1O3GA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA02
2STAE 4CR5A 2G4TA 2IN2A 3VB4A 1HXEH 4KKDA 4JMYA 2FXRA 1SPJA 1UTKA 2FIRH 1ORFA 1OYQA 2UWPA 1Y3WA 1WQSA 4F4OC 3MH7A 1NPMA 2JETC 1KSNA 1BTWA 3SGBE 1KXAA 5EODA 1TQ0B 1CHGA 1DT2A 1PPFE 4LZ1H 1HCGA 1K22H 1TBZH 1CQQA 4K1SA 4ISNA 2GMTC 4CBOA 5DG6A 4Y7BA 5JYIA 2BY7X 3CS0A 2PTNA 1QJ1B 4CREA 1W7GH 1SI5H 3ZVGA 1DITH 3P92A 2G5VA 1DXPA 1EAUA 4GAWA 1FIZA 1HBTH 2XTTB 4XDEA 1IOEA 3P8OA 2VVVA 3STJA 1ZSJA 3SV2H 2W7UA 1YGCH 4JZ1A 3TVJB 5A2MH 1GHYH 2HOBA 1HB0B 1S84A 1W0ZU 3HK6B 3A8BA 3BSQA 2PUQH 1AD8H 1C2EA 4I33A 1GI1A 2V3OH 3SHAH 3VB3A 1GBTA 1HJAB 2VWMA 2FX4A 2Z9GA 3PTNA 1E36B 5DO4H 1HFDA 3KF2A 1GHZA 4AGJA 2V3HH 1NN6A 1O3AA 4AZ2B 2Z3CA 5C5NA 2P94A 4MG3A 4UD9H 3UR9A 2JETB 1BOQA 1YPHC 3LGYA 4UEHH 3SU6A 1NM6A 1DPOA 3IG6B 2FOHA 4Z0KA 2Z6BD 3LKWA 2AYWA 2VIDA 1TNKA 2XBWA 4U32A 2GMTB 1RJXB 1TRYA 1A0JA 2ZG0H 1L0ZA 4E7RG 2TGDA 1Y59T 2BZ6H 2P59A 1K2I1 3PO1B 2CGAA 2P8OC 3BG4C 4D7GA 1D3PB 1GDNA 2HGTH 4I8LA 4ZXYH 5K0HA 4ABJA 2QN5T 2FPZA 4A7IB 3RLWH 3M61U 1ZGVA 4NSVA 3BTTE 1FY3A 3FAOA 2ZA5A 1TPSA 3O8DA 3RXIA 2J2UA 5LH8A 5LPFA 3PWCA 2FTLE 1SLWB 3NPSA 4NSYA 1DWBH 1GDUA 3H7OA 3M3VA 5EQRA 1O0DH 1YLCA 3OYPA 1ZJDA 4NIXA 1GHBF 1TOMH 2KAIB 2ALPA 1BQYA 1O3BA 1GI0A 1TBRH 5TCCA 2Z9IA 3GYLB 1D6WA 7GCHG 1C5WB 3RMMH 1WTHD 3QGJA 3U9AH 1LVBA 1GJDB 4NIWA 4NIYA 2PHBA 4DG4A 3U8TH 1O3HA 4MLFB 4I32A 1O2RA 4A6LA 2BVRH 2W7SA 4JK6A 1KXFA 1SLUB 3MMGA 2GT7A 4X1SU 1P2QA 1K1LA 1S83A 1DFPA 1YF4A 3M5MA 4FXGH 2G8TA 4B74A 2QC2A 1T8OA 3RXEA 1LKAA 2JH5D 1OKXA 1OWHA 1GMHG 1BB0B 4Y0YE 2WPKS 1P8VC 2P8OB 3BG4B 2AIQA 4GCHF 1DVAH 1L2EA 4A92A 1PPCE 3D65E 1EAXA 1FNIA 5CMXH 1IQMA 1GI5A 1C5SA 1FLEE 2ODPA 3T5FH 1ZJKA 1J16A 2ANMH 4YOIA 4ZHAA 4K2YA 2C8YB 1O2GH 1VGCC 2VB0A 3LGTA 2GTBA 3QDZB 3H7TA 3DUXH 5GWZA 3RXUA 1XUFA 1Z7KA 1PQAA 5EQQA 5ESBA 3SO3A 1MKWH 5C1XA 2XXLA 5C20A 2Z9LA 2WV5A 3GYMA 4XSKU 3GY6A 1ZRBA 2QA9E 5IDKA 1ZPZA 2H9HA 2BY9X 3SGQE 1UK4A 3ZZ4A 4U2WA 2P16A 4ZHLU 3RLYH 4X8VH 5FXLA 1AB9C 1HIAB 1QL8A 2JH0D 4UFEH 4XOJA 2F83A 4JCNA 3M7QA 3F9GA 1UTJA 2HNTE 4Y8ZA 1LPKB 2FESH 2VIVA 3S69A 4A1TA 4MVNA 1G3CA 4O9VA 2ODQA 4UE7H 1LHCH 3UIRA 2SNVA 1QBOA 1FN6A 3TK5A 1CO7E 4U30A 1RTLA 4K3JA 2QXHA 2YNAA 3SNBA 1W7XH 2R0LA 2OQUA 3SJ8A 2FZZA 1C2KA 1VGCB 4WH8A 1KXCA 2ZFRH 1QRXA 1ZHRA 1AWFH 1UVOA 4MTBA 1AO5A 4Y11E 3RXRA 1S5SA 2FI3E 2VH6A 4X1RU 1QA0A 2A4OA 5C67A 1CGJE 5DK1A 1EAIA 3V13A 1HDTH 2ZECA 1SGQE 1GMDF 1AFQC 1AB9B 2AMPA 1O3GA 1GBKA 4FUGA 1CA8B 2GT8A 4DIIH 1RIWC 1FMGA 3P6ZB 1Q31A 5L2ZH 5AFZH 4Q2KA 2OTVA 2A7JA 4JYVH 1SGPE 2A0QB 1FN8A 2P3UB 1KDQB 1FV9A 3PLKA 3ATLA 1SGIB 3STIA 4O3TA 1IQGA 2BY6X 4FU8A 4ZKOU 2BLQA 4MDSA 1TPOA 1W13U 1KY9A 1UVUH 3LGWA 5BRRE 3KEEA 1QB1A 1TWXB 3SBKA 2AFQB 1MTUA 1A4WH 2HPPH 1C2DA 3U98H 1SOZA 1H8DH 4FU7A 2EI8A 2GZ8A 2IOTA 3OTJE 4K5ZA 3UUZA 5F8TA 1OWIA 2FOEA 1G2MA 1N8OC 1GHBG 4DCDA 1ANCA 1HLTH 5DGJA 1O30A 2F9PA 4ASHA 4TWYA 2ZZUH 3TJOA 2PTCE 1ZGIA 1QL9A 1C5QA 1DX5M 3ZZCA 3U1JB 1CU1A 4FUJA 5F6MA 1KLTA 1AFQB 1XUGA 2FYQA 2WPJS 1DS2E 3T28A 3ZVAA 1BTUA 1GL0E 2ZDVH 5FX6A 2PR3A 1RIWB 3QX5H 1LVYA 1OP8A 2P95A 1VCQA 1GBMA 3KQEA 4MNXA 3PLPA 1F7ZA 3MO6A 1SGNE 1SMFE 4Y8XA 4ISOA 1O5BB 1P2NA 2FP7B 4GCHG 3O8BA 1SGFG 2KAIA 2ZDKA 4A1VA 5IYTA 1GBIA 3FP8E 3QUMP 5DJ7A 3A8CA 5GDSH 4OS1A 1IAUA 1C5VA 1H8IH 3Q00A 5J4QA 2NU0E 2F9VA 2WINI 5HM9A 1O3IA 3ZZ6A 1PQ5A 1C1MA 3GOVB 1ABIH 1RTFB 1GHXH 5DP7A 1K28D 2QCYA 4YESB 3MNBA 1N8OB 1ELDE 1TGSZ 1QRWA 5E0HA 1RXPA 2BQ7B 4CRBA 2ANKH 3P8GA 2ZU1A 4ZKRU 1W14U 4JZEH 1PYTC 1BRUP 4I8KA 2C8ZB 3PROA 1O2UA 3DA9B 3I78A 1IQJA 1C9PA 3K65B 3DT0H 1MCTA 1QQ4A 1C5UA 1EB1H 1P9UA 2UUJB 1KLIH 1Z8GA 4NWLA 2W3KA 3LGUA 2C4FH 4B2CA 1QFKH 1C2JA 1SGFA 2BLWA 1DWDH 4BAMB 2ZNKH 4K1EA 1RGQA 3T62A 2GCTC 2FEQH 3G01A 1MKXK 3R3GB 3A85A 3F9EA 1MTSA 1S85A 1ZHPA 4NZLA 1MZDA 1EJAA 1TIOA 1ELEE 1C5MD 3MI4A 3TITA 1THSH 1DUAA 1HIAA 2ZPRA 1C1TA 4Y71A 4YLUA 1A5HA 1NFUA 2R2MB 3ZYEA 4BOHA 2ZCLP 3SU4A 3F1SB 3SN8A 1BCUH 1AFEH 2ZU4A 4XBDA 2Y82A 1LVMA 2A5KA 3ZVEA 1O37A 1JIMA 1SFIA 1TFXA 2FO9A 1GMDG 5TJXA 2ZQ1A 4ZKSU 1DXWA 3KIDU 1Q3XA 4LOYH 4THNH 4RN6A 1OOKB 1OSSA 1O2IA 2ZHQH 5A8XA 1TLDA 3SNEA 1WYKA 2B0FA 4BXSA 1NU7B 5ABWA 4WXVA 2BDCA 2GVFA 4I8JA 3N7OA 1GCDA 1SR5C 1T7CA 4QT8C 3MU4A 1DSTA 1ZR0A 1OWJA 5T3HA 1HRTH 2SGQE 3SJ9A 3UTUH 5JBCS 3RU4E 5AVDA 4DJZB 1RRKA 3ZZ8A 1AY6H 1GPZA 2O9QA 3NK8A 3S0NA 3FVFB 4K8YA 4MPUA 5DP9A 1NROH 4X8UH 