XWAA 4X6OA 1YPLH 1NRRH 1MU6B 2HVXA 1O2WA 3DA9B 2PV9B 4SGBE 1C5XB 4B74A 1UTJA 1BTHH 1D6WA 4D7FA 3SNEA 1LKBA 4GHTA 1K21H 4IMQA 3BTQE 3IG6B 2CXVA 4MPWA 2JETB 4IC5A 1ETSH 3ATIA 1FONA 3D23A 1N6YA 1SBWA 6ESTA 3RM0H 1G3DA 4Q7ZA 2R3UA 2CF9H 1UTQA 1DICA 3FZZA 2ZIQH 3HK3B 2EA3A 1E34B 1D3PB 1TRNA 3URDA 2VU8E 4LOYH 4NA8A 1MKWK 3A87A 5HM9A 1UMAH 2BMGB 3GCNA 1O5DH 2F9NA 3GDVA 3SQHE 2BOKA 3KGPA 3SI3H 1YLDA 2ZTYA 1FY5A 3L6PA 4FVDA 1N6XA 2RDLA 3LGYA 4NIXA 1GWAA 3PO1B 3BG4B 1P03A 4X2YA 1CHOF 1EB2A 2VIPA 2AIQA 2IPHA 4JZFH 2BLWA 1MH0A 2Y6TA 4X2VA 1HUTH 2XCNA 3U8RH 1O5EH 1GBJA 1SLUB 1KXAA 1YGCH 1TNGA 4O3UA 1ID5H 2ZFSA 2ZPRA 5ESBA 1HV7A 2GD4B 4X1SU 4GPGA 1THRH 2G8TA 5BPEA 1MZDA 1YC0A 4NWKA 3Q3XA 1ANEA 3HGNA 3QN7A 1OP0A 2P94A 1GCTB 4X8UH 1O3NA 4ZHMU 5FPYA 3T5FH 2R9PA 2V3HH 2XW9A 2NWNA 1P09A 3H5CB 5C3NA 1TPOA 4OS2A 3VEQB 1XM1A 3SHCH 2VIQA 4Q7XA 3ZZ5A 4AZ2B 1PYTD 1FZZA 1K1PA 4MTBA 2PSXA 1EX3A 2G4TA 5GIBA 2HALA 5EQSA 3O8BA 5C67A 1MMJN 3SHAH 1BA8B 1JRSA 2BX4A 2FOMB 4AG2A 2VVVA 2UWLA 4AORA 2FYQA 2Z9IA 2FX6A 5HGGA 3K6YA 1EZSC 1KXFA 1M9UA 1EQ9A 4Y71A 1MAYA 3PLPA 4ZAEA 1O3EA 3M3TA 5LPRA 1GI6A 3LDXH 3ZZBA 2W3KA 2Y81A 2XBVA 3GYLB 3ATLA 1WTHD 2PR3A 4ESTE 1ANDA 1ARBA 1O34A 3GCTF 4WMDA 5IDKA 9LPRA 3P95A 2FXRA 1TMUH 3UTUH 1AY6H 3KQCA 5AF9H 1P9UA 3QDZB 3OU0A 3TJUA 3UR9A 1YPHE 2CHAB 1CT2E 4ISLA 1ZMNA 2PKAA 3GICB 4IC6A 1TE0A 4FU7A 5C1UA 5E0GA 4MPVA 2QXHA 5EXLA 1GJ5H 5DP9A 5C2ZA 1V6DA 1CA0B 1NFWA 1K1NA 1YCPK 1TIOA 2XBWA 8GCHF 5JBTA 4DVAU 5DK1A 2LNCA 3SU1A 1P06A 2VH0A 4CHAC 2GGVB 4AG1A 3U9AH 1O2KA 3TLOA 1KYNA 2A45B 4YM9A 3UUZA 3UFAA 1GMHG 5A09A 1UK4A 4ZUHA 1IQIA 1NFXA 1L4ZA 1FDPA 2ODQA 1C2LA 4IMZA 1AE5A 1NRSH 3A85A 1BTWA 2FOBA 4AN7A 1VGCB 1TOCB 4GAWA 3HKJB 3ZZAA 1NTPA 4B71A 1TX7A 1C1NA 1C2DA 4FUEA 3T29A 1UHBA 2BZAA 3P70B 2A31A 3LH1A 3H7OA 1NC6A 2EI7A 5L6NH 1ESAA 1GI2A 2BLVA 3MU5A 2QIQA 1VITG 3O8DA 1FV9A 3ZZDA 2BOHB 3U1IB 4X8TH 1O3PB 4UFDH 1G2LA 2A5AA 2F9UA 3G01A 3W94A 1V2QT 1P12E 4Y7BA 4ZKOU 2DE9A 4AYVB 1GHXH 4X1QU 2BVSH 4IN1A 3GY2A 1TGNA 2BD5A 2HOBA 2IN2A 2O8LA 1HAHH 1A1RA 4MVNA 5GDSH 1S82A 1VITH 2VIDA 2WV4A 5EW1H 3BG4C 5K0HA 5LPFA 5HYOA 2PUXB 2Y5HA 1IAUA 2FTLE 1OX1A 1GL1A 1WTGH 2F3CE 1C1OA 1J14A 4ABFA 2BXTH 5IYTA 1UTPA 2VWLA 3M7UA 5T3HA 1DWCH 1CBWB 2ALVA 1AE8H 3Q3YA 2ZHWH 1HIAB 4I7YH 2SGPE 3S7HB 1YM0A 2BD2A 3PWBA 1HB0B 1DLEA 1SMFE 1EJMA 1GDUA 1QJ7B 2PWXA 1SGFG 3A7ZA 2AGGX 3VGCC 4WH6A 3RU4D 3K6ZA 4MDSA 1HAZB 2D1JA 7GCHG 3HATH 4D9QA 1W3CA 4HGCA 5E2OA 2VVCA 2VIVA 2AEIH 1O2HA 2BQ6B 2J38A 3BIVH 4TWWA 1FN6A 5EPNA 1LPZB 1HCGA 3RXDA 4BAMB 4DOQA 5DP7A 4ISOA 1O2VA 1G3BA 1HAYB 3C27B 6GCHF 2ZTXA 1DWDH 2HLCA 1NROH 1ZPBA 2ZFTA 4OGYA 3EGKH 1GHWH 2JH6D 4RSPA 2SFAA 2F9BH 2FDAA 4NSVA 5EGMA 2GZ9A 4WJG2 1YPJH 2OUAA 2W7SA 2QAAA 2VINA 2C8ZB 2GCHF 1VCWA 1PPBH 2Z3DA 1SB1H 2V0BA 5DP3A 1XUIA 1HFDA 2WPKS 4CREA 2ZZUH 3VXFH 1GI7B 1T8OA 4OGXA 1LHDH 3U69H 1NT1A 3MWIU 3MNCA 1AKSB 4XDEA 1GBHA 3V3MA 1CT0E 1U6QA 3SU6A 3LKWA 4BAOB 1E38B 3UNRA 1SGIB 3EYDA 4AOQA 5AVDA 2I6QA 4BTIB 1RTLA 3C1KA 3FP7E 5DJ7A 1WU1A 1AB9C 5A8YA 4MPXA 2OINA 3E90B 2WINI 1XUFA 2FOCA 1W7GH 2PKSB 2AMQA 2OD3B 3BTGE 4I32A 5FHTA 5DG6A 1P10A 4ZHAA 3SV2H 4XBCA 5DP6A 1NRNH 1IHSH 3RXIA 1SQOA 4BTTB 1DWEH 1GVLA 3A8CA 1DS2E 1GJ8B 2FOEA 4BTUB 2QF3A 4CR5A 3BIUH 3Q3KA 1ZPCA 3IWMA 2AH4X 2GT8A 1FNIA 3SN8A 1XVMA 1VGCC 1E0FD 2Y7ZA 1OWEA 1EXFA 2H6MA 3AASA 2CN0H 1ZHPA 1RTKA 4MG3A 2YOLA 2BQ7B 2SGAA 1K1LA 4E7NA 1ZRBA 1SHHB 2P8OB 2VNTA 3UNQA 2H2ZA 1GHAG 3S0NA 2Y80A 1TB6H 2VGCC 3TU7H 4WMEA 3PYHA 3ZVBA 1V3XA 5F8XA 5JPMH 3PV4A 1FPHH 1AZ8A 1BITA 1C1WH 1A4WH 4MNWA 1MU8B 2FP7B 1XUHA 1GJ6A 3LGIA 3RP2A 3GY6A 3UOUA 4WMFA 1HRTH 1DVAH 4BOHA 5ABWA 1GBBA 1VZQH 4M7GA 2XRCA 1C2KA 2J92A 3ITIA 1AQ7A 2FS9A 3SGAE 2GTBA 3SU4A 1ELDE 2ODPA 2NU4E 3A8AA 2GMTC 5HXFA 4OS1A 1CBWC 2BY5X 1GCDA 2Y5FA 1KSNA 1NY22 1C5OH 2ZHQH 2WPMS 4Y7AA 4GCHF 1QL9A 3LGVA 1CGHA 5DKMA 1TA2A 1K1OA 1OP8A 1UCYK 1HAXB 1N8OB 3SV8A 3ZVDA 3MU4A 5E0JA 1K22H 4KTUA 4X0WU 2ZGXH 2BDIA 1P01A 1LO6A 1O2GH 4KGAA 3E91A 3R3GB 2Z94A 3RLWH 1RRKA 2OBOA 1BB0B 2ANWA 1A61H 1EZUC 3LGTA 1SSXA 1F2SE 4NIVA 2JKHA 1TAWA 3GISB 4NWLA 3BG8A 1B5GH 1WV7H 1C5WB 2O8WA 3F9FA 1ZGVA 3QWCH 4ZXYH 3SJ9A 5GCHF 1FAXA 3V13A 3SUGA 1GBIA 2G5NA 2A1DB 1C5UA 1YKTA 1DT2A 3PTBA 1YPMH 2BDGA 5ETXA 1GBCA 1SQTA 3HPTB 3TIUA 1W10U 4A5TS 2BDHA 1SPJA 4LK4A 2HGTH 1EAIA 3UIRA 2BD7A 1V2JT 1SOTA 3PLBA 3MH4A 1HAOH 1OYTH 1JIRA 4Y0ZE 1YPKH 1KTTB 1ZRKA 2D8WA 2PFEA 3EE0B 1G2MA 1PJPA 2ALPA 2GP9B 1AWHB 2A4OA 3AW1A 4FU8A 2ANMH 1GVKB 1PPEE 4X8SH 5ESTE 2ZDLA 1HAVB 1ANBA 3GOVB 1LKAA 1DX5M 4NGAH 4GSOA 1QNJA 4AGKA 2W26A 1QBNA 3RXCA 1UJ1A 1TLDA 1TYNA 4Y0YE 7LPRA 3E6PH 2BZ6H 2H9HA 1OPHB 2ZA5A 5AHGH 1GHYH 2FOAA 3Q76A 1IHTH 1S83A 2XC4A 4UFEH 4ZHLU 1QFKH 4B2AA 2ZPSA 1A5HA 1KDQA 1EPTA 1P04A 2QGRA 3RC6A 2Y7XA 2UWPA 3SZNA 1JOUB 3ENSB 1ZTKA 1BTPA 1QBVH 3BTKE 1BMNH 1FY4A 1WQVH 1MBQA 1ZSJA 2FO9A 3EDXB 1FJSA 1ESBA 1CHOG 1G30B 2ZCHP 