1PYTD

Ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
251
structure length
251
Chain Sequence
CGAPIFQPNLSARVVGGEDAIPHSWPWQISLQYLRDNTWRHTCGGTLITPNHVLTAAHCISNTLTYRVALGKNNLEVEDEAGSLYVGVDTIFVHEKWNSFLVRNDIALIKLAETVELGDTIQVACLPSEGSLLPQDYPCFVTGWGRLYTNGPIAAELQQGLQPVVDYATCSQRDWWGTTVKETMVCAGGDGVISACNGDSGGPLNCQADGQWDVRGIVSFGSGLSCNTFKKPTVFTRVSAYIDWINQKLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCARBOXYPEPTIDASE A
publication title The three-dimensional structure of the native ternary complex of bovine pancreatic procarboxypeptidase A with proproteinase E and chymotrypsinogen C.
pubmed rcsb
molecule tags Ternary complex (zymogen)
total genus 46
structure length 251
sequence length 251
ec nomenclature ec 3.4.21.2: Chymotrypsin C.
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytD02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytD01
1O2PA 1UVUH 2XNIA 1UTMA 2AFQB 1O2KA 1FPHH 1UK4A 4KTUA 5HM9A 3BTTE 3TGIE 1DXPA 4IMQA 4TYDA 1ANBA 3LC5A 3LH3A 2AS9A 1LVOA 2WV4A 1JRTA 1GBDA 1TNJA 3TJOA 4JK5A 2FTMA 4AGKA 1W7GH 1BHXF 3F6UH 1HJAC 4KGAA 3SU3A 1P3CA 2OD3B 4O03A 3PLBA 1S82A 2ANKH 4H6TA 1C1TA 2J95A 3EYDA 1V3XA 4WJG2 1DE7H 3KNXA 3BTWE 1HAIH 4HTCH 5EXLA 2VWMA 4BAKB 1T4UH 5I25A 5GCHF 1VR1H 4LK4A 5TJXA 2F83A 1Z7KA 1QB9A 3SGAE 4B2CA 6GCHF 2BDIA 4WMDA 4GLYA 4IC6A 3RM2H 5C1XA 2OTVA 4MPUA 1QRZA 1ELGA 1S81A 3HK3B 3ZVGA 1FDPA 1TPAE 2Z94A 4YOGA 4YTAA 1LKAA 1UK2A 2FS8A 1C1UH 1C4U2 2YOLA 1P57B 4FUGA 1HAYB 4UFFH 4D7GA 1Z1IA 1GI7B 3S9AA 1GL1A 5E2OA 1MKWK 1H8IH 1TIOA 3Q3YA 1AB9C 2G51A 2PLXA 2AEIH 2ILNA 3UNRA 2CF8H 1AVWA 2QXIA 2Y6TA 3MH5A 3ZZ6A 3IWMA 1ZLRA 1O3JA 2BVRH 1Y3UA 3OTJE 1OYQA 4CHAB 1EPTB 4U30A 1FIZA 2ZI2H 2JH5D 1DX5M 3VGCB 2G55A 2ODQA 2OQUA 3U1JB 3S7HB 3PWCA 1QL8A 1DWDH 2ZDVH 2WPMS 4QT8C 1ZGVA 1ABJH 1V2QT 2XWAA 3HATH 2QXGA 5EQRA 2Z9GA 2GMTB 3M7QA 4DG4A 1XUIA 2BLOA 2P3FH 4X6MA 3P17H 4UD9H 3PM3A 5JPMH 3U8OH 3SJ8A 1OWKA 1KLIH 2ZGCA 1O2VA 3SHCH 3AW1A 3TH3H 1DANH 1LDTT 3A83A 1QTFA 1C5RA 4ABIA 1GGDC 1BT7A 5HXFA 3SU5A 4ASHA 1O3EA 1PPGE 1V2OT 3GCTF 1O5BB 3F68H 5FX5A 1S0RA 3ZZ4A 1QBOA 2HPPH 1K1JA 1E37B 1HLTH 4I33A 1Y59T 4Y76A 1RFNA 3SNEA 4A92A 3NZIA 3SNBA 1EB1H 1MCVA 1UCYH 1GI5A 3D65E 4Y0ZE 2P16A 2TBSA 2D26C 3ATIA 3PMAB 3TJNA 3LONA 4AFZA 3S9CA 1RXPA 1JRSA 1QFKH 4Z0KA 4B75A 4X8TH 2W3KA 1J9CH 3OY6U 1TX7A 3M5MA 1EXFA 1TABE 2FP7B 3E0PB 3UR6A 4GHTA 1UTNA 2PKAA 1ELTA 1T31A 1P2IA 1T8MA 3RC6A 3RXTA 3FP8E 1WU1A 5FPSA 4FU8A 2VIVA 1TNHA 2EEKA 3EGKH 1UHBA 2W5EA 4MTBA 5DP5A 4CREA 2EI6A 2GVFA 1ZHPA 1TA6A 1TMTH 5EU8A 1S83A 3MO9A 1WQVH 3K6ZA 1G3BA 2H9TH 1NU9A 2P59A 2PKAB 1HV7A 1OOKB 1L2EA 2A0QB 1CGIE 1QRXA 1T8NA 1GI3A 1YP9A 1XUFA 1P9UA 3N7OA 2ZU4A 4AG1A 3MFJA 2J92A 1SOTA 2ZGHA 4OS4A 3RXJA 1SBWA 5DP7A 1NFXA 1HAVB 1TGNA 2BHGA 1ETRH 2B0FA 3RXKA 1SC8U 1U6QA 3NWUA 1L1JA 2ZPQA 1B5GH 1J17T 4UE7H 5F8ZA 1O30A 1UTJA 2BD3A 5BRRE 7ESTE 1UVTH 4M7GA 3ATKA 1M9UA 1HGTH 1AWHB 2FIRH 1BTHH 4E7NA 1V2KT 3A8CA 4D8NA 1GMCG 2G5NA 3UUZA 2W7UA 4JZ1A 3STJA 2Z6BD 1S85A 1P03A 1GJ4H 2WPIS 1LO6A 1E35B 3TLOA 1V2JT 3AAVA 5JYIA 2H1UA 1CA8B 5DGJA 1AQ7A 4IN2A 1HAZB 2AH4X 4CBNA 3ZZ8A 2PSXA 1VITF 1XUKA 1IQMA 2RA3A 1KSNA 2NU0E 1SVPA 3LU9B 1HCGA 3SJIA 2AMQA 1IQNA 1KLTA 3E1XB 5DP9A 1XKAC 1BB0B 2BD2A 3MO3A 2FXRA 2BQ7B 2LNCA 3MH6A 1QCPA 1ORFA 4CRAA 1GDNA 5DO4H 1C2JA 4X0WU 3T5FH 1THPB 4INLA 1H8DH 1ZPZA 1O3PB 1C5OH 1FUJA 2BDAA 3KIDU 1TGSZ 1O3HA 2NU3E 1ZJKA 2HVXA 1PPHE 1DOJA 4YOJA 1C2MA 3A7WA 4MLFB 1E36B 1SHYA 3RC4A 1HIAA 2HNTC 1C5VA 3A7YA 1UJ1A 1ANDA 3VB3A 1GCTC 1SGIB 1A7SA 3A85A 5A0CA 2ANMH 2LPRA 1XMNB 2STBE 2FLBH 2OLGA 3RXUA 1AWFH 5J4QA 4YO9A 2SGEE 2VGCC 2I6QA 1JMOH 4HGCA 4BAQB 3L33A 1NN6A 2ZDMA 2OBQA 1EQ9A 3WY8A 1YYY1 4MDSA 2FX4A 1C5UA 3D23A 3P8GA 2BDYA 5DJ7A 1EJMA 3TJVA 3ITIA 3MMGA 3V13A 1A0HB 3A81A 4IMZA 3QDZB 1CU1A 3FANA 4ABBA 3H7OA 4FU9A 2FI4E 3LJOA 1RRKA 1GHAF 1GJBB 3SNAA 3PLPA 1WTGH 1YPKH 2XC5A 1AFEH 3GY6A 1V2TT 3A7TA 1C2LA 1H4WA 2BD9A 1ZMLA 4FUDA 1C5WB 3SN8A 4ZXXH 3I77A 4B73A 1CA0B 4O3TA 2XC0A 1O2OA 4NCYA 1ZR0A 4F4OC 4Y7BA 3KHVA 1FJSA 2Y82A 4B2AA 2ZG0H 4NFFA 1YGCH 5CE1A 3M5LA 2HNTF 1GI6A 1CGHA 2GD4B 1Y3VA 1XXDA 3SQHE 2FTLE 1BRUP 2F9UA 3BV9B 2BYAX 1C2EA 1ELDE 4HZHA 1XKBC 2HGTH 1EJAA 4OS2A 2GP9B 4Q7ZA 5T6FA 1OWIA 2A4GA 4X6OA 1GI8B 1A2CH 1HDTH 3HKJB 3TJUA 5DP4A 3VB4A 3GCNA 1IQIA 5A09A 3LGVA 4WMEA 3SUDA 4R8TB 5ESBA 5ABWA 4GCHG 3IG6B 5LGOA 1GGDB 3BTFE 1MD8A 2QXJA 4LXBH 2CN0H 3UREA 1ABIH 3CS0A 3E91A 1O3NA 3M5OA 3UOPA 1C1QA 4Y7AA 5DKMA 3U8TH 3RXMA 1MQ5A 2AYWA 1FMGA 1YKTA 2VINA 3SI3H 1TALA 2BQWB 1WUNH 2C8XB 1KDQA 1OWDA 1E38B 2ZZUH 3MNSA 3PB1E 1K2I1 1LQDB 1O5AB 3M37A 4JYUH 1YC0A 5FXLA 3P6ZB 4CHAC 1EPTC 2WYGA 3E0NB 3VGCC 5EGMA 1SQTA 2ZFQH 1DY9A 1JIMA 2Y5HA 1WYKA 1GHWH 3URCA 1O0DH 6CHAB 1NT1A 1BMLA 2BDGA 3MNBA 4BAHB 1E34B 3GY8A 3BG8A 4KKDA 4BANB 4X8SH 4CRDA 5I46H 2CHAC 3QTVH 2BXUH 3D62A 1FAKH 4IN1A 1L4ZA 2GTBA 2TGAA 3T2NA 4X2WA 3FAOA 4XFQA 2B8OH 3E3TA 2ZGBH 5G4BA 3VPKA 4ZHAA 1K22H 1AU8A 1TQ7B 4BOHA 1GG6B 2H2ZA 3UWJH 3LGIA 2ASUB 1OWEA 1ELAA 3OYPA 1EATA 1EB2A 1O3AA 1RD3B 4MVNA 1P9SA 4NZQA 2F9VA 3RU4T 1PPZA 1ANCA 2BDBA 1DFPA 2G52A 4BAMB 1QJ1B 2GV7A 