4X2WA 1BRAA 1TOCB 5HYOA 1NRQH 3RXGA 2QAAA 1DOJA 3ATWA 3TJUA 3SV9A 1KDQA 2BQWB 1AN1E 1V2VT 3T29A 4TPIZ 3RC6A 1KTTB 1O3JA 3EDXB 4DGJA 1HAHH 2BHGA 3SHCH 1GI3A 3CS7A 4WMFA 1BMAA 3UOPA 2TBSA 2RA3A 4NA7A 2HVXA 4A5TS 1Y5UT 1GMCF 1LCYA 1K1OA 5GIBA 7GCHF 1EP6A 2A32A 4Y0ZE 3ELAH 3PTBA 3KN2A 1B0FA 2XBYA 2IPHA 1A5GH 3TGIE 2ZHFH 3EQ0H 1VCPA 5EPYA 2ZTZA 1EASA 3QTOH 4LXBH 6GCHF 1QBVH 2TGTA 1VITH 1XUHA 3OSYA 4H42U 7LPRA 2Y6TA 5FBEA 3OY5U 1H4WA 3SU2A 3LJOA 4YOJA 1A7SA 1OYTH 3E3TA 1FUJA 1C2IA 4CRCA 4Y10E 3ZVCA 3RXVA 1A0LA 1DSUA 4B71A 1MCVA 4NG9H 4KTUA 2ZGBH 3SQEE 3M3SA 2BD2A 2B8OH 4ISIH 2ZFFH 2C8WB 4K69A 4X0WU 1V2JT 5DP4A 3I29A 3SV7A 3V3MA 1SQOA 2VIOA 3SJKA 5HMAA 2YOLA 1G3EA 4GUXA 1YPJH 3TPIZ 1NRRH 2R9PA 2ZU3A 4M7GA 2PKSC 1HJAC 5EG4A 3M7TA 3GY3A 4ESTE 3WY8A 1CT2E 3AAVA 1TMUH 3LPRA 4WF8A 4UFFH 4MPWA 2BVXH 1FDPA 1AVWA 3LC3A 1CA0C 3SNAA 3PMHB 2I6QA 3M5NA 5JBAS 4FU9A 1F5RA 4AFZA 2OC8A 1NRPH 1J8AA 2ANWA 3GY8A 4FUDA 3SNDA 1ELGA 1SLVB 1JRSA 2OCVB 1ZMJA 1XM1A 1GJBB 2R0KA 4NFEA 4Q7ZA 2OD3B 5T6GA 4Y6DA 4AYYB 1F2SE 2Q1JA 2FOMB 1TA2A 2A31A 2XYAA 3PO1C 5GJ4B 3TNSA 1C1SA 3CENA 3ESTA 2TPIZ 2V0BA 5E8EH 4WMEA 3CP7A 4H6TA 2PW8H 1WOFA 2SGFE 1ZRKA 2A4GA 4LZ4B 1AUTC 1B0EA 1EZQA 4UONA 5DP3A 1ZTKA 4MPXA 1E38B 2UUKB 5LPRA 3LH1A 1Z71A 5AHGH 2VVUA 2PKSB 4RSPA 4E05H 2FWWA 3SI4H 4KTCA 3ATIA 1EOJA 1F92A 2G81E 1T32A 1OXGA 5LGOA 1SSXA 2G52A 3NZIA 1FZZA 3ZV9A 5F03A 1EUFA 2BX4A 1CA0B 2D2DA 1NO9H 5C1UA 3QTVH 1O2QA 3BTKE 1LPGB 2GV7A 1IQKA 4IC5A 4K1TA 3MO9A 5EQSA 1L1NA 1L4DA 1ZTJA 2ZTYA 1O2MA 1NY22 2P93A 4CR9A 5FPTA 4BAOB 4DIHH 2GD4B 3F9FA 5J4SA 2XBXA 1L1JA 4ABEA 2F9BH 3SV8A 2ZU2A 1XVOA 1NFXA 1GI4A 2FS9A 3MNCA 1BITA 4RKOB 5DP5A 2BLVA 2J38A 4UDWH 1O3CA 2A45B 1O3DA 3TNTA 2OUAA 2ZHDA 2O8WA 2STBE 2R2WU 2YNBA 3M35A 3URDA 3GCTF 2PKAB 3MFJA 3SQHE 3SZNA 1C1OA 1KTSB 4YO9A 2WPHS 2NU2E 3ODDA 1MMJN 1XXFA 1QCPA 5PTPA 4ABIA 1SVPA 3E0NB 1AI8H 1GMCG 2BOKA 3RXJA 1YCPH 4OS6A 1C5LH 3RXBA 2VJ1A 3RDZA 2PV9B 2OC7A 3P8FA 4DVAU 1GG6C 1AE8H 2W5EA 3D23A 2BY5X 1K1JA 3V12A 3BTME 2PGQB 1A1RA 6GCHG 1SL3A 1O5DH 2A7HA 1NFWA 3IWMA 4DURA 2GCHF 3A7VA 1TPAE 3RC5A 3RU4D 5I25A 5FPSA 3AVZA 1IQEA 4ZXXH 1KXDA 2UWLA 3BV9B 1VJ9U 3QZRA 3L6PA 1OPHB 4OS7A 1TONA 3EAJA 1OP2A 3P70B 1O3PB 3MH5A 2H9TH 4D8NA 2ZWLH 2BVSH 4GVUA 3TIUA 3ATMA 4WJG2 2O8UA 1GJ5H 1QBNA 2VWOA 1B5GH 1TB6H 1EX3A 2FX6A 2F9NA 2ANYA 4XFQA 1V2MT 2ZQ2A 1FPHH 1D3QB 1YLDA 6LPRA 1S0RA 3UWJH 5HXFA 3TH4H 2AGIX 4IMQA 4FUCA 3DFLA 4X2VA 4Z6AH 1GG6B 4H6SB 1QRZA 1NRNH 4X2YA 1VCWA 3RXSA 2VVCA 2OC1A 3LGIA 2G51A 1FJSA 4JZDH 3SOSA 1UTNA 2VINA 2FOBA 1QIXB 1Z1JA 2Y7XA 3KCGH 1TA6A 1P0SH 4B1TA 3VFEA 2WPMS 1T8MA 1JWTA 1RD3B 1O36A 1BRBE 4BAKB 2THFB 3KQBA 1T31A 3Q77A 3P95A 5AFYH 1NTPA 3HGNA 2GP9B 1UVPA 4NA9H 4U01A 4ZHMU 1AIXH 4AYVB 3UFAA 1NFYA 3A89A 1BBRE 1N6XA 1W2KH 2VIQA 2HPQH 4B2AA 4XE4A 1GBJA 1O2LA 3ZVBA 2QYIA 3QN7A 1UJ1A 5FX5A 4CH8B 2ZFSA 3URCA 1O5EH 3GDVA 1FY8E 2H1UA 2D26C 4Q7XA 1C2LA 1UTPA 3SJOA 2VGCC 6CHAC 5A0CA 1P05A 1EP5A 3LDXH 4IN1A 2ZI2H 2EI7A 2BDYA 3M37A 5FPYA 4DW2U 1O2WA 1H9IE 2F91A 3V0XA 1Z6JH 1JMOH 2DUCA 3FZZA 4TY7A 2PGBB 4AB9A 2G4UA 1Y8TA 1SGTA 3A86A 1WV7H 4CH2B 1XUJA 1O5GH 3D49H 4SGBE 1IHTH 4B2BA 4D76A 1LHFH 1ZOMA 1CBWC 5GPIB 1J17T 1GBLA 1MAYA 1Y3VA 1MTWA 1P11E 4FUEA 2J95A 1O2OA 2UUYA 5ESTE 4AFUA 1G30B 1TNIA 2RDLA 3AW1A 1IQIA 1GVZA 1Y5AT 3GDUA 5EXNA 3BEUA 4YM9A 1H9HE 2BD9A 3GCTG 3K9XB 1AUJA 2ZPSA 5F8ZA 4ABBA 2ALVA 4BAQB 1C2HA 2QXGA 2A7CA 2P3FH 5DP8A 9LPRA 3HKJB 2F9OA 3VB5A 1YBWA 2ZDLA 1C4U2 1EB2A 1Z8JB 2ZF0H 4BNRA 1O5CB 2FOCA 1PJPA 3U1IB 2VGCB 1KYNA 2Y81A 4Q80A 4WY3A 5A0AE 6CHAB 1WAYB 1S0QA 1GI2A 1C2GA 1CGHA 4DT7B 2F3CE 1UCYE 2R3UA 2ZO3H 1XKBC 4IMZA 4YTAA 2RCEA 1FI8A 3E1XB 4NIVA 5JB9S 5SGAE 1UK3A 3PWBA 2PKAA 3T27A 3VPKA 2VU8E 4HFPB 1MAXA 1CBWB 2GCHG 4F49A 1BTZA 1F0RA 1NT1A 1V2UT 2OP9A 4MNYA 1GBCA 1A2CH 3KQDA 1AZ8A 1IQHA 1K1MA 1IQFA 1Z1IA 3RUOA 1L1GA 1HUTH 1LVOA 1ETSH 2H5DA 1SGRE 3KNXA 4BTIB 2GDEH 3S7HB 2J92A 1G36A 1P12E 1TABE 1C1RA 3O8CA 2B5TB 1DDJA 2GGVB 5EOKA 4I8HA 1BBRH 1UO6A 4WMDA 2BDAA 4FUHA 1OS8A 1ANEA 1ESTA 1RTKA 2Z3DA 3FP6E 2ZGCA 5C5OA 1E0FD 1ABJH 5CHAB 5BPEA 1G3DA 1EJNA 1CSOE 1O3EA 1YPLH 1FAXA 2O8MA 1EPTC 2EEKA 2K1QA 1O3KA 1QL7A 4ABDA 2OBOA 2ZDMA 4X6PA 3M36A 1LHGH 1O2ZA 1O2VA 4R8TB 1TGNA 2ZP0H 2FTMA 1CT4E 4X1NU 4D9RA 4VGCC 1EJMA 3ZZDA 1SGEE 2ZDAH 1OWKA 2Z3EA 3GY5A 1C9TA 2AIPA 2VWLA 4UFDH 3K6ZA 1NS3A 1LQEA 4XBBA 1GI7B 4ZROA 