1O5FH 1O2UA 3CENA 3A80A 1PQ8A 2TBSA 4HI3A 2KAIB 1OXGA 2ZNKH 3PWCA 1B0EA 4U01A 3I29A 4IGDA 3UWIA 1IQJA 1H9IE 3FFGA 4FUBA 5L30H 2OTVA 1P2IA 3PLKA 1LHGH 1IOEA 1CE5A 3TK5A 3BTTE 4CHAB 4D76A 1NS3A 2BY7X 3SJ8A 1O3IA 3QK1A 4ABBA 1S6FA 2P8OC 1YCPM 2V35A 2G52A 2NU0E 1IQLA 4MPUA 1A3BH 5GXPA 1HJ8A 1W0ZU 2SGQE 2QCYA 1HJ9A 2W5EA 1BTYA 1Y3XA 1VCQA 1AWFH 1GMDF 1RD3B 1RJXB 3KHVA 1E36B 1D3DB 4FXGH 3AW0A 2VB0A 4U30A 1CSOE 2BD8A 2SGFE 1EAWA 1MD8A 3KIDU 2G81E 1C2JA 1TGTA 1TPPA 2Z3EA 3U1JB 4OS5A 2FMJA 2A4QA 4WY3A 3NCLA 4AB9A 2OQUA 3TJNA 3LC5A 4XOJA 1HPGA 5PTPA 1KIGH 1Q3XA 1W12U 3LJOA 1O33A 1QIXB 1V2TT 2FOHA 3FP8E 5CHAC 4I8HA 1MCTA 1MKWH 2VJ1A 3VFEA 1QB6A 4X1RU 2EC9H 1N8OC 2FI4E 3KNXA 2ZCKP 3K9XB 1V2WT 2FYRA 1O31A 3GCTG 1YPGH 4B76A 1O2LA 3VB6A 2P3UB 1SR5C 2A2QH 5DP5A 2IJOB 1RTFB 3QZQA 1O3LA 1TBQH 2AYWA 3FP6E 1S6HA 1O2MA 1LHCH 1G3EA 3RXQA 3M5NA 3LC3A 1Z71A 4YOJA 1XX9A 3M35A 4X1PU 4CRAA 1UK2A 5EQQA 5J4SA 4DURA 4E06H 1PPHE 2ZU3A 1BRAA 4UEHH 1JMOH 3MU0A 8GCHG 1GBFA 4BAHB 2AMDA 2WUBA 1C1QA 4MQAA 1OOKB 2QY0B 4K1SA 1UTLM 1O3GA 3RMNH 3VGCB 1F0SA 3K2UA 1V2KT 1Z7KA 1H8IH 1K1IA 3ODDA 3SNBA 1D4PB 1FQ3A 5JBCS 1C5LH 3KQBA 4GVUA 5A2MH 2CF8H 1C4Y2 2BYAX 2PW8H 4AGJA 3RDZA 1TX6A 3F9GA 3LONA 3E1XB 1WAYB 2J34A 2XC0A 1LPGB 1YPEH 2Q6DA 3ZVFA 3BTME 1THSH 3AAUA 2AFQB 1ELGA 1O3DA 2QF0A 3NZIA 1V2OT 4FVBA 2VIWA 1GI4A 2G55A 1RIWC 4XBBA 2BM2A 4ABDA 5DO4H 3EAJA 3CS0A 1NFUA 1O5BB 2F91A 2ZFQH 2WPJS 5C20A 4WXIA 1TX8A 4RKOB 4AFUA 4UFFH 2A4RA 3QX5H 4D9RA 1SGNE 5HMAA 2GV7A 3S69A 3T25A 1RS0A 1O2PA 2ZDMA 1RXPA 1OWIA 2H9EH 8KME2 3UQVA 1L2EA 3V0XA 2F83A 1O2QA 2ZDVH 3KQDA 4NA7A 4ABGA 3RM2H 1HLTH 1TGSZ 1W7XH 2AS9A 2HNTF 4YOGA 1J8AA 1ACBE 2BY8X 3FVFB 1Y5UT 3A8DA 1C1PA 4JZEH 3A7TA 2C8WB 4FUIA 4ABIA 1AB9B 3RXFA 1A2CH 2ZU2A 1Y8TA 3DFLA 3QO6A 4J1YA 1DANH 1YCPH 3PM3A 1XUJA 1AD8H 4DW2U 2EEKA 1WUNH 3UOPA 1ZHMA 1OKXA 4X6PA 1BRBE 4CBOA 1NRQH 1FIWA 1TNHA 3VB4A 2RA0A 1W13U 4BXWA 6LPRA 2DUCA 1GG6C 3F1SB 2XCFA 4AB8A 3SNCA 5GWZA 1EPTC 2QN5T 2YNBA 5FAHA 1QQUA 1VJAU 1BTXA 1SGCA 1W11U 3RXBA 3WY8A 1ESTA 6GCHG 2M5TA 1K1MA 1ELBA 1N1LA 3FANA 3P8FA 1UVUH 3M61U 4BAKB 4QT8C 1O3MA 1TBZH 1GMCF 3SW2B 2VGCB 1ETTH 4YLQH 1ZZZA 3SUDA 1TONA 2SNWA 2FTMA 2BD3A 3MYWA 2GCTC 4XE4A 1QHRB 4A7IB 1GI9B 1D9IA 3R0FA 4ZMAH 2OC7A 2GCHG 1C5MD 1SGPE 4D7GA 4X6MA 4YOIA 3ZZ7A 1OWHA 2ZDAH 1C1SA 1SGEE 1UVOA 1WOFA 3L33A 4JCNA 1H1BA 2Z3CA 1WCZA 2R3YA 3ZZ3A 5FBIA 2SNVA 1KXEA 2GMTB 3IITA 3URCA 1ZLRA 2B5TB 3ZV8A 1EB1H 1S84A 4NIWA 1O5GH 3GYMA 1F0TA 1MTNC 4JMYA 1EAXA 2AIPA 4F49A 4KP0A 5A0AE 3L3TA 3CS7A 3RXMA 1UHBB 4A1TA 2A7HA 3TJOA 2Q6GA 3QTOH 3PB1E 2QXIA 2DE8A 3OYPA 1XMNB 2ZC9H 1BBRK 1Y3UA 1IQNA 2TGTA 4UD9H 3ZZ4A 1O2NA 1O2SA 5C1XA 4MLFB 1AUJA 1AUTC 3SUFA 3RXHA 1HBTH 2ZQ2A 3PMAB 1J15A 4KTSA 1O3OA 3GY5A 4B2BA 2BDAA 1AKSA 4JK5A 1L1GA 1BCUH 3RU4E 1C5NH 5L2ZH 4JZDH 3D65E 3T27A 2ZG0H 2BD4A 2ZO3H 2FS8A 3RXEA 1Z6EA 4UDWH 3TITA 3LH3A 1OSSA 1ZOMA 3S9CA 4B73A 2Z9LA 2A32A 4J2YB 2I6SA 4CH8B 3JZ1B 1C5TA 4RKJB 2BVXH 2OC0A 4JZIA 4DT7B 2C8XB 3TNTA 1DSTA 1JXPA 1SLVB 2CGAA 4ASHA 2PHBA 4FU9A 1NESE 2CV3A 3NUMA 3BTFE 1G37A 1GHBF 1A0JA 2F9VA 1YYY1 1G36A 2PSYA 1SHYA 1Y3WA 3DFJA 2R2WU 3SGBE 1VJ9U 1TFXA 1EZXC 5DP8A 3AVZA 1ZTLA 5E2PA 1F0RA 4TY6A 1HXFH 2ZHFH 4AFZA 1C5SA 1Z6JH 3MO6A 3TGKE 1KLTA 4GCHG 1H9HE 3MFJA 1YF4A 4F4OC 1V2ST 1O38A 2ZFRH 3U8TH 1SOZA 3VB3A 1ZJDA 4MNXA 2HRVA 4MNVA 1TA6A 1CHGA 1GBDA 1SVPA 1A7SA 1UCYE 1E37B 2UUYA 5H4IB 1SG8B 1QTFA 1O30A 3ZVAA 1O2YA 1CT4E 5DP4A 3UREA 2ZU1A 1K9OE 3HGPA 1FXYA 1T4VH 1IQFA 5GCHG 1WQSA 3TK9A 1P9SA 1UVTH 2GDEH 1TRYA 4K8YA 1TGBA 1C2IA 3VB5A 1A0LA 3SU0A 4B2CA 3ATMA 4Y8XA 2VVUA 3A81A 3UWJH 5TCAA 4X6NA 5DPAA 1NO9H 2ODYB 4CBNA 1AO5A 4YLUA 1ZMJA 5K7RA 3GY4A 1OS8A 4VGCC 1YBWA 1GVZA 3W95A 5JB8S 5GJ4B 5A8XA 1XUKA 4Y10E 1H8DH 2V3OH 3A88A 2ZECA 3F9EA 3GCHC 4BNRA 1C5ZB 1O5AB 3MHWU 2HPQH 5FPTA 3ZZ8A 1UO6A 1D3TB 2R0KA 5I25A 4B1TA 1P2MA 1XUGA 1AZZA 3B8JA 1LQEA 4HZHA 1XVOA 2P93A 4H42U 2ESTE 1NZQH 4FUJA 1P2QA 3ZYEA 4TPYA 1FUJA 2BTCE 1BMMH 1GJBB 1GJAB 5CHAB 2TGPZ 3RXRA 3RC4A 1DDJA 2A7JA 1J17T 3M7QA 5C5OA 5F8TA 2HWLB 1CGIE 4FUFA 3T28A 1QL7A 5EXNA 5JBAS 2J95A 1GDQA 3QGJA 2J4IA 1ZHRA 1S0QA 1G32B 1UCYH 1W2KH 1MUEB 1EP6A 4ISNA 4JK6A 2Q1JA 1T8LA 2ZDKA 2ZWLH 4CRGA 1C2MA 1PQAA 4R0IA 3CP7A 4XBDA 3OTJE 3A84A 1TQ7B 1C1VH 3MH7A 4O97A 4OS7A 1ORFA 2PLXA 5EG4A 5DGJA 3KL6A 4Y11E 6CHAC 1TBRH 2BY9X 2FPZA 4D8NA 2OC8A 1GI8B 3RXLA 3SJOA 4NG9H 4IBLH 1KLJH 2BLOA 2GV6A 2O8TA 1GJ9B 1RFNA 2ZEBA 4ABEA 4HTCH 2STBE 1UTKA 2Z9KA 1HYLA 1EATA 1LVYA 4O3TA 2OLGA 2UUKB 2OCVB 3ESTA 5G4BA 1OWJA 1AFQC 5EOKA 1DOJA 1O37A 2UUJB 2GKVE 1V2PT 3M37A 4Q80A 3RXPA 1EOLA 1MKXK 1O2RA 4Y8YA 3A7YA 2BDCA 1SGFA 5TJXA 3NK8A 3RLYH 1GMDG 3ZVEA 2WV5A 4ABJA 4Z6AH 3O8RA 1D3QB 1ABIH 1JWTA 2FODA 1VCPA 2UUFB 5C5NA 1RIWB 4IS5A 1IQKA 1ZJKA 2GZ7A 1GBKA 3B9FH 2J94A 2FI3E 5EQRA 1L0ZA 1QGFA 1T4UH 2B9LA 3EA8A 4Y6DA 2HNTC 3KCGH 2WPIS 2QA9E 4TWYA 2IOTA 2ZP0H 