3LONA

Hcv ns3-4a protease domain with ketoamide inhibitor narlaprevir
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/inhibitor
molecule keywords Genome polyprotein
publication title Candidate selection and preclinical evaluation culminating in the discovery of Narlaprevir (SCH 900518): A potent, selective and orally efficacious second generation HCV NS3 serine protease inhibitor
rcsb
source organism Hepatitis c virus subtype 1a
total genus 37
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lonA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3lonA01
1O2KA 1VZQH 1TONA 5E0JA 1YPMH 1FN6A 1X7AC 3K2UA 5CMXH 5C5NA 4YESB 3TVJB 1RTFB 1MTUA 3FVFB 1N6XA 2H5CA 1LHCH 3GYMA 3E1XB 5DP3A 1CGHA 1DPOA 1RD3B 1DITH 2HRVA 2BMGB 2D26C 1HAGE 1E37B 3STIA 1Y59T 1EB1H 2BTCE 4ZHMU 3TH4H 2ZDNA 8KME2 4GCHG 3MH6A 1FY5A 1ZR0A 2Y81A 4Y0ZE 1HB0B 1V3XA 1C5XB 3RMLH 2ZU2A 3T5FH 3RXUA 1SI5H 4YLUA 3URCA 3LC3A 4F4OC 4F49A 1O2IA 3LJJA 2GT8A 3KEEA 3MNSA 5DK1A 1GJDB 1WOFA 1ZZZA 2JETC 3A82A 3SQEE 5E0GA 1T7CA 1S0RA 1TPSA 4B2AA 1GHAG 1FQ3A 4FU9A 6GCHF 1J16A 3U98H 1KDQA 3ZV8A 4X8SH 2AMQA 1V2PT 1KXEA 1C4V2 3BTWE 3H7TA 4YOIA 3U8RH 2DE8A 1TYNA 1HYLA 1BJUA 4DJZB 1BDAA 3TJVA 1GJ7B 3E3TA 5DP4A 1O3OA 2TRMA 3RMOH 3TJUA 1G36A 1KLIH 3WY8A 2AS9A 2BD4A 2QXIA 2ZA5A 2GV7A 1UCYK 2ZFSA 1TPAE 2Z6BD 1CGJE 1NZQH 3A86A 1SGDE 3A84A 4JZIA 3RXGA 1TPOA 1NFXA 3BTKE 1GPZA 3A7VA 4HI3A 5IDKA 3ATMA 5T6FA 1BTPA 1K1PA 1P9UA 3SU1A 4B2CA 2BB4A 3ELAH 1FJSA 1SFQB 1UVOA 1YCPK 1ZPBA 3D23A 4U01A 5ESBA 3ZZ5A 4AG1A 3LGYA 2BY9X 2FZZA 5E2PA 2XRCA 2GTBA 4I8KA 1CA8B 2A32A 1S5SA 5FAHA 2Y7XA 1P03A 4X1QU 5DGJA 1G3EA 3O8DA 3BIUH 5EXLA 3F9EA 1KTSB 1Z1JA 2WPKS 1EPTC 4PROA 3A8AA 4VGCB 3UQOA 2J4IA 2EI7A 2Y7ZA 1P3CA 1QY6A 2FOCA 4JMYA 2IPHA 2VH0A 3KQDA 3RC4A 2Y82A 2Z9IA 4CRBA 1INCA 1F5LA 1UMAH 3SJOA 1KXCA 1MTWA 2C4FH 5JYIA 1GG6B 1O5BB 1HAVB 1C1PA 3GISB 2F9UA 1TGNA 2A7JA 4J1YA 1FV9A 4K3JA 4KELA 5B6OA 2Z3CA 4WXVA 3SNCA 3AW0A 3T25A 2AEIH 5AF9H 1EAXA 1W3CA 2ZDKA 1Z71A 3FAOA 3ZZ3A 2QXHA 1E0FD 2ZHQH 2I6QA 2HWLB 1BMMH 3IWMA 1ELTA 3NK8A 1HNEE 3RUOA 4OGYA 1Y8TA 2CGAA 2R3UA 1SVPA 3GDUA 2FYRA 4RKJB 2ZU4A 1V2NT 4ABBA 1LVMA 3LIWA 1LMWB 1NROH 2ZHEH 1CSOE 1OYTH 3T26A 3U1JB 1CT0E 1BBRE 1BMAA 1GBCA 4KP0A 1PPZA 2BDBA 3RU4D 1P9SA 1TWXB 4X2XA 4ESTE 1CBWC 1AE8H 5C3NA 2XWBI 2AMPA 4AYYB 1BTWA 1OWDA 1NPMA 1HPGA 1LPGB 1QL9A 4B2BA 1QGFA 2VH6A 1F0TA 1ZGVA 3K9XB 1ANEA 1FNIA 4TPYA 1ZSLA 1SGEE 1KIGH 1TX7A 1VCPA 2GMTB 1SL3A 2CHAB 4MPXA 1C2IA 1GMCF 3MO9A 3SUGA 2STBE 2ZNKH 3FFGA 1YPEH 4MPUA 3BTHE 1SHYA 2XBXA 3SOSA 1ZMJA 1Y3WA 3O8CA 1C4U2 4X2WA 1W10U 1KLJH 1AWFH 1C5RA 1PPEE 4DIHH 4YOGA 1P3EA 1TPPA 3GDSA 1ELAA 1SR5C 4YZUA 2RA0A 1OP0A 3TLOA 1OP8A 1ZMNA 2O8LA 3RLYH 1QB1A 3AAVA 1YLDA 3RXVA 4B71A 2F4LA 1TBRH 1V2RT 1WCZA 4ZKOU 1O2HA 3VGCC 1EX3A 1CGIE 1H4WA 4B74A 3S9CA 2BQWB 2FPZA 1TLDA 2NU0E 4XSKU 1BOQA 1AFQC 3SU3A 2CXVA 1AI8H 1HXEH 2ZGJA 4YOJA 2R0KA 1TRYA 2C90B 3M5MA 2VVVA 2QGRA 3A89A 1N8OC 3OYPA 1DDJA 3PMHB 3SN8A 1VGCC 3SU5A 1MZAA 3SV9A 2G51A 1JRSA 2ALPA 2FX4A 1MAYA 4INHA 4JZFH 1QHRB 1QJ6B 2V3HH 1K28D 1V2TT 1TGTA 3OX7U 2ANWA 3SNDA 5GXPA 3ZVFA 1ORFA 1SGNE 1LPZB 3TGKE 1BTXA 4IMZA 1WQVH 1ABIH 1PPHE 3BSQA 4OM9A 1SLXB 4BOHA 2BZ6H 2QF0A 1JRTA 1NO9H 3P8NA 2D2DA 3SU0A 3A7TA 3BTTE 2XCFA 3V0XA 1A5HA 3RXQA 2XNIA 4AYVB 4ABEA 1HAVA 3MNBA 1NTPA 2YOLA 4B75A 2CF9H 3QX5H 1FY1A 4H6TA 1K9OE 2JKHA 5ESTE 4AGKA 4ABIA 2FOFA 1GDQA 1EUFA 3VB3A 2Z7FE 3ZVGA 4O97A 4DT7B 4AFQA 1IQNA 4FUCA 1QRZA 1SHHB 3BTDE 1F7ZA 2C8ZB 3SI4H 1O38A 5LPFA 1S82A 1MUEB 3SW2B 1GJAB 1AUTC 2BVXH 1XUGA 3MI4A 1LPKB 1DXPA 3MU8A 3MNXA 4K1EA 3KQCA 1G2LA 3A8BA 2Q6FA 5EPNA 2WUCA 4U32A 5T6DA 3RXJA 3UIRA 4IS5A 1H8DH 1EAWA 1TNIA 2PV9B 1YLCA 2JETB 5AVDA 1G2MA 1IQHA 1HIAB 2AGIX 3VPKA 1OPHB 6ESTA 2K1QA 2QAAA 1AN1E 1YKTA 4UE7H 4MPVA 1GJBB 4RN6A 5GCHG 4D8NA 1HJ8A 2R2MB 5G4BA 4BAKB 5JPMH 1P57B 2B5TB 3QN7A 2WPMS 1HAOH 1UTKA 2EC9H 2A5IA 2C8WB 1O2VA 4SGAE 3RC6A 3T28A 5LPRA 2NU4E 3ATLA 5GJ4B 4ABDA 2QXJA 3TPIZ 2Z9JA 1P2MA 1THPB 2J92A 9LPRA 4AN7A 1EZSC 3MYWA 1A46H 1ELEE 5A2MH 1Z1IA 2GT7A 3PB1E 3F9HA 1C1WH 2FS9A 2VIWA 4HZHA 1NFWA 3E6PH 2FO9A 2FWWA 2QA9E 4XOJA 2BY6X 2ZPRA 1V2WT 1UVSH 1EZUC 1GVKB 3RXAA 1VR1H 2ZFQH 4RKOB 3MTYA 4Y7BA 3W94A 1XMNB 3O8RA 4FUHA 4X8UH 3HATH 3KF2A 2ANYA 1C5NH 1JIRA 1B7XB 1EPTB 3UWJH 4E05H 2F3CE 4ABJA 1L4DA 2ZI2H 1WBGB 2G5VA 1AY6H 2BDAA 1AB9C 3NUMA 4TY7A 2GX4A 1CU1A 1G3CA 4AFUA 4NGAH 4UEHH 1IQLA 4AORA 1MU8B 3ATIA 4FUFA 3KGPA 3GY6A 2A1DB 1GI1A 5C67A 2P95A 1DVAH 2XC5A 1HJAC 5DP6A 4CH2B 4DGJA 4XE4A 1UTPA 1PJPA 4CBNA 5T1VA 1GJ5H 1DY8A 4NWKA 4E7RG 1W12U 1O3HA 1P06A 3B8JA 3LGUA 4K69A 3M7UA 1GI9B 2W7UA 5ABWA 3QZRA 1UTNA 3Q3YA 4M7GA 1T4UH 6LPRA 1BRCE 4MNYA 3IG6B 3AK5A 3A7YA 4INLA 1UVTH 5FPSA 2ZQ1A 2F9OA 3VB5A 3ODFA 1LVYA 1LDTT 1D4PB 1W0ZU 2UUKB 5DG6A 4ZHAA 1C9TA 3U9AH 3ZYEA 2XYAA 3U1IB 1QTFA 1W14U 3M61U 5IYTA 1GBMA 2XBWA 4GSOA 1B0EA 1A3EH 1CBWB 3P92A 2AMDA 1TNLA 2CF8H 4CRGA 3HGPA 1UTMA 3L3TA 1C5TA 3NCLA 3B23B 1AGJA 1SLVB 4NFFA 1EZQA 2VBCA 1P0SH 3M7TA 1MD8A 2AIPA 3SV2H 4Z6AH 3TJNA 3SZEA 2SNVA 1LHDH 2BDYA 3AW1A 4MTBA 