1PYTD

Ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
251
structure length
251
Chain Sequence
CGAPIFQPNLSARVVGGEDAIPHSWPWQISLQYLRDNTWRHTCGGTLITPNHVLTAAHCISNTLTYRVALGKNNLEVEDEAGSLYVGVDTIFVHEKWNSFLVRNDIALIKLAETVELGDTIQVACLPSEGSLLPQDYPCFVTGWGRLYTNGPIAAELQQGLQPVVDYATCSQRDWWGTTVKETMVCAGGDGVISACNGDSGGPLNCQADGQWDVRGIVSFGSGLSCNTFKKPTVFTRVSAYIDWINQKLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ternary complex (zymogen)
molecule keywords PROCARBOXYPEPTIDASE A
publication title The three-dimensional structure of the native ternary complex of bovine pancreatic procarboxypeptidase A with proproteinase E and chymotrypsinogen C.
pubmed rcsb
total genus 46
structure length 251
sequence length 251
ec nomenclature ec 3.4.21.2: Chymotrypsin C.
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytD02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytD01
1DDJA 2AYWA 5JBAS 5A0AE 2QN5T 3SV8A 2RA0A 3UWIA 5F6MA 1P02A 1GWAA 2V0BA 2VIVA 1A5HA 3T62A 1MAXA 4Y0YE 1F92A 3GISB 1GBMA 1ORFA 2BTCE 2W3KA 3SQEE 2Y81A 5FBEA 1SFQB 1ZR0A 3G01A 4PROA 4ZHAA 2BX4A 4A6LA 4UFFH 5CE1A 1SGEE 4BTIB 1GHYH 2SGAA 1ELGA 1Z1JA 2XW9A 5F8TA 1KY9A 5E0HA 1SGYE 1C2EA 1B7XB 3TPIZ 3M61U 1IHTH 1EP6A 1DUAA 4X6NA 1XXDA 2WUBA 1AKSA 3RXRA 4QT8C 4Y8ZA 4ABDA 1O2MA 4JCNA 2ZFRH 2ZA5A 1PYTC 1C1PA 1GJAB 3TK9A 1EX3A 3UQVA 1P09A 1ARCA 2G8TA 1HAZB 1PYTD 1AFQB 5I25A 1LDTT 4H42U 1TNIA 3L33A 1V2MT 3SI4H 2FZZA 1YKTA 4ABBA 4B75A 2ZC9H 1T8MA 1F2SE 2SFAA 4UONA 3VFEA 1NRSH 1ESBA 5A2MH 1E36B 3BTHE 1AMHA 1AVWA 1DPOA 3FZDA 1FPHH 1QB9A 1ZHMA 4X8UH 5EXMA 4YOIA 1BTHH 3SQHE 1T4UH 1HJAC 1QB1A 1ETRH 2FX6A 1QB6A 1O34A 1QA7A 1GBTA 1OYTH 1QIXB 2VWOA 5ESBA 1UVPA 3RLWH 3O8RA 1XUGA 1E37B 3PROA 1BA8B 4DIIH 4K60A 1C1NA 1HLTH 3AW0A 1SMFE 3MYWA 4YTAA 5EPYA 1VGCB 1IQNA 3M5OA 4O97A 3KIDU 4AB8A 2PGBB 2R2WU 3T29A 2HPPH 1MKWH 5DPAA 1OWHA 7KMEH 3ODFA 2B0FA 1RGQA 3EA8A 3AVZA 2A5IA 2Z9GA 1NT1A 1ELEE 1KLIH 2VH6A 3IITA 3I29A 1G36A 3KNXA 4DGJA 2ODPA 2WYJA 1O5AB 1GI3A 1KDQB 3ODDA 5GWZA 2XWAA 3ATLA 1UCYH 4X2XA 1LHCH 1C1QA 4SGBE 2ZHWH 5DP7A 1L4ZA 1DANH 3TK5A 2BD5A 1ABIH 1VCPA 3O8CA 1QBOA 1MCVA 1BRUP 1LO6A 1OOKB 3F9HA 1FN8A 1ELFA 5EW1H 2QYIA 2TGAA 3M37A 2PGQB 2GGVB 1A61H 2NWNA 2F9BH 1O33A 2B8OH 1UVOA 3LJOA 4IC6A 2ZU4A 2IJOB 5EOKA 3SORA 1TA6A 1TNHA 1DWBH 1H4WA 6GCHG 1A1RA 3E3TA 1P12E 2SGDE 1GDQA 1PQ5A 2C8WB 4ZUHA 1EZQA 4DCDA 2ZZUH 3CS7A 1YPHC 3UR6A 3TK6A 1EAXA 1C5TA 3OSYA 5C1XA 1MUEB 1O30A 3RXTA 1HAOH 3P92A 1SQOA 1THSH 1HXFH 5SGAE 1GHAF 1TRNA 4IMZA 3SUDA 1V2VT 5CHAC 3RLYH 2XCFA 2FMJA 4OS2A 1C2HA 5FPYA 1O2LA 1TPOA 1ZJDA 2GCTB 3UUZA 3QGNB 2ZHQH 1BOQA 1VCQA 4OS1A 3LT3A 5LGOA 4XSKU 3TH3H 5TJXA 2SGEE 4ABIA 1PPCE 4JMYA 2YOLA 4I8GA 1LVOA 1SOTA 4IC5A 1THPB 4IGDA 3RXEA 3RXSA 4R0IA 3ZYEA 3QZQA 2KAIA 1QBVH 1UVUH 1TB6H 1Q2WA 3A8AA 2HOBA 1C1VH 1MQ5A 2F9PA 1O38A 1GBIA 4X6OA 3TJNA 4UFDH 3GY4A 2VB0A 4ABEA 1CE5A 4MPVA 3M35A 2QIQA 2F91A 1GI1A 1O3HA 3GDUA 4AG1A 2ZEBA 1S85A 4AYVB 4CHAC 5FHTA 2ZU3A 3TVJB 4K8YA 4XFQA 5EG4A 4B74A 2QA9E 1SFIA 1C4V2 1J16A 5JBBS 1SHYA 1W3CA 1BMAA 4K5ZA 4B2CA 1DWCH 1MMJN 3L6PA 2FM2A 1HAXB 1O3GA 3RU4E 1K1NA 1TRYA 3LPRA 1GJBB 1KLTA 4RSPA 2BDHA 2ZDNA 2NU4E 1YPJH 5EQSA 1QRZA 1V2LT 2VJ1A 3A89A 2AIPA 1AZ8A 5LPEA 3V7TA 1DSTA 3LH3A 1O3EA 3PTBA 1MTNB 2C90B 3V12A 3PTNA 3UWJH 4JZEH 3DFLA 3T2NA 2GT8A 2BVRH 2BY6X 2ZFTA 2HVXA 4JZFH 3V3MA 1RS0A 2WYGA 4K3JA 1IQEA 1H9LB 1JWTA 3MWIU 1P8VC 2ZPQA 3VGCC 1P3EA 1GJ9B 4XBBA 5DP4A 2A7JA 2BM2A 1G32B 2FEQH 4NZLA 4FUDA 2PSXA 3FP7E 3ZZBA 1BZXE 2SNVA 1MBMA 2C8YB 4BNRA 2W5EA 1CHOF 3MFJA 1S0RA 4U2WA 5EQQA 5JPMH 2V3OH 1C5RA 3SU2A 3U8OH 3R3GB 7LPRA 3GCOA 1VCWA 1CVWH 2NU1E 1MKWK 3ZZ7A 1OPHB 3VB3A 3A8CA 3GCTF 3K9XB 4Y7BA 1GBBA 2ZHEH 1AWFH 1NC6A 1HYLA 2OTVA 2LNCA 4X1QU 3PMBB 1W0YH 1L2EA 1DE7H 5C3NA 4MPWA 2J9NA 5EODA 1Z8RA 1EZXC 5GDSH 1J15A 3UPEA 2PR3A 2XC4A 3MH4A 1N1LA 2B9LA 1GMHF 2NU3E 4MPXA 1KLJH 1YF4A 2R3YA 2WUCA 5JB9S 4ABAA 3KEEA 4CRCA 1TNLA 4B2BA 2EC9H 1NU9A 1S81A 1WOFA 1EB2A 1GCTB 2TGTA 3FANA 2QC2A 1ZGVA 1GJ7B 4H6SB 2CJIA 4I7YH 1D9IA 3D65E 7GCHG 1N6YA 1L4DA 2OP9A 4K1EA 3KQCA 3U8RH 2ZNKH 3KF2A 2QGRA 1LQEA 1OX1A 1UO6A 2O9QA 5E8EH 1DY9A 1G3EA 1HCGA 3E91A 1C2JA 4JZ1A 1NO9H 2Z6BD 1AQ7A 1MTSA 3RXDA 4AFSA 2XYAA 4FUEA 1PQAA 3A7WA 1O2YA 1O2UA 1OYQA 2PKAB 4O3TA 2GZ9A 2J92A 2ZU1A 2XBWA 1AY6H 1EZUC 2Q6DA 2HWLB 3S9AA 8KME2 1O2HA 2ZGBH 1ZRBA 4ISLA 5FCRA 1EOLA 1N8OC 1ZZZA 4XBDA 1D3PB 5F8XA 1GHWH 1GJ8B 4NIWA 3LGIA 3TLOA 1FLEE 3SU0A 1RD3B 1LMWB 3E8LA 3BV9B 1TPPA 2BD3A 4F4OC 2AERH 1C2LA 4X2YA 1IQJA 3GY6A 3QLPH 1MZAA 3EYDA 2OCVB 4B2AA 3TGIE 2SGFE 1S0QA 1LPGB 1O36A 4O9VA 2WPLS 4GLYA 4M7GA 1O2QA 5IDKA 3URCA 3A80A 5EU8A 1GMDF 3A83A 1JBUH 4AOQA 4X6MA 4CBOA 1C5XB 1OKXA 2FTLE 2O8TA 4OS4A 1CA0B 2Q1JA 1Y5AT 2FOHA 3GCHC 3PWCA 1KSNA 2CMYA 1E35B 1GBDA 1TMUH 4FUIA 5L30H 1AUTC 1G3DA 3URDA 5LPRA 4NIXA 1W7XH 1MQ6A 3UTUH 1AB9C 1GJDB 4CR9A 1T31A 3FVFB 4BTUB 4E7RG 1LHGH 1WV7H 1C1TA 2CHAC 2JKHA 1FDPA 5EXLA 2QF3A 3HKJB 3A84A 2JH0D 3MH7A 1RTFB 1LKBA 4NIVA 3UNSA 1NZQH 2AMDA 3QDZB 2Q6GA 2HRVA 1EAUA 1D6RA 3GOVB 1YCPM 3PMJA 3SU1A 2VIOA 3BTWE 4MG3A 3SJOA 1LCYA 5JB8S 4X1SU 1O2PA 2BDAA 