1PYTD

Ternary complex of procarboxypeptidase a, proproteinase e, and chymotrypsinogen c
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
251
structure length
251
Chain Sequence
CGAPIFQPNLSARVVGGEDAIPHSWPWQISLQYLRDNTWRHTCGGTLITPNHVLTAAHCISNTLTYRVALGKNNLEVEDEAGSLYVGVDTIFVHEKWNSFLVRNDIALIKLAETVELGDTIQVACLPSEGSLLPQDYPCFVTGWGRLYTNGPIAAELQQGLQPVVDYATCSQRDWWGTTVKETMVCAGGDGVISACNGDSGGPLNCQADGQWDVRGIVSFGSGLSCNTFKKPTVFTRVSAYIDWINQKLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROCARBOXYPEPTIDASE A
publication title The three-dimensional structure of the native ternary complex of bovine pancreatic procarboxypeptidase A with proproteinase E and chymotrypsinogen C.
pubmed rcsb
molecule tags Ternary complex (zymogen)
total genus 46
structure length 251
sequence length 251
ec nomenclature ec 3.4.21.2: Chymotrypsin C.
pdb deposition date 1995-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytD02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pytD01
1EZSC 3NUMA 1WV7H 4WVPE 3P8GA 3W94A 1Z7KA 3H7OA 1K1LA 4RN6A 1GBFA 3VPKA 1DM4B 1O5GH 3JZ1B 1HIAA 2XBVA 2YNBA 3NPSA 1Q2WA 1ZPZA 3D23A 4XOJA 5GCHF 2ZG0H 1BRBE 3IWMA 3ATMA 3S7HB 1TBRH 1ANEA 1BRCE 1A2CH 2BVSH 3A85A 1LHEH 1ZOMA 2FOGA 1PPFE 3MMGA 4E06H 1BTPA 3BTWE 1P09A 2EI6A 1WTHD 2ODQA 5A8XA 4THNH 1UTMA 5K7RA 1PQ8A 1K1IA 1EUFA 3T25A 4CH2B 1QY6A 3KN2A 2FM2A 3GCHB 3U8OH 1RFNA 1C5QA 1C5WB 2FWWA 4X1PU 1WQVH 4ABAA 1GWAA 1O38A 1C9PA 1HB0B 3W95A 2PGQB 1P04A 3RC4A 3SU3A 5C1UA 4NIXA 4JYVH 3U1IB 4GPGA 1ZMJA 2BB4A 2BMGB 1DFPA 1PQ5A 1C4Y2 3RC5A 1HUTH 2VU8E 1GJ6A 1FNIA 3A84A 1O5FH 1O2VA 3SUEA 1GJ7B 4YLUA 2ZDVH 1O36A 1O3OA 2GT7A 3ATWA 1JXPA 1O31A 2OQUA 2ZCLP 1TX6A 3SU6A 1HJ9A 2R0KA 1GVKB 4R8TB 1J15A 1AWFH 3PM3A 4ABHA 4MDSA 1TRYA 1NESE 1O5BB 1O3DA 2GGVB 2H9TH 4ABFA 1FDPA 5JBTA 2VWLA 1W11U 2BDBA 1Z8JB 3UY9A 1YBWA 2OCVB 4DW2U 2HRVA 1W8BH 1F0TA 1C4U2 3M5LA 1ZRBA 2C8WB 3SZNA 3BF6H 1SHYA 2JH6D 1NRSH 4K1EA 1SVPA 2FI3E 2P3FH 2UWLA 1TONA 2WPHS 4UFFH 2BD3A 2RG3A 4CHAC 1MTWA 8GCHG 1GI8B 1GBAA 1UVTH 5L2ZH 5A0BA 4B71A 3BTQE 3A8DA 1NFXA 3UTUH 4JZEH 3KQBA 3SNAA 1NRQH 5AHGH 5L6NH 2UUJB 3U1JB 5HXFA 5LPEA 1TGNA 1KSNA 1N8OB 4Q80A 1ZGVA 1GBKA 4ABEA 3M7UA 1N6XA 1TPOA 1NTPA 1DANH 3ZVCA 1BRUP 1BHXF 2G4UA 1A1RA 1ZLRA 2HNTE 1NY22 2ZFPH 4XBBA 1N6YA 2C8YB 4FUCA 3VXFH 1E37B 2AH4X 5GPIB 1O35A 3BTTE 1Z1JA 5C5OA 5JBBS 1MKWH 2QV1A 1UK3A 2VWMA 2ZO3H 4R0IA 1QL7A 3SGQE 4GHTA 5T6GA 1G2LA 4TPYA 2R0LA 1P10A 1KXEA 3LGIA 1TGTA 3SJ8A 4DT7B 4AFZA 2P3UB 2F9UA 2QA9E 1DLKB 2FOBA 1YC0A 3A8CA 1K1NA 1SMFE 4YT6H 1UVUH 1P11E 5EQQA 1S84A 1V2WT 2V0BA 3RXVA 1O2MA 2A5AA 2W3IA 3RC6A 1RTFB 1TQ0B 1YLDA 3K6ZA 4NGAH 2WPMS 1BIOA 3UR6A 4CBOA 1BMMH 1DS2E 1HJ8A 4Q7YA 2THFB 2B0FA 3BIVH 1C1VH 2ZHDA 5GCHG 1ZZZA 1AUJA 1BCUH 1CA0C 1MMJN 5G4BA 1C1NA 1YPLH 3RXCA 3MI4A 1RIWC 1WBGB 1L4ZA 4A1TA 1ZSLA 2IJOB 4I8KA 3RXFA 4FU7A 3SHCH 1C2MA 2P93A 4X2YA 3BTFE 1FQ3A 3S0NA 2O8MA 1Y8TA 2HALA 2ZZUH 1PFXC 3TGJE 3GISB 2F9NA 1BBRE 1UTOA 1IQGA 4BAHB 3GCOA 1YPHE 3LH3A 1O2UA 3ZZ6A 1U6QA 1PPHE 1SGFA 1AZZA 1N1LA 3ZVAA 2TGPZ 2QC2A 1MZDA 4CH8B 2BD2A 1QL9A 1K1OA 1ARCA 2V3OH 2Y7ZA 1TFXA 1OS8A 4A1XA 2ZFTA 3QGNB 3MWIU 2Z3CA 5T6FA 1C2EA 4DG4A 1C2IA 1FMGA 4DVAU 1MZAA 1ANCA 1DUAA 1TIOA 3SV6A 1TMTH 1KYNA 4GAWA 1RD3B 1HAGE 4UFDH 1FY8E 1MD7A 4J2YB 1FY1A 1GL0E 2QGRA 1L0ZA 3SNEA 1BB0B 1Z8RA 2LPRA 3RMOH 3RMLH 3TNTA 1FIWA 1K1PA 3CENA 1IAUA 1GI6A 3TLOA 2XYAA 1C1MA 3P6ZB 1A0HB 1DT2A 1T31A 3BEUA 1VITF 1K1JA 4A1VA 1XXFA 2A4RA 2J92A 2WINI 4I32A 1NC6A 3STJA 2P3TB 2BZ6H 2LNCA 3O8BA 1ZTKA 3ZV9A 1GHWH 1H9LB 1V2VT 3MU1A 1C5PA 1JWTA 1UVPA 3TVJB 3QK1A 1TA2A 1VR1H 3RU4D 3AVZA 2H1UA 4HGCA 1BJVA 1A0JA 1BZXE 2Z9KA 5A0CA 1TB6H 3TJUA 4ESTE 1SC8U 4NA7A 1EOLA 2UUYA 2NU1E 2HPPH 4RKOB 2GP9B 1QTFA 3QO6A 2A1DB 1QRZA 3L3TA 1W7XH 2PTCE 1C5OH 1OYQA 1GHVH 1THSH 2ZDMA 4MLFB 1ETSH 1FZZA 1LVYA 1EP6A 1GG6B 2WPKS 2AERH 2G81E 3S9AA 1FPCH 1BUIA 1GMDG 1SGFG 1UVOA 1OWIA 2AGIX 2VIVA 1D3QB 1GCDA 2F91A 3A7WA 3ZZAA 3Q3XA 4MPXA 1GI3A 1C5RA 4TYDA 1BJUA 3M5NA 5JBCS 1OX1A 1KDQB 1HAOH 2ZDAH 4AB9A 3ZZ5A 1P2IA 4NZQA 3VGCC 2STBE 5F03A 4OS1A 3ATLA 2A31A 3ODFA 1ELVA 1BOQA 2BQ6B 1CE5A 1O5AB 5EXMA 3ZV8A 3R3GB 1EQ9A 3SGAE 5EOKA 3ZYEA 2FOHA 3U8TH 3PMBB 1ELCA 1NZQH 3SUGA 1XUKA 1TAWA 4CRGA 1C2KA 1M9UA 4OS2A 1TALA 2ESTE 5HM9A 2UUFB 3T2NA 1GJ9B 3EAJA 4GUXA 3QTOH 3PMJA 3QZRA 1UJ1A 1KLTA 1F5RA 4NSYA 4WMFA 3MNSA 3TU7H 3ZVBA 3URCA 2PSYA 4U30A 4JZDH 1EASA 1YPKH 5EG4A 1SHHB 4YOGA 1S6FA 2IOTA 3KIDU 4ABDA 1HXEH 1SGRE 3ZZDA 3BG4B 4WMDA 1LKAA 1CBWC 4X1QU 4I8LA 3P17H 2Q6FA 5E8EH 2XWBI 1WTGH 2XBWA 1C5UA 2ZHQH 4OGXA 3HATH 1HBTH 1BTYA 1BMLA 1HV7A 3T27A 1Y3VA 2Y6TA 2D1JA 5FHTA 3OY5U 3UNQA 3SUFA 1C5YB 3LPRA 4ZKNU 1C1PA 3RMNH 1FIZA 4U32A 1C5VA 3EA7A 1TNGA 1QB1A 1WAYB 1IQKA 1OWHA 1YCPM 2Z6BD 2ANYA 5FX6A 4B2BA 1MQ6A 4BXWA 5E2OA 3SGBE 1LQEA 2ZGXH 1CGHA 3VB4A 1G3BA 3MTYA 2K1QA 2VIPA 2H9EH 4BAMB 1UTNA 1Y59T 2BM2A 1O2RA 5HYOA 4TY7A 3MH5A 2G51A 1GI4A 2SGDE 4OS6A 5JYIA 3SOSA 2D2DA 2AMDA 1KXAA 1MU8B 3AAVA 5AF9H 3A89A 1TNLA 4IC5A 2NU2E 2TGDA 2WV5A 1MH0A 2W7SA 2VIOA 2XTTB 4K2YA 1O2WA 1IQHA 3F1SB 3M7TA 1QJ1B 4Y11E 1EAXA 2VB0A 3GCTF 2GDDA 1BTZA 