1P2QA 1ANDA 2C93B 1GHAF 1C5ZB 1DM4B 3PV2A 1IHTH 1GJ9B 3LGTA 1D6WA 1HIAA 1NRPH 3UOPA 2VWLA 2ZFTA 1C2GA 3UOUA 1SGTA 2ZHWH 3TNSA 4QT8C 1O3GA 3QO6A 4GAWA 2G4UA 3PTNA 1FPCH 1IOEA 2XCNA 4Y79A 1MAXA 1C5QA 1DWBH 1YP9A 3NZIA 2Y5HA 3NPSA 4TWWA 1UK4A 3QDZB 3ZVCA 4DY7B 1P09A 2CJIA 3SNEA 3ZVEA 5TCCA 4MDSA 1H9IE 2OINA 2Y5FA 3P6ZB 3VGCB 1KYNA 4Q2KA 1ESTA 4CHAC 7ESTE 2ZGCA 1QQ4A 1NN6A 1GBLA 2V3OH 1AFQB 1GJ4H 2F9PA 2ZDVH 2W7SA 1UTOA 1TX6A 1B5GH 3TU7H 2XBYA 1A0JA 1O2RA 4TWYA 3A8CA 1N8OB 3LH3A 3E16B 3U8TH 1WTHD 3ZZ9A 1BBRH 1PQAA 2A4GA 3TJOA 2QY0B 4Q7YA 1VGCB 1P10A 1V2MT 1J8AA 3VXFH 4Y8ZA 1W0YH 2R3YA 2R9PA 4ABHA 4GVUA 1C5MD 3ATKA 4Z0KA 1OWEA 3UNQA 1SGIB 3UWIA 1EPTA 2WPLS 1G37A 1TNKA 2A2XH 4BTTB 1TE0A 5K0HA 1P2KA 2HPQH 4JK6A 4UFEH 5FPTA 1BA8B 5HXFA 5E8EH 2VWMA 2R0LA 5E0HA 1NFYA 1PPBH 2IN2A 3LH1A 1GBEA 5HMAA 4FU7A 1O3IA 1V2QT 1PPCE 1QIXB 1RJXB 4AGJA 3UR6A 1AD8H 1EAIA 1ACBE 1EKBB 3A88A 1O5CB 4ZXYH 4NIXA 3NXPA 4HGCA 1KY9A 1ZMLA 2ULLA 1O2TA 4JZDH 2DE9A 4I33A 3MFJA 5FX6A 1LHFH 2PKSC 3QUMP 3DFJA 1LO6A 2VIDA 1GCTC 3E0PB 1GJ8B 1G3DA 4ZKSU 4D9RA 1GI4A 2VIOA 2TBSA 3M7QA 2FI4E 1SB1H 1ARBA 3E0NB 2ZO3H 4X6OA 4FUDA 1BBRK 1HLTH 2A4QA 3A87A 4ISNA 2ZU3A 3ZZ4A 2A4OA 1UTQA 5A8ZA 1K1MA 2DUCA 2BXTH 1AWHB 3HK3B 4A6LA 2AYWA 3UY9A 4JK5A 1GGDB 1MKWH 4FU8A 2Z94A 4ZKNU 1B0FA 1F2SE 1A1RA 1QRXA 2JH0D 2ZTZA 3HK6B 5L2YH 2F9VA 1MU6B 2ZGBH 3KIDU 4FVBA 1O5DH 5CHAC 2EEKA 5EXMA 3QGJA 3K65B 1O30A 1EJAA 1FIZA 3BTQE 4WY3A 1JBUH 3LDXH 1KSNA 1Z8IB 2ZU1A 1C1NA 1K1LA 4BTIB 2HLCA 1BHXB 1YCPM 2I6SA 2EI6A 3EE0B 3PLBA 1PYTC 1T31A 2AGEX 4CH8B 1CA0C 2Z3DA 4ISOA 1ZHMA 2P59A 4FUIA 4X8VH 1OSSA 2HNTF 1NU9A 3BTGE 3I78A 1LHGH 1O2OA 3M3VA 1IQGA 5JBBS 2RG3A 3D65E 2SGFE 1DE7H 5GPIB 2P8OC 1O32A 4ZKRU 3RXCA 1S83A 1ETRH 3PTBA 1F5RA 4DIIH 2BDGA 1HAIH 1H9HE 2D1JA 3BEUA 2P93A 1ZPCA 1HGTH 5AFYH 1U6QA 4UONA 3OTPA 4CREA 4LZ4B 3A8DA 3TGJE 1EP6A 1AB9B 1BRAA 4NIVA 3SQHE 3SU4A 1QR3E 2FS8A 2FOMB 1O5FH 4GLYA 5JDUB 3SI3H 1AVXA 1QB9A 2ZCHP 1T4VH 3T29A 1J14A 1Q2WA 1A0LA 3R0FA 4D7GA 5C20A 1UO6A 1MKWK 2A7HA 5EW2H 1O2GH 5A09A 2ZPQA 3TGIE 2OK5A 5PTPA 2H9EH 1ZGIA 2UUYA 1V2KT 4H42U 3TIUA 1C1OA 4FUJA 1NT1A 2OC8A 2FOGA 2J95A 4UFDH 3L33A 1O2JA 4Y6DA 5L6NH 2BZAA 2NWNA 3QZQA 2PKAB 1T8OA 3MH4A 5HM2A 1Z6JH 3P8OA 3RXSA 1QA7A 3SNAA 1GI0A 2ANKH 6CHAC 1L1GA 2XC4A 3LC5A 1QURH 1J17T 3DUXH 4YLQH 2PUQH 5C1XA 3V12A 1BMNH 4D9QA 4LZ1H 4Y11E 2VIVA 2G55A 1T8LA 3GYLB 2BDCA 2FOHA 1AQ7A 4JYTA 4WH8A 4Y8XA 2YNAA 5C1UA 2A31A 2ALVA 5GCHF 2C8XB 1ZJDA 3RXRA 3SGBE 1O3AA 4MQAA 1UK3A 1BZXE 2GCTB 3RXKA 3L6PA 3A80A 1ELGA 1O0DH 1P05A 1QL8A 5SGAE 4CRCA 1O3MA 1IQKA 1FIWA 2BVSH 1CO7E 1L1NA 2QXGA 2VGCC 1O3DA 2Y6TA 3GDVA 3BTFE 3KL6A 6GCHG 2ASUB 2FXRA 1ARCA 2ZCKP 3SGQE 2GCHF 2VINA 2ZP0H 5FHTA 1OYQA 1BTZA 1XXDA 1BTYA 1ZTLA 3QGNB 1TIOA 2FOBA 4UFGH 1C5WB 1OKXA 1OOKB 1VCWA 4AB8A 1ID5H 3RXBA 3UPEA 3MHWU 5FXLA 3TK6A 2Z3EA 4CHAB 2HVXA 1FAKH 3C1KA 3OY6U 3K6YA 4ASHA 1WQSA 2BQ7B 4GUXA 4KTUA 3EGKH 4CRDA 4MNXA 3S7KB 3R3GB 5FPYA 2WZQA 3IITA 1GI7B 1ZHPA 2SNWA 2GKVE 3F68H 1W7XH 2XXLA 3GCNA 4ABGA 3K6ZA 2ZCLP 4O9VA 1QRWA 2G8TA 5T3HA 1GBBA 3P17H 2EA3A 2BX3A 4Y0YE 5A0BA 2C3SA 4JYVH 3ODDA 4R0IA 2UUJB 3I29A 1QBVH 1N1LA 2OC7A 1O3NA 2BX4A 1A7SA 4Y71A 1GJCB 1GI6A 4U2WA 3RXTA 1EATA 2Y80A 1C4Y2 2PSYA 1XVMA 5EOKA 3SNBA 2G52A 2OLGA 1WYKA 3M35A 1IQEA 4I8JA 1SGQE 3MU1A 2GZ8A 3GOVB 1KXBA 3TNTA 3SJKA 2SGPE 3ESTA 3TH2H 4NCYA 1UHBB 4IBLH 1O2NA 1UK2A 1GMHG 5HGGA 2PKSB 1OWHA 1XVOA 2QYIA 3TH3H 5HM9A 2NU3E 2PKAA 4BAQB 1FY8E 1GCTB 1BB0B 1OXGA 1QQUA 4DCDA 2A7CA 4INKA 1OWKA 2V35A 1D9IA 1L4ZA 1LQEA 3BG4C 3FANA 2ZECA 2SFAA 1C5LH 3RP2A 1A5GH 4GHQA 1XXFA 4GHTA 1C5YB 4OS6A 2O8UA 4WMEA 2OQUA 7LPRA 3O8BA 3MWIU 1HAYB 1HBTH 1VITH 2IOTA 2HPPH 1C2EA 1NY22 2A4RA 4ZAEA 1O3KA 2Z9LA 2BOHB 1BT7A 1XUFA 1SMFE 3ZVBA 2BD2A 5BPEA 1IQJA 3PROA 2A0QB 4YTAA 1LVOA 1V2LT 2BLWA 1AZ8A 3SV7A 2ZTYA 3T2NA 2C8YB 2RDLA 2G81E 2KAIB 4I32A 3LPRA 2BY7X 1HRTH 2OUAA 4AOQA 5CHAB 2GZ9A 1JWTA 3RXHA 2WINI 3P8GA 1GMDG 1KLTA 5F8ZA 3PLKA 1XUIA 4X6MA 1AUJA 3RDZA 1UVPA 2J34A 1F0RA 5EODA 1EAUA 3W95A 3M5NA 3N7OA 4BAHB 1EQ9A 8LPRA 1C1SA 2RCEA 5AFZH 2FTLE 5DO4H 2G00A 4LXBH 4ZMAH 4XBBA 2AIQA 4K1SA 4HTCH 2P8OB 1PQ8A 5EXNA 2VB0A 2IJD1 5ETXA 1WUNH 2ZDAH 3F9GA 2BM2A 2ZWLH 5F8XA 5A8YA 1GHVH 3SJ8A 1GVLA 2Y5GA 1G3BA 4WXIA 3SJ9A 1YF4A 1C2HA 3SO3A 1HAHH 4WH6A 1WXRA 8GCHG 1O2SA 1O5GH 3ZVAA 5EGMA 1EP5A 1EASA 1O3EA 1RXPA 1BMLA 1Y3VA 1O2XA 1O34A 1O3FA 4OS7A 1AZZA 1O3JA 2XW9A 5GDSH 4MVNA 2OD3B 1SGPE 2XBVA 4FUGA 4O3UA 1A61H 4TPIZ 2BD9A 1ELFA 1CE5A 4E7NA 3H09A 2P94A 2XC0A 4K5ZA 5HYOA 3MO6A 4SGBE 1VITG 1IQIA 1K2I1 1C5SA 2PGBB 1DICA 1OWIA 1GBKA 1TNHA 1P04A 1KXAA 5GNDA 3PMJA 3EDXB 2LPRA 2ZDMA 4TY6A 1SLUB 1TRMA 5F03A 4XBCA 2F9NA 1UHBA 3A7XA 1CHOG 2PGQB 4GCHF 4CR5A 6CHAB 2A45B 3MU5A 3RXFA 1W7GH 4AFZA 5EQQA 4CRAA 2ZKSA 2QF3A 4NSVA 1ETSH 1KXFA 2A5AA 3FP7E 3KCGH 3PV4A 1NRRH 1SGCA 1TA6A 1O5AB 5I25A 2V0BA 4RI0A 2BXUH 1SG8B 1C5PA 1JMOH 1IAUA 2FP7B 5A0CA 5L30H 1T32A 1SLWB 1E36B 2OBQA 4X1RU 1HCGA 4I8HA 1RS0A 3A7WA 3RMNH 1ANCA 3H5CB 1K21H 2BOKA 2HALA 1EOLA 1C5OH 1C9PA 1JIMA 1DANH 1UTJA 2OCVB 4X1PU 