1LPZB 2BLQA 2ZFTA 3SNDA 3B23B 1UK3A 2ZECA 1TOCB 1UMAH 2A4QA 2UWOA 1O36A 1Z71A 5L30H 1GHZA 2ZGXH 3EE0B 1QB1A 5C3NA 4ZXYH 1T32A 1MAXA 2QF0A 2AGIX 1GBAA 2O8WA 4SGBE 1CHOG 8KME2 3RM0H 1GDUA 3A82A 1A5GH 5JBTA 4AYVB 1FY1A 1G3EA 1S84A 1ZGIA 1S6FA 2THFB 1ELFA 2C4FH 1GBEA 2GCTB 1LVMA 3MOCA 1NZQH 4KELA 1OP2A 3TPIZ 1HB0B 3SO3A 1F0UA 3C1KA 2G4UA 3BEFB 4I8HA 1YCPK 2CGAA 2AGEX 4DIIH 1NRSH 2O8TA 1GBKA 1GJAB 2ZHDA 3TK9A 1JBUH 5IDKA 1D3PB 1QA7A 2ZO3H 1BQYA 3RXVA 4TPYA 2QYIA 1O33A 2RA0A 2IN2A 1CHGA 2F9OA 4CH8B 2M5TA 5EOKA 1Q3XA 5ESTE 2XCNA 6ESTA 1NS3A 1ZZZA 2UUYA 2VU8E 1O31A 3FZZA 2PV9B 2A2QH 3A89A 4AG2A 1L0ZA 1C1WH 1L1GA 4D9QA 1TB6H 2XRCA 2ALPA 1K1OA 1TQ0B 1J15A 1QJ6B 2BZ6H 4NIVA 1A4WH 4ZKOU 1LVBA 1OWHA 2PWXA 1BOQA 1K1NA 2GCHG 2ZCHP 1SG8B 1XXFA 5A0AE 1O3GA 2OC7A 2BD8A 2FOAA 1GDQA 5JBBS 1BTXA 1NROH 4DOQA 1TMBH 2WPHS 1NFUA 1W14U 5HYOA 4LZ1H 1SSXA 4H4FA 2C8YB 4FVDA 1FY3A 2PGBB 1N1LA 1T7CA 1QY6A 3SV7A 1WBGB 1NTPA 3G01A 3E6PH 3PMBB 3QUMP 5GXPA 2VIOA 1WSSH 4AOQA 1V2RT 3F9EA 5ETXA 4AFUA 1S6HA 2H5CA 1P2QA 4E06H 1RGQA 2ALVA 3TNTA 4JK6A 3ZV9A 2DE8A 4INHA 2WV5A 4HFPB 2KAIB 4Y10E 5EQQA 1SGPE 1Y5UT 3GY4A 1RS0A 3VEQB 2BM2A 2BQ6B 1SFQB 1FAXA 5C1YA 1FN8A 1LHDH 1SGYE 1BTPA 3PV4A 3SUEA 3DHKH 1IAUA 4RKOB 3RXSA 2ZU2A 2JETB 3QK1A 3DD2H 3TH4H 2YNBA 3MHWU 4ZKSU 3PO1C 4WH6A 4VGCB 1C9PA 3RU4E 3PMJA 1DXWA 1SFIA 8GCHG 2PSYA 2SFAA 3UPEA 1FLEE 2PW8H 4WH8A 2J34A 2FYQA 1PPCE 2FOMB 1ZTLA 1C2FA 3RMOH 1BA8B 2F9PA 2GZ8A 2I6SA 3NPSA 4K2YA 2JH6D 4DT7B 1XM1A 1TE0A 2D2DA 2R0LA 2TIOA 2Z3EA 4JZFH 4ZUHA 1ACBE 3P8OA 2FPZA 5EPNA 1GBBA 3PTBA 1FI8A 2ZWLH 3AASA 5HM2A 3BIVH 5GPIB 3A7VA 1BBRE 1OP8A 1P01A 3NK8A 1PPBH 1D6WA 1AHTH 2FMJA 2EC9H 2PKSB 5GJ4B 1KTTB 2Y7ZA 1ETTH 1OWJA 1EPTA 1O3MA 1C1PA 1YPEH 1FY5A 2B7DH 1NFYA 3LC3A 4TWYA 1CA0C 1GHBG 1HNEE 1W12U 3V12A 1F2SE 3SJ9A 2FODA 4AFSA 1F0RA 1SQAA 1VCPA 1C5MD 3P8NA 4ISIH 2BX4A 5FCKA 3RMLH 5DK1A 4ZAEA 2AERH 1DWEH 1NC6A 1XVMA 1IQGA 1XX9A 3GICB 3SV6A 5E8EH 1AMHA 4ZH8A 3M3VA 3P70B 3UQVA 4HI3A 4YLQH 3FVFB 1BRBE 1O3CA 3ZZCA 1FQ3A 4Y8ZA 3A88A 2CHAB 1VITH 1HBTH 4ISHH 1EAWA 3FP7E 2CXVA 3RXIA 3RDZA 1DICA 3UNSA 1HJ8A 1O3OA 1NFWA 1D4PB 2WYJA 1O2GH 1V2VT 1CVWH 1KXDA 2HLCA 1TRMA 6GCHG 1KXBA 1QA0A 1BJUA 2VIPA 3GY7A 1VJAU 1SGDE 1SMFE 2G5VA 2FI3E 5F6MA 3SW2B 3O8DA 1BBRK 2AIPA 1GMCF 5A8XA 4X1QU 2W7SA 1F5KU 1W11U 3GY2A 1P2OA 1O2UA 1O2TA 3F1SB 1MKWH 6CHAC 3HGPA 3C27B 2A1DB 2XC4A 1PPEE 1KTSB 2PUXB 4Y6DA 1HAVA 1RIWB 1TLDA 4K3JA 3UQOA 2QXHA 3A7ZA 4CR9A 1UVPA 1GG6C 3QZRA 3TK6A 3VB6A 1GWAA 2A5KA 3CENA 3L3TA 1THSH 1D6RA 4Y71A 1A5IA 2YNAA 2FS9A 3MWIU 1G3DA 1AD8H 1O5CB 3SQEE 1NRRH 2VWNA 3CP7A 2XYAA 2FM2A 1ZTKA 1C2HA 1VCWA 1QBVH 1DVAH 1N8OB 4GVUA 4UFGH 4ZMAH 1CO7E 3BTHE 3TU7H 2ZP0H 5CMXH 1AKSB 3ZVEA 1V2ST 3RLWH 1AE5A 3ZV8A 2A32A 1G30B 4XBCA 3M35A 2VNTA 1IQFA 1TA2A 1SGEE 5T6GA 1QQ4A 2H6MA 3EQ0H 4KP0A 3UTUH 2FOGA 1JWTA 3PYHA 1LQEA 2TPIZ 4NSYA 1CT0E 3BN9A 4A1XA 1SGQE 2O9QA 1DY8A 2ZHQH 5AFYH 1JIRA 4H6SB 5C5NA 1TRYA 3K9XB 2GCTC 4X2XA 4GPGA 5A0BA 3QX5H 1QURH 2VWLA 5JBCS 1HXEH 1VZQH 1MU6B 4YT7H 2TGPZ 3T29A 1O5GH 5EG4A 3JZ1B 2RG3A 4B1TA 1V6DA 2PHBA 2XWBI 1K21H 4DVAU 4AORA 1AVGH 7KMEH 3Q76A 2ZGJA 1ESTA 1ZMNA 1C5ZB 4ABHA 2SGAA 3KQEA 5GDSH 4NWLA 2WINI 1NRPH 2XBVA 1G2MA 4UEHH 1MKXK 4GSOA 3FP6E 3RXEA 3A84A 1F7ZA 2GV6A 1P0SH 1Q31A 2ZHFH 1HYLA 1LKBA 4I8LA 5HGGA 4NGAH 1C1SA 3PO1B 1DLKB 2QV1A 3SJKA 2AIQA 4AFQA 3BTGE 4FUFA 2R9PA 1Y5BT 1HFDA 3MU4A 3ATWA 2A7JA 3ZVCA 1Z8GA 2UUJB 2ZKSA 5AHGH 1SR5C 1GI9B 3GY5A 4CRCA 1ZPCA 4WY3A 4TWWA 2QN5T 1CSOE 1F0SA 5E0HA 1T4VH 2Z3CA 3BTKE 2ZEBA 4NIWA 5DP8A 4NWKA 3HPTB 1O35A 4Z6AH 1SI5H 1N6YA 1DWCH 2FWWA 3V0XA 2O8LA 4MG3A 1SLUB 1YLCA 3DFLA 3RXAA 1TGBA 1G32B 3SI4H 3A86A 1BMAA 1C2GA 1F5LA 4NSVA 1DSUA 3IITA 3OY5U 1SQOA 3QZQA 1HPGA 4I8JA 1FV9A 2OBOA 1EZUC 3RXQA 1MUEB 1GL0E 4ABGA 4ISOA 1EP6A 1J14A 5L2YH 1BDAA 1SGNE 3TVJB 1ESAA 4I8GA 2V6NA 4NA8A 4FUHA 2JETC 4ZROA 2F9NA 4GUXA 4A1VA 1D3QB 3RXLA 1H1BA 1WTHD 2ZQ1A 4VGCC 4DY7B 1SGCA 1KYNA 5DP6A 3P92A 2Z3DA 1SB1H 1KY9A 3GISB 5C1UA 1GI2A 4XSKU 1D9IA 2UWPA 1UVOA 5SGAE 1YBWA 1GBLA 1O2IA 3O8CA 1WQSA 1BUIA 2BY5X 4UFEH 5C2ZA 2GGVB 3BTME 1Y3WA 2PFEA 3ZYDA 3AVZA 4CRGA 1QNJA 4MNYA 2QA9E 5F8XA 2C3SA 1ANEA 3FFGA 1YPLH 3ZVFA 1SOZA 3OSYA 4B76A 2SNWA 4ZHMU 5A8ZA 3SGBE 4I32A 2PKSC 5GIBA 2QAAA 2F9BH 1FY8E 1EAUA 2J94A 3ODDA 1P06A 3F9GA 4AN7A 2BB4A 5K7RA 3JZ2B 2FOHA 3S69A 3GY3A 5FPYA 1JOUB 2IJOB 3BG4B 5A8YA 1AY6H 3KQDA 1O2WA 1ZHRA 3LGUA 1O3KA 1G37A 1L4DA 2B5TB 2BD4A 2BLVA 1TOMH 4ABAA 3ZZ9A 1K1PA 1O2HA 1QJ7B 1GHAG 3QLPH 1TAWA 2EI7A 5FPTA 1DPOA 1SGFG 3SU2A 1LVYA 1Z8JB 1O3BA 1UTPA 3V7TA 1SGTA 1GVKB 1GVZA 4WF8A 1OP0A 1OXGA 2BY6X 1HXFH 1V2MT 3SZNA 2ZDLA 4MNVA 2GKVE 9ESTA 3U69H 1GMDF 1QQUA 3H7TA 2ZFSA 3W95A 2BTCE 1J16A 4OS7A 3LT3A 3ODFA 4IBLH 1XVOA 3RXGA 1PYTC 1P04A 4ABJA 1P2KA 4K8YA 3K65B 2EI8A 1GMHG 4ZKRU 1GI0A 2F91A 1YM0A 2ANWA 2ZFFH 3UR9A 3VXFH 2Y5GA 3TIUA 5E2PA 5TCCA 1O2QA 3SV8A 2VVVA 1RTLA 1TX8A 4FUCA 3SUGA 2ZTYA 2P8OB 3MO6A 4K60A 1QL9A 1VGCB 3O8BA 2BX3A 3RP2A 1UTLM 4XDEA 1A1RA 3SU0A 2VH0A 3F9HA 5PTPA 4IGDA 1CT4E 4IS5A 1CBWC 3B9FH 4X2YA 2Z9KA 4BNRA 2ZTXA 2OCVB 1Y5AT 3PROA 1O3DA 4KTSA 2GCHF 