1K1JA 1QRWA 1GGDC 4H4FA 1JBUH 4INKA 5EPYA 2SGDE 2H9TH 4YO9A 3MNXA 2QYIA 1C5QA 1O2JA 1QY6A 3VPKA 1MD7A 4CRCA 2TRMA 1ELCA 3P8GA 2ILNA 1YP9A 2R0LA 1Z1JA 1OWDA 1MQ6A 3E16B 1FMGA 2B0FA 3NXPA 1GBAA 4U32A 5B6OA 1BTUA 1KXCA 2O9QA 1DFPA 2P3TB 1QL8A 4IN2A 3S7KB 3VB7A 2GVFA 2D2DA 2A5KA 5F6MA 3MU1A 1GBTA 1ZMLA 1JIMA 2XNIA 1LVOA 1GJCB 1KXBA 3BTHE 3E3TA 5LGOA 1P8VC 3K65B 3SJIA 3NWUA 4DGJA 2VIOA 3LJJA 2AGEX 1O2OA 2P59A 3A7WA 1HJAC 3KEEA 1LTOA 1BTZA 3A83A 1IQMA 1HNEE 1LHFH 1GG6B 1DM4B 3AAVA 1KDQB 3MNBA 1EPTB 1ZPZA 1TNLA 3SOSA 2BX3A 1BMAA 1VR1H 1AFEH 5JBBS 3RXKA 1KXDA 1ZR0A 1C1TA 2FLBH 1OYQA 2C90B 2FM2A 3GY8A 4KELA 3S9BA 2BLQA 2GCTB 3SUEA 1HDTH 4K2YA 1GI5A 4Y76A 1B7XB 3N7OA 1BJVA 3TK6A 1MBMA 4NZQA 1TMTH 4CRDA 5EU8A 3MOCA 1V2VT 3RC5A 1DY9A 3KN2A 1P2OA 3ZZ9A 2H5CA 4BXSA 3QLPH 1ELTA 4H6TA 2ZPQA 1Q31A 1SFQB 2JH0D 1QRZA 4LZ4B 4THNH 1FN8A 1O3HA 1DE7H 1QR3E 1TMBH 2BB4A 3B23B 3SU5A 1L1NA 1BDAA 1MTNB 3SQEE 1T8MA 3MTYA 1MQ5A 1CA8B 1PYTC 3NKKA 8LPRA 1G9IE 1O0DH 5FCKA 1SGRE 1GL0E 1K2I1 4K5ZA 4INLA 4AFQA 3SJKA 5GPIB 1Y5AT 3PTNA 4FUDA 1V2MT 1IQHA 1EJAA 2TGDA 1YPHC 1Y3YA 3Q77A 1Z8GA 4A6LA 4CRBA 2Z9GA 3RXTA 1CGJE 2OXSA 1KLIH 2K1QA 3UQOA 2FEQH 2WYJA 3HK6B 1AVWA 4Q2KA 3T2NA 4DIIH 3T26A 1W8BH 3E8LA 4WF8A 3GDSA 2QXJA 3RXSA 2A0QB 9ESTA 1DXWA 1LDTT 1P0SH 1V2LT 1GJDB 2ZCLP 2XBXA 4K69A 1SGQE 3UR6A 1PPZA 1GMCG 1QQ4A 1RGQA 4YZUA 3TGIE 4PROA 4Y79A 2ZGCA 4KKDA 4GHQA 2XXLA 1X7AC 1P05A 2D26C 1PPGE 1C4V2 4AX9H 2PGBB 5JB9S 3S9AA 1O2ZA 4E7RG 2C8YB 4WH8A 5I46H 1GHVH 3ZVCA 1F92A 4R8TB 4ZKRU 1EP5A 1C4U2 3Q00A 2W3IA 2OC1A 5FXLA 1BRUP 3RXAA 2AGIX 2G51A 1TQ0B 3QZRA 1QA7A 4A1VA 3SV7A 1FPCH 3U98H 3TJVA 1S5SA 4GLYA 4IW4E 4JYVH 1ARCA 3MU8A 1HAPH 1MTWA 3M36A 5A0CA 1HXEH 1SGYE 4ISHH 5LPEA 1LPKB 2FZZA 1A5GH 4HFPB 3V7TA 1ZSLA 5FPSA 2ZDNA 3LGUA 1LMWB 4ABAA 1C5RA 1GI3A 1YLCA 3H7TA 4K1EA 4NFFA 3SNDA 1XKBC 1C2HA 3SORA 2CJIA 4JYTA 4FUGA 3TGJE 1ETRH 3BEUA 2YNAA 3D49H 4I8KA 1GBMA 1C1MA 2ZI2H 3RXJA 2O8MA 1P3CA 5JYIA 4TY7A 2GDDA 1XXFA 3UPEA 3LU9B 3MH5A 4CR9A 1XKAC 1WBGB 4Y8ZA 4YT7H 5J4QA 1O3KA 1ELEE 1BBRE 1CVWH 1Z1IA 2JH5D 4WXVA 4YTAA 4KTCA 1DPOA 1GBEA 4LXBH 1QB1A 2PKAB 2LPRA 4SGAE 5SGAE 2ANKH 2XTTB 3OY6U 1HIAA 2JETC 1MZAA 3SBKA 2QV1A 4VGCB 1SLWB 1C5YB 2F9PA 3SNAA 4O9VA 1UK3A 1V2NT 3GCHB 1B0FA 1G3CA 1UTNA 2FX4A 1AU8A 1BHXF 2C3SA 3E0PB 1Q2WA 5LH8A 1EAUA 3RUOA 2ZTZA 4Q7YA 3RMLH 3A7VA 3MH6A 5BRRE 1GI0A 2FOGA 3E0NB 3SI4H 4AYYB 3PMBB 4JYUH 2P3FH 1BQYA 3I77A 7KMEH 1A0HB 3F68H 1GHBG 2FLRH 1UVPA 1TOMH 5CMXH 4CRFA 2PGQB 1CO7E 1EZQA 1TPSA 3M5LA 3RXOA 1GPZA 4AFSA 4NA9H 2BD9A 1O35A 1T32A 3EQ0H 3PO1C 3RMOH 5T6FA 1EJNA 5F8ZA 2ZKSA 3MO3A 2UWOA 4ZH8A 1O2XA 1BZXE 4JZ1A 1CQQA 3LOXA 4X8VH 1FIZA 2ZU5A 4OS4A 1C5PA 3RXGA 1LVBA 3MNSA 3STJA 1ELVA 1QCPA 2WPHS 2BVRH 2W7UA 3VXEH 2J9NA 2QXGA 1IQEA 2ZGBH 2H5DA 5EXMA 1BT7A 2WYGA 1DSUA 1P2JA 4X2WA 1ZSKA 3LGWA 1IQGA 1BBRH 4UFGH 4X1NU 1HAIH 1MTUA 6CHAB 1GMHF 1QJ1B 1C2GA 1NRPH 5CE1A 3UY9A 4BAQB 4CH2B 3STIA 1GCTC 1E35B 2FWWA 2Z6BD 3A8BA 2TPIZ 3ATKA 5AFYH 1AMHA 1MTVA 3TH3H 2GT7A 3BEFB 2ANYA 1TNKA 8ESTE 1C2EA 4WVPE 2G4UA 3MMGA 1FY8E 1A46H 1AIXH 3EA9A 1DY8A 2TIOA 3TPIZ 1THPB 3PMJA 3I78A 4X2XA 2AMPA 2PTNA 2ZGHA 1SGTA 4NFEA 2GX4A 5E8EH 1AFQB 1O2IA 1OWKA 4I33A 1O39A 1F0UA 1O5CB 4H6SB 1ABJH 1VITF 1S81A 1WYKA 2PTCE 3ATWA 1DLKB 1FLEE 4NSYA 2A7CA 1DUEA 4MNYA 3T62A 2SGEE 1H9LB 4TYDA 3P92A 4K1TA 1QB9A 2THFB 2QC2A 1GI1A 1NU9A 2VWOA 2OQ5A 3TH4H 3A7XA 1KY9A 5FBEA 4DJZB 3A89A 1LQDB 3DT0H 3EA7A 1PPCE 1P2NA 4WWYA 4I8JA 3P8NA 1Y5BT 1QRXA 4BANB 1GGDB 4K60A 2BY6X 4INHA 3NPSA 4K8BA 1UVSH 2CHAC 2P16A 1AN1E 2VWNA 4DIHH 3BSQA 2NU2E 1O2TA 4O03A 5E0HA 1TALA 3A86A 3GCOA 2V6NA 3MO9A 1UTMA 3P17H 3ZV9A 1C9PA 1S0RA 3SV9A 1CA0C 2ZHEH 4ZROA 1TNIA 1QA0A 3BTEE 1F5LA 4LZ1H 3GDUA 3KQEA 1W14U 1T31A 3M5MA 1SI5H 1TPAE 2XC5A 1T8NA 2BQWB 2EI8A 2GZ8A 2BHGA 1MCVA 1O3FA 1GJ4H 1D6RA 4Z0KA 7GCHF 1F5KU 2Z9JA 1SL3A 2XWBI 5FCRA 1AI8H 1LCYA 3U8OH 3BTWE 5JDUB 2VH6A 1Z8IB 4FUHA 3BTDE 3FZDA 3SO3A 4ZXXH 3BEIB 2ZU4A 4NIYA 1P3EA 3V12A 1A5IA 1GHZA 2A4GA 1NFYA 1HJAB 1V2RT 3D62A 1DUAA 2FI5E 1TGCA 1FAKH 3LT3A 1MAXA 4ZKSU 4A1XA 5L2YH 1PFXC 1C2FA 2ZGJA 5T6DA 1L1JA 2P95A 2Z7FE 1P2KA 1AVGH 5C1YA 1O3AA 1BHXB 4XSKU 1S85A 4E05H 5FX6A 1FI8A 1HAGE 4K3JA 1WSSH 1JRTA 3BN9A 3RU4T 2RG3A 1W0YH 2CMYA 3P6ZB 1CU1A 1GJ7B 1ANCA 2WPLS 1EUFA 2FESH 3DHKH 2VWMA 1SGDE 2TGAA 3DD2H 5A0BA 4ZKNU 1O32A 7ESTE 1AVXA 2R2MB 3GY7A 1Z8JB 2XBYA 5F03A 3FAOA 3QUMP 2NU1E 3ODFA 1DXPA 1V2UT 2ZFPH 3PROA 1QJ6B 4DY7B 5EW2H 3QGNB 1SFIA 4OS6A 4ABHA 2ZHDA 3HKIB 2F9OA 1F5RA 2PUQH 1BRCE 1BUIA 1HAVA 2H1UA 2ZF0H 1FY1A 1Y59T 3MI4A 1NN6A 1K28D 3QTVH 1O3BA 2ZFFH 3RXVA 5T6GA 2BDBA 1ZGIA 1EKBB 1ELAA 3M3VA 3SV6A 1OP2A 2OP9A 3F6UH 2BDYA 1BOQA 1QBOA 1Y3VA 2OBQA 1ZYOA 5A8ZA 1KTSB 1BMLA 1L4DA 1NM6A 3JZ2B 3RXUA 2AERH 4GUXA 1LVMA 2Y5GA 2ASUB
chains in the Genus database with same CATH superfamily