1PPZA 1UK3A 1HGTH 1QL9A 2FWWA 2JETB 1KXCA 1C5NH 1ZTJA 4MQAA 2STBE 5DJ7A 1P06A 4O03A 1ZGIA 4D9RA 4ZMAH 4WMDA 4MNWA 1LPZB 3MOCA 2QXHA 2UUFB 3RXHA 3ZVBA 5HGGA 1GDUA 3NK8A 3S7HB 3VPKA 1FY3A 3O8DA 1C5ZB 3T26A 5J4QA 1KDQA 1O3KA 1NY22 1MD7A 3TH2H 1QQ4A 1K1PA 4K8BA 1OP8A 1QA0A 2J4IA 1AFQC 1Q31A 2PUQH 1O2IA 2ANMH 1EJMA 1IQFA 4JYTA 3SGBE 1UTPA 1K21H 1O5DH 1SL3A 3RM2H 2VIQA 2EI8A 1FJSA 2G00A 2CXVA 2QCYA 1ZMNA 3P8OA 1GBHA 4BAHB 3A7XA 1SQTA 2BB4A 1G2LA 3F9FA 1ELAA 1F0SA 2Y7ZA 1F0UA 1RTLA 1LVMA 1O32A 4AN7A 3RXVA 1YPKH 2G52A 1C5VA 1P2QA 3SOSA 1RXPA 1KIGH 1ANCA 1YPMH 1TNKA 4MDSA 1GHBG 3GYLB 1PPEE 4IBLH 5A8YA 1SI5H 3BG4B 4GCHF 1VGCC 4O3UA 2Z94A 3BEIB 1G3CA 1EKBB 2QAAA 4YZUA 2ODYB 3K6ZA 2W3IA 3RXLA 4ZROA 1O39A 8GCHF 1CBWB 3QK1A 2OC0A 4ABJA 3SV6A 1MTUA 1P2IA 3ZVAA 1TGBA 4K1TA 1C5YB 1NESE 1F7ZA 2UWLA 3SGQE 3Q3XA 3N7OA 5K0HA 2TRMA 1BTWA 2AMQA 2F9UA 5EXNA 4GAWA 3RXPA 1DT2A 1ELVA 1W11U 2BX3A 1CHGA 4ISOA 4TPYA 1L1NA 1OP2A 1C1SA 2V35A 1PPGE 3PYHA 2XBYA 3LKWA 3BTTE 5ABWA 1VITH 1HAIH 5A8ZA 1NFYA 3E0PB 1O0DH 4H6TA 4BAMB 2VNTA 2A2QH 1J8AA 1EJAA 3WY8A 4FUBA 1J17T 4ZXXH 1GI6A 2TIOA 2ZHDA 4B76A 2FLRH 1IQIA 1DLKB 2BLWA 5C2ZA 1P9UA 2XRCA 3AAVA 3R0FA 1P2JA 5L2ZH 3ELAH 2TGPZ 1YC0A 2O8LA 4HZHA 2FYQA 4A7IB 3FP8E 4VGCB 4GUXA 3S9CA 2IOTA 4BXWA 1YPEH 1RJXB 2FOFA 3RC6A 2ALPA 2B7DH 5TCAA 5AVDA 1OXGA 2ZIQH 4BAQB 3ZZ5A 3VXFH 3NUMA 1EP5A 3GICB 1O3NA 3LONA 1K1LA 1O3BA 1DM4B 3FP6E 1O3MA 3P8NA 1NM6A 1YP9A 4LXBH 2HPQH 3MI4A 1SR5C 1CT4E 3IWMA 1C2FA 2ALVA 5H4IB 3LGYA 1Y5UT 2GCTC 4OGYA 5FAHA 2WPJS 2ZO3H 4OS6A 1TONA 1B0EA 1TWXB 2GDDA 2ZDKA 3QGJA 1RIWC 4KKDA 3UFAA 3RXKA 5GCHF 4DOQA 3ZZAA 4HFPB 3ZV8A 2BQ7B 1HIAB 4NIYA 3TJOA 4DW2U 3LGVA 2FTMA 3SN8A 4Y8XA 4CREA 3F9GA 1BDAA 1UHBA 3RMLH 4R8TB 5DP3A 1GBLA 2PUXB 1BITA 1V2UT 2Z7FE 2ULLA 1Y59T 4X8SH 1AN1E 1DOJA 4E7NA 1GL1A 1ZPBA 2OBOA 3RP2A 3NZIA 2VVVA 3OY6U 2FP7B 1Z8JB 4B73A 3ZVEA 3I77A 1NFXA 4TPIZ 1XUKA 9ESTA 1BIOA 3QX5H 5HM2A 3A7VA 2ZCLP 1TGSZ 3ZZ3A 3LGUA 2PV9B 2BDCA 1V2OT 3A8DA 1INCA 1HAYB 3SV7A 2BDBA 3K2UA 1O3IA 3BTEE 1AIXH 4LOYH 3PLKA 3K6YA 2VWLA 1GI8B 3NWUA 1GMCG 4MVNA 2AIQA 4KTUA 1O2NA 2VWNA 3PO1B 4BXSA 4MPUA 1MTVA 1P05A 3RU4D 1C2KA 4SGAE 1DXPA 1MTNC 3SI3H 3P8GA 1YGCH 2AH4X 2GMTC 3RXOA 1QBNA 1DUEA 1HFDA 2GKVE 1T4VH 1FUJA 4WXIA 1CGHA 1E38B 2ZCHP 1BCUH 2P95A 2OC7A 2PKSB 3BTGE 4LZ1H 1QTFA 1FI8A 1O37A 4YOGA 3RXFA 1C4Y2 2HALA 3SU3A 1G2MA 1OWDA 1TGCA 3SHAH 1EXFA 5HMAA 3SU4A 1ELBA 1AVXA 4DURA 2XTTB 1C1MA 4ZAEA 2GCHF 1TBZH 5T6GA 1HJ8A 1QCPA 4KTCA 2FOBA 1BUIA 4Q80A 1SGNE 1GI7B 1UMAH 3HKIB 2OLGA 1P03A 2YNAA 1ZTKA 3U98H 2J34A 4IN1A 2G51A 1F5RA 2PLXA 3L3TA 2UWPA 3UQOA 3UNQA 1MZDA 3W94A 3PWBA 1GBAA 2HNTC 2GDEH 5CMXH 4TY6A 1O3OA 1QURH 3DD2H 2G4UA 2BLOA 5GIBA 4AZ2B 2K1QA 1XKAC 1HRTH 1WCZA 2FOGA 2FYRA 4FUCA 4XDEA 1TX6A 1FAXA 1MBQA 3QWCH 3EAJA 1G30B 1AVGH 4WF8A 1CGJE 1GHXH 3MU5A 1SOZA 1G37A 2BY9X 1XMNB 4YT7H 2ZDLA 1D6WA 2BD4A 1Y3VA 3JZ1B 4ISNA 4KELA 1SBWA 1F0TA 1O3JA 2PTNA 2P93A 1EPTA 3RM0H 1P01A 5AF9H 3MNXA 1KXEA 3A82A 3PB1E 4LZ4B 4GHTA 1ZMJA 4UDWH 4X8TH 5C5OA 1S84A 2F3CE 2XBVA 1YPHE 1IQMA 1T7CA 2PSYA 1XVOA 1ZPCA 5ETXA 5JDUB 2Y5HA 1A0LA 1D3QB 1JRTA 1Y3UA 5AFZH 3T28A 3MNSA 3RXQA 4I32A 1CA8B 3B8JA 1O3FA 4FUHA 2FOCA 4K2YA 3KN2A 4INLA 4NA7A 4BAOB 1LTOA 2Y82A 1OWIA 1ELTA 2OQ5A 4GPGA 1O3AA 5GPIB 4CRFA 5FCKA 4HTCH 2A32A 3A7TA 4ABFA 2F83A 3AASA 1SQAA 2FIRH 4WWYA 3A85A 1UJ1A 2ZCKP 1E0FD 1S6FA 2A4GA 5AHGH 2V3HH 2UUJB 1HAPH 1L1GA 1YBWA 3UIRA 1DWEH 1RRKA 2PFEA 1A4WH 1QJ7B 1KXDA 1A2CH 1FONA 2EEKA 2W26A 2WINI 5A09A 2HNTE 1LHFH 1O5CB 1DFPA 2J2UA 3BTKE 2CF8H 1TFXA 3SNDA 1BTYA 1UTOA 1KYNA 4U32A 3SNEA 2CN0H 3RXUA 3A7YA 4I8KA 3ZVGA 5T6FA 5GXPA 4Y7AA 4ZKOU 2A4OA 1THRH 2C93B 4RKOB 3VB7A 5DGJA 3PMHB 3STIA 1H9IE 1CA0C 2VINA 1EPTC 1DX5M 1ANDA 1ZJKA 4MNVA 3OYPA 3ZZCA 3H5CB 5LPFA 2WPMS 1XXFA 2Y6TA 1BMMH 7ESTE 1GPZA 2Z9JA 1VJ9U 2EI7A 1HAHH 1T8NA 3VB4A 1ZPZA 1K1OA 1O2JA 3SHCH 1PPFE 3U1IB 4AGJA 1S5SA 1C1RA 1A5GH 1GGDC 1X7AC 3QTVH 2QV1A 4DVAU 3V0XA 3MU4A 4F49A 2RG3A 3MMGA 1XUHA 1DY8A 4JZDH 2GTBA 5HM9A 5F03A 2ZQ2A 1TYNA 1O2XA 4RN6A 1C1WH 1GMDG 3I78A 1VITF 4AGKA 1TNGA 1MD8A 4ZHLU 4D9QA 2VU8E 4X2VA 2P8OC 3TJUA 1P2KA 2ANWA 2F9NA 3ZVCA 1BRAA 3SO3A 1ARBA 3NXPA 2JETC 3E16B 3FAOA 5JYIA 1A5IA 3M36A 5K7RA 1BMLA 1ESAA 1SB1H 4OS5A 4Q7ZA 3RDZA 1E34B 1PJPA 4KTSA 1P9SA 1MAYA 4YM9A 5C20A 3QUMP 1C2DA 3RMOH 3A81A 1UVSH 3S69A 2BD8A 3ATWA 1NRRH 4IN2A 3KQBA 3SV2H 2J38A 4NSVA 1AZZA 5FPTA 3EGKH 2VIPA 3RUOA 4ASHA 4YOJA 3O8BA 3SV9A 2GX4A 2AMPA 3BIUH 2VVCA 5JBTA 2PW8H 3EA9A 1EATA 4A5TS 1O2VA 2G55A 2QXIA 1O5GH 2ZECA 2TBSA 4XOJA 5EPNA 1D3TB 2TPIZ 4KP0A 3UY9A 3KGPA 2KAIB 3M3TA 2Z9LA 5C5NA 3LC5A 5E2PA 2P3FH 2C8XB 1KTSB 6CHAC 3D49H 7GCHF 3LC3A 1BMNH 2BDIA 1O2RA 3T27A 1SGFG 3LDXH 3SNBA 5A0CA 2ZFSA 3BG8A 1SLWB 1EASA 1JXPA 1WAYB 1EQ9A 1C9TA 2CV3A 1BB0B 3M5LA 2ZFQH 1ABJH 2OBQA 4YESB 4NA9H 1YCPH 3A8BA 1AE5A 1QNJA 3VXEH 5GJ4B 3ENSB 1CT0E 1S82A 4INHA 1MCTA 5I46H 2R0KA 3RXJA 3DA9B 3VEQB 2A5KA 1O3LA 5FX5A 1LHEH 3MH5A 4Y10E 1TX7A 4J2YB 5C1UA 1ANEA 5E0JA 2BDYA 3GCNA 1ZYOA 1GVKB 4IMQA 3PMAB 1AE8H 3BG4C 3GDVA 1EB1H 4BOHA 1MTWA 2Z3DA 3FZZA 1Z6JH 3SJIA 1BTPA 4ZH8A 2WPKS 