3TU7H 2GKVE 1KXEA 3SORA 3VB6A 3SJIA 1FONA 4O03A 1SFQB 2P3TB 1ZMNA 1QA7A 3SUGA 1TAWA 1GI6A 1PYTD 3FP7E 1FY1A 1HYLA 2BDBA 2BD8A 3UOUA 1SB1H 1HGTH 2GV6A 1AKSB 4X1PU 4IW4E 1HNEE 3SU5A 3U8OH 1E34B 1O3NA 1ELFA 1P3CA 2XRCA 2VIPA 3UPEA 1YPHE 4JK5A 4WXIA 1QHRB 3A7ZA 1YPMH 3MU5A 3RM0H 4X8TH 5C2ZA 3OU0A 2ZEBA 1UCYH 2C90B 3E8LA 4MPVA 1Z8IB 5K7RA 1UTQA 1ZPBA 1N6YA 2BMGB 1ACBE 1EPTB 1OP0A 1GBDA 5E0JA 3TJVA 3SUEA 1BT7A 1C5TA 2PWXA 2SNWA 4HTCH 1YCPM 1TALA 1C2MA 1D3TB 1FAKH 1FPCH 3UNQA 4VGCB 3RXDA 1O2HA 4HI3A 1T4UH 3MNSA 2FLRH 2BZAA 1XUKA 2RG3A 1P3EA 3QZQA 2Y5FA 1O2YA 4GHTA 2ULLA 5FBIA 4NGAH 3E0PB 3FANA 1O2TA 1EXFA 1GL1A 2Y5GA 2ZPQA 3A84A 2XCFA 1UTOA 1UHBA 3SU3A 2WUCA 2HNTF 3SU1A 2Y7ZA 1NZQH 1M9UA 4Y8YA 1LHEH 2BY8X 8KME2 5EPNA 3VXFH 4NZQA 1Y3XA 1AMHA 3KQCA 4OGYA 3E16B 1MQ6A 1TPPA 5EW1H 1O5FH 1FQ3A 4AFQA 1MD7A 1HAVB 5B6OA 1GJ6A 4E7NA 1WQVH 1AHTH 2Q6DA 1BTXA 1C4Y2 1QY6A 2CV3A 2QGRA 1F5LA 2A4QA 1O35A 3F68H 2BM2A 1VJAU 1P2OA 3JZ1B 1S6FA 4TPYA 5T6DA 2FOGA 2AS9A 2OC0A 2H5CA 3L33A 1CVWH 1A3EH 1GJAB 5L30H 1U6QA 1V2NT 1BMNH 1V2TT 4BXWA 1TNGA 1AE5A 2DE9A 1D9IA 1XKAC 1CHOF 1V2RT 1GWAA 4GHQA 1ANBA 1Y3YA 3MU0A 4XBCA 1O32A 4O3UA 1V2ST 3BIVH 5ETXA 2TIOA 2BXUH 4NWKA 2XC4A 1TMBH 1C5OH 3BIUH 3M7UA 2J34A 1V6DA 4YLQH 1GVLA 4R0IA 4K8BA 3Q76A 4FUFA 4CRDA 1TYNA 2DE8A 5C1YA 4BTTB 2I6SA 2NU4E 1V2PT 2TRMA 1LHDH 4CBNA 1ELVA 2A5IA 3BN9A 1VR1H 1BDAA 1QB6A 2XWAA 2AERH 4A1XA 1P2KA 1PPGE 1EZUC 2C3SA 4FUIA 2FODA 3A88A 1Q2WA 1HV7A 1EZXC 3KL6A 3SUDA 1TRMA 1HAGE 1GJCB 4KELA 1D6RA 4ABAA 2BXTH 2XC5A 3GICB 3F9HA 1GDQA 1HJ9A 1LQDB 1IHSH 1XX9A 3ZZBA 1JRTA 2O8TA 1P9SA 1C5YB 3PM3A 3VB7A 2F9UA 2Z94A 4OS2A 1Y5BT 2XWBI 1P2IA 2SGAA 3AW0A 3HPTB 2R3YA 1GHVH 1ZMLA 4AFSA 2ZHWH 8ESTE 4D7FA 2ZU5A 2FI5E 3A8DA 3MWIU 2XNIA 3MU1A 1RFNA 1ZLRA 1ELCA 3K2UA 1GBHA 2FOFA 1MKWK 2NU1E 4BANB 3ITIA 1AWHB 1O2XA 4GPGA 1P04A 3TH3H 4Y79A 5TCAA 4CRFA 4OS5A 3MO3A 2NU3E 2ODYB 3BF6H 4INLA 1O2KA 1FY4A 1SHHB 3KGPA 3UNSA 2XCNA 3P17H 2ILNA 5F8XA 3A80A 3RXKA 3TH2H 1XXDA 2TGPZ 3A87A 2ZC9H 3DD2H 1T8LA 1TNLA 2A5AA 1H1BA 2WPIS 4Q7YA 4IN2A 3LJJA 1TQ7B 1W0YH 4IBLH 1UVTH 1AKSA 1K9OE 5EGMA 4ABHA 1MQ5A 5GCHG 1SGCA 1UVSH 3ZZ7A 2AMQA 2BB4A 3HKIB 4GLYA 3E90B 3UREA 2FLBH 1MTNC 2ZDNA 5DP6A 1D3DB 1ETTH 3MNXA 3RMNH 2B7DH 3RXMA 2B9LA 1F0TA 1F5KU 2J9NA 3GY4A 4FUBA 5E2PA 1QURH 1ZZZA 2QXIA 4AGKA 2VH0A 3A83A 1EPTA 1ZHMA 3PV4A 2OXSA 3BTDE 4YOGA 1TMTH 4KTSA 1S82A 2A4RA 1QB9A 1VITF 3NXPA 5L6NH 1TX7A 1QNJA 5GXPA 3QWCH 2Z7FE 5FCRA 2J4IA 1C5PA 2PUXB 3QK1A 1JXPA 3SUFA 3S9BA 1CT0E 3V7TA 1DUEA 1GJ7B 2ZIQH 3H5CB 3GCHC 4TWWA 2CHAC 3ZVFA 1YKTA 1EAWA 2H6MA 1WBGB 1YP9A 7ESTE 3LIWA 1GBBA 5HGGA 2Z9KA 4KP0A 3RU4T 1QR3E 2J94A 1YM0A 1QQUA 2ZFQH 2AGGX 2BD4A 1O2JA 2OINA 2QF0A 1K1NA 2BDHA 2WYJA 4I7YH 1ZSLA 2LNCA 1QTFA 3I77A 1CHOG 1HAVA 3W94A 1MTNB 4UFGH 1C1VH 2CMYA 3A81A 3O8RA 3BTQE 3TK6A 1Z6EA 3LC5A 1AVXA 5A8YA 1EQ9A 1O38A 1HAZB 4FVDA 1C1WH 1DLEA 1P02A 2VIWA 4NCYA 3VXEH 1DY9A 1LKBA 3A82A 3UWIA 3IITA 3MOCA 4RKJB 2BD5A 2FM2A 3U8RH 5DKMA 1JBUH 1PPHE 1A0HB 2Y80A 3ENSB 5JB8S 3GCHB 2CHAB 1MU6B 3FZDA 1BMMH 1N1LA 1W3CA 5A0BA 4OS4A 1O3FA 2PSXA 1BTYA 2AMDA 1WUNH 2XC0A 1DM4B 4I31A 2A1DB 1G37A 1P2MA 1ELBA 1MD8A 1MTVA 2ZHEH 1J15A 3A7XA 2Z9JA 1SQTA 4JZIA 1ESAA 5HM2A 3OX7U 1OWEA 4ISHH 1T8NA 5LPEA 1VZQH 2G55A 2SGEE 1SOTA 4AG1A 2BQ6B 3B8JA 4CRAA 3HATH 4FVBA 4E06H 3PMBB 4OGXA 3OY6U 1BJUA 3RXTA 1O3MA 2CJIA 3SI3H 1GHWH 1WTGH 2FOAA 2WUBA 2LPRA 1BBRK 1TNJA 5EXLA 1HAPH 2FI4E 1PQ8A 1LPZB 1EOLA 3AASA 3LT3A 3S9AA 1W10U 1THRH 4KGAA 1RS0A 3C1KA 1AZZA 3GCNA 3QO6A 1ZTLA 5JBBS 2BTCE 3GY2A 4SGAE 1TX6A 2WV4A 2SGDE 2VNTA 1XUIA 2JKHA 4B76A 1E37B 4DY7B 1UMAH 3TK9A 3RMLH 4X6NA 1XVMA 4JYTA 6ESTA 1DY8A 1K21H 1NRSH 2GDDA 2W3IA 3UR6A 2SFAA 3ZZAA 1CE5A 1YPEH 1GI9B 3RXHA 1HAYB 1WCZA 2FMJA 1MH0A 4I8GA 1A3BH 3AAUA 1JIRA 1UHBB 1A46H 3GCOA 3K6YA 1LO6A 1C2FA 1SG8B 1INCA 4JZFH 1EZSC 3RXQA 3VEQB 2ZGXH 3Q3YA 3LOXA 2ZCKP 1ARCA 1V3XA 4YT6H 2CN0H 2QXJA 5E2OA 3QLPH 2XW9A 5JBTA 1O2SA 3DHKH 4X8SH 3C27B 1IQLA 2SGPE 1P09A 8GCHF 2A2XH 1O2NA 2ZCHP 4J1YA 2RA0A 1GJ9B 4HGCA 1VITG 4MNWA 2H2ZA 2EC9H 1FY5A 1SBWA 1QJ7B 4DOQA 1ANDA 1SLXB 5H4IB 2ZTXA 3RXFA 4IC6A 3RXOA 1V2OT 5I46H 1UCYK 2ZGHA 1X7AC 3PMAB 4Y76A 4CRGA 1AU8A 3BTFE 1C5NH 2JH6D 3F6UH 4HZHA 1E35B 3A8AA 4JYUH 3BTWE 3BTEE 1O3OA 2AEIH 2ASUB 1J9CH 1EATA 1TGTA 4INHA 5CHAC 1MBMA 1EKBB 1GI8B 1NC6A 1A61H 5A8ZA 1C1QA 1SGDE 1SHYA 3GDSA 1JOUB 