1O3GA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA02
2PGQB 3RP2A 4NWLA 2YNBA 1BTUA 3RXUA 4Q7ZA 5K0HA 4D9QA 1QCPA 3RM2H 1D6WA 1Y3UA 2ZTZA 1MTNC 4AYYB 1HLTH 1E36B 1A0HB 3SORA 1O34A 5A0CA 2F9VA 2VWMA 4ZH8A 1ID5H 1V2NT 5TCAA 4I8KA 2FOBA 2SGEE 2SGPE 1RXPA 1G3DA 3LPRA 5EPYA 2EEKA 2G55A 1WV7H 2K1QA 2TRMA 4WMEA 4Y0YE 4MPVA 5DP8A 4U2WA 1W13U 1WQVH 5DP3A 1RJXB 1S6FA 2C93B 3RXVA 2TGDA 1V2WT 3SZNA 3MU5A 3BIUH 1PPZA 1BJVA 3EAJA 1S85A 2ZHFH 4TWYA 1IHSH 1SQTA 1TA6A 1SGQE 4CH8B 1MD7A 2YOLA 3UR9A 1W2KH 3M3SA 2HPPH 4LK4A 5E0HA 3OYPA 3L3TA 1TNLA 1ELDE 1GJ4H 1O31A 4FVBA 4CHAC 1ZGIA 2BTCE 4MVNA 1OX1A 1O2NA 1UMAH 2FOFA 1O3HA 1TPSA 4NA8A 1F5LA 1MCTA 4CREA 3U8OH 1QL8A 1NRNH 1BTPA 1C5SA 2AIQA 1OP8A 1EPTA 1FPCH 4MNVA 1FY5A 4AYVB 1ZJKA 4XFQA 4I32A 4WXVA 1FMGA 4OS2A 3VB7A 1ELTA 3M5NA 1A4WH 1LKBA 4CRFA 3QTOH 1O2QA 1FNIA 2VVUA 1GHAF 3A8CA 5IDKA 4HZHA 1ESAA 2PTCE 3D49H 1TRYA 4O3UA 3FZZA 3FP7E 3SO3A 3RXLA 2H5DA 4ZAEA 2ZPSA 3ZZ6A 1TWXB 5J4SA 1BCUH 1TB6H 3GCHB 2XBXA 4UFGH 1JIMA 1KXAA 4NIWA 1NRPH 1UVSH 4IW4E 1HCGA 1RFNA 2R3UA 3AW0A 3RU4E 2GX4A 1TBQH 3LOXA 1E34B 1G3CA 1HJAC 4FUDA 2QF3A 1P11E 2C8XB 1PPEE 1Z8JB 3U1IB 1T8NA 2GTBA 3HKIB 1ZTJA 3HK6B 5ESTE 2PKSB 5EXNA 1L1NA 1EOJA 4K8YA 1LCYA 2A45B 1Z6EA 4YOGA 2B8OH 4ZHMU 7KMEH 2NU3E 1P3EA 1C5OH 1H8DH 1U6QA 1THRH 5LH8A 4CR9A 1SLXB 1Z1IA 2ZP0H 4WY3A 1NFXA 5JDUB 1VITF 4HI3A 4Y79A 3RMLH 1PPGE 2GMTB 3QN7A 3Q3YA 1O2OA 1AE8H 4JZFH 1A46H 4AN7A 2CHAB 4ZUHA 3PLPA 2RCEA 4MPWA 4GAWA 6GCHF 4LOYH 1V2UT 1FJSA 2BDAA 2WPLS 1NESE 2C8YB 2XWAA 4X8VH 1GJCB 1GMDF 3E0PB 3E91A 2WV4A 1MD8A 1RD3B 1FAXA 2HGTH 4UFEH 3T26A 4B71A 2BLQA 1ETSH 3FP8E 1T8LA 3VGCB 1AB9C 3A7YA 1KLTA 4FUIA 1MH0A 1V3XA 3M3TA 1SGDE 4OS1A 5HM9A 1A7SA 3E3TA 1O3IA 2A7HA 4DCDA 3QK1A 1ZHPA 4XDEA 1O3OA 2JH5D 2ZI2H 3RM0H 1RTKA 1NFUA 8LPRA 1GHBG 4M7GA 5GXPA 1G30B 3BTME 1AFQB 1QB1A 3DFJA 4K69A 1HB0B 2ZDVH 1UTKA 3TNTA 1AU8A 3S7HB 3LGWA 1IQKA 1RGQA 1BMAA 2P3TB 2XCNA 3GISB 4A1XA 2G8TA 2ZHEH 1THPB 2R2MB 4ISLA 4X8UH 1NC6A 4AZ2B 1YPGH 3A7ZA 2PUXB 2HOBA 3SU5A 5AFYH 3A82A 2Z6BD 1GVLA 2Y7XA 4JK6A 1HAVB 1XMNB 1F0UA 2WPJS 1JMOH 3ZZDA 1K1OA 3VXEH 1TAWA 3DHKH 5DK1A 1C5XB 1HJ8A 1QFKH 4O9VA 2O8WA 3ZZBA 1CBWB 7GCHF 1D6RA 1XVOA 1L4ZA 1W7GH 2QC2A 2XYAA 1T4UH 1BT7A 1SFIA 1IQIA 2FOCA 2WUBA 3N7OA 5EQRA 1FIWA 1DE7H 1PPHE 3UOPA 3I29A 1F0RA 2ODPA 4GPGA 2XBVA 2ZFTA 4BANB 1SLUB 5A09A 3SNDA 4X2XA 1QB6A 2B7DH 4D9RA 3K6ZA 1UTJA 3LH1A 2FMJA 1OWDA 1BQYA 4FU8A 4XE4A 1ANEA 1E0FD 2QYIA 1LPZB 1DLKB 1HAPH 3A8AA 1QJ6B 2BQ7B 5GIBA 4ABIA 1BB0B 2Z94A 3CS0A 3ZZ3A 2B0FA 3HK3B 1G32B 2A4OA 3TLOA 2G4UA 1MTWA 2HNTE 1C5UA 1FLEE 2BVRH 4YTAA 3T62A 3V3MA 1Y5BT 3SUEA 1O2HA 1O2MA 1EXFA 1GG6C 3BTDE 3V13A 4NA7A 2AFQB 4NSVA 3HKJB 1P0SH 1TA2A 3RXHA 1O30A 4MPXA 4X8TH 1FZZA 4Y71A 1SHHB 5CHAB 4B2AA 2XCFA 2A4RA 1C5QA 1UTOA 2J38A 3RU4T 1ZOMA 3D23A 1DDJA 3PB1E 2XC4A 5CMXH 3RXQA 2WYJA 1S5SA 2FPZA 2FO9A 2HRVA 1BTYA 1HAVA 3E6PH 2FOEA 4KKDA 1DS2E 2BDHA 3RXSA 2H6MA 2PGBB 3MNCA 1UO6A 1NM6A 1YYY1 1WSSH 2FIRH 2C4FH 4X6MA 1QHRB 2O8MA 3P8NA 5GJ4B 1GVZA 1F7ZA 2J4IA 2FESH 2RA0A 4H6TA 2C8WB 1Q31A 5FBIA 3SBKA 1RIWB 4ABAA 4ABJA 3JZ2B 4Y11E 3RMOH 1WTGH 2J2UA 1DVAH 2ZDNA 2PFEA 2NU4E 4R0IA 2BOKA 2ZGXH 1FY3A 1BRBE 4ZKOU 3O8CA 1EPTC 1ZRBA 2SGDE 5E8EH 2Q6FA 5H4IB 4IC5A 1OYQA 1CHOF 4ABEA 1O2SA 3U98H 1NRRH 1S82A 4HTCH 1AWHB 2VINA 3TH3H 1DWEH 1TYNA 6CHAB 3ESTA 3OY5U 2F83A 1Y3VA 1C5VA 1S81A 3SU2A 1HAZB 4WVPE 1KLIH 5F8XA 4Y6DA 1AVWA 3A83A 3EDXB 1AVGH 1BRCE 1GJ5H 1Z8GA 1AVXA 3EA8A 2VJ1A 1SGRE 2ZHQH 1XKBC 2A31A 2BX3A 3ZVDA 3DFLA 4TY7A 3U8TH 4YESB 3T25A 1GI0A 2BVSH 1OWKA 1C5RA 2VH6A 2Y5HA 2GCTB 4CRCA 4D7FA 4E7NA 1QJ1B 1TIOA 1O2PA 5LPFA 3PROA 1EATA 2O8LA 4YLQH 4B74A 3LJOA 1BTWA 1DY8A 1EP6A 2EC9H 4I31A 1C2GA 4OGYA 1CHGA 3LDXH 5FPYA 3KF2A 3GOVB 5JPMH 4ABHA 1YLDA 1QY6A 5DP6A 2FX4A 4DGJA 3G01A 1ZPCA 1SPJA 3U8RH 1O35A 2BD2A 2QA9E 4ZMAH 1W11U 1O2KA 2ZDLA 4WWYA 3ATMA 4X2VA 4A7IB 1Y5UT 2BY9X 4JYUH 4NIXA 3ZVAA 1ETRH 3RXEA 1P10A 4I7YH 1ZSJA 2GDDA 2GP9B 1GHWH 1SGNE 3RLYH 1KTTB 3SGQE 1K1MA 2H5CA 4NFEA 5C1XA 5I25A 1TQ0B 3QZQA 1C5TA 1JRSA 2HNTC 2ZGJA 3MU4A 3ZZCA 1A0LA 1LHGH 4XBDA 1BUIA 1NPMA 2XNIA 2FTLE 3PLKA 1G36A 1XUGA 3RU4D 2RG3A 2JH6D 5FXLA 5F8ZA 1GHYH 4ASHA 3MU8A 3BIVH 1V6DA 1N8OB 5TJXA 1Q3XA 1K1NA 1P12E 5LPEA 1D3PB 3GCHC 5EOKA 1ANDA 4H42U 1TMBH 2ZG0H 5EQSA 1LVYA 1O2VA 2Z9KA 5C1UA 2UWPA 4KELA 1FY1A 1X7AC 1YCPM 2ANMH 2ZU5A 3STJA 8GCHG 2G5VA 4Y8ZA 1QQUA 5F6MA 1MU8B 1ZPBA 1C1UH 5EPNA 2FYRA 5LPRA 1W10U 3TGJE 1PQ8A 1NTPA 4YT7H 2PKSC 5GCHG 4CRDA 3ATLA 1FN6A 1O3MA 2XC0A 1PFXC 5AHGH 2Y5FA 5PTPA 4Y0ZE 1VITG 1SGPE 1QNJA 2BDGA 2HLCA 3T2NA 1LPGB 3TH2H 1O2IA 4VGCB 1KXBA 1GWAA 1GDNA 1SFQB 2BOHB 4O97A 2ANYA 2Z9GA 2GMTC 1GMDG 1HXEH 3AAVA 4TPIZ 4IN1A 2H9EH 3SNBA 3EE0B 2CHAC 1PQAA 2A1DB 3SU0A 2TGTA 4ZHAA 2F9OA 1HBTH 2BZAA 1WBGB 3UQVA 3R3GB 4JZIA 1BA8B 4NZLA 4BTTB 3Q3KA 3KQBA 2AIPA 4FUHA 3OTJE 3EA7A 1O3GA 3GCTF 1A3BH 1O5AB 1TRNA 3VGCC 5TCCA 1VJ9U 5J4QA 3Q3XA 5E0GA 1ABIH 1GBKA 1BZXE 2AGIX 2BZ6H 1EB1H 1OYTH 3SJOA 5F03A 4OS7A 2CMYA 1EX3A 3M36A 