4U30A 3M7UA 2H5DA 1CBWC 1NPMA 1HPGA 3M7TA 1SC8U 2SGQE 1CQQA 1NU7B 1GI4A 1HIAA 5PTPA 1VR1H 5FPSA 3ZZDA 1NFWA 2HLCA 3TNTA 2EI6A 4D7GA 3TU7H 1QGFA 4X0WU 1SLXB 1NRNH 2BOKA 1TOCB 2VGCB 2A31A 1H8DH 2Q6FA 4NSYA 4WMEA 9LPRA 1SGTA 2BXTH 1V2JT 3RXGA 1FZZA 1WU1A 2GV7A 4I33A 4HI3A 4UFEH 1CSOE 4ZKSU 1SGFA 4WMFA 3DFJA 3PV4A 1NTPA 1ETSH 3MU8A 2GZ7A 1GG6B 2ANKH 5DG6A 4WXVA 2XC5A 1GCDA 2WV5A 1C5OH 2BLQA 4VGCC 2O8UA 4MNYA 4RKJB 1YM0A 6LPRA 4A92A 1BJVA 3M3SA 3A86A 1XX9A 3MO6A 3MTYA 2D26C 1TMBH 2A5AA 1BHXF 3MHWU 1W12U 2P3TB 3GCHB 3STJA 2AS9A 5T3HA 1JIMA 2W7UA 3B23B 2FDAA 4IW4E 2OINA 4WH6A 3E1XB 1CO7E 2RDLA 3BEUA 1W2KH 1FV9A 2FLBH 1GI2A 1HAVB 1P2NA 4WH8A 2ZPRA 1S83A 4X1RU 1OSSA 2VH0A 1IQLA 2H6MA 4KGAA 1Z6EA 3CP7A 5C67A 4AFZA 4D8NA 2AFQB 4TWWA 1HJ9A 3M3VA 4Y6DA 4Z6AH 4ESTE 5A8XA 1IQKA 3HGNA 1DS2E 1GJ4H 3GY2A 2BZ6H 2H5CA 1O2GH 3Q76A 1XM1A 1HNEE 1TOMH 1NS3A 3LJJA 1DLEA 3KQEA 1PQ7A 1D4PB 3EA7A 4Y8YA 4INKA 1ZOMA 1GI0A 1MKXH 1NROH 1AGJA 2BY7X 3SJ8A 2OQUA 1EOJA 1ACBE 1NN6A 1V2WT 1QL7A 3D23A 4Y76A 2QXGA 3H7TA 1C1UH 2BOHB 1DITH 1WQSA 3BF6H 3ATIA 1O35A 2G5VA 3BTDE 5GCHG 2FI3E 2G81E 5EQRA 3ZVFA 1FY5A 2FOAA 2R3UA 2SGPE 2ZQ1A 3PO1C 2ZFFH 1OWEA 4GVUA 2FI5E 2FODA 3P95A 1WBGB 1TPAE 1PFXC 3W95A 1FXYA 3SNCA 1B0FA 8ESTE 1KXFA 1GHBF 2BHGA 1QHRB 1IQGA 2A7HA 1BTZA 1AWHB 3P8FA 1SVPA 1K28D 3LGWA 1P2OA 1GBFA 3EE0B 4OS7A 2ZP0H 1W0ZU 2R0LA 2DE8A 3MO9A 2BDGA 1F5LA 1XUFA 3SUFA 1WQVH 1TBRH 3LU9B 1AFEH 3DHKH 3Q3KA 1OWKA 2QY0B 5A0BA 4GSOA 2PKSC 1YCPK 3AW1A 5BPEA 1IHSH 5FBIA 1C5UA 4K69A 2B5TB 5L2YH 2H9EH 1A0JA 2BD2A 3OX7U 3Q77A 3LH1A 4UE7H 1C5MD 2ZTZA 3E90B 3PLBA 4I8LA 2D8WA 3NPSA 2Z3CA 1P0SH 2FOEA 1RFNA 3QZRA 1HB0B 1RTKA 2BLVA 1YLDA 3FFGA 1J14A 3UREA 2AGGX 1HXEH 3MH6A 5DP6A 3ZYDA 2OUAA 2W7SA 4AB9A 1C4U2 2HNTF 4NA8A 4CRGA 1GI9B 1SGPE 3ATMA 1L1JA 5LH8A 4J1YA 4HGCA 1UTMA 1UCYE 3C27B 1DSUA 1TGNA 1W7GH 1XUJA 3ESTA 1BRCE 3DUXH 4CH2B 2FI4E 1T32A 1F5KU 1UTKA 4Y0ZE 5E0GA 3F9EA 1JIRA 2PTCE 3HGPA 1GHAG 1KTTB 1KXAA 1LPKB 3U1JB 2ZG0H 4X6PA 2J95A 3UNRA 3C1KA 1LHDH 1V6DA 1FY4A 2I6SA 1SG8B 3TITA 3D62A 2Y7XA 5ESTE 2CF9H 2GCHG 2GD4B 3SW2B 1C5PA 1Q3XA 1UTNA 2A4RA 5DKMA 3OU0A 4GHQA 2DE9A 3ZV9A 4WJG2 1AU8A 1TABE 2BZAA 1WSSH 3RC5A 1YYY1 2J94A 4CRDA 4CBNA 2ZDMA 3BIVH 3MNBA 1DWDH 1FNIA 2Z9KA 5EGMA 2UUYA 2F9VA 1PQ8A 1IQHA 2XBXA 1UK2A 2ZDVH 2TGDA 1HBTH 3T5FH 3F1SB 1GI5A 5F8ZA 1O2OA 4XE4A 2O8MA 4NWKA 2WPIS 3BTFE 1QL8A 1QRXA 2Y5GA 4AYYB 1W14U 4FU9A 1TMTH 4CH8B 1M9UA 3CS0A 2FPZA 1YLCA 2H1UA 4NFFA 1A3BH 1T8OA 3SJ9A 3UR9A 5DP5A 1K9OE 2YNBA 3F68H 2M5TA 3P6ZB 4Y79A 4FUGA 2JH5D 2BY8X 1JMOH 1WTHD 1O2KA 2C4FH 4YO9A 1DXWA 1HJAB 1P2MA 2PKAA 2ILNA 2A1DB 3TNSA 2A7CA 2GP9B 2IPHA 2Y80A 2BMGB 3PLPA 1JOUB 4MLFB 5JBCS 4DG4A 1SLUB 4Q7YA 2AGEX 1QR3E 4WVPE 1LVYA 2FS8A 4MTBA 1V2TT 4AFQA 2OC1A 2XNIA 2PHBA 4ABHA 1BHXB 2BQWB 1QY6A 3T25A 4ZHMU 3SUGA 1ELCA 4FU8A 1QFKH 3E0NB 1RIWB 1OWJA 1GBCA 2ZTXA 4FXGH 4E05H 2A45B 3ZVDA 1GMCF 3M5NA 4NWLA 1W10U 3TH4H 2VWMA 1ELDE 6GCHF 1AHTH 1C9PA 1TAWA 3VB5A 1O2WA 2BVXH 2THFB 1H8IH 4JK5A 4U01A 1MKXK 2STAE 2RCEA 1EJNA 4FU7A 4NGAH 4YLUA 4I8JA 3S7KB 2NU0E 1PPBH 1ZSLA 4AFUA 1V3XA 1Z7KA 1N6XA 1GCTC 3QTOH 1AKSB 3RXIA 3A7ZA 2P3UB 1BTXA 2Z3EA 1TBQH 5AFYH 3LIWA 1DVAH 3TGKE 1CHOG 1FIWA 2A0QB 2BY5X 2PWXA 2ZTYA 1GHVH 5E2OA 2FS9A 4XBCA 1BQYA 1LQDB 2ZKSA 3ZZ6A 1GJCB 1GDNA 3ZZ8A 3JZ2B 2VVUA 5FX6A 4MNXA 2BD9A 1G3BA 5L6NH 1O3CA 3SUEA 3GCTG 3BN9A 1TX8A 1EAWA 1SHHB 1SSXA 3K65B 1FY8E 2AEIH 3QN7A 1MU6B 1Z71A 1WYKA 1SGRE 4Q2KA 4DT7B 3V13A 1A7SA 3B9FH 2ZHFH 4BTTB 1GMHG 2QF0A 1V2QT 3LOXA 3ATKA 3RMNH 3LGTA 3P17H 3KL6A 2H9HA 2P16A 2XC0A 4I8HA 4JZIA 4ZKRU 3UOPA 4CRAA 5HYOA 2O8WA 4Y11E 5EW2H 1L0ZA 2G4TA 1EAIA 1YPLH 1XKBC 1T8LA 1A3EH 2GMTB 2ZU2A 3HK3B 1UTLM 2BD7A 3SZNA 3RXMA 2FO9A 2BVSH 1K1JA 1TALA 2FX4A 2VIDA 3ZZ4A 1EZSC 1SGQE 2D2DA 1NRPH 5CHAB 1LKAA 1FAKH 3BTQE 2XCNA 2OXSA 4Q7XA 8LPRA 2WV4A 4Z0KA 1UK4A 3RMMH 1SLVB 1UHBB 3NKKA 1IOEA 1AD8H 1F0RA 3SBKA 1CU1A 5T6DA 1ZTLA 2UWOA 5HXFA 1ZMLA 2ESTE 2RA3A 1GL0E 1O2ZA 2ANYA 1VITG 1FQ3A 1TGTA 1ZHPA 1EUFA 2P59A 4IS5A 4TYDA 1HV7A 3SJKA 4A1VA 4ISIH 2BQ6B 1BBRE 2FESH 4FUFA 1BRBE 1ZHRA 3BSQA 1FPCH 1UTQA 4ZKNU 1QQUA 2ODQA 1TA2A 1A46H 1UTJA 1BT7A 2QXJA 5C1YA 1TE0A 1TRMA 5DK1A 1B5GH 4A1XA 1UCYK 2C3SA 4CHAB 3IG6B 2ZDAH 1TIOA 4ISHH 1O3DA 4X1PU 2ZWLH 4X2WA 1GJ6A 4TY7A 2R9PA 3U9AH 3AAUA 3RXCA 4B71A 1BBRH 1LVBA 3HATH 1D3DB 1QJ1B 1Y5BT 1V2ST 3A87A 1ID5H 1HUTH 2NU2E 1C5SA 1KXBA 1JRSA 5J4SA 2OC8A 3TGJE 1HAVA 3GY5A 2OD3B 3KQDA 3SNAA 4AG2A 4NG9H 1GHZA 2JH6D 1GBJA 1WUNH 2ZPSA 2IN2A 2AGIX 1O5EH 1Y8TA 1Y3WA 1O2SA 3A88A 1P11E 4TWYA 1V2NT 4X1NU 4WY3A 4K1SA 4YT6H 3M5MA 1V2RT 1Y3XA 2EA3A 3P70B 3ZZ9A 4UFGH 3NCLA 2BXUH 2VGCC 1NRQH 2A2XH 4JYVH 2A4QA 3MU0A 2H9TH 1ZLRA 3VGCB 1P3CA 1CGIE 1QJ6B 4CR5A 1SGIB 4UEHH 1FIZA 1S6HA 4JK6A 4BANB 3Q00A 1MU8B 2ZF0H 3U8TH 1GVZA 1GG6C 1Z1IA 4LK4A 3RXAA 1CT2E 1W13U 3OY5U 4FVDA 4DIHH 2ZU5A 3GDSA 4ZXYH 3KHVA 1ZSKA 4FVBA 1FMGA 5DP8A 4AORA 2ZGJA 1TQ0B 2CGAA 4X8VH 1PPHE 4D76A 1GBEA 2UUKB 2DUCA 1BTUA 4OGXA 3TIUA 2WPHS 3CENA 1W8BH 2I6QA 3VB6A 2GVFA 3S0NA 4E06H 1TQ7B 3TJVA 1VZQH 5DO4H 1NFUA 1EPTB 1UVTH 4AX9H 1O3PB 1C2GA 5BRRE 6ESTA 3GY7A 