1QGFA 1PQ7A 1PPEE 2G00A 1P03A 3HK3B 2PFEA 1G2LA 3P8NA 3Q3KA 1O3LA 2BD7A 3ZZ9A 1C1UH 2Y5HA 1H9LB 4WWYA 2C93B 1THPB 1V2LT 3U69H 2QIQA 3T26A 3RXCA 4TYDA 5A09A 2D8WA 4X6OA 7KMEH 4CHAC 2BDIA 5JPMH 1G3BA 3BEFB 2GZ7A 3MYWA 1O5AB 2G5NA 1KXBA 3LGVA 3RMOH 3SGAE 1TE0A 3KHVA 1BMLA 4GSOA 1DE7H 2A2QH 1FIWA 4MQAA 4H4FA 1BRCE 1F0SA 3MHWU 1ARBA 5L2YH 3LU9B 1MBQA 3TJNA 3LONA 3R0FA 1P10A 1P01A 3NCLA 1K1IA 3GY7A 1PPZA 3NUMA 5T6FA 3VGCC 2PSYA 1J14A 5FAHA 1GCTC 2XBVA 1PPBH 4AOQA 1YPGH 1BTPA 2QY0B 4BAHB 4D9QA 1C1NA 1W8BH 4ISLA 3JZ2B 3T2NA 2M5TA 4AX9H 3TGKE 1KIGH 1QJ6B 1GHAF 1YPKH 1DLKB 2AH4X 1DWEH 4WVPE 3FFGA 2EI6A 3A7TA 1BTHH 3EA8A 4MNVA 1PFXC 4LK4A 3L3TA 1C5ZB 3ZVDA 2FYRA 5JDUB 4WH6A 4CHAB 3E6PH 3PYHA 4TY6A 1TX8A 3UQVA 1GVKB 3ZZ5A 1ESBA 1MUEB 1HPGA 2TGAA 3A7WA 5CE1A 3BG8A 3UQOA 1C4V2 1O2PA 1P57B 1A5IA 1B7XB 3T25A 1O33A 2ZKSA 1S81A 3QGNB 1HXFH 3M3TA 3MTYA 4IGDA 4PROA 5FHTA 4ZAEA 1OX1A 4NA8A 2GX4A 2WYGA 2NWNA 3E91A 1ID5H 3VGCB 1UTMA 3M5OA 3LH3A 3EGKH 4IS5A 1GCTB 3ZV8A 5EXMA 1TNHA 2HNTC 2Q6GA 3SW2B 4ABFA 1S6HA 3D62A 1OWDA 2D1JA 1V2QT 2CXVA 1V2WT 3NKKA 3B23B 3SNCA 3EE0B 2AGEX 2HWLB 1T4VH 1Z8RA 3RXLA 2C8XB 1ZSKA 2UWOA 1Y3UA 3EA9A 1GGDC 4X1QU 2HRVA 1LDTT 5E0GA 4ZKNU 1ELAA 3M5LA 8GCHG 1HAOH 4AORA 5C3NA 2CF9H 5GCHF 4ZH8A 3BTGE 1BJVA 1ZYOA 1TGCA 4B75A 2CF8H 1NESE 2HALA 3TLOA 1KLJH 4X2XA 2BD3A 1BA8B 1SC8U 4INKA 3SU0A 1F0UA 3RC4A 1O39A 1HAXB 2OLGA 4X6MA 1UTLM 1V2KT 2GZ9A 1BZXE 3GISB 3B9FH 2BX3A 2OBQA 4Y7AA 3EYDA 5DPAA 2H9EH 2GCTB 3DFJA 3UY9A 9ESTA 1DANH 3ATKA 5EW2H 3SV6A 1DICA 1HAIH 1HJ8A 2V6NA 1FXYA 3ZZ3A 1GBAA 5EU8A 1BUIA 3MH6A 4NFFA 4ABGA 1C5RA 3W95A 1YYY1 3BTHE 1BHXF 2IJOB 2BOHB 1MU8B 5FCKA 3ZYDA 3RM2H 1UK2A 3PMJA 1GJ8B 1W12U 3HGPA 1GGDB 3EA7A 4BTUB 1P2JA 1AVGH 1TBQH 3Q3XA 1DWCH 1BIOA 3A7YA 2ESTE 1BHXB 4O97A 1C5XB 3MU8A 2UUFB 1ELTA 4YT7H 2VWNA 1AGJA 4J2YB 3S9CA 1ETRH 1WSSH 4K60A 2W26A 2ZGJA 2QF3A 1LTOA 1NU9A 2V35A 5G4BA 1GBFA 1W11U 2BDGA 2ZFPH 1O31A 2EA3A 4AN7A 2PLXA 1G9IE 3PB1E 1TRNA 3MH4A 2ZFTA 4B73A 1GJ4H 1YCPK 3RXAA 2BLOA 2QV1A 1YC0A 1GBEA 1LMWB 1TGBA 2Q6FA 1AQ7A 3RP2A 4AG2A 3UNRA 1ZPCA 1K1PA 2BYAX 4AB8A 1P06A 3ODFA 1C1PA 8LPRA 2WPLS 1GMHF 2FDAA 3BEIB 1CGIE 1SQAA 4YZUA 3NWUA 1GHAG 4ZMAH 4ZUHA 3TGJE 2O8LA 1G32B 1SGYE 1XMNB 3RXPA 1MKXH 2HLCA 3S7KB 1D4PB 1WU1A 1MZAA 2OQ5A 1O34A 1IQNA 3PLBA 5AF9H 2FS8A 1L4ZA
chains in the Genus database with same CATH superfamily
2STAE 4CR5A 2G4TA 2IN2A 3VB4A 1HXEH 4KKDA 4JMYA 2FXRA 1SPJA 1UTKA 2FIRH 1ORFA 1OYQA 2UWPA 1Y3WA 1WQSA 4F4OC 3MH7A 1NPMA 2JETC 1KSNA 1BTWA 3SGBE 1KXAA 5EODA 1TQ0B 1CHGA 1DT2A 1PPFE 4LZ1H 1HCGA 1K22H 1TBZH 3FKSD 1CQQA 4K1SA 3F0OA 5EJLA 4ISNA 2GMTC 4CBOA 5DG6A 4Y7BA 5JYIA 2BY7X 2W6JD 3CS0A 1UW7A 2PTNA 1QJ1B 4CREA 1SQRA 1SI5H 1W7GH 3ZVGA 1DITH 3P92A 2G5VA 1DXPA 1EAUA 4GAWA 5EIYA 1FIZA 1HBTH 2XTTB 4XDEA 1IOEA 3P8OA 2VVVA 3STJA 1ZSJA 3SV2H 2W7UA 1YGCH 4JZ1A 1W0JD 3TVJB 5A2MH 1WDIA 1GHYH 2HOBA 1HB0B 1S84A 1W0ZU 5C94A 3HK6B 3A8BA 3BSQA 2PUQH 1AD8H 1C2EA 4I33A 1GI1A 2V3OH 3SHAH 3VB3A 1H8HD 1GBTA 1HJAB 2VWMA 2FX4A 2Z9GA 3FOAA 1E36B 3PTNA 5DO4H 1HFDA 3KF2A 3KYGA 1GHZA 4AGJA 2V3HH 1NN6A 1O3AA 4AZ2B 2Z3CA 5C5NA 2P94A 4MG3A 4UD9H 3UR9A 2JETB 3N7DA 1BOQA 1YPHC 3LGYA 4I86A 4UEHH 5C17A 3SU6A 1NM6A 1DPOA 3IG6B 2FOHA 4Z0KA 2Z6BD 3LKWA 2AYWA 2VIDA 1TNKA 2XBWA 4U32A 2GMTB 1RJXB 1TRYA 1A0JA 2ZG0H 1L0ZA 4E7RG 2KCYA 2TGDA 1Y59T 2BZ6H 2P59A 1K2I1 3PO1B 2CGAA 2P8OC 3BG4C 4D7GA 1D3PB 1GDNA 2HGTH 4I8LA 4ZXYH 5K0HA 4RT1A 4ABJA 2QN5T 2FPZA 4A7IB 3RLWH 3M61U 1ZGVA 4NSVA 3BTTE 1FY3A 3FAOA 2ZA5A 1TPSA 3O8DA 3RXIA 2J2UA 5LH8A 5LPFA 3PWCA 2FTLE 1SLWB 3NPSA 4NSYA 1DWBH 1GDUA 3H7OA 3M3VA 5EQRA 1O0DH 1YLCA 3OYPA 1ZJDA 4NIXA 1GHBF 1TOMH 2KAIB 2ALPA 1BQYA 1O3BA 4B6FA 1GI0A 1TBRH 5TCCA 2Z9IA 3GYLB 1D6WA 7GCHG 1C5WB 3RMMH 1WTHD 3QGJA 3U9AH 1LVBA 1GJDB 4NIWA 4NIYA 2PHBA 4DG4A 3U8TH 1O3HA 4MLFB 4I32A 1O2RA 4A6LA 2BVRH 2W7SA 1BMFD 4JK6A 1KXFA 1SLUB 3MMGA 2GT7A 4X1SU 4ACAA 1P2QA 1K1LA 1S83A 1DFPA 1YF4A 3M5MA 4FXGH 2G8TA 3OE7D 4B74A 2QC2A 1T8OA 3RXEA 1LKAA 2JH5D 1OKXA 1OWHA 1GMHG 1BB0B 4Y0YE 2WPKS 1P8VC 2P8OB 3BG4B 2AIQA 4GCHF 1DVAH 1L2EA 3N7EA 4A92A 1PPCE 3D65E 1EAXA 1FNIA 5CMXH 1IQMA 1GI5A 1C5SA 1FLEE 2ODPA 3T5FH 1ZJKA 1J16A 2ANMH 4YOIA 4ZHAA 4K2YA 2C8YB 1O2GH 4Z1MD 1VGCC 2VB0A 3LGTA 2GTBA 3QDZB 2IJD1 3H7TA 3DUXH 5GWZA 3RXUA 1XUFA 1Z7KA 1PQAA 3NRLA 5EQQA 5ESBA 3SO3A 1MKWH 5C1XA 2XXLA 5C20A 2Z9LA 2WV5A 3GYMA 