1BRUP 1G3EA 2BQWB 1YPMH 4I8HA 3MH4A 1CU1A 2GCHG 4KGAA 3SHAH 4NIVA 1AFQC 1TX7A 3P70B 1O39A 4H6SB 4FUBA 2QGRA 1AI8H 1UTMA 1GMCG 1TBZH 2VIOA 5JB9S 1IAUA 1BMLA 1GBAA 2HVXA 1JBUH 1KYNA 4JZDH 4AGKA 2QIQA 2D2DA 1FONA 3SV7A 2ZIQH 3BG4B 1VR1H 1QB9A 2JETB 4XSKU 5EXLA 1A1RA 1CT2E 2ZECA 5T6GA 4DVAU 2CF8H 1GBEA 4A5TS 3F9GA 3UIRA 3S0NA 1BHXB 2FX6A 1GBCA 5FAHA 4FUEA 3E8LA 3MO3A 2PKAB 4ZKSU 1C2DA 1SGTA 3OU0A 2VVCA 2W7SA 3AAUA 1VCWA 1Y3WA 1GMHF 1LQDB 3GY4A 4B2BA 1UK3A 2TIOA 1CBWC 1H1BA 4AB8A 1TABE 1W7XH 3A7VA 5AF9H 1SVPA 2QCYA 2BD4A 1K9OE 4GCHF 4JZ1A 2O8UA 4B76A 1AIXH 2CN0H 3GY7A 1VITH 1J14A 3GCNA 2CJIA 4UDWH 4SGAE 1BTZA 2XTTB 1HXFH 7LPRA 2ZQ1A 2OLGA 1GJDB 2WYGA 4NA9H 1HGTH 1BBRK 2UWOA 5FPSA 4YOIA 8ESTE 3GY3A 1LHEH 3RUOA 1BRAA 1DPOA 2ZCLP 3SV2H 1CGHA 1DLEA 1Z8RA 1LHFH 4ABFA 2A2QH 2A4QA 3URDA 1GBDA 4JCNA 1EP5A 2HNTF 3NK8A 3BTGE 1CA8B 3RC6A 2QY0B 2OQUA 2A5IA 1O3CA 1EASA 2PTNA 2FODA 1XUKA 4X1PU 4X0WU 3A86A 1J9CH 1WUNH 5DJ7A 2FYQA 3SQHE 2Z9JA 3IG6B 4B73A 1AGJA 3F9FA 1QRZA 2DE8A 2BMGB 5CHAC 2P8OB 2BD9A 1W0ZU 1ZMNA 1QRWA 3BTHE 3SQEE 5L6NH 3QGJA 4TPYA 3A88A 2AGGX 3GY5A 4DURA 1IQMA 1ESTA 2EI8A 2G51A 4E05H 2KAIB 1E37B 2PKAA 3A84A 4ISNA 1MKWH 1QA0A 1SI5H 3HPTB 2H1UA 4RKJB 1YBWA 1O2XA 3K6YA 3E90B 5A0BA 2O9QA 1EB2A 3RXAA 1VZQH 1C9PA 1NZQH 1DSTA 3QWCH 1K28D 3O8DA 1HAHH 3BEIB 2PV9B 1GCTC 3SNEA 1RIWC 4ZXYH 2ZU1A 1RTLA 4ABBA 4MNWA 2PSYA 3KEEA 1CHOG 2D26C 5FPTA 4CR5A 3LGTA 1P2NA 1ANCA 2R2WU 3VXFH 2GZ7A 1XX9A 4U30A 3OY6U 1O3PB 2ESTE 1K2I1 1C5YB 1N1LA 1XM1A 2ZGHA 1YPLH 1G3BA 3BTWE 6CHAC 1A2CH 1S0RA 3LU9B 3PO1B 3UWJH 3RLWH 3S9AA 3TJVA 1HJ9A 1SGCA 1DUAA 2SGAA 2A32A 1TPAE 1W0YH 3PMHB 3MU1A 1JRTA 2BLWA 4X6NA 3CP7A 4CRBA 2VNTA 1O2TA 3RXPA 3S9CA 2SGQE 5C67A 1ZGVA 4NFFA 2GDEH 4JYVH 5GWZA 2OINA 1WCZA 4FXGH 1GBBA 1O2WA 1OOKB 3EA9A 2ZFSA 1TGNA 4Y10E 1MTVA 2GCTC 5EG4A 3Q76A 3MO9A 4XBCA 1O3KA 3QGNB 3VPKA 3S69A 3SV9A 4WXIA 5DGJA 1P05A 2GV6A 1L2EA 1V2VT 1V2MT 1F2SE 2KAIA 2ZNKH 3GDSA 4GSOA 2BDCA 4MNXA 3SOSA 1O3FA 1O3LA 3C27B 3V12A 1SC8U 4K1EA 4BAMB 1ZMJA 2ZFRH 1AE5A 1C1OA 1C1RA 1HAGE 2ZZUH 1TGTA 3RXOA 2QXHA 1C2HA 1P09A 1O3AA 1BOQA 1M9UA 2XW9A 2ZU3A 5A0AE 1TGCA 1P3CA 2ZGBH 3LKWA 5A2MH 5DP5A 1BBRE 5GDSH 4MQAA 1J17T 4F4OC 1P9SA 1SGYE 2VIQA 4AORA 2ZQ2A 5FX6A 4AG1A 1GBLA 1FN8A 2BYAX 1CGIE 3LT3A 1GBIA 4J2YB 4Y7BA 3M7TA 1GBHA 1P2KA 2A4GA 4QT8C 2BHGA 1W14U 1IQLA 5EXMA 2WPIS 1DOJA 1ZZZA 2Z9IA 1OWIA 1W3CA 2PUQH 3RXIA 3GCOA 2IPHA 4AGJA 4KP0A 2UUFB 1W8BH 4ZXXH 2BY5X 5K7RA 1KDQB 7ESTE 1YLCA 2OD3B 2GD4B 2GT8A 4AB9A 1TBRH 1TPOA 4IC6A 3VFEA 1N8OC 1NRSH 5JBTA 3KL6A 1D4PB 4J1YA 1JIRA 1YPEH 2F9UA 1YPHE 1C5MD 4UFFH 4AFSA 1VGCB 1SQAA 1Y3XA 2PHBA 5T3HA 1GJ6A 5EW2H 1C2LA 2P59A 5IYTA 5T6DA 2FLBH 2BD7A 2ZDKA 6LPRA 1GDUA 2FOHA 1GHZA 5HXFA 5DKMA 2H9HA 1YP9A 2VB0A 1BMMH 4ZKRU 2NU2E 1GI6A 3EQ0H 2A7JA 3VEQB 2J34A 1CT0E 2WPHS 5FBEA 3SGAE 5EU8A 2VVVA 3LGIA 1UTQA 1GHXH 3CS7A 4MNYA 1KIGH 2BD8A 4TWWA 1UK4A 4IS5A 1O36A 4O3TA 1AD8H 2VIWA 4VGCC 4A92A 3FFGA 5DP4A 2FI3E 4INKA 3BEUA 3SHCH 2I6SA 1YGCH 1WQSA 2W3KA 5HYOA 2STBE 1QL7A 1GBJA 2BLVA 2QAAA 4LZ4B 1MKWK 1FI8A 3SU6A 3MTYA 1THSH 1TLDA 4F49A 4RSPA 1TX8A 3ZZ8A 3L6PA 1HPGA 1O33A 3CENA 4K60A 1VCPA 4LZ1H 2AH4X 3M61U 1IQGA 4UEHH 1ARCA 2STAE 4KTSA 2CF9H 3KN2A 2GZ9A 4X2WA 2VGCB 4SGBE 3ZVCA 5JYIA 3QLPH 3GYLB 1KDQA 1KXEA 2PSXA 4ISHH 2Y80A 2ZU4A 3MO6A 1HAXB 2G81E 3LC5A 4Z0KA 1C1QA 1UJ1A 2Z3CA 1GCTB 3TK9A 1JWTA 1P2IA 2ZC9H 2J95A 4JZEH 3C1KA 2BD5A 1NO9H 3ELAH 4TY6A 1KY9A 3GY6A 1V2PT 1QA7A 3SI4H 1L0ZA 1HAOH 1S6HA 5A8XA 3BG4C 2H9TH 3NPSA 2JETC 1C5LH 1DICA 4THNH 3P8OA 4XOJA 2O8TA 3STIA 1ZSKA 3W95A 2VH0A 1AZZA 3EYDA 1QJ7B 1ZSLA 3QO6A 3RXJA 1FXYA 3LJJA 1SR5C 1NN6A 1MTUA 3BG8A 3ZZ4A 5L30H 1SOTA 4OS5A 3GY2A 4JMYA 1L1GA 4AFQA 2SNWA 1A0JA 3FAOA 3KNXA 1HUTH 4WJG2 1Q2WA 2EI6A 4INHA 2ZCHP 1EZQA 3TJUA 1H4WA 4CRAA 3SGBE 1HFDA 1P8VC 3AVZA 3PYHA 1QRXA 1O37A 2V6NA 3P8GA 1TNJA 5ETXA 2ZHDA 3DD2H 2FOGA 2BY7X 1B0FA 1A5IA 2AERH 3RC5A 1O3BA 1MAYA 2EI7A 2P93A 2BB4A 4AOQA 1XXDA 3QUMP 1YC0A 1AMHA 1S83A 2HALA 3BTKE 3IWMA 4D7GA 3SV8A 1IHTH 2C8ZB 3IITA 2ZPQA 3F1SB 1CVWH 1YPHC 4NCYA 3I78A 2C3SA 1BBRH 1PJPA 1DX5M 4NZQA 3Q77A 2ZHWH 1O5CB 1J15A 3TITA 4JYTA 3RXCA 5BRRE 1QBOA 2ZA5A 2V3OH 1MQ5A 3UQOA 4DJZB 3ITIA 1O2YA 1CSOE 1UTNA 3ZZAA 1MKXK 2P8OC 1NT1A 2F3CE 4X8SH 1C9TA 1GJ7B 4BTIB 2LPRA 1C1SA 1E35B 1XUJA 2AMQA 1AKSB 1GHAG 3D65E 3ZVBA 3SI3H 1GI2A 1PPCE 3LH3A 3UR6A 1GGDC 1K1JA 4ABDA 1GHBF 2D8WA 1TNHA 3UNSA 2RDLA 1GL1A 3TH4H 1EKBB 3OX7U 1G2LA 3A8BA 3UUZA 4UFDH 3B23B 1LMWB 4BAKB 1V2LT 3FANA 2UUJB 1AUTC 2IN2A 3OSYA 2VU8E 3KQEA 4DW2U 3TPIZ 1GJ8B 3E1XB 4DG4A 3M37A 1FPHH 1UHBB 2OTVA 2A5AA 2BY6X 3TGIE 1A5HA 4IMZA 1AHTH 1C4U2 3U9AH 2P95A 4DT7B 3BTFE 1T32A 2IOTA 2V3HH 1LVOA 1NRQH 1OPHB 1PQ5A 3S9BA 2BD3A 1H8IH 4YO9A 2Q6DA 2ZFQH 1ELGA 2Y5GA 3PMAB 1OWHA 2P3FH 1QGFA 3V0XA 2VWOA 2FZZA 2AGEX 1GPZA 3PO1C 3TIUA 1Z1JA 1MAXA 1P03A 1TX6A 3O8RA 1ARBA 3BTEE 1UCYH 1XVMA 1ZR0A 1S0QA 3K65B 2Y7ZA 6GCHG 1O2UA 3SU1A 1J8AA 4BXWA 3B8JA 1OKXA 4HGCA 1GBTA 3RXFA 3TU7H 3DUXH 1WTHD 4LXBH 