1KLJH 2FYRA 3MU0A 3KQCA 3LIWA 3FZZA 1QBNA 2ZTYA 3MNBA 5C20A 3SW2B 3DHKH 2VVCA 3FANA 3SI3H 3RUOA 2DE8A 2PW8H 2CJIA 3A86A 1ABIH 1YM0A 3JZ2B 1QA7A 5SGAE 2AGGX 4INHA 1Y5UT 1GHAG 3ZVEA 2GX4A 3C27B 1KTTB 2ANKH 2ZF0H 1A5HA 1O5DH 1TPPA 5EU8A 1QHRB 1S0RA 1ZMLA 4TWWA 4MNXA 2CF8H 1NT1A 5CMXH 1ZSJA 3FAOA 1CVWH 1G37A 3LJOA 4TPIZ 1TGBA 1GDQA 3E16B 4KGAA 2G52A 1SGNE 1O3JA 2PKAB 3BSQA 5JDUB 1AB9B 3FZDA 2OC0A 2GCHG 2J94A 3TH3H 1H9IE 4NZLA 3UR9A 1CGIE 3E90B 1IQFA 3GCHC 1TRMA 8GCHF 1NRPH 2WV4A 1VZQH 2J4IA 1KLIH 3DA9B 1ZHRA 2ULLA 4DY7B 1BT7A 2XBYA 3SQHE 4NCYA 3P8FA 1TWXB 1TQ7B 2GZ9A 3EE0B 1NPMA 2FEQH 2BLVA 2GMTC 1J9CH 1V2OT 1SLWB 1CO7E 2FOMB 1IQEA 2ZNKH 3Q3KA 3RXUA 4BTIB 3ZZ4A 3RU4E 1EKBB 4MNYA 2A4QA 1GI7B 4ZHLU 1ZMNA 1GGDC 2VJ1A 3EA9A 4ISHH 1EB1H 1W12U 1XUJA 2P59A 4BANB 1P9UA 1IQLA 5FCRA 1HIAB 2GKVE 3OY6U 2VINA 2DE9A 1G3CA 1SI5H 2C8XB 5GIBA 1ZPBA 1L4DA 1G9IE 1MTSA 1UCYK 5AFZH 4OGYA 2BD8A 1F5LA 2FZZA 2ZIQH 1OP8A 1W7GH 1LVBA 3A88A 1SBWA 2TGAA 2FS9A 4AB8A 4ZKRU 3LDXH 3GICB 2F9OA 3F68H 1CT2E 1SB1H 1XUGA 3EYDA 1ELEE 3M7QA 1SQTA 3ZVGA 2VIWA 1V3XA 2AFQB 3NZIA 2ZQ1A 1OWDA 5EPNA 3A7YA 3RXEA 2FS8A 4CRBA 1GCTB 1CSOE 3EGKH 4BXSA 1CU1A 5AVDA 1SLXB 4FUFA 5A2MH 1THPB 2JH0D 3ATKA 1KXBA 1NO9H 1H4WA 1BA8B 1NFYA 1FI8A 3RM0H 1C1TA 1FN6A 3RXDA 1SR5C 2KAIA 2BXTH 1C1SA 3BTDE 3M3VA 1TA6A 1WYKA 4FUEA 1EOJA 3GYLB 1HAHH 4BAKB 1V6DA 1GHBG 1V2UT 4Y0YE 3S9BA 3SO3A 5I25A 4IN2A 4NIVA 4SGBE 2VVVA 3I29A 1GI0A 4X8TH 1AFEH 4Q7XA 1FXYA 1LVMA 1P2QA 4Y79A 1EX3A 1O2KA 2FPZA 2FX4A 1SGCA 2FDAA 3Q77A 1O2ZA 4FU9A 1LVOA 1O3PB 1HJAC 3Q76A 3LGTA 2BD4A 4AGKA 1DDJA 1O2TA 2ZFQH 3RXMA 2BDAA 1DWEH 2HGTH 1W14U 3UREA 4YZUA 1AI8H 2BD9A 1E0FD 3MU4A 4A5TS 1WQSA 2BDCA 4HTCH 1HLTH 3L33A 3MO9A 3GCTG 1DX5M 2BLWA 3PB1E 1A3EH 2A45B 2P8OB 4H42U 2R2MB 1O3CA 1P8VC 2NWNA 1QJ7B 4E05H 2GT8A 5C2ZA 1O3IA 5FBEA 1EZXC 3UOUA 1ZPCA 4B2AA 4JZFH 4X1NU 5IYTA 1AIXH 3T62A 1GI5A 1UHBA 1DY9A 1L2EA 4KTCA 1F0SA 1ELTA 1YGCH 1E36B 1VJAU 1D3PB 3KNXA 1GJAB 1PPBH 3PWBA 1D4PB 5FPTA 5JB8S 1XX9A 1H8IH 2F83A 4HFPB 3PO1B 3I78A 1NN6A 1TNKA 1BTWA 1FPHH 1PPCE 1JBUH 4YTAA 3GYMA 2RCEA 1MQ5A 1OYTH 1IHTH 2CGAA 1DUEA 3AASA 2ZTXA 4IGDA 4X6MA 2FXRA 3SU1A 3TH4H 3MFJA 4B1TA 1SPJA 1HDTH 3E0PB 1BTHH 3LKWA 3PWCA 2NU4E 5C5NA 5K0HA 3BN9A 2XC4A 2FO9A 5E2PA 1PPGE 1KTSB 1NRNH 4DCDA 2O8LA 2CHAB 4ABBA 4ISNA 2PWXA 1TMUH 1QB9A 3Q3YA 4A6LA 3OSYA 4IMZA 2BY9X 7GCHG 4GVUA 4HI3A 2XNIA 2Z3DA 2R2WU 3HGPA 4ABGA 1GMDF 3OX7U 1Y3XA 1BTXA 2BY8X 3QUMP 5EW1H 2ANWA 2HNTC 2M5TA 4Y8YA 2EI8A 1SQAA 4WY3A 4DURA 1AE8H 4ZMAH 5GWZA 4K1TA 1TYNA 1YCPK 4MNWA 2O8TA 5EQSA 1EB2A 3S7KB 4ZXYH 2FYQA 1AZ8A 1DWDH 1C5XB 3DFJA 1WOFA 1C1UH 6ESTA 1GJDB 2FLBH 2FX6A 2GCTB 1DICA 4DOQA 1C2HA 5EW2H 3RXIA 2B5TB 2GV7A 4YM9A 8LPRA 2ZWLH 1EXFA 1GBHA 2Y5HA 3P70B 1BHXB 2EEKA 2Y5FA 2XW9A 5DP9A 2B7DH 2NU3E 2W3KA 1P57B 1CT4E 2QXIA 3BEIB 1QJ6B 3LH1A 1P2JA 1DWBH 1DY8A 4X1SU 4X6OA 2GTBA 3SHAH 1P03A 4Q2KA 2ZGJA 2H5DA 1QCPA 1ANDA 3MO6A 4O9VA 3VEQB 3PLBA 3UFAA 3A87A 1LTOA 1ZJKA 2I6SA 5HM2A 2CF9H 4KTSA 3IITA 1VCPA 1H9HE 2FP7B 3GOVB 2PUXB 2J38A 2Z3EA 2OTVA 5A8ZA 1LHFH 5JBAS 1IQJA 2P94A 4LZ4B 4BAQB 3ENSB 3Q00A 1YPHC 1C1OA 1Z8GA 4LOYH 1AY6H 1GBCA 4O03A 4X2XA 1Z6EA 2D8WA 1SFIA 5LGOA 2BOKA 1C5SA 1A0LA 3KQEA 3PLKA 2AMQA 3B9FH 1GL1A 1HPGA 1O2JA 1WUNH 4NIYA 2YOLA 1XVMA 4A92A 2VIDA 1IOEA 2OLGA 1UCYH 3K2UA 4BNRA 2B9LA 4CRFA 1MAYA 1O3MA 3GDVA 1F0RA 5T6DA 6CHAB 2SGPE 2TGTA 1G2MA 5FBIA 1DVAH 4CHAB 1P12E 4YOJA 4VGCC 1ESBA 3GY6A 4JMYA 1B0FA 1S6HA 1BRAA 4OS4A 3O8CA 3ATIA 3M37A 1ESTA 2GZ8A 1VCWA 1YKTA 4K8YA 1O2XA 1OOKB 1SL3A 1IQNA 1P3EA 1W3CA 2GZ7A 4JYTA 3RU4T 1O3AA 4Z0KA 2XCNA 3RXPA 1ELDE 3LOXA 3LGYA 3NWUA 1P2NA 1A3BH 3ZZBA 2FESH 4CREA 3MH7A 1O3LA 1C5ZB 3K65B 3T5FH 4B73A 2PTNA 1HAXB 5ESBA 3A7XA 1AVXA 3SJIA 4CR5A 4NA8A 1D6RA 4MNVA 4KELA 1SGPE 4WMEA 3IG6B 1GHAF 3DD2H 4KP0A 4JK5A 1TBQH 2ZFRH 3PMAB 1HNEE 1KXCA 1D9IA 1MTVA 1AVGH 1ESAA 1MBMA 4DIHH 1NRRH 1K22H 1Z6JH 1AHTH 5FPSA 1QQUA 2D26C 3K9XB 4INLA 2GCHF 2PKSB 5AFYH 3M61U 2FLRH 1GJ5H 2B8OH 2WPJS 2J95A 4AFQA 4AN7A 1YF4A 5DPAA 4BOHA 3P8OA 4ZXXH 2SNVA 2Y81A 4GCHG 1GBTA 2YNAA 4UE7H 2HOBA 3ZYDA 1EAIA 1FUJA 1E38B 2PHBA 4FUHA 2Z9GA 3EDXB 1GBLA 3ELAH 4GHQA 4MPVA 1V2JT 3A7TA 3BTHE 3AW0A 1O3KA 1OPHB 1AU8A 2BX3A 3HKIB 4X6PA 1UTKA 1CA0B 1RIWB 4D7GA 1VITH 1QB6A 2C90B 1DLEA 1A46H 1B7XB 1UK4A 3DT0H 1QA0A 4H6SB 5DP5A 2C93B 4ZROA 3PV4A 1O3HA 5CHAC 4Y10E 2H9HA 3GDSA 3BV9B 4AFSA 1GBEA 1XM1A 2SFAA 2ZCKP 1J8AA 1IHSH 3MYWA 4UD9H 1UTLM 2H2ZA 1HAIH 3URDA 5JB9S 1O2IA 3NKKA 1K9OE 5C1XA 2QY0B 4OS7A 1QL8A 1XXDA 2BDGA 1UTPA 3BTGE 3A80A 3SORA 1J17T 2A0QB 2ILNA 2BQ7B 4Y71A 2HPQH 1GJ8B 1GHXH 4UDWH 4FUGA 5EGMA 1AB9C 2PGBB 3KGPA 4I8HA 1JRTA 2HVXA 3TIUA 1EPTB 1JRSA 1BMAA 1CGJE 2BVXH 2R3UA 3RXJA 4K60A 3LU9B 4NSVA 1FN8A 3MOCA 1F7ZA 1AUTC 4Y76A 2RDLA 1T8LA 2GD4B 3A8AA 1O2QA 1G30B 4ZHAA 2BY6X 1F2SE 3LGVA 4TWYA 2VIQA 5ETXA 3VB5A 3TJVA 3F9FA 3OTJE 4RSPA 5CE1A 4JCNA 2JETB 4Y0ZE 3LJJA 4OS5A 3P8NA 1O39A 3UWIA 4PROA 3QDZB 1S83A 3C1KA 4KTUA 1MTNB 3EQ0H 2VGCB 3PTBA 4AORA 4B74A 1RXPA 2F9PA 2OBOA 1LPKB 1GHBF 3UUZA 3SU4A 3SJ9A 3M36A 4H4FA 3LC5A 1GJ4H 4X6NA 3ZZ8A 4ZKOU 1AN1E 1T32A 3QX5H 4O3UA 4WF8A 