1ZJKA 5GWZA 2QN5T 1JXPA 2RA3A 5DP8A 2UUFB 1Y5BT 3OU0A 4U30A 4DW2U 1Z6EA 1AE5A 2VGCB 1F0UA 3RXEA 1ZSJA 1Z8RA 2KAIA 3MOCA 1Y5AT 3P95A 4FVDA 1L0ZA 1K1IA 1O2MA 4B6EA 1YPJH 4LOYH 1MCVA 2VIQA 3TK9A 2FLRH 2HGTH 3LOXA 3PYHA 3STJA 3UTUH 1G30B 3C27B 1O2LA 5FBEA 2OXSA 2FI5E 1DWCH 2VNTA 4IW4E 2H1UA 1D6RA 1OS8A 2ZU5A 4X2VA 1MKXH 1PPGE 2AFQB 1DX5M 2FMJA 1TGBA 2B7DH 4AX9H 1MTVA 1FPHH 2BD8A 1MCTA 1V6DA 3S7HB 2ZEBA 1P11E 3VXEH 4UDWH 2UWLA 1OWJA 2BDHA 1Y3YA 1RTKA 3RXIA 1C1VH 2W5EA 1THSH 1TOCB 2W3IA 5F8TA 1XUJA 1TB6H 4THNH 4BXSA 3RM2H 1L2EA 2SGAA 1O2PA 1FONA 1DS2E 3BF6H 2H9TH 1P02A 3FZDA 3UNRA 1EJMA 1GDNA 4FXGH 1F5KU 2A5KA 1TNJA 1G9IE 1PQ5A 4R8TB 4YT6H 1BHXF 1FI8A 1FMGA 1A2CH 1C2JA 3F6UH 4ABAA 2BHGA 3G01A 1KTTB 1EXFA 1LHEH 1O3CA 1GVZA 2BYAX 3BIVH 1XKBC 1BJVA 1V2ST 5JB8S 3GICB 1BQYA 3CS7A 4NSYA 2WHXA 1A0HB 2M5TA 3V7TA 3QWCH 1HDTH 3GCTG 1UVUH 1O2YA 2XTTB 1YCPH 2OQ5A 2PHBA 3GY2A 2GD4B 1DSUA 3ITIA 4WJG2 4ISHH 2WV5A 3S69A 4I7YH 1OX1A 3M37A 1MKXK 1DUAA 2V6NA 5TCAA 2BD7A 1GBDA 1RIWC 1TMUH 1ZHRA 3BTME 3BG4B 1GI3A 4O03A 1QCPA 3QTOH 7GCHG 1XKAC 4NFEA 3ZZ6A 1ELBA 5DP9A 2ODPA 2Q6GA 1ZRKA 1NU7B 3BG8A 1YPGH 1GBIA 1MTSA 3PMBB 3SV6A 2D8WA 1O3PB 4AB9A 5J4QA 3KNXA 1VJAU 1TOMH 2QIQA 1IQFA 3S0NA 1N6YA 1H1BA 1P12E 1K1OA 1SC8U 4GPGA 4NIWA 1DWDH 1H8IH 1ZPZA 5JBTA 1D3DB 1MQ5A 3SUFA 4I31A 3M36A 1GWAA 4OS2A 1O33A 3HPTB 1JOUB 3UUZA 1PFXC 1ZOMA 2TGTA 3LGIA 3PLPA 4CR9A 3SU2A 1G32B 2O9QA 1TQ0B 2OBOA 3A83A 1GHBG 3B9FH 1FY4A 1AVWA 3FP8E 3Q76A 2PTNA 4ISLA 4MPWA 1GCDA 2ZC9H 4DG4A 2AH4X 3PV5A 5FCRA 2J94A 2ZTXA 3PWCA 1GJ6A 1A5IA 4AFSA 1C1UH 3DHKH 1AIXH 1HV7A 1TRNA 3P70B 1EB2A 1EZXC 1PPFE 3S9AA 8ESTE 2WUBA 4KTCA 3SHAH 2BDIA 1NRQH 1DXWA 1MTNC 1WTGH 3RLWH 3T62A 5I46H 4NIYA 1RTLA 1YC0A 3SUDA 2ZGHA 2VVUA 1THRH 2P3FH 5DPAA 2Q1JA 1DWEH 3RXMA 2PUXB 1CT4E 4OGXA 2P3UB 2J9NA 3DFLA 1QFKH 2J2UA 3M5LA 3SUEA 1QBOA 5EQSA 1P2IA 2VU8E 1SPJA 2NU1E 3OY5U 3RMMH 4MLFB 1GHYH 2PLXA 1K22H 1SGFG 1NRNH 9ESTA 1HJAB 5GIBA 3RU4T 1O5EH 2IJOB 1S6FA 1HXFH 4WMFA 4XFQA 3QK1A 1FN8A 1D3QB 1AHTH 2W3KA 1SOZA 2JH5D 1F0SA 1FLEE 1Q3XA 4Y8YA 2VVCA 4A1TA 5T6GA 4DVAU 1IHSH 4H4FA 3DD2H 3HKIB 3EAJA 4BAOB 1E38B 1GMHF 5EW1H 4YM9A 3ZZAA 1HFDA 1D3PB 1GBHA 3D62A 3QTVH 3UNSA 2WPHS 2XWAA 3AAUA 4Y7AA 3GCHC 4UFFH 2TGPZ 4A5TS 5C2ZA 1T8NA 3MU4A 2ZFRH 4ZHLU 2H6MA 1LKAA 1C2DA 4ZUHA 1S85A 1SGRE 1W8BH 1MD7A 2FTMA 1C5VA 2FODA 1D3TB 1TABE 2VIPA 4M9FA 1C1MA 1MBMA 2UWOA 1ZYOA 1PQ7A 2TPIZ 5FX5A 2H9HA 1GHWH 1O2UA 3Q3KA 4B6FA 1FDPA 3SV8A 1P01A 5CE1A 2SGDE 2P16A 4RSPA 1FXYA 5DP7A 4KTSA 1SOTA 1TMBH 2PTCE 4NZLA 1GI8B 5FBIA 5FCKA 3JZ1B 2ZG0H 3LT3A 1UCYE 4IC6A 3MH7A 3RC5A 2H2ZA 2BY5X 1KXDA 1GMDF 3PO1C 4NA7A 1GI5A 3Q77A 3T27A 4ZH8A 2ZHDA 4A1VA 1DT2A 3LJOA 1S81A 1A4WH 5A8XA 4J2YB 4IMQA 1ESBA 1HAXB 1SGFA 1YPHE 3FZZA 3V3MA 1MZDA 2BLQA 4JYUH 1RFNA 2WV9A 1P2NA 2GVFA 4Q80A 1TQ7B 1GBTA 2FX6A 2THFB 2WPJS 3KHVA 5EU8A 1LKBA 1O37A 5K7RA 2HOBA 1Z7KA 2UWPA 3BEFB 3SORA 3V13A 4IGDA 2ZIQH 1SSXA 7KMEH 2YNBA 4BTUB 2PWXA 1QA0A 5AHGH 4WWYA 4B76A 2VWNA 2FOEA 5JBAS 3RU4E 3EYDA 5TJXA 1GL0E 2ILNA 4MG3A 1BCUH 4K2YA 4BNRA 1ZSKA 3CS0A 5L2ZH 1M9UA 2ZHFH 4K8YA 2WYJA 4DURA 2OC1A 8GCHF 1DLKB 3RXPA 2GDDA 1GHZA 2BLOA 3NWUA 4K1TA 4B73A 3Q3XA 2BY8X 1V2OT 1BUIA 2GV6A 3Q00A 4OS4A 5A0AE 1SQOA 1UTLM 4X1NU 2OTVA 1ZTKA 3ZVDA 1ELCA 2GDEH 1SQAA 1IQMA 1VITF 3VB6A 3ZZBA 3HGNA 1LCYA 4Q7ZA 1LTOA 4IN2A 1DUEA 2Z9GA 4WVPE 1SQTA 3SGAE 1P2JA 3GY3A 5F6MA 2ODQA 3BN9A 4X6PA 4DOQA 3E8LA 2FIRH 2OP9A 4Q7XA 1HAPH 1CHOF 1WAYB 2SGEE 4WMDA 3FP6E 1GDUA 5EQRA 1GHXH 1ZLRA 1SFIA 4CBOA 3AVZA 1NM6A 2AGGX 2ZF0H 3KQBA 4X2YA 1S84A 3TK5A 1FAXA 1RIWB 3E91A 1QNJA 4MNWA 1DOJA 1FUJA 1TALA 2O8MA 1NS3A 1SBWA 1ZRBA 2B0FA 4A7IB 3DT0H 1TA2A 2LNCA 1Q31A 4ZXXH 4MNVA 2F83A 2QV1A 5BRRE 3A85A 1YBWA 1YPHC 3UREA 4I8LA 3M3TA 1TFXA 1ANBA 2WYGA 1TGCA 1MQ6A 1WSSH 3QLPH 3MMGA 4OS1A 3M5OA 2CN0H 3PMAB 3EA7A 1GMCG 3GY4A 3UFAA 4D7FA 2BD5A 3OTJE 3CENA 1V2VT 1GGDC 1HAZB 1Y3UA 4X1SU 3EQ0H 5C1YA 2H5DA 2HNTE 1SGYE 1O2ZA 3ZV9A 3F9FA 4JZEH 5LH8A 2B8OH 4WF8A 4ISIH 2BVRH 1WV7H 4A1XA 1CA0B 1L1JA 2B9LA 2PW8H 2GCHG 1QL7A 2ZFPH 1Z8GA 1GL1A 2ODYB 2ANMH 3SU6A 2G4TA 2G5NA 3F1SB 3OSYA 4X0WU 4A92A 2TGDA 4KKDA 1LQDB 2PFEA 3URDA 1QJ7B 4YT7H 1FZZA 1T8MA 3SYJA 1CT2E 5H4IB 1S0QA 1VCQA 1BTUA 5J4SA 1MTNB 2P3TB 4NZQA 2VWOA 1AKSB 2F9BH 3BEIB 1W11U 1YPLH 3RXOA 1H9LB 3ATWA 1EJNA 1Y3XA 5EG4A 1C5UA 2ESTE 4X6NA 2NU2E 1O2QA 1GBJA 4I8GA 4VGCC 1J15A 2R2WU 1F92A 3HKJB 3RXLA 4BXWA 5LGOA 1YGCH 3ZZ8A 2O8WA 3MH5A 3EA8A 3RXDA 4KGAA 3DA9B 1MMJN 3VEQB 1TAWA 3E90B 1K1JA 1RRKA 4ZROA 1O35A 2F91A 1O31A 1C2FA 2ZDLA 1GG6C 1XUKA 2TGAA 2QCYA 4NWLA 2BQ6B 1ABJH 3MNCA 4NA8A 1BTHH 1V2JT 5EPYA 1Y5UT 1AVGH 1MBQA 1S6HA 1ELVA 2GP9B 2ZGXH 1AFEH 3VB7A 3JZ2B 4IN1A 3I77A 5JBCS 3LGWA 1GBFA 3GCTF 4CRFA 2CV3A 2W26A 1AU8A 5E2OA 3U69H 3LGVA 2WV4A 1NC6A 3GCOA 1W2KH 2TIOA 3ZZ7A 2QC2A 1CHGA 3GCHB 1NESE 3GY8A 2BLVA 1YYY1 1WU1A 1TBZH 1MH0A 1XM1A 4FUEA 3ZZCA 1PYTD 3P8FA 7GCHF 1V2UT 4FUBA 3LKWA 2WPIS 2HNTC 1O2WA 2GGVB 2PSXA 1GI2A 2BD3A 5DP5A 4HFPB 3BTEE 1C2MA 1RGQA 1O3BA 3UR9A 1BRUP 2EI8A 2STAE 4Y10E 4B1TA 3UQVA 1TMTH 1TGSZ 1TNGA 