3ZYDA 5AFZH 1BIOA 1GHAF 1MKXH 4NCYA 1PPFE 4XFQA 1SLXB 1J16A 4YT6H 2RA3A 1LHEH 3OY5U 1F7ZA 3NRLA 3SGQE 1UTOA 4I8LA 1XXDA 2J98B 1AGJA 1EASA 1DITH 1P57B 2KAIA 3ZZCA 2NU3E 1C9TA 2ULLA 3M5OA 2C4FH 3ELAH 1QZ8A 4DCDA 1HGTH 1SC8U 1NU7B 2XYAA 3DUXH 3F3BA 1O3CA 2BXUH 1EOJA 3OX7U 1O3JA 3M3SA 4P02A 4U2WA 3SU2A 4FUCA 3P8OA 1A3EH 4TPIZ 2Q6FA 2WUCA 2YMSD 3WW7A 2O8UA 2ZQ1A 2B7DH 2C93B 4YESB 3TVJB 1TWXB 4B75A 3KF2A 1NPMA 1ELFA 1C1RA 1C5VA 3M7TA 1P02A 1J9CH 3SU3A 1PQ7A 1FY3A 1ZTJA 2J2UA 3PV5A 1DWBH 2PKSC 4DG4A 4A92A 1BJUA 5TCCA 1P11E 2G5VA 2G00A 3LIWA 1Z8RA 1GDNA 1MTSA 3RMMH 3PMHB 1TRMA 1GBLA 1QURH 3LPRA 2HPPH 1O36A 3ZVGA 3TH2H 1INCA 2FOFA 4I8GA 1BMFD 2Y82A 1T7CA 1H4WA 2WHXA 1TNJA 3F0PA 2B8OH 3A82A 3TNSA 2RCEA 4UONA 3BF6H 4ISIH 1AHTH 3ZZ6A 4NZLA 3BV9B 1SQAA 1C1UH 4RN6A 2FIRH 1PQ5A 3GY3A 3OSYA 5EODA 5HM2A 4I31A 4DT4A 5FX5A 2EI6A 2A5IA 3O8CA 2HNTE 2A2XH 2STAE 1TABE 3F9HA 3UNSA 4UE7H 2XWAA 4X6OA 1YPLH 1NRRH 1MU6B 2HVXA 3WWFA 1O2WA 3DA9B 2PV9B 4SGBE 1C5XB 4B74A 1UTJA 1BTHH 1D6WA 4D7FA 3SNEA 1LKBA 4GHTA 1K21H 4IMQA 3BTQE 3IG6B 2CXVA 4MPWA 2JETB 4IC5A 1ETSH 3ATIA 1FONA 3D23A 1N6YA 1SBWA 6ESTA 3RM0H 1G3DA 4Q7ZA 2R3UA 2CF9H 1UTQA 1DICA 2F43B 3FZZA 2ZIQH 3HK3B 2EA3A 1E34B 1D3PB 1TRNA 3URDA 2VU8E 4LOYH 4NA8A 1MKWK 3A87A 5HM9A 1UMAH 2BMGB 3GCNA 1O5DH 2F9NA 3GDVA 3SQHE 2BOKA 3KGPA 3SI3H 1YLDA 2ZTYA 1FY5A 3L6PA 4FVDA 1N6XA 2RDLA 2K0QA 3LGYA 4NIXA 1GWAA 3PO1B 3BG4B 3CNRA 1P03A 4X2YA 1CHOF 1EB2A 2VIPA 2AIQA 2IPHA 4JZFH 2BLWA 2J5UA 1MH0A 2Y6TA 4X2VA 1HUTH 2XCNA 3U8RH 1O5EH 1GBJA 1SLUB 1KXAA 1YGCH 2GJGA 2KX4A 1TNGA 4O3UA 1ID5H 2ZFSA 2ZPRA 5ESBA 1HV7A 2GD4B 4X1SU 4GPGA 1THRH 2G8TA 5BPEA 1MZDA 1YC0A 4NWKA 3Q3XA 1ANEA 3HGNA 3QN7A 1OP0A 2P94A 1GCTB 4X8UH 1O3NA 4ZHMU 5FPYA 3T5FH 2R9PA 2V3HH 2XW9A 2NWNA 1P09A 3H5CB 5C3NA 1TPOA 4F48B 4OS2A 3VEQB 1XM1A 3SHCH 2VIQA 4Q7XA 3ZZ5A 4AZ2B 1PYTD 1FZZA 3F0OA 1K1PA 4MTBA 2PSXA 1EX3A 2G4TA 5GIBA 2HALA 5EQSA 2VBCA 3O8BA 5C67A 5EJZA 1MMJN 3SHAH 1BA8B 1JRSA 2BX4A 2FOMB 4AG2A 5KGOA 2VVVA 2UWLA 4AORA 2FYQA 2Z9IA 2FX6A 5HGGA 3K6YA 4YXWD 3MQKC 1EZSC 1KXFA 1M9UA 1EQ9A 4Y71A 1MAYA 3PLPA 4ZAEA 1O3EA 3M3TA 5LPRA 1GI6A 3LDXH 3ZZBA 2W3KA 2Y81A 2XBVA 3GYLB 3ATLA 1WTHD 2PR3A 4ESTE 1ANDA 1ARBA 1O34A 3GCTF 4WMDA 5IDKA 9LPRA 3DSPA 3P95A 2FXRA 1TMUH 2CK3D 3UTUH 1AY6H 3KQCA 5AF9H 1P9UA 3QDZB 3OU0A 3TJUA 3UR9A 1YPHE 2CHAB 1CT2E 4ISLA 1ZMNA 2PKAA 3GICB 4IC6A 1TE0A 4FU7A 5C1UA 5E0GA 4MPVA 2QXHA 5EXLA 1GJ5H 5DP9A 5C2ZA 1V6DA 1CA0B 1NFWA 1K1NA 1YCPK 1TIOA 2XBWA 8GCHF 5JBTA 4DVAU 5DK1A 2LNCA 3SU1A 1P06A 2VH0A 4CHAC 2GGVB 4AG1A 3U9AH 3FKSD 1O2KA 3TLOA 1KYNA 2A45B 4YM9A 3UUZA 3UFAA 1GMHG 5A09A 1UK4A 4ZUHA 1IQIA 1NFXA 2J97A 4XRNA 1L4ZA 1FDPA 2ODQA 4HG6A 1C2LA 4IMZA 1AE5A 1NRSH 3A85A 1BTWA 2FOBA 2KFWA 4AN7A 1VGCB 1TOCB 4GAWA 3HKJB 3ZZAA 1NTPA 4B71A 1TX7A 1C1NA 1C2DA 4FUEA 3T29A 2M2AA 1UHBA 2BZAA 3P70B 2A31A 3LH1A 3H7OA 1NC6A 2EI7A 5L6NH 1ESAA 1GI2A 2BLVA 3MU5A 2QIQA 1VITG 3O8DA 1FV9A 3ZZDA 2BOHB 3PRDA 3U1IB 4X8TH 1O3PB 4UFDH 1G2LA 2A5AA 2F9UA 3G01A 3W94A 1V2QT 1P12E 4Y7BA 4ZKOU 2DE9A 4AYVB 1GHXH 4X1QU 2BVSH 4IN1A 3GY2A 1TGNA 2BD5A 2HOBA 2IN2A 2O8LA 1HAHH 1A1RA 4MVNA 5GDSH 1S82A 1VITH 2VIDA 2WV4A 5EW1H 3BG4C 5K0HA 5LPFA 5HYOA 2PUXB 2KZ4A 2Y5HA 1IAUA 2FTLE 1OX1A 1GL1A 1WTGH 2F3CE 1C1OA 1J14A 4ABFA 2BXTH 5IYTA 1UTPA 2VWLA 3M7UA 5T3HA 1DWCH 1CBWB 2ALVA 1AE8H 3Q3YA 2ZHWH 1HIAB 4I7YH 2SGPE 3S7HB 1YM0A 2BD2A 3PWBA 1HB0B 1DLEA 2RFKC 1SMFE 1EJMA 1GDUA 1QJ7B 2PWXA 1SGFG 3A7ZA 2AGGX 3VGCC 4WH6A 3RU4D 3K6ZA 4MDSA 1HAZB 2D1JA 7GCHG 3HATH 4D9QA 1W3CA 4HGCA 5E2OA 2VVCA 2VIVA 2AEIH 1O2HA 2BQ6B 2J38A 3BIVH 4TWWA 1FN6A 5EPNA 1LPZB 1HCGA 3RXDA 4BAMB 4DOQA 5DP7A 4ISOA 1O2VA 1G3BA 5C0TA 1HAYB 3OAAD 3C27B 4TSFD 6GCHF 2ZTXA 4Z1MD 1DWDH 2HLCA 1NROH 1ZPBA 2ZFTA 4OGYA 3EGKH 1GHWH 2JH6D 4RSPA 2RDEA 2SFAA 2F9BH 2FDAA 4NSVA 5EGMA 2GZ9A 4WJG2 1YPJH 2OUAA 2W7SA 1UW7A 2QAAA 2VINA 2C8ZB 2GCHF 1VCWA 1PPBH 2Z3DA 1SB1H 2V0BA 5DP3A 5EIYA 1XUIA 1HFDA 2WPKS 4CREA 2ZZUH 3VXFH 1GI7B 1T8OA 4OGXA 1LHDH 3U69H 1NT1A 3MWIU 3MNCA 1AKSB 4XDEA 1GBHA 3V3MA 1CT0E 1U6QA 3SU6A 3LKWA 4BAOB 1E38B 3UNRA 2PP6A 1SGIB 3EYDA 4AOQA 5AVDA 2I6QA 4BTIB 1RTLA 3C1KA 3FP7E 3OE7D 5DJ7A 1WU1A 1AB9C 5A8YA 4MPXA 2OINA 3E90B 2WINI 1XUFA 2FOCA 1W7GH 2PKSB 2AMQA 2OD3B 3BTGE 4FOUC 4I32A 5FHTA 5DG6A 1P10A 4ZHAA 3SV2H 4XBCA 5DP6A 1NRNH 1IHSH 3PRBA 3RXIA 1SQOA 4BTTB 1DWEH 1GVLA 3A8CA 1DS2E 1GJ8B 2FOEA 4BTUB 2QF3A 4CR5A 3BIUH 3Q3KA 1ZPCA 3IWMA 2AH4X 5HIZA 2GT8A 1FNIA 3SN8A 1XVMA 1VGCC 1E0FD 2WV9A 2Y7ZA 1OWEA 1EXFA 2H6MA 3AASA 2CN0H 1ZHPA 1RTKA 4MG3A 2YOLA 2BQ7B 2SGAA 1K1LA 4E7NA 1ZRBA 1SHHB 2P8OB 2VNTA 2K8IA 3UNQA 2H2ZA 1GHAG 3S0NA 2Y80A 1TB6H 2VGCC 3TU7H 2KCOA 4WMEA 3PYHA 3W1EA 1V3XA 3ZVBA 5F8XA 5JPMH 3PV4A 1FPHH 1AZ8A 1BITA 1C1WH 1A4WH 4MNWA 1MU8B 2FP7B 3OEED 1XUHA 1NBMD 1GJ6A 3LGIA 3RP2A 3GY6A 3UOUA 4WMFA 1HRTH 1DVAH 4BOHA 5ABWA 1GBBA 1VZQH 2KCPA 4M7GA 2XRCA 1C2KA 2J92A 3ITIA 1AQ7A 2FS9A 3SGAE 2GTBA 3SU4A 1ELDE 2ODPA 2NU4E 