1YCPH 2Y80A 2A5KA 1E34B 1YPEH 4FUIA 5EODA 3A83A 1SFQB 1ZR0A 4NWKA 5FCKA 1GVLA 1GJBB 4K3JA 4ASHA 1OP2A 1DITH 1JMOH 1AO5A 1NFWA 4MPUA 2H5CA 1K21H 4ISOA 1MKXK 1MTUA 3RXRA 2ZKSA 1VGCB 1LCYA 1O2LA 1O3NA 3GY2A 4ZKSU 5A8YA 1FONA 2Q6GA 2OC8A 4Y7BA 1EAWA 2F3CE 1B5GH 1V2RT 1UMAH 1O2SA 1P2KA 3BTEE 1DXPA 1AWHB 2WYJA 3M35A 1RJXB 5ESTE 3ZZ7A 1C9TA 2SGAA 1D3DB 1CT0E 2AYWA 2QIQA 3B23B 3BTME 5DP7A 2A7JA 2OP9A 2G5NA 2OBQA 1HFDA 1MUEB 4X8VH 1L1JA 1A7SA 1P2OA 2G4TA 3VB7A 1L1GA 4X0WU 4DIIH 1GMHG 2V3HH 2QF3A 1F92A 3BTKE 3B8JA 1RGQA 2QXGA 1TBZH 4IC6A 4ISLA 1C5LH 4XE4A 1G3EA 1BITA 4MPWA 4UFGH 1PYTD 2ALVA 1OWKA 2HWLB 3MH6A 1ABJH 4D8NA 5JPMH 3AAUA 4AGJA 4E7NA 4X8SH 2PR3A 1NFUA 1TNHA 2FTMA 5J4SA 1C2DA 3A82A 3TITA 3DUXH 2XC5A 4UEHH 7GCHF 3E6PH 2P8OC 3VXEH 7ESTE 1C4V2 1QFKH 2QXJA 2ZTZA 1CBWB 1YP9A 1WSSH 1K1MA 1O33A 1O37A 2O9QA 2VH0A 1EJAA 2ZU2A 3U69H 1ZTJA 2A4GA 4YESB 4Y8XA 3RMMH 1O0DH 2OUAA 2KAIB 1EZUC 1GBMA 1S85A 3MNXA 3RXLA 1XUIA 1V2LT 1AKSA 2VH6A 2O8UA 2ZHWH 1H8DH 5DK1A 1G3DA 1T4UH 3E0NB 2FTLE 1WCZA 5C67A 1YPGH 2ZGHA 2FOEA 1V2KT 3P95A 1PPEE 2BZAA 5BPEA 1J16A 2H6MA 2PKAA 3QGJA 1KIGH 1AQ7A 8KME2 2FIRH 5F6MA 1O34A 3S69A 1QBOA 2W26A 1HAVA 4F4OC 4XFQA 3N7OA 4MTBA 1RS0A 1JOUB 4K5ZA 4Z6AH 3LGUA 3SV7A 1GHYH 1XVOA 3L6PA 1N8OC 3SV2H 4CR9A 1TOMH 1LO6A 4DJZB 1JIMA 1LPGB 3UNRA 2AIPA 4X2WA 1GMCF 4O3TA 3MNCA 2XCFA 3T26A 2AS9A 5F8XA 1O5CB 3E91A 3FFGA 2HLCA 4ZUHA 1FV9A 3RXGA 5DO4H 1GBDA 1UHBB 3UQVA 1D6WA 1KY9A 1SGIB 1XKBC 2W7UA 2O8WA 2OQ5A 1ANBA 3MU8A 1QIXB 3KCGH 3RDZA 2G55A 4WH8A 1RTKA 1UVSH 1XUFA 2BDIA 2BHGA 2SGFE 2OINA 2XXLA 1GBIA 3V7TA 3D49H 3S9CA 1GHZA 3MHWU 1P05A 3SBKA 2ZU4A 2GDEH 2WUCA 2GCTC 4AZ2B 2QAAA 2FI5E 3A8BA 1TNJA 4AX9H 5F8TA 3E3TA 2UWPA 5FX5A 3ZVDA 1UTJA 4AG2A 3STIA 1XKAC 3H5CB 4LK4A 2SGQE 1GI9B 1O32A 4YO9A 3TK5A 3RXKA 1AFQB 5C3NA 1ETTH 2V35A 2WPIS 2VWOA 2A32A 2VWNA 2ZU1A 4A7IB 1L1NA 1HRTH 6LPRA 1ARBA 4I33A 3K6YA 3QN7A 2G00A 3O8DA 2SNWA 4CRDA 1J14A 2Z94A 1O3FA 1SOZA 1LHDH 2GMTB 1O2HA 1ELFA 3RP2A 1Q3XA 1OKXA 1UCYE 4M7GA 1SGDE 4Y8ZA 1THRH 6GCHG 1SQOA 1GGDB 2G5VA 1AMHA 1ID5H 1G32B 1MCTA 3BEFB 1T7CA 1YPMH 3RXHA 1O2GH 2ASUB 4FUBA 1P06A 3V3MA 2BD7A 3RXQA 3ZZ3A 1OXGA 1ELBA 1XMNB 4FUDA 3CS0A 1ORFA 4BTUB 1UTQA 2BX4A 2ZDNA 3PROA 1QR3E 2BOHB 3HK6B 1C2FA 4RKJB 1MD8A 2FOCA 1BBRK 1H1BA 1P02A 1TNIA 1QQ4A 1T4VH 1OP0A 2W5EA 3SJKA 2JKHA 1WU1A 2FI4E 2ZDKA 2V6NA 1MBQA 4UFEH 4CRAA 1NU9A 2QCYA 1Z8IB 6CHAC 1EAUA 3OYPA 4LZ1H 3PMHB 2Z9LA 1HAZB 4GSOA 2ZHEH 2C4FH 3SN8A 4YT7H 4GCHF 3MH4A 1P2MA 2A4OA 4K1SA 1T8MA 1QNJA 3E8LA 1O2OA 1P01A 1MKXH 1TX8A 2R3YA 3RXBA 3SNDA 4NFEA 4B75A 1ZHPA 3RXOA 2ZI2H 4ABJA 1TRNA 1PYTC 4D9QA 5DKMA 4ZAEA 2BLOA 4D9RA 3ZZCA 1S0QA 3PLPA 2VNTA 1SLVB 5LPRA 2F9VA 1LKBA 2ODYB 4JK6A 3DFLA 1FLEE 1V2NT 3I77A 1V2TT 4I31A 4XDEA 3LGWA 2XC0A 3V12A 1PJPA 1GI1A 3GY3A 3OU0A 1MAXA 4FVBA 1C5MD 1HJAB 4JZIA 1F5KU 5LH8A 3SV9A 1FAKH 1CHOG 1A5GH 3F6UH 8ESTE 2PKSC 4AYVB 4K8BA 2WUBA 1O2NA 2PSXA 1GG6C 1W0YH 4Q7ZA 5FXLA 2FMJA 2STAE 1GMCG 4Y6DA 1EZQA 2A5IA 5C1YA 1O5EH 3GDUA 4O97A 1EP5A 1FY5A 4JYUH 1Y3WA 2ZPRA 4UONA 4KKDA 1BQYA 2C8ZB 4B2CA 2BD5A 2TBSA 2EC9H 1PQAA 1HYLA 3MO3A 1GDUA 2ZGCA 1P0SH 1C2LA 4QT8C 1W10U 4AG1A 3F9HA 1TOCB 3TH2H 3TNSA 4AFUA 5ABWA 4IBLH 1P3CA 3SNBA 2CN0H 1EJMA 2JH5D 3ITIA 3QZQA 4WXVA 4INKA 2A7HA 1TPSA 1EJNA 3P92A 3QTVH 1V2MT 1NU7B 2QYIA 1MCVA 3GY5A 1TMBH 3QWCH 2TPIZ 4I8JA 3FP8E 1AE5A 1C5TA 1LQDB 1E35B 1V2PT 3TPIZ 2GV6A 1ZRKA 3M3TA 3MU5A 3M5MA 3U9AH 2ZFFH 2BLQA 4D76A 2HNTF 4WXIA 4ISIH 2I6QA 2BXUH 2J34A 1EPTC 1Z71A 1C5NH 3ODDA 1QRXA 5PTPA 1IQIA 3BG4C 2VVUA 1TPAE 1AD8H 4CBNA 3CS7A 1MU6B 1LMWB 1KXFA 1P9SA 1RTLA 2BDYA 2R9PA 2JETC 1YPJH 2XBXA 2ZDLA 4HZHA 2ZC9H 1DPOA 5GXPA 2G8TA 1INCA 1HXFH 1LPZB 5DP3A 2A7CA 3UQOA 3GCNA 1MTNC 3UNSA 2VGCC 1T8NA 1GPZA 3BG8A 1OWJA 2FOAA 1SG8B 3SQEE 2IPHA 3LT3A 1G36A 2ZFSA 5E0GA 3QLPH 1QURH 1QRWA 5DJ7A 3A81A 2BY5X 3ESTA 4MVNA 2ZPQA 4IN1A 4X1RU 1DE7H 3HKJB 1C1QA 1GMHF 4AOQA 1SSXA 3FVFB 1ETRH 2ZPSA 2GVFA 1GI2A 3LC3A 4B76A 5LPFA 1C1RA 1IQMA 1ZJDA 3ZZ9A 1ZGIA 3CP7A 3GY7A 9LPRA 1T8OA 3PTNA 1PPZA 4NA9H 5L30H 1A4WH 2OC7A 2OC1A 1BDAA 1LHGH 4XBDA 2QF0A 5EQRA 3SUDA 3VB3A 1VGCC 3FP6E 1NM6A 3GY4A 4D7FA 1HCGA 2UUKB 1HAYB 1DWCH 5T3HA 1AGJA 1Y5BT 2RA0A 3GY8A 4I8GA 4CRCA 2ZU5A 4FVDA 4NG9H 2Y82A 3RM2H 1ZSKA 2CV3A 1KXDA 4YOIA 3PYHA 1QBVH 1F0UA 3BIUH 3V0XA 3NK8A 5TCCA 1S82A 1AVWA 2TRMA 2XRCA 4FXGH 3WY8A 5E0HA 4LXBH 4MQAA 3RLYH 5FPYA 1Y3YA 1NROH 1GBJA 1SLUB 5HMAA 2Z7FE 4ZHMU 4Y7AA 5A0AE 2BVRH 3KQDA 3SNCA 5A09A 1V2ST 3RXSA 3SU0A 1UO6A 3TGIE 4X8UH 3KEEA 4X2VA 5BRRE 1Y5AT 2ZGBH 4SGAE 2RA3A 4WJG2 3HGNA 5B6OA 1B0EA 2BY7X 1BBRH 2CXVA 5EPYA 4IW4E 1TE0A 2AGEX 4VGCB 2A2XH 1TX7A 1PQ7A 4JZ1A 4WH6A 1DSTA 1KDQA 1VJ9U 1ZYOA 2ZQ2A 3TK9A 1RRKA 1O3EA 2Z9IA 5TCAA 1DOJA 1K28D 1ACBE 3AW1A 4U01A 3VB6A 1SOTA 5DP6A 1ELGA 2J2UA 2PFEA 1BTUA 1XUHA 1FY3A 3A7VA 3H7TA 3T29A 3NCLA 3O8RA 2WPLS 4FUJA 2SGEE 2BDHA 3UWJH 2PV9B 3A7ZA 1CQQA 4U2WA 1Y3UA 4IS5A 2Q1JA 1BMNH 1SGYE 1JIRA 4XBCA 2ZECA 1EPTA 1DXWA 1SGTA 3F9EA 1SGEE 4F49A 4I7YH 2PUQH 2ZHFH 1GBBA 1YYY1 1GCTC 2Y7XA 4BTTB 2CMYA 4XSKU 3SJOA 5TJXA 5GJ4B 5DP4A 2Q6DA 1S5SA 1OSSA 3UOPA 2XWAA 3U8RH 2ANMH 3UPEA 