4JYUH 3GY3A 1C2IA 1XVMA 3ITIA 3SGAE 2R2MB 5FXLA 2XWBI 5B6OA 3SU6A 2D1JA 1BJUA 4DY7B 4THNH 4NFEA 3QO6A 3U69H 2FXRA 3RC4A 4D7FA 1C1OA 3GY8A 5IYTA 3Q3YA 2Z9IA 3MU1A 4DJZB 1GGDB 1A0HB 2Y5FA 1GBKA 2VIWA 5TCCA 1YPGH 2F9OA 1C5WB 1O2TA 3MO3A 1FY1A 1ETTH 3RU4T 1K22H 1GJ5H 1SGDE 1O5BB 1ESTA 2FOMB 3BEFB 1H9HE 2XXLA 4NZQA 4BAKB 1C5QA 2P8OB 3M7QA 1FN6A 1K1IA 1Z8GA 1ANBA 3HK6B 1C2MA 3DT0H 1P10A 2GZ8A 2ZGXH 1H1BA 2ASUB 4UD9H 1N8OB 4YLQH 2LPRA 4H4FA 3SU5A 1Z8IB 1AO5A 1HDTH 1IAUA 3GYMA 1C5LH 4GCHG 3EQ0H 3OTJE 1P04A 4ABGA 3S9BA 1G9IE 8GCHG 1SGCA 3HPTB 5DP9A 1K1MA 1ZSJA 1MH0A 1U6QA 4Y71A 1O31A 3KCGH 4B1TA 3E6PH 1AUJA 4CRBA 1ZRKA 2G5NA 2ZGHA 5G4BA 1OP0A 2C8ZB 4NCYA 1WTGH 3UOUA 1P57B 1TNJA 3F6UH 1V2PT 2ZGCA 3BTME 3PM3A 6CHAB 1J9CH 2BYAX 1Y3YA 1SPJA 4FUJA 1HAGE 2GT7A 2SNWA 2P94A 1DICA 2GV6A 4A1TA 3EDXB 2ZI2H 1QRWA 2ZFPH 2V6NA 1XUIA 2H2ZA 1K2I1 1V2KT 1TPSA 1AB9B 2HGTH 3H7OA 3RXBA 1O5FH 1TLDA 1BBRK 1GVLA 3MNCA 1OS8A 2CHAB 1AI8H 1VJAU 4I31A
chains in the Genus database with same CATH superfamily
1DDJA 2AYWA 3SZEA 5JBAS 5A0AE 2QN5T 3SV8A 2RA0A 3UWIA 5F6MA 1P02A 1GWAA 2V0BA 2VIVA 1A5HA 1UW7A 1MAXA 3T62A 4Y0YE 1F92A 3GISB 1GBMA 1ORFA 2BTCE 2W3KA 3SQEE 2Y81A 5FBEA 2LELA 1SFQB 1ZR0A 3G01A 4I86A 4PROA 4ZHAA 2BX4A 4A6LA 4UFFH 5CE1A 1SGEE 4BTIB 1GHYH 2SGAA 1ELGA 1H8HD 1Z1JA 2XW9A 5F8TA 1KY9A 5E0HA 1SGYE 1C2EA 1B7XB 3TPIZ 3M61U 1IHTH 1EP6A 1DUAA 4X6NA 1XXDA 2WUBA 1AKSA 3RXRA 4QT8C 4Y8ZA 4ABDA 1O2MA 4JCNA 2ZFRH 2ZA5A 1PYTC 1C1PA 1GJAB 3TK9A 1EX3A 3UQVA 1P09A 1ARCA 2G8TA 4FOUC 1HAZB 1PYTD 1AFQB 5I25A 1LDTT 4H42U 1TNIA 3L33A 1V2MT 3SI4H 2FZZA 1YKTA 4ABBA 4B75A 2ZC9H 1T8MA 1F2SE 2SFAA 4UONA 3VFEA 1NRSH 1ESBA 5A2MH 1E36B 3BTHE 1AMHA 1AVWA 1DPOA 3FZDA 1FPHH 3MQKC 1QB9A 1ZHMA 4X8UH 5EXMA 4YOIA 1BTHH 3SQHE 1T4UH 1HJAC 1QB1A 1ETRH 2AHME 2FX6A 1QB6A 1O34A 1QA7A 1GBTA 1OYTH 1QIXB 2VWOA 5ESBA 1UVPA 3RLWH 3O8RA 1XUGA 1E37B 3PROA 1BA8B 4DIIH 4K60A 1C1NA 1HLTH 3AW0A 1SMFE 3MYWA 4YTAA 5EPYA 1VGCB 1IQNA 3M5OA 4O97A 3KIDU 4AB8A 2PGBB 2R2WU 3T29A 2HPPH 1MKWH 5DPAA 1OWHA 3OTPA 7KMEH 3ODFA 2B0FA 4XD7D 1RGQA 1QZ8A 2JIZD 3EA8A 3AVZA 2A5IA 2Z9GA 1NT1A 1ELEE 1KLIH 3CNRA 2VH6A 3IITA 3I29A 1G36A 3KNXA 4DGJA 2ODPA 2WYJA 1O5AB 1GI3A 1KDQB 5EJ1A 3ODDA 5GWZA 2XWAA 3ATLA 2EY4C 1UCYH 2V7QD 5FL7D 4X2XA 1LHCH 1C1QA 4SGBE 2ZHWH 5DP7A 1L4ZA 1DANH 2VBCA 3TK5A 2BD5A 1ABIH 1VCPA 3O8CA 1QBOA 1MCVA 1BRUP 1LO6A 1OOKB 3DSOA 3F9HA 1FN8A 1ELFA 5EW1H 2QYIA 2TGAA 3M37A 2PGQB 2GGVB 1A61H 2NWNA 2F9BH 1O33A 2B8OH 1UVOA 3LJOA 4IC6A 2ZU4A 2IJOB 5EOKA 3SORA 1TA6A 1TNHA 1DWBH 5F53A 1H4WA 6GCHG 1A1RA 3E3TA 1P12E 2SGDE 1GDQA 1PQ5A 2C8WB 4ZUHA 1EZQA 4DCDA 2ZZUH 3CS7A 1YPHC 3UR6A 3TK6A 1EAXA 1C5TA 3OSYA 5C1XA 1MUEB 1O30A 3RXTA 1HAOH 3P92A 1SQOA 1THSH 1HXFH 5SGAE 1GHAF 1TRNA 3N7EA 4IMZA 3SUDA 1V2VT 5CHAC 3RLYH 2XCFA 2FMJA 4OS2A 1C2HA 5FPYA 1O2LA 1TPOA 1ZJDA 2GCTB 3UUZA 3QGNB 2ZHQH 1BOQA 4RT1A 1VCQA 4OS1A 3LT3A 5LGOA 4XSKU 3TH3H 5TJXA 2SGEE 4ABIA 1PPCE 4JMYA 2YOLA 4I8GA 1LVOA 1SOTA 4IC5A 2L74A 1THPB 4IGDA 3RXEA 3RXSA 4R0IA 3ZYEA 3QZQA 2KAIA 1QBVH 5CHBA 1UVUH 1TB6H 1Q2WA 3A8AA 2HOBA 1C1VH 1MQ5A 2F9PA 1O38A 1GBIA 4X6OA 3TJNA 4UFDH 3GY4A 5C94A 2VB0A 4ABEA 1CE5A 4MPVA 3M35A 2QIQA 2F91A 1GI1A 1O3HA 3GDUA 4AG1A 3FO8D 2ZEBA 1S85A 4AYVB 4CHAC 5FHTA 2ZU3A 3TVJB 4K8YA 4XFQA 5EG4A 4B74A 2QA9E 1SFIA 1C4V2 1J16A 5JBBS 1SHYA 1W3CA 1BMAA 4K5ZA 4B2CA 1DWCH 1E1QD 1MMJN 3L6PA 2FM2A 1HAXB 1O3GA 3RU4E 1K1NA 1TRYA 3LPRA 1GJBB 1KLTA 4RSPA 2BDHA 2ZDNA 2NU4E 1YPJH 5EQSA 1QRZA 1V2LT 2VJ1A 3A89A 2AIPA 1AZ8A 5LPEA 3V7TA 1DSTA 3LH3A 1O3EA 3PTBA 1MTNB 2C90B 3V12A 3PTNA 3UWJH 4JZEH 3DFLA 3T2NA 2GT8A 2BVRH 2BY6X 2ZFTA 2HVXA 4JZFH 3V3MA 1RS0A 2WYGA 4K3JA 1IQEA 3F0OA 1H9LB 1JWTA 3MWIU 1P8VC 2ZPQA 3VGCC 1P3EA 1GJ9B 4XBBA 5DP4A 2A7JA 2BM2A 1G32B 2FEQH 4NZLA 4FUDA 2PSXA 3FP7E 3ZZBA 1BZXE 2SNVA 1MBMA 2C8YB 4BNRA 2W5EA 1CHOF 3MFJA 1S0RA 4U2WA 5EQQA 5JPMH 2V3OH 1C5RA 3SU2A 3U8OH 3R3GB 7LPRA 3GCOA 1VCWA 1CVWH 2NU1E 1MKWK 3ZZ7A 1OPHB 3VB3A 3A8CA 3GCTF 3K9XB 4Y7BA 1GBBA 2ZHEH 1AWFH 1NC6A 1HYLA 2OTVA 2LNCA 4X1QU 3PMBB 1W0YH 1L2EA 1DE7H 5C3NA 4MPWA 2J9NA 5EODA 3FN8A 1Z8RA 1EZXC 5GDSH 1J15A 3UPEA 2PR3A 2XC4A 3MH4A 1N1LA 2B9LA 1GMHF 2NU3E 4MPXA 1KLJH 1YF4A 2R3YA 2WUCA 5JB9S 4ABAA 3KEEA 4CRCA 1TNLA 4B2BA 2EC9H 1NU9A 1S81A 1WOFA 1EB2A 1GCTB 2TGTA 3FANA 2QC2A 1ZGVA 1GJ7B 4H6SB 2CJIA 4I7YH 1D9IA 3D65E 7GCHG 1N6YA 1L4DA 2OP9A 4K1EA 3KQCA 3U8RH 2ZNKH 3KF2A 2QGRA 1LQEA 1OX1A 1UO6A 2O9QA 5E8EH 1DY9A 1G3EA 1HCGA 3E91A 1C2JA 4JZ1A 1NO9H 2Z6BD 1AQ7A 1MTSA 3RXDA 4AFSA 2XYAA 4FUEA 1PQAA 3A7WA 1O2YA 1O2UA 1OYQA 2PKAB 4O3TA 2GZ9A 2J92A 2ZU1A 2XBWA 3KYFA 1AY6H 1EZUC 2Q6DA 2HWLB 3S9AA 8KME2 1O2HA 2ZGBH 1ZRBA 4ISLA 5FCRA 1EOLA 1N8OC 1ZZZA 4XBDA 3OEED 1D3PB 5F8XA 1GHWH 1GJ8B 4NIWA 3LGIA 3TLOA 4FETA 1FLEE 3SU0A 1RD3B 1LMWB 3E8LA 3BV9B 1TPPA 5HKKD 2BD3A 4F4OC 2AERH 1C2LA 4X2YA 1IQJA 3GY6A 3QLPH 1MZAA 3EYDA 2OCVB 4B2AA 3TGIE 2SGFE 1S0QA 1LPGB 1O36A 4O9VA 2WPLS 4GLYA 4M7GA 1O2QA 5IDKA 3URCA 3A80A 5EU8A 1GMDF 3A83A 1JBUH 3NRLA 4AOQA 4X6MA 4CBOA 1C5XB 1OKXA 2FTLE 2O8TA 4OS4A 1CA0B 2Q1JA 1Y5AT 2FOHA 3GCHC 3PWCA 1KSNA 2CMYA 1E35B 1GBDA 