3A81A 5DKMA 2VJ1A 1HJ9A 1O36A 2CHAC 1XUHA 1VJ9U 2GMTC 4IC5A 1KDQB 2GZ7A 1DLEA 3SHCH 1K1NA 3S9BA 1P2OA 5C5OA 2CMYA 4K60A 1ETTH 1YPKH 2ZQ2A 4Y76A 2GCTC 3PM3A 1E34B 3SZNA 3LONA 2FM2A 1ELDE 2J38A 2FDAA 1Z8JB 3PO1B 3M3SA 4LK4A 2FOAA 1GHBF 1QBNA 4UD9H 1BRBE 2FLBH 1NFUA 3H7OA 1DY9A 1YM0A 3SBKA 4OS5A 4TYDA 1TX8A 2Q6DA 3ZYDA 3U8OH 1UJ1A 4YO9A 4NG9H 2OC0A 1HUTH 1C1TA 1C2LA 1ZTJA 1GBAA 3NKKA 3RM0H 1EOJA 3A7ZA 1CQQA 3KQEA 1E35B 4E06H 2O8TA 4O3TA 4ABFA 5JB9S 1QB6A 3MO3A 3BV9B 3KN2A 1C2KA 1DFPA 1BITA 3D49H 1AMHA 1QJ1B 5B6LA 2ZFFH 3MU0A 4AG2A 3CP7A 4X8TH 1AKSA 4K8BA 2FEQH 4D76A 1CVWH 4JCNA 4AZ2B 1W13U 1TBQH 2FESH 1DSTA 2ZZUH 2FI3E 1O39A 3GY5A 1J9CH 2A2QH 1BIOA 1C1RA 1O3LA 4XBDA 3GY7A 4BAMB 1C1QA 1OP2A 3ZZDA 3SJIA 4BANB 4JZ1A 1NRSH 1A3BH 2PR3A 1P8VC 4NA9H 3LU9B 2AERH 3VFEA 5DJ7A 1LVBA 1AO5A 3AASA 1UCYH 2SGQE 1FY3A 2JH6D 1XX9A 5LPEA 3PWBA 4H6SB 3TITA 2Z9KA 2ZPSA 3VB4A 3EA9A 4XDEA 2FYQA 3ENSB 1ESAA
chains in the Genus database with same CATH superfamily
1O2KA 1VZQH 1TONA 5E0JA 1YPMH 1FN6A 1X7AC 3K2UA 4ACBA 5CMXH 5C5NA 4YESB 3TVJB 1RTFB 1MTUA 3FVFB 1N6XA 2H5CA 1LHCH 3GYMA 3E1XB 5DP3A 1CGHA 1DPOA 1RD3B 1DITH 2HRVA 2BMGB 2D26C 1HAGE 1E37B 3STIA 1Y59T 1EB1H 2BTCE 4ZHMU 4TSFD 3TH4H 2ZDNA 8KME2 4GCHG 3MH6A 1FY5A 1ZR0A 2Y81A 4Y0ZE 1HB0B 1V3XA 1C5XB 4YXWD 3RMLH 2ZU2A 3T5FH 3RXUA 1SI5H 4YLUA 3URCA 3LC3A 4F4OC 4F49A 1O2IA 3LJJA 2GT8A 3KEEA 3MNSA 5DK1A 1GJDB 1WOFA 1ZZZA 2JETC 3A82A 3SQEE 2J98A 5E0GA 1T7CA 1S0RA 1TPSA 4B2AA 1GHAG 1FQ3A 4FU9A 6GCHF 1J16A 3U98H 1KDQA 3ZV8A 4X8SH 2AMQA 1V2PT 1KXEA 1C4V2 3BTWE 3H7TA 4YOIA 3U8RH 2DE8A 1K0HA 1TYNA 1HYLA 1BJUA 4DJZB 1BDAA 3TJVA 1GJ7B 3E3TA 5DP4A 1O3OA 2TRMA 3RMOH 3TJUA 1G36A 1KLIH 3WY8A 2AS9A 2BD4A 2QXIA 2ZA5A 2GV7A 1UCYK 2ZFSA 1TPAE 2Z6BD 1CGJE 1NZQH 3A86A 1SGDE 3A84A 4JZIA 3RXGA 1TPOA 1NFXA 3BTKE 1GPZA 3A7VA 4HI3A 5IDKA 3ATMA 2WSSD 5T6FA 4TT3D 1BTPA 1K1PA 1P9UA 3SU1A 4B2CA 2BB4A 3ELAH 1FJSA 2YMSC 1SFQB 1UVOA 1YCPK 1ZPBA 3D23A 4U01A 5ESBA 3ZZ5A 4AG1A 3LGYA 2BY9X 2FZZA 3CNRA 5E2PA 2XRCA 2GTBA 4I8KA 1CA8B 2A32A 1S5SA 5FAHA 2Y7XA 1P03A 4X1QU 5DGJA 1G3EA 3O8DA 3BIUH 5EXLA 3F9EA 1KTSB 1Z1JA 2WPKS 1EPTC 4PROA 3A8AA 4VGCB 4F48B 1E79D 3UQOA 2J4IA 2EI7A 2Y7ZA 1P3CA 1QY6A 2FOCA 4JMYA 2IPHA 3FN8A 2VH0A 3KQDA 3RC4A 5EIYA 2Y82A 2Z9IA 4CRBA 1INCA 1F5LA 1UMAH 2W6ID 3SJOA 1KXCA 1MTWA 2HLDD 2C4FH 5JYIA 1UW7A 1GG6B 1O5BB 2RDEA 1HAVB 1C1PA 3GISB 2F9UA 1TGNA 2A7JA 4J1YA 1FV9A 4K3JA 4KELA 5B6OA 2Z3CA 4WXVA 3SNCA 3AW0A 3T25A 2AEIH 2RFKC 5AF9H 1EAXA 1W3CA 2ZDKA 1Z71A 3FAOA 3ZZ3A 2QXHA 1E0FD 2ZHQH 2I6QA 2HWLB 1BMMH 3IWMA 1ELTA 3NK8A 1HNEE 3RUOA 4OGYA 1Y8TA 2CGAA 2R3UA 1SVPA 3GDUA 2FYRA 4RKJB 4XD7D 2ZU4A 1E1RD 1V2NT 4ABBA 1LVMA 3LIWA 1LMWB 1NROH 2ZHEH 1CSOE 1OYTH 3T26A 3U1JB 1CT0E 1BBRE 1BMAA 1GBCA 4KP0A 1PPZA 2BDBA 3RU4D 1P9SA 2F43B 1TWXB 4X2XA 4ESTE 1CBWC 1AE8H 5C3NA 2XWBI 2AMPA 4AYYB 1BTWA 1OWDA 1NPMA 1HPGA 1LPGB 1QL9A 4B2BA 1QGFA 2VH6A 1F0TA 1ZGVA 3K9XB 1ANEA 1FNIA 4TPYA 1ZSLA 1SGEE 1KIGH 1TX7A 1VCPA 2GMTB 1SL3A 2CHAB 4MPXA 1C2IA 1GMCF 3MO9A 3SUGA 4Q63A 2STBE 2ZNKH 3FFGA 1YPEH 4MPUA 3BTHE 1SHYA 2XBXA 3SOSA 1ZMJA 1Y3WA 3O8CA 1C4U2 4X2WA 1W10U 1KLJH 1AWFH 1C5RA 1PPEE 4DIHH 4YOGA 1P3EA 1TPPA 3GDSA 5EJ1A 1ELAA 1SR5C 5HKKD 4YZUA 2RA0A 1OP0A 3TLOA 1OP8A 1ZMNA 2O8LA 3RLYH 1QB1A 3AAVA 1YLDA 3RXVA 4B71A 2F4LA 1TBRH 1V2RT 1WCZA 4ZKOU 1O2HA 3VGCC 1EX3A 1CGIE 1H4WA 4B74A 3S9CA 2BQWB 2FPZA 1TLDA 2NU0E 4XSKU 1BOQA 1AFQC 3SU3A 2CXVA 1AI8H 1HXEH 2ZGJA 4YOJA 2R0KA 1TRYA 2C90B 3M5MA 2VVVA 2QGRA 3A89A 1N8OC 3OYPA 1DDJA 3PMHB 3SN8A 1VGCC 3SU5A 1MZAA 3SV9A 2G51A 1JRSA 2ALPA 2FX4A 1MAYA 4INHA 4JZFH 1QHRB 1QJ6B 2V3HH 1K28D 1V2TT 1TGTA 3OX7U 4FETA 2ANWA 3SNDA 5GXPA 3ZVFA 1ORFA 1SGNE 1LPZB 3TGKE 1BTXA 4IMZA 1WQVH 1ABIH 1PPHE 3BSQA 4OM9A 1SLXB 4BOHA 2BZ6H 1YLNA 2QF0A 3UAIC 1JRTA 1NO9H 3P8NA 2D2DA 3SU0A 3A7TA 3BTTE 2XCFA 3V0XA 4HG6A 1A5HA 3RXQA 2XNIA 4AYVB 4ABEA 1HAVA 3MNBA 1NTPA 2YOLA 4B75A 2CF9H 3QX5H 1FY1A 4H6TA 1K9OE 2JKHA 3DSGA 5ESTE 4ABIA 4AGKA 2FOFA 3F2FA 1GDQA 1EUFA 3VB3A 2QF4A 2Z7FE 3ZVGA 4O97A 4DT7B 4AFQA 1IQNA 4FUCA 1QRZA 1SHHB 3BTDE 1F7ZA 2C8ZB 3SI4H 1O38A 5LPFA 1S82A 1MUEB 4RT0A 3SW2B 1GJAB 1AUTC 2BVXH 1XUGA 3MI4A 1LPKB 1DXPA 3MU8A 2GJGA 3MNXA 4K1EA 3KQCA 1G2LA 3A8BA 3WWFA 2Q6FA 5EPNA 2WUCA 4U32A 5T6DA 3RXJA 3UIRA 4IS5A 1H8DH 1EAWA 1TNIA 2PV9B 1YLCA 2JETB 5AVDA 1G2MA 1IQHA 1HIAB 2AGIX 3VPKA 1OPHB 6ESTA 2K1QA 2QAAA 1AN1E 1YKTA 4UE7H 4MPVA 1GJBB 4RN6A 5GCHG 4D8NA 1HJ8A 1BMFD 2R2MB 5G4BA 4BAKB 5JPMH 1P57B 2B5TB 3QN7A 3MQKC 4RT1A 4FOUC 2WPMS 1HAOH 1UTKA 2EC9H 2A5IA 2C8WB 1O2VA 4SGAE 3RC6A 3T28A 5LPRA 2NU4E 3ATLA 5GJ4B 4ABDA 2QXJA 3TPIZ 2Z9JA 1P2MA 1THPB 2J92A 9LPRA 4AN7A 1EZSC 3MYWA 1A46H 1ELEE 5A2MH 1Z1IA 2GT7A 3PB1E 3F9HA 1C1WH 2FS9A 2VIWA 4HZHA 1NFWA 5IK2D 3E6PH 2FO9A 2FWWA 2QA9E 2YMSB 4XOJA 2BY6X 2ZPRA 1V2WT 2EY4C 1UVSH 3OEHD 1EZUC 1GVKB 3RXAA 1VR1H 2ZFQH 4RKOB 5HIZA 3MTYA 4Y7BA 3W94A 1XMNB 3O8RA 4FUHA 1NBME 3HATH 3KF2A 4X8UH 2ANYA 1C5NH 4ZCNA 1JIRA 1B7XB 1EPTB 3UWJH 4E05H 2F3CE 4ABJA 1L4DA 2ZI2H 1WBGB 2G5VA 1AY6H 2BDAA 1AB9C 3NUMA 4TY7A 2GX4A 1CU1A 1G3CA 