4XSKU 3GY6A 1ZRBA 5CHBA 2QA9E 5IDKA 1ZPZA 2H9HA 2BY9X 3SGQE 1UK4A 3ZZ4A 4U2WA 2P16A 4ZHLU 3RLYH 4X8VH 5FXLA 1AB9C 1HIAB 1QL8A 2JH0D 4UFEH 4XOJA 2F83A 4JCNA 2PP6A 3M7QA 3F9GA 1UTJA 2HNTE 4Y8ZA 1LPKB 2FESH 2VIVA 3S69A 4A1TA 4MVNA 3W1EA 1G3CA 4O9VA 2ODQA 4UE7H 1LHCH 3UIRA 2SNVA 1QBOA 1FN6A 3TK5A 1CO7E 4U30A 1RTLA 4K3JA 2QXHA 2YNAA 1SKYE 3SNBA 1W7XH 2R0LA 2OQUA 3SJ8A 2FZZA 1C2KA 1VGCB 4WH8A 1KXCA 2ZFRH 4DT4A 1QRXA 1COWD 1ZHRA 5KEDA 1AWFH 1UVOA 4MTBA 1AO5A 4Y11E 3RXRA 1S5SA 2FI3E 2VH6A 4X1RU 1QA0A 2A4OA 5C67A 1CGJE 5DK1A 1EAIA 3OAAD 3V13A 1HDTH 2ZECA 1SGQE 1GMDF 1AFQC 5HIYA 1AB9B 3MQKC 2AMPA 1O3GA 1GBKA 4FUGA 1CA8B 2AHME 2GT8A 4DIIH 1RIWC 1FMGA 3P6ZB 1Q31A 5L2ZH 5AFZH 4Q2KA 2OTVA 2A7JA 4JYVH 1SGPE 2A0QB 1FN8A 2P3UB 1KDQB 1FV9A 3PLKA 3ATLA 1SGIB 5C0TA 3STIA 4O3TA 1IQGA 2BY6X 2WHXA 4FU8A 4ZKOU 2BLQA 4MDSA 1TPOA 1W13U 1KY9A 1UVUH 3LGWA 5BRRE 3KEEA 1QB1A 1TWXB 3SBKA 2AFQB 1MTUA 1A4WH 2HPPH 1C2DA 3U98H 1SOZA 1H8DH 4FU7A 2EI8A 2GZ8A 2IOTA 3OTJE 4K5ZA 3UUZA 5F8TA 1OWIA 2FOEA 1G2MA 1N8OC 1GHBG 4DCDA 1ANCA 1HLTH 5DGJA 5CDFE 1O30A 2F9PA 4ASHA 4TWYA 2ZZUH 3FN8A 3TJOA 2PTCE 1ZGIA 1QL9A 1C5QA 1DX5M 3ZZCA 3U1JB 4Q4LA 1CU1A 4FUJA 5F6MA 1KLTA 1AFQB 1XUGA 2FYQA 2WPJS 1DS2E 3T28A 3ZVAA 1BTUA 1GL0E 3PV5A 2ZDVH 5FX6A 2PR3A 1RIWB 3QX5H 1LVYA 1OP8A 2P95A 1VCQA 1GBMA 3KQEA 4MNXA 3PLPA 1F7ZA 3MO6A 1SGNE 1SMFE 4Y8XA 4ISOA 1O5BB 1P2NA 2FP7B 4GCHG 3O8BA 1SGFG 2KAIA 2ZDKA 4A1VA 5IYTA 1GBIA 3FP8E 3QUMP 5DJ7A 3A8CA 5GDSH 4OS1A 1IAUA 1C5VA 1H8IH 3Q00A 5J4QA 2NU0E 2F9VA 1NBMD 2WINI 5HM9A 1O3IA 3ZZ6A 1PQ5A 1C1MA 3GOVB 1ABIH 1RTFB 1GHXH 5DP7A 1K28D 2QCYA 4YESB 3MNBA 5T1VA 1N8OB 1ELDE 1TGSZ 1QRWA 5E0HA 1RXPA 2BQ7B 4CRBA 2ANKH 3P8GA 2ZU1A 4ZKRU 1W14U 4JZEH 1PYTC 1BRUP 4I8KA 2C8ZB 3PROA 1O2UA 3DA9B 3I78A 1IQJA 1C9PA 3K65B 3DT0H 1MCTA 1QQ4A 1C5UA 1EB1H 1P9UA 2UUJB 1KLIH 1Z8GA 4NWLA 2W3KA 1QZ8A 3LGUA 2C4FH 4B2CA 1QFKH 1C2JA 1SGFA 2BLWA 1DWDH 4BAMB 2ZNKH 4K1EA 1RGQA 3T62A 2GCTC 2FEQH 3G01A 1MKXK 3R3GB 3A85A 3F9EA 1MTSA 1S85A 1ZHPA 4NZLA 1MZDA 1EJAA 1TIOA 1ELEE 1C5MD 3MI4A 3TITA 1THSH 1DUAA 1HIAA 2ZPRA 1C1TA 4Y71A 4YLUA 1A5HA 1NFUA 2R2MB 4XRNA 3ZYEA 4BOHA 2ZCLP 3SU4A 3F1SB 3SN8A 1BCUH 1AFEH 2ZU4A 4XBDA 2Y82A 1LVMA 2A5KA 3ZVEA 1O37A 1JIMA 1SFIA 1TFXA 2FO9A 1GMDG 5TJXA 2ZQ1A 4ZKSU 1DXWA 3KIDU 1Q3XA 4LOYH 4THNH 4RN6A 1OOKB 1OSSA 1O2IA 2ZHQH 5A8XA 1TLDA 5GNDA 3SNEA 1WYKA 2B0FA 4BXSA 1NU7B 5ABWA 4WXVA 2BDCA 2GVFA 4I8JA 3N7OA 1GCDA 1SR5C 1T7CA 4QT8C 3MU4A 5EJ1A 1DSTA 1ZR0A 1OWJA 5T3HA 1HRTH 2SGQE 3SJ9A 3UTUH 5JBCS 3RU4E 5AVDA 4DJZB 1RRKA 3ZZ8A 1AY6H 1GPZA 2O9QA 3NK8A 4P00A 3S0NA 3FVFB 4K8YA 4MPUA 5DP9A 1NROH 4X8UH 4X2WA 2GJGA 1BRAA 1TOCB 2LP6A 5HYOA 1NRQH 3RXGA 2QAAA 1DOJA 3ATWA 3TJUA 3SV9A 1KDQA 2BQWB 1AN1E 1V2VT 3T29A 4TPIZ 3RC6A 4Q63A 1KTTB 1O3JA 3EDXB 4DGJA 1HAHH 4FOUC 2BHGA 3SHCH 1GI3A 3CS7A 3WWBA 4WMFA 1BMAA 3UOPA 2KCOA 2RA3A 2TBSA 2HVXA 4NA7A 4A5TS 1Y5UT 1GMCF 1LCYA 1K1OA 5GIBA 7GCHF 1EP6A 2A32A 4Y0ZE 3ELAH 3PTBA 3KN2A 1B0FA 2XBYA 2IPHA 1A5GH 3TGIE 2ZHFH 3EE7A 3EQ0H 1VCPA 5EPYA 2ZTZA 1EASA 3QTOH 4LXBH 6GCHF 1QBVH 2TGTA 1VITH 1XUHA 3OSYA 4H42U 7LPRA 2XOKD 2Y6TA 5FBEA 3AK5A 3OY5U 1H4WA 3SU2A 3LJOA 4YOJA 1A7SA 1OYTH 3E3TA 2KFWA 1FUJA 1C2IA 4CRCA 4Y10E 3ZVCA 3RXVA 1A0LA 1DSUA 4B71A 1MCVA 4NG9H 4KTUA 2ZGBH 3SQEE 3M3SA 2BD2A 2B8OH 4ISIH 4P02A 2ZFFH 2C8WB 4K69A 4X0WU 1V2JT 5DP4A 3I29A 3SV7A 3V3MA 1SQOA 2VIOA 3SJKA 5HMAA 2YOLA 1G3EA 4GUXA 1YPJH 3TPIZ 1NRRH 2R9PA 2ZU3A 4M7GA 2PKSC 1HJAC 5EG4A 3M7TA 3GY3A 4ESTE 3WY8A 1CT2E 3AAVA 1TMUH 3LPRA 4WF8A 4UFFH 4MPWA 2BVXH 1FDPA 1AVWA 3LC3A 1CA0C 3SNAA 3PMHB 2I6QA 3M5NA 5JBAS 4FU9A 1F5RA 4AFZA 2OC8A 1NRPH 1J8AA 2ANWA 3GY8A 4FUDA 3SNDA 1ELGA 1SLVB 1JRSA 2OCVB 1MABB 1ZMJA 1XM1A 1GJBB 2R0KA 4NFEA 4Q7ZA 2OD3B 5T6GA 4Y6DA 4AYYB 2OK5A 1F2SE 2Q1JA 2FOMB 1TA2A 2A31A 2XYAA 3PO1C 5GJ4B 3TNSA 1C1SA 4ACBA 3CENA 3ESTA 2TPIZ 2V0BA 5E8EH 4WMEA 3CP7A 4H6TA 2PW8H 1WOFA 5B6LA 2SGFE 1ZRKA 4RI0A 2A4GA 4LZ4B 1AUTC 1B0EA 1EZQA 4UONA 5DP3A 1ZTKA 4MPXA 1E38B 2UUKB 5LPRA 3LH1A 1Z71A 5AHGH 2VVUA 2PKSB 4RSPA 4E05H 2FWWA 3SI4H 4KTCA 3ATIA 1EOJA 1F92A 2G81E 1T32A 1OXGA 5LGOA 1SSXA 2G52A 3NZIA 1FZZA 3ZV9A 5F03A 1EUFA 2BX4A 1CA0B 2K0QA 2D2DA 1NO9H 5C1UA 3QTVH 4XD7D 1O2QA 3BTKE 1LPGB 2GV7A 1IQKA 4IC5A 4K1TA 3MO9A 5EQSA 1L1NA 1L4DA 1ZTJA 2ZTYA 1O2MA 1NY22 2P93A 4CR9A 5FPTA 4BAOB 4DIHH 2GD4B 3F9FA 5J4SA 2XBXA 1L1JA 4ABEA 2F9BH 3SV8A 