1O2YA 2FODA 1VCQA 1ZHMA 5EXLA 3SU5A 7LPRA 1GVZA 1HAPH 3F9GA 3V13A 1MKWK 3VFEA 4K69A 5L2YH 1VITG 1UK2A 1LHCH 2OXSA 9ESTA 3RXAA 1QGFA 2C3SA 3G01A 1YLCA 1TGSZ 1EATA 3E1XB 6GCHF 3VGCB 1GDNA 1ZTLA 1A5IA 7KMEH 1LDTT 2ZEBA 1CA8B 3KHVA 5CHAB 2EI7A 4NWLA 5DGJA 4TY6A 1AKSB 1ELAA 1Q31A 2Y5GA 4IMQA 1K2I1 1X7AC 4DGJA 2P16A 3TJOA 3M5OA 2AEIH 2J9NA 3SI4H 2AMPA 1Z1IA 3RXTA 2TIOA 2ODPA 2ZU3A 1W0ZU 1O2PA 2Z9JA 4J1YA 4ABIA 5FAHA 3RLWH 3UIRA 1C2JA 2EA3A 3ZVFA 3LONA 1W2KH 5E0JA 5H4IB 5I46H 3SU2A 1AFQC 1HAVB 3T28A 5J4QA 1FJSA 2P95A 5DP8A 3HK3B 2WYGA 1TGCA 1V2QT 3R0FA 5HGGA 2ZCHP 2DUCA 2F9BH 3NXPA 1CHGA 2NU0E 3TK6A 1SGQE 3U98H 4WWYA 4ZH8A 2ZP0H 1GJCB 1HGTH 1FY4A 1C1WH 3D65E 1A61H 4MG3A 4NIWA 1O30A 3M3SA 4AYYB 3PO1C 3KF2A 5F8ZA 1W13U 3D62A 1DSUA 1D3TB 2BYAX 1O3BA 4FU8A 1NS3A 3TGKE 1C2GA 3SV8A 2OD3B 4BAOB 1O3GA 3KL6A 2AIQA 4GLYA 2FOFA 5EXNA 5GDSH 2IN2A 3EA8A 4NFFA 1S81A 2QXHA 3HPTB 4H6TA 1TLDA 1TABE 2QN5T 1FAXA 1CHOF 3FP7E 5IDKA 1OWEA 2CHAC 2UWOA 2PLXA 2A2QH 3TJNA 5DG6A 4E7RG 2BQWB 2ALPA 2BTCE 2ZA5A 4YLQH
chains in the Genus database with same CATH superfamily
1EZSC 3NUMA 1WV7H 4WVPE 3P8GA 3W94A 1Z7KA 3H7OA 1K1LA 4RN6A 1GBFA 3VPKA 1DM4B 1O5GH 3JZ1B 1HIAA 2KZ4A 2XBVA 2YNBA 3NPSA 1Q2WA 2LP6A 1ZPZA 3D23A 4XOJA 5GCHF 2ZG0H 1BRBE 3IWMA 3ATMA 3S7HB 1TBRH 5EJLA 1ANEA 1BRCE 1A2CH 2BVSH 3A85A 1LHEH 1ZOMA 2FOGA 1PPFE 3MMGA 4E06H 1BTPA 3BTWE 1P09A 1K0HA 2EI6A 1WTHD 2ODQA 3FOAA 5A8XA 3OAAD 4THNH 1UTMA 5K7RA 1PQ8A 1K1IA 1EUFA 3T25A 5CHBA 4CH2B 1QY6A 3KN2A 2FM2A 3GCHB 3U8OH 1RFNA 1C5QA 1C5WB 2FWWA 4X1PU 2J5UA 1WQVH 4ABAA 1GWAA 1O38A 1C9PA 1HB0B 3W95A 2PGQB 1P04A 3RC4A 3SU3A 5C1UA 4NIXA 4JYVH 3U1IB 4GPGA 1ZMJA 2BB4A 3WWFA 2BMGB 1DFPA 3N99A 1PQ5A 1C4Y2 3RC5A 1HUTH 2VU8E 1GJ6A 1FNIA 3A84A 1O5FH 1O2VA 3SUEA 1GJ7B 4YLUA 2ZDVH 1O36A 1O3OA 5IK2D 2GT7A 3ATWA 1JXPA 1O31A 2OQUA 2ZCLP 1TX6A 3SU6A 1HJ9A 2R0KA 1GVKB 4R8TB 1J15A 1AWFH 3PM3A 4ABHA 4MDSA 1TRYA 1NESE 1O5BB 1O3DA 2GGVB 2H9TH 4ABFA 1FDPA 5JBTA 2VWLA 1W11U 2BDBA 1Z8JB 1W0KD 1YBWA 3UY9A 2OCVB 4DW2U 2HRVA 1W8BH 1F0TA 1C4U2 3M5LA 1ZRBA 2C8WB 3SZNA 3BF6H 1SHYA 2JH6D 2LELA 1NRSH 4K1EA 1SVPA 2FI3E 2P3FH 2UWLA 1TONA 2WPHS 4UFFH 2BD3A 2RG3A 4CHAC 1MTWA 8GCHG 1GI8B 1GBAA 1UVTH 4XRNA 5L2ZH 5A0BA 4B71A 3BTQE 3A8DA 1NFXA 3UTUH 4JZEH 3KQBA 3SNAA 1NRQH 5AHGH 5L6NH 2UUJB 3U1JB 5HXFA 5LPEA 1TGNA 1KSNA 1N8OB 4Q80A 1ZGVA 1GBKA 4ABEA 3M7UA 1N6XA 1TPOA 1NTPA 1DANH 3ZVCA 1BRUP 2WHXA 1BHXF 2G4UA 1A1RA 1ZLRA 2HNTE 1NY22 5HIZA 2ZFPH 4XBBA 1N6YA 2C8YB 4FUCA 3SZEA 3VXFH 1E37B 2AH4X 5GPIB 1O35A 3BTTE 1Z1JA 5C5OA 5JBBS 1MKWH 2QV1A 1UK3A 2VWMA 2ZO3H 4R0IA 1QL7A 3SGQE 4GHTA 5T6GA 1G2LA 4TPYA 2R0LA 1P10A 1KXEA 3LGIA 1TGTA 3SJ8A 4DT7B 5HIYA 4AFZA 2P3UB 2F9UA 2QA9E 1DLKB 2FOBA 1YC0A 3A8CA 1K1NA 1SMFE 4YT6H 1UVUH 1P11E 5EQQA 1S84A 1V2WT 2V0BA 3RXVA 1O2MA 1QZ8A 2A5AA 2W3IA 3RC6A 1RTFB 1TQ0B 1YLDA 3K6ZA 1YWUA 4NGAH 2WPMS 1E1QD 1BIOA 3UR6A 4CBOA 1BMMH 1DS2E 1HJ8A 4Q7YA 5CDFE 2THFB 2B0FA 3BIVH 1C1VH 2ZHDA 5GCHG 1ZZZA 1AUJA 1BCUH 1CA0C 1MMJN 5G4BA 1C1NA 1YPLH 3RXCA 3MI4A 1RIWC 1WBGB 1L4ZA 4ACAA 3N7DA 4A1TA 1ZSLA 2IJOB 4I8KA 3RXFA 4FU7A 3SHCH 1C2MA 1YLNA 2P93A 3BTFE 1FQ3A 4X2YA 3S0NA 2O8MA 1Y8TA 2HALA 2ZZUH 1PFXC 3TGJE 3GISB 2F9NA 1BBRE 1UTOA 1IQGA 4BAHB 3GCOA 1YPHE 3LH3A 1O2UA 3ZZ6A 2V7QD 1U6QA 1PPHE 1SGFA 1AZZA 1N1LA 3ZVAA 2JJ2D 2TGPZ 2QC2A 1MZDA 4CH8B 2BD2A 1QL9A 1K1OA 1ARCA 2V3OH 2Y7ZA 4F48B 1TFXA 1OS8A 4A1XA 2ZFTA 3QGNB 3MWIU 2Z3CA 3FO8D 5T6FA 1C2EA 4DG4A 1C2IA 1FMGA 4DVAU 1MZAA 1ANCA 1DUAA 1TIOA 3SV6A 1TMTH 1KYNA 4GAWA 1RD3B 1HAGE 4UFDH 1FY8E 1MD7A 4J2YB 1FY1A 1GL0E 2QGRA 1L0ZA 3SNEA 1BB0B 1Z8RA 2LPRA 3RMOH 3RMLH 3TNTA 1FIWA 1K1PA 3CENA 1IAUA 3MQKC 1GI6A 3TLOA 2XYAA 1C1MA 3P6ZB 1A0HB 1EFRD 1DT2A 1T31A 3BEUA 1VITF 1K1JA 4A1VA 1XXFA 2A4RA 2J92A 2WINI 4I32A 2PP6A 1NC6A 3STJA 2P3TB 2BZ6H 2LNCA 3O8BA 1ZTKA 3ZV9A 1GHWH 1H9LB 1V2VT 3MU1A 1C5PA 1JWTA 1UVPA 3TVJB 3QK1A 1TA2A 1VR1H 3RU4D 3AVZA 2H1UA 4HGCA 1BJVA 1A0JA 1BZXE 2Z9KA 5A0CA 1TB6H 3TJUA 4ESTE 1SC8U 4NA7A 1EOLA 2UUYA 2NU1E 2HPPH 4RKOB 2GP9B 1QTFA 3QO6A 2A1DB 1QRZA 3L3TA 1W7XH 2PTCE 1C5OH 1OYQA 1GHVH 1THSH 2VBCA 2ZDMA 4MLFB 1WDIA 1UW7A 1ETSH 1FZZA 1LVYA 1EP6A 1GG6B 2WPKS 2AERH 2G81E 3S9AA 1FPCH 1BUIA 1GMDG 1SGFG 2EY4C 1UVOA 1OWIA 2AGIX 2VIVA 1D3QB 1GCDA 2F91A 3A7WA 3ZZAA 3Q3XA 4MPXA 1GI3A 1C5RA 4TYDA 1BJUA 3M5NA 5JBCS 1OX1A 1KDQB 4TT3D 1HAOH 2ZDAH 5GNDA 5F53A 4AB9A 3ZZ5A 1P2IA 4NZQA 3VGCC 2STBE 5F03A 4OS1A 3ATLA 2A31A 3ODFA 1ELVA 1FX0B 1BOQA 2BQ6B 1CE5A 1O5AB 5EXMA 3ZV8A 3R3GB 1EQ9A 3SGAE 5EOKA 3ZYEA 2FOHA 3U8TH 3PMBB 1ELCA 1NZQH 3SUGA 1XUKA 1TAWA 4CRGA 1C2KA 1M9UA 4OS2A 1TALA 2ESTE 5HM9A 2UUFB 3T2NA 1GJ9B 3EAJA 4GUXA 3QTOH 3PMJA 3QZRA 1UJ1A 5FL7D 3VG8A 1KLTA 1F5RA 4NSYA 4WMFA 3MNSA 3TU7H 3ZVBA 3URCA 5C94A 2PSYA 4U30A 4JZDH 1EASA 1YPKH 5EG4A 1SHHB 4YOGA 1S6FA 2IOTA 3KIDU 4ABDA 1HXEH 1SGRE 3ZZDA 3BG4B 4WMDA 1LKAA 1CBWC 4X1QU 4I8LA 3P17H 2Q6FA 5E8EH 2XWBI 1WTGH 2XBWA 1C5UA 2ZHQH 4OGXA 3HATH 1HBTH 1BTYA 1BMLA 1HV7A 3T27A 1Y3VA 2Y6TA 2D1JA 5FHTA 3OY5U 3UNQA 3SUFA 1C5YB 3LPRA 4ZKNU 1C1PA 3RMNH 1FIZA 4U32A 1C5VA 3EA7A 1TNGA 1QB1A 1WAYB 1IQKA 1OWHA 1YCPM 2Z6BD 3F2GA 2ANYA 