1O2YA 4TY7A 2NU4E 2CMYA 1GBCA 4ISLA 3TH2H 1G2LA 1SLVB 1RIWC 2HPQH 1EAIA 1MZAA 2BY9X 3Q3KA 4I8KA 1D3DB 5C20A 1THRH 1ZRBA 1QL7A 2HRVA 2BZAA 1BMMH 1C2KA 1MCTA 2Z9IA 2ZHWH 3HGNA 3RUOA 1QIXB 1SPJA 4NFEA 5FAHA 1FN6A 1MTVA 2A4RA 1KXCA 1TBZH 3LJJA 1GBMA 1W10U 1TRNA 4U01A 1NU7B 3H5CB 4X1SU 1YPHE 1YPGH 2W3IA 2Z9LA 1N8OC 1O2RA 4D76A 5BPEA 1C4Y2 2SGFE 1O2LA 2Z7FE 1UTQA 1EOLA 1GI4A 1NRQH 1Z8IB 3GDSA 5F8TA 2OC8A 1BTWA 1TNKA 3L6PA 4Q80A 1MTSA 2FO9A 5EPYA 3GDVA 4X6NA 2G4TA 1YF4A 3VXEH 5CHAB 4O97A 5DPAA 5FCRA 4U2WA 3RXOA 2VB0A 4WWYA 3EA8A 1JXPA 1HAPH 1OSSA 3SUFA 3KQBA 1VJ9U 1ZSKA 2Z9JA 1O2ZA 1ZMJA 1GBIA 2KAIA 2VWOA 3LH1A 1PQ5A 5H4IB 2GX4A 5LPFA 1ZOMA 1HAGE 1FY4A 1QB6A 1TYNA 1P10A 1TNIA 1UCYE 4K1SA 5TCAA 1OPHB 2H5DA 5FBIA 2ZA5A 4DJZB 4NA9H 1ZHMA 5LPRA 2ZQ2A 2CV3A 4CH2B 1W2KH 4CR5A 1P09A 4XBDA 3SU1A 3P8FA 4MNWA 3GDUA 2R3UA 1SGRE 2W26A 1BTZA 1YPMH 4YESB 4TPIZ 1OKXA 2PTNA 2BD7A 3MU0A 2J38A 2A5IA 1GHBF 2D1JA 3LPRA 2AMPA 2FESH 4YOIA 1A0JA 2FYRA 3GYLB 2TGTA 3SHAH 4X1RU 1ZYOA 1BZXE 1YCPH 2F3CE 4OS1A 1C1OA 2Y81A 2ZIQH 1F5RA 1KXEA 5K0HA 3RXCA 2FOCA 1SHHB 1C1MA 3M3TA 4BAOB 3HKIB 1TPPA 1QRWA 4RN6A 1O2NA 1A3EH 7GCHG 2ZDKA 1GJ7B 3TNSA 3KN2A 2GZ9A 3U1IB 2FDAA 1LTOA 5DP3A 2QIQA 4BXWA 2XTTB 3ZZAA 1LMWB 4DGJA 3KQCA 9LPRA 2VJ1A 1AGJA 1ZJDA 1G3CA 1TBQH 1HUTH 2OINA 3A8DA 3SGQE 3DA9B 1MBMA 4OS6A 4AZ2B 4BTIB 3VFEA 1P2NA 1P3EA 1C2IA 2J9NA 5JBAS 3LGYA 3ATMA 3RXBA 2BVXH 3SNCA 3Q77A 1B0FA 3BEUA 3TITA 1K1LA 2HALA 3B8JA 4D9RA 3LGTA 1XUJA 3LGWA 2HNTE 3BF6H 1RJXB 4ISNA 4XBBA 3GCHB 1EP5A 4ABEA 1AVXA 1UCYK 1MQ6A 2V3HH 3T27A 1GI1A 1H9HE 1MTWA 1RTKA 3O8RA 2HWLB 3SV2H 4CRBA 1EJNA 1EKBB 3RC5A 3TK5A 1S0QA 1ELBA 1LHFH 1W0YH 2PGQB 4KTCA 1ZRKA 5EODA 2ZU5A 4BTUB 5F03A 5IYTA 2ZDNA 1Q2WA 2A7CA 1IQEA 1ESBA 4X8UH 1TONA 3ENSB 1DM4B 1INCA 2B9LA 2A31A 3S9BA 1PFXC 2C93B 3UIRA 1ETSH 5C5OA 4Y8XA 1CQQA 4WVPE 1QGFA 1O2JA 3KL6A 4X6PA 1B7XB 1SLWB 3VB7A 3UFAA 3KEEA 5JB8S 1ARCA 1GJ5H 3GYMA 3GOVB 2GDDA 2Q6FA 1PJPA 2WUCA 1MH0A 3PWBA 4IW4E 4OGXA 2A45B 1AE8H 3ATLA 3T62A 1K1IA 1O2MA 5AFZH 2JH0D 3SV9A 1F92A 5GCHG 3DUXH 1C5YB 4AX9H 1GJ8B 2O8MA 1O5DH 2Q6DA 3BG4C 2XW9A 3ZVAA 3MTYA 4K1EA 4AB8A 4Y11E 2G81E 3S7KB 4MPXA 1A5HA 1MTNB 2A5AA 1L1NA 2Y5FA 4Y79A 5E0JA 5HMAA 3LKWA 3OU0A 4A6LA 3E16B 1BJVA 1TX6A 1TBRH 4Q2KA 3TGJE 1UTKA 4IC5A 3V3MA 1WV7H 4FUEA 4INKA 1XUHA 2BOKA 2UUFB 4O3UA 2ZU3A 3M3SA 2ODPA 3ZZ3A 2BXTH 3TGKE 3ZZDA 3U9AH 3R3GB 4OS5A 1CBWB 4MQAA 3MU8A 1KXFA 3MH4A 2Y80A 2PUQH 1PQ7A 1XUGA 3KF2A 1HAXB 3QGNB 4AYYB 3SORA 5EW2H 1E0FD 2R2MB 2QF3A 2BLWA 2ZFPH 1DS2E 3P95A 4BTTB 1PYTD 1FPCH 1C9TA 1YPHC 2XBXA 1C1VH 2BMGB 3MU5A 4R0IA 3RMNH 2NU2E 5FBEA 3MI4A 1AKSA 1CT2E 3M7TA 1NM6A 3STIA 2V3OH 1AFQC 1KLJH 1WAYB 2OQ5A 2P93A 4K5ZA 4X1PU 1ZTJA 2VVUA 1EAXA 4CBOA 1RTFB 3ZVBA 2FEQH 1O2XA 1GVLA 4H42U 2P3TB 5AVDA 2P8OC 1EZXC 1V2UT 1Y3XA 3M5NA 1PQ8A 2G00A 1VGCC 2OC0A 3QN7A 3ZYEA 2A7HA 2D8WA 2A4OA 5EQSA 4GAWA 4B71A 3Q3XA 3GCTG 3MYWA 1IHTH 1UHBB 4A1TA 1BHXB 4NIYA 2R3YA 2Q6GA 3LDXH 4FU7A 4O9VA 1DITH 2OXSA 2R0KA 5A2MH 1BRAA 1WOFA 2AGGX 3QTOH 3U98H 2IPHA 1TPSA 3RXDA 3RXPA 4FXGH 4ESTE 1BBRH 1KXAA 4B2BA 5C67A 3A7XA 3F9FA 3RLYH 1FONA 1QHRB 5J4SA 1Y3YA 2QCYA 1O3FA 3UWIA 1O5FH 2FX6A 3M36A 1P2JA 3R0FA 3MNCA 2G8TA 1MAYA 1GJDB 2XBWA 1P12E 4JCNA 1YPJH 8LPRA 2DE9A 1PPFE 4GHQA 4JYVH 1IHSH 2VIDA 3BSQA 1TFXA 2FOFA 5B6OA 1TPOA 3SOSA 3S0NA 3CS7A 1GBTA 1UO6A 2OC1A 4DCDA 1W0ZU 2H9HA 4JYTA 1Y8TA 1YCPM 1P11E 2FZZA 3NUMA 3AAUA 1W8BH 3QGJA 1AO5A 4A5TS 1WCZA 1N6XA 5CHAC 2J4IA 3T25A 1Z1JA 2XCFA 2ZCKP 2CJIA 3NKKA 4JMYA 2A2XH 2STAE 1C1NA 1CE5A 1P02A 3DFJA 3I78A 4UDWH 1AUJA 1OX1A 1HJAB 1O37A 2AMDA 2H9EH 1S5SA 2FOEA 4PROA 2P94A 3SU4A 2ODYB 4Q7YA 1A61H 1TNLA 2ZNKH 1C5TA 4JZDH 2R2WU 5EXMA 1B0EA 2GZ7A 4Q7XA 3D49H 4MNXA 1P8VC 5DG6A 4ZHLU 1BMNH 1EOJA 1W7XH 1AZ8A 4GCHF 2ZPRA 2PTCE 1HAOH 1DLEA 4WXIA 4FUJA 1DDJA 2BDHA 3LIWA 2BOHB 1FXYA 8ESTE 3MU1A 4I7YH 2J2UA 4RSPA 2ZU1A 1HJ9A 1LHCH 1SLXB 1VITG 1HIAB 4F49A 4AB9A 2TGDA 2O8UA 4J1YA 5AF9H 2ZFRH 3EA9A 1F0TA 1KIGH 1O3LA 1V2NT 1YLDA 5GWZA 1GCDA 1DUEA 2ULLA 1LCYA 4ABFA 3RMMH 1A0LA 3ZZ7A 2C8ZB 1IQHA 2SGQE 3BEIB 3RXRA 1FZZA 4X2VA 1AB9B 2OP9A 1GHVH 2XXLA 2VIWA 2WPLS 1MKXH 3BTEE 3ELAH 3T26A 4JZEH 1LHGH 2WPJS 4U32A 3BTQE 4A7IB 1HRTH 5T6DA 1GHYH 4DURA 1BTUA 4J2YB 2NU1E 4XOJA 1IQJA 3KGPA 1T8LA 1GMHF 3BIUH 2FLRH 2BY8X 3PMHB 2GDEH 3RXFA 4LZ4B 1MD7A 1O38A 2OUAA 3SJOA 1TNGA 3K6YA 1LPGB 2GT8A 4SGAE 4THNH 1C5XB 2QGRA 3GCHC 3LOXA 3ZZ5A 1UTOA 2BDCA 3KCGH 1DWBH 1IOEA 1HAHH 2FOBA 2GT7A 1Z6EA 4OGYA 5EW1H 2NWNA 3PTNA 1PQAA 1BIOA 2ZCLP 1GBFA 4D7FA 3I29A 4DIHH 1LHEH 2Q1JA 5E0GA 1GJ6A 1O32A 1IQLA 1QBNA 4Y0YE 4YT6H 4NG9H 1CHOF 2ZPSA 3W94A 2RCEA 4MPWA 2VH6A 5LH8A 2IOTA 1BTYA 2C8WB 2VIQA 4YZUA 3UOUA 4FUIA 2P3UB 2ANYA 2Y7XA 1EZSC 4Y8YA 2P95A 4E7RG 1EX3A 3EA7A 4UFDH 3K2UA 1TGCA 1P05A 3NCLA 1GJCB 2ZHEH 1H9IE 1ELCA 1C5LH 1KDQB 4X1NU 1AFQB 2VVCA 2GMTC 4BXSA 4ABDA 3EAJA 4RKJB 1A3BH 1TGTA 3URDA 3A80A 1C5SA 1MTNC 2SNVA 2BVSH 1GHXH 4I31A 4NA7A 3PLKA 1K28D 1FIWA 1NRNH 1C4V2 1GPZA 1C1RA 2PR3A 3Q00A 4WXVA 2HOBA 3GCOA 3M7UA 2QY0B 1IQKA 4K1TA 1C5PA 4WMFA 1AI8H 1ZSJA 1V2PT 1SL3A 1TMUH 1BCUH 2JKHA 1TWXB 3SBKA 1UVSH 