1MQ6A 1TGSZ 3MU0A 2TGPZ 3MH7A 2Q1JA 5B6OA 2XBYA 6ESTA 1HYLA 3MOCA 4WMDA 5T6FA 5CE1A 2FOMB 3KCGH 2H2ZA 2ILNA 3ODDA 1B0EA 1DWBH 1AKSA 1HV7A 4GUXA 3SN8A 2IJOB 2ZEBA 1KTSB 4A1VA 3KGPA 3KQDA 2J9NA 2BDBA 1LPKB 3TK5A 1KSNA 2XRCA 5C5NA 1C5WB 2PR3A 4KTCA 4WF8A 2VIPA 5A8ZA 2FTMA 3M3VA 3UPEA 1GDQA 3K9XB 2EA3A 1SL3A 1F0SA 2R0KA 3ZZ5A 1UHBA 1LDTT 1BJUA 3RDZA 1YKTA 3PTNA 1KXDA 4X1RU 1EQ9A 4BNRA 2ZF0H 2ZFPH 1ELEE 4YZUA 2WV5A 1DXWA 2WPMS 3RXBA 1W12U 5AFZH 3SUDA 1DUEA 4X6PA 1SLWB 5ABWA 1GBMA 3PWCA 4WH8A 1N6XA 3DA9B 3MH5A 2TGAA 1TMUH 3UNRA 7GCHG 1GJBB 2XBWA 3AASA 3QX5H 1DXPA 4DOQA 4ESTE 2BXTH 1F92A 1VCQA 3SJ9A 2A2XH 2FDAA 3NCLA 3GYMA 4GLYA 3ZV9A 3A7XA 1GI5A 1ETTH 4OS6A 1SHYA 3LGUA 1EZUC 4K1TA 2ANKH 1SGIB 1IOEA 3I77A 1VGCC 3L33A 1C5NH 5EODA 2A5KA 2QF0A 1O2RA 4DIHH 2DUCA 1K1PA 2OP9A 2Z3EA 2NU1E 1IQHA 1P2JA 1P04A 1CA0B 1HDTH 3A7TA 3ENSB 5GPIB 2B5TB 9LPRA 4MG3A 1E38B 3PM3A 1C5ZB 1O3EA 2GV7A 1B5GH 1LQEA 1BIOA 3ZVFA 4ABGA 1J16A 1H9IE 1O5GH 3P92A 3RXRA 1ELVA 4ISIH 1TALA 2FS8A 2PWXA 4PROA 2ZO3H 1C1NA 1ABJH 5C5OA 1UTPA 3GDUA 1MUEB 2ANWA 3BTQE 3T27A 3GDVA 3SJKA 4KTUA 1O5DH 1KLJH 3PMJA 4TYDA 3T5FH 1C1TA 1PYTC 1K21H 3A80A 3RMNH 3W94A 4GVUA 3UFAA 2ZPRA 5EGMA 1FIZA 2OC0A 5LGOA 1Z7KA 2PLXA 1G2MA 1GGDB 3PV4A 2Z9LA 4OGXA 1WYKA 1JXPA 1IQFA 1ZYOA 1O5EH 2ZTXA 3GICB 1ZLRA 4Y8XA 2G00A 1O2GH 5DPAA 3SUGA 1D9IA 1ELAA 3RMMH 1DITH 4I8LA 1TFXA 1V2TT 2VGCC 3F9EA 2FI5E 1KXFA 1P01A 1XUIA 2V35A 4IMQA 1YM0A 1CGJE 5F8TA 1C2MA 3MH6A 3E0NB 2ODQA 2UWLA 3BV9B 1TONA 3F68H 1WU1A 3QDZB 5E0JA 5L2YH 4FU7A 1UCYK 1QR3E 2FXRA 5JBAS 2ALVA 1O2LA 1OWEA 3NUMA 4Y7AA 5DP7A 2OC8A 2G4TA 2GT7A 3NKKA 1Z71A 3RC4A 4E06H 1DWDH 1TNKA 4Q2KA 1OP0A 4GHTA 1ANBA 1EUFA 1V2ST 4K8BA 1GVKB 4ZHLU 8GCHF 1L4DA 3BF6H 2FM2A 1WAYB 3JZ1B 4Y76A 2AMPA 2FLRH 1G9IE 4BOHA 1CT4E 1K1IA 1AO5A 1A5GH 1QQ4A 1PQ7A 2B9LA 2OXSA 1TNIA 4Q80A 1T4VH 3KIDU 4OS4A 5GCHF 2BQ6B 2GKVE 2G5NA 1IQJA 1D3QB 4I33A 2GVFA 3A7WA 1EAWA 2XXLA 2SNVA 4BXSA 4ISOA 5FX5A 3URCA 1UVTH 3LIWA 1ESBA 1O5BB 1GI3A 1QBNA 3M7QA 3VB5A 4HFPB 3UWIA 4YLUA 3HGPA 1GBFA 1AZ8A 4I8GA 1EOLA 1HNEE 5FHTA 4IBLH 5BPEA 1D3TB 1SGFA 1ZPZA 1DM4B 1O3DA 4BAHB 3MMGA 1MU6B 4XBBA 1UVPA 5C20A 1OSSA 4YT6H 2R9PA 3M35A 3FP6E 4R8TB 4A1TA 5DG6A 1V2RT 2LNCA 3A8DA 3UTUH 2XWBI 1O3JA 2I6QA 2A0QB 1EAXA 4CH2B 2GCHF 1ZRKA 1MKXH 1C1PA 1O2ZA 1L1JA 1RRKA 1UTLM 1GMCF 1DWCH 4H4FA 1NFWA 4K2YA 3UREA 2JKHA 2AYWA 2Q6GA 1SSXA 3WY8A 1V2QT 2ZFFH 3RXMA 1MCVA 1PYTD 1OWJA 1BITA 1PPBH 3MNBA 3SNAA 1T31A 2ZTYA 2JH0D 4UD9H 1TOCB 2OC1A 1MTNB 1YF4A 3QTVH 2UUKB 1T7CA 2FP7B 4RKOB 5JB8S 4X1QU 4A6LA 2VWNA 3MYWA 4MLFB 2ZWLH 3VB4A 2C90B 1LHDH 1ZMLA 2PW8H 1ORFA 4CRGA 1H9HE 5E2OA 2ULLA 3K2UA 2R3YA 3BEFB 5SGAE 1AUJA 3M5MA 5DP9A 2P3UB 3H7OA 1YCPH 1NS3A 2ZDAH 1GJAB 2WPKS 1UCYE 2TBSA 3T29A 1DANH 2OBOA 3ZZ7A 3F9HA 5C3NA 2CGAA 1V2JT 4E7RG 3GCTG 5JBCS 3HGNA 1V2OT 4U32A 1SOZA 4CBOA 3F6UH 2G52A 2Y6TA 1CO7E 2BXUH 5JBBS 1LTOA 1DT2A 1P06A 4CHAB 3V7TA 1C1VH 1P2QA 4DIIH 2FI4E 1AY6H 1A61H 1HAIH 1O0DH 1FUJA 4K3JA 5HGGA 4JK5A 4YOJA 1IQNA 1Z8IB 2BY8X 1XUHA 1QBVH 3MNSA 1MTSA 1GI4A 1ELBA 2CV3A 2AS9A 2P94A 2THFB 3TNSA 1IQEA 1RTFB 2OBQA 3B9FH 1PPFE 1QIXB 3ZV8A 1F5RA 3EGKH 5HMAA 4AX9H 1INCA 3ODFA 1T8OA 3BSQA 3D62A 4NGAH 2BVXH 1NFYA 2BDYA 3UOUA 2ZDMA 3MWIU 1C2IA 3LC3A 1C2JA 3M7UA 4O03A 5C1YA 1SBWA 2QV1A 1P57B 3A85A 8KME2 1ACBE 1GMHG 1O5FH 1N6YA 3FZDA 1O32A 3BN9A 3NWUA 1FV9A 2F9PA 3NZIA 3MHWU 2Z7FE 3TJNA 3LONA 1ELCA 1UK2A 1LKAA 3SJ8A 4GCHG 3A81A 1HJAB 4CBNA 4D76A 1C1MA 2HPQH 2YNAA 3LGYA 3A89A 1EAUA 1AN1E 2ASUB 1EAIA 2ZCKP 2ZGCA 1NROH 3SU3A 4BTUB 4WMFA 4AG2A 3U1JB 1JOUB 1GCDA 3QZRA 1TPPA 2WUCA 3KHVA 3LGVA 1MZDA 4Q7XA 5E2PA 2QXIA 1RS0A 4BAQB 5EQQA 2NU0E 1LVBA 3U69H 9ESTA 1CA0C 1EJNA 1GI1A 3MNXA 4AFZA 2ODYB 2GZ8A 1FQ3A 4IGDA 1MZAA 3AW1A 2Y81A 4NSYA 1K22H 4K5ZA 4RN6A 2QN5T 5A8YA 1AFEH 1SGFG 3H5CB 1DFPA 4FU9A 1GHVH 3RXKA 1C2EA 1AB9B 1EZXC 2WINI 3UNQA 1LVMA 3KQCA 3SNCA 1SLVB 3PWBA 4WH6A 3S7KB 3M5OA 2VWLA 1AQ7A 5ESBA 4Z6AH 2BDIA 2OCVB 1V2KT 3ZVGA 4B2CA 4UONA 1ZJDA 2UUYA 3ATIA 2FEQH 2TPIZ 1ZHRA 4U01A 1CQQA 3SUFA 1P9UA 1MMJN 1SMFE 2FOAA 2BLOA 4MDSA 4FVDA 3ATWA 2XC5A 2SGFE 2ZU2A 2QXGA 2A7CA 3O8BA 4ZKNU 1C1WH 1EJAA 2W7UA 4MTBA 1FAKH 1BMNH 1DY9A 2ALPA 5FCKA 2Y82A 3NXPA 4AFUA 4BAOB 3MI4A 3TVJB 4X6OA 3BTTE 1HIAB 1KXCA 4B1TA 5L2ZH 5C2ZA 4I8JA 2F9BH 1Y5AT 1ELFA 1ZTKA 3Q00A 4Q7YA 1NU9A 1B7XB 3GY8A 1TE0A 3SU4A 2R0LA 4ZROA 5HM2A 4X1SU 1UVUH 5DO4H 3RXGA 1C2KA 5EW1H 2GGVB 1G37A 3PMBB 4GHQA 1YCPK 2NWNA 1GI8B 2OC7A 4DY7B 1O2JA 1QTFA 1GL0E 3PTBA 1F0TA 1SQOA 1XUFA 1TQ7B 2HWLB 2RA3A 3VB6A 4MPUA 1P2OA 4Y8YA 1Y8TA 4NIYA 4NG9H 3E16B 1TOMH 3FVFB 3M5LA 2D1JA 1C4V2 1ZHMA 1Y3YA 1ZTLA 3ZYEA 4D8NA 2QXJA 3SW2B 1K1LA 1QURH 4FUJA 2BX4A 1D3DB 2CXVA 2DE9A 1Y59T 5AVDA 2SFAA 3TJOA 3VB3A 1YPJH 2F9NA 2AMDA 1O3NA 1F5KU 1T8MA 4YM9A 1LHCH 1BTXA 1GG6B 1OS8A 5FCRA 2OUAA 1GI7B 1QL9A 3ATKA 3ZVEA 2V0BA 2M5TA 1C5PA 2Z3DA 3T28A 3ZYDA 3SV6A 2J94A 3R0FA 3RXTA 4INLA 3MFJA 2W26A 3P17H 4X2YA 1OXGA 1BHXF 1BTHH 5I46H 1FY4A 2OQ5A 2VIVA 1AWFH 1P02A 3DT0H 2ZKSA 1HIAA 1SGEE 1XKAC 2VIDA 1O38A 1P2MA 1A3EH 1SB1H 1GJ9B 1FDPA 1YPKH 1HAYB 1EJMA 4FUCA 3SJIA 3ZZ9A 1Z6JH 1MBQA 3RXDA 1BDAA 1C4Y2 1LO6A 4B75A 1TGBA 3UY9A 1MBMA 3TK6A 2AEIH 1SG8B 1HRTH 3P8FA 1WOFA 1S84A 3TGKE 1TRMA 1GI9B 2F91A 1VJAU 4X1NU 3PLBA 1FY8E 2BM2A 4IN2A 1H9LB 4K1SA 1EZSC 3HATH 1C2FA 1EPTB 2FWWA 4UE7H 1NY22 1CE5A 1NU7B 3A87A 1XXFA 3P95A 2W5EA 4FUGA 2J92A 4FUFA 2P16A 1OP2A 1TMTH 3H7TA 3P6ZB 4NWKA 2FS9A 5G4BA 1UVOA 2W3IA 1DSUA 1TNGA