5FX6A 3SYJA 4B2BA 1MQ6A 4BXWA 5E2OA 3SGBE 1LQEA 2ZGXH 3OFND 1CGHA 3VB4A 1G3BA 3MTYA 2K1QA 2VIPA 2H9EH 4BAMB 1UTNA 1Y59T 2BM2A 1O2RA 5HYOA 3OEHD 4TY7A 3MH5A 2G51A 1GI4A 2SGDE 4OS6A 5JYIA 3SOSA 2D2DA 2AMDA 1KXAA 1MU8B 3AAVA 5AF9H 3A89A 1TNLA 4IC5A 2NU2E 2TGDA 2WV5A 1MH0A 2W7SA 2VIOA 2XTTB 4K2YA 1BMFD 1O2WA 1IQHA 3F1SB 3M7TA 1QJ1B 4Y11E 1EAXA 2VB0A 3GCTF 2GDDA 1BTZA 1KLJH 2FYRA 3MU0A 3KQCA 3LIWA 3FZZA 1QBNA 2ZTYA 3MNBA 5C20A 3SW2B 3DHKH 2VVCA 3FANA 3SI3H 3RUOA 2DE8A 2PW8H 2CJIA 3A86A 1ABIH 1YM0A 3JZ2B 1QA7A 5SGAE 2AGGX 4INHA 1Y5UT 1GHAG 3ZVEA 2GX4A 3C27B 1KTTB 2ANKH 2ZF0H 1A5HA 1O5DH 1TPPA 2EQNA 1QHRB 2V3MA 5EU8A 1S0RA 1ZMLA 4RT1A 2JJ1D 4TWWA 4MNXA 2CF8H 1NT1A 5CMXH 1ZSJA 3FAOA 1CVWH 1G37A 3LJOA 4TPIZ 1TGBA 1GDQA 3E16B 4KGAA 2G52A 1SGNE 1O3JA 2PKAB 3BSQA 4I86A 5JDUB 1AB9B 3FZDA 2OC0A 2GCHG 2OK5A 4RI0A 2J94A 3TH3H 1H9IE 4NZLA 3UR9A 1CGIE 3E90B 1IQFA 3GCHC 1TRMA 8GCHF 1NRPH 2WV4A 1VZQH 2J4IA 1KLIH 3DA9B 1ZHRA 2ULLA 4DY7B 1BT7A 2XBYA 3SQHE 4NCYA 3P8FA 1TWXB 1TQ7B 2GZ9A 2XNDD 3EE0B 1NPMA 2FEQH 4Z1MD 2BLVA 2GMTC 1J9CH 1V2OT 1SLWB 1CO7E 2FOMB 1IQEA 2ZNKH 3Q3KA 3RXUA 4BTIB 3ZZ4A 3RU4E 1EKBB 4MNYA 2A4QA 1GI7B 4ZHLU 1ZMNA 1GGDC 2VJ1A 3EA9A 4ISHH 1EB1H 1W12U 1XUJA 2P59A 4BANB 1P9UA 1IQLA 5FCRA 1HIAB 2GKVE 3OY6U 2VINA 2DE9A 1G3CA 1SI5H 2C8XB 5GIBA 1ZPBA 1L4DA 1G9IE 1MTSA 1UCYK 5AFZH 4OGYA 2BD8A 1F5LA 2FZZA 2ZIQH 1OP8A 3WWBA 1W7GH 1LVBA 3A88A 1SBWA 2TGAA 2FS9A 4AB8A 4ZKRU 3LDXH 2YMSB 3GICB 2F9OA 3F68H 1CT2E 1SB1H 1XUGA 3EYDA 1ELEE 3M7QA 1SQTA 3ZVGA 2VIWA 1V3XA 2AFQB 3NZIA 2ZQ1A 1OWDA 5EPNA 3A7YA 3RXEA 3EE7A 2FS8A 4CRBA 1GCTB 1CSOE 3EGKH 4BXSA 1CU1A 5AVDA 1SLXB 4FUFA 4DT4A 2CK3D 5A2MH 1THPB 2JH0D 3ATKA 1KXBA 1NO9H 1H4WA 1BA8B 1NFYA 1FI8A 3RM0H 1C1TA 1FN6A 3RXDA 4OM9A 1SR5C 2KAIA 2BXTH 1C1SA 3BTDE 3M3VA 1TA6A 1WYKA 4FUEA 1NBME 1EOJA 3GYLB 1HAHH 4BAKB 1V6DA 1GHBG 1V2UT 4Y0YE 3S9BA 3SO3A 2IPQX 2KX4A 5I25A 4IN2A 4NIVA 4SGBE 2VVVA 3I29A 1GI0A 4X8TH 1AFEH 4Q7XA 1FXYA 1LVMA 1P2QA 4Y79A 1EX3A 1O2KA 2FPZA 2FX4A 1SGCA 2FDAA 3Q77A 1O2ZA 4FU9A 1LVOA 1O3PB 1HJAC 3Q76A 3LGTA 2BD4A 4Q4LA 4AGKA 1DDJA 1O2TA 2ZFQH 3RXMA 2BDAA 1DWEH 2HGTH 1W14U 3UREA 4YZUA 1AI8H 2BD9A 1E0FD 3MU4A 4A5TS 1WQSA 2BDCA 4HTCH 1HLTH 1KMHB 3L33A 3MO9A 3GCTG 1DX5M 2BLWA 3PB1E 1A3EH 2A45B 2P8OB 4H42U 2R2MB 1O3CA 1P8VC 2NWNA 5KGOA 1QJ7B 4E05H 2GT8A 5C2ZA 1O3IA 5FBEA 1EZXC 2XOKD 3UOUA 1ZPCA 4B2AA 4JZFH 4X1NU 5IYTA 1AIXH 3T62A 1GI5A 1UHBA 1DY9A 1L2EA 4KTCA 1F0SA 1ELTA 1YGCH 1E36B 1VJAU 3U28C 1D3PB 3KNXA 1GJAB 1PPBH 3PWBA 1D4PB 5FPTA 5JB8S 1XX9A 1H8IH 2F83A 4HFPB 3PO1B 3I78A 1NN6A 1TNKA 1BTWA 1FPHH 1PPCE 1JBUH 4YTAA 3GYMA 2RCEA 1MQ5A 1OYTH 5DN6D 1IHTH 2CGAA 5B6LA 1DUEA 3AASA 2ZTXA 4M9FA 4IGDA 4X6MA 2FXRA 3SU1A 3TH4H 3MFJA 4B1TA 1SPJA 1HDTH 3E0PB 1BTHH 3LKWA 2KR7A 3PWCA 2NU4E 5C5NA 5K0HA 3BN9A 1H8HD 2XC4A 2FO9A 5E2PA 1PPGE 1KTSB 1NRNH 4DCDA 2O8LA 2CHAB 4ABBA 4ISNA 2PWXA 1TMUH 1QB9A 3Q3YA 4A6LA 3OSYA 4IMZA 2BY9X 7GCHG 4GVUA 4HI3A 2XNIA 2Z3DA 2R2WU 3HGPA 2L6OA 4ABGA 1GMDF 3OX7U 1Y3XA 1BTXA 2BY8X 3QUMP 5EW1H 2ANWA 2HNTC 2M5TA 4Y8YA 2EI8A 1SQAA 4WY3A 4DURA 1AE8H 4ZMAH 5GWZA 4K1TA 1TYNA 1YCPK 4MNWA 2O8TA 5EQSA 1EB2A 3S7KB 4ZXYH 2FYQA 1AZ8A 1DWDH 2WV9A 1C5XB 3DFJA 1WOFA 1C1UH 6ESTA 1GJDB 2FLBH 2FX6A 2GCTB 1DICA 4DOQA 3WW7A 1C2HA 5EW2H 3RXIA 2B5TB 2GV7A 4YM9A 8LPRA 2ZWLH 1EXFA 1GBHA 2Y5HA 3P70B 1BHXB 1COWD 2EEKA 2XW9A 2Y5FA 2B7DH 2NU3E 2W3KA 3UB0A 5DP9A 1P57B 1CT4E 2QXIA 3BEIB 1QJ6B 3LH1A 1P2JA 1DWBH 1DY8A 4X1SU 4X6OA 2GTBA 4HG6A 3SHAH 1P03A 4Q2KA 2ZGJA 1W0JD 2H5DA 3KYFA 1QCPA 1ANDA 3MO6A 4O9VA 3VEQB 3PLBA 3UFAA 3A87A 1LTOA 1ZJKA 2I6SA 5HM2A 2CF9H 4KTSA 4ASUD 3IITA 1VCPA 1H9HE 2FP7B 3GOVB 2PUXB 2J38A 2Z3EA 2OTVA 2KCOA 5A8ZA 1LHFH 5JBAS 1IQJA 2P94A 2L74A 4BAQB 3ENSB 3Q00A 1YPHC 1C1OA 1Z8GA 4LOYH 4LZ4B 1AY6H 1GBCA 4O03A 4X2XA 1Z6EA 2D8WA 1SFIA 5LGOA 2BOKA 1C5SA 1A0LA 3KQEA 3PLKA 2AMQA 3B9FH 1GL1A 1HPGA 1O2JA 1WUNH 4NIYA 2YOLA 1XVMA 4A92A 2QE7D 1IOEA 2VIDA 2OLGA 4P02A 1UCYH 3K2UA 4BNRA 2B9LA 4CRFA 1MAYA 1O3MA 2KFWA 3GDVA 1F0RA 5T6DA 6CHAB 2SGPE 2TGTA 1G2MA 5FBIA 1DVAH 4CHAB 1P12E 4YOJA 4VGCC 1ESBA 3GY6A 4JMYA 1B0FA 2WSSD 1VKYA 1S6HA 1BRAA 4OS4A 1WXRA 3O8CA 3ATIA 3M37A 2HVYB 1ESTA 2GZ8A 1VCWA 1YKTA 4K8YA 1O2XA 5EIYA 1OOKB 1SL3A 1IQNA 1P3EA 1W3CA 2GZ7A 4JYTA 3RU4T 1O3AA 4Z0KA 3UAIC 1YY3A 2XCNA 3RXPA 1ELDE 3LOXA 3LGYA 3NWUA 1P2NA 1A3BH 3ZZBA 2FESH 4CREA 3MH7A 1O3LA 1C5ZB 3K65B 3T5FH 4B73A 2PTNA 1HAXB 5ESBA 3A7XA 1AVXA 3SJIA 4CR5A 4NA8A 1D6RA 4MNVA 4P00A 2AHME 4KELA 1SGPE 4WMEA 3IG6B 1GHAF 3DD2H 4KP0A 4JK5A 2F4LA 1TBQH 2ZFRH 3PMAB 1HNEE 1KXCA 1D9IA 1MTVA 1AVGH 1ESAA 1MBMA 4DIHH 1NRRH 1K22H 1Z6JH 1AHTH 5FPSA 1QQUA 2D26C 5HKKD 3K9XB 4INLA 2GCHF 2PKSB 5AFYH 3M61U 2FLRH 1GJ5H 2B8OH 2WPJS 2J95A 4AFQA 4AN7A 1YF4A 5DPAA 4BOHA 3P8OA 4ZXXH 2SNVA 2Y81A 4GCHG 1GBTA 2YNAA 4UE7H 2HOBA 3ZYDA 1EAIA 1FUJA 1E38B 1OHHD 2PHBA 4FUHA 2Z9GA 3EDXB 1GBLA 3ELAH 4GHQA 4MPVA 1V2JT 3A7TA 3BTHE 3AW0A 1O3KA 1OPHB 1AU8A 2BX3A 3HKIB 4X6PA 1UTKA 1CA0B 1RIWB 4D7GA 1VITH 1QB6A 2C90B 1DLEA 1A46H 1B7XB 1UK4A 3DT0H 1QA0A 4H6SB 5DP5A 2C93B 4ZROA 3PV4A 1O3HA 5CHAC 4Y10E 2H9HA 3GDSA 3BV9B 4AFSA 1GBEA 1XM1A 