3A8AA 2GMTC 5HXFA 4OS1A 1CBWC 2BY5X 1GCDA 1E79D 2Y5FA 1KSNA 1NY22 1C5OH 2ZHQH 2WPMS 4Y7AA 4GCHF 1QL9A 3LGVA 1CGHA 5DKMA 1TA2A 1K1OA 1OP8A 1UCYK 1HAXB 1N8OB 3SV8A 3ZVDA 3MU4A 5E0JA 1K22H 4KTUA 4X0WU 2QF4A 2ZGXH 2BDIA 1P01A 1LO6A 1O2GH 4KGAA 3U28C 3E91A 2J98A 3R3GB 2Z94A 3RLWH 1RRKA 2OBOA 1BB0B 2ANWA 1A61H 1EZUC 3LGTA 1SSXA 5C17A 1F2SE 4NIVA 2JKHA 1TAWA 3GISB 4NWLA 3BG8A 1B5GH 1WV7H 1C5WB 2O8WA 3F9FA 1ZGVA 3QWCH 4ZXYH 3SJ9A 5GCHF 1FAXA 3V13A 3SUGA 1GBIA 2G5NA 2A1DB 1C5UA 1YKTA 3EE7A 1DT2A 3SZEA 3PTBA 1YPMH 2BDGA 5ETXA 1GBCA 1SQTA 3HPTB 3TIUA 1W10U 4A5TS 2BDHA 1SPJA 4LK4A 2HGTH 1EAIA 3UIRA 2BD7A 1V2JT 1SOTA 3PLBA 3MH4A 1HAOH 1OYTH 1JIRA 4Y0ZE 1YPKH 1KTTB 1ZRKA 2D8WA 2PFEA 3EE0B 1G2MA 1PJPA 2ALPA 2GP9B 1AWHB 2L74A 2A4OA 3AW1A 4FU8A 2ANMH 1GVKB 1PPEE 4X8SH 1MABB 5ESTE 2ZDLA 4TT3D 1HAVB 1ANBA 3GOVB 1LKAA 1DX5M 4NGAH 4GSOA 1QNJA 4AGKA 2W26A 1QBNA 3RXCA 1UJ1A 1TLDA 1TYNA 4XD7D 4Y0YE 7LPRA 3E6PH 2BZ6H 2H9HA 3OEHD 1OPHB 2ZA5A 5AHGH 1GHYH 2FOAA 3Q76A 1IHTH 1S83A 2XC4A 4UFEH 4ZHLU 1QFKH 4B2AA 2ZPSA 1A5HA 1KDQA 1EPTA 1P04A 2QGRA 3RC6A 2Y7XA 2UWPA 3SZNA 1JOUB 3ENSB 3KQ5A 1ZTKA 1BTPA 1QBVH 3BTKE 1BMNH 1FY4A 1WQVH 1MBQA 1ZSJA 2FO9A 3EDXB 3N99A 1FJSA 1ESBA 1CHOG 1G30B 2ZCHP 1O5FH 1O2UA 3CENA 3A80A 1PQ8A 2TBSA 4HI3A 2KAIB 1OXGA 2ZNKH 3PWCA 1B0EA 4U01A 3I29A 4IGDA 3UWIA 4ASUD 1IQJA 1H9IE 1S6LA 3FFGA 4FUBA 5L30H 2OTVA 1P2IA 3PLKA 1LHGH 1WXRA 1IOEA 1CE5A 3TK5A 3BTTE 4CHAB 4D76A 1NS3A 2BY7X 3SJ8A 1O3IA 3QK1A 4ABBA 1S6FA 2P8OC 1YCPM 2V35A 2G52A 2NU0E 1IQLA 4MPUA 3N7EA 1A3BH 5GXPA 1HJ8A 1W0ZU 2SGQE 2QCYA 1HJ9A 2W5EA 1BTYA 1Y3XA 1VCQA 1AWFH 1GMDF 1RD3B 1RJXB 3KHVA 1E36B 5B6LA 1D3DB 4FXGH 3AW0A 2VB0A 4U30A 1CSOE 2BD8A 2SGFE 1EAWA 1MD8A 3KIDU 2G81E 1C2JA 1TGTA 1TPPA 2Z3EA 3U1JB 4OS5A 2FMJA 2A4QA 4WY3A 3NCLA 4AB9A 2OQUA 3TJNA 3LC5A 4XOJA 1HPGA 5PTPA 1KIGH 1Q3XA 1W12U 3LJOA 1O33A 1QIXB 1V2TT 2FOHA 3FP8E 5CHAC 4I8HA 1MCTA 1MKWH 2VJ1A 3VFEA 1QB6A 4X1RU 2EC9H 1N8OC 1E1RD 2FI4E 3KNXA 2ZCKP 3K9XB 1V2WT 2FYRA 1O31A 3GCTG 1YPGH 4B76A 1O2LA 3VB6A 2W6JD 2P3UB 1SR5C 2A2QH 5DP5A 2IJOB 1RTFB 3QZQA 1O3LA 5DSFA 1TBQH 2AYWA 4ACBA 3FP6E 1S6HA 1O2MA 1LHCH 1G3EA 3RXQA 3M5NA 3LC3A 1Z71A 4YOJA 1XX9A 3M35A 4X1PU 4CRAA 1UK2A 5EQQA 5J4SA 4DURA 4E06H 1PPHE 2ZU3A 1BRAA 4UEHH 1JMOH 3MU0A 8GCHG 1GBFA 4BAHB 2AMDA 2WUBA 1C1QA 4MQAA 1OOKB 2QY0B 4K1SA 1UTLM 1O3GA 2YMSC 3RMNH 3VGCB 1F0SA 3K2UA 1V2KT 1Z7KA 3DSGA 1H8IH 1K1IA 3H09A 3ODDA 1D4PB 1FQ3A 3SNBA 5JBCS 1C5LH 3KQBA 4GVUA 5A2MH 2CF8H 1C4Y2 2BYAX 2PW8H 4AGJA 3RDZA 3DSOA 1TX6A 3F9GA 3LONA 2WPDD 3E1XB 1WAYB 2J34A 2XC0A 1LPGB 1YPEH 2Q6DA 3ZVFA 3BTME 1THSH 3AAUA 2AFQB 1ELGA 1O3DA 2QF0A 3NZIA 1V2OT 4FVBA 2VIWA 1GI4A 2G55A 1RIWC 4XBBA 2BM2A 4ABDA 5DO4H 3EAJA 3CS0A 2KR7A 1NFUA 1O5BB 2EY4C 2F91A 2ZFQH 2WPJS 5C20A 4WXIA 1TX8A 4RKOB 4AFUA 5CDFE 4UFFH 2A4RA 3QX5H 4D9RA 1SGNE 5HMAA 2GV7A 3S69A 3T25A 1RS0A 1O2PA 2ZDMA 1RXPA 1OWIA 2H9EH 8KME2 3UQVA 1L2EA 3V0XA 2F83A 1O2QA 2ZDVH 3KQDA 4NA7A 4ABGA 3RM2H 1HLTH 1TGSZ 1W7XH 2AS9A 2HNTF 4YOGA 1J8AA 1ACBE 2BY8X 3FVFB 1Y5UT 3A8DA 1C1PA 4JZEH 3A7TA 2C8WB 4FUIA 4ABIA 1AB9B 3RXFA 1A2CH 2ZU2A 1Y8TA 3DFLA 3QO6A 4J1YA 1DANH 1YCPH 3PM3A 1XUJA 1AD8H 4DW2U 2EEKA 1WUNH 3UOPA 3GS9A 1ZHMA 1OKXA 4X6PA 1BRBE 4CBOA 1NRQH 1YWUA 1FIWA 1TNHA 3VB4A 3SYJA 2RA0A 1W13U 4BXWA 6LPRA 2DUCA 1GG6C 3F1SB 3UAIC 2XCFA 4AB8A 3SNCA 5GWZA 1EPTC 2QN5T 2YNBA 5FAHA 1QQUA 1VJAU 1BTXA 1SGCA 1W11U 3RXBA 3WY8A 1ESTA 6GCHG 2M5TA 1K1MA 1ELBA 1N1LA 3FANA 2QE7D 3P8FA 1UVUH 3M61U 4BAKB 4QT8C 1O3MA 1SKYE 1TBZH 1GMCF 3SW2B 2VGCB 1ETTH 4YLQH 1ZZZA 5F53A 3SUDA 5KEDA 1TONA 2SNWA 2FTMA 2BD3A 3MYWA 2GCTC 4XE4A 1QHRB 4A7IB 1GI9B 1D9IA 3R0FA 4ZMAH 2OC7A 2GCHG 1C5MD 1SGPE 2WZQA 4D7GA 4X6MA 4YOIA 3ZZ7A 3ZIAD 1OWHA 2ZDAH 1C1SA 5EJLA 1SGEE 1UVOA 1WOFA 3L33A 4JCNA 1H1BA 2V3MA 2Z3CA 1WCZA 2R3YA 3ZZ3A 5FBIA 2SNVA 1KXEA 2GMTB 3IITA 3URCA 1ZLRA 2B5TB 3ZV8A 1EB1H 1S84A 4NIWA 1O5GH 3GYMA 1F0TA 1MTNC 1WDIA 4JMYA 1EAXA 2AIPA 4F49A 4KP0A 5A0AE 3L3TA 1COWD 3CS7A 3RXMA 1UHBB 2HLDD 4A1TA 2A7HA 3TJOA 2Q6GA 3QTOH 3PB1E 2QXIA 2DE8A 3OYPA 1XMNB 2ZC9H 1BBRK 1Y3UA 1IQNA 2TGTA 4UD9H 3ZZ4A 1O2NA 1O2SA 5C1XA 4MLFB 1AUJA 3FOAA 1AUTC 3SUFA 3RXHA 1HBTH 2ZQ2A 3PMAB 1J15A 4KTSA 1O3OA 3GY5A 4B2BA 2BDAA 1AKSA 4JK5A 1L1GA 1BCUH 3RU4E 1C5NH 5L2ZH 4JZDH 3D65E 3T27A 2ZG0H 2BD4A 2ZO3H 2FS8A 3RXEA 1Z6EA 4UDWH 3TITA 2L6OA 3LH3A 1OSSA 1ZOMA 3S9CA 4B73A 2Z9LA 2A32A 4J2YB 2I6SA 4CH8B 2IPQX 3JZ1B 1C5TA 4RKJB 2JDID 2BVXH 2OC0A 4JZIA 4DT7B 2C8XB 3TNTA 1DSTA 1JXPA 1SLVB 2CGAA 4ASHA 2PHBA 4FU9A 1NESE 2CV3A 3NUMA 3BTFE 1G37A 1GHBF 1A0JA 5IK2D 2F9VA 1YYY1 1G36A 2PSYA 1SHYA 1Y3WA 3DFJA 2R2WU 3SGBE 1VJ9U 1TFXA 1EZXC 5DP8A 3AVZA 1ZTLA 5E2PA 1F0RA 4TY6A 1HXFH 2ZHFH 4AFZA 1C5SA 1Z6JH 3MO6A 3TGKE 1KLTA 4GCHG 1H9HE 3MFJA 1YF4A 4F4OC 1V2ST 1O38A 2ZFRH 3U8TH 1SOZA 3VB3A 1ZJDA 4MNXA 2HRVA 4MNVA 1TA6A 1CHGA 3F2GA 3OTPA 1GBDA 1SVPA 1A7SA 1UCYE 1E37B 2UUYA 