1TMUH 4FUIA 5L30H 1AUTC 1G3DA 3URDA 5LPRA 4NIXA 1W7XH 1MQ6A 3UTUH 1AB9C 2RDEA 1GJDB 4CR9A 1T31A 3FVFB 4BTUB 4E7RG 1LHGH 1WV7H 1C1TA 2CHAC 2JKHA 1FDPA 5EXLA 2QF3A 3HKJB 3A84A 2JH0D 3MH7A 1RTFB 1LKBA 4NIVA 3UNSA 1NZQH 2AMDA 3QDZB 2Q6GA 2HRVA 1EAUA 1D6RA 3GOVB 1YCPM 3PMJA 3SU1A 2VIOA 3BTWE 4MG3A 3SJOA 1LCYA 5JB8S 4X1SU 1O2PA 2BDAA 1PPZA 1UK3A 1HGTH 1QL9A 2FWWA 2JETB 1KXCA 1C5NH 1ZTJA 1SQRA 4MQAA 1YWUA 2STBE 5DJ7A 1H8ED 1P06A 4O03A 1ZGIA 4D9RA 5EJZA 4ZMAH 4WMDA 4MNWA 1LPZB 3MOCA 4ZCNA 2QXHA 2UUFB 3RXHA 3ZVBA 5HGGA 1GDUA 3NK8A 3S7HB 3VPKA 1FY3A 3O8DA 1C5ZB 3T26A 5J4QA 1KDQA 1O3KA 1NY22 2PP6A 1MD7A 5KGOA 3TH2H 1QQ4A 1K1PA 4K8BA 1OP8A 1QA0A 2J4IA 1AFQC 1Q31A 2PUQH 1O2IA 2ANMH 1EJMA 1IQFA 4JYTA 2KX4A 3SGBE 1UTPA 1K21H 1O5DH 1SL3A 3RM2H 2VIQA 2EI8A 1FX0B 1FJSA 2G00A 2CXVA 2QCYA 1ZMNA 2KR7A 3P8OA 1GBHA 4M9FA 4BAHB 3A7XA 1SQTA 2BB4A 1G2LA 3F9FA 3OFND 1ELAA 1F0SA 2Y7ZA 1F0UA 1RTLA 1LVMA 1O32A 4AN7A 3RXVA 1YPKH 2G52A 1C5VA 1P2QA 3SOSA 1RXPA 1KIGH 1ANCA 1YPMH 1TNKA 4MDSA 1GHBG 3GYLB 1PPEE 4IBLH 5A8YA 1SI5H 3BG4B 4GCHF 1VGCC 4O3UA 2RFKC 2Z94A 3BEIB 1G3CA 1EKBB 2QAAA 4YZUA 2ODYB 3K6ZA 2W3IA 3RXLA 4ZROA 1O39A 1W0KD 8GCHF 1CBWB 3QK1A 2OC0A 4ABJA 3SV6A 2L6OA 1MTUA 1P2IA 3ZVAA 1TGBA 4K1TA 1C5YB 1NESE 1F7ZA 2UWLA 3SGQE 3Q3XA 3N7OA 2YMSC 5K0HA 2TRMA 1BTWA 2AMQA 2F9UA 5EXNA 4GAWA 4RI0A 3RXPA 1DT2A 1ELVA 1W11U 2BX3A 1CHGA 4ISOA 4TPYA 1L1NA 1OP2A 1C1SA 2V35A 1PPGE 3PYHA 2XBYA 3LKWA 3BTTE 5ABWA 1VITH 1HAIH 1S6LA 1NFYA 5A8ZA 2WSSD 3E0PB 1O0DH 4H6TA 4BAMB 2VNTA 1NBMD 2A2QH 1J8AA 1EJAA 3WY8A 4FUBA 1J17T 4ZXXH 1GI6A 2TIOA 2ZHDA 3OAAD 4B76A 2FLRH 5B6LA 1COWD 1IQIA 1DLKB 2BLWA 5C2ZA 1P9UA 4F48B 2XRCA 3AAVA 3R0FA 1P2JA 5L2ZH 3ELAH 2TGPZ 1YC0A 2XOKD 2O8LA 4HZHA 2FYQA 4A7IB 3FP8E 4VGCB 4GUXA 3S9CA 2IOTA 4BXWA 1YPEH 1RJXB 2FOFA 3RC6A 2ALPA 2B7DH 5TCAA 5AVDA 3SYJA 1OXGA 2ZIQH 4BAQB 3ZZ5A 3VXFH 3NUMA 1EP5A 3GICB 1O3NA 3LONA 1K1LA 1O3BA 1DM4B 3FP6E 1O3MA 3P8NA 4RT0A 1NM6A 1YP9A 4LXBH 2HPQH 3MI4A 1SR5C 1CT4E 2EQNA 3IWMA 1C2FA 2KCAA 3F2HA 2ALVA 2KZ4A 5H4IB 3LGYA 1Y5UT 2GCTC 4OGYA 5FAHA 2WPJS 2ZO3H 4OS6A 1TONA 1B0EA 1TWXB 2GDDA 2ZDKA 3QGJA 1RIWC 4KKDA 3UFAA 3RXKA 5GCHF 4DOQA 3PV5A 3ZZAA 4HFPB 3ZV8A 2BQ7B 1HIAB 4NIYA 3TJOA 4DW2U 3LGVA 2FTMA 3SN8A 2F4LA 4Y8XA 2XNDD 4CREA 3F9GA 1BDAA 1UHBA 3RMLH 4R8TB 5DP3A 1GBLA 2M2AA 2PUXB 3ZIAD 1BITA 1V2UT 5DSFA 2Z7FE 5EJLA 2ULLA 1Y59T 4X8SH 1AN1E 1DOJA 4E7NA 1GL1A 1ZPBA 2OBOA 3RP2A 3NZIA 2VVVA 3OY6U 4B6FA 2FP7B 1Z8JB 4B73A 3ZVEA 4Q4LA 1NBME 3I77A 1NFXA 4TPIZ 1XUKA 9ESTA 1BIOA 3QX5H 5HM2A 1BMFD 3A7VA 2ZCLP 1TGSZ 3ZZ3A 3LGUA 2PV9B 2BDCA 5C0UA 3N99A 1V2OT 3A8DA 1INCA 1HAYB 3SV7A 2BDBA 3K2UA 1O3IA 3BTEE 1AIXH 4LOYH 3PLKA 3K6YA 2VWLA 1GI8B 3NWUA 1GMCG 2QF5A 4MVNA 2AIQA 4KTUA 1O2NA 2VWNA 3PO1B 4BXSA 4MPUA 3W1EA 5DN6D 1MTVA 1P05A 3RU4D 5C0TA 1C2KA 4SGAE 1DXPA 1MTNC 3SI3H 3P8GA 1YGCH 2AH4X 2GMTC 3RXOA 1QBNA 1DUEA 1HFDA 2F43B 2GKVE 1T4VH 2K0QA 1FUJA 4WXIA 1CGHA 1E38B 2ZCHP 1BCUH 2P95A 2OC7A 2PKSB 3BTGE 4LZ1H 1QTFA 1FI8A 1O37A 4YOGA 3RXFA 1C4Y2 2HALA 3SU3A 1G2MA 1OWDA 1TGCA 3SHAH 1EXFA 5HMAA 3SU4A 1ELBA 1AVXA 4DURA 2XTTB 1C1MA 4ZAEA 3WW7A 2GCHF 2KM0A 1TBZH 5T6GA 1HJ8A 1QCPA 4KTCA 2FOBA 1BUIA 4Q80A 1SGNE 1GI7B 1UMAH 3HKIB 2OLGA 1E1RD 1P03A 1ZTKA 2YNAA 3U98H 2J34A 4IN1A 2G51A 1F5RA 2PLXA 3L3TA 2UWPA 3UQOA 3UNQA 1MZDA 3W94A 3PWBA 1GBAA 2HNTC 2GDEH 5CMXH 4TY6A 1O3OA 1QURH 3DD2H 2G4UA 2BLOA 5GIBA 4AZ2B 2K1QA 1XKAC 2JJ1D 1HRTH 1WCZA 3EE7A 2FOGA 2FYRA 4FUCA 4XDEA 1TX6A 1FAXA 1MBQA 3QWCH 3EAJA 1G30B 1AVGH 4WF8A 1CGJE 1GHXH 3MU5A 1SOZA 1G37A 2BY9X 1XMNB 4YT7H 2ZDLA 1D6WA 2BD4A 1Y3VA 3JZ1B 4ISNA 2W6ID 4KELA 1SBWA 1F0TA 1O3JA 2PTNA 2P93A 1EPTA 3RM0H 1P01A 5AF9H 2KCYA 3MNXA 1KXEA 3A82A 3PB1E 4LZ4B 4GHTA 1ZMJA 4UDWH 4X8TH 5C5OA 1S84A 2F3CE 2XBVA 1YPHE 1IQMA 1T7CA 2PSYA 1WDIA 1XVOA 1ZPCA 5ETXA 5JDUB 2Y5HA 1A0LA 1D3QB 1JRTA 1Y3UA 5AFZH 3T28A 3MNSA 4B6EA 3PV2A 3RXQA 4I32A 1CA8B 3B8JA 1O3FA 4FUHA 2FOCA 4K2YA 3KN2A 4INLA 4NA7A 4BAOB 2HVYB 1LTOA 2Y82A 1OWIA 1ELTA 2OQ5A 3N7DA 4GPGA 2V3MA 1O3AA 5GPIB 4CRFA 5FCKA 4HTCH 2A32A 3A7TA 4ABFA 2F83A 3AASA 1SQAA 2FIRH 3F2FA 4WWYA 3A85A 1UJ1A 2ZCKP 1E0FD 2WPDD 1S6FA 2A4GA 5AHGH 2V3HH 2UUJB 1HAPH 1L1GA 1YBWA 3UIRA 1DWEH 1RRKA 2PFEA 1A4WH 1QJ7B 1KXDA 1A2CH 1FONA 2EEKA 2W26A 2WINI 5A09A 2HNTE 1LHFH 1O5CB 1DFPA 2J2UA 3BTKE 2CF8H 1TFXA 3SNDA 1BTYA 1UTOA 1KYNA 4U32A 3SNEA 2CN0H 3RXUA 3A7YA 4I8KA 3ZVGA 5T6FA 5GXPA 4Y7AA 1WXRA 4ZKOU 2A4OA 1THRH 2C93B 4RKOB 3VB7A 5DGJA 3PMHB 3STIA 1H9IE 1CA0C 5T1VA 2VINA 1EPTC 1DX5M 1ANDA 1ZJKA 4MNVA 3OYPA 3ZZCA 3H5CB 5LPFA 2WPMS 1XXFA 2Y6TA 1BMMH 7ESTE 1GPZA 2Z9JA 1VJ9U 2EI7A 1HAHH 1T8NA 3VB4A 1MABB 1ZPZA 1K1OA 1O2JA 3SHCH 1PPFE 3U1IB 4AGJA 1S5SA 1C1RA 1A5GH 1GGDC 1E79D 1X7AC 3QTVH 2QV1A 4DVAU 3V0XA 3MU4A 4F49A 2RG3A 3MMGA 1XUHA 1DY8A 4JZDH 2GTBA 5HM9A 5F03A 2ZQ2A 1TYNA 1O2XA 4RN6A 1C1WH 1GMDG 3I78A 1VITF 4AGKA 1TNGA 1MD8A 4ZHLU 4D9QA 2VU8E 4X2VA 1YLNA 2P8OC 3TJUA 5EIYA 1P2KA 2J97A 2ANWA 2F9NA 3ZVCA 1BRAA 3SO3A 1ARBA 3NXPA 2JETC 3E16B 3FAOA 5JYIA 1A5IA 3M36A 5K7RA 1BMLA 1ESAA 1SB1H 4OS5A 4Q7ZA 3RDZA 1E34B 1PJPA 4KTSA 1P9SA 1MAYA 4YM9A 5C20A 3QUMP 