1MMJN 2DUCA 1A46H 1DT2A 3UY9A 1EUFA 1NY22 1W13U 2SGPE 2ZC9H 1QR3E 2BD5A 4XE4A 4UONA 1O2SA 4YM9A 2WUBA 3T28A 1O3IA 5FX6A 5L2ZH 3A87A 4ZKNU 1K9OE 4LOYH 1SGFA 4E05H 2BY7X 3U8RH 1MBQA 3HK6B 1G9IE 1OS8A 1ARBA 2ESTE 1ZPBA 4K69A 4JZIA 1GMDG 5L6NH 3E8LA 4X8VH 1V2WT 1DSTA 1NPMA 1X7AC 1ZSLA 1H9LB 4B74A 1O39A 1EASA 3MH7A 5JDUB 1ID5H 1BRCE 2ZTZA 1DUAA 1FNIA 1T8OA 2V0BA 1GJ9B 1ELEE 4DW2U 2EA3A 1VCQA 3DT0H 1BITA 5T3HA 6LPRA 7LPRA 1D3TB 2QC2A 3RXHA 1W3CA 7GCHF 8GCHF 5LPEA 1Z8RA 1P2MA 3QO6A 3VB5A 1Z6JH 5JB9S 1GBJA 3SU6A 2WPKS 1EZQA 3UNQA 3E90B 5EXNA 1G36A 3ZVDA 3A8AA 3MNXA 4NIXA 1NESE 2TRMA 1AIXH 1CGJE 1J8AA 4AGJA 2K1QA 1K1MA 1GCTB 3OX7U 1V2LT 4CRFA 3AW0A 2ZDAH 4FUBA 1MTUA 1MZDA 2ZF0H 2V35A 2C90B 3ESTA 1AUTC 3RU4D 1NO9H 1ELVA 3ZZBA 2VGCB 4K8BA 1AN1E 2RDLA 2XBYA 1O5EH 1AZZA 3A8BA 4NZLA 4TY6A 1C2DA 2UUKB 3FZDA 3QWCH 1OYTH 1O34A 3EDXB 2SGDE 4FVBA 1C5QA 1GBHA 2FI5E 2UWLA 4YLUA 3NXPA 4MPVA 5FHTA 1LPKB 3BTDE 1MU8B 1C5NH 3M61U 2CF9H
chains in the Genus database with same CATH superfamily
1O2PA 1UVUH 3ZIAD 2XNIA 1UTMA 2AFQB 1O2KA 1FPHH 1UK4A 4KTUA 5HM9A 3BTTE 3TGIE 1DXPA 4IMQA 4TYDA 1ANBA 3LC5A 3LH3A 2AS9A 1LVOA 2WV4A 1JRTA 1GBDA 1TNJA 3TJOA 4JK5A 2FTMA 4AGKA 1W7GH 1BHXF 1NBMD 1HJAC 3F6UH 4KGAA 3SU3A 1P3CA 2OD3B 4O03A 3PLBA 1S82A 2ANKH 3W1EA 4H6TA 1C1TA 2J95A 1E1RD 3EYDA 1V3XA 4WJG2 4ASUD 1DE7H 3KNXA 3BTWE 1HAIH 4HTCH 5EXLA 2VWMA 4BAKB 1SQRA 1T4UH 5I25A 5GCHF 1VR1H 4LK4A 5TJXA 2F83A 1Z7KA 1QB9A 3SGAE 4B2CA 6GCHF 2BDIA 4WMDA 4GLYA 4IC6A 3RM2H 5C1XA 2OK5A 2OTVA 4MPUA 1QRZA 1ELGA 1S81A 3HK3B 3ZVGA 1WDIA 1FDPA 1TPAE 2Z94A 4YOGA 4YTAA 1LKAA 1UK2A 2FS8A 3OAAD 1C1UH 1C4U2 1WXRA 2YOLA 1P57B 4FUGA 1HAYB 4UFFH 4D7GA 1Z1IA 1GI7B 3S9AA 1GL1A 5E2OA 1MKWK 1H8IH 1TIOA 3Q3YA 1UW7A 1AB9C 2G51A 2PLXA 2AEIH 2ILNA 3UNRA 2CF8H 1AVWA 2QXIA 2Y6TA 3MH5A 3ZZ6A 3IWMA 1ZLRA 1O3JA 2BVRH 4ACAA 1Y3UA 2W6JD 3OTJE 4XD7D 1OYQA 4CHAB 1EPTB 4U30A 1FIZA 2ZI2H 2JH5D 1DX5M 3VGCB 2G55A 2ODQA 2OQUA 5CHBA 3U1JB 3S7HB 3PWCA 1QL8A 1DWDH 2ZDVH 2WPMS 4QT8C 1ZGVA 1ABJH 3F3BA 1V2QT 2XWAA 3HATH 2QXGA 5EQRA 2Z9GA 2GMTB 3M7QA 4DG4A 1XUIA 2BLOA 2P3FH 4X6MA 3P17H 4UD9H 3PM3A 5JPMH 3U8OH 3SJ8A 1OWKA 1KLIH 2ZGCA 1H8ED 1O2VA 3SHCH 3AW1A 3TH3H 1DANH 1LDTT 3A83A 1QTFA 1C5RA 4ABIA 1GGDC 1BT7A 5HXFA 3SU5A 4ASHA 1O3EA 1PPGE 3FOAA 1V2OT 3GCTF 1O5BB 3F68H 5FX5A 1S0RA 3ZZ4A 1QBOA 2HPPH 1K1JA 1E37B 1HLTH 4I33A 1Y59T 4Y76A 1RFNA 3SNEA 4A92A 5C0TA 3NZIA 3SNBA 1EB1H 1MCVA 1UCYH 1GI5A 3D65E 4Y0ZE 2P16A 2TBSA 2D26C 3ATIA 3PMAB 3TJNA 3LONA 4AFZA 3S9CA 1RXPA 1JRSA 1QFKH 4Z0KA 4B75A 3OEHD 4X8TH 2W3KA 4TT3D 1J9CH 3OY6U 3F2FA 1TX7A 3M5MA 1EXFA 2VBCA 1TABE 3WWFA 2FP7B 3E0PB 3UR6A 4GHTA 1UTNA 2PKAA 1ELTA 1T31A 1P2IA 1T8MA 2AHME 3RC6A 3RXTA 3FP8E 1WU1A 5FPSA 4FU8A 2VIVA 1TNHA 2EEKA 3EGKH 1UHBA 2W5EA 4MTBA 5DP5A 4CREA 2EI6A 2GVFA 1ZHPA 1TA6A 1TMTH 5EU8A 1S83A 3MO9A 1WQVH 3K6ZA 2KCOA 1G3BA 2H9TH 1NU9A 2P59A 2PKAB 1HV7A 1OOKB 1L2EA 3OTPA 2A0QB 1CGIE 1QRXA 1T8NA 1GI3A 1YP9A 1XUFA 1P9UA 3N7OA 2ZU4A 4AG1A 3MFJA 2J92A 1SOTA 2ZGHA 4OS4A 3RXJA 1SBWA 5DP7A 1NFXA 1HAVB 1TGNA 2BHGA 1ETRH 2B0FA 3RXKA 1SC8U 1U6QA 3NWUA 1L1JA 2ZPQA 1B5GH 1J17T 4UE7H 5F8ZA 1O30A 1UTJA 2BD3A 5BRRE 7ESTE 1UVTH 4M7GA 3ATKA 1M9UA 2KCAA 1HGTH 1AWHB 2FIRH 1BTHH 4E7NA 1V2KT 3A8CA 4D8NA 1GMCG 1YWUA 2G5NA 3UUZA 2W7UA 4JZ1A 3STJA 2Z6BD 1S85A 1H8HD 1P03A 2J98A 1GJ4H 2WPIS 1LO6A 1E35B 3TLOA 1V2JT 3AAVA 5JYIA 2H1UA 1CA8B 5DGJA 3H09A 1AQ7A 4IN2A 1HAZB 2AH4X 4CBNA 3ZZ8A 2PSXA 4ZCNA 1VITF 1XUKA 1IQMA 2RA3A 1KSNA 2NU0E 1SVPA 3LU9B 1HCGA 3SJIA 2AMQA 1IQNA 1KLTA 3E1XB 5DP9A 1XKAC 1BB0B 2BD2A 3MO3A 2FXRA 2BQ7B 2LNCA 3MH6A 1QCPA 1ORFA 4CRAA 1GDNA 5DO4H 1C2JA 4X0WU 3T5FH 1THPB 4INLA 1H8DH 1ZPZA 1O3PB 1C5OH 1FUJA 2BDAA 3KIDU 4F55A 1TGSZ 1O3HA 2NU3E 1ZJKA 2HVXA 1PPHE 1DOJA 4YOJA 1C2MA 3A7WA 4MLFB 1E36B 1SHYA 3RC4A 3FO8D 1HIAA 2HNTC 1C5VA 3A7YA 1UJ1A 1ANDA 3VB3A 1GCTC 2RDEA 1SGIB 1A7SA 3A85A 5A0CA 2ANMH 2LPRA 1XMNB 2STBE 2FLBH 2OLGA 3RXUA 1AWFH 5J4QA 4YO9A 2SGEE 2VGCC 2I6QA 1JMOH 4HGCA 4BAQB 3L33A 1NN6A 2ZDMA 2OBQA 1EQ9A 3WY8A 1YYY1 4MDSA 2FX4A 1C5UA 2J5UA 3D23A 3P8GA 2BDYA 5DJ7A 1EJMA 3TJVA 3ITIA 3MMGA 3V13A 1A0HB 3A81A 4IMZA 3QDZB 5B6LA 1CU1A 3FANA 4ABBA 3FN8A 3H7OA 4FU9A 2FI4E 3LJOA 1RRKA 1GHAF 1GJBB 3SNAA 3PLPA 1WTGH 1YPKH 2XC5A 1AFEH 3GY6A 1V2TT 3A7TA 1YY3A 1C2LA 2BD9A 1H4WA 1ZMLA 4FUDA 1C5WB 3SN8A 4ZXXH 3I77A 4B73A 1CA0B 4O3TA 2XC0A 1O2OA 4NCYA 1ZR0A 4F4OC 4Y7BA 3KHVA 1FJSA 2Y82A 4B2AA 2ZG0H 4NFFA 1YGCH 5CE1A 3M5LA 2HNTF 1GI6A 1CGHA 2GD4B 1QZ8A 1Y3VA 1XXDA 3OEED 3SQHE 2FTLE 4Q4LA 1BRUP 2F9UA 3BV9B 2BYAX 1C2EA 1ELDE 4HZHA 1XKBC 2HGTH 1EJAA 4OS2A 2GP9B 4Q7ZA 5T6FA 1OWIA 1SKYE 2A4GA 4X6OA 1GI8B 1A2CH 1HDTH 3HKJB 3TJUA 5DP4A 3VB4A 3GCNA 1IQIA 5A09A 3LGVA 4WMEA 3SUDA 4R8TB 5ESBA 5ABWA 4GCHG 2JJ1D 3IG6B 5LGOA 1GGDB 4RT0A 3BTFE 1MD8A 2QXJA 4LXBH 2CN0H 3UREA 1ABIH 3CS0A 3E91A 1O3NA 3M5OA 3UOPA 1C1QA 4Y7AA 5DKMA 3U8TH 3RXMA 1MQ5A 2AYWA 1FMGA 1YKTA 2VINA 3SI3H 1TALA 2BQWB 1WUNH 2C8XB 1KDQA 1OWDA 1E38B 2ZZUH 3MNSA 3PB1E 1K2I1 1LQDB 3UB0A 2EQNA 1O5AB 3M37A 4JYUH 1YC0A 5FXLA 2WZQA 3P6ZB 4CHAC 1EPTC 2WYGA 3E0NB 3VGCC 5EGMA 1SQTA 5KEDA 