chains in the Genus database with same CATH superfamily
2PGQB 3RP2A 4NWLA 2YNBA 1BTUA 3RXUA 4Q7ZA 5K0HA 4D9QA 1QCPA 3RM2H 1D6WA 1Y3UA 2ZTZA 1MTNC 4AYYB 1HLTH 1E36B 2J98A 1A0HB 3SORA 1O34A 5A0CA 2F9VA 2VWMA 4ZH8A 1ID5H 1V2NT 4HG6A 5TCAA 4I8KA 2FOBA 2SGEE 2XOKD 2SGPE 1RXPA 1G3DA 3LPRA 5EPYA 2EEKA 2G55A 4ASUD 1WV7H 2K1QA 2TRMA 4WMEA 4Y0YE 4MPVA 5DP8A 4U2WA 1W13U 1WQVH 5DP3A 1RJXB 1S6FA 2C93B 3RXVA 2TGDA 1V2WT 3SZNA 4DT4A 3MU5A 3BIUH 1PPZA 1BJVA 3EAJA 1S85A 2ZHFH 4TWYA 1IHSH 1SQTA 1TA6A 1SGQE 4CH8B 5KGOA 1MD7A 2YOLA 3UR9A 1W2KH 3M3SA 2HPPH 4LK4A 5E0HA 3OYPA 3L3TA 1TNLA 1ELDE 1GJ4H 1O31A 4FVBA 4CHAC 3OFND 5EJLA 1ZGIA 2BTCE 4MVNA 1OX1A 1O2NA 1UMAH 2FOFA 1O3HA 1TPSA 4NA8A 1F5LA 1MCTA 4CREA 3U8OH 1QL8A 1NRNH 1BTPA 1C5SA 2AIQA 1OP8A 1EPTA 1FPCH 4MNVA 1FY5A 4AYVB 1ZJKA 4XFQA 4I32A 4WXVA 1FMGA 4OS2A 3VB7A 1ELTA 3M5NA 1A4WH 1LKBA 4CRFA 3QTOH 1O2QA 1FNIA 2VVUA 1GHAF 3A8CA 2YMSC 5IDKA 4HZHA 1ESAA 2PTCE 3D49H 1TRYA 4O3UA 3FZZA 3FP7E 3SO3A 2IJD1 5KECA 3RXLA 2H5DA 4ZAEA 2ZPSA 3ZZ6A 1TWXB 5J4SA 1BCUH 1TB6H 3GCHB 2XBXA 4UFGH 1JIMA 1KXAA 4NIWA 1NRPH 1UVSH 4IW4E 1HCGA 1RFNA 2R3UA 4TSFD 3AW0A 3RU4E 2GX4A 4YXWD 1TBQH 3LOXA 1E34B 1G3CA 1HJAC 4FUDA 2QF3A 1P11E 2C8XB 1PPEE 1Z8JB 3U1IB 1T8NA 2GTBA 3HKIB 1ZTJA 3HK6B 5ESTE 2PKSB 5EXNA 1L1NA 1EOJA 4K8YA 1LCYA 2A45B 1Z6EA 4YOGA 2B8OH 3OE7D 4ZHMU 7KMEH 2NU3E 1P3EA 1C5OH 1H8DH 1U6QA 1THRH 5LH8A 4CR9A 1SLXB 1Z1IA 2ZP0H 4WY3A 1NFXA 5JDUB 1VITF 4HI3A 4Y79A 3RMLH 1PPGE 2GMTB 3QN7A 3Q3YA 1O2OA 1AE8H 4JZFH 1A46H 4AN7A 2CHAB 4ZUHA 3PLPA 2RCEA 4MPWA 4GAWA 6GCHF 4LOYH 1V2UT 1FJSA 2BDAA 2WPLS 1NESE 2C8YB 2XWAA 4X8VH 1GJCB 1GMDF 3E0PB 3E91A 2WV4A 1MD8A 1RD3B 1FAXA 2HGTH 4UFEH 3T26A 4B71A 5IK2D 2BLQA 1ETSH 3FP8E 1E1QD 1T8LA 3VGCB 1AB9C 3A7YA 1KLTA 4FUIA 1MH0A 1V3XA 3M3TA 1SGDE 4OS1A 5HM9A 1A7SA 3E3TA 1O3IA 2A7HA 4DCDA 3QK1A 1ZHPA 4XDEA 1O3OA 2JH5D 2ZI2H 3RM0H 1RTKA 1NFUA 8LPRA 1GHBG 4M7GA 5GXPA 1G30B 3BTME 1AFQB 1QB1A 3DFJA 4K69A 1HB0B 2ZDVH 1UTKA 3TNTA 1AU8A 2WHXA 3S7HB 3LGWA 1IQKA 1RGQA 1BMAA 2P3TB 2XCNA 3GISB 2W6ID 4A1XA 2G8TA 2ZHEH 1THPB 2R2MB 4ISLA 4X8UH 1NC6A 4AZ2B 1YPGH 3A7ZA 2PUXB 2HOBA 3SU5A 5AFYH 3A82A 2Z6BD 1GVLA 2Y7XA 4JK6A 1HAVB 1XMNB 1F0UA 2WPJS 1JMOH 3ZZDA 1K1OA 2LP6A 3VXEH 1TAWA 3DHKH 5DK1A 1C5XB 1HJ8A 1QFKH 4O9VA 2O8WA 3ZZBA 1CBWB 7GCHF 1D6RA 1XVOA 1L4ZA 1W7GH 2QC2A 2XYAA 1W0JD 1T4UH 1BT7A 1SFIA 1IQIA 2FOCA 2WUBA 3N7OA 5EQRA 5KEDA 1FIWA 1DE7H 1PPHE 3UOPA 3I29A 1F0RA 2ODPA 4GPGA 1E79D 2XBVA 2ZFTA 4BANB 1SLUB 5A09A 3SNDA 4X2XA 1QB6A 2B7DH 4D9RA 3K6ZA 1UTJA 3LH1A 2FMJA 1OWDA 1BQYA 4FU8A 4XE4A 1ANEA 1E0FD 2QYIA 1LPZB 1DLKB 1HAPH 2WV9A 3A8AA 1QJ6B 2BQ7B 5GIBA 4ABIA 2YMSD 3F0OA 1BB0B 2Z94A 3CS0A 3ZZ3A 2B0FA 3HK3B 1G32B 3F2HA 2A4OA 3TLOA 2G4UA 1MTWA 2HNTE 1C5UA 1FLEE 2BVRH 4YTAA 3T62A 3V3MA 1Y5BT 3SUEA 1O2HA 1O2MA 1EXFA 5CDFE 1GG6C 3BTDE 3V13A 4NA7A 2AFQB 4NSVA 3HKJB 1P0SH 1TA2A 5HIZA 3RXHA 1O30A 4MPXA 4X8TH 1FZZA 4Y71A 1SHHB 5CHAB 4B2AA 2XCFA 2A4RA 1C5QA 1UTOA 2J38A 3RU4T 1ZOMA 3D23A 1DDJA 3PB1E 5F53A 2XC4A 5CMXH 4Z1MD 3RXQA 2WYJA 1S5SA 2FPZA 2FO9A 2HRVA 1BTYA 1HAVA 3E6PH 2FOEA 4KKDA 1DS2E 2BDHA 3RXSA 2H6MA 2PGBB 3MNCA 1UO6A 1NM6A 4Q4LA 1YYY1 1WSSH 3PV2A 2FIRH 2C4FH 4X6MA 1QHRB 2O8MA 3P8NA 5GJ4B 4FETA 1GVZA 1F7ZA 2J4IA 2FESH 2RA0A 4H6TA 2C8WB 3WWFA 1Q31A 5FBIA 3MQKC 3SBKA 1RIWB 4ABAA 3AK5A 4ABJA 3JZ2B 4Y11E 3RMOH 1WTGH 2J2UA 1DVAH 2ZDNA 2PFEA 2NU4E 4R0IA 2BOKA 2ZGXH 1FY3A 1BRBE 4ZKOU 3O8CA 1EPTC 1ZRBA 2SGDE 5E8EH 2Q6FA 5H4IB 4IC5A 1OYQA 1CHOF 4ABEA 1O2SA 3U98H 2JJ2D 1NRRH 1S82A 4HTCH 1AWHB 2VINA 3TH3H 1DWEH 1TYNA 6CHAB 3ESTA 3OY5U 2F83A 1Y3VA 1YWUA 1C5VA 1S81A 3SU2A 1HAZB 4WVPE 1KLIH 5F8XA 4Y6DA 1AVWA 3A83A 3EDXB 1AVGH 1BRCE 1GJ5H 1Z8GA 1AVXA 3EA8A 2VJ1A 5C0TA 1SGRE 2ZHQH 3DSOA 1XKBC 2A31A 2BX3A 3ZVDA 3DFLA 4TY7A 3U8TH 4YESB 3T25A 1GI0A 2BVSH 1OWKA 1C5RA 2VH6A 2Y5HA 2GCTB 4CRCA 4D7FA 4E7NA 1QJ1B 1TIOA 1O2PA 5LPFA 3PROA 2KM0A 1EATA 2O8LA 4YLQH 4B74A 3LJOA 1BTWA 1DY8A 1EP6A 2EC9H 4I31A 1C2GA 4OGYA 1CHGA 3LDXH 5FPYA 3KF2A 3GOVB 5JPMH 4ABHA 1YLDA 1W0KD 1QY6A 3PV5A 5DP6A 2FX4A 4DGJA 3G01A 1ZPCA 1SPJA 3U8RH 1O35A 2BD2A 2QA9E 4ZMAH 1W11U 1O2KA 2ZDLA 4WWYA 3ATMA 4X2VA 4A7IB 1Y5UT 2BY9X 4JYUH 4NIXA 3ZVAA 1ETRH 3RXEA 1P10A 4I7YH 2JDID 1ZSJA 2GDDA 2GP9B 1GHWH 1SGNE 3RLYH 1KTTB 3SGQE 1K1MA 2H5CA 4NFEA 5C1XA 5I25A 1TQ0B 3QZQA 1C5TA 1JRSA 2HNTC 2ZGJA 3MU4A 3ZZCA 1A0LA 1LHGH 4XBDA 1BUIA 1NPMA 3NRLA 3N7DA 2XNIA 2FTLE 3PLKA 1G36A 1XUGA 3RU4D 2RG3A 2JH6D 5FXLA 5F8ZA 1GHYH 4ASHA 3MU8A 3BIVH 1V6DA 1N8OB 5TJXA 3UB0A 1Q3XA 1K1NA 1P12E 5LPEA 1D3PB 3GCHC 5EOKA 