1C2DA 3RMOH 3A81A 1UVSH 3S69A 2BD8A 3ATWA 1NRRH 4IN2A 3KQBA 3SV2H 2J38A 4NSVA 1AZZA 5FPTA 3EGKH 2VIPA 3RUOA 4ASHA 4YOJA 3O8BA 3SV9A 2GX4A 2AMPA 3BIUH 2VVCA 5JBTA 2PW8H 3EA9A 3F2GA 1EATA 4A5TS 1O2VA 2G55A 2QXIA 1O5GH 2ZECA 2TBSA 4XOJA 5EPNA 1D3TB 2TPIZ 4KP0A 3UY9A 3KGPA 2KAIB 3M3TA 2Z9LA 5C5NA 3LC5A 5E2PA 2P3FH 2C8XB 1KTSB 6CHAC 3D49H 7GCHF 3LC3A 1BMNH 2BDIA 1O2RA 3T27A 1SGFG 1K0HA 3LDXH 3SNBA 5A0CA 2ZFSA 3BG8A 1SLWB 1EASA 1JXPA 1WAYB 1EQ9A 1C9TA 3GS9A 2CV3A 1BB0B 3M5LA 2ZFQH 1ABJH 2OBQA 4YESB 4NA9H 1YCPH 3A8BA 1AE5A 1QNJA 3VXEH 5GJ4B 3ENSB 1CT0E 1S82A 4INHA 1MCTA 5I46H 2R0KA 3UB0A 3RXJA 3DA9B 3VEQB 5HIYA 2A5KA 1O3LA 5FX5A 1LHEH 3MH5A 4Y10E 1TX7A 4J2YB 5C1UA 1ANEA 5E0JA 2BDYA 3GCNA 4YXWD 1ZYOA 1GVKB 4IMQA 3PMAB 1AE8H 3BG4C 3GDVA 1EB1H 4BOHA 1MTWA 2Z3DA 3FZZA 1Z6JH 3SJIA 1BTPA 4ZH8A 2WPKS 4U30A 3M7UA 2H5DA 1CBWC 1NPMA 1HPGA 3M7TA 1SC8U 2OK5A 4ACAA 2SGQE 1CQQA 1NU7B 5C17A 1GI4A 1HIAA 5PTPA 1VR1H 5FPSA 3ZZDA 1NFWA 2HLCA 3TNTA 3FKSD 2EI6A 4D7GA 3TU7H 1QGFA 4X0WU 1SLXB 1NRNH 2BOKA 2JDID 1TOCB 2VGCB 2A31A 1H8DH 2Q6FA 4NSYA 4WMEA 9LPRA 1SGTA 2BXTH 3DSGA 1V2JT 3RXGA 3U28C 1FZZA 1WU1A 2CK3D 2GV7A 4I33A 4HI3A 4UFEH 1CSOE 4ZKSU 1SGFA 4WMFA 3DFJA 3PV4A 1NTPA 1ETSH 3MU8A 2GZ7A 1GG6B 2ANKH 5DG6A 4WXVA 2XC5A 1GCDA 2WV5A 1C5OH 2BLQA 4VGCC 2O8UA 3PRBA 4MNYA 2QE7D 4RKJB 4P00A 1YM0A 6LPRA 4A92A 1BJVA 3M3SA 3A86A 1XX9A 3MO6A 3MTYA 2D26C 1TMBH 2A5AA 1BHXF 3MHWU 1W12U 2P3TB 3GCHB 3STJA 2AS9A 5T3HA 1JIMA 2W7UA 3B23B 4TT3D 2FDAA 4IW4E 2OINA 4WH6A 3E1XB 1CO7E 2RDLA 3BEUA 1W2KH 1FV9A 2KCOA 2FLBH 1GI2A 1HAVB 1P2NA 4WH8A 2ZPRA 1S83A 4X1RU 1OSSA 2VH0A 1IQLA 2H6MA 4KGAA 1Z6EA 1VKYA 3CP7A 3UAIC 5C67A 4AFZA 4D8NA 2AFQB 4TWWA 1EFRD 1HJ9A 3M3VA 4ACBA 4Y6DA 4Z6AH 4ESTE 5A8XA 1IQKA 3HGNA 1DS2E 1GJ4H 3GY2A 2BZ6H 2H5CA 1O2GH 3Q76A 1XM1A 1HNEE 1TOMH 1NS3A 2YMSD 3LJJA 1DLEA 3KQEA 1PQ7A 1D4PB 3EA7A 4Y8YA 4INKA 1ZOMA 1GI0A 1MKXH 1NROH 3H09A 1AGJA 2BY7X 3SJ8A 2OQUA 1EOJA 1ACBE 1NN6A 1V2WT 1QL7A 3D23A 4Y76A 2QXGA 3H7TA 1C1UH 2BOHB 1DITH 4TSFD 1WQSA 3BF6H 3ATIA 1O35A 2G5VA 3BTDE 5GCHG 2FI3E 2G81E 5EQRA 3ZVFA 1FY5A 2FOAA 2R3UA 2SGPE 5KECA 2ZQ1A 3PO1C 2ZFFH 1OWEA 4GVUA 2FI5E 2FODA 3P95A 1WBGB 1TPAE 1PFXC 3W95A 1FXYA 3SNCA 1B0FA 8ESTE 1KXFA 1GHBF 2BHGA 2K8IA 1QHRB 1IQGA 2A7HA 1BTZA 1AWHB 3P8FA 1SVPA 1K28D 3LGWA 1P2OA 1GBFA 3EE0B 4OS7A 2ZP0H 1W0ZU 2R0LA 2DE8A 3MO9A 2BDGA 1F5LA 1XUFA 3SUFA 1WQVH 1TBRH 3LU9B 1AFEH 3DHKH 3Q3KA 1OWKA 2QY0B 5A0BA 4GSOA 2PKSC 1YCPK 3AW1A 5BPEA 1IHSH 5FBIA 1C5UA 4K69A 3AK5A 2B5TB 5L2YH 2H9EH 1A0JA 1OHHD 2J98B 3VG8A 2BD2A 3OX7U 3Q77A 3LH1A 4UE7H 1C5MD 2ZTZA 3E90B 3PLBA 4I8LA 2D8WA 3NPSA 2Z3CA 1P0SH 3OE7D 2FOEA 1RFNA 3QZRA 1HB0B 1RTKA 2BLVA 1YLDA 3FFGA 1J14A 4OM9A 3UREA 2AGGX 1HXEH 3MH6A 5DP6A 5HIZA 3ZYDA 2OUAA 2W7SA 4AB9A 1C4U2 2HNTF 4NA8A 4CRGA 1GI9B 1SGPE 3ATMA 1L1JA 5LH8A 4J1YA 4HGCA 1UTMA 1UCYE 3C27B 1DSUA 1TGNA 1W7GH 1XUJA 3ESTA 1BRCE 3DUXH 4CH2B 2FI4E 1T32A 1F5KU 1UTKA 2QF4A 4Y0ZE 5E0GA 3F9EA 4HG6A 1JIRA 2PTCE 3HGPA 1GHAG 4P02A 1KTTB 1KXAA 4DT4A 1LPKB 3U1JB 2ZG0H 4X6PA 1SKYE 2J95A 3UNRA 3C1KA 1LHDH 1V6DA 1FY4A 2I6SA 1SG8B 3TITA 3D62A 2Y7XA 5ESTE 4Z1MD 2J5UA 2YMSB 2CF9H 2GCHG 2GD4B 3SW2B 1C5PA 1Q3XA 1UTNA 2A4RA 3KYGA 3OU0A 2WZQA 4GHQA 5DKMA 2DE9A 3ZV9A 4WJG2 1AU8A 1TABE 2BZAA 1WSSH 3RC5A 1YYY1 2J94A 4CRDA 4CBNA 2ZDMA 3BIVH 3MNBA 1DWDH 1FNIA 2Z9KA 5EGMA 2UUYA 2F9VA 1PQ8A 1IQHA 2XBXA 1UK2A 2ZDVH 2TGDA 1HBTH 3T5FH 3F1SB 1GI5A 5F8ZA 1O2OA 4XE4A 2O8MA 4NWKA 2WPIS 3BTFE 1QL8A 1QRXA 2Y5GA 4AYYB 1W14U 4FU9A 1TMTH 4CH8B 1M9UA 3CS0A 2FPZA 1YLCA 3FOAA 2H1UA 4NFFA 1A3BH 1T8OA 3SJ9A 3UR9A 2KCPA 5DP5A 1K9OE 2YNBA 3F68H 2M5TA 3P6ZB 4Y79A 4FUGA 2JH5D 2BY8X 1JMOH 1WTHD 1O2KA 2C4FH 4YO9A 1DXWA 1HJAB 1P2MA 2PKAA 2ILNA 2A1DB 3TNSA 5CDFE 2A7CA 2GP9B 2IPHA 2Y80A 2BMGB 3PLPA 1JOUB 4MLFB 5JBCS 4DG4A 1SLUB 4Q7YA 2AGEX 1QR3E 4WVPE 1LVYA 2FS8A 4MTBA 1V2TT 4AFQA 2OC1A 2XNIA 2PHBA 4ABHA 1BHXB 2BQWB 1QY6A 3T25A 4ZHMU 3SUGA 1ELCA 4FU8A 1QFKH 3E0NB 1RIWB 1OWJA 1GBCA 2ZTXA 4FXGH 4E05H 2A45B 3ZVDA 1GMCF 3M5NA 4NWLA 1W10U 3TH4H 2VWMA 1ELDE 5IK2D 6GCHF 1AHTH 1C9PA 1TAWA 3VB5A 1O2WA 2BVXH 2THFB 1H8IH 4JK5A 4U01A 1MKXK 2STAE 2RCEA 1EJNA 4FU7A 4NGAH 4YLUA 4I8JA 3S7KB 2NU0E 1PPBH 1ZSLA 4AFUA 1V3XA 1Z7KA 1N6XA 1GCTC 3QTOH 1AKSB 3RXIA 3A7ZA 2P3UB 1BTXA 2Z3EA 1TBQH 5AFYH 3LIWA 1DVAH 3TGKE 1CHOG 1FIWA 2A0QB 2BY5X 2PWXA 2ZTYA 1GHVH 5E2OA 2FS9A 4XBCA 1BQYA 1LQDB 2ZKSA 3ZZ6A 1GJCB 1GDNA 3ZZ8A 3JZ2B 2VVUA 5FX6A 4MNXA 2BD9A 1G3BA 5L6NH 1O3CA 3SUEA 4XRNA 3GCTG 3BN9A 1TX8A 1EAWA 1SHHB 1SSXA 3K65B 1FY8E 3KQ5A 2AEIH 3QN7A 1MU6B 1Z71A 1WYKA 1SGRE 4Q2KA 4DT7B 3V13A 1A7SA 3B9FH 2ZHFH 4BTTB 1GMHG 2QF0A 1V2QT 3LOXA 3ATKA 3RMNH 3LGTA 3P17H 3KL6A 2H9HA 2P16A 2XC0A 4I8HA 4JZIA 4ZKRU 3UOPA 4CRAA 5HYOA 2O8WA 4Y11E 5EW2H 1L0ZA 2G4TA 1EAIA 1YPLH 3DCLA 1XKBC 1T8LA 3F3BA 1A3EH 2GMTB 2ZU2A 3HK3B 1UTLM 2BD7A 3SZNA 3RXMA 2FO9A 2KFWA 2BVSH 1K1JA 4ASUD 1TALA 2FX4A 2VIDA 3ZZ4A 1EZSC 1SGQE 2D2DA 1NRPH 5CHAB 1YY3A 1LKAA 1FAKH 3BTQE 2XCNA 2OXSA 3WWBA 2WV9A 4Q7XA 8LPRA 2WV4A 4Z0KA 1UK4A 3RMMH 1SLVB 5KEDA 1UHBB 3NKKA 5GNDA 1IOEA 1AD8H 1F0RA 3SBKA 1CU1A 2IPQX 5T6DA 1ZTLA 