5H4IB 1SG8B 1QTFA 1O30A 3ZVAA 3PV2A 1O2YA 1CT4E 5DP4A 3UREA 2ZU1A 1K9OE 3HGPA 1FXYA 1T4VH 1IQFA 5GCHG 1WQSA 3TK9A 1P9SA 1UVTH 2GDEH 1TRYA 4K8YA 1TGBA 1C2IA 3VB5A 1A0LA 3KYFA 3SU0A 4B2CA 3ATMA 2V7QD 4Y8XA 2VVUA 3A81A 3UWJH 5TCAA 4X6NA 5DPAA 1NO9H 2ODYB 2XOKD 4RT1A 4CBNA 1AO5A 4YLUA 1ZMJA 5K7RA 3GY4A 1OS8A 4VGCC 1YBWA 1GVZA 3W95A 5JB8S 5GJ4B 5A8XA 1XUKA 1EFRD 1H8DH 2V3OH 4Y10E 3A88A 2ZECA 3F9EA 3GCHC 4BNRA 1C5ZB 1O5AB 3MHWU 2HPQH 5FPTA 3ZZ8A 1UO6A 1D3TB 2R0KA 5I25A 4B1TA 1P2MA 1XUGA 1AZZA 3B8JA 1LQEA 4HZHA 1XVOA 2P93A 4H42U 2ESTE 1NZQH 4FUJA 1P2QA 1K0HA 3ZYEA 4TPYA 1FUJA 2BTCE 4B6EA 1BMMH 1GJBB 1GJAB 5CHAB 2TGPZ 3RXRA 3RC4A 1DDJA 1NBME 2A7JA 1J17T 3M7QA 5C5OA 5F8TA 2HWLB 1CGIE 4FUFA 3T28A 1QL7A 5EXNA 5JBAS 2J95A 1GDQA 3QGJA 2J4IA 1ZHRA 1S0QA 1G32B 1UCYH 1W2KH 1MUEB 1EP6A 4ISNA 4JK6A 2Q1JA 1T8LA 2ZDKA 2ZWLH 4CRGA 1C2MA 1PQAA 4R0IA 3CP7A 4XBDA 3OTJE 3A84A 1TQ7B 1C1VH 3MH7A 4O97A 4OS7A 1ORFA 2PLXA 5EG4A 5DGJA 3KL6A 4Y11E 6CHAC 1TBRH 2BY9X 2FPZA 4D8NA 2OC8A 1GI8B 3RXLA 3SJOA 4NG9H 4IBLH 5GNDA 1KLJH 2BLOA 2GV6A 2O8TA 1GJ9B 1RFNA 4P00A 2ZEBA 4ABEA 4HTCH 2STBE 1UTKA 2Z9KA 1HYLA 1EATA 1LVYA 4O3TA 2OLGA 2UUKB 2OCVB 3ESTA 5G4BA 3VG8A 1OWJA 1AFQC 5EOKA 1DOJA 1O37A 2UUJB 2GKVE 1V2PT 3M37A 4Q80A 3RXPA 1EOLA 1MKXK 1O2RA 3FN8A 3A7YA 4Y8YA 2BDCA 1SGFA 5TJXA 3NK8A 3RLYH 1GMDG 3ZVEA 2WV5A 4ABJA 4Z6AH 3O8RA 1D3QB 1ABIH 1JWTA 2LP6A 2FODA 1VCPA 2UUFB 5C5NA 1RIWB 4IS5A 1IQKA 1ZJKA 2GZ7A 1GBKA 3B9FH 2J94A 5DN6D 4F55A 2FI3E 5EQRA 1L0ZA 1QGFA 1T4UH 2B9LA 3EA8A 4Y6DA 2HNTC 3KCGH 2WPIS 2QA9E 4TWYA 2IOTA 5C94A 2ZP0H 1K1JA 1QRWA 1GGDC 4H4FA 1JBUH 4INKA 5EPYA 2SGDE 2H9TH 4YO9A 3MNXA 2QYIA 1C5QA 1O2JA 1QY6A 3VPKA 1MD7A 4CRCA 2XNDD 2TRMA 1ELCA 3P8GA 1H8ED 2ILNA 1YP9A 1VKYA 4ZCNA 2R0LA 1Z1JA 1OWDA 1MQ6A 3E16B 1FMGA 4FETA 2B0FA 3NXPA 1GBAA 4U32A 5B6OA 1BTUA 1KXCA 2O9QA 1DFPA 2P3TB 1QL8A 4IN2A 3S7KB 3VB7A 2GVFA 2D2DA 2A5KA 5F6MA 3MU1A 1GBTA 1ZMLA 1JIMA 2XNIA 1LVOA 1GJCB 1KXBA 3BTHE 3E3TA 5LGOA 1P8VC 3K65B 3SJIA 3WWBA 3NWUA 4DGJA 2VIOA 3LJJA 2AGEX 1O2OA 2P59A 3A7WA 1HJAC 3KEEA 1LTOA 1BTZA 3A83A 1IQMA 1HNEE 1LHFH 1GG6B 1DM4B 3AAVA 1KDQB 3MNBA 1EPTB 1ZPZA 1TNLA 3SOSA 2BX3A 1KMHB 1YY3A 1BMAA 1VR1H 1AFEH 1W0JD 5JBBS 3RXKA 1KXDA 1ZR0A 1C1TA 2FLBH 1OYQA 2C90B 2FM2A 5FL7D 3GY8A 4KELA 3S9BA 2BLQA 2GCTB 3SUEA 1HDTH 4K2YA 1GI5A 4Y76A 1B7XB 3N7OA 1BJVA 3TK6A 1MBMA 4NZQA 1TMTH 4CRDA 5EU8A 3MOCA 1V2VT 3RC5A 1DY9A 3KN2A 1P2OA 2LELA 3ZZ9A 2H5CA 4BXSA 3QLPH 1ELTA 4H6TA 2ZPQA 1Q31A 1SFQB 2JH0D 1QRZA 4LZ4B 4RI0A 4THNH 1FN8A 1O3HA 1DE7H 1QR3E 1TMBH 2BB4A 3B23B 3SU5A 1L1NA 1BDAA 1MTNB 3SQEE 1T8MA 3MTYA 1MQ5A 3AK5A 1CA8B 1PYTC 3NKKA 8LPRA 1G9IE 2HVYB 1O0DH 5FCKA 4Q63A 1SGRE 1GL0E 1K2I1 4K5ZA 4INLA 4AFQA 3SJKA 5GPIB 1Y5AT 3PTNA 4FUDA 1V2MT 1IQHA 1EJAA 2TGDA 1YPHC 1Y3YA 3Q77A 1Z8GA 4A6LA 4CRBA 2Z9GA 3RXTA 1CGJE 2OXSA 1KLIH 2K1QA 3UQOA 2FEQH 2WYJA 3HK6B 1AVWA 4Q2KA 3T2NA 4DIIH 3T26A 1W8BH 3E8LA 4WF8A 3GDSA 2QXJA 3RXSA 2A0QB 2WSSD 9ESTA 1DXWA 1LDTT 1P0SH 1V2LT 1GJDB 2ZCLP 2XBXA 4K69A 1SGQE 3UR6A 1PPZA 1GMCG 1QQ4A 1RGQA 4YZUA 3TGIE 4PROA 4Y79A 5HKKD 2ZGCA 4KKDA 4GHQA 2XXLA 1YLNA 4B6FA 1X7AC 1P05A 2D26C 1PPGE 1C4V2 4AX9H 2PGBB 5JB9S 3S9AA 1O2ZA 4E7RG 2C8YB 4WH8A 5I46H 1GHVH 3ZVCA 1F92A 4R8TB 4ZKRU 1EP5A 4AC9A 1C4U2 3Q00A 2W3IA 2OC1A 5FXLA 1BRUP 3RXAA 2AGIX 2G51A 1TQ0B 3QZRA 1QA7A 4A1VA 2EQNA 3SV7A 1FPCH 3U98H 3TJVA 1S5SA 4GLYA 4IW4E 4JYVH 1ARCA 3MU8A 1HAPH 1MTWA 3M36A 5A0CA 1HXEH 1SGYE 4ISHH 5LPEA 1LPKB 2FZZA 1A5GH 4HFPB 3V7TA 1ZSLA 5FPSA 2ZDNA 3LGUA 1LMWB 4ABAA 1C5RA 1GI3A 1YLCA 3H7TA 4K1EA 4NFFA 3SNDA 1XKBC 1C2HA 3SORA 2CJIA 4JYTA 4FUGA 3TGJE 1ETRH 3BEUA 2YNAA 3D49H 4I8KA 1GBMA 1C1MA 2ZI2H 3RXJA 2O8MA 2JJ1D 2W6ID 1H8HD 1P3CA 5JYIA 4TY7A 2GDDA 1XXFA 3UPEA 3LU9B 3MH5A 4CR9A 1XKAC 1WBGB 4Y8ZA 4YT7H 5J4QA 1O3KA 1ELEE 1BBRE 1CVWH 1Z1IA 2JH5D 4WXVA 4YTAA 4KTCA 1DPOA 1GBEA 4LXBH 5KECA 1QB1A 2PKAB 2LPRA 4SGAE 5SGAE 2ANKH 2XTTB 3OY6U 1HIAA 2KM0A 2JETC 1MZAA 2JIZD 3SBKA 2QV1A 4VGCB 1SLWB 1C5YB 2F9PA 3SNAA 4O9VA 1UK3A 1V2NT 3GCHB 1B0FA 1G3CA 1UTNA 2FX4A 1AU8A 1BHXF 2C3SA 3E0PB 1Q2WA 5LH8A 1EAUA 3RUOA 2ZTZA 4Q7YA 3RMLH 3A7VA 3MH6A 5BRRE 1GI0A 2FOGA 3E0NB 3SI4H 4AYYB 3PMBB 4JYUH 2P3FH 1BQYA 3I77A 7KMEH 1A0HB 1W0KD 3F68H 1GHBG 2FLRH 1UVPA 1TOMH 5CMXH 4CRFA 2PGQB 1CO7E 1EZQA 1TPSA 4RT0A 3M5LA 3RXOA 1GPZA 4AFSA 4NA9H 2BD9A 1O35A 1T32A 3FO8D 3EQ0H 2IJD1 3PO1C 3RMOH 2F4LA 5T6FA 1EJNA 5F8ZA 2ZKSA 3MO3A 2UWOA 4ZH8A 1O2XA 1BZXE 4JZ1A 1CQQA 3LOXA 4X8VH 1FIZA 2ZU5A 4OS4A 1C5PA 3RXGA 1LVBA 3MNSA 3STJA 1ELVA 1QCPA 2WPHS 2BVRH 2W7UA 3VXEH 2J9NA 2QXGA 1IQEA 2ZGBH 2H5DA 5EXMA 1BT7A 2WYGA 1DSUA 1P2JA 4Q4LA 4X2WA 1FX0B 1ZSKA 3LGWA 1IQGA 1BBRH 4UFGH 4X1NU 1HAIH 1MTUA 6CHAB 1GMHF 1QJ1B 1C2GA 1NRPH 5CE1A 3UY9A 4BAQB 4CH2B 3STIA 1GCTC 1E35B 2FWWA 2Z6BD 3A8BA 2TPIZ 3ATKA 5AFYH 1AMHA 1MTVA 3TH3H 2GT7A 3BEFB 2ANYA 1TNKA 1E1QD 8ESTE 1C2EA 4WVPE 2G4UA 3MMGA 1FY8E 1A46H 