4AFUA 4NGAH 4UEHH 1IQLA 4AORA 1MU8B 3ATIA 4FUFA 3KGPA 3GY6A 2A1DB 1GI1A 5C67A 2P95A 1DVAH 2XC5A 1HJAC 5DP6A 4CH2B 4DGJA 4XE4A 1UTPA 1PJPA 4CBNA 5T1VA 1GJ5H 1DY8A 4NWKA 4E7RG 3PRBA 1W12U 1O3HA 1P06A 3B8JA 3LGUA 4K69A 3M7UA 1GI9B 2W7UA 5ABWA 3QZRA 1UTNA 3Q3YA 4M7GA 3F2GA 1T4UH 2KZ4A 6LPRA 1BRCE 4MNYA 3IG6B 3AK5A 3A7YA 4INLA 1UVTH 5FPSA 2ZQ1A 2F9OA 3VB5A 3ODFA 1LVYA 1LDTT 5KGOA 1D4PB 1W0ZU 2UUKB 5DG6A 4ZHAA 1C9TA 3U9AH 3ZYEA 2XYAA 3U1IB 1QTFA 1W14U 3M61U 5IYTA 1GBMA 2XBWA 4GSOA 1B0EA 1A3EH 1CBWB 3P92A 2AMDA 1TNLA 2CF8H 4CRGA 3HGPA 1UTMA 3L3TA 1C5TA 3NCLA 3B23B 1AGJA 5HIYA 1SLVB 2VBCA 1EZQA 4NFFA 1P0SH 3M7TA 1MD8A 2KM0A 2AIPA 3SV2H 4Z6AH 3TJNA 3SZEA 2SNVA 1LHDH 2BDYA 3WWBA 3AW1A 4MTBA 1P2QA 1ANDA 2C93B 1GHAF 1C5ZB 1DM4B 3PV2A 1IHTH 1GJ9B 3LGTA 1D6WA 1HIAA 1NRPH 3UOPA 2VWLA 2ZFTA 1C2GA 3UOUA 3OFND 3N7DA 1SGTA 2ZHWH 3TNSA 4QT8C 1O3GA 3QO6A 4GAWA 2G4UA 3PTNA 1FPCH 1IOEA 2XCNA 4Y79A 1MAXA 1C5QA 1DWBH 1YP9A 3NZIA 2Y5HA 3NPSA 4TWWA 1UK4A 5KEDA 3QDZB 3ZVCA 4DY7B 1P09A 2CJIA 3SNEA 3ZVEA 5TCCA 4MDSA 1H9IE 2OINA 2Y5FA 3P6ZB 3VGCB 1KYNA 4Q2KA 1ESTA 4CHAC 7ESTE 2ZGCA 1QQ4A 1NN6A 1GBLA 2V3OH 1AFQB 1GJ4H 2F9PA 2ZDVH 2J97A 2W7SA 1UTOA 1TX6A 1B5GH 3TU7H 2XBYA 4ACAA 1A0JA 1O2RA 4TWYA 3A8CA 1N8OB 3LH3A 3E16B 3U8TH 1WTHD 3ZZ9A 1BBRH 1PQAA 2A4GA 3TJOA 2QY0B 4Q7YA 1VGCB 1P10A 1V2MT 1J8AA 3VXFH 4Y8ZA 1W0YH 2R3YA 2R9PA 4ABHA 4GVUA 1C5MD 3ATKA 4Z0KA 1OWEA 3UNQA 1SGIB 3UWIA 1EPTA 2WPLS 1G37A 1TNKA 2A2XH 4BTTB 1TE0A 5K0HA 1P2KA 2HPQH 4JK6A 4UFEH 5FPTA 1BA8B 5HXFA 5E8EH 2VWMA 2R0LA 5E0HA 1NFYA 1PPBH 2IN2A 3LH1A 1GBEA 5HMAA 4FU7A 1O3IA 1V2QT 2EQNA 1PPCE 1QIXB 1RJXB 4AGJA 3UR6A 1AD8H 1EAIA 1ACBE 1EKBB 3A88A 1O5CB 4ZXYH 4NIXA 5EJLA 3NXPA 4HGCA 1KY9A 1ZMLA 2ULLA 1O2TA 4JZDH 2DE9A 4I33A 3MFJA 5FX6A 1LHFH 2PKSC 3QUMP 3DFJA 1LO6A 2VIDA 1GCTC 3E0PB 1GJ8B 1G3DA 4ZKSU 4D9RA 1GI4A 2VIOA 2TBSA 3M7QA 2FI4E 1SB1H 1ARBA 3E0NB 2ZO3H 3UB0A 4X6OA 4FUDA 1BBRK 1HLTH 2A4QA 3A87A 4ISNA 3F2HA 2ZU3A 3ZZ4A 2A4OA 1UTQA 5A8ZA 1K1MA 2DUCA 2BXTH 1AWHB 3HK3B 4A6LA 2AYWA 3UY9A 4JK5A 1GGDB 1MKWH 3WW7A 2CK3D 4FU8A 4I86A 2Z94A 4ZKNU 1B0FA 1F2SE 1A1RA 1QRXA 2JH0D 2ZTZA 3HK6B 5L2YH 2F9VA 1MU6B 2ZGBH 3KIDU 4FVBA 1O5DH 5CHAC 2EEKA 5EXMA 3QGJA 3K65B 1O30A 1EJAA 1FIZA 3BTQE 4WY3A 1JBUH 3LDXH 1KSNA 1Z8IB 2ZU1A 1C1NA 1K1LA 4BTIB 2HLCA 1BHXB 1YCPM 2I6SA 2EI6A 3EE0B 3PLBA 1PYTC 1T31A 2AGEX 4CH8B 1CA0C 2Z3DA 4ISOA 1ZHMA 2P59A 4FUIA 4X8VH 1OSSA 2HNTF 1NU9A 3BTGE 3I78A 1LHGH 1O2OA 3M3VA 1IQGA 5JBBS 2RG3A 3D65E 2SGFE 5KECA 1DE7H 5GPIB 2P8OC 1O32A 4ZKRU 4P00A 3RXCA 1S83A 4XRNA 1ETRH 3PTBA 1F5RA 4DIIH 2BDGA 1HAIH 1H9HE 2D1JA 3BEUA 2P93A 1ZPCA 1HGTH 3OTPA 1U6QA 5AFYH 4UONA 4CREA 4LZ4B 3A8DA 3TGJE 2WPDD 1EP6A 1AB9B 1BRAA 4NIVA 3SQHE 3SU4A 1QR3E 2FS8A 2FOMB 1O5FH 4GLYA 5JDUB 3DSOA 3SI3H 1AVXA 1QB9A 2ZCHP 1T4VH 3T29A 1J14A 1Q2WA 1A0LA 3R0FA 4D7GA 5C20A 1UO6A 1MKWK 2A7HA 1QZ8A 5EW2H 1O2GH 5A09A 2ZPQA 3TGIE 2OK5A 5PTPA 2H9EH 1ZGIA 2UUYA 1V2KT 4H42U 3TIUA 1C1OA 4FUJA 1NT1A 2OC8A 2FOGA 2J95A 4UFDH 3L33A 1O2JA 4Y6DA 5L6NH 2BZAA 2NWNA 3QZQA 2PKAB 1T8OA 3MH4A 5HM2A 5CDFE 1Z6JH 3P8OA 3RXSA 1QA7A 3SNAA 1GI0A 2ANKH 6CHAC 1L1GA 2XC4A 3LC5A 1QURH 1J17T 3DUXH 4YLQH 2K0QA 2PUQH 5C1XA 3V12A 1BMNH 4D9QA 4LZ1H 4Y11E 2VIVA 2G55A 1T8LA 1W0JD 2BDCA 3GYLB 2FOHA 1AQ7A 4JYTA 4WH8A 4Y8XA 2YNAA 5C1UA 2A31A 2ALVA 5GCHF 2C8XB 1ZJDA 3RXRA 3SGBE 1O3AA 4MQAA 1UK3A 1BZXE 2GCTB 3RXKA 3L6PA 3A80A 1ELGA 1O0DH 1P05A 1QL8A 5SGAE 4CRCA 1O3MA 1IQKA 1FIWA 2BVSH 1CO7E 1L1NA 2QXGA 2VGCC 1O3DA 2Y6TA 3GDVA 3BTFE 3KL6A 6GCHG 2ASUB 2FXRA 1ARCA 1KMHB 2ZCKP 2GCHF 3SGQE 2VINA 2ZP0H 5FHTA 1OYQA 1BTZA 1XXDA 1BTYA 1ZTLA 3QGNB 1TIOA 2FOBA 4UFGH 1C5WB 1OKXA 1OOKB 1VCWA 4AB8A 1ID5H 3RXBA 3UPEA 3MHWU 2K8IA 5FXLA 3TK6A 2Z3EA 4CHAB 2HVXA 1FAKH 3C1KA 3OY6U 3K6YA 4ASHA 1WQSA 2BQ7B 4GUXA 4KTUA 3EGKH 4CRDA 4MNXA 3S7KB 3R3GB 5FPYA 2WZQA 3IITA 1GI7B 1ZHPA 2SNWA 2GKVE 3F68H 1W7XH 2XXLA 3GCNA 4ABGA 3K6ZA 2KCOA 2AHME 2ZCLP 1QRWA 4O9VA 2G8TA 5T3HA 1GBBA 3P17H 2EA3A 2BX3A 4Y0YE 5A0BA 2C3SA 4JYVH 3ODDA 4R0IA 2UUJB 3I29A 1QBVH 1N1LA 2OC7A 1O3NA 3GS9A 2BX4A 1A7SA 5C0UA 4Y71A 1GJCB 1GI6A 4U2WA 3RXTA 1EATA 2Y80A 1C4Y2 3FOAA 2PSYA 1XVMA 3ZIAD 5EOKA 3SNBA 2G52A 2OLGA 1WYKA 3M35A 1IQEA 4I8JA 1SGQE 3MU1A 2GZ8A 3GOVB 2KCAA 1KXBA 5DN6D 3TNTA 5C0TA 3SJKA 2SGPE 3ESTA 3TH2H 4NCYA 1UHBB 4IBLH 1O2NA 1UK2A 1GMHG 5HGGA 2PKSB 1OWHA 1XVOA 2QYIA 3TH3H 5HM9A 2NU3E 2PKAA 4BAQB 1FY8E 1GCTB 1BB0B 1OXGA 1QQUA 4DCDA 2A7CA 4INKA 1OWKA 2V35A 1D9IA 1L4ZA 1LQEA 3BG4C 3FANA 2ZECA 2SFAA 1C5LH 3RP2A 1A5GH 4GHQA 1XXFA 4GHTA 1C5YB 4OS6A 2O8UA 4WMEA 2OQUA 7LPRA 3O8BA 3MWIU 1HAYB 1HBTH 1VITH 2IOTA 1FX0B 2HPPH 1C2EA 1NY22 2A4RA 4ZAEA 1O3KA 2Z9LA 2BOHB 1BT7A 1XUFA 1E1QD 1SMFE 3ZVBA 2BD2A 5C94A 5BPEA 1IQJA 3PROA 2A0QB 4YTAA 1LVOA 1V2LT 2BLWA 1AZ8A 3SV7A 2ZTYA 3T2NA 2C8YB 2RDLA 2G81E 2KAIB 4I32A 3LPRA 2BY7X 1HRTH 2OUAA 4AOQA 5CHAB 2GZ9A 1JWTA 4F55A 3RXHA 2WINI 3P8GA 1GMDG 1KLTA 5F8ZA 2IPQX 3PLKA 1XUIA 4X6MA 1AUJA 3RDZA 1UVPA 2J34A 1F0RA 5EODA 1EAUA 3W95A 3M5NA 3N7OA 4BAHB 1EQ9A 8LPRA 1C1SA 2RCEA 5AFZH 2FTLE 5DO4H 1WDIA 2G00A 4LXBH 