2ZFQH 1DY9A 1JIMA 2Y5HA 1WYKA 1GHWH 3URCA 5DN6D 1O0DH 6CHAB 1NT1A 1BMLA 2BDGA 3MNBA 4BAHB 1E34B 3GY8A 3BG8A 4KKDA 4BANB 4X8SH 4CRDA 5I46H 2CHAC 3QTVH 2BXUH 3D62A 1FAKH 4IN1A 1L4ZA 2GTBA 2TGAA 3T2NA 4X2WA 3FAOA 4XFQA 2B8OH 3E3TA 2ZGBH 5G4BA 3VPKA 4ZHAA 1K22H 1AU8A 1TQ7B 4BOHA 1GG6B 5KECA 2H2ZA 3UWJH 3LGIA 2ASUB 1OWEA 1ELAA 3OYPA 1EATA 1EB2A 1O3AA 1RD3B 4MVNA 1P9SA 4NZQA 2F9VA 3RU4T 1PPZA 1ANCA 2BDBA 1DFPA 2G52A 4BAMB 1QJ1B 2GV7A 1LPZB 2BLQA 2ZFTA 3SNDA 3B23B 1UK3A 5EJLA 2ZECA 1TOCB 1UMAH 2A4QA 2UWOA 1O36A 1Z71A 5L30H 1GHZA 2ZGXH 3EE0B 1QB1A 5C3NA 4ZXYH 1T32A 1MAXA 2QF0A 2AGIX 1GBAA 2O8WA 4SGBE 1CHOG 8KME2 3RM0H 1GDUA 3A82A 1A5GH 5JBTA 4AYVB 3OE7D 1FY1A 1G3EA 1S84A 1ZGIA 1S6FA 2THFB 1ELFA 2C4FH 2K8IA 1GBEA 2GCTB 1LVMA 3MOCA 4AC9A 1NZQH 4KELA 1OP2A 3TPIZ 1HB0B 3SO3A 1F0UA 3C1KA 2G4UA 3BEFB 4I8HA 1YCPK 2CGAA 2AGEX 4DIIH 1NRSH 2O8TA 1GBKA 1GJAB 2ZHDA 3TK9A 1JBUH 5IDKA 1D3PB 1QA7A 2ZO3H 1BQYA 3RXVA 4TPYA 2QYIA 1O33A 2RA0A 2IN2A 1CHGA 2F9OA 4CH8B 2M5TA 5EOKA 1Q3XA 5ESTE 2XCNA 6ESTA 1NS3A 1ZZZA 2UUYA 2VU8E 1O31A 3FZZA 2PV9B 2A2QH 3A89A 4AG2A 1L0ZA 1C1WH 1L1GA 4D9QA 1TB6H 2XRCA 2ALPA 5EJZA 1K1OA 1TQ0B 1J15A 1QJ6B 2BZ6H 4NIVA 1A4WH 4ZKOU 1LVBA 1OWHA 2PWXA 1BOQA 1K1NA 2GCHG 2ZCHP 1SG8B 1XXFA 5A0AE 1O3GA 2OC7A 2BD8A 2FOAA 1GDQA 5JBBS 1BTXA 1NROH 2KM0A 4DOQA 1TMBH 2WPHS 1NFUA 1W14U 5HYOA 4LZ1H 1SSXA 4H4FA 2C8YB 4FVDA 1FY3A 2PGBB 1N1LA 1T7CA 1QY6A 3SV7A 1WBGB 1NTPA 3G01A 3E6PH 3PMBB 3QUMP 5GXPA 2VIOA 1WSSH 4AOQA 1V2RT 3F9EA 5ETXA 4AFUA 1S6HA 2H5CA 1P2QA 4E06H 1RGQA 2ALVA 3TNTA 4JK6A 3ZV9A 2DE8A 4INHA 2WV5A 4HFPB 4FETA 2KAIB 4Y10E 5EQQA 1SGPE 1Y5UT 3GY4A 1RS0A 2LELA 3VEQB 2BM2A 2BQ6B 1SFQB 2IPQX 1FAXA 5C1YA 1FN8A 1LHDH 1SGYE 1BTPA 3PV4A 3SUEA 3DHKH 1IAUA 4RKOB 2WPDD 3RXSA 2ZU2A 2JETB 3QK1A 3DD2H 3TH4H 5FL7D 3KYFA 2YNBA 3MHWU 4ZKSU 3PO1C 4WH6A 4VGCB 1C9PA 3RU4E 3PMJA 1DXWA 1SFIA 8GCHG 2PSYA 2SFAA 3UPEA 1FLEE 2PW8H 4WH8A 2J34A 2FYQA 1PPCE 2FOMB 1ZTLA 1C2FA 3RMOH 1BA8B 3F2HA 2F9PA 2GZ8A 2I6SA 3NPSA 4K2YA 2JH6D 4DT7B 1XM1A 1TE0A 2D2DA 2R0LA 2TIOA 2Z3EA 4JZFH 4ZUHA 1ACBE 3P8OA 2FPZA 5EPNA 4Z1MD 1GBBA 3PTBA 1FI8A 1S6LA 2ZWLH 3AASA 5HM2A 2JJ2D 3BIVH 5GPIB 3A7VA 1BBRE 1OP8A 1P01A 3NK8A 3PRBA 1PPBH 1D6WA 1AHTH 2FMJA 2EC9H 2PKSB 5GJ4B 1KTTB 2Y7ZA 1ETTH 1OWJA 1EPTA 1O3MA 1C1PA 1YPEH 1FY5A 2B7DH 1NBME 1NFYA 3LC3A 4TWYA 3KQ5A 1CA0C 1GHBG 1HNEE 1W12U 3V12A 1F2SE 4M9FA 3SJ9A 2FODA 4AFSA 1F0RA 1SQAA 1VCPA 1C5MD 3P8NA 4ISIH 2BX4A 5FCKA 3RMLH 5DK1A 4ZAEA 2AERH 2HVYB 1DWEH 1NC6A 1XVMA 1IQGA 1XX9A 3GICB 3SV6A 5E8EH 1AMHA 4ZH8A 3M3VA 2YMSD 3P70B 3UQVA 4HI3A 2K0QA 4YLQH 3FVFB 1BRBE 1O3CA 2KCYA 3ZZCA 1FQ3A 4Y8ZA 1E79D 3A88A 3UAIC 2CHAB 1VITH 1HBTH 4ISHH 5CDFE 1EAWA 3FP7E 2CXVA 3RXIA 3RDZA 1DICA 3UNSA 1HJ8A 1O3OA 1NFWA 1D4PB 2WYJA 1O2GH 1V2VT 1CVWH 1KXDA 2HLCA 3PV2A 5T1VA 1TRMA 6GCHG 1KXBA 1QA0A 3CNRA 1BJUA 1MABB 2VIPA 3GY7A 1VJAU 2JIZD 1SGDE 4TSFD 1SMFE 2G5VA 2FI3E 5F6MA 3SW2B 3O8DA 1BBRK 2AIPA 1GMCF 5A8XA 4X1QU 2W7SA 1F5KU 1W11U 3GY2A 1P2OA 1O2UA 1O2TA 3F1SB 1MKWH 6CHAC 3HGPA 3C27B 2A1DB 2XC4A 1PPEE 1KTSB 2PUXB 4Y6DA 1HAVA 1RIWB 1TLDA 4K3JA 3UQOA 2QXHA 3A7ZA 4CR9A 1UVPA 1GG6C 3QZRA 3TK6A 3VB6A 1GWAA 2A5KA 3CENA 3L3TA 1THSH 1D6RA 4Y71A 1A5IA 2YNAA 2F43B 2FS9A 3MWIU 1G3DA 2XOKD 1AD8H 1O5CB 3SQEE 1NRRH 2VWNA 3CP7A 2XYAA 2FM2A 1ZTKA 1C2HA 1VCWA 5C0UA 1QBVH 1DVAH 1N8OB 4GVUA 4UFGH 4ZMAH 1CO7E 3BTHE 3TU7H 2ZP0H 5CMXH 1AKSB 3F0PA 3ZVEA 1V2ST 3RLWH 1AE5A 3ZV8A 2A32A 1G30B 4XBCA 3M35A 2VNTA 1IQFA 5GNDA 3AK5A 1TA2A 1SGEE 5T6GA 1QQ4A 2H6MA 3EQ0H 4KP0A 3UTUH 2FOGA 1JWTA 3PYHA 1LQEA 2TPIZ 4NSYA 1CT0E 3BN9A 4A1XA 1SGQE 2O9QA 1DY8A 1EFRD 2ZHQH 5AFYH 1JIRA 4H6SB 5C5NA 1TRYA 3K9XB 2GCTC 4X2XA 4GPGA 5A0BA 3QX5H 1QURH 2VWLA 5JBCS 1HXEH 1VZQH 2JDID 1MU6B 4YT7H 2TGPZ 3T29A 1O5GH 5EG4A 3JZ1B 2RG3A 4B1TA 1V6DA 2PHBA 2XWBI 1K21H 4DVAU 4AORA 1AVGH 7KMEH 3Q76A 2ZGJA 1ESTA 1ZMNA 1C5ZB 4ABHA 2SGAA 3KQEA 5GDSH 4NWLA 2WINI 1NRPH 5EJ1A 2XBVA 1G2MA 4UEHH 1MKXK 4GSOA 3FP6E 3RXEA 4B6FA 3A84A 1F7ZA 2GV6A 1P0SH 1Q31A 2ZHFH 4F48B 1HYLA 1LKBA 4I8LA 5HGGA 4NGAH 1C1SA 3PO1B 1DLKB 2QV1A 3SJKA 2AIQA 4AFQA 3BTGE 4FUFA 2R9PA 1Y5BT 1HFDA 3MU4A 3ATWA 2A7JA 3ZVCA 1Z8GA 1OHHD 2UUJB 2ZKSA 5AHGH 1SR5C 1GI9B 3GY5A 4CRCA 1ZPCA 4WY3A 4TWWA 2QN5T 1CSOE 1F0SA 5E0HA 1T4VH 2Z3CA 3BTKE 2ZEBA 4NIWA 5DP8A 4NWKA 4RT1A 3HPTB 1O35A 4Z6AH 1SI5H 1N6YA 1DWCH 2FWWA 5KGOA 2O8LA 4MG3A 3V0XA 1SLUB 1YLCA 3DFLA 3RXAA 1TGBA 1G32B 4XRNA 2PP6A 3SI4H 3A86A 1BMAA 1C2GA 1F5LA 4NSVA 1DSUA 3IITA 3OY5U 1SQOA 3QZQA 1HPGA 4I8JA 1FV9A 2OBOA 1EZUC 3RXQA 1MUEB 1GL0E 4ABGA 4ISOA 1EP6A 1J14A 5L2YH 1BDAA 1SGNE 3TVJB 1ESAA 4I8GA 2V6NA 4NA8A 2KZ4A 4FUHA 2JETC 4ZROA 2F9NA 4GUXA 4A1VA 1D3QB 3RXLA 1H1BA 1WTHD 2ZQ1A 4VGCC 4DY7B 1SGCA 1KYNA 5DP6A 2KX4A 3P92A 2Z3DA 1SB1H 1KY9A 3GISB 5C1UA 1GI2A 4XSKU 1D9IA 2UWPA 1UVOA 2QE7D 5SGAE 1YBWA 1GBLA 1O2IA 3O8CA 2GJGA 1WQSA 1BUIA 2BY5X 4UFEH 5C2ZA 2GGVB 3BTME 1Y3WA 2KFWA 2PFEA 3ZYDA 3AVZA 4CRGA 1QNJA 4MNYA 2QA9E 5F8XA 2C3SA 1ANEA 3FFGA 1YPLH 3ZVFA 1SOZA 3OSYA 4B76A 2SNWA 4ZHMU 5A8ZA 3SGBE 4I32A 2PKSC 5GIBA 2QAAA 2F9BH 1FY8E 1EAUA 2J94A 2RFKC 3ODDA 1P06A 3F9GA 4AN7A 