1AIXH 3EA9A 1DY8A 1SQRA 2TIOA 1THPB 3PMJA 3TPIZ 3I78A 4X2XA 2AMPA 2PTNA 2ZGHA 1SGTA 4NFEA 2GX4A 3N7DA 5E8EH 1AFQB 1O2IA 1OWKA 4I33A 2AHME 5CHBA 1O39A 1F0UA 1O5CB 4H6SB 1ABJH 2YMSB 1VITF 1S81A 1WYKA 2PTCE 3ATWA 1DLKB 4I86A 1FLEE 2JJ2D 4NSYA 3UB0A 2A7CA 1DUEA 3DCLA 4MNYA 3T62A 2SGEE 1H9LB 4TYDA 3P92A 4K1TA 1QB9A 2THFB 2QC2A 1GI1A 1NU9A 2VWOA 4ACAA 2OQ5A 3TH4H 3A7XA 2OK5A 1KY9A 5FBEA 4DJZB 3A89A 1LQDB 3DT0H 3EA7A 1PPCE 1OHHD 1P2NA 4WWYA 5T1VA 4I8JA 3P8NA 1Y5BT 1QRXA 3F2HA 4BANB 1GGDB 4K60A 2BY6X 4INHA 3NPSA 4K8BA 1UVSH 2CHAC 2P16A 1AN1E 2VWNA 4DIHH 3KYGA 3BSQA 2NU2E 1O2TA 4O03A 5E0HA 1TALA 3A86A 3GCOA 2V6NA 3MO9A 1UTMA 3P17H 3ZV9A 1C9PA 1S0RA 3SV9A 1CA0C 2ZHEH 4ZROA 1TNIA 1QA0A 3BTEE 1F5LA 4LZ1H 3GDUA 3KQEA 1W14U 1T31A 3M5MA 5C0UA 3F2FA 1SI5H 1TPAE 2XC5A 1T8NA 2BQWB 2EI8A 2GZ8A 4M9FA 2BHGA 1MCVA 1O3FA 1GJ4H 1D6RA 4Z0KA 7GCHF 1F5KU 3OFND 2Z9JA 1SL3A 2XWBI 5FCRA 1AI8H 1LCYA 3U8OH 3BTWE 5JDUB 2VH6A 1Z8IB 2KCYA 4FUHA 3BTDE 3FZDA 3SO3A 2KCAA 4ZXXH 3BEIB 2ZU4A 4NIYA 1P3EA 3V12A 1A5IA 1GHZA 2A4GA 1NFYA 1HJAB 2QF5A 1V2RT 3D62A 1DUAA 2FI5E 1TGCA 1FAKH 3LT3A 1MAXA 4ZKSU 4A1XA 5L2YH 1PFXC 1C2FA 2ZGJA 5T6DA 1L1JA 2P95A 2Z7FE 1P2KA 1AVGH 5C1YA 1O3AA 1BHXB 4XSKU 1S85A 4E05H 5FX6A 1FI8A 1HAGE 4K3JA 1WSSH 1JRTA 3BN9A 3RU4T 2RG3A 1W0YH 2CMYA 3P6ZB 1CU1A 1GJ7B 1ANCA 2WPLS 1EUFA 2FESH 3DHKH 2VWMA 1SGDE 2TGAA 3DD2H 5A0BA 4ZKNU 1O32A 7ESTE 1AVXA 2R2MB 5EJ1A 3GY7A 1Z8JB 2XBYA 5F03A 3FAOA 3QUMP 2NU1E 3ODFA 1DXPA 1V2UT 2ZFPH 3PROA 1QJ6B 4DY7B 5EW2H 3QGNB 1SFIA 4OS6A 4ABHA 2ZHDA 3HKIB 2F9OA 1F5RA 2PUQH 1BRCE 5HIYA 1BUIA 1HAVA 2H1UA 2ZF0H 1FY1A 1Y59T 4OM9A 3MI4A 1NN6A 1K28D 3QTVH 1O3BA 2ZFFH 3RXVA 5T6GA 2BDBA 1ZGIA 1EKBB 1ELAA 3M3VA 3SV6A 1OP2A 2OP9A 3F6UH 2BDYA 1BOQA 1QBOA 1Y3VA 2OBQA 1ZYOA 5A8ZA 1KTSB 1BMLA 1L4DA 1NM6A 3JZ2B 3RXUA 2AERH 4GUXA 1LVMA 2Y5GA 2ASUB
chains in the Genus database with same CATH topology
3ZYDA 5AFZH 1BIOA 1GHAF 1MKXH 4NCYA 1PPFE 4XFQA 1SLXB 1J16A 4YT6H 2RA3A 1LHEH 3OY5U 1F7ZA 3SGQE 1UTOA 4I8LA 1XXDA 1AGJA 1EASA 1DITH 1P57B 2KAIA 3ZZCA 2NU3E 1C9TA 2ULLA 3M5OA 2C4FH 3ELAH 4DCDA 1HGTH 1SC8U 1NU7B 2XYAA 3DUXH 1O3CA 2BXUH 1EOJA 3OX7U 1O3JA 3M3SA 4U2WA 3SU2A 4FUCA 3P8OA 1A3EH 4TPIZ 2Q6FA 2WUCA 2O8UA 2ZQ1A 2B7DH 2C93B 4YESB 3TVJB 1TWXB 4B75A 3KF2A 1NPMA 1ELFA 1C1RA 1C5VA 3M7TA 1P02A 1J9CH 3SU3A 1PQ7A 1FY3A 1ZTJA 2J2UA 1DWBH 2PKSC 4DG4A 4A92A 1BJUA 5TCCA 1P11E 2G5VA 2G00A 3LIWA 1Z8RA 1GDNA 1MTSA 3RMMH 3PMHB 1TRMA 1GBLA 1QURH 3LPRA 2HPPH 1O36A 3ZVGA 3TH2H 1INCA 2FOFA 4I8GA 2Y82A 1T7CA 1H4WA 1TNJA 2B8OH 3A82A 3TNSA 2RCEA 4UONA 3BF6H 4ISIH 1AHTH 3ZZ6A 4NZLA 3BV9B 1SQAA 1C1UH 4RN6A 2FIRH 1PQ5A 3GY3A 3OSYA 5EODA 5HM2A 4I31A 5FX5A 2EI6A 2A5IA 3O8CA 2HNTE 2A2XH 2STAE 1TABE 3F9HA 3UNSA 4UE7H 2XWAA 4X6OA 1YPLH 1NRRH 1MU6B 2HVXA 1O2WA 3DA9B 2PV9B 4SGBE 1C5XB 4B74A 1UTJA 1BTHH 1D6WA 4D7FA 3SNEA 1LKBA 4GHTA 1K21H 4IMQA 3BTQE 3IG6B 2CXVA 4MPWA 2JETB 4IC5A 1ETSH 3ATIA 1FONA 3D23A 1N6YA 1SBWA 6ESTA 3RM0H 1G3DA 4Q7ZA 2R3UA 2CF9H 1UTQA 1DICA 3FZZA 2ZIQH 3HK3B 2EA3A 1E34B 1D3PB 1TRNA 3URDA 2VU8E 4LOYH 4NA8A 1MKWK 3A87A 5HM9A 1UMAH 2BMGB 3GCNA 1O5DH 2F9NA 3GDVA 3SQHE 2BOKA 3KGPA 3SI3H 1YLDA 2ZTYA 1FY5A 3L6PA 4FVDA 1N6XA 2RDLA 3LGYA 4NIXA 1GWAA 3PO1B 3BG4B 1P03A 4X2YA 1CHOF 1EB2A 2VIPA 2AIQA 2IPHA 4JZFH 2BLWA 1MH0A 2Y6TA 4X2VA 1HUTH 2XCNA 3U8RH 1O5EH 1GBJA 1SLUB 1KXAA 1YGCH 1TNGA 4O3UA 1ID5H 2ZFSA 2ZPRA 5ESBA 1HV7A 2GD4B 4X1SU 4GPGA 1THRH 2G8TA 5BPEA 1MZDA 1YC0A 4NWKA 3Q3XA 1ANEA 3HGNA 3QN7A 1OP0A 2P94A 1GCTB 4X8UH 1O3NA 4ZHMU 5FPYA 3T5FH 2R9PA 2V3HH 2XW9A 2NWNA 1P09A 3H5CB 5C3NA 1TPOA 4OS2A 3VEQB 1XM1A 3SHCH 2VIQA 4Q7XA 3ZZ5A 4AZ2B 1PYTD 1FZZA 1K1PA 4MTBA 2PSXA 1EX3A 2G4TA 5GIBA 2HALA 5EQSA 3O8BA 5C67A 1MMJN 3SHAH 1BA8B 1JRSA 2BX4A 2FOMB 4AG2A 2VVVA 2UWLA 4AORA 2FYQA 2Z9IA 2FX6A 5HGGA 3K6YA 1EZSC 1KXFA 1M9UA 1EQ9A 4Y71A 1MAYA 3PLPA 4ZAEA 1O3EA 3M3TA 5LPRA 1GI6A 3LDXH 3ZZBA 2W3KA 2Y81A 2XBVA 3GYLB 3ATLA 1WTHD 2PR3A 4ESTE 1ANDA 1ARBA 1O34A 3GCTF 4WMDA 5IDKA 9LPRA 3P95A 2FXRA 1TMUH 3UTUH 1AY6H 3KQCA 5AF9H 1P9UA 3QDZB 3OU0A 3TJUA 3UR9A 1YPHE 2CHAB 1CT2E 4ISLA 1ZMNA 2PKAA 3GICB 4IC6A 1TE0A 4FU7A 5C1UA 5E0GA 4MPVA 2QXHA 5EXLA 1GJ5H 5DP9A 5C2ZA 1V6DA 1CA0B 1NFWA 1K1NA 1YCPK 1TIOA 2XBWA 8GCHF 5JBTA 4DVAU 5DK1A 2LNCA 3SU1A 1P06A 2VH0A 4CHAC 2GGVB 4AG1A 3U9AH 1O2KA 3TLOA 1KYNA 2A45B 4YM9A 3UUZA 3UFAA 1GMHG 5A09A 1UK4A 4ZUHA 1IQIA 1NFXA 1L4ZA 1FDPA 2ODQA 1C2LA 4IMZA 1AE5A 1NRSH 3A85A 1BTWA 2FOBA 4AN7A 1VGCB 1TOCB 4GAWA 3HKJB 3ZZAA 1NTPA 4B71A 1TX7A 1C1NA 1C2DA 4FUEA 3T29A 1UHBA 2BZAA 3P70B 2A31A 3LH1A 3H7OA 1NC6A 2EI7A 5L6NH 1ESAA 1GI2A 2BLVA 3MU5A 2QIQA 1VITG 3O8DA 1FV9A 3ZZDA 2BOHB 3U1IB 4X8TH 1O3PB 4UFDH 1G2LA 2A5AA 2F9UA 3G01A 3W94A 1V2QT 1P12E 4Y7BA 4ZKOU 2DE9A 4AYVB 1GHXH 4X1QU 2BVSH 4IN1A 3GY2A 1TGNA 2BD5A 2HOBA 2IN2A 2O8LA 1HAHH 1A1RA 4MVNA 5GDSH 1S82A 1VITH 2VIDA 2WV4A 5EW1H 3BG4C 5K0HA 5LPFA 