4ZMAH 4XBBA 2AIQA 1YWUA 4K1SA 4HTCH 2P8OB 1PQ8A 5EXNA 2VB0A 2IJD1 5ETXA 1WUNH 2ZDAH 3F9GA 2BM2A 2ZWLH 5F8XA 5A8YA 1GHVH 3SJ8A 1GVLA 2Y5GA 1G3BA 2KCYA 4WXIA 1YF4A 1C2HA 3SJ9A 3SO3A 1HAHH 4WH6A 1WXRA 8GCHG 1O2SA 1O5GH 3ZVAA 5EGMA 1EP5A 1EASA 1O3EA 1RXPA 1BMLA 1Y3VA 1O2XA 1O34A 1O3FA 4OS7A 1AZZA 1O3JA 2XW9A 5GDSH 4MVNA 2OD3B 1SGPE 2XBVA 4FUGA 4O3UA 1A61H 4TPIZ 2JJ2D 2BD9A 1ELFA 1CE5A 3H09A 4E7NA 2P94A 2XC0A 4K5ZA 5HYOA 3MO6A 4SGBE 1VITG 1IQIA 1K2I1 1C5SA 1SKYE 2PGBB 1DICA 1OWIA 1GBKA 1TNHA 1P04A 1KXAA 5GNDA 3PMJA 3EDXB 2LPRA 2ZDMA 4TY6A 1SLUB 1H8HD 1TRMA 5F03A 4XBCA 2F9NA 1UHBA 3A7XA 1CHOG 2PGQB 4GCHF 4CR5A 6CHAB 2A45B 3MU5A 3RXFA 2JIZD 1W7GH 4AFZA 5EQQA 4CRAA 2ZKSA 2QF3A 4NSVA 1ETSH 1KXFA 2A5AA 3FP7E 3KCGH 3PV4A 1NRRH 1SGCA 1TA6A 1O5AB 2LP6A 5I25A 2V0BA 4RI0A 2BXUH 1SG8B 1C5PA 1JMOH 1IAUA 2FP7B 5A0CA 2YMSD 5L30H 1T32A 1SLWB 1E36B 2OBQA 4X1RU 1HCGA 4I8HA 1RS0A 3A7WA 3RMNH 1ANCA 3H5CB 1K21H 2BOKA 2HALA 1EOLA 1C5OH 1C9PA 1JIMA 1DANH 1UTJA 2OCVB 4X1PU 1ZJKA 5GWZA 2QN5T 1JXPA 2RA3A 5DP8A 2UUFB 1Y5BT 3OU0A 4U30A 4DW2U 1Z6EA 3OE7D 1AE5A 2VGCB 1F0UA 3RXEA 2W6JD 1ZSJA 1Z8RA 2KAIA 3MOCA 1Y5AT 3P95A 4FVDA 1L0ZA 1K1IA 1O2MA 4B6EA 1YPJH 4LOYH 1MCVA 2VIQA 3TK9A 2FLRH 2HGTH 3F3BA 3LOXA 3PYHA 3STJA 3UTUH 1G30B 1VKYA 3C27B 1O2LA 5FBEA 2OXSA 2FI5E 1DWCH 2VNTA 4IW4E 2H1UA 1D6RA 1OS8A 2ZU5A 4X2VA 1MKXH 1PPGE 2AFQB 1DX5M 2FMJA 1TGBA 2B7DH 4AX9H 1MTVA 1FPHH 2BD8A 1MCTA 1V6DA 3S7HB 2ZEBA 1P11E 3VXEH 4UDWH 5CHBA 1MABB 2UWLA 1OWJA 2BDHA 1Y3YA 1RTKA 3RXIA 2KCPA 1C1VH 1COWD 2W5EA 1THSH 1TOCB 2W3IA 5F8TA 1XUJA 1TB6H 4THNH 4BXSA 3RM2H 1L2EA 2J5UA 2SGAA 1O2PA 1FONA 1DS2E 3BF6H 5C17A 2H9TH 1P02A 3FZDA 3UNRA 1EJMA 1GDNA 4FXGH 1F5KU 2A5KA 1TNJA 1G9IE 1PQ5A 3N7EA 4R8TB 4YT6H 1BHXF 1FI8A 1FMGA 1A2CH 1C2JA 3F6UH 4ABAA 2BHGA 3OEED 3G01A 1KTTB 1EXFA 1H8ED 1LHEH 4DT4A 1O3CA 1GVZA 2BYAX 3BIVH 1XKBC 1BJVA 1V2ST 5JB8S 3GICB 1BQYA 3CS7A 4NSYA 2WHXA 1A0HB 2M5TA 3V7TA 3QWCH 1HDTH 3GCTG 3KQ5A 1UVUH 1O2YA 2XNDD 2XTTB 1YCPH 2OQ5A 2PHBA 3GY2A 2GD4B 1DSUA 3ITIA 4WJG2 4ISHH 2WV5A 3S69A 2V7QD 4I7YH 1OX1A 3M37A 1MKXK 1DUAA 2V6NA 5TCAA 2BD7A 1GBDA 1RIWC 1TMUH 1ZHRA 3BTME 3BG4B 1GI3A 4O03A 1QCPA 3QTOH 7GCHG 1XKAC 4NFEA 3ZZ6A 1ELBA 5DP9A 2ODPA 2Q6GA 1ZRKA 1NU7B 3BG8A 1YPGH 1GBIA 1MTSA 3PMBB 3SV6A 2D8WA 1O3PB 4AB9A 5J4QA 3KNXA 4P02A 1VJAU 1TOMH 2QIQA 1IQFA 3S0NA 1N6YA 1H1BA 1P12E 1K1OA 1SC8U 4GPGA 4NIWA 1DWDH 1H8IH 1S6LA 1ZPZA 5JBTA 1D3DB 1MQ5A 3SUFA 4I31A 3M36A 5EJZA 1GWAA 4OS2A 1O33A 3HPTB 1JOUB 3UUZA 1PFXC 1ZOMA 2TGTA 3LGIA 3PLPA 4CR9A 3SU2A 1G32B 2O9QA 1SQRA 1TQ0B 2OBOA 3A83A 1GHBG 3B9FH 1FY4A 3DSPA 1AVWA 3FP8E 3Q76A 2PTNA 4ISLA 4MPWA 1GCDA 2ZC9H 4DG4A 2AH4X 3PV5A 5FCRA 2J94A 2ZTXA 2KR7A 3PWCA 1GJ6A 1A5IA 4AFSA 1C1UH 3DHKH 1AIXH 1HV7A 1TRNA 3P70B 1EB2A 1EZXC 1PPFE 3S9AA 4ASUD 8ESTE 2L6OA 2WUBA 4KTCA 3SHAH 2BDIA 1NRQH 1DXWA 1MTNC 1WTGH 3RLWH 3T62A 5I46H 4NIYA 1RTLA 1YC0A 3SUDA 2ZGHA 2VVUA 1THRH 2P3FH 5DPAA 2Q1JA 1DWEH 3RXMA 2PUXB 1CT4E 4OGXA 2P3UB 2J9NA 3DFLA 1QFKH 2J2UA 3M5LA 3SUEA 1QBOA 5EQSA 1P2IA 2VU8E 1SPJA 2NU1E 3OY5U 3RMMH 4MLFB 1GHYH 2PLXA 1K22H 1SGFG 1NRNH 9ESTA 2L74A 1HJAB 5GIBA 3RU4T 1O5EH 2IJOB 1S6FA 1HXFH 4WMFA 4XFQA 3QK1A 1FN8A 1D3QB 1AHTH 2W3KA 1SOZA 2JH5D 1F0SA 1FLEE 1Q3XA 2LELA 4Y8YA 2VVCA 4A1TA 2M2AA 5T6GA 4DVAU 1IHSH 4H4FA 3DD2H 3HKIB 3EAJA 3DCLA 4BAOB 3FKSD 1E38B 1GMHF 5EW1H 4YM9A 3ZZAA 1HFDA 1D3PB 1GBHA 3D62A 3QTVH 3UNSA 2WPHS 2XWAA 3AAUA 4Y7AA 3GCHC 3N99A 4UFFH 2TGPZ 4A5TS 5C2ZA 1T8NA 3MU4A 2ZFRH 4ZHLU 2H6MA 1LKAA 1C2DA 4ZUHA 1S85A 1SGRE 1W8BH 1MD7A 2FTMA 1C5VA 2FODA 1D3TB 1TABE 2VIPA 4M9FA 1C1MA 1MBMA 2UWOA 1ZYOA 1PQ7A 2TPIZ 5FX5A 2H9HA 1GHWH 1O2UA 2JDID 3Q3KA 4B6FA 1FDPA 3NRLA 3SV8A 1P01A 5CE1A 2SGDE 2P16A 4RSPA 1FXYA 5DP7A 4KTSA 1SOTA 1TMBH 2PTCE 4NZLA 1GI8B 5FBIA 5FCKA 3JZ1B 2ZG0H 3LT3A 1UCYE 4IC6A 3MH7A 3RC5A 2H2ZA 2BY5X 1KXDA 1GMDF 3PO1C 4NA7A 1GI5A 3Q77A 3T27A 4ZH8A 2ZHDA 4A1VA 1DT2A 3LJOA 1S81A 1A4WH 5A8XA 4J2YB 4IMQA 1ESBA 1HAXB 1SGFA 1YPHE 3FZZA 3V3MA 1MZDA 2BLQA 4JYUH 1RFNA 2WV9A 1P2NA 2GVFA 4Q80A 1TQ7B 1GBTA 2FX6A 2THFB 2WPJS 3KHVA 5EU8A 1LKBA 1O37A 5K7RA 2HOBA 1Z7KA 2UWPA 3BEFB 3SORA 3V13A 4IGDA 2ZIQH 1SSXA 7KMEH 2YNBA 4BTUB 2PWXA 1QA0A 5AHGH 4WWYA 4B76A 2VWNA 2FOEA 5JBAS 3RU4E 3EYDA 5TJXA 2JJ1D 1GL0E 2ILNA 4MG3A 1BCUH 4K2YA 4BNRA 1ZSKA 3CS0A 5L2ZH 3OAAD 1M9UA 2ZHFH 4K8YA 2WYJA 4DURA 2OC1A 8GCHF 1DLKB 3RXPA 2GDDA 1GHZA 2BLOA 3NWUA 4K1TA 4B73A 3Q3XA 2BY8X 1V2OT 1BUIA 2GV6A 3Q00A 4OS4A 5A0AE 1SQOA 1UTLM 4X1NU 2OTVA 1ZTKA 3ZVDA 1ELCA 2GDEH 1SQAA 1IQMA 1VITF 3VB6A 3ZZBA 2QE7D 3HGNA 1LCYA 4Q7ZA 1LTOA 4IN2A 1DUEA 2Z9GA 4WVPE 1SQTA 3SGAE 1P2JA 3GY3A 5F6MA 2ODQA 3BN9A 4X6PA 4DOQA 3E8LA 2FIRH 2OP9A 4Q7XA 1HAPH 1CHOF 1WAYB 2SGEE 4WMDA 3FP6E 1GDUA 5EQRA 2XOKD 1GHXH 1ZLRA 1SFIA 4CBOA 3AVZA 1NBMD 1NM6A 2AGGX 2ZF0H 3KQBA 4X2YA 1S84A 3TK5A 1FAXA 1RIWB 3E91A 1QNJA 4MNWA 1DOJA 1FUJA 1TALA 2O8MA 5DSFA 1NS3A 1SBWA 1ZRBA 2B0FA 4A7IB 3DT0H 1TA2A 2LNCA 1Q31A 4ZXXH 1YY3A 4MNVA 2F83A 2KX4A 2QV1A 3A85A 1YBWA 5BRRE 1YPHC 3UREA 3F0PA 4I8LA 3M3TA 1TFXA 1ANBA 2WYGA 1TGCA 1MQ6A 1WSSH 