2BB4A 5K7RA 3JZ2B 2FOHA 3S69A 3GY3A 5FPYA 1JOUB 2IJOB 3BG4B 5A8YA 1AY6H 3KQDA 1O2WA 1ZHRA 3LGUA 1O3KA 1G37A 1L4DA 2B5TB 2BD4A 2BLVA 1TOMH 4ABAA 3ZZ9A 1K1PA 1O2HA 1QJ7B 1GHAG 3SZEA 3QLPH 1TAWA 2EI7A 5FPTA 1DPOA 1SGFG 3SU2A 2W6ID 1LVYA 1Z8JB 3DSPA 1O3BA 1UTPA 3V7TA 1COWD 5F53A 1SGTA 1GVKB 1GVZA 4WF8A 1OP0A 5HKKD 1OXGA 2BY6X 4RI0A 1HXFH 1V2MT 3SZNA 2ZDLA 4MNVA 2GKVE 9ESTA 3U69H 1GMDF 1QQUA 3H7TA 2ZFSA 3W95A 2BTCE 1J16A 2KR7A 4OS7A 3LT3A 3ODFA 4IBLH 1XVOA 3RXGA 1PYTC 1P04A 4ABJA 1P2KA 4K8YA 3K65B 2EI8A 1GMHG 4ZKRU 1GI0A 2F91A 1YM0A 2ANWA 2ZFFH 3UR9A 3VXFH 2Y5GA 3TIUA 5E2PA 5TCCA 1O2QA 4ACBA 3SV8A 2VVVA 1RTLA 1TX8A 4FUCA 3SUGA 2ZTYA 2P8OB 3MO6A 1KMHB 4K60A 1QL9A 1VGCB 3O8BA 2BX3A 3RP2A 1UTLM 4XDEA 3NRLA 1A1RA 3SU0A 2VH0A 3F9HA 5PTPA 4IGDA 1CT4E 4IS5A 1CBWC 3B9FH 4X2YA 2Z9KA 3N7DA 4I86A 4BNRA 2ZTXA 2OCVB 1Y5AT 3PROA 1O3DA 4KTSA 2GCHF 3VG8A 1O2YA 4TY7A 2NU4E 2CMYA 1GBCA 2LP6A 4ISLA 2EY4C 3TH2H 1G2LA 1SLVB 1RIWC 2HPQH 1EAIA 1MZAA 2BY9X 3Q3KA 4I8KA 1D3DB 5C20A 1THRH 3F2GA 1ZRBA 1QL7A 2HRVA 2BZAA 1BMMH 1C2KA 1MCTA 2Z9IA 2ZHWH 3HGNA 3RUOA 1YLNA 2V3MA 1QIXB 1SPJA 4NFEA 5FAHA 1FN6A 1MTVA 5HIYA 2A4RA 2WV9A 1KXCA 1TBZH 3LJJA 1GBMA 3KYGA 1W10U 1TRNA 4U01A 1NU7B 3H5CB 4X1SU 1YPHE 1YPGH 2W3IA 2Z9LA 4P00A 1N8OC 1O2RA 4D76A 5BPEA 1C4Y2 2SGFE 3FKSD 5DSFA 4FOUC 1BMFD 1O2LA 2Z7FE 1UTQA 1EOLA 1GI4A 1NRQH 1Z8IB 3GDSA 5F8TA 2OC8A 1BTWA 1TNKA 3L6PA 4Q80A 1MTSA 2FO9A 5EPYA 3GDVA 4X6NA 2G4TA 1YF4A 3VXEH 5CHAB 5C94A 4O97A 5DPAA 5FCRA 4U2WA 3RXOA 2VB0A 1VKYA 4WWYA 3EA8A 1JXPA 1HAPH 1OSSA 3SUFA 3KQBA 1VJ9U 1ZSKA 2Z9JA 1O2ZA 1ZMJA 1GBIA 2KAIA 2VWOA 3LH1A 1PQ5A 5H4IB 2GX4A 5LPFA 1ZOMA 1HAGE 1FY4A 1QB6A 1TYNA 1P10A 1TNIA 1UCYE 4K1SA 5TCAA 1OPHB 2H5DA 5FBIA 2ZA5A 4DJZB 4NA9H 1ZHMA 5LPRA 2ZQ2A 2IJD1 2CV3A 4CH2B 1W2KH 4CR5A 1P09A 4XBDA 3SU1A 3P8FA 4MNWA 3GDUA 2R3UA 1SGRE 2W26A 1BTZA 1YPMH 4YESB 4TPIZ 1OKXA 2PTNA 2BD7A 3MU0A 2J38A 2A5IA 1GHBF 2D1JA 3LPRA 2AMPA 2FESH 4YOIA 1A0JA 2FYRA 3GYLB 2TGTA 3SHAH 4X1RU 1ZYOA 5IK2D 1BZXE 1YCPH 2F3CE 4OS1A 1C1OA 2Y81A 2ZIQH 1F5RA 1KXEA 5K0HA 3RXCA 2FOCA 2QF5A 1SHHB 1C1MA 3M3TA 4BAOB 3HKIB 1TPPA 1QRWA 4RN6A 1O2NA 1A3EH 7GCHG 2ZDKA 1GJ7B 3TNSA 3KN2A 2GZ9A 3U1IB 2FDAA 1LTOA 5DP3A 2QIQA 4BXWA 2XTTB 3ZZAA 1LMWB 4DGJA 3KQCA 9LPRA 2VJ1A 1AGJA 1ZJDA 1G3CA 1TBQH 1HUTH 2OINA 3A8DA 3SGQE 3DA9B 1MBMA 4OS6A 4AZ2B 4BTIB 3VFEA 1P2NA 1P3EA 1K0HA 1C2IA 2J9NA 5JBAS 3LGYA 3ATMA 3RXBA 2KCPA 2BVXH 5HIZA 3SNCA 3Q77A 1B0FA 3BEUA 3TITA 1K1LA 2HALA 3B8JA 4D9RA 3LGTA 1XUJA 3LGWA 2HNTE 3BF6H 2YMSB 4Q63A 4YXWD 1RJXB 4ISNA 4XBBA 3GCHB 1EP5A 4ABEA 1AVXA 1UCYK 1MQ6A 3PRDA 2V3HH 3T27A 1GI1A 1H9HE 1MTWA 1RTKA 3O8RA 2HWLB 3SV2H 4CRBA 1EJNA 1EKBB 3RC5A 3TK5A 1S0QA 1ELBA 4HG6A 1LHFH 1W0YH 2PGQB 4KTCA 1ZRKA 5EODA 2ZU5A 4BTUB 5F03A 5IYTA 2ZDNA 1Q2WA 2A7CA 1IQEA 1ESBA 4X8UH 1TONA 5EIYA 3ENSB 1DM4B 1INCA 2B9LA 2A31A 3S9BA 1PFXC 2C93B 3UIRA 1ETSH 5C5OA 4Y8XA 1CQQA 4WVPE 1QGFA 1O2JA 3KL6A 4X6PA 1B7XB 1SLWB 3VB7A 3UFAA 3KEEA 5JB8S 1ARCA 1FX0B 1GJ5H 3GYMA 3GOVB 2GDDA 2Q6FA 1PJPA 2WUCA 1MH0A 3PWBA 4IW4E 4OGXA 2A45B 1AE8H 3ATLA 3T62A 1K1IA 1O2MA 5AFZH 2JH0D 3SV9A 1F92A 5GCHG 3DUXH 1C5YB 4AX9H 1GJ8B 2O8MA 1O5DH 2Q6DA 3BG4C 2XW9A 3ZVAA 3MTYA 4K1EA 4AB8A 4Y11E 2G81E 3S7KB 4MPXA 1A5HA 1MTNB 2A5AA 1L1NA 2Y5FA 4Y79A 5E0JA 5HMAA 3LKWA 3OU0A 4A6LA 3E16B 1BJVA 1TX6A 1TBRH 4Q2KA 3TGJE 1UTKA 4IC5A 3V3MA 1WV7H 4FUEA 4INKA 1XUHA 2BOKA 2UUFB 4O3UA 2ZU3A 3M3SA 2ODPA 3ZZ3A 2BXTH 3TGKE 3ZZDA 3U9AH 3R3GB 4OS5A 1CBWB 4MQAA 3MU8A 1KXFA 3MH4A 2Y80A 2PUQH 1PQ7A 1XUGA 3KF2A 1HAXB 3QGNB 4AYYB 3SORA 5EW2H 1E0FD 2R2MB 2QF3A 2BLWA 2ZFPH 1DS2E 3P95A 4BTTB 1PYTD 1FPCH 1C9TA 1YPHC 2XBXA 1C1VH 2BMGB 3MU5A 4R0IA 3RMNH 2NU2E 5FBEA 3MI4A 1AKSA 1CT2E 3M7TA 1NM6A 3STIA 2V3OH 1AFQC 1KLJH 1WAYB 2OQ5A 2P93A 4K5ZA 4X1PU 1ZTJA 2VVUA 1EAXA 4CBOA 1RTFB 3ZVBA 2FEQH 3N7EA 1O2XA 1GVLA 4H42U 2P3TB 5AVDA 2P8OC 1EZXC 1V2UT 1Y3XA 3M5NA 1PQ8A 2G00A 1VGCC 2OC0A 3QN7A 3ZYEA 2A7HA 2D8WA 2A4OA 5EQSA 4GAWA 4B71A 3Q3XA 3GCTG 3MYWA 1IHTH 1UHBB 4A1TA 1BHXB 4NIYA 2R3YA 2Q6GA 3LDXH 4FU7A 4O9VA 1DITH 2OXSA 2R0KA 5A2MH 1BRAA 1WOFA 2AGGX 3QTOH 3U98H 2IPHA 1TPSA 3SYJA 3RXDA 3RXPA 4FXGH 4ESTE 1BBRH 1KXAA 4B2BA 5C67A 3A7XA 3F9FA 3RLYH 2WSSD 1FONA 1QHRB 5J4SA 1Y3YA 2QCYA 1O3FA 3PV5A 3UWIA 1O5FH 2FX6A 3M36A 1P2JA 3R0FA 3MNCA 2G8TA 1MAYA 1GJDB 2XBWA 1P12E 4JCNA 1YPJH 8LPRA 2DE9A 5C17A 1PPFE 4GHQA 4JYVH 1IHSH 2VIDA 3BSQA 1TFXA 2FOFA 5B6OA 1TPOA 3SOSA 3S0NA 3CS7A 1GBTA 1UO6A 2OC1A 4DCDA 1W0ZU 2H9HA 2J98B 4JYTA 1Y8TA 1YCPM 1P11E 2FZZA 3NUMA 3AAUA 1W8BH 3QGJA 1AO5A 4A5TS 1WCZA 3OFND 1N6XA 5CHAC 2J4IA 3T25A 1Z1JA 2XCFA 2ZCKP 2CJIA 3NKKA 4JMYA 2CK3D 2A2XH 2STAE 1C1NA 1CE5A 1P02A 3DFJA 3I78A 4UDWH 1AUJA 1OX1A 1HJAB 1O37A 2AMDA 2H9EH 1S5SA 2FOEA 4PROA 2P94A 3SU4A 2ODYB 4Q7YA 1A61H 1TNLA 2ZNKH 1C5TA 4JZDH 2R2WU 5EXMA 1B0EA 2GZ7A 4Q7XA 3D49H 4MNXA 1P8VC 5DG6A 4ZHLU 4OM9A 1BMNH 1EOJA 1W7XH 1AZ8A 4GCHF 2ZPRA 2PTCE 1HAOH 1DLEA 4WXIA 4FUJA 1DDJA 2BDHA 3LIWA 2BOHB 1FXYA 8ESTE 3MU1A 4I7YH 2J2UA 4RSPA 2ZU1A 1HJ9A 1LHCH 1SLXB 1VITG 1HIAB 4F49A 3F0OA 4AB9A 2TGDA 2O8UA 4J1YA 5AF9H 2ZFRH 3EA9A 1F0TA 1KIGH 