2SFAA 2ZCKP 1J8AA 1IHSH 3MYWA 4UD9H 1UTLM 3OTPA 2H2ZA 1HAIH 1SKYE 3URDA 5JB9S 1O2IA 3NKKA 1K9OE 5C1XA 2QY0B 4OS7A 1QL8A 1XXDA 1NBMD 2BDGA 1UTPA 3BTGE 3A80A 3SORA 1J17T 2A0QB 2ILNA 2BQ7B 4Y71A 2HPQH 1GJ8B 1GHXH 4UDWH 4FUGA 5EGMA 1AB9C 2PGBB 3KGPA 4I8HA 1JRTA 2HVXA 3TIUA 1EPTB 1JRSA 1BMAA 1CGJE 2BVXH 2R3UA 3RXJA 4K60A 3LU9B 4NSVA 1FN8A 3MOCA 4RT0A 1F7ZA 1AUTC 4Y76A 2RDLA 1T8LA 2GD4B 2W6JD 3A8AA 3GS9A 1O2QA 1G30B 4ZHAA 2BY6X 1F2SE 3LGVA 4TWYA 2VIQA 5ETXA 3VB5A 3TJVA 3F9FA 3OTJE 4RSPA 5CE1A 4JCNA 2JETB 4Y0ZE 3LJJA 4OS5A 3P8NA 1O39A 3UWIA 4PROA 3QDZB 1S83A 3C1KA 4KTUA 1MTNB 3EQ0H 2VGCB 3PTBA 4AORA 4B74A 1RXPA 2F9PA 2OBOA 1LPKB 1GHBF 3UUZA 3SU4A 3SJ9A 3M36A 4H4FA 3LC5A 1GJ4H 4X6NA 3ZZ8A 4ZKOU 1AN1E 1T32A 3QX5H 4O3UA 4WF8A 1YCPH 2Y80A 2A5KA 1E34B 1YPEH 4FUIA 5EODA 2J98A 3A83A 1SFQB 1ZR0A 4NWKA 5FCKA 1GVLA 1GJBB 4B6FA 4K3JA 4ASHA 1OP2A 1DITH 1JMOH 1AO5A 1NFWA 4MPUA 2H5CA 1K21H 4ISOA 1MKXK 1MTUA 5KEDA 3RXRA 2ZKSA 1VGCB 1LCYA 1O2LA 1O3NA 3GY2A 4ZKSU 5A8YA 1FONA 2Q6GA 2OC8A 4Y7BA 1EAWA 2F3CE 1B5GH 3FN8A 1V2RT 1UMAH 1O2SA 1P2KA 3BTEE 1DXPA 3DSOA 1AWHB 2WYJA 3M35A 1RJXB 5ESTE 3ZZ7A 3KQ5A 1C9TA 2SGAA 1D3DB 1CT0E 2AYWA 2K8IA 2QIQA 3B23B 3BTME 5DP7A 2A7JA 2OP9A 2G5NA 2OBQA 1HFDA 1MUEB 4X8VH 1L1JA 1A7SA 1P2OA 2G4TA 4ZCNA 3VB7A 1L1GA 4X0WU 4DIIH 1GMHG 2V3HH 2QF3A 1F92A 3BTKE 3B8JA 1RGQA 2QXGA 1TBZH 4IC6A 3F2HA 4ISLA 1C5LH 4XE4A 1G3EA 1BITA 4MPWA 4UFGH 1PYTD 2ALVA 1OWKA 2HWLB 3MH6A 1ABJH 4D8NA 5JPMH 3AAUA 4AGJA 4E7NA 4X8SH 2GJGA 2PR3A 1NFUA 1TNHA 2FTMA 5J4SA 1C2DA 3A82A 3TITA 3DUXH 2XC5A 4UEHH 1H8ED 7GCHF 3E6PH 2P8OC 3VXEH 7ESTE 1C4V2 1QFKH 2QXJA 2ZTZA 1CBWB 1YP9A 1E79D 1WSSH 1K1MA 1O33A 1O37A 2O9QA 2VH0A 1EJAA 2ZU2A 3U69H 1ZTJA 2A4GA 4YESB 4Y8XA 3RMMH 1O0DH 2OUAA 2KAIB 1EZUC 1GBMA 1S85A 3MNXA 3RXLA 1XUIA 1V2LT 1AKSA 2VH6A 3F0PA 2O8UA 2ZHWH 1H8DH 5DK1A 1G3DA 1T4UH 3E0NB 2F43B 2FTLE 1WCZA 5C67A 1YPGH 2ZGHA 2FOEA 1V2KT 3H09A 1PPEE 2BZAA 3P95A 5BPEA 1J16A 2H6MA 2PKAA 3QGJA 1KIGH 1AQ7A 8KME2 2FIRH 5F6MA 1O34A 3S69A 1QBOA 2W26A 4XD7D 1HAVA 4F4OC 4XFQA 3N7OA 4MTBA 1RS0A 1JOUB 4K5ZA 3KYGA 4Z6AH 3LGUA 3SV7A 1GHYH 1XVOA 3L6PA 1N8OC 2RDEA 3SV2H 4CR9A 1TOMH 1LO6A 3PRDA 4DJZB 1JIMA 1LPGB 3UNRA 2AIPA 4X2WA 1GMCF 4O3TA 3MNCA 2XCFA 3T26A 2AS9A 5F8XA 1O5CB 3E91A 3FFGA 2HLCA 4F55A 4ZUHA 1FV9A 3RXGA 5DO4H 1GBDA 1UHBB 3UQVA 1D6WA 1KY9A 1SGIB 1XKBC 2W7UA 2O8WA 2OQ5A 1ANBA 3MU8A 1QIXB 3KCGH 3RDZA 2G55A 4WH8A 1RTKA 1UVSH 1XUFA 2BDIA 2BHGA 2SGFE 2OINA 2XXLA 1GBIA 3V7TA 3D49H 3S9CA 2JDID 1GHZA 3MHWU 1P05A 3SBKA 2ZU4A 2GDEH 2WUCA 2GCTC 4AZ2B 2QAAA 2FI5E 3A8BA 1TNJA 4AX9H 5F8TA 3E3TA 2UWPA 5FX5A 3ZVDA 1UTJA 4AG2A 3STIA 1XKAC 3H5CB 4LK4A 2SGQE 1GI9B 1O32A 4YO9A 3TK5A 3RXKA 1AFQB 5C3NA 1ETTH 2V35A 2WPIS 2VWOA 2A32A 2VWNA 2ZU1A 4A7IB 1L1NA 1HRTH 6LPRA 2W6ID 1ARBA 4I33A 3K6YA 3QN7A 2G00A 3O8DA 2SNWA 4CRDA 1J14A 2Z94A 1O3FA 1SOZA 1LHDH 2GMTB 1O2HA 1ELFA 3RP2A 1Q3XA 1OKXA 1UCYE 4M7GA 1SGDE 4Y8ZA 1THRH 6GCHG 1SQOA 1GGDB 2G5VA 1AMHA 1ID5H 1G32B 1MCTA 3BEFB 1T7CA 1YPMH 3RXHA 1O2GH 2ASUB 4FUBA 1P06A 3V3MA 2BD7A 3RXQA 2JIZD 3ZZ3A 1OXGA 1ELBA 1XMNB 3DSGA 4FUDA 3CS0A 1ORFA 4BTUB 1UTQA 2BX4A 2ZDNA 3PROA 1QR3E 2BOHB 3HK6B 1C2FA 4RKJB 1MD8A 2FOCA 1BBRK 1H1BA 1P02A 1TNIA 1QQ4A 1T4VH 1OP0A 2WPDD 2W5EA 3SJKA 2JKHA 1WU1A 2FI4E 2ZDKA 2V6NA 1MBQA 4UFEH 4CRAA 1NU9A 2QCYA 1Z8IB 6CHAC 3W1EA 1EAUA 3OYPA 4LZ1H 3PMHB 2Z9LA 1HAZB 3OE7D 3PRBA 2ZHEH 4GSOA 2C4FH 3SN8A 4YT7H 4GCHF 3MH4A 1P2MA 2A4OA 4K1SA 1T8MA 1QNJA 3E8LA 1O2OA 1P01A 1MKXH 1TX8A 2R3YA 3RXBA 3SNDA 4NFEA 4B75A 1ZHPA 3RXOA 2ZI2H 4ABJA 1TRNA 1PYTC 4FETA 4D9QA 5DKMA 4ZAEA 2BLOA 4D9RA 3ZZCA 1S0QA 3PLPA 2VNTA 1SLVB 5LPRA 2F9VA 1LKBA 2IJD1 2ODYB 4JK6A 3DFLA 1FLEE 1V2NT 5DSFA 3PV5A 3I77A 1V2TT 4I31A 4XDEA 3LGWA 2XC0A 3V12A 1PJPA 1GI1A 3GY3A 3OU0A 1MAXA 4FVBA 1C5MD 1HJAB 4JZIA 1F5KU 5LH8A 3SV9A 1FAKH 1CHOG 1A5GH 3F6UH 3OEED 8ESTE 2PKSC 2QF5A 4AYVB 4K8BA 2WUBA 1O2NA 2PSXA 1GG6C 1W0YH 4Q7ZA 5FXLA 2FMJA 2STAE 1GMCG 4Y6DA 1EZQA 2A5IA 5C1YA 1O5EH 3GDUA 4O97A 1EP5A 1FY5A 4JYUH 3DSPA 2YMSD 3AK5A 1E1RD 1Y3WA 2ZPRA 4UONA 4KKDA 1BQYA 2C8ZB 4B2CA 2BD5A 2TBSA 2EC9H 1PQAA 1HYLA 4AC9A 3MO3A 1GDUA 2ZGCA 4FOUC 1P0SH 1C2LA 4QT8C 1W10U 4AG1A 3F9HA 1TOCB 3TH2H 3TNSA 4AFUA 5ABWA 4IBLH 1P3CA 3SNBA 2CN0H 1EJMA 2JH5D 3ITIA 3QZQA 4WXVA 4INKA 2A7HA 1TPSA 1EJNA 3P92A 3QTVH 1V2MT 1NU7B 2QYIA 1MCVA 3GY5A 1TMBH 3QWCH 2TPIZ 4I8JA 3FP8E 1AE5A 1C5TA 1LQDB 1E35B 1V2PT 3TPIZ 2GV6A 1ZRKA 3M3TA 3MU5A 3M5MA 3U9AH 2ZFFH 2BLQA 4D76A 2HNTF 4WXIA 4ISIH 2I6QA 2BXUH 2J34A 1EPTC 1Z71A 5EJZA 1C5NH 3ODDA 1QRXA 5PTPA 1IQIA 3BG4C 2VVUA 1TPAE 1AD8H 4CBNA 3CS7A 3PV2A 1MU6B 1LMWB 1KXFA 1P9SA 1RTLA 2BDYA 2R9PA 2JETC 1YPJH 2XBXA 2ZDLA 4HZHA 2ZC9H 1DPOA 5GXPA 2G8TA 2RFKC 1INCA 1HXFH 5EJ1A 1LPZB 5DP3A 2A7CA 3UQOA 3GCNA 1MTNC 3UNSA 2VGCC 1T8NA 1GPZA 3BG8A 1OWJA 2FOAA 1SG8B 3SQEE 2IPHA 3LT3A 1G36A 2ZFSA 5E0GA 3QLPH 1QURH 1QRWA 1MABB 5DJ7A 3A81A 2BY5X 3ESTA 4MVNA 2ZPQA 4IN1A 4X1RU 1DE7H 3HKJB 1C1QA 1GMHF 4AOQA 1SSXA 3F0OA 3FVFB 1ETRH 2ZPSA 2GVFA 1GI2A 3LC3A 4B76A 5LPFA 1C1RA 1IQMA 1ZJDA 3ZZ9A 2K0QA 1ZGIA 3CP7A 3GY7A 9LPRA 1T8OA 3PTNA 1PPZA 2KM0A 4NA9H 5L30H 1A4WH 