2ZU2A 1XVOA 4FETA 1NFXA 2WV9A 1GI4A 2FS9A 3MNCA 1BITA 4RKOB 5DP5A 2BLVA 2J38A 1NBME 4UDWH 1O3CA 2A45B 1O3DA 3TNTA 2OUAA 2ZHDA 2O8WA 2WSSD 2STBE 2R2WU 2YNBA 2WPDD 3M35A 3URDA 3GCTF 2PKAB 3MFJA 3SQHE 3SZNA 1C1OA 1KTSB 4YO9A 2WPHS 2NU2E 3ODDA 1MMJN 1XXFA 1QCPA 5PTPA 4ABIA 1SVPA 3E0NB 1AI8H 1GMCG 2BOKA 3RXJA 1YCPH 4OS6A 1C5LH 2KCAA 3RXBA 2RDEA 2VJ1A 3RDZA 2PV9B 2OC7A 3P8FA 4DVAU 1GG6C 1AE8H 2W5EA 3D23A 2BY5X 1K1JA 3V12A 3BTME 2JIZD 2PGQB 1A1RA 6GCHG 4TSFD 1SL3A 2V3MA 1O5DH 2A7HA 1NFWA 3IWMA 4DURA 2GCHF 3A7VA 1TPAE 3RC5A 3RU4D 1FX0B 5I25A 5FPSA 3AVZA 1IQEA 4ZXXH 1KXDA 2UWLA 3BV9B 1VJ9U 3QZRA 3L6PA 1OPHB 4OS7A 1TONA 3EAJA 1OP2A 3P70B 1O3PB 3MH5A 2H9TH 4D8NA 2ZWLH 2BVSH 4GVUA 3TIUA 3ATMA 4WJG2 2O8UA 5C0UA 1GJ5H 1QBNA 2VWOA 1B5GH 2IPQX 1TB6H 1EX3A 2FX6A 2F9NA 2ANYA 4XFQA 1V2MT 2ZQ2A 1FPHH 1D3QB 1YLDA 6LPRA 1S0RA 3UWJH 5HXFA 3TH4H 2AGIX 4IMQA 4FUCA 3DFLA 4X2VA 4Z6AH 1GG6B 4H6SB 1QRZA 1NRNH 4X2YA 1H8ED 1VCWA 3RXSA 2VVCA 2OC1A 3LGIA 2G51A 1FJSA 4JZDH 3SOSA 1UTNA 2VINA 2FOBA 1QIXB 1Z1JA 2Y7XA 3KCGH 1TA6A 1P0SH 4B1TA 3VFEA 2WPMS 1T8MA 3FO8D 5EJZA 1JWTA 1RD3B 1O36A 1BRBE 4BAKB 2THFB 3KQBA 1T31A 3Q77A 3P95A 5AFYH 2K8IA 1NTPA 3HGNA 2GP9B 1UVPA 4NA9H 4U01A 4ZHMU 1AIXH 4AYVB 3UFAA 3KQ5A 1NFYA 3A89A 1BBRE 1N6XA 1W2KH 2VIQA 2HPQH 4B2AA 4XE4A 1GBJA 1O2LA 3ZVBA 2QYIA 3QN7A 1UJ1A 5FX5A 4CH8B 2ZFSA 3URCA 1O5EH 3GDVA 1FY8E 2H1UA 2D26C 4Q7XA 1C2LA 1UTPA 3SJOA 2VGCC 6CHAC 5A0CA 1P05A 1EP5A 3LDXH 4IN1A 2ZI2H 2EI7A 2BDYA 3M37A 5FPYA 4DW2U 1O2WA 1H9IE 2F91A 3V0XA 1Z6JH 1JMOH 2DUCA 3FZZA 4TY7A 2PGBB 4AB9A 2G4UA 1Y8TA 1SGTA 3A86A 1WV7H 4CH2B 1XUJA 1O5GH 3U28C 3D49H 4SGBE 1IHTH 4B2BA 4D76A 1LHFH 1ZOMA 2YMSC 1CBWC 5GPIB 5KECA 1J17T 1GBLA 1MAYA 1Y3VA 1MTWA 1P11E 4FUEA 2J95A 1O2OA 2UUYA 5ESTE 4AFUA 1G30B 1TNIA 2RDLA 2HLDD 3AW1A 1IQIA 1GVZA 3OTPA 1Y5AT 3GDUA 5EXNA 3BEUA 4YM9A 5KGOA 2WZQA 1H9HE 3H09A 2BD9A 3GCTG 3K9XB 1AUJA 2ZPSA 5F8ZA 4ABBA 2ALVA 4BAQB 1C2HA 2QXGA 2A7CA 2P3FH 5DP8A 9LPRA 3HKJB 2F9OA 3VB5A 1YBWA 2ZDLA 1C4U2 1EB2A 1Z8JB 2ZF0H 2VBCA 4BNRA 1O5CB 2FOCA 1EFRD 1PJPA 3U1IB 2VGCB 1KYNA 2Y81A 4Q80A 4WY3A 5A0AE 6CHAB 1WAYB 1S0QA 1GI2A 1C2GA 1CGHA 4DT7B 2F3CE 1UCYE 2R3UA 2ZO3H 1XKBC 4IMZA 4YTAA 2RCEA 1FI8A 3E1XB 4NIVA 5JB9S 5SGAE 3PRBA 1UK3A 3PWBA 2PKAA 3T27A 3VPKA 2VU8E 2JJ1D 2YMSB 4HFPB 1MAXA 1CBWB 2GCHG 4F49A 1BTZA 1F0RA 1NT1A 1V2UT 2OP9A 4MNYA 1GBCA 1A2CH 3KQDA 1AZ8A 1IQHA 1K1MA 1IQFA 1Z1IA 3RUOA 1L1GA 1HUTH 1LVOA 1ETSH 2H5DA 3F0PA 1E79D 1SGRE 3KNXA 4BTIB 2GDEH 3S7HB 2J92A 1G36A 1VKYA 1P12E 1TABE 1C1RA 3O8CA 3GS9A 2B5TB 1DDJA 2GGVB 5EOKA 4I8HA 1BBRH 1UO6A 4WMDA 2BDAA 4FUHA 1OS8A 1ANEA 1ESTA 1RTKA 2Z3DA 3FP6E 2ZGCA 5C5OA 1E0FD 1ABJH 5CHAB 5BPEA 1G3DA 1EJNA 1CSOE 1O3EA 1YPLH 1FAXA 2O8MA 1EPTC 2EEKA 2K1QA 1O3KA 3F2HA 1QL7A 4RT0A 4ABDA 2OBOA 2ZDMA 4X6PA 3M36A 1LHGH 1O2ZA 1O2VA 4R8TB 1TGNA 2ZP0H 2FTMA 1CT4E 4X1NU 4D9RA 4VGCC 1EJMA 3ZZDA 1SGEE 2ZDAH 1OWKA 2Z3EA 3GY5A 4TT3D 1C9TA 2AIPA 2VWLA 4UFDH 3K6ZA 1NS3A 1LQEA 4XBBA 1GI7B 4ZROA 2M2AA 3TU7H 2GKVE 4OM9A 1KXEA 2EQNA 3SORA 3VB6A 3SJIA 1FONA 4O03A 1SFQB 2P3TB 3SZEA 1ZMNA 1QA7A 3SUGA 1TAWA 1GI6A 1PYTD 3FP7E 1FY1A 1HYLA 2BDBA 2BD8A 3UOUA 1SB1H 1HGTH 2GV6A 1AKSB 4X1PU 4IW4E 1HNEE 3SU5A 3U8OH 1E34B 1O3NA 1ELFA 1P3CA 2XRCA 2VIPA 3UPEA 1YPHE 4JK5A 2KCPA 4WXIA 1QHRB 3A7ZA 1YPMH 1E1QD 3MU5A 3RM0H 4X8TH 5C2ZA 3OU0A 2ZEBA 1UCYH 2C90B 3E8LA 4MPVA 1Z8IB 5K7RA 1UTQA 1ZPBA 2HVYB 1N6YA 2BMGB 1ACBE 1EPTB 1OP0A 1GBDA 5E0JA 3TJVA 3SUEA 1BT7A 1C5TA 2PWXA 2SNWA 4HTCH 1YCPM 1TALA 1C2MA 1D3TB 1FAKH 1FPCH 3UNQA 4VGCB 3RXDA 1O2HA 4HI3A 1T4UH 3MNSA 2FLRH 2BZAA 1XUKA 2RG3A 1P3EA 4YXWD 3QZQA 2Y5FA 1O2YA 4GHTA 2ULLA 5FBIA 4NGAH 3E0PB 3FANA 1O2TA 1EXFA 3DSPA 1GL1A 2Y5GA 2ZPQA 3A84A 2XCFA 1UTOA 1UHBA 3SU3A 2KZ4A 2WUCA 2HNTF 3SU1A 2Y7ZA 1NZQH 1M9UA 4Y8YA 1LHEH 2BY8X 8KME2 5EPNA 3VXFH 4NZQA 1Y3XA 1AMHA 3KQCA 4OGYA 3E16B 1MQ6A 1TPPA 5EW1H 1O5FH 1FQ3A 4AFQA 1MD7A 1HAVB 5B6OA 1GJ6A 4E7NA 1WQVH 1AHTH 2Q6DA 1BTXA 1C4Y2 1QY6A 2CV3A 2QGRA 1F5LA 2A4QA 1O35A 3F68H 2BM2A 1VJAU 1P2OA 3F2FA 2RFKC 3JZ1B 1S6FA 4TPYA 5T6DA 2FOGA 2AS9A 2OC0A 2H5CA 3L33A 1CVWH 1A3EH 1GJAB 5L30H 1U6QA 1V2NT 1BMNH 1V2TT 4BXWA 1TNGA 1AE5A 2DE9A 1D9IA 1XKAC 1CHOF 1V2RT 1GWAA 4GHQA 1ANBA 1Y3YA 3MU0A 4XBCA 1O32A 4O3UA 1V2ST 3BIVH 5ETXA 2TIOA 2BXUH 2KR7A 4NWKA 2CK3D 2XC4A 4HG6A 1TMBH 1C5OH 3BIUH 3M7UA 2J34A 1V6DA 4YLQH 1GVLA 4R0IA 4K8BA 3Q76A 4FUFA 