4P02A 1O3LA 1V2NT 1YLDA 5GWZA 1GCDA 1DUEA 2ULLA 3DSOA 1LCYA 4ABFA 3RMMH 1A0LA 3ZZ7A 2C8ZB 4B6EA 1IQHA 2SGQE 3BEIB 3RXRA 1FZZA 4X2VA 1AB9B 2OP9A 1GHVH 2XXLA 2VIWA 2WPLS 1MKXH 3BTEE 3ELAH 3T26A 4JZEH 1LHGH 2WPJS 4U32A 3BTQE 4A7IB 1HRTH 5T6DA 1GHYH 4DURA 1BTUA 4J2YB 2NU1E 4XOJA 1IQJA 2QF4A 1T8LA 3KGPA 1GMHF 3BIUH 2FLRH 2BY8X 3PMHB 2GDEH 3RXFA 3WWBA 1MD7A 1O38A 2HLDD 4LZ4B 2OUAA 3SJOA 1TNGA 3K6YA 1LPGB 2GT8A 2YMSC 4SGAE 4THNH 1C5XB 2QGRA 3GCHC 3GS9A 3LOXA 3ZZ5A 1UTOA 2BDCA 3KCGH 1DWBH 1IOEA 1HAHH 2FOBA 2GT7A 1Z6EA 4OGYA 5EW1H 2NWNA 3PTNA 1PQAA 1BIOA 2ZCLP 1GBFA 4D7FA 3I29A 3MQKC 4DIHH 1LHEH 2Q1JA 5E0GA 1GJ6A 1O32A 1IQLA 1QBNA 4Y0YE 2J97A 4YT6H 4NG9H 2L6OA 1CHOF 2ZPSA 3W94A 2RCEA 4MPWA 2VH6A 2V7QD 5LH8A 2IOTA 1BTYA 2C8WB 2VIQA 4YZUA 3UOUA 3DCLA 4FUIA 1W0KD 2P3UB 2ANYA 2Y7XA 1EZSC 4Y8YA 2P95A 4E7RG 1EX3A 3EA7A 4UFDH 3K2UA 1TGCA 1P05A 3NCLA 1GJCB 2ZHEH 1E1QD 1H9IE 1ELCA 1C5LH 1KDQB 4X1NU 1AFQB 2VVCA 2GMTC 4BXSA 4ABDA 3EAJA 4RKJB 1A3BH 1TGTA 3URDA 3A80A 1C5SA 1MTNC 2SNVA 2BVSH 1GHXH 4I31A 4NA7A 3PLKA 1K28D 1FIWA 1NRNH 1C4V2 1GPZA 2WHXA 1C1RA 2PR3A 3Q00A 4WXVA 2HOBA 3GCOA 3M7UA 2QY0B 1IQKA 4K1TA 3U28C 1C5PA 4WMFA 1AI8H 1ZSJA 1V2PT 1SL3A 1TMUH 1BCUH 2JKHA 1TWXB 3SBKA 1UVSH 1MMJN 2DUCA 1A46H 1DT2A 3UY9A 1EUFA 1NY22 1W13U 2SGPE 2ZC9H 1QR3E 2M2AA 2BD5A 4XE4A 4UONA 1O2SA 4YM9A 2WUBA 3T28A 1O3IA 5FX6A 5L2ZH 3A87A 2XNDD 4ZKNU 1K9OE 4LOYH 1W0JD 1SGFA 4E05H 2BY7X 3U8RH 1MBQA 3HK6B 1G9IE 1OS8A 1ARBA 2ESTE 3DSGA 1ZPBA 4K69A 4DT4A 4JZIA 1GMDG 5L6NH 3E8LA 4X8VH 1V2WT 1DSTA 1NPMA 1X7AC 1ZSLA 1H9LB 4B74A 1O39A 1EASA 3MH7A 5JDUB 1ID5H 1BRCE 2ZTZA 1DUAA 1FNIA 1T8OA 2V0BA 1GJ9B 1ELEE 4DW2U 2EA3A 1VCQA 3DT0H 1BITA 2F4LA 5T3HA 6LPRA 7LPRA 1D3TB 2QC2A 3RXHA 1W3CA 7GCHF 8GCHF 5LPEA 1Z8RA 1P2MA 3QO6A 3VB5A 1Z6JH 5JB9S 1GBJA 3SU6A 2WPKS 1EZQA 3UNQA 3E90B 5EXNA 1G36A 3ZVDA 3A8AA 3MNXA 4NIXA 1NESE 2TRMA 1AIXH 1CGJE 1J8AA 4AGJA 2L74A 2K1QA 1K1MA 1GCTB 3OX7U 1V2LT 4CRFA 3WW7A 3AW0A 2ZDAH 4FUBA 1MTUA 1MZDA 2ZF0H 2V35A 2C90B 3ESTA 3N99A 1AUTC 3RU4D 1NO9H 1ELVA 3ZZBA 2VGCB 4K8BA 1AN1E 2RDLA 2XBYA 1O5EH 1AZZA 3A8BA 4NZLA 4TY6A 3EE7A 1C2DA 2UUKB 3FZDA 3QWCH 1OYTH 1O34A 3EDXB 2SGDE 4FVBA 1C5QA 1GBHA 2FI5E 2UWLA 4YLUA 3NXPA 4MPVA 5FHTA 1LPKB 3BTDE 1MU8B 1C5NH 3M61U 2CF9H
chains in the Genus database with same CATH topology
1O2PA 1UVUH 2XNIA 1UTMA 2AFQB 1O2KA 1FPHH 1UK4A 4KTUA 5HM9A 3BTTE 3TGIE 1DXPA 4IMQA 4TYDA 1ANBA 3LC5A 3LH3A 2AS9A 1LVOA 2WV4A 1JRTA 1GBDA 1TNJA 3TJOA 4JK5A 2FTMA 4AGKA 1W7GH 1BHXF 3F6UH 1HJAC 4KGAA 3SU3A 1P3CA 2OD3B 4O03A 3PLBA 1S82A 2ANKH 4H6TA 1C1TA 2J95A 3EYDA 1V3XA 4WJG2 1DE7H 3KNXA 3BTWE 1HAIH 4HTCH 5EXLA 2VWMA 4BAKB 1T4UH 5I25A 5GCHF 1VR1H 4LK4A 5TJXA 2F83A 1Z7KA 1QB9A 3SGAE 4B2CA 6GCHF 2BDIA 4WMDA 4GLYA 4IC6A 3RM2H 5C1XA 2OTVA 4MPUA 1QRZA 1ELGA 1S81A 3HK3B 3ZVGA 1FDPA 1TPAE 2Z94A 4YOGA 4YTAA 1LKAA 1UK2A 2FS8A 1C1UH 1C4U2 2YOLA 1P57B 4FUGA 1HAYB 4UFFH 4D7GA 1Z1IA 1GI7B 3S9AA 1GL1A 5E2OA 1MKWK 1H8IH 1TIOA 3Q3YA 1AB9C 2G51A 2PLXA 2AEIH 2ILNA 3UNRA 2CF8H 1AVWA 2QXIA 2Y6TA 3MH5A 3ZZ6A 3IWMA 1ZLRA 1O3JA 2BVRH 1Y3UA 3OTJE 1OYQA 4CHAB 1EPTB 4U30A 1FIZA 2ZI2H 2JH5D 1DX5M 3VGCB 2G55A 2ODQA 2OQUA 3U1JB 3S7HB 3PWCA 1QL8A 1DWDH 2ZDVH 2WPMS 4QT8C 1ZGVA 1ABJH 1V2QT 2XWAA 3HATH 2QXGA 5EQRA 2Z9GA 2GMTB 3M7QA 4DG4A 1XUIA 2BLOA 2P3FH 4X6MA 3P17H 4UD9H 3PM3A 5JPMH 3U8OH 3SJ8A 1OWKA 1KLIH 2ZGCA 1O2VA 3SHCH 3AW1A 3TH3H 1DANH 1LDTT 3A83A 1QTFA 1C5RA 4ABIA 1GGDC 1BT7A 5HXFA 3SU5A 4ASHA 1O3EA 1PPGE 1V2OT 3GCTF 1O5BB 3F68H 5FX5A 1S0RA 3ZZ4A 1QBOA 2HPPH 1K1JA 1E37B 1HLTH 4I33A 1Y59T 4Y76A 1RFNA 3SNEA 4A92A 3NZIA 3SNBA 1EB1H 1MCVA 1UCYH 1GI5A 3D65E 4Y0ZE 2P16A 2TBSA 2D26C 3ATIA 3PMAB 3TJNA 3LONA 4AFZA 3S9CA 1RXPA 1JRSA 1QFKH 4Z0KA 4B75A 4X8TH 2W3KA 1J9CH 3OY6U 1TX7A 3M5MA 1EXFA 1TABE 2FP7B 3E0PB 3UR6A 4GHTA 1UTNA 2PKAA 1ELTA 1T31A 1P2IA 1T8MA 3RC6A 3RXTA 3FP8E 1WU1A 5FPSA 4FU8A 2VIVA 1TNHA 2EEKA 3EGKH 1UHBA 2W5EA 4MTBA 5DP5A 4CREA 2EI6A 2GVFA 1ZHPA 1TA6A 1TMTH 5EU8A 1S83A 3MO9A 1WQVH 3K6ZA 1G3BA 2H9TH 1NU9A 2P59A 2PKAB 1HV7A 1OOKB 1L2EA 2A0QB 1CGIE 1QRXA 1T8NA 1GI3A 1YP9A 1XUFA 1P9UA 3N7OA 2ZU4A 4AG1A 3MFJA 2J92A 1SOTA 2ZGHA 4OS4A 3RXJA 1SBWA 5DP7A 1NFXA 1HAVB 1TGNA 2BHGA 1ETRH 2B0FA 3RXKA 1SC8U 1U6QA 3NWUA 1L1JA 2ZPQA 1B5GH 1J17T 4UE7H 5F8ZA 1O30A 1UTJA 2BD3A 5BRRE 7ESTE 1UVTH 4M7GA 3ATKA 1M9UA 1HGTH 1AWHB 2FIRH 1BTHH 4E7NA 1V2KT 3A8CA 4D8NA 1GMCG 2G5NA 3UUZA 2W7UA 4JZ1A 3STJA 2Z6BD 1S85A 1P03A 1GJ4H 2WPIS 1LO6A 1E35B 3TLOA 1V2JT 3AAVA 5JYIA 2H1UA 1CA8B 5DGJA 1AQ7A 4IN2A 1HAZB 2AH4X 4CBNA 3ZZ8A 2PSXA 1VITF 1XUKA 1IQMA 2RA3A 1KSNA 2NU0E 1SVPA 3LU9B 1HCGA 3SJIA 2AMQA 1IQNA 1KLTA 3E1XB 5DP9A 1XKAC 1BB0B 2BD2A 3MO3A 2FXRA 2BQ7B 2LNCA 3MH6A 1QCPA 1ORFA 4CRAA 1GDNA 5DO4H 1C2JA 4X0WU 3T5FH 1THPB 4INLA 1H8DH 1ZPZA 1O3PB 1C5OH 1FUJA 2BDAA 3KIDU 1TGSZ 1O3HA 2NU3E 1ZJKA 2HVXA 1PPHE 1DOJA 4YOJA 1C2MA 3A7WA 4MLFB 1E36B 1SHYA 3RC4A 1HIAA 2HNTC 1C5VA 3A7YA 1UJ1A 1ANDA 3VB3A 1GCTC 1SGIB 1A7SA 3A85A 5A0CA 2ANMH 2LPRA 1XMNB 2STBE 2FLBH 2OLGA 3RXUA 1AWFH 5J4QA 4YO9A 2SGEE 2VGCC 2I6QA 1JMOH 4HGCA 4BAQB 3L33A 1NN6A 2ZDMA 2OBQA 1EQ9A 3WY8A 