5HYOA 2PUXB 2Y5HA 1IAUA 2FTLE 1OX1A 1GL1A 1WTGH 2F3CE 1C1OA 1J14A 4ABFA 2BXTH 5IYTA 1UTPA 2VWLA 3M7UA 5T3HA 1DWCH 1CBWB 2ALVA 1AE8H 3Q3YA 2ZHWH 1HIAB 4I7YH 2SGPE 3S7HB 1YM0A 2BD2A 3PWBA 1HB0B 1DLEA 1SMFE 1EJMA 1GDUA 1QJ7B 2PWXA 1SGFG 3A7ZA 2AGGX 3VGCC 4WH6A 3RU4D 3K6ZA 4MDSA 1HAZB 2D1JA 7GCHG 3HATH 4D9QA 1W3CA 4HGCA 5E2OA 2VVCA 2VIVA 2AEIH 1O2HA 2BQ6B 2J38A 3BIVH 4TWWA 1FN6A 5EPNA 1LPZB 1HCGA 3RXDA 4BAMB 4DOQA 5DP7A 4ISOA 1O2VA 1G3BA 1HAYB 3C27B 6GCHF 2ZTXA 1DWDH 2HLCA 1NROH 1ZPBA 2ZFTA 4OGYA 3EGKH 1GHWH 2JH6D 4RSPA 2SFAA 2F9BH 2FDAA 4NSVA 5EGMA 2GZ9A 4WJG2 1YPJH 2OUAA 2W7SA 2QAAA 2VINA 2C8ZB 2GCHF 1VCWA 1PPBH 2Z3DA 1SB1H 2V0BA 5DP3A 1XUIA 1HFDA 2WPKS 4CREA 2ZZUH 3VXFH 1GI7B 1T8OA 4OGXA 1LHDH 3U69H 1NT1A 3MWIU 3MNCA 1AKSB 4XDEA 1GBHA 3V3MA 1CT0E 1U6QA 3SU6A 3LKWA 4BAOB 1E38B 3UNRA 1SGIB 3EYDA 4AOQA 5AVDA 2I6QA 4BTIB 1RTLA 3C1KA 3FP7E 5DJ7A 1WU1A 1AB9C 5A8YA 4MPXA 2OINA 3E90B 2WINI 1XUFA 2FOCA 1W7GH 2PKSB 2AMQA 2OD3B 3BTGE 4I32A 5FHTA 5DG6A 1P10A 4ZHAA 3SV2H 4XBCA 5DP6A 1NRNH 1IHSH 3RXIA 1SQOA 4BTTB 1DWEH 1GVLA 3A8CA 1DS2E 1GJ8B 2FOEA 4BTUB 2QF3A 4CR5A 3BIUH 3Q3KA 1ZPCA 3IWMA 2AH4X 2GT8A 1FNIA 3SN8A 1XVMA 1VGCC 1E0FD 2Y7ZA 1OWEA 1EXFA 2H6MA 3AASA 2CN0H 1ZHPA 1RTKA 4MG3A 2YOLA 2BQ7B 2SGAA 1K1LA 4E7NA 1ZRBA 1SHHB 2P8OB 2VNTA 3UNQA 2H2ZA 1GHAG 3S0NA 2Y80A 1TB6H 2VGCC 3TU7H 4WMEA 3PYHA 3ZVBA 1V3XA 5F8XA 5JPMH 3PV4A 1FPHH 1AZ8A 1BITA 1C1WH 1A4WH 4MNWA 1MU8B 2FP7B 1XUHA 1GJ6A 3LGIA 3RP2A 3GY6A 3UOUA 4WMFA 1HRTH 1DVAH 4BOHA 5ABWA 1GBBA 1VZQH 4M7GA 2XRCA 1C2KA 2J92A 3ITIA 1AQ7A 2FS9A 3SGAE 2GTBA 3SU4A 1ELDE 2ODPA 2NU4E 3A8AA 2GMTC 5HXFA 4OS1A 1CBWC 2BY5X 1GCDA 2Y5FA 1KSNA 1NY22 1C5OH 2ZHQH 2WPMS 4Y7AA 4GCHF 1QL9A 3LGVA 1CGHA 5DKMA 1TA2A 1K1OA 1OP8A 1UCYK 1HAXB 1N8OB 3SV8A 3ZVDA 3MU4A 5E0JA 1K22H 4KTUA 4X0WU 2ZGXH 2BDIA 1P01A 1LO6A 1O2GH 4KGAA 3E91A 3R3GB 2Z94A 3RLWH 1RRKA 2OBOA 1BB0B 2ANWA 1A61H 1EZUC 3LGTA 1SSXA 1F2SE 4NIVA 2JKHA 1TAWA 3GISB 4NWLA 3BG8A 1B5GH 1WV7H 1C5WB 2O8WA 3F9FA 1ZGVA 3QWCH 4ZXYH 3SJ9A 5GCHF 1FAXA 3V13A 3SUGA 1GBIA 2G5NA 2A1DB 1C5UA 1YKTA 1DT2A 3PTBA 1YPMH 2BDGA 5ETXA 1GBCA 1SQTA 3HPTB 3TIUA 1W10U 4A5TS 2BDHA 1SPJA 4LK4A 2HGTH 1EAIA 3UIRA 2BD7A 1V2JT 1SOTA 3PLBA 3MH4A 1HAOH 1OYTH 1JIRA 4Y0ZE 1YPKH 1KTTB 1ZRKA 2D8WA 2PFEA 3EE0B 1G2MA 1PJPA 2ALPA 2GP9B 1AWHB 2A4OA 3AW1A 4FU8A 2ANMH 1GVKB 1PPEE 4X8SH 5ESTE 2ZDLA 1HAVB 1ANBA 3GOVB 1LKAA 1DX5M 4NGAH 4GSOA 1QNJA 4AGKA 2W26A 1QBNA 3RXCA 1UJ1A 1TLDA 1TYNA 4Y0YE 7LPRA 3E6PH 2BZ6H 2H9HA 1OPHB 2ZA5A 5AHGH 1GHYH 2FOAA 3Q76A 1IHTH 1S83A 2XC4A 4UFEH 4ZHLU 1QFKH 4B2AA 2ZPSA 1A5HA 1KDQA 1EPTA 1P04A 2QGRA 3RC6A 2Y7XA 2UWPA 3SZNA 1JOUB 3ENSB 1ZTKA 1BTPA 1QBVH 3BTKE 1BMNH 1FY4A 1WQVH 1MBQA 1ZSJA 2FO9A 3EDXB 1FJSA 1ESBA 1CHOG 1G30B 2ZCHP 1O5FH 1O2UA 3CENA 3A80A 1PQ8A 2TBSA 4HI3A 2KAIB 1OXGA 2ZNKH 3PWCA 1B0EA 4U01A 3I29A 4IGDA 3UWIA 1IQJA 1H9IE 3FFGA 4FUBA 5L30H 2OTVA 1P2IA 3PLKA 1LHGH 1IOEA 1CE5A 3TK5A 3BTTE 4CHAB 4D76A 1NS3A 2BY7X 3SJ8A 1O3IA 3QK1A 4ABBA 1S6FA 2P8OC 1YCPM 2V35A 2G52A 2NU0E 1IQLA 4MPUA 1A3BH 5GXPA 1HJ8A 1W0ZU 2SGQE 2QCYA 1HJ9A 2W5EA 1BTYA 1Y3XA 1VCQA 1AWFH 1GMDF 1RD3B 1RJXB 3KHVA 1E36B 1D3DB 4FXGH 3AW0A 2VB0A 4U30A 1CSOE 2BD8A 2SGFE 1EAWA 1MD8A 3KIDU 2G81E 1C2JA 1TGTA 1TPPA 2Z3EA 3U1JB 4OS5A 2FMJA 2A4QA 4WY3A 3NCLA 4AB9A 2OQUA 3TJNA 3LC5A 4XOJA 1HPGA 5PTPA 1KIGH 1Q3XA 1W12U 3LJOA 1O33A 1QIXB 1V2TT 2FOHA 3FP8E 5CHAC 4I8HA 1MCTA 1MKWH 2VJ1A 3VFEA 1QB6A 4X1RU 2EC9H 1N8OC 2FI4E 3KNXA 2ZCKP 3K9XB 1V2WT 2FYRA 1O31A 3GCTG 1YPGH 4B76A 1O2LA 3VB6A 2P3UB 1SR5C 2A2QH 5DP5A 2IJOB 1RTFB 3QZQA 1O3LA 1TBQH 2AYWA 3FP6E 1S6HA 1O2MA 1LHCH 1G3EA 3RXQA 3M5NA 3LC3A 1Z71A 4YOJA 1XX9A 3M35A 4X1PU 4CRAA 1UK2A 5EQQA 5J4SA 4DURA 4E06H 1PPHE 2ZU3A 1BRAA 4UEHH 1JMOH 3MU0A 8GCHG 1GBFA 4BAHB 2AMDA 2WUBA 1C1QA 4MQAA 1OOKB 2QY0B 4K1SA 1UTLM 1O3GA 3RMNH 3VGCB 1F0SA 3K2UA 1V2KT 1Z7KA 1H8IH 1K1IA 3ODDA 3SNBA 1D4PB 1FQ3A 5JBCS 1C5LH 3KQBA 4GVUA 5A2MH 2CF8H 1C4Y2 2BYAX 2PW8H 4AGJA 3RDZA 1TX6A 3F9GA 3LONA 3E1XB 1WAYB 2J34A 2XC0A 1LPGB 1YPEH 2Q6DA 3ZVFA 3BTME 1THSH 3AAUA 2AFQB 1ELGA 1O3DA 2QF0A 3NZIA 1V2OT 4FVBA 2VIWA 1GI4A 2G55A 1RIWC 4XBBA 2BM2A 4ABDA 5DO4H 3EAJA 3CS0A 1NFUA 1O5BB 2F91A 2ZFQH 2WPJS 5C20A 4WXIA 1TX8A 4RKOB 4AFUA 4UFFH 2A4RA 3QX5H 4D9RA 1SGNE 5HMAA 2GV7A 3S69A 3T25A 1RS0A 1O2PA 2ZDMA 1RXPA 1OWIA 2H9EH 8KME2 3UQVA 1L2EA 3V0XA 2F83A 1O2QA 2ZDVH 3KQDA 4NA7A 4ABGA 3RM2H 1HLTH 1TGSZ 1W7XH 2AS9A 2HNTF 4YOGA 1J8AA 1ACBE 2BY8X 3FVFB 1Y5UT 3A8DA 1C1PA 4JZEH 3A7TA 2C8WB 4FUIA 4ABIA 1AB9B 3RXFA 1A2CH 2ZU2A 1Y8TA 3DFLA 3QO6A 4J1YA 1DANH 1YCPH 3PM3A 1XUJA 1AD8H 4DW2U 2EEKA 1WUNH 3UOPA 1ZHMA 1OKXA 4X6PA 1BRBE 4CBOA 1NRQH 1FIWA 1TNHA 3VB4A 2RA0A 1W13U 4BXWA 6LPRA 2DUCA 1GG6C 3F1SB 2XCFA 4AB8A 3SNCA 5GWZA 1EPTC 2QN5T 2YNBA 5FAHA 1QQUA 1VJAU 1BTXA 1SGCA 1W11U 3RXBA 3WY8A 1ESTA 6GCHG 2M5TA 1K1MA 1ELBA 1N1LA 3FANA 3P8FA 1UVUH 3M61U 4BAKB 4QT8C 1O3MA