2M2AA 1ANDA 4H42U 1TMBH 2ZG0H 5EQSA 1LVYA 1O2VA 2Z9KA 5C1UA 2UWPA 4KELA 1FY1A 1X7AC 1YCPM 2ANMH 2ZU5A 3STJA 8GCHG 2G5VA 4Y8ZA 3SYJA 1QQUA 5F6MA 1MU8B 1ZPBA 1C1UH 5EPNA 2FYRA 5LPRA 1W10U 3TGJE 1PQ8A 1NTPA 4YT7H 2PKSC 5GCHG 4CRDA 3ATLA 1FN6A 1O3MA 2XC0A 1PFXC 5AHGH 2Y5FA 5PTPA 4Y0ZE 1VITG 1SGPE 1QNJA 2BDGA 2HLCA 3T2NA 1LPGB 3TH2H 1O2IA 4VGCB 1KXBA 1GWAA 1GDNA 1SFQB 2BOHB 4O97A 2ANYA 2Z9GA 2GMTC 1GMDG 1HXEH 3AAVA 4TPIZ 4IN1A 2H9EH 3SNBA 3EE0B 2CHAC 1PQAA 2A1DB 3SU0A 2TGTA 4ZHAA 2F9OA 1HBTH 2BZAA 1WBGB 3UQVA 3R3GB 1EFRD 4JZIA 1BA8B 1SQRA 4NZLA 4BTTB 3Q3KA 3KQBA 2AIPA 4FUHA 3OTJE 3EA7A 1O3GA 3GCTF 1A3BH 4RT0A 1O5AB 1TRNA 3VG8A 3VGCC 5TCCA 1VJ9U 5J4QA 3Q3XA 5E0GA 1ABIH 1GBKA 1BZXE 2AGIX 2BZ6H 1EB1H 1OYTH 3SJOA 5F03A 4OS7A 2CMYA 1EX3A 3M36A 1BRUP 1G3EA 2BQWB 1YPMH 4F55A 4I8HA 3MH4A 1CU1A 2GCHG 4KGAA 3SHAH 4NIVA 1AFQC 1TX7A 3P70B 1O39A 4H6SB 4FUBA 2QGRA 1AI8H 1UTMA 1GMCG 1TBZH 2VIOA 5JB9S 1IAUA 1BMLA 1GBAA 2HVXA 1JBUH 1KYNA 4JZDH 4AGKA 2QIQA 2D2DA 1FONA 3SV7A 2ZIQH 3BG4B 1VR1H 1QB9A 1WXRA 2JETB 4XSKU 5EXLA 1A1RA 1CT2E 2ZECA 5T6GA 4DVAU 2CF8H 1GBEA 4A5TS 3F9GA 3UIRA 3S0NA 1BHXB 2FX6A 1GBCA 5FAHA 4FUEA 4P02A 3E8LA 3MO3A 2PKAB 4ZKSU 1C2DA 1SGTA 3OU0A 2VVCA 2W7SA 3AAUA 1VCWA 1Y3WA 1GMHF 1LQDB 3GY4A 4B2BA 1UK3A 2TIOA 1S6LA 1CBWC 1H1BA 4AB8A 1TABE 1W7XH 3A7VA 5AF9H 1SVPA 2QCYA 2BD4A 1K9OE 2JIZD 4GCHF 4JZ1A 2O8UA 4B76A 1AIXH 2CN0H 3GY7A 1VITH 1J14A 3GCNA 2CJIA 4UDWH 4SGAE 1BTZA 2XTTB 1HXFH 7LPRA 2ZQ1A 2OLGA 1GJDB 2WYGA 4NA9H 1HGTH 1BBRK 2UWOA 5FPSA 4YOIA 8ESTE 3GY3A 1LHEH 3RUOA 1BRAA 1DPOA 2ZCLP 3SV2H 1CGHA 1DLEA 1Z8RA 1LHFH 4ABFA 2A2QH 2A4QA 3SZEA 3URDA 1GBDA 4JCNA 1EP5A 2HNTF 3NK8A 3BTGE 1CA8B 2AHME 3RC6A 2QY0B 2OQUA 4XD7D 2A5IA 1O3CA 1EASA 2PTNA 2FODA 1XUKA 4X1PU 4X0WU 3A86A 1J9CH 1WUNH 5DJ7A 2FYQA 3SQHE 2Z9JA 3IG6B 4B73A 1AGJA 3F9FA 1QRZA 2DE8A 2BMGB 2RFKC 5CHAC 2P8OB 2BD9A 1W0ZU 1ZMNA 1QRWA 3BTHE 3F3BA 3SQEE 3QGJA 5L6NH 4TPYA 2HVYB 3A88A 2AGGX 4P00A 3GY5A 4DURA 1IQMA 1ESTA 2EI8A 2G51A 4E05H 2KAIB 1E37B 2PKAA 3A84A 4ISNA 1MKWH 1QA0A 1SI5H 3HPTB 2H1UA 4RKJB 1SKYE 1YBWA 1O2XA 3K6YA 3E90B 5A0BA 2O9QA 1EB2A 3RXAA 1VZQH 1C9PA 1NZQH 4OM9A 1DSTA 4B6FA 3QWCH 1K28D 1YLNA 3O8DA 1HAHH 3BEIB 2PV9B 1GCTC 3SNEA 1RIWC 4ZXYH 2ZU1A 1RTLA 4ABBA 4MNWA 2PSYA 3KEEA 1CHOG 5EIYA 2PP6A 2D26C 5FPTA 4CR5A 3LGTA 1P2NA 1ANCA 2R2WU 3VXFH 1K0HA 2GZ7A 1XX9A 4U30A 2KFWA 3OY6U 1O3PB 2ESTE 3DSGA 1K2I1 1C5YB 1N1LA 1XM1A 2ZGHA 1YPLH 1G3BA 3BTWE 6CHAC 1A2CH 1S0RA 3LU9B 3PO1B 3UWJH 4XRNA 2WZQA 3RLWH 3S9AA 3TJVA 1HJ9A 1SGCA 1DUAA 2SGAA 2A32A 1TPAE 1W0YH 3PMHB 3MU1A 1JRTA 2BLWA 4X6NA 3CP7A 4CRBA 2VNTA 2V7QD 1O2TA 3RXPA 3S9CA 2SGQE 5C67A 1ZGVA 4M9FA 4NFFA 2GDEH 4JYVH 5GWZA 2OINA 1WCZA 4FXGH 1GBBA 1O2WA 1OOKB 3EA9A 2ZFSA 1TGNA 4Y10E 1MTVA 2GCTC 3ZIAD 5EG4A 3Q76A 3FN8A 3MO9A 4XBCA 1O3KA 3QGNB 3VPKA 3DCLA 3S69A 3SV9A 4WXIA 5DGJA 1P05A 2GV6A 1L2EA 1V2VT 1V2MT 1F2SE 2KAIA 2ZNKH 3GDSA 4GSOA 2BDCA 4MNXA 3SOSA 1O3FA 3DSPA 1O3LA 3C27B 3V12A 1SC8U 4K1EA 4BAMB 1ZMJA 2ZFRH 1AE5A 1C1OA 1C1RA 1HAGE 2ZZUH 1TGTA 3RXOA 2QXHA 1C2HA 1P09A 1O3AA 1BOQA 1M9UA 2XW9A 2ZU3A 5A0AE 1TGCA 1P3CA 2ZGBH 3LKWA 3N99A 5DP5A 5A2MH 1BBRE 5GDSH 4MQAA 1J17T 4F4OC 1P9SA 1SGYE 2VIQA 4AORA 2ZQ2A 5FX6A 4AG1A 1GBLA 1FN8A 2BYAX 1CGIE 3LT3A 1GBIA 4J2YB 4Y7BA 3M7TA 1GBHA 1P2KA 2A4GA 4QT8C 2BHGA 1W14U 1IQLA 5EXMA 2WPIS 1DOJA 1ZZZA 2Z9IA 1OWIA 1W3CA 2PUQH 3RXIA 3GCOA 2IPHA 4AGJA 4KP0A 2UUFB 1W8BH 4ZXXH 2BY5X 3F0PA 5K7RA 1KDQB 7ESTE 1YLCA 2OD3B 2GD4B 2GT8A 4AB9A 1TBRH 1TPOA 4IC6A 3VFEA 1N8OC 1NRSH 5JBTA 3KL6A 1D4PB 4J1YA 1JIRA 1YPEH 2F9UA 1YPHE 1C5MD 4UFFH 4AFSA 1VGCB 1SQAA 1Y3XA 2PHBA 5T3HA 1GJ6A 5EW2H 1C2LA 2P59A 5IYTA 5T6DA 2FLBH 2BD7A 2ZDKA 6LPRA 1GDUA 2FOHA 1GHZA 5HXFA 5DKMA 2H9HA 1YP9A 2VB0A 1BMMH 4ZKRU 2NU2E 1GI6A 3EQ0H 2A7JA 3VEQB 2J34A 1CT0E 2WPHS 5FBEA 3SGAE 5EU8A 2VVVA 3LGIA 1UTQA 1GHXH 3CS7A 4MNYA 1KIGH 2BD8A 4TWWA 1UK4A 4IS5A 1O36A 5C0UA 4O3TA 1AD8H 2VIWA 4VGCC 4A92A 2KR7A 3FFGA 5DP4A 4TT3D 2FI3E 4INKA 3BEUA 3SHCH 2I6SA 1YGCH 1WQSA 2W3KA 5HYOA 2STBE 1QL7A 1GBJA 2BLVA 1E1RD 2QAAA 4LZ4B 1MKWK 1FI8A 3SU6A 3MTYA 1THSH 1TLDA 4F49A 4RSPA 1TX8A 3ZZ8A 1WDIA 3L6PA 1HPGA 1O33A 3CENA 4K60A 1VCPA 4LZ1H 2AH4X 3M61U 1IQGA 4UEHH 1ARCA 2STAE 4KTSA 2F43B 2CF9H 3KN2A 2GZ9A 4X2WA 2VGCB 4SGBE 3ZVCA 5JYIA 3QLPH 3GYLB 1KDQA 1KXEA 2PSXA 4ISHH 2Y80A 2ZU4A 3MO6A 1HAXB 2G81E 2OK5A 3LC5A 4Z0KA 1C1QA 1UJ1A 2Z3CA 1GCTB 3TK9A 1JWTA 1P2IA 2ZC9H 2J95A 4JZEH 3C1KA 2WPDD 2BD5A 1NO9H 3ELAH 4TY6A 1KY9A 3GY6A 1V2PT 1QA7A 3SI4H 1L0ZA 1HAOH 1S6HA 5A8XA 3BG4C 2H9TH 3NPSA 2JETC 1C5LH 1DICA 4THNH 3P8OA 3KQ5A 2O8TA 4XOJA 3STIA 1ZSKA 3W95A 2VH0A 1AZZA 3EYDA 1QJ7B 1ZSLA 2GJGA 3QO6A 1FXYA 3RXJA 3LJJA 1SR5C 1NN6A 1MTUA 3BG8A 3ZZ4A 5L30H 1SOTA 4ACAA 4OS5A 3GY2A 4JMYA 1L1GA 4AFQA 2SNWA 1A0JA 3FAOA 3KNXA 5CHBA 1HUTH 4WJG2 1Q2WA 2EI6A 4INHA 2ZCHP 1EZQA 3TJUA 1H4WA 4CRAA 3SGBE 1HFDA 1P8VC 3AVZA 3PYHA 1QRXA 1O37A 2V6NA 3P8GA 1TNJA 5ETXA 2ZHDA 3DD2H 2FOGA 2BY7X 1B0FA 1A5IA 2AERH 3RC5A 1O3BA 1MAYA 2EI7A 2P93A 2BB4A 