3QLPH 3MMGA 4OS1A 3M5OA 2CN0H 3PMAB 3EA7A 1GMCG 3GY4A 3UFAA 4D7FA 2BD5A 3OTJE 3CENA 1V2VT 1GGDC 1HAZB 1Y3UA 4X1SU 3EQ0H 3PRDA 5C1YA 2H5DA 2HNTE 1SGYE 1O2ZA 3ZV9A 3F9FA 4JZEH 5LH8A 2B8OH 4WF8A 4ISIH 2BVRH 1WV7H 3FO8D 4A1XA 1CA0B 1L1JA 2B9LA 2PW8H 2GCHG 1QL7A 2ZFPH 1Z8GA 1GL1A 2ODYB 2ANMH 3SU6A 2G4TA 2G5NA 3F1SB 3OSYA 4X0WU 4A92A 4AC9A 2TGDA 4KKDA 1LQDB 2PFEA 3URDA 1QJ7B 4YT7H 1FZZA 1T8MA 3SYJA 1CT2E 4Z1MD 5H4IB 1S0QA 1VCQA 1BTUA 5J4SA 1MTNB 2P3TB 4NZQA 2VWOA 1AKSB 2F9BH 3BEIB 1W11U 2HVYB 3U28C 1YPLH 3RXOA 1H9LB 3ATWA 1EJNA 3EE7A 1Y3XA 5EG4A 1C5UA 2ESTE 4X6NA 2NU2E 1O2QA 1GBJA 4I8GA 4VGCC 1J15A 2R2WU 1F92A 1OHHD 3HKJB 3RXLA 4BXWA 5LGOA 1YGCH 3ZZ8A 2O8WA 3MH5A 3EA8A 3RXDA 4KGAA 4Q4LA 3DA9B 1MMJN 3VEQB 1TAWA 3E90B 1K1JA 1RRKA 4ZROA 1O35A 2F91A 1O31A 1C2FA 2ZDLA 1GG6C 1XUKA 2TGAA 2QCYA 4NWLA 2BQ6B 1ABJH 3MNCA 4NA8A 1BTHH 1V2JT 2V3MA 5EPYA 1Y5UT 1AVGH 1MBQA 1S6HA 1ELVA 3VG8A 2GP9B 2ZGXH 1AFEH 3VB7A 3JZ2B 4IN1A 2PP6A 3I77A 5JBCS 1EFRD 3LGWA 1GBFA 3GCTF 4CRFA 2CV3A 2W26A 1AU8A 5E2OA 3U69H 3LGVA 2WV4A 1NC6A 3GCOA 1W2KH 2TIOA 3ZZ7A 2QC2A 1CHGA 2KFWA 3GCHB 1NESE 3GY8A 2BLVA 1YYY1 1WU1A 1TBZH 1MH0A 1XM1A 4FUEA 3ZZCA 1PYTD 3P8FA 7GCHF 1V2UT 4FUBA 3LKWA 2WPIS 2HNTC 1O2WA 2GGVB 2PSXA 1GI2A 2BD3A 5DP5A 4HFPB 3BTEE 1C2MA 1RGQA 1O3BA 3UR9A 1BRUP 2EI8A 2STAE 4Y10E 2J98B 4B1TA 3UQVA 1TMTH 1TGSZ 1TNGA 3A81A 5DKMA 2VJ1A 1HJ9A 1O36A 2CHAC 1XUHA 1VJ9U 2GMTC 4IC5A 1KDQB 2GZ7A 1DLEA 3SHCH 1K1NA 3S9BA 1P2OA 5C5OA 2CMYA 4K60A 1ETTH 1YPKH 2ZQ2A 4Y76A 2GCTC 3PM3A 1E34B 3SZNA 3LONA 2FM2A 1ELDE 2J38A 2FDAA 1Z8JB 3PO1B 3M3SA 4LK4A 2FOAA 1GHBF 1QBNA 4UD9H 1BRBE 2FLBH 1NFUA 3H7OA 1DY9A 1YM0A 3SBKA 4OS5A 4TYDA 1TX8A 2Q6DA 3ZYDA 3U8OH 1UJ1A 4YO9A 3KYGA 4NG9H 2OC0A 1HUTH 1C1TA 1C2LA 1ZTJA 1GBAA 3NKKA 3RM0H 1EOJA 3A7ZA 1CQQA 3KQEA 1E35B 4E06H 2O8TA 4O3TA 4ABFA 5JB9S 1QB6A 3MO3A 3BV9B 3KN2A 1C2KA 1DFPA 1BITA 3D49H 1AMHA 1QJ1B 5F53A 5B6LA 2ZFFH 3MU0A 4AG2A 5FL7D 3CP7A 4X8TH 1AKSA 4K8BA 2FEQH 4D76A 3W1EA 1CVWH 4JCNA 4AZ2B 1W13U 1TBQH 2FESH 1DSTA 2ZZUH 2FI3E 1O39A 3GY5A 1W0KD 1J9CH 2A2QH 1BIOA 3F0OA 1C1RA 1O3LA 4XBDA 3GY7A 4BAMB 1C1QA 1OP2A 3ZZDA 3SJIA 4BANB 4JZ1A 1NRSH 1A3BH 2PR3A 1P8VC 4NA9H 3LU9B 2AERH 3VFEA 5DJ7A 1LVBA 1AO5A 3AASA 1UCYH 2SGQE 1FY3A 2JH6D 1XX9A 5LPEA 2QF5A 3PWBA 4H6SB 3TITA 2Z9KA 2ZPSA 3VB4A 3EA9A 4XDEA 2FYQA 3KYFA 3ENSB 1ESAA
chains in the Genus database with same CATH topology
1O2KA 1VZQH 1TONA 5E0JA 1YPMH 1FN6A 1X7AC 3K2UA 5CMXH 5C5NA 4YESB 3TVJB 1RTFB 1MTUA 3FVFB 1N6XA 2H5CA 1LHCH 3GYMA 3E1XB 5DP3A 1CGHA 1DPOA 1RD3B 1DITH 2HRVA 2BMGB 2D26C 1HAGE 1E37B 3STIA 1Y59T 1EB1H 2BTCE 4ZHMU 3TH4H 4TSFD 2ZDNA 8KME2 4GCHG 3MH6A 1FY5A 1ZR0A 2Y81A 4Y0ZE 1HB0B 1V3XA 1C5XB 4YXWD 3RMLH 2ZU2A 3T5FH 3RXUA 1SI5H 4YLUA 3URCA 3LC3A 4F4OC 4F49A 1O2IA 3LJJA 2GT8A 3KEEA 3MNSA 5DK1A 1GJDB 1WOFA 1ZZZA 2JETC 3A82A 3SQEE 5E0GA 1T7CA 1S0RA 1TPSA 4B2AA 1GHAG 1FQ3A 4FU9A 6GCHF 1J16A 3U98H 1KDQA 3ZV8A 4X8SH 2AMQA 1V2PT 1KXEA 1C4V2 3BTWE 3H7TA 4YOIA 3U8RH 2DE8A 1TYNA 1HYLA 1BJUA 4DJZB 1BDAA 3TJVA 1GJ7B 3E3TA 5DP4A 1O3OA 2TRMA 3RMOH 3TJUA 1G36A 1KLIH 3WY8A 2AS9A 2BD4A 2QXIA 2ZA5A 2GV7A 1UCYK 2ZFSA 1TPAE 2Z6BD 1CGJE 1NZQH 3A86A 1SGDE 3A84A 4JZIA 3RXGA 1TPOA 1NFXA 3BTKE 1GPZA 3A7VA 4HI3A 5IDKA 3ATMA 5T6FA 2WSSD 4TT3D 1BTPA 1K1PA 1P9UA 3SU1A 4B2CA 2BB4A 3ELAH 1FJSA 2YMSC 1SFQB 1UVOA 1YCPK 1ZPBA 3D23A 4U01A 5ESBA 3ZZ5A 4AG1A 3LGYA 2BY9X 2FZZA 5E2PA 2XRCA 2GTBA 4I8KA 1CA8B 2A32A 1S5SA 5FAHA 2Y7XA 1P03A 4X1QU 5DGJA 1G3EA 3O8DA 3BIUH 5EXLA 3F9EA 1KTSB 1Z1JA 2WPKS 1EPTC 4PROA 3A8AA 4VGCB 1E79D 3UQOA 2J4IA 2EI7A 2Y7ZA 1P3CA 1QY6A 2FOCA 4JMYA 2IPHA 3FN8A 2VH0A 3KQDA 3RC4A 2Y82A 2Z9IA 4CRBA 1INCA 1F5LA 1UMAH 2W6ID 3SJOA 1KXCA 1MTWA 2HLDD 2C4FH 5JYIA 1GG6B 1O5BB 1HAVB 1C1PA 3GISB 2F9UA 1TGNA 2A7JA 4J1YA 1FV9A 4K3JA 4KELA 5B6OA 2Z3CA 4WXVA 3SNCA 3AW0A 3T25A 2AEIH 5AF9H 1EAXA 1W3CA 2ZDKA 1Z71A 3FAOA 3ZZ3A 2QXHA 1E0FD 2ZHQH 2I6QA 2HWLB 1BMMH 3IWMA 1ELTA 3NK8A 1HNEE 3RUOA 4OGYA 1Y8TA 2CGAA 2R3UA 1SVPA 3GDUA 2FYRA 4RKJB 4XD7D 2ZU4A 1E1RD 1V2NT 4ABBA 1LVMA 3LIWA 1LMWB 1NROH 2ZHEH 1CSOE 1OYTH 3T26A 3U1JB 1CT0E 1BBRE 1BMAA 1GBCA 4KP0A 1PPZA 2BDBA 3RU4D 1P9SA 2F43B 1TWXB 4X2XA 4ESTE 1CBWC 1AE8H 5C3NA 2XWBI 2AMPA 4AYYB 1BTWA 1OWDA 1NPMA 1HPGA 1LPGB 1QL9A 4B2BA 1QGFA 2VH6A 1F0TA 1ZGVA 3K9XB 1ANEA 1FNIA 4TPYA 1ZSLA 1SGEE 1KIGH 1TX7A 1VCPA 2GMTB 1SL3A 2CHAB 4MPXA 1C2IA 1GMCF 3MO9A 3SUGA 4Q63A 2STBE 2ZNKH 3FFGA 1YPEH 4MPUA 3BTHE 1SHYA 2XBXA 3SOSA 1ZMJA 1Y3WA 3O8CA 1C4U2 4X2WA 1W10U 1KLJH 1AWFH 1C5RA 1PPEE 4DIHH 4YOGA 1P3EA 1TPPA 3GDSA 5HKKD 1ELAA 1SR5C 4YZUA 2RA0A 1OP0A 3TLOA 1OP8A 1ZMNA 2O8LA 3RLYH 1QB1A 3AAVA 1YLDA 3RXVA 4B71A 2F4LA 1TBRH 1V2RT 1WCZA 4ZKOU 1O2HA 3VGCC 1EX3A 1CGIE 1H4WA 4B74A 3S9CA 2BQWB 2FPZA 1TLDA 2NU0E 4XSKU 1BOQA 1AFQC 3SU3A 2CXVA 1AI8H 1HXEH 2ZGJA 4YOJA 2R0KA 1TRYA 2C90B 3M5MA 2VVVA 2QGRA 3A89A 1N8OC 3OYPA 1DDJA 3PMHB 3SN8A 1VGCC 3SU5A 1MZAA 3SV9A 2G51A 1JRSA 2ALPA 2FX4A 1MAYA 4INHA 4JZFH 1QHRB 1QJ6B 2V3HH 1K28D 1V2TT 1TGTA 3OX7U 4FETA 2ANWA 3SNDA 5GXPA 3ZVFA 1ORFA 1SGNE 1LPZB 3TGKE 1BTXA 4IMZA 