2UWOA 5HXFA 1ZMLA 2ESTE 2RA3A 1GL0E 1O2ZA 2ANYA 1VITG 1FQ3A 1TGTA 2WHXA 1ZHPA 1EUFA 2P59A 4IS5A 4TYDA 1HV7A 3SJKA 4A1VA 4ISIH 2BQ6B 1BBRE 4F55A 2FESH 4FUFA 1BRBE 1ZHRA 3BSQA 1FPCH 1UTQA 4ZKNU 1QQUA 2ODQA 1TA2A 1A46H 1UTJA 1BT7A 2QXJA 2JJ2D 5C1YA 1TE0A 1TRMA 5DK1A 1B5GH 4A1XA 1UCYK 2C3SA 4CHAB 3IG6B 2ZDAH 1TIOA 4ISHH 1O3DA 4X1PU 2ZWLH 4X2WA 1GJ6A 4TY7A 2R9PA 3U9AH 3AAUA 3RXCA 3PRDA 4B71A 1BBRH 1LVBA 3HATH 1D3DB 1QJ1B 1Y5BT 1V2ST 3A87A 1ID5H 1HUTH 2NU2E 1C5SA 1KXBA 1JRSA 5J4SA 2OC8A 3TGJE 1HAVA 3GY5A 2OD3B 3KQDA 3OEHD 3SNAA 4AG2A 4NG9H 1GHZA 2JH6D 1GBJA 1WUNH 2ZPSA 2IN2A 2AGIX 1O5EH 1Y8TA 1Y3WA 1O2SA 3A88A 1P11E 1W0JD 4TWYA 1V2NT 4X1NU 4WY3A 4K1SA 4YT6H 3M5MA 1V2RT 1Y3XA 2EA3A 3P70B 3ZZ9A 4UFGH 3NCLA 2BXUH 2VGCC 1NRQH 2A2XH 4JYVH 2A4QA 2GJGA 3MU0A 2H9TH 1ZLRA 3VGCB 1P3CA 1CGIE 1QJ6B 4CR5A 1SGIB 4UEHH 3WWFA 1FIZA 1S6HA 4JK6A 4BANB 3Q00A 1MU8B 2ZF0H 3U8TH 1GVZA 1GG6C 1Z1IA 4LK4A 3RXAA 1CT2E 2IJD1 1W13U 3OY5U 4FVDA 4DIHH 2ZU5A 3GDSA 4ZXYH 3KHVA 1ZSKA 4FVBA 1FMGA 5DP8A 4AORA 2ZGJA 1TQ0B 2CGAA 4X8VH 1PPHE 4D76A 1GBEA 2UUKB 2DUCA 1BTUA 4OGXA 3TIUA 2WPHS 3CENA 1W8BH 2I6QA 3VB6A 2GVFA 3S0NA 4E06H 1TQ7B 3TJVA 1VZQH 5DO4H 1NFUA 1EPTB 1UVTH 4AX9H 3F0PA 1O3PB 1C2GA 5BRRE 6ESTA 3GY7A 4JYUH 3GY3A 1C2IA 1XVMA 4AC9A 3ITIA 3SGAE 2R2MB 5FXLA 2XWBI 5B6OA 3SU6A 2D1JA 1BJUA 4DY7B 4THNH 4NFEA 3QO6A 3U69H 2FXRA 3RC4A 4D7FA 1C1OA 2J98A 3GY8A 5IYTA 3Q3YA 2Z9IA 3MU1A 4Q63A 4DJZB 1GGDB 1A0HB 2Y5FA 1GBKA 2VIWA 5TCCA 1YPGH 2F9OA 1C5WB 1O2TA 3MO3A 1FY1A 1ETTH 3RU4T 1K22H 1GJ5H 1SGDE 1O5BB 1ESTA 2FOMB 3BEFB 1H9HE 2XXLA 4NZQA 4BAKB 1C5QA 2P8OB 3M7QA 1FN6A 1K1IA 1Z8GA 1ANBA 3HK6B 1C2MA 3DT0H 1P10A 2GZ8A 2ZGXH 1H1BA 2ASUB 4UD9H 1N8OB 4YLQH 2W6JD 2LPRA 4H4FA 3SU5A 1Z8IB 1AO5A 1HDTH 1IAUA 3GYMA 1C5LH 4GCHG 3EQ0H 3OTJE 1P04A 4ABGA 3S9BA 1KMHB 1G9IE 8GCHG 1SGCA 3HPTB 5DP9A 1K1MA 1ZSJA 1MH0A 1U6QA 4Y71A 1O31A 2HLDD 3KCGH 4B1TA 3E6PH 1AUJA 4CRBA 1ZRKA 2G5NA 2ZGHA 5G4BA 1OP0A 2C8ZB 4NCYA 1WTGH 3UOUA 1P57B 1TNJA 3F6UH 1V2PT 2ZGCA 3BTME 3PM3A 6CHAB 1J9CH 2BYAX 1Y3YA 1SPJA 4FUJA 1HAGE 2GT7A 2SNWA 2P94A 1DICA 2GV6A 4A1TA 3EDXB 2LP6A 2ZI2H 1QRWA 2ZFPH 2V6NA 1XUIA 3DSPA 2H2ZA 1K2I1 1V2KT 1TPSA 1AB9B 2HGTH 3H7OA 3RXBA 1O5FH 1TLDA 1BBRK 1GVLA 3MNCA 1OS8A 2CHAB 1AI8H 1VJAU 4I31A
chains in the Genus database with same CATH topology
1DDJA 2AYWA 5JBAS 5A0AE 2QN5T 3SV8A 2RA0A 3UWIA 5F6MA 1P02A 1GWAA 2V0BA 2VIVA 1A5HA 3T62A 1MAXA 4Y0YE 1F92A 3GISB 1GBMA 1ORFA 2BTCE 2W3KA 3SQEE 2Y81A 5FBEA 1SFQB 1ZR0A 3G01A 4PROA 4ZHAA 2BX4A 4A6LA 4UFFH 5CE1A 1SGEE 4BTIB 1GHYH 2SGAA 1ELGA 1Z1JA 2XW9A 5F8TA 1KY9A 5E0HA 1SGYE 1C2EA 1B7XB 3TPIZ 3M61U 1IHTH 1EP6A 1DUAA 4X6NA 1XXDA 2WUBA 1AKSA 3RXRA 4QT8C 4Y8ZA 4ABDA 1O2MA 4JCNA 2ZFRH 2ZA5A 1PYTC 1C1PA 1GJAB 3TK9A 1EX3A 3UQVA 1P09A 1ARCA 2G8TA 1HAZB 1PYTD 1AFQB 5I25A 1LDTT 4H42U 1TNIA 3L33A 1V2MT 3SI4H 2FZZA 1YKTA 4ABBA 4B75A 2ZC9H 1T8MA 1F2SE 2SFAA 4UONA 3VFEA 1NRSH 1ESBA 5A2MH 1E36B 3BTHE 1AMHA 1AVWA 1DPOA 3FZDA 1FPHH 1QB9A 1ZHMA 4X8UH 5EXMA 4YOIA 1BTHH 3SQHE 1T4UH 1HJAC 1QB1A 1ETRH 2FX6A 1QB6A 1O34A 1QA7A 1GBTA 1OYTH 1QIXB 2VWOA 5ESBA 1UVPA 3RLWH 3O8RA 1XUGA 1E37B 3PROA 1BA8B 4DIIH 4K60A 1C1NA 1HLTH 3AW0A 1SMFE 3MYWA 4YTAA 5EPYA 1VGCB 1IQNA 3M5OA 4O97A 3KIDU 4AB8A 2PGBB 2R2WU 3T29A 2HPPH 1MKWH 5DPAA 1OWHA 7KMEH 3ODFA 2B0FA 1RGQA 3EA8A 3AVZA 2A5IA 2Z9GA 1NT1A 1ELEE 1KLIH 2VH6A 3IITA 3I29A 1G36A 3KNXA 4DGJA 2ODPA 2WYJA 1O5AB 1GI3A 1KDQB 3ODDA 5GWZA 2XWAA 3ATLA 1UCYH 4X2XA 1LHCH 1C1QA 4SGBE 2ZHWH 5DP7A 1L4ZA 1DANH 3TK5A 2BD5A 1ABIH 1VCPA 3O8CA 1QBOA 1MCVA 1BRUP 1LO6A 1OOKB 3F9HA 1FN8A 1ELFA 5EW1H 2QYIA 2TGAA 3M37A 2PGQB 2GGVB 1A61H 2NWNA 2F9BH 1O33A 2B8OH 1UVOA 3LJOA 4IC6A 2ZU4A 2IJOB 5EOKA 3SORA 1TA6A 1TNHA 1DWBH 1H4WA 6GCHG 1A1RA 3E3TA 1P12E 2SGDE 1GDQA 1PQ5A 2C8WB 4ZUHA 1EZQA 4DCDA 2ZZUH 3CS7A 1YPHC 3UR6A 3TK6A 1EAXA 1C5TA 3OSYA 5C1XA 1MUEB 1O30A 3RXTA 1HAOH 3P92A 1SQOA 1THSH 1HXFH 5SGAE 1GHAF 1TRNA 4IMZA 3SUDA 1V2VT 5CHAC 3RLYH 2XCFA 2FMJA 4OS2A 1C2HA 5FPYA 1O2LA 1TPOA 1ZJDA 2GCTB 3UUZA 3QGNB 2ZHQH 1BOQA 1VCQA 4OS1A 3LT3A 5LGOA 4XSKU 3TH3H 5TJXA 2SGEE 4ABIA 1PPCE 4JMYA 2YOLA 4I8GA 1LVOA 1SOTA 4IC5A 1THPB 4IGDA 3RXEA 3RXSA 4R0IA 3ZYEA 3QZQA 2KAIA 1QBVH 1UVUH 1TB6H 1Q2WA 3A8AA 2HOBA 1C1VH 1MQ5A 2F9PA 1O38A 1GBIA 4X6OA 3TJNA 4UFDH 3GY4A 2VB0A 4ABEA 1CE5A 4MPVA 3M35A 2QIQA 2F91A 1GI1A 1O3HA 3GDUA 4AG1A 2ZEBA 1S85A 4AYVB 4CHAC 5FHTA 2ZU3A 3TVJB 4K8YA 4XFQA 5EG4A 4B74A 2QA9E 1SFIA 1C4V2 1J16A 5JBBS 1SHYA 1W3CA 1BMAA 4K5ZA 4B2CA 1DWCH 1MMJN 3L6PA 2FM2A 1HAXB 1O3GA 3RU4E 1K1NA 1TRYA 3LPRA 1GJBB 1KLTA 4RSPA 2BDHA 2ZDNA 2NU4E 1YPJH 5EQSA 1QRZA 1V2LT 2VJ1A 3A89A 2AIPA 1AZ8A 5LPEA 3V7TA 1DSTA 3LH3A 1O3EA 3PTBA 1MTNB 2C90B 3V12A 3PTNA 3UWJH 4JZEH 3DFLA 3T2NA 2GT8A 2BVRH 2BY6X 2ZFTA 2HVXA 4JZFH 3V3MA 1RS0A 2WYGA 4K3JA 1IQEA 1H9LB 1JWTA 3MWIU 1P8VC 2ZPQA 3VGCC 1P3EA 1GJ9B 4XBBA 5DP4A 2A7JA 2BM2A 1G32B 2FEQH 4NZLA 4FUDA 2PSXA 3FP7E 3ZZBA 1BZXE 2SNVA 1MBMA 2C8YB 4BNRA 2W5EA 1CHOF 3MFJA 1S0RA 4U2WA 5EQQA 5JPMH 2V3OH 1C5RA 3SU2A 3U8OH 3R3GB 7LPRA 3GCOA 1VCWA 1CVWH 2NU1E 1MKWK 3ZZ7A 1OPHB 3VB3A 3A8CA 3GCTF 3K9XB 4Y7BA 