4AOQA 1XXDA 3QUMP 1YC0A 3WW7A 1AMHA 1S83A 2HALA 3BTKE 3IWMA 4D7GA 3SV8A 1IHTH 2C8ZB 3IITA 2ZPQA 3F1SB 1CVWH 1YPHC 4NCYA 3I78A 2L6OA 2QE7D 2C3SA 5HIYA 1BBRH 1PJPA 1DX5M 4NZQA 3Q77A 2ZHWH 1O5CB 1J15A 3TITA 4JYTA 3RXCA 5BRRE 1QBOA 2ZA5A 2V3OH 1MQ5A 3UQOA 4DJZB 3ITIA 1O2YA 1CSOE 1UTNA 3ZZAA 1MKXK 1NT1A 2F3CE 2P8OC 4X8SH 1C9TA 1GJ7B 4BTIB 2LPRA 1C1SA 1E35B 1XUJA 2AMQA 1AKSB 1GHAG 3D65E 3ZVBA 3SI3H 1GI2A 1PPCE 3LH3A 3UR6A 1GGDC 1K1JA 4ABDA 1GHBF 2D8WA 1TNHA 3UNSA 2K8IA 2RDLA 1GL1A 3TH4H 1EKBB 3OX7U 1G2LA 3A8BA 3UUZA 4UFDH 3B23B 1LMWB 4BAKB 1V2LT 3FANA 2UUJB 1AUTC 2IN2A 3OSYA 2VU8E 3KQEA 4DW2U 3TPIZ 1GJ8B 5B6LA 3E1XB 4DG4A 3M37A 1FPHH 1UHBB 2OTVA 2A5AA 2BY6X 3TGIE 1A5HA 4IMZA 3PRDA 1AHTH 1C4U2 3U9AH 2P95A 4DT7B 3BTFE 1T32A 2IOTA 2V3HH 1LVOA 1NRQH 1OPHB 1PQ5A 3S9BA 2BD3A 1H8IH 4YO9A 2Q6DA 2ZFQH 1ELGA 2Y5GA 3PMAB 1OWHA 2P3FH 1QGFA 3V0XA 2VWOA 2FZZA 2K0QA 2AGEX 1GPZA 3PO1C 3TIUA 1Z1JA 1MAXA 1P03A 1TX6A 3O8RA 1ARBA 3BTEE 5GNDA 1UCYH 1XVMA 2KCAA 1ZR0A 1S0QA 3K65B 2Y7ZA 4RT1A 1O2UA 3SU1A 6GCHG 1J8AA 4BXWA 3B8JA 1OKXA 4HGCA 3FO8D 1GBTA 3RXFA 3TU7H 3DUXH 1WTHD 4I86A 4LXBH 1MQ6A 1TGSZ 2QF4A 3MU0A 2TGPZ 2LELA 3MH7A 2Q1JA 5B6OA 2XBYA 4RI0A 6ESTA 1HYLA 3MOCA 4WMDA 5T6FA 5CE1A 2FOMB 3KCGH 2H2ZA 2ILNA 3ODDA 1B0EA 1DWBH 1AKSA 1HV7A 4GUXA 3SN8A 2IJOB 2ZEBA 1KTSB 2IPQX 4A1VA 3KGPA 5EJZA 5DN6D 3KQDA 2J9NA 2BDBA 1LPKB 3TK5A 1KSNA 2J97A 2XRCA 5C5NA 1C5WB 2PR3A 4KTCA 4WF8A 2VIPA 5A8ZA 2FTMA 3M3VA 3UPEA 1GDQA 3K9XB 2EA3A 1SL3A 1F0SA 2R0KA 3ZZ5A 1UHBA 1LDTT 3OEED 1BJUA 3RDZA 1YKTA 3PTNA 1KXDA 4X1RU 1EQ9A 4BNRA 2ZF0H 2ZFPH 1ELEE 4YZUA 2WV5A 1DXWA 2WPMS 3RXBA 1W12U 5AFZH 3SUDA 1DUEA 4X6PA 1SLWB 5ABWA 1GBMA 3PWCA 4WH8A 1N6XA 3DA9B 3MH5A 2TGAA 1TMUH 1OHHD 1UW7A 3UNRA 7GCHG 1GJBB 2XBWA 3AASA 3QX5H 1DXPA 4DOQA 4ESTE 2BXTH 1F92A 1VCQA 3SJ9A 2A2XH 2FDAA 3NCLA 3GYMA 5HKKD 4GLYA 3ZV9A 3A7XA 1GI5A 1ETTH 4OS6A 1SHYA 3LGUA 5FL7D 1EZUC 4K1TA 2ANKH 1SGIB 1IOEA 3I77A 1VGCC 3L33A 1C5NH 5EODA 2A5KA 2QF0A 1O2RA 4DIHH 2DUCA 1K1PA 2OP9A 2Z3EA 2NU1E 1IQHA 1P2JA 1P04A 1CA0B 1HDTH 3A7TA 3ENSB 5C94A 5GPIB 2B5TB 9LPRA 4MG3A 1E38B 3H09A 3PM3A 1C5ZB 1O3EA 2GV7A 1B5GH 1LQEA 1BIOA 3ZVFA 4ABGA 1J16A 1H9IE 1O5GH 3P92A 3RXRA 1ELVA 4ISIH 1TALA 1YY3A 2FS8A 2PWXA 4PROA 2ZO3H 1C1NA 1ABJH 5C5OA 1UTPA 3GDUA 1MUEB 2ANWA 3BTQE 3T27A 3GDVA 3SJKA 4KTUA 1O5DH 1KLJH 3PMJA 4TYDA 3T5FH 1C1TA 1PYTC 1K21H 3A80A 3RMNH 3W94A 4GVUA 3UFAA 2ZPRA 5EGMA 1FIZA 2OC0A 5LGOA 1Z7KA 2PLXA 1G2MA 1GGDB 3PV4A 2Z9LA 4OGXA 1WYKA 1JXPA 1IQFA 1ZYOA 1O5EH 2ZTXA 3GICB 1ZLRA 4Y8XA 2G00A 1O2GH 5DPAA 3SUGA 1D9IA 1ELAA 3RMMH 1DITH 4I8LA 1TFXA 1V2TT 2VGCC 3F9EA 2FI5E 1KXFA 1P01A 1XUIA 2V35A 3EE7A 4IMQA 1YM0A 1CGJE 5F8TA 1C2MA 3MH6A 3E0NB 2ODQA 2UWLA 3BV9B 1TONA 3F68H 1WU1A 3QDZB 5E0JA 5L2YH 4FU7A 5C17A 1UCYK 1QR3E 2FXRA 5JBAS 2ALVA 1O2LA 1OWEA 3NUMA 4AC9A 4Y7AA 5DP7A 2OC8A 2G4TA 2GT7A 3NKKA 1Z71A 3RC4A 4E06H 1DWDH 1TNKA 4Q2KA 1OP0A 4GHTA 1ANBA 1EUFA 1V2ST 4K8BA 1GVKB 4ZHLU 8GCHF 1L4DA 3BF6H 2FM2A 1WAYB 3JZ1B 4Y76A 2AMPA 2FLRH 1G9IE 4BOHA 1CT4E 1K1IA 2KCPA 1AO5A 1A5GH 1QQ4A 1PQ7A 2B9LA 2OXSA 1TNIA 4Q80A 1T4VH 3KIDU 4OS4A 5GCHF 2BQ6B 2GKVE 2G5NA 1IQJA 1D3QB 4I33A 1FX0B 2GVFA 3A7WA 3F2GA 1EAWA 2XXLA 2SNVA 4BXSA 4ISOA 3FKSD 5EJ1A 2WSSD 5FX5A 3URCA 1UVTH 3LIWA 1ESBA 1O5BB 1GI3A 1QBNA 3M7QA 3VB5A 4HFPB 3UWIA 4YLUA 3HGPA 1GBFA 2EQNA 1AZ8A 4I8GA 1EOLA 1HNEE 2QF5A 5FHTA 4IBLH 5BPEA 1D3TB 1SGFA 1ZPZA 1DM4B 1O3DA 4BAHB 3MMGA 1MU6B 4XBBA 1UVPA 5C20A 1OSSA 4YT6H 2R9PA 3M35A 2W6JD 3FP6E 4R8TB 1COWD 4A1TA 5DG6A 1V2RT 2LNCA 3A8DA 3UTUH 2XWBI 1O3JA 2I6QA 2A0QB 1EAXA 4CH2B 2GCHF 1ZRKA 1MKXH 1C1PA 1O2ZA 1L1JA 1RRKA 1UTLM 1GMCF 1DWCH 4H4FA 1NFWA 4K2YA 3UREA 2JKHA 2AYWA 3F2FA 2Q6GA 1SSXA 3WY8A 1V2QT 2ZFFH 3RXMA 1MCVA 1PYTD 3GS9A 1OWJA 1BITA 1PPBH 3MNBA 3SNAA 1T31A 2ZTYA 2JH0D 4UD9H 1TOCB 2OC1A 1MTNB 1YF4A 1NBME 3QTVH 2L74A 2UUKB 1T7CA 2FP7B 4RKOB 5JB8S 4X1QU 4A6LA 2VWNA 3MYWA 4MLFB 2ZWLH 3VB4A 2C90B 1LHDH 2EY4C 1ZMLA 2J5UA 2PW8H 1ORFA 4CRGA 1H9HE 1KMHB 5E2OA 5DSFA 2ULLA 3K2UA 2R3YA 3BEFB 5SGAE 1AUJA 3M5MA 5DP9A 2P3UB 3H7OA 1YCPH 1NS3A 2ZDAH 1GJAB 2WPKS 4ACBA 1UCYE 2JJ1D 2TBSA 3T29A 3U28C 1DANH 2OBOA 3ZZ7A 3F9HA 5C3NA 2CGAA 1V2JT 4E7RG 3GCTG 5JBCS 3HGNA 1V2OT 4U32A 1SOZA 2HLDD 4CBOA 3F6UH 2G52A 2Y6TA 1CO7E 2BXUH 5JBBS 1BMFD 1LTOA 1DT2A 1P06A 4CHAB 3V7TA 3W1EA 1C1VH 1P2QA 4DIIH 2FI4E 1AY6H 1H8HD 1A61H 1HAIH 1O0DH 1FUJA 4K3JA 5HGGA 4JK5A 4YOJA 1IQNA 1Z8IB 2BY8X 1XUHA 3OEHD 1QBVH 3MNSA 1MTSA 1GI4A 1ELBA 2V3MA 2CV3A 2AS9A 2P94A 2THFB 3OAAD 3TNSA 1IQEA 1RTFB 2OBQA 3B9FH 1PPFE 1QIXB 2YMSB 1F5RA 3ZV8A 3EGKH 5HMAA 4AX9H 1INCA 3ODFA 1T8OA 3BSQA 3D62A 4NGAH 2BVXH 1NFYA 2BDYA 3UOUA 2ZDMA 3MWIU 1C2IA 3LC3A 1C2JA 3M7UA 4O03A 5C1YA 1SBWA 2QV1A 1P57B 3A85A 8KME2 1ACBE 1GMHG 1O5FH 1N6YA 3FZDA 1O32A 4B6EA 3BN9A 3NWUA 1FV9A 2F9PA 3NZIA 2KCOA 3MHWU 2Z7FE 3TJNA 3LONA 1VKYA 1ELCA 1UK2A 1LKAA 3SJ8A 4GCHG 3A81A 1HJAB 2CK3D 4CBNA 4D76A 1C1MA 2HPQH 2YNAA 3LGYA 3A89A 1EAUA 1AN1E 2ASUB 1EAIA 2ZCKP 2ZGCA 1NROH 3SU3A 4BTUB 4WMFA 