4CRDA 1TYNA 2DE8A 5C1YA 4BTTB 3VG8A 2I6SA 2NU4E 1V2PT 2TRMA 1LHDH 4F55A 4CBNA 1ELVA 2A5IA 3BN9A 1VR1H 1BDAA 1QB6A 2XWAA 2AERH 4A1XA 1P2KA 1PPGE 1EZUC 2C3SA 4FUIA 2FODA 3A88A 1Q2WA 1HV7A 2F43B 1EZXC 3KL6A 3SUDA 1TRMA 1HAGE 1GJCB 4KELA 1D6RA 4ABAA 2BXTH 2XC5A 3GICB 3F9HA 1GDQA 1HJ9A 1LQDB 1IHSH 1XX9A 3ZZBA 1JRTA 2O8TA 1P9SA 3WWFA 1C5YB 3PM3A 3VB7A 2F9UA 2Z94A 4OS2A 1E1RD 1Y5BT 2J98B 2XWBI 1P2IA 3UAIC 2SGAA 3AW0A 3HPTB 2R3YA 1GHVH 1ZMLA 5DN6D 4AFSA 2ZHWH 8ESTE 2QF5A 4D7FA 2ZU5A 2FI5E 3A8DA 3MWIU 2XNIA 3MU1A 1RFNA 1ZLRA 1ELCA 3K2UA 1GBHA 2FOFA 1MKWK 2NU1E 4BANB 3ITIA 1AWHB 1O2XA 4GPGA 1P04A 3TH3H 4Y79A 5TCAA 4CRFA 4OS5A 3MO3A 2NU3E 2ODYB 3BF6H 4INLA 1O2KA 1FY4A 1SHHB 3KGPA 3UNSA 2XCNA 3P17H 2ILNA 5F8XA 3A80A 3F2GA 3RXKA 3TH2H 1XXDA 2TGPZ 3A87A 2ZC9H 3DD2H 5DSFA 1T8LA 1TNLA 2A5AA 1H1BA 2WPIS 4Q7YA 4IN2A 3LJJA 1TQ7B 1W0YH 4IBLH 1UVTH 1AKSA 1K9OE 5EGMA 4ABHA 1MQ5A 5GCHG 1SGCA 1UVSH 3ZZ7A 2AMQA 2BB4A 3HKIB 4GLYA 3E90B 3UREA 2FLBH 1MTNC 2ZDNA 5DP6A 1D3DB 4ASUD 1ETTH 3MNXA 3RMNH 2B7DH 3RXMA 2B9LA 1F0TA 1F5KU 2J9NA 3GY4A 4FUBA 5E2PA 1QURH 1ZZZA 2QXIA 4AGKA 2VH0A 3A83A 1EPTA 1ZHMA 3PV4A 2OXSA 3BTDE 4YOGA 2XNDD 1TMTH 4KTSA 1S82A 2A4RA 4M9FA 1QB9A 1VITF 3NXPA 5L6NH 1K0HA 1TX7A 1QNJA 5GXPA 3F3BA 2Z7FE 3QWCH 5FCRA 2J4IA 1C5PA 2PUXB 3QK1A 1JXPA 3SUFA 3S9BA 1CT0E 5F53A 1DUEA 3V7TA 3DSOA 1GJ7B 2ZIQH 3H5CB 3GCHC 4TWWA 2CHAC 3ZVFA 1YKTA 2J5UA 1EAWA 2H6MA 1WBGB 1YP9A 7ESTE 3LIWA 1GBBA 5HGGA 2Z9KA 4KP0A 3RU4T 1QR3E 2J94A 2W6ID 1YM0A 1QQUA 2ZFQH 2AGGX 2BD4A 1O2JA 2OINA 2QF0A 1K1NA 2BDHA 2WYJA 4I7YH 1ZSLA 2LNCA 1QTFA 3I77A 1CHOG 1HAVA 3W94A 1MTNB 4UFGH 1C1VH 2CMYA 3A81A 3O8RA 3BTQE 3TK6A 1Z6EA 3LC5A 1AVXA 5A8YA 1EQ9A 3ZIAD 1O38A 1HAZB 4FVDA 1C1WH 1DLEA 3N99A 1P02A 2VIWA 4NCYA 3VXEH 1DY9A 1LKBA 3A82A 3UWIA 2LELA 4ZCNA 3IITA 3MOCA 4RKJB 2BD5A 2FM2A 3U8RH 5DKMA 1JBUH 1PPHE 1A0HB 2Y80A 3ENSB 5JB8S 3GCHB 2CHAB 1MU6B 3FZDA 1BMMH 1N1LA 1W3CA 5A0BA 4OS4A 1O3FA 2PSXA 1BTYA 2AMDA 1WUNH 2XC0A 1DM4B 4I31A 2A1DB 1G37A 1P2MA 1ELBA 1MD8A 1MTVA 2ZHEH 1J15A 3A7XA 2Z9JA 1SQTA 4JZIA 1WXRA 1ESAA 5HM2A 3OX7U 1OWEA 4ISHH 1T8NA 5LPEA 1VZQH 2G55A 2SGEE 1SOTA 4AG1A 2BQ6B 3B8JA 4CRAA 3HATH 4FVBA 4E06H 3PMBB 4OGXA 3OY6U 1BJUA 3RXTA 1O3MA 2CJIA 3SI3H 1GHWH 1WTGH 2FOAA 2WUBA 2LPRA 1BBRK 1TNJA 5EXLA 1HAPH 4B6EA 2FI4E 1PQ8A 1LPZB 1EOLA 3AASA 3LT3A 3S9AA 2F4LA 2L74A 1W10U 1THRH 4KGAA 1RS0A 3C1KA 1AZZA 3GCNA 3QO6A 1ZTLA 5JBBS 2BTCE 3GY2A 4SGAE 1TX6A 3OEHD 2WV4A 2SGDE 2VNTA 2J98A 1XUIA 2JKHA 4B76A 2JJ2D 1E37B 4DY7B 1UMAH 3TK9A 3RMLH 4X6NA 1XVMA 4JYTA 6ESTA 1DY8A 1K21H 1NRSH 2GDDA 2W3IA 3UR6A 2SFAA 1YWUA 3ZZAA 1CE5A 1YPEH 1GI9B 3RXHA 1HAYB 1WCZA 2FMJA 1MH0A 4I8GA 1A3BH 3AAUA 1JIRA 1UHBB 1A46H 3GCOA 3K6YA 1LO6A 1C2FA 1SG8B 1INCA 4JZFH 1EZSC 3RXQA 3VEQB 2ZGXH 3Q3YA 3LOXA 2ZCKP 1ARCA 1V3XA 4YT6H 2CN0H 2QXJA 5E2OA 3QLPH 2XW9A 5JBTA 3OFND 3WW7A 1O2SA 3DHKH 4X8SH 3C27B 1IQLA 2SGPE 1P09A 8GCHF 2A2XH 1O2NA 2ZCHP 4J1YA 2RA0A 1GJ9B 5FL7D 4HGCA 1VITG 4MNWA 1W0KD 1S6LA 2KM0A 2H2ZA 2EC9H 1FY5A 1SBWA 2J97A 1QJ7B 4DOQA 1ANDA 1SLXB 5H4IB 2ZTXA 3RXFA 4IC6A 3RXOA 1V2OT 5I46H 1UCYK 2ZGHA 1X7AC 5HIZA 3PMAB 4Y76A 4CRGA 1AU8A 3BTFE 1C5NH 2JH6D 3F6UH 4HZHA 1E35B 3A8AA 4JYUH 3BTWE 3BTEE 3SYJA 1O3OA 2AEIH 2ASUB 1J9CH 2YMSD 1EATA 1TGTA 4INHA 5CHAC 1MBMA 1EKBB 1GI8B 1NC6A 1A61H 5A8ZA 1C1QA 1SGDE 1SHYA 3GDSA 3CNRA 1JOUB 1QGFA 1PQ7A 1PPEE 2G00A 1P03A 3HK3B 2PFEA 1G2LA 3P8NA 3Q3KA 1O3LA 2BD7A 3ZZ9A 1C1UH 2Y5HA 1H9LB 4WWYA 2C93B 1THPB 1V2LT 3U69H 2QIQA 3T26A 3RXCA 2QF4A 4TYDA 5A09A 2D8WA 4X6OA 7KMEH 4CHAC 2BDIA 5JPMH 1G3BA 3BEFB 2GZ7A 3MYWA 1O5AB 2G5NA 1KXBA 3LGVA 3RMOH 3SGAE 1TE0A 3KHVA 1BMLA 4GSOA 1DE7H 2A2QH 1FIWA 4MQAA 4H4FA 1BRCE 1F0SA 3MHWU 1ARBA 3KYFA 5L2YH 3LU9B 1MBQA 3TJNA 3LONA 3R0FA 1P10A 1P01A 3NCLA 1K1IA 3GY7A 1PPZA 3NUMA 5T6FA 3VGCC 2PSYA 1J14A 1KMHB 5FAHA 1YY3A 1GCTC 2XBVA 1PPBH 4AOQA 1YPGH 1BTPA 2QY0B 4BAHB 4D9QA 1C1NA 1W8BH 4ISLA 3JZ2B 3T2NA 2M5TA 2KX4A 4AX9H 3TGKE 5IK2D 1KIGH 1QJ6B 1GHAF 1YPKH 1DLKB 3PV2A 2AH4X 1DWEH 4WVPE 3FFGA 2V7QD 2EI6A 3A7TA 1BTHH 3EA8A 4MNVA 1PFXC 4LK4A 3L3TA 1C5ZB 3ZVDA 2FYRA 5JDUB 4WH6A 4CHAB 3E6PH 3PYHA 4TY6A 1TX8A 3UQVA 2L6OA 1GVKB 3ZZ5A 1ESBA 1MUEB 1HPGA 2TGAA 3A7WA 5CE1A 3BG8A 3UQOA 1C4V2 1O2PA 1P57B 1A5IA 1B7XB 3T25A 1O33A 2ZKSA 1S81A 3QGNB 1HXFH 3M3TA 3MTYA 4F48B 5HKKD 4IGDA 4PROA 5FHTA 4ZAEA 1OX1A 4NA8A 2GX4A 2WYGA 2NWNA 3E91A 1ID5H 