1GBBA 2ZHEH 1AWFH 1NC6A 1HYLA 2OTVA 2LNCA 4X1QU 3PMBB 1W0YH 1L2EA 1DE7H 5C3NA 4MPWA 2J9NA 5EODA 1Z8RA 1EZXC 5GDSH 1J15A 3UPEA 2PR3A 2XC4A 3MH4A 1N1LA 2B9LA 1GMHF 2NU3E 4MPXA 1KLJH 1YF4A 2R3YA 2WUCA 5JB9S 4ABAA 3KEEA 4CRCA 1TNLA 4B2BA 2EC9H 1NU9A 1S81A 1WOFA 1EB2A 1GCTB 2TGTA 3FANA 2QC2A 1ZGVA 1GJ7B 4H6SB 2CJIA 4I7YH 1D9IA 3D65E 7GCHG 1N6YA 1L4DA 2OP9A 4K1EA 3KQCA 3U8RH 2ZNKH 3KF2A 2QGRA 1LQEA 1OX1A 1UO6A 2O9QA 5E8EH 1DY9A 1G3EA 1HCGA 3E91A 1C2JA 4JZ1A 1NO9H 2Z6BD 1AQ7A 1MTSA 3RXDA 4AFSA 2XYAA 4FUEA 1PQAA 3A7WA 1O2YA 1O2UA 1OYQA 2PKAB 4O3TA 2GZ9A 2J92A 2ZU1A 2XBWA 1AY6H 1EZUC 2Q6DA 2HWLB 3S9AA 8KME2 1O2HA 2ZGBH 1ZRBA 4ISLA 5FCRA 1EOLA 1N8OC 1ZZZA 4XBDA 1D3PB 5F8XA 1GHWH 1GJ8B 4NIWA 3LGIA 3TLOA 1FLEE 3SU0A 1RD3B 1LMWB 3E8LA 3BV9B 1TPPA 2BD3A 4F4OC 2AERH 1C2LA 4X2YA 1IQJA 3GY6A 3QLPH 1MZAA 3EYDA 2OCVB 4B2AA 3TGIE 2SGFE 1S0QA 1LPGB 1O36A 4O9VA 2WPLS 4GLYA 4M7GA 1O2QA 5IDKA 3URCA 3A80A 5EU8A 1GMDF 3A83A 1JBUH 4AOQA 4X6MA 4CBOA 1C5XB 1OKXA 2FTLE 2O8TA 4OS4A 1CA0B 2Q1JA 1Y5AT 2FOHA 3GCHC 3PWCA 1KSNA 2CMYA 1E35B 1GBDA 1TMUH 4FUIA 5L30H 1AUTC 1G3DA 3URDA 5LPRA 4NIXA 1W7XH 1MQ6A 3UTUH 1AB9C 1GJDB 4CR9A 1T31A 3FVFB 4BTUB 4E7RG 1LHGH 1WV7H 1C1TA 2CHAC 2JKHA 1FDPA 5EXLA 2QF3A 3HKJB 3A84A 2JH0D 3MH7A 1RTFB 1LKBA 4NIVA 3UNSA 1NZQH 2AMDA 3QDZB 2Q6GA 2HRVA 1EAUA 1D6RA 3GOVB 1YCPM 3PMJA 3SU1A 2VIOA 3BTWE 4MG3A 3SJOA 1LCYA 5JB8S 4X1SU 1O2PA 2BDAA 1PPZA 1UK3A 1HGTH 1QL9A 2FWWA 2JETB 1KXCA 1C5NH 1ZTJA 4MQAA 2STBE 5DJ7A 1P06A 4O03A 1ZGIA 4D9RA 4ZMAH 4WMDA 4MNWA 1LPZB 3MOCA 2QXHA 2UUFB 3RXHA 3ZVBA 5HGGA 1GDUA 3NK8A 3S7HB 3VPKA 1FY3A 3O8DA 1C5ZB 3T26A 5J4QA 1KDQA 1O3KA 1NY22 1MD7A 3TH2H 1QQ4A 1K1PA 4K8BA 1OP8A 1QA0A 2J4IA 1AFQC 1Q31A 2PUQH 1O2IA 2ANMH 1EJMA 1IQFA 4JYTA 3SGBE 1UTPA 1K21H 1O5DH 1SL3A 3RM2H 2VIQA 2EI8A 1FJSA 2G00A 2CXVA 2QCYA 1ZMNA 3P8OA 1GBHA 4BAHB 3A7XA 1SQTA 2BB4A 1G2LA 3F9FA 1ELAA 1F0SA 2Y7ZA 1F0UA 1RTLA 1LVMA 1O32A 4AN7A 3RXVA 1YPKH 2G52A 1C5VA 1P2QA 3SOSA 1RXPA 1KIGH 1ANCA 1YPMH 1TNKA 4MDSA 1GHBG 3GYLB 1PPEE 4IBLH 5A8YA 1SI5H 3BG4B 4GCHF 1VGCC 4O3UA 2Z94A 3BEIB 1G3CA 1EKBB 2QAAA 4YZUA 2ODYB 3K6ZA 2W3IA 3RXLA 4ZROA 1O39A 8GCHF 1CBWB 3QK1A 2OC0A 4ABJA 3SV6A 1MTUA 1P2IA 3ZVAA 1TGBA 4K1TA 1C5YB 1NESE 1F7ZA 2UWLA 3SGQE 3Q3XA 3N7OA 5K0HA 2TRMA 1BTWA 2AMQA 2F9UA 5EXNA 4GAWA 3RXPA 1DT2A 1ELVA 1W11U 2BX3A 1CHGA 4ISOA 4TPYA 1L1NA 1OP2A 1C1SA 2V35A 1PPGE 3PYHA 2XBYA 3LKWA 3BTTE 5ABWA 1VITH 1HAIH 5A8ZA 1NFYA 3E0PB 1O0DH 4H6TA 4BAMB 2VNTA 2A2QH 1J8AA 1EJAA 3WY8A 4FUBA 1J17T 4ZXXH 1GI6A 2TIOA 2ZHDA 4B76A 2FLRH 1IQIA 1DLKB 2BLWA 5C2ZA 1P9UA 2XRCA 3AAVA 3R0FA 1P2JA 5L2ZH 3ELAH 2TGPZ 1YC0A 2O8LA 4HZHA 2FYQA 4A7IB 3FP8E 4VGCB 4GUXA 3S9CA 2IOTA 4BXWA 1YPEH 1RJXB 2FOFA 3RC6A 2ALPA 2B7DH 5TCAA 5AVDA 1OXGA 2ZIQH 4BAQB 3ZZ5A 3VXFH 3NUMA 1EP5A 3GICB 1O3NA 3LONA 1K1LA 1O3BA 1DM4B 3FP6E 1O3MA 3P8NA 1NM6A 1YP9A 4LXBH 2HPQH 3MI4A 1SR5C 1CT4E 3IWMA 1C2FA 2ALVA 5H4IB 3LGYA 1Y5UT 2GCTC 4OGYA 5FAHA 2WPJS 2ZO3H 4OS6A 1TONA 1B0EA 1TWXB 2GDDA 2ZDKA 3QGJA 1RIWC 4KKDA 3UFAA 3RXKA 5GCHF 4DOQA 3ZZAA 4HFPB 3ZV8A 2BQ7B 1HIAB 4NIYA 3TJOA 4DW2U 3LGVA 2FTMA 3SN8A 4Y8XA 4CREA 3F9GA 1BDAA 1UHBA 3RMLH 4R8TB 5DP3A 1GBLA 2PUXB 1BITA 1V2UT 2Z7FE 2ULLA 1Y59T 4X8SH 1AN1E 1DOJA 4E7NA 1GL1A 1ZPBA 2OBOA 3RP2A 3NZIA 2VVVA 3OY6U 2FP7B 1Z8JB 4B73A 3ZVEA 3I77A 1NFXA 4TPIZ 1XUKA 9ESTA 1BIOA 3QX5H 5HM2A 3A7VA 2ZCLP 1TGSZ 3ZZ3A 3LGUA 2PV9B 2BDCA 1V2OT 3A8DA 1INCA 1HAYB 3SV7A 2BDBA 3K2UA 1O3IA 3BTEE 1AIXH 4LOYH 3PLKA 3K6YA 2VWLA 1GI8B 3NWUA 1GMCG 4MVNA 2AIQA 4KTUA 1O2NA 2VWNA 3PO1B 4BXSA 4MPUA 1MTVA 1P05A 3RU4D 1C2KA 4SGAE 1DXPA 1MTNC 3SI3H 3P8GA 1YGCH 2AH4X 2GMTC 3RXOA 1QBNA 1DUEA 1HFDA 2GKVE 1T4VH 1FUJA 4WXIA 1CGHA 1E38B 2ZCHP 1BCUH 2P95A 2OC7A 2PKSB 3BTGE 4LZ1H 1QTFA 1FI8A 1O37A 4YOGA 3RXFA 1C4Y2 2HALA 3SU3A 1G2MA 1OWDA 1TGCA 3SHAH 1EXFA 5HMAA 3SU4A 1ELBA 1AVXA 4DURA 2XTTB 1C1MA 4ZAEA 2GCHF 1TBZH 5T6GA 1HJ8A 1QCPA 4KTCA 2FOBA 1BUIA 4Q80A 1SGNE 1GI7B 1UMAH 3HKIB 2OLGA 1P03A 2YNAA 1ZTKA 3U98H 2J34A 4IN1A 2G51A 1F5RA 2PLXA 3L3TA 2UWPA 3UQOA 3UNQA 1MZDA 3W94A 3PWBA 1GBAA 2HNTC 2GDEH 5CMXH 4TY6A 1O3OA 1QURH 3DD2H 2G4UA 2BLOA 5GIBA 4AZ2B 2K1QA 1XKAC 1HRTH 1WCZA 2FOGA 2FYRA 4FUCA 4XDEA 1TX6A 1FAXA 1MBQA 3QWCH 3EAJA 1G30B 1AVGH 4WF8A 1CGJE 1GHXH 3MU5A 1SOZA 1G37A 2BY9X 1XMNB 4YT7H 2ZDLA 1D6WA 2BD4A 1Y3VA 3JZ1B 4ISNA 4KELA 1SBWA 1F0TA 1O3JA 2PTNA 2P93A 1EPTA 3RM0H 1P01A 5AF9H 3MNXA 1KXEA 3A82A 3PB1E 4LZ4B 4GHTA 1ZMJA 4UDWH 4X8TH 5C5OA 1S84A 2F3CE 2XBVA 1YPHE 1IQMA 1T7CA 2PSYA 1XVOA 1ZPCA 5ETXA 5JDUB 2Y5HA 1A0LA 1D3QB 1JRTA 1Y3UA 5AFZH 3T28A 3MNSA 3RXQA 4I32A 1CA8B 3B8JA 1O3FA 4FUHA 2FOCA 4K2YA 3KN2A 4INLA 4NA7A 4BAOB 1LTOA 2Y82A 1OWIA 1ELTA 2OQ5A 4GPGA 1O3AA 5GPIB 4CRFA 5FCKA 4HTCH 2A32A 3A7TA 4ABFA 2F83A 3AASA 1SQAA 2FIRH 4WWYA 3A85A 1UJ1A 2ZCKP 1E0FD 1S6FA 2A4GA 5AHGH 2V3HH 2UUJB 1HAPH 1L1GA 1YBWA 3UIRA 1DWEH 1RRKA 2PFEA 1A4WH 1QJ7B 1KXDA 1A2CH 1FONA 2EEKA 2W26A 2WINI 5A09A 2HNTE 1LHFH 1O5CB 1DFPA 2J2UA 3BTKE 2CF8H 1TFXA 3SNDA 1BTYA 1UTOA 1KYNA 4U32A 3SNEA 2CN0H 3RXUA 3A7YA 4I8KA 3ZVGA 5T6FA 5GXPA 4Y7AA 4ZKOU 2A4OA 1THRH 2C93B 4RKOB 3VB7A 5DGJA<