2OC7A 4YXWD 2OC1A 1BDAA 1S6LA 1LHGH 4XBDA 2QF0A 5EQRA 3SUDA 3VB3A 1VGCC 3FP6E 1NM6A 3GY4A 4D7FA 1HCGA 2UUKB 3NRLA 1HAYB 1DWCH 5T3HA 1AGJA 1Y5BT 2RA0A 3GY8A 4I8GA 4CRCA 2ZU5A 4FVDA 4NG9H 2Y82A 3RM2H 1ZSKA 2CV3A 1KXDA 4YOIA 3PYHA 1QBVH 1F0UA 5C17A 3BIUH 3V0XA 3NK8A 5TCCA 1S82A 5T1VA 1AVWA 2TRMA 2XRCA 4FXGH 3WY8A 5E0HA 4LXBH 4MQAA 3RLYH 5FPYA 1Y3YA 2KCYA 1NROH 1GBJA 3DCLA 1SLUB 5HMAA 2Z7FE 4ZHMU 4Y7AA 5A0AE 2BVRH 3KQDA 3SNCA 5A09A 1V2ST 3RXSA 3SU0A 1UO6A 3TGIE 2J98B 4X8UH 3KEEA 4X2VA 5BRRE 1Y5AT 2ZGBH 4SGAE 2RA3A 4WJG2 3HGNA 5B6OA 1B0EA 2BY7X 1BBRH 2CXVA 5EPYA 4IW4E 1TE0A 2AGEX 4VGCB 2A2XH 1TX7A 3F2FA 1PQ7A 4JZ1A 4WH6A 1DSTA 1KDQA 1VJ9U 3ZIAD 1ZYOA 4ACBA 2M2AA 2ZQ2A 3TK9A 1RRKA 1O3EA 2Z9IA 5TCAA 1DOJA 1K28D 1ACBE 3AW1A 4U01A 3VB6A 1SOTA 5DP6A 1ELGA 2J2UA 2PFEA 1BTUA 1XUHA 1FY3A 3A7VA 3H7TA 2WZQA 3T29A 3NCLA 3O8RA 2QF4A 2WPLS 4FUJA 2SGEE 2BDHA 3UWJH 2PV9B 3A7ZA 1CQQA 4U2WA 1Y3UA 2YMSC 4IS5A 2Q1JA 1BMNH 1SGYE 1JIRA 4XBCA 2ZECA 1EPTA 1DXWA 1SGTA 3F9EA 1SGEE 4F49A 4I7YH 2PUQH 2ZHFH 1GBBA 1YYY1 1GCTC 3F3BA 2Y7XA 1SQRA 4BTTB 2CMYA 4XSKU 3SJOA 5TJXA 5GJ4B 5DP4A 2Q6DA 1S5SA 1OSSA 3UOPA 2XWAA 3U8RH 2ANMH 3UPEA 3N7EA 1O2YA 2FODA 1VCQA 1ZHMA 5EXLA 3SU5A 7LPRA 1GVZA 1HAPH 3F9GA 3V13A 1MKWK 3VFEA 4K69A 5L2YH 1VITG 1UK2A 1LHCH 2OXSA 9ESTA 3RXAA 1QGFA 2C3SA 3G01A 1YLCA 1TGSZ 1EATA 3E1XB 6GCHF 3VGCB 1GDNA 1ZTLA 1A5IA 7KMEH 1LDTT 2ZEBA 1CA8B 3KHVA 5CHAB 2EI7A 3CNRA 4NWLA 5DGJA 4TY6A 1AKSB 1ELAA 1Q31A 2Y5GA 4IMQA 1K2I1 1X7AC 4DGJA 2P16A 3TJOA 3M5OA 2AEIH 2J9NA 3SI4H 5KECA 2AMPA 1Z1IA 3RXTA 2TIOA 2ODPA 2ZU3A 1W0ZU 1O2PA 2Z9JA 4J1YA 4ABIA 5FAHA 3RLWH 3UIRA 1C2JA 2EA3A 3ZVFA 3LONA 1W2KH 5E0JA 5H4IB 5I46H 3SU2A 1AFQC 1HAVB 3T28A 4Q63A 5J4QA 1FJSA 2P95A 5DP8A 3HK3B 2WYGA 1TGCA 1V2QT 3R0FA 5HGGA 2ZCHP 2DUCA 2F9BH 3NXPA 1CHGA 2NU0E 3TK6A 1SGQE 3U98H 4WWYA 4ZH8A 5C0UA 2ZP0H 1GJCB 1HGTH 1FY4A 1C1WH 3D65E 1A61H 4MG3A 4NIWA 1O30A 3M3SA 4B6EA 4AYYB 3PO1C 3KF2A 5F8ZA 1W13U 3D62A 1DSUA 1D3TB 2BYAX 2KCPA 1O3BA 4FU8A 5C0TA 1NS3A 3TGKE 1C2GA 3SV8A 2OD3B 4BAOB 3FKSD 2HLDD 1O3GA 3KL6A 2AIQA 4GLYA 2FOFA 5EXNA 5GDSH 2J97A 2IN2A 3EA8A 4NFFA 1S81A 2QXHA 3HPTB 4H6TA 1TLDA 4TSFD 1TABE 2QN5T 1FAXA 1CHOF 2KCAA 3FP7E 5IDKA 1OWEA 2CHAC 2UWOA 2PLXA 2A2QH 3TJNA 5DG6A 4E7RG 2BQWB 2ALPA 2BTCE 2ZA5A 4YLQH
chains in the Genus database with same CATH topology
1EZSC 3NUMA 1WV7H 4WVPE 3P8GA 3W94A 1Z7KA 3H7OA 1K1LA 4RN6A 1GBFA 3VPKA 1DM4B 1O5GH 3JZ1B 1HIAA 2XBVA 2YNBA 3NPSA 1Q2WA 1ZPZA 3D23A 4XOJA 5GCHF 2ZG0H 1BRBE 3IWMA 3ATMA 3S7HB 1TBRH 1ANEA 1BRCE 1A2CH 2BVSH 3A85A 1LHEH 1ZOMA 2FOGA 1PPFE 3MMGA 4E06H 1BTPA 3BTWE 1P09A 2EI6A 1WTHD 2ODQA 5A8XA 4THNH 1UTMA 5K7RA 1PQ8A 1K1IA 1EUFA 3T25A 4CH2B 1QY6A 3KN2A 2FM2A 3GCHB 3U8OH 1RFNA 1C5QA 1C5WB 2FWWA 4X1PU 1WQVH 4ABAA 1GWAA 1O38A 1C9PA 1HB0B 3W95A 2PGQB 1P04A 3RC4A 3SU3A 5C1UA 4NIXA 4JYVH 3U1IB 4GPGA 1ZMJA 2BB4A 2BMGB 1DFPA 1PQ5A 1C4Y2 3RC5A 1HUTH 2VU8E 1GJ6A 1FNIA 3A84A 1O5FH 1O2VA 3SUEA 1GJ7B 4YLUA 2ZDVH 1O36A 1O3OA 2GT7A 3ATWA 1JXPA 1O31A 2OQUA 2ZCLP 1TX6A 3SU6A 1HJ9A 2R0KA 1GVKB 4R8TB 1J15A 1AWFH 3PM3A 4ABHA 4MDSA 1TRYA 1NESE 1O5BB 1O3DA 2GGVB 2H9TH 4ABFA 1FDPA 5JBTA 2VWLA 1W11U 2BDBA 1Z8JB 3UY9A 1YBWA 2OCVB 4DW2U 2HRVA 1W8BH 1F0TA 1C4U2 3M5LA 1ZRBA 2C8WB 3SZNA 3BF6H 1SHYA 2JH6D 1NRSH 4K1EA 1SVPA 2FI3E 2P3FH 2UWLA 1TONA 2WPHS 4UFFH 2BD3A 2RG3A 4CHAC 1MTWA 8GCHG 1GI8B 1GBAA 1UVTH 5L2ZH 5A0BA 4B71A 3BTQE 3A8DA 1NFXA 3UTUH 4JZEH 3KQBA 3SNAA 1NRQH 5AHGH 5L6NH 2UUJB 3U1JB 5HXFA 5LPEA 1TGNA 1KSNA 1N8OB 4Q80A 1ZGVA 1GBKA 4ABEA 3M7UA 1N6XA 1TPOA 1NTPA 1DANH 3ZVCA 1BRUP 1BHXF 2G4UA 1A1RA 1ZLRA 2HNTE 1NY22 2ZFPH 4XBBA 1N6YA 2C8YB 4FUCA 3VXFH 1E37B 2AH4X 5GPIB 1O35A 3BTTE 1Z1JA 5C5OA 5JBBS 1MKWH 2QV1A 1UK3A 2VWMA 2ZO3H 4R0IA 1QL7A 3SGQE 4GHTA 5T6GA 1G2LA 4TPYA 2R0LA 1P10A 1KXEA 3LGIA 1TGTA 3SJ8A 4DT7B 4AFZA 2P3UB 2F9UA 2QA9E 1DLKB 2FOBA 1YC0A 3A8CA 1K1NA 1SMFE 4YT6H 1UVUH 1P11E 5EQQA 1S84A 1V2WT 2V0BA 3RXVA 1O2MA 2A5AA 2W3IA 3RC6A 1RTFB 1TQ0B 1YLDA 3K6ZA 4NGAH 2WPMS 1BIOA 3UR6A 4CBOA 1BMMH 1DS2E 1HJ8A 4Q7YA 2THFB 2B0FA 3BIVH 1C1VH 2ZHDA 5GCHG 1ZZZA 1AUJA 1BCUH 1CA0C 1MMJN 5G4BA 1C1NA 1YPLH 3RXCA 3MI4A 1RIWC 1WBGB 1L4ZA 4A1TA 1ZSLA 2IJOB 4I8KA 3RXFA 4FU7A 3SHCH 1C2MA 2P93A 4X2YA 3BTFE 1FQ3A 3S0NA 2O8MA 1Y8TA 2HALA 2ZZUH 1PFXC 3TGJE 3GISB 2F9NA 1BBRE 1UTOA 1IQGA 4BAHB 3GCOA 1YPHE 3LH3A 1O2UA 3ZZ6A 1U6QA 1PPHE 1SGFA 1AZZA 1N1LA 3ZVAA 2TGPZ 2QC2A 1MZDA 4CH8B 2BD2A 1QL9A 1K1OA 1ARCA 2V3OH 2Y7ZA 1TFXA 1OS8A 4A1XA 2ZFTA 3QGNB 3MWIU 2Z3CA 5T6FA 1C2EA 4DG4A 1C2IA 1FMGA 4DVAU 1MZAA 1ANCA 1DUAA 1TIOA 3SV6A 1TMTH 1KYNA 4GAWA 1RD3B 1HAGE 4UFDH 1FY8E 1MD7A 4J2YB 1FY1A 1GL0E 2QGRA 1L0ZA 3SNEA 1BB0B 1Z8RA 2LPRA 3RMOH 3RMLH 3TNTA 1FIWA 1K1PA 3CENA 1IAUA 1GI6A 3TLOA 2XYAA 1C1MA 3P6ZB 1A0HB 1DT2A 1T31A 3BEUA 1VITF 1K1JA 4A1VA 1XXFA 2A4RA 2J92A 2WINI 4I32A 1NC6A 3STJA 2P3TB 2BZ6H 2LNCA 3O8BA 1ZTKA 3ZV9A 1GHWH 1H9LB 1V2VT 3MU1A 1C5PA 1JWTA 1UVPA 3TVJB 3QK1A 1TA2A 1VR1H 3RU4D 3AVZA 2H1UA 4HGCA 1BJVA 1A0JA 1BZXE 2Z9KA 5A0CA 1TB6H 3TJUA 4ESTE 1SC8U 4NA7A 1EOLA 2UUYA 2NU1E 2HPPH 4RKOB 2GP9B 1QTFA 3QO6A 2A1DB 1QRZA 3L3TA 1W7XH 2PTCE 