1WQVH 1ABIH 1PPHE 3BSQA 4OM9A 1SLXB 4BOHA 2BZ6H 2QF0A 1JRTA 1NO9H 3P8NA 2D2DA 3SU0A 3A7TA 3BTTE 2XCFA 3V0XA 1A5HA 3RXQA 2XNIA 4AYVB 4ABEA 1HAVA 3MNBA 1NTPA 2YOLA 4B75A 2CF9H 3QX5H 1FY1A 4H6TA 1K9OE 2JKHA 5ESTE 4AGKA 4ABIA 2FOFA 3F2FA 1GDQA 1EUFA 3VB3A 2QF4A 2Z7FE 3ZVGA 4O97A 4DT7B 4AFQA 1IQNA 4FUCA 1QRZA 1SHHB 3BTDE 1F7ZA 2C8ZB 3SI4H 1O38A 5LPFA 1S82A 1MUEB 3SW2B 1GJAB 1AUTC 2BVXH 1XUGA 3MI4A 1LPKB 1DXPA 3MU8A 3MNXA 4K1EA 3KQCA 1G2LA 3A8BA 3WWFA 2Q6FA 5EPNA 2WUCA 4U32A 5T6DA 3RXJA 3UIRA 4IS5A 1H8DH 1EAWA 1TNIA 2PV9B 1YLCA 2JETB 5AVDA 1G2MA 1IQHA 1HIAB 2AGIX 3VPKA 1OPHB 6ESTA 2K1QA 2QAAA 1AN1E 1YKTA 4UE7H 4MPVA 1GJBB 4RN6A 5GCHG 4D8NA 1HJ8A 1BMFD 2R2MB 5G4BA 4BAKB 5JPMH 1P57B 2B5TB 3QN7A 2WPMS 1HAOH 1UTKA 2EC9H 2A5IA 2C8WB 1O2VA 4SGAE 3RC6A 3T28A 5LPRA 2NU4E 3ATLA 5GJ4B 4ABDA 2QXJA 3TPIZ 2Z9JA 1P2MA 1THPB 2J92A 9LPRA 4AN7A 1EZSC 3MYWA 1A46H 1ELEE 5A2MH 1Z1IA 2GT7A 3PB1E 3F9HA 1C1WH 2FS9A 2VIWA 4HZHA 1NFWA 5IK2D 3E6PH 2FO9A 2FWWA 2QA9E 2YMSB 4XOJA 2BY6X 2ZPRA 1V2WT 1UVSH 3OEHD 1EZUC 1GVKB 3RXAA 1VR1H 2ZFQH 4RKOB 3MTYA 4Y7BA 3W94A 1XMNB 3O8RA 4FUHA 4X8UH 3HATH 3KF2A 1NBME 2ANYA 1C5NH 4ZCNA 1JIRA 1B7XB 1EPTB 3UWJH 4E05H 2F3CE 4ABJA 1L4DA 2ZI2H 1WBGB 2G5VA 1AY6H 2BDAA 1AB9C 3NUMA 4TY7A 2GX4A 1CU1A 1G3CA 4AFUA 4NGAH 4UEHH 1IQLA 4AORA 1MU8B 3ATIA 4FUFA 3KGPA 3GY6A 2A1DB 1GI1A 5C67A 2P95A 1DVAH 2XC5A 1HJAC 5DP6A 4CH2B 4DGJA 4XE4A 1UTPA 1PJPA 4CBNA 5T1VA 1GJ5H 1DY8A 4NWKA 4E7RG 3PRBA 1W12U 1O3HA 1P06A 3B8JA 3LGUA 4K69A 3M7UA 1GI9B 2W7UA 5ABWA 3QZRA 1UTNA 3Q3YA 4M7GA 3F2GA 1T4UH 2KZ4A 6LPRA 1BRCE 4MNYA 3IG6B 3AK5A 3A7YA 4INLA 1UVTH 5FPSA 2ZQ1A 2F9OA 3VB5A 3ODFA 1LVYA 1LDTT 1D4PB 1W0ZU 2UUKB 5DG6A 4ZHAA 1C9TA 3U9AH 3ZYEA 2XYAA 3U1IB 1QTFA 1W14U 3M61U 5IYTA 1GBMA 2XBWA 4GSOA 1B0EA 1A3EH 1CBWB 3P92A 2AMDA 1TNLA 2CF8H 4CRGA 3HGPA 1UTMA 3L3TA 1C5TA 3NCLA 3B23B 1AGJA 1SLVB 4NFFA 1EZQA 2VBCA 1P0SH 3M7TA 1MD8A 2KM0A 2AIPA 3SV2H 4Z6AH 3TJNA 3SZEA 2SNVA 1LHDH 2BDYA 3WWBA 3AW1A 4MTBA 1P2QA 1ANDA 2C93B 1GHAF 1C5ZB 1DM4B 3PV2A 1IHTH 1GJ9B 3LGTA 1D6WA 1HIAA 1NRPH 3UOPA 2VWLA 2ZFTA 1C2GA 3UOUA 3OFND 3N7DA 1SGTA 2ZHWH 3TNSA 4QT8C 1O3GA 3QO6A 4GAWA 2G4UA 3PTNA 1FPCH 1IOEA 2XCNA 4Y79A 1MAXA 1C5QA 1DWBH 1YP9A 3NZIA 2Y5HA 3NPSA 4TWWA 1UK4A 3QDZB 3ZVCA 4DY7B 1P09A 2CJIA 3SNEA 3ZVEA 5TCCA 4MDSA 1H9IE 2OINA 2Y5FA 3P6ZB 3VGCB 1KYNA 4Q2KA 1ESTA 4CHAC 7ESTE 2ZGCA 1QQ4A 1NN6A 1GBLA 2V3OH 1AFQB 1GJ4H 2F9PA 2ZDVH 2W7SA 1UTOA 1TX6A 1B5GH 3TU7H 2XBYA 1A0JA 1O2RA 4TWYA 3A8CA 1N8OB 3LH3A 3E16B 3U8TH 1WTHD 3ZZ9A 1BBRH 1PQAA 2A4GA 3TJOA 2QY0B 4Q7YA 1VGCB 1P10A 1V2MT 1J8AA 3VXFH 4Y8ZA 1W0YH 2R3YA 2R9PA 4ABHA 4GVUA 1C5MD 3ATKA 4Z0KA 1OWEA 3UNQA 1SGIB 3UWIA 1EPTA 2WPLS 1G37A 1TNKA 2A2XH 4BTTB 1TE0A 5K0HA 1P2KA 2HPQH 4JK6A 4UFEH 5FPTA 1BA8B 5HXFA 5E8EH 2VWMA 2R0LA 5E0HA 1NFYA 1PPBH 2IN2A 3LH1A 1GBEA 5HMAA 4FU7A 1O3IA 1V2QT 1PPCE 1QIXB 1RJXB 4AGJA 3UR6A 1AD8H 1EAIA 1ACBE 1EKBB 3A88A 1O5CB 4ZXYH 4NIXA 3NXPA 4HGCA 1KY9A 1ZMLA 2ULLA 1O2TA 4JZDH 2DE9A 4I33A 3MFJA 5FX6A 1LHFH 2PKSC 3QUMP 3DFJA 1LO6A 2VIDA 1GCTC 3E0PB 1GJ8B 1G3DA 4ZKSU 4D9RA 1GI4A 2VIOA 2TBSA 3M7QA 2FI4E 1SB1H 1ARBA 3E0NB 2ZO3H 3UB0A 4X6OA 4FUDA 1BBRK 1HLTH 2A4QA 3A87A 4ISNA 3F2HA 2ZU3A 3ZZ4A 2A4OA 1UTQA 5A8ZA 1K1MA 2DUCA 2BXTH 1AWHB 3HK3B 4A6LA 2AYWA 3UY9A 4JK5A 1GGDB 1MKWH 3WW7A 2CK3D 4FU8A 2Z94A 4ZKNU 1B0FA 1F2SE 1A1RA 1QRXA 2JH0D 2ZTZA 3HK6B 5L2YH 2F9VA 1MU6B 2ZGBH 3KIDU 4FVBA 1O5DH 5CHAC 2EEKA 5EXMA 3QGJA 3K65B 1O30A 1EJAA 1FIZA 3BTQE 4WY3A 1JBUH 3LDXH 1KSNA 1Z8IB 2ZU1A 1C1NA 1K1LA 4BTIB 2HLCA 1BHXB 1YCPM 2I6SA 2EI6A 3EE0B 3PLBA 1PYTC 1T31A 2AGEX 4CH8B 1CA0C 2Z3DA 4ISOA 1ZHMA 2P59A 4FUIA 4X8VH 1OSSA 2HNTF 1NU9A 3BTGE 3I78A 1LHGH 1O2OA 3M3VA 1IQGA 5JBBS 2RG3A 3D65E 2SGFE 1DE7H 5GPIB 2P8OC 1O32A 4ZKRU 3RXCA 1S83A 1ETRH 3PTBA 1F5RA 4DIIH 2BDGA 1HAIH 1H9HE 2D1JA 3BEUA 2P93A 1ZPCA 1HGTH 5AFYH 1U6QA 4UONA 3OTPA 4CREA 4LZ4B 3A8DA 3TGJE 2WPDD 1EP6A 1AB9B 1BRAA 4NIVA 3SQHE 3SU4A 1QR3E 2FS8A 2FOMB 1O5FH 4GLYA 5JDUB 3DSOA 3SI3H 1AVXA 1QB9A 2ZCHP 1T4VH 3T29A 1J14A 1Q2WA 1A0LA 3R0FA 4D7GA 5C20A 1UO6A 1MKWK 2A7HA 5EW2H 1O2GH 5A09A 2ZPQA 3TGIE 2OK5A 5PTPA 2H9EH 1ZGIA 2UUYA 1V2KT 4H42U 3TIUA 1C1OA 4FUJA 1NT1A 2OC8A 2FOGA 2J95A 4UFDH 3L33A 1O2JA 4Y6DA 5L6NH 2BZAA 2NWNA 3QZQA 2PKAB 1T8OA 3MH4A 5HM2A 5CDFE 1Z6JH 3P8OA 3RXSA 1QA7A 3SNAA 1GI0A 2ANKH 6CHAC 1L1GA 2XC4A 3LC5A 1QURH 1J17T 3DUXH 4YLQH 2K0QA 2PUQH 5C1XA 3V12A 1BMNH 4D9QA 4LZ1H 4Y11E 2VIVA 2G55A 1T8LA 3GYLB 2BDCA 1W0JD 2FOHA 1AQ7A 4JYTA 4WH8A 4Y8XA 2YNAA 5C1UA 2A31A 2ALVA 5GCHF 2C8XB 1ZJDA 3RXRA 3SGBE 1O3AA 4MQAA 1UK3A 1BZXE 2GCTB 3RXKA 3L6PA 3A80A 1ELGA 1O0DH 1P05A 1QL8A 5SGAE 4CRCA 1O3MA 1IQKA 1FIWA 2BVSH 1CO7E 1L1NA 2QXGA 2VGCC 1O3DA 2Y6TA 3GDVA 3BTFE 3KL6A 6GCHG 2ASUB 2FXRA 1ARCA 2ZCKP 3SGQE 2GCHF 1KMHB 2VINA 2ZP0H 5FHTA 1OYQA 1BTZA 1XXDA 1BTYA 1ZTLA 3QGNB 1TIOA 2FOBA 4UFGH 1C5WB 1OKXA 1OOKB 1VCWA 4AB8A 1ID5H 3RXBA 3UPEA 3MHWU 5FXLA 2K8IA 3TK6A 2Z3EA 4CHAB 2HVXA 1FAKH 3C1KA 3OY6U 3K6YA 4ASHA 1WQSA 2BQ7B 4GUXA 4KTUA 3EGKH 4CRDA 4MNXA 3S7KB 3R3GB 5FPYA 2WZQA 3IITA 1GI7B 1ZHPA