1YYY1 4MDSA 2FX4A 1C5UA 3D23A 3P8GA 2BDYA 5DJ7A 1EJMA 3TJVA 3ITIA 3MMGA 3V13A 1A0HB 3A81A 4IMZA 3QDZB 1CU1A 3FANA 4ABBA 3H7OA 4FU9A 2FI4E 3LJOA 1RRKA 1GHAF 1GJBB 3SNAA 3PLPA 1WTGH 1YPKH 2XC5A 1AFEH 3GY6A 1V2TT 3A7TA 1C2LA 1H4WA 2BD9A 1ZMLA 4FUDA 1C5WB 3SN8A 4ZXXH 3I77A 4B73A 1CA0B 4O3TA 2XC0A 1O2OA 4NCYA 1ZR0A 4F4OC 4Y7BA 3KHVA 1FJSA 2Y82A 4B2AA 2ZG0H 4NFFA 1YGCH 5CE1A 3M5LA 2HNTF 1GI6A 1CGHA 2GD4B 1Y3VA 1XXDA 3SQHE 2FTLE 1BRUP 2F9UA 3BV9B 2BYAX 1C2EA 1ELDE 4HZHA 1XKBC 2HGTH 1EJAA 4OS2A 2GP9B 4Q7ZA 5T6FA 1OWIA 2A4GA 4X6OA 1GI8B 1A2CH 1HDTH 3HKJB 3TJUA 5DP4A 3VB4A 3GCNA 1IQIA 5A09A 3LGVA 4WMEA 3SUDA 4R8TB 5ESBA 5ABWA 4GCHG 3IG6B 5LGOA 1GGDB 3BTFE 1MD8A 2QXJA 4LXBH 2CN0H 3UREA 1ABIH 3CS0A 3E91A 1O3NA 3M5OA 3UOPA 1C1QA 4Y7AA 5DKMA 3U8TH 3RXMA 1MQ5A 2AYWA 1FMGA 1YKTA 2VINA 3SI3H 1TALA 2BQWB 1WUNH 2C8XB 1KDQA 1OWDA 1E38B 2ZZUH 3MNSA 3PB1E 1K2I1 1LQDB 1O5AB 3M37A 4JYUH 1YC0A 5FXLA 3P6ZB 4CHAC 1EPTC 2WYGA 3E0NB 3VGCC 5EGMA 1SQTA 2ZFQH 1DY9A 1JIMA 2Y5HA 1WYKA 1GHWH 3URCA 1O0DH 6CHAB 1NT1A 1BMLA 2BDGA 3MNBA 4BAHB 1E34B 3GY8A 3BG8A 4KKDA 4BANB 4X8SH 4CRDA 5I46H 2CHAC 3QTVH 2BXUH 3D62A 1FAKH 4IN1A 1L4ZA 2GTBA 2TGAA 3T2NA 4X2WA 3FAOA 4XFQA 2B8OH 3E3TA 2ZGBH 5G4BA 3VPKA 4ZHAA 1K22H 1AU8A 1TQ7B 4BOHA 1GG6B 2H2ZA 3UWJH 3LGIA 2ASUB 1OWEA 1ELAA 3OYPA 1EATA 1EB2A 1O3AA 1RD3B 4MVNA 1P9SA 4NZQA 2F9VA 3RU4T 1PPZA 1ANCA 2BDBA 1DFPA 2G52A 4BAMB 1QJ1B 2GV7A 1LPZB 2BLQA 2ZFTA 3SNDA 3B23B 1UK3A 2ZECA 1TOCB 1UMAH 2A4QA 2UWOA 1O36A 1Z71A 5L30H 1GHZA 2ZGXH 3EE0B 1QB1A 5C3NA 4ZXYH 1T32A 1MAXA 2QF0A 2AGIX 1GBAA 2O8WA 4SGBE 1CHOG 8KME2 3RM0H 1GDUA 3A82A 1A5GH 5JBTA 4AYVB 1FY1A 1G3EA 1S84A 1ZGIA 1S6FA 2THFB 1ELFA 2C4FH 1GBEA 2GCTB 1LVMA 3MOCA 1NZQH 4KELA 1OP2A 3TPIZ 1HB0B 3SO3A 1F0UA 3C1KA 2G4UA 3BEFB 4I8HA 1YCPK 2CGAA 2AGEX 4DIIH 1NRSH 2O8TA 1GBKA 1GJAB 2ZHDA 3TK9A 1JBUH 5IDKA 1D3PB 1QA7A 2ZO3H 1BQYA 3RXVA 4TPYA 2QYIA 1O33A 2RA0A 2IN2A 1CHGA 2F9OA 4CH8B 2M5TA 5EOKA 1Q3XA 5ESTE 2XCNA 6ESTA 1NS3A 1ZZZA 2UUYA 2VU8E 1O31A 3FZZA 2PV9B 2A2QH 3A89A 4AG2A 1L0ZA 1C1WH 1L1GA 4D9QA 1TB6H 2XRCA 2ALPA 1K1OA 1TQ0B 1J15A 1QJ6B 2BZ6H 4NIVA 1A4WH 4ZKOU 1LVBA 1OWHA 2PWXA 1BOQA 1K1NA 2GCHG 2ZCHP 1SG8B 1XXFA 5A0AE 1O3GA 2OC7A 2BD8A 2FOAA 1GDQA 5JBBS 1BTXA 1NROH 4DOQA 1TMBH 2WPHS 1NFUA 1W14U 5HYOA 4LZ1H 1SSXA 4H4FA 2C8YB 4FVDA 1FY3A 2PGBB 1N1LA 1T7CA 1QY6A 3SV7A 1WBGB 1NTPA 3G01A 3E6PH 3PMBB 3QUMP 5GXPA 2VIOA 1WSSH 4AOQA 1V2RT 3F9EA 5ETXA 4AFUA 1S6HA 2H5CA 1P2QA 4E06H 1RGQA 2ALVA 3TNTA 4JK6A 3ZV9A 2DE8A 4INHA 2WV5A 4HFPB 2KAIB 4Y10E 5EQQA 1SGPE 1Y5UT 3GY4A 1RS0A 3VEQB 2BM2A 2BQ6B 1SFQB 1FAXA 5C1YA 1FN8A 1LHDH 1SGYE 1BTPA 3PV4A 3SUEA 3DHKH 1IAUA 4RKOB 3RXSA 2ZU2A 2JETB 3QK1A 3DD2H 3TH4H 2YNBA 3MHWU 4ZKSU 3PO1C 4WH6A 4VGCB 1C9PA 3RU4E 3PMJA 1DXWA 1SFIA 8GCHG 2PSYA 2SFAA 3UPEA 1FLEE 2PW8H 4WH8A 2J34A 2FYQA 1PPCE 2FOMB 1ZTLA 1C2FA 3RMOH 1BA8B 2F9PA 2GZ8A 2I6SA 3NPSA 4K2YA 2JH6D 4DT7B 1XM1A 1TE0A 2D2DA 2R0LA 2TIOA 2Z3EA 4JZFH 4ZUHA 1ACBE 3P8OA 2FPZA 5EPNA 1GBBA 3PTBA 1FI8A 2ZWLH 3AASA 5HM2A 3BIVH 5GPIB 3A7VA 1BBRE 1OP8A 1P01A 3NK8A 1PPBH 1D6WA 1AHTH 2FMJA 2EC9H 2PKSB 5GJ4B 1KTTB 2Y7ZA 1ETTH 1OWJA 1EPTA 1O3MA 1C1PA 1YPEH 1FY5A 2B7DH 1NFYA 3LC3A 4TWYA 1CA0C 1GHBG 1HNEE 1W12U 3V12A 1F2SE 3SJ9A 2FODA 4AFSA 1F0RA 1SQAA 1VCPA 1C5MD 3P8NA 4ISIH 2BX4A 5FCKA 3RMLH 5DK1A 4ZAEA 2AERH 1DWEH 1NC6A 1XVMA 1IQGA 1XX9A 3GICB 3SV6A 5E8EH 1AMHA 4ZH8A 3M3VA 3P70B 3UQVA 4HI3A 4YLQH 3FVFB 1BRBE 1O3CA 3ZZCA 1FQ3A 4Y8ZA 3A88A 2CHAB 1VITH 1HBTH 4ISHH 1EAWA 3FP7E 2CXVA 3RXIA 3RDZA 1DICA 3UNSA 1HJ8A 1O3OA 1NFWA 1D4PB 2WYJA 1O2GH 1V2VT 1CVWH 1KXDA 2HLCA 1TRMA 6GCHG 1KXBA 1QA0A 1BJUA 2VIPA 3GY7A 1VJAU 1SGDE 1SMFE 2G5VA 2FI3E 5F6MA 3SW2B 3O8DA 1BBRK 2AIPA 1GMCF 5A8XA 4X1QU 2W7SA 1F5KU 1W11U 3GY2A 1P2OA 1O2UA 1O2TA 3F1SB 1MKWH 6CHAC 3HGPA 3C27B 2A1DB 2XC4A 1PPEE 1KTSB 2PUXB 4Y6DA 1HAVA 1RIWB 1TLDA 4K3JA 3UQOA 2QXHA 3A7ZA 4CR9A 1UVPA 1GG6C 3QZRA 3TK6A 3VB6A 1GWAA 2A5KA 3CENA 3L3TA 1THSH 1D6RA 4Y71A 1A5IA 2YNAA 2FS9A 3MWIU 1G3DA 1AD8H 1O5CB 3SQEE 1NRRH 2VWNA 3CP7A 2XYAA 2FM2A 1ZTKA 1C2HA 1VCWA 1QBVH 1DVAH 1N8OB 4GVUA 4UFGH 4ZMAH 1CO7E 3BTHE 3TU7H 2ZP0H 5CMXH 1AKSB 3ZVEA 1V2ST 3RLWH 1AE5A 3ZV8A 2A32A 1G30B 4XBCA 3M35A 2VNTA 1IQFA 1TA2A 1SGEE 5T6GA 1QQ4A 2H6MA 3EQ0H 4KP0A 3UTUH 2FOGA 1JWTA 3PYHA 1LQEA 2TPIZ 4NSYA 1CT0E 3BN9A 4A1XA 1SGQE 2O9QA 1DY8A 2ZHQH 5AFYH 1JIRA 4H6SB 5C5NA 1TRYA 3K9XB 2GCTC 4X2XA 4GPGA 5A0BA 3QX5H 1QURH 2VWLA 5JBCS 1HXEH 1VZQH 1MU6B 4YT7H 2TGPZ 3T29A 1O5GH 5EG4A 3JZ1B 2RG3A 4B1TA 1V6DA 2PHBA 2XWBI 1K21H 4DVAU 4AORA 1AVGH 7KMEH 3Q76A 2ZGJA 1ESTA 1ZMNA 1C5ZB 4ABHA 2SGAA 3KQEA 5GDSH 4NWLA 2WINI 1NRPH 2XBVA 1G2MA 4UEHH 1MKXK 4GSOA 3FP6E 3RXEA 3A84A 1F7ZA 2GV6A 1P0SH 1Q31A 2ZHFH 1HYLA 1LKBA 4I8LA 5HGGA 4NGAH 1C1SA 3PO1B 1DLKB 2QV1A 3SJKA 2AIQA 4AFQA 3BTGE 4FUFA 2R9PA 1Y5BT 1HFDA 3MU4A 3ATWA 2A7JA 3ZVCA 1Z8GA 2UUJB 2ZKSA 5AHGH 1SR5C 1GI9B 3GY5A 4CRCA 1ZPCA 4WY3A 4TWWA 2QN5T 1CSOE 1F0SA 5E0HA 1T4VH 2Z3CA 3BTKE 2ZEBA 4NIWA 5DP8A 4NWKA 3HPTB 1O35A 4Z6AH 1SI5H 1N6YA 1DWCH 2FWWA 3V0XA 2O8LA 4MG3A 1SLUB 1YLCA 3DFLA 3RXAA 1TGBA 1G32B 3SI4H 3A86A 1BMAA 1C2GA