1C5OH 1OYQA 1GHVH 1THSH 2ZDMA 4MLFB 1ETSH 1FZZA 1LVYA 1EP6A 1GG6B 2WPKS 2AERH 2G81E 3S9AA 1FPCH 1BUIA 1GMDG 1SGFG 1UVOA 1OWIA 2AGIX 2VIVA 1D3QB 1GCDA 2F91A 3A7WA 3ZZAA 3Q3XA 4MPXA 1GI3A 1C5RA 4TYDA 1BJUA 3M5NA 5JBCS 1OX1A 1KDQB 1HAOH 2ZDAH 4AB9A 3ZZ5A 1P2IA 4NZQA 3VGCC 2STBE 5F03A 4OS1A 3ATLA 2A31A 3ODFA 1ELVA 1BOQA 2BQ6B 1CE5A 1O5AB 5EXMA 3ZV8A 3R3GB 1EQ9A 3SGAE 5EOKA 3ZYEA 2FOHA 3U8TH 3PMBB 1ELCA 1NZQH 3SUGA 1XUKA 1TAWA 4CRGA 1C2KA 1M9UA 4OS2A 1TALA 2ESTE 5HM9A 2UUFB 3T2NA 1GJ9B 3EAJA 4GUXA 3QTOH 3PMJA 3QZRA 1UJ1A 1KLTA 1F5RA 4NSYA 4WMFA 3MNSA 3TU7H 3ZVBA 3URCA 2PSYA 4U30A 4JZDH 1EASA 1YPKH 5EG4A 1SHHB 4YOGA 1S6FA 2IOTA 3KIDU 4ABDA 1HXEH 1SGRE 3ZZDA 3BG4B 4WMDA 1LKAA 1CBWC 4X1QU 4I8LA 3P17H 2Q6FA 5E8EH 2XWBI 1WTGH 2XBWA 1C5UA 2ZHQH 4OGXA 3HATH 1HBTH 1BTYA 1BMLA 1HV7A 3T27A 1Y3VA 2Y6TA 2D1JA 5FHTA 3OY5U 3UNQA 3SUFA 1C5YB 3LPRA 4ZKNU 1C1PA 3RMNH 1FIZA 4U32A 1C5VA 3EA7A 1TNGA 1QB1A 1WAYB 1IQKA 1OWHA 1YCPM 2Z6BD 2ANYA 5FX6A 4B2BA 1MQ6A 4BXWA 5E2OA 3SGBE 1LQEA 2ZGXH 1CGHA 3VB4A 1G3BA 3MTYA 2K1QA 2VIPA 2H9EH 4BAMB 1UTNA 1Y59T 2BM2A 1O2RA 5HYOA 4TY7A 3MH5A 2G51A 1GI4A 2SGDE 4OS6A 5JYIA 3SOSA 2D2DA 2AMDA 1KXAA 1MU8B 3AAVA 5AF9H 3A89A 1TNLA 4IC5A 2NU2E 2TGDA 2WV5A 1MH0A 2W7SA 2VIOA 2XTTB 4K2YA 1O2WA 1IQHA 3F1SB 3M7TA 1QJ1B 4Y11E 1EAXA 2VB0A 3GCTF 2GDDA 1BTZA 1KLJH 2FYRA 3MU0A 3KQCA 3LIWA 3FZZA 1QBNA 2ZTYA 3MNBA 5C20A 3SW2B 3DHKH 2VVCA 3FANA 3SI3H 3RUOA 2DE8A 2PW8H 2CJIA 3A86A 1ABIH 1YM0A 3JZ2B 1QA7A 5SGAE 2AGGX 4INHA 1Y5UT 1GHAG 3ZVEA 2GX4A 3C27B 1KTTB 2ANKH 2ZF0H 1A5HA 1O5DH 1TPPA 5EU8A 1QHRB 1S0RA 1ZMLA 4TWWA 4MNXA 2CF8H 1NT1A 5CMXH 1ZSJA 3FAOA 1CVWH 1G37A 3LJOA 4TPIZ 1TGBA 1GDQA 3E16B 4KGAA 2G52A 1SGNE 1O3JA 2PKAB 3BSQA 5JDUB 1AB9B 3FZDA 2OC0A 2GCHG 2J94A 3TH3H 1H9IE 4NZLA 3UR9A 1CGIE 3E90B 1IQFA 3GCHC 1TRMA 8GCHF 1NRPH 2WV4A 1VZQH 2J4IA 1KLIH 3DA9B 1ZHRA 2ULLA 4DY7B 1BT7A 2XBYA 3SQHE 4NCYA 3P8FA 1TWXB 1TQ7B 2GZ9A 3EE0B 1NPMA 2FEQH 2BLVA 2GMTC 1J9CH 1V2OT 1SLWB 1CO7E 2FOMB 1IQEA 2ZNKH 3Q3KA 3RXUA 4BTIB 3ZZ4A 3RU4E 1EKBB 4MNYA 2A4QA 1GI7B 4ZHLU 1ZMNA 1GGDC 2VJ1A 3EA9A 4ISHH 1EB1H 1W12U 1XUJA 2P59A 4BANB 1P9UA 1IQLA 5FCRA 1HIAB 2GKVE 3OY6U 2VINA 2DE9A 1G3CA 1SI5H 2C8XB 5GIBA 1ZPBA 1L4DA 1G9IE 1MTSA 1UCYK 5AFZH 4OGYA 2BD8A 1F5LA 2FZZA 2ZIQH 1OP8A 1W7GH 1LVBA 3A88A 1SBWA 2TGAA 2FS9A 4AB8A 4ZKRU 3LDXH 3GICB 2F9OA 3F68H 1CT2E 1SB1H 1XUGA 3EYDA 1ELEE 3M7QA 1SQTA 3ZVGA 2VIWA 1V3XA 2AFQB 3NZIA 2ZQ1A 1OWDA 5EPNA 3A7YA 3RXEA 2FS8A 4CRBA 1GCTB 1CSOE 3EGKH 4BXSA 1CU1A 5AVDA 1SLXB 4FUFA 5A2MH 1THPB 2JH0D 3ATKA 1KXBA 1NO9H 1H4WA 1BA8B 1NFYA 1FI8A 3RM0H 1C1TA 1FN6A 3RXDA 1SR5C 2KAIA 2BXTH 1C1SA 3BTDE 3M3VA 1TA6A 1WYKA 4FUEA 1EOJA 3GYLB 1HAHH 4BAKB 1V6DA 1GHBG 1V2UT 4Y0YE 3S9BA 3SO3A 5I25A 4IN2A 4NIVA 4SGBE 2VVVA 3I29A 1GI0A 4X8TH 1AFEH 4Q7XA 1FXYA 1LVMA 1P2QA 4Y79A 1EX3A 1O2KA 2FPZA 2FX4A 1SGCA 2FDAA 3Q77A 1O2ZA 4FU9A 1LVOA 1O3PB 1HJAC 3Q76A 3LGTA 2BD4A 4AGKA 1DDJA 1O2TA 2ZFQH 3RXMA 2BDAA 1DWEH 2HGTH 1W14U 3UREA 4YZUA 1AI8H 2BD9A 1E0FD 3MU4A 4A5TS 1WQSA 2BDCA 4HTCH 1HLTH 3L33A 3MO9A 3GCTG 1DX5M 2BLWA 3PB1E 1A3EH 2A45B 2P8OB 4H42U 2R2MB 1O3CA 1P8VC 2NWNA 1QJ7B 4E05H 2GT8A 5C2ZA 1O3IA 5FBEA 1EZXC 3UOUA 1ZPCA 4B2AA 4JZFH 4X1NU 5IYTA 1AIXH 3T62A 1GI5A 1UHBA 1DY9A 1L2EA 4KTCA 1F0SA 1ELTA 1YGCH 1E36B 1VJAU 1D3PB 3KNXA 1GJAB 1PPBH 3PWBA 1D4PB 5FPTA 5JB8S 1XX9A 1H8IH 2F83A 4HFPB 3PO1B 3I78A 1NN6A 1TNKA 1BTWA 1FPHH 1PPCE 1JBUH 4YTAA 3GYMA 2RCEA 1MQ5A 1OYTH 1IHTH 2CGAA 1DUEA 3AASA 2ZTXA 4IGDA 4X6MA 2FXRA 3SU1A 3TH4H 3MFJA 4B1TA 1SPJA 1HDTH 3E0PB 1BTHH 3LKWA 3PWCA 2NU4E 5C5NA 5K0HA 3BN9A 2XC4A 2FO9A 5E2PA 1PPGE 1KTSB 1NRNH 4DCDA 2O8LA 2CHAB 4ABBA 4ISNA 2PWXA 1TMUH 1QB9A 3Q3YA 4A6LA 3OSYA 4IMZA 2BY9X 7GCHG 4GVUA 4HI3A 2XNIA 2Z3DA 2R2WU 3HGPA 4ABGA 1GMDF 3OX7U 1Y3XA 1BTXA 2BY8X 3QUMP 5EW1H 2ANWA 2HNTC 2M5TA 4Y8YA 2EI8A 1SQAA 4WY3A 4DURA 1AE8H 4ZMAH 5GWZA 4K1TA 1TYNA 1YCPK 4MNWA 2O8TA 5EQSA 1EB2A 3S7KB 4ZXYH 2FYQA 1AZ8A 1DWDH 1C5XB 3DFJA 1WOFA 1C1UH 6ESTA 1GJDB 2FLBH 2FX6A 2GCTB 1DICA 4DOQA 1C2HA 5EW2H 3RXIA 2B5TB 2GV7A 4YM9A 8LPRA 2ZWLH 1EXFA 1GBHA 2Y5HA 3P70B 1BHXB 2EEKA 2Y5FA 2XW9A 5DP9A 2B7DH 2NU3E 2W3KA 1P57B 1CT4E 2QXIA 3BEIB 1QJ6B 3LH1A 1P2JA 1DWBH 1DY8A 4X1SU 4X6OA 2GTBA 3SHAH 1P03A 4Q2KA 2ZGJA 2H5DA 1QCPA 1ANDA 3MO6A 4O9VA 3VEQB 3PLBA 3UFAA 3A87A 1LTOA 1ZJKA 2I6SA 5HM2A 2CF9H 4KTSA 3IITA 1VCPA 1H9HE 2FP7B 3GOVB 2PUXB 2J38A 2Z3EA 2OTVA 5A8ZA 1LHFH 5JBAS 1IQJA 2P94A 4LZ4B 4BAQB 3ENSB 3Q00A 1YPHC 1C1OA 1Z8GA 4LOYH 1AY6H 1GBCA 4O03A 4X2XA 1Z6EA 2D8WA 1SFIA 5LGOA 2BOKA 1C5SA 1A0LA 3KQEA 3PLKA 2AMQA 3B9FH 1GL1A 1HPGA 1O2JA 1WUNH 4NIYA 2YOLA 1XVMA 4A92A 2VIDA 1IOEA 2OLGA 1UCYH 3K2UA 4BNRA 2B9LA 4CRFA 1MAYA 1O3MA 3GDVA 1F0RA 5T6DA 6CHAB 2SGPE 2TGTA 1G2MA 5FBIA 1DVAH 4CHAB 1P12E 4YOJA 4VGCC 1ESBA 3GY6A 4JMYA 1B0FA 1S6HA 1BRAA 4OS4A 3O8CA 3ATIA 3M37A 1ESTA 2GZ8A 1VCWA 1YKTA 4K8YA 1O2XA 1OOKB 1SL3A 1IQNA 1P3EA 1W3CA 2GZ7A 4JYTA 3RU4T 1O3AA 4Z0KA 2XCNA 3RXPA 1ELDE 3LOXA 3LGYA 3NWUA 1P2NA 1A3BH 3ZZBA 2FESH 4CREA 3MH7A 1O3LA 1C5ZB 3K65B 3T5FH 4B73A 2PTNA 1HAXB 5ESBA 3A7XA 1AVXA 3SJIA 4CR5A 4NA8A 1D6RA 4MNVA 4KELA 1SGPE 4WMEA