4AG2A 3U1JB 1JOUB 1GCDA 3QZRA 1TPPA 2WUCA 3KHVA 3LGVA 1MZDA 4Q7XA 5E2PA 2QXIA 1RS0A 4BAQB 5EQQA 2NU0E 1LVBA 3U69H 9ESTA 1CA0C 1EJNA 1GI1A 3N7EA 3MNXA 4AFZA 2ODYB 3PRBA 3KYGA 2GZ8A 1FQ3A 4IGDA 1MZAA 3AW1A 2Y81A 4NSYA 1K22H 4K5ZA 4RN6A 2QN5T 5A8YA 1AFEH 1SGFG 3H5CB 1DFPA 4FU9A 1GHVH 3RXKA 1C2EA 1AB9B 1EZXC 2WINI 3UNQA 1LVMA 3KQCA 3SNCA 1SLVB 3KYFA 3PWBA 4WH6A 3S7KB 3M5OA 2VWLA 1AQ7A 5ESBA 4Z6AH 2BDIA 2OCVB 1V2KT 3ZVGA 4B2CA 2XNDD 4UONA 1ZJDA 2UUYA 3ATIA 2FEQH 2TPIZ 1ZHRA 4U01A 1CQQA 3SUFA 2KCYA 1P9UA 1MMJN 1SMFE 2FOAA 2BLOA 4MDSA 4FVDA 3ATWA 2XC5A 2SGFE 2ZU2A 2QXGA 2A7CA 3O8BA 4ZKNU 1C1WH 2KX4A 1EJAA 2W7UA 4MTBA 1FAKH 1BMNH 1DY9A 2ALPA 5FCKA 2Y82A 3NXPA 4AFUA 4BAOB 3MI4A 3TVJB 4X6OA 3BTTE 1HIAB 1KXCA 1H8ED 4B1TA 5L2ZH 5C2ZA 4I8JA 5T1VA 2F9BH 1Y5AT 1QZ8A 1ELFA 4Q63A 1ZTKA 3Q00A 4Q7YA 1NU9A 1B7XB 3GY8A 1TE0A 3SU4A 2R0LA 4ZROA 5HM2A 4X1SU 1UVUH 5DO4H 3RXGA 1C2KA 5EW1H 2GGVB 1G37A 3OTPA 3PMBB 4ZCNA 4GHQA 1YCPK 2NWNA 1GI8B 1MABB 2OC7A 4DY7B 1O2JA 1QTFA 1GL0E 3PTBA 1F0TA 1SQOA 1XUFA 1TQ7B 2HWLB 2RA3A 3VB6A 4MPUA 1P2OA 4Y8YA 1Y8TA 4NIYA 4NG9H 3E16B 1TOMH 3FVFB 3M5LA 2D1JA 1C4V2 1ZHMA 1Y3YA 1ZTLA 3ZYEA 4D8NA 2QXJA 3SW2B 2F4LA 1K1LA 1QURH 4FUJA 2BX4A 1D3DB 2CXVA 2DE9A 1Y59T 5AVDA 2SFAA 3TJOA 3VB3A 1YPJH 2F9NA 2AMDA 1O3NA 1F5KU 2J98B 3UAIC 1T8MA 4YM9A 1LHCH 1BTXA 1GG6B 1OS8A 5FCRA 2OUAA 1GI7B 1QL9A 3ATKA 3ZVEA 2V0BA 2RDEA 2M5TA 3CNRA 1C5PA 4F48B 2Z3DA 3T28A 3ZYDA 3SV6A 2J94A 3R0FA 3RXTA 4INLA 3MFJA 2W26A 3P17H 4X2YA 1OXGA 1BHXF 1BTHH 5I46H 1FY4A 2OQ5A 2VIVA 1AWFH 1P02A 3DT0H 2ZKSA 1HIAA 1SGEE 1XKAC 2VIDA 1O38A 1P2MA 1A3EH 1SB1H 1GJ9B 1FDPA 1YPKH 1HAYB 1EJMA 4FUCA 3SJIA 3ZZ9A 1Z6JH 1MBQA 3RXDA 1BDAA 1C4Y2 1LO6A 4B75A 1TGBA 3UY9A 1MBMA 2KZ4A 3TK6A 2AEIH 1SG8B 1HRTH 3P8FA 1WOFA 1S84A 3TGKE 1TRMA 1GI9B 2F91A 1VJAU 4X1NU 3PLBA 3WWBA 1FY8E 2BM2A 4IN2A 1H9LB 4K1SA 1EZSC 3HATH 1C2FA 1EPTB 2FWWA 4UE7H 4FOUC 1NY22 1CE5A 1NU7B 3A87A 1XXFA 3P95A 3FOAA 2W5EA 4FUGA 2J92A 1NBMD 4FUFA 2P16A 2VBCA 1OP2A 1TMTH 3H7TA 3P6ZB 4NWKA 2FS9A 5G4BA 1UVOA 2W3IA 1DSUA 1TNGA
chains in the Genus database with same CATH topology
2PGQB 3RP2A 4NWLA 2YNBA 1BTUA 3RXUA 4Q7ZA 5K0HA 4D9QA 1QCPA 3RM2H 1D6WA 1Y3UA 2ZTZA 1MTNC 4AYYB 1HLTH 1E36B 1A0HB 3SORA 1O34A 5A0CA 2F9VA 2VWMA 4ZH8A 1ID5H 1V2NT 5TCAA 4I8KA 2FOBA 2SGEE 2SGPE 1RXPA 1G3DA 3LPRA 5EPYA 2EEKA 2G55A 1WV7H 2K1QA 2TRMA 4WMEA 4Y0YE 4MPVA 5DP8A 4U2WA 1W13U 1WQVH 5DP3A 1RJXB 1S6FA 2C93B 3RXVA 2TGDA 1V2WT 3SZNA 3MU5A 3BIUH 1PPZA 1BJVA 3EAJA 1S85A 2ZHFH 4TWYA 1IHSH 1SQTA 1TA6A 1SGQE 4CH8B 1MD7A 2YOLA 3UR9A 1W2KH 3M3SA 2HPPH 4LK4A 5E0HA 3OYPA 3L3TA 1TNLA 1ELDE 1GJ4H 1O31A 4FVBA 4CHAC 1ZGIA 2BTCE 4MVNA 1OX1A 1O2NA 1UMAH 2FOFA 1O3HA 1TPSA 4NA8A 1F5LA 1MCTA 4CREA 3U8OH 1QL8A 1NRNH 1BTPA 1C5SA 2AIQA 1OP8A 1EPTA 1FPCH 4MNVA 1FY5A 4AYVB 1ZJKA 4XFQA 4I32A 4WXVA 1FMGA 4OS2A 3VB7A 1ELTA 3M5NA 1A4WH 1LKBA 4CRFA 3QTOH 1O2QA 1FNIA 2VVUA 1GHAF 3A8CA 5IDKA 4HZHA 1ESAA 2PTCE 3D49H 1TRYA 4O3UA 3FZZA 3FP7E 3SO3A 3RXLA 2H5DA 4ZAEA 2ZPSA 3ZZ6A 1TWXB 5J4SA 1BCUH 1TB6H 3GCHB 2XBXA 4UFGH 1JIMA 1KXAA 4NIWA 1NRPH 1UVSH 4IW4E 1HCGA 1RFNA 2R3UA 3AW0A 3RU4E 2GX4A 1TBQH 3LOXA 1E34B 1G3CA 1HJAC 4FUDA 2QF3A 1P11E 2C8XB 1PPEE 1Z8JB 3U1IB 1T8NA 2GTBA 3HKIB 1ZTJA 3HK6B 5ESTE 2PKSB 5EXNA 1L1NA 1EOJA 4K8YA 1LCYA 2A45B 1Z6EA 4YOGA 2B8OH 4ZHMU 7KMEH 2NU3E 1P3EA 1C5OH 1H8DH 1U6QA 1THRH 5LH8A 4CR9A 1SLXB 1Z1IA 2ZP0H 4WY3A 1NFXA 5JDUB 1VITF 4HI3A 4Y79A 3RMLH 1PPGE 2GMTB 3QN7A 3Q3YA 1O2OA 1AE8H 4JZFH 1A46H 4AN7A 2CHAB 4ZUHA 3PLPA 2RCEA 4MPWA 4GAWA 6GCHF 4LOYH 1V2UT 1FJSA 2BDAA 2WPLS 1NESE 2C8YB 2XWAA 4X8VH 1GJCB 1GMDF 3E0PB 3E91A 2WV4A 1MD8A 1RD3B 1FAXA 2HGTH 4UFEH 3T26A 4B71A 2BLQA 1ETSH 3FP8E 1T8LA 3VGCB 1AB9C 3A7YA 1KLTA 4FUIA 1MH0A 1V3XA 3M3TA 1SGDE 4OS1A 5HM9A 1A7SA 3E3TA 1O3IA 2A7HA 4DCDA 3QK1A 1ZHPA 4XDEA 1O3OA 2JH5D 2ZI2H 3RM0H 1RTKA 1NFUA 8LPRA 1GHBG 4M7GA 5GXPA 1G30B 3BTME 1AFQB 1QB1A 3DFJA 4K69A 1HB0B 2ZDVH 1UTKA 3TNTA 1AU8A 3S7HB 3LGWA 1IQKA 1RGQA 1BMAA 2P3TB 2XCNA 3GISB 4A1XA 2G8TA 2ZHEH 1THPB 2R2MB 4ISLA 4X8UH 1NC6A 4AZ2B 1YPGH 3A7ZA 2PUXB 2HOBA 3SU5A 5AFYH 3A82A 2Z6BD 1GVLA 2Y7XA 4JK6A 1HAVB 1XMNB 1F0UA 2WPJS 1JMOH 3ZZDA 1K1OA 3VXEH 1TAWA 3DHKH 5DK1A 1C5XB 1HJ8A 1QFKH 4O9VA 2O8WA 3ZZBA 1CBWB 7GCHF 1D6RA 1XVOA 1L4ZA 1W7GH 2QC2A 2XYAA 1T4UH 1BT7A 1SFIA 1IQIA 2FOCA 2WUBA 3N7OA 5EQRA 1FIWA 1DE7H 1PPHE 3UOPA 3I29A 1F0RA 2ODPA 4GPGA 2XBVA 2ZFTA 4BANB 1SLUB 5A09A 3SNDA 4X2XA 1QB6A 2B7DH 4D9RA 3K6ZA 1UTJA 3LH1A 2FMJA 1OWDA 1BQYA 4FU8A 4XE4A 1ANEA 1E0FD 2QYIA 1LPZB 1DLKB 1HAPH 3A8AA 1QJ6B 2BQ7B 5GIBA 4ABIA 1BB0B 2Z94A 3CS0A 3ZZ3A 2B0FA 3HK3B 1G32B 2A4OA 3TLOA 2G4UA 1MTWA 2HNTE 1C5UA 1FLEE 2BVRH 4YTAA 3T62A 3V3MA 1Y5BT 3SUEA 1O2HA 1O2MA 1EXFA 1GG6C 3BTDE 3V13A 4NA7A 2AFQB 4NSVA 3HKJB 1P0SH 1TA2A 3RXHA 1O30A 4MPXA 4X8TH 1FZZA 4Y71A 1SHHB 5CHAB 4B2AA 2XCFA 2A4RA 1C5QA 1UTOA 2J38A 3RU4T 1ZOMA 3D23A 1DDJA 3PB1E 2XC4A 5CMXH 3RXQA 2WYJA 1S5SA 2FPZA 2FO9A 2HRVA 1BTYA 1HAVA 3E6PH 2FOEA 4KKDA 1DS2E 2BDHA 3RXSA 2H6MA 2PGBB 3MNCA 1UO6A 1NM6A 1YYY1 1WSSH 2FIRH 2C4FH 4X6MA 1QHRB 2O8MA 3P8NA 5GJ4B 1GVZA 1F7ZA 2J4IA 2FESH 2RA0A 4H6TA 2C8WB 1Q31A 5FBIA 3SBKA 1RIWB 4ABAA 4ABJA 3JZ2B 4Y11E 3RMOH 1WTGH 2J2UA 1DVAH 2ZDNA 2PFEA 2NU4E 4R0IA 2BOKA 2ZGXH 1FY3A 1BRBE 4ZKOU 3O8CA 1EPTC 1ZRBA 2SGDE 5E8EH 2Q6FA 5H4IB 4IC5A 1OYQA 1CHOF 4ABEA 1O2SA 3U98H 1NRRH 1S82A 4HTCH 1AWHB 2VINA 3TH3H 1DWEH 1TYNA 6CHAB 3ESTA 3OY5U 2F83A 1Y3VA 1C5VA 1S81A 3SU2A 1HAZB 4WVPE 1KLIH 5F8XA 4Y6DA 1AVWA 3A83A 3EDXB 1AVGH 1BRCE 1GJ5H 1Z8GA 1AVXA 3EA8A 2VJ1A 1SGRE 2ZHQH 1XKBC 2A31A 2BX3A 3ZVDA 3DFLA 4TY7A 3U8TH 4YESB 3T25A 1GI0A 2BVSH 1OWKA 1C5RA 2VH6A 2Y5HA 2GCTB 4CRCA 4D7FA 4E7NA 1QJ1B 1TIOA 1O2PA 5LPFA 3PROA 1EATA 2O8LA 4YLQH 4B74A 3LJOA 1BTWA 1DY8A 1EP6A 2EC9H 4I31A 1C2GA 4OGYA 1CHGA 3LDXH 5FPYA 3KF2A 3GOVB 5JPMH 4ABHA 1YLDA 1QY6A 5DP6A 2FX4A 4DGJA 3G01A 1ZPCA 1SPJA 3U8RH 1O35A 2BD2A 2QA9E 4ZMAH 1W11U 1O2KA 2ZDLA 4WWYA 3ATMA 4X2VA 4A7IB 1Y5UT 2BY9X 4JYUH 4NIXA 3ZVAA 1ETRH 3RXEA 1P10A 4I7YH 1ZSJA 2GDDA 2GP9B 1GHWH 1SGNE 3RLYH 1KTTB 3SGQE 1K1MA 2H5CA 4NFEA 5C1XA 5I25A 1TQ0B 3QZQA 1C5TA 1JRSA 2HNTC 2ZGJA 3MU4A 3ZZCA 1A0LA 1LHGH 4XBDA 1BUIA 1NPMA 2XNIA 2FTLE 3PLKA 1G36A 1XUGA 3RU4D 2RG3A 2JH6D 5FXLA 5F8ZA 1GHYH 4ASHA 3MU8A 3BIVH 1V6DA 1N8OB 5TJXA 1Q3XA 1K1NA 1P12E 5LPEA 1D3PB 3GCHC 5EOKA 1ANDA 4H42U 1TMBH 2ZG0H 5EQSA 1LVYA 1O2VA 2Z9KA 5C1UA 2UWPA 4KELA 1FY1A 1X7AC 1YCPM 2ANMH 2ZU5A 3STJA 8GCHG 2G5VA 4Y8ZA 1QQUA 5F6MA 1MU8B 1ZPBA 1C1UH 5EPNA 2FYRA 5LPRA 1W10U 3TGJE 1PQ8A 1NTPA 4YT7H 2PKSC 5GCHG 4CRDA 3ATLA 1FN6A 1O3MA 2XC0A 1PFXC 5AHGH 2Y5FA 5PTPA 4Y0ZE 1VITG 1SGPE 1QNJA 2BDGA 2HLCA 3T2NA 1LPGB 3TH2H 1O2IA 4VGCB 1KXBA 1GWAA 1GDNA 1SFQB 2BOHB 4O97A 2ANYA 2Z9GA 2GMTC 1GMDG 1HXEH 3AAVA 4TPIZ 4IN1A 2H9EH 3SNBA 3EE0B 2CHAC 1PQAA 2A1DB 3SU0A 2TGTA 4ZHAA 2F9OA 1HBTH 2BZAA 1WBGB 3UQVA 3R3GB 4JZIA 1BA8B 4NZLA 4BTTB 3Q3KA 3KQBA 2AIPA 4FUHA 3OTJE 3EA7A 1O3GA 3GCTF 1A3BH 1O5AB 1TRNA 3VGCC 5TCCA 1VJ9U 5J4QA 3Q3XA 5E0GA 1ABIH 1GBKA 1BZXE 2AGIX 2BZ6H 1EB1H 1OYTH 3SJOA 5F03A 4OS7A 2CMYA 1EX3A 3M36A 1BRUP 1G3EA 2BQWB 1YPMH 4I8HA 3MH4A 1CU1A 2GCHG 4KGAA 3SHAH 4NIVA 1AFQC 1TX7A 3P70B 1O39A 4H6SB 4FUBA 2QGRA 1AI8H 1UTMA 1GMCG 1TBZH 2VIOA 5JB9S 1IAUA 1BMLA 1GBAA 2HVXA 1JBUH 1KYNA 4JZDH 4AGKA 2QIQA 2D2DA 1FONA 3SV7A 2ZIQH 3BG4B 1VR1H 1QB9A 2JETB 4XSKU 5EXLA 1A1RA 1CT2E 2ZECA 5T6GA 4DVAU 2CF8H 1GBEA 4A5TS 3F9GA 3UIRA 3S0NA 1BHXB 2FX6A 1GBCA 5FAHA 4FUEA 3E8LA 3MO3A 2PKAB 4ZKSU 1C2DA 1SGTA 3OU0A 2VVCA 2W7SA 3AAUA 1VCWA 1Y3WA 1GMHF 1LQDB 3GY4A 4B2BA 1UK3A 2TIOA 1CBWC 1H1BA 4AB8A 1TABE 1W7XH 3A7VA 5AF9H 1SVPA 2QCYA 2BD4A 1K9OE 4GCHF 4JZ1A 2O8UA 4B76A 1AIXH 2CN0H 3GY7A 1VITH 1J14A 3GCNA 2CJIA 4UDWH 4SGAE 1BTZA 2XTTB 1HXFH 7LPRA 2ZQ1A 2OLGA 1GJDB 2WYGA 4NA9H 1HGTH 1BBRK 2UWOA 5FPSA 4YOIA 8ESTE 3GY3A 1LHEH 3RUOA 1BRAA 1DPOA 2ZCLP 3SV2H 1CGHA 1DLEA 1Z8RA 1LHFH 4ABFA 2A2QH 2A4QA 3URDA 1GBDA 4JCNA 1EP5A 2HNTF 3NK8A 3BTGE 1CA8B 3RC6A 2QY0B 2OQUA 2A5IA 1O3CA 1EASA 2PTNA 2FODA 1XUKA 4X1PU 4X0WU 3A86A 1J9CH 1WUNH 5DJ7A 2FYQA 3SQHE 2Z9JA 3IG6B 4B73A 1AGJA 3F9FA 1QRZA 2DE8A 2BMGB 5CHAC 2P8OB 2BD9A 1W0ZU 1ZMNA 1QRWA 3BTHE 3SQEE 5L6NH 3QGJA 4TPYA 3A88A 2AGGX 3GY5A 4DURA 1IQMA 1ESTA 2EI8A 2G51A 4E05H 2KAIB 1E37B 2PKAA 3A84A 4ISNA 1MKWH 1QA0A 1SI5H 3HPTB 2H1UA 4RKJB 1YBWA 1O2XA 3K6YA 3E90B 5A0BA 2O9QA 1EB2A 3RXAA 1VZQH 1C9PA 1NZQH 1DSTA 3QWCH 1K28D 3O8DA 1HAHH 3BEIB 2PV9B 1GCTC 3SNEA 1RIWC 4ZXYH 2ZU1A 1RTLA 4ABBA 4MNWA 2PSYA 3KEEA 1CHOG 2D26C 5FPTA 4CR5A 3LGTA 1P2NA 1ANCA 2R2WU 3VXFH 2GZ7A 1XX9A 4U30A 3OY6U 1O3PB 2ESTE 1K2I1 1C5YB 1N1LA 1XM1A 2ZGHA 1YPLH 1G3BA 3BTWE 6CHAC 1A2CH 1S0RA 3LU9B 3PO1B 3UWJH 3RLWH 3S9AA 3TJVA 1HJ9A 1SGCA 1DUAA 2SGAA 2A32A 1TPAE 1W0YH 3PMHB 3MU1A 1JRTA 2BLWA 4X6NA 3CP7A 4CRBA 2VNTA 1O2TA 3RXPA 3S9CA 2SGQE 5C67A 1ZGVA 4NFFA 2GDEH 4JYVH 5GWZA 2OINA 1WCZA 4FXGH 1GBBA 1O2WA 1OOKB 3EA9A 2ZFSA 1TGNA 4Y10E 1MTVA 2GCTC 5EG4A 3Q76A 3MO9A 4XBCA 1O3KA 3QGNB 3VPKA 3S69A 3SV9A 4WXIA 5DGJA 1P05A 2GV6A 1L2EA 1V2VT 1V2MT 1F2SE 2KAIA 2ZNKH 3GDSA 4GSOA 2BDCA 4MNXA 3SOSA 1O3FA 1O3LA 3C27B 3V12A 1SC8U 4K1EA 4BAMB 1ZMJA 2ZFRH 1AE5A 1C1OA 1C1RA 1HAGE 2ZZUH 1TGTA 3RXOA 2QXHA 1C2HA 1P09A 1O3AA 1BOQA 1M9UA 2XW9A 2ZU3A 5A0AE 1TGCA 1P3CA 2ZGBH 3LKWA 5A2MH 5DP5A 1BBRE 5GDSH 4MQAA 1J17T 4F4OC 1P9SA 1SGYE 2VIQA 4AORA 2ZQ2A 5FX6A 4AG1A 1GBLA 1FN8A 2BYAX 1CGIE 3LT3A 1GBIA 4J2YB 4Y7BA 3M7TA 1GBHA 1P2KA 2A4GA 4QT8C 2BHGA 1W14U 1IQLA 5EXMA 2WPIS 1DOJA 1ZZZA 2Z9IA 1OWIA 1W3CA 2PUQH 3RXIA 3GCOA 2IPHA 4AGJA 4KP0A 2UUFB 1W8BH 4ZXXH 2BY5X 5K7RA 1KDQB 7ESTE 1YLCA 2OD3B 2GD4B 2GT8A 4AB9A 1TBRH 1TPOA 4IC6A 3VFEA 1N8OC 1NRSH 5JBTA 3KL6A 1D4PB 4J1YA 1JIRA 1YPEH 2F9UA 1YPHE 1C5MD 4UFFH 4AFSA 1VGCB 1SQAA 1Y3XA 2PHBA 5T3HA 1GJ6A 5EW2H 1C2LA 2P59A 5IYTA 5T6DA 2FLBH 2BD7A 2ZDKA 6LPRA 1GDUA 2FOHA 1GHZA 5HXFA 5DKMA 2H9HA 1YP9A 2VB0A 1BMMH 4ZKRU 2NU2E 1GI6A 3EQ0H 2A7JA 3VEQB 2J34A 1CT0E 2WPHS 5FBEA 3SGAE 5EU8A 2VVVA 3LGIA 1UTQA 1GHXH 3CS7A 4MNYA 1KIGH 2BD8A 4TWWA 1UK4A 4IS5A 1O36A 4O3TA 1AD8H 2VIWA