3VGCB 1UTMA 3M5OA 3LH3A 3EGKH 4IS5A 1GCTB 3ZV8A 5EXMA 1TNHA 2HNTC 2Q6GA 3SW2B 4ABFA 1S6HA 3D62A 1OWDA 2D1JA 1V2QT 2CXVA 1V2WT 3NKKA 3B23B 3SNCA 3EE0B 2AGEX 2HWLB 1T4VH 1Z8RA 3RXLA 2C8XB 1ZSKA 2UWOA 1Y3UA 3EA9A 1GGDC 4X1QU 2HRVA 1LDTT 2EY4C 5E0GA 4ZKNU 1ELAA 3M5LA 8GCHG 1HAOH 4AORA 1YLNA 5C3NA 2CF9H 4AC9A 5GCHF 4ZH8A 3BTGE 1BJVA 3DSGA 1ZYOA 1TGCA 4B75A 2CF8H 1NESE 2HALA 3TLOA 1KLJH 4X2XA 2BD3A 2QE7D 3PRDA 1BA8B 1SC8U 4INKA 3SU0A 3UB0A 1F0UA 3RC4A 1O39A 1HAXB 2OLGA 4X6MA 1UTLM 1V2KT 2GZ9A 1BZXE 3GISB 3B9FH 2BX3A 2OBQA 4Y7AA 3EYDA 5DPAA 2H9EH 2GCTB 3DFJA 3UY9A 9ESTA 1DANH 3ATKA 5EW2H 3SV6A 1DICA 1HAIH 1HJ8A 2V6NA 1FXYA 3ZZ3A 1GBAA 5EU8A 1BUIA 3MH6A 4NFFA 4ABGA 1C5RA 3W95A 1YYY1 3BTHE 1BHXF 2IJOB 2BOHB 1MU8B 5FCKA 3ZYDA 3RM2H 1UK2A 3PMJA 1GJ8B 1W12U 3HGPA 1GGDB 3EA7A 4BTUB 1P2JA 1AVGH 1TBQH 3Q3XA 1DWCH 1BIOA 3A7YA 2ESTE 1BHXB 4O97A 1C5XB 3MU8A 2UUFB 1ELTA 4YT7H 2VWNA 1AGJA 4J2YB 3S9CA 1ETRH 1WSSH 4K60A 2W26A 2ZGJA 2QF3A 1LTOA 1NU9A 2V35A 5G4BA 1GBFA 1W11U 2BDGA 2ZFPH 1O31A 2JDID 2EA3A 4AN7A 2PLXA 1G9IE 3PB1E 1TRNA 3MH4A 2ZFTA 4B73A 1GJ4H 1YCPK 3RXAA 2BLOA 2QV1A 1YC0A 1GBEA 1LMWB 1TGBA 2Q6FA 1AQ7A 3RP2A 4AG2A 3UNRA 3OEED 1ZPCA 1K1PA 2BYAX 4AB8A 1P06A 3ODFA 1C1PA 8LPRA 2WPLS 1GMHF 2FDAA 3BEIB 1OHHD 3DCLA 1CGIE 1SQAA 4YZUA 3NWUA 1GHAG 4ZMAH 4ZUHA 3TGJE 1G32B 1SGYE 1XMNB 2O8LA 3RXPA 1MKXH 2HLCA 3S7KB 1D4PB 1WU1A 1MZAA 2OQ5A 1O34A 1IQNA 3PLBA 5AF9H 2FS8A 1L4ZA
chains in the Genus database with same CATH topology
2STAE 4CR5A 2G4TA 2IN2A 3VB4A 1HXEH 4KKDA 4JMYA 2FXRA 1SPJA 1UTKA 2FIRH 1ORFA 1OYQA 2UWPA 1Y3WA 1WQSA 4F4OC 3MH7A 1NPMA 2JETC 1KSNA 1BTWA 3SGBE 1KXAA 5EODA 1TQ0B 1CHGA 1DT2A 1PPFE 4LZ1H 1HCGA 1K22H 1TBZH 1CQQA 4K1SA 4ISNA 2GMTC 4CBOA 5DG6A 4Y7BA 5JYIA 2BY7X 3CS0A 2PTNA 1QJ1B 4CREA 1W7GH 1SI5H 3ZVGA 1DITH 3P92A 2G5VA 1DXPA 1EAUA 4GAWA 1FIZA 1HBTH 2XTTB 4XDEA 1IOEA 3P8OA 2VVVA 3STJA 1ZSJA 3SV2H 2W7UA 1YGCH 4JZ1A 3TVJB 5A2MH 1GHYH 2HOBA 1HB0B 1S84A 1W0ZU 3HK6B 3A8BA 3BSQA 2PUQH 1AD8H 1C2EA 4I33A 1GI1A 2V3OH 3SHAH 3VB3A 1GBTA 1HJAB 2VWMA 2FX4A 2Z9GA 3PTNA 1E36B 5DO4H 1HFDA 3KF2A 1GHZA 4AGJA 2V3HH 1NN6A 1O3AA 4AZ2B 2Z3CA 5C5NA 2P94A 4MG3A 4UD9H 3UR9A 2JETB 1BOQA 1YPHC 3LGYA 4UEHH 3SU6A 1NM6A 1DPOA 3IG6B 2FOHA 4Z0KA 2Z6BD 3LKWA 2AYWA 2VIDA 1TNKA 2XBWA 4U32A 2GMTB 1RJXB 1TRYA 1A0JA 2ZG0H 1L0ZA 4E7RG 2TGDA 1Y59T 2BZ6H 2P59A 1K2I1 3PO1B 2CGAA 2P8OC 3BG4C 4D7GA 1D3PB 1GDNA 2HGTH 4I8LA 4ZXYH 5K0HA 4ABJA 2QN5T 2FPZA 4A7IB 3RLWH 3M61U 1ZGVA 4NSVA 3BTTE 1FY3A 3FAOA 2ZA5A 1TPSA 3O8DA 3RXIA 2J2UA 5LH8A 5LPFA 3PWCA 2FTLE 1SLWB 3NPSA 4NSYA 1DWBH 1GDUA 3H7OA 3M3VA 5EQRA 1O0DH 1YLCA 3OYPA 1ZJDA 4NIXA 1GHBF 1TOMH 2KAIB 2ALPA 1BQYA 1O3BA 1GI0A 1TBRH 5TCCA 2Z9IA 3GYLB 1D6WA 7GCHG 1C5WB 3RMMH 1WTHD 3QGJA 3U9AH 1LVBA 1GJDB 4NIWA 4NIYA 2PHBA 4DG4A 3U8TH 1O3HA 4MLFB 4I32A 1O2RA 4A6LA 2BVRH 2W7SA 4JK6A 1KXFA 1SLUB 3MMGA 2GT7A 4X1SU 1P2QA 1K1LA 1S83A 1DFPA 1YF4A 3M5MA 4FXGH 2G8TA 4B74A 2QC2A 1T8OA 3RXEA 1LKAA 2JH5D 1OKXA 1OWHA 1GMHG 1BB0B 4Y0YE 2WPKS 1P8VC 2P8OB 3BG4B 2AIQA 4GCHF 1DVAH 1L2EA 4A92A 1PPCE 3D65E 1EAXA 1FNIA 5CMXH 1IQMA 1GI5A 1C5SA 1FLEE 2ODPA 3T5FH 1ZJKA 1J16A 2ANMH 4YOIA 4ZHAA 4K2YA 2C8YB 1O2GH 1VGCC 2VB0A 3LGTA 2GTBA 3QDZB 3H7TA 3DUXH 5GWZA 3RXUA 1XUFA 1Z7KA 1PQAA 5EQQA 5ESBA 3SO3A 1MKWH 5C1XA 2XXLA 5C20A 2Z9LA 2WV5A 3GYMA 4XSKU 3GY6A 1ZRBA 2QA9E 5IDKA 1ZPZA 2H9HA 2BY9X 3SGQE 1UK4A 3ZZ4A 4U2WA 2P16A 4ZHLU 3RLYH 4X8VH 5FXLA 1AB9C 1HIAB 1QL8A 2JH0D 4UFEH 4XOJA 2F83A 4JCNA 3M7QA 3F9GA 1UTJA 2HNTE 4Y8ZA 1LPKB 2FESH 2VIVA 3S69A 4A1TA 4MVNA 1G3CA 4O9VA 2ODQA 4UE7H 1LHCH 3UIRA 2SNVA 1QBOA 1FN6A 3TK5A 1CO7E 4U30A 1RTLA 4K3JA 2QXHA 2YNAA 3SNBA 1W7XH 2R0LA 2OQUA 3SJ8A 2FZZA 1C2KA 1VGCB 4WH8A 1KXCA 2ZFRH 1QRXA 1ZHRA 1AWFH 1UVOA 4MTBA 1AO5A 4Y11E 3RXRA 1S5SA 2FI3E 2VH6A 4X1RU 1QA0A 2A4OA 5C67A 1CGJE 5DK1A 1EAIA 3V13A 1HDTH 2ZECA 1SGQE 1GMDF 1AFQC 1AB9B 2AMPA 1O3GA 1GBKA 4FUGA 1CA8B 2GT8A 4DIIH 1RIWC 1FMGA 3P6ZB 1Q31A 5L2ZH 5AFZH 4Q2KA 2OTVA 2A7JA 4JYVH 1SGPE 2A0QB 1FN8A 2P3UB 1KDQB 1FV9A 3PLKA 3ATLA 1SGIB 3STIA 4O3TA 1IQGA 2BY6X 4FU8A 4ZKOU 2BLQA 4MDSA 1TPOA 1W13U 1KY9A 1UVUH 3LGWA 5BRRE 3KEEA 1QB1A 1TWXB 3SBKA 2AFQB 1MTUA 1A4WH 2HPPH 1C2DA 3U98H 1SOZA 1H8DH 4FU7A 2EI8A 2GZ8A 2IOTA 3OTJE 4K5ZA 3UUZA 5F8TA 1OWIA 2FOEA 1G2MA 1N8OC 1GHBG 4DCDA 1ANCA 1HLTH 5DGJA 1O30A 2F9PA 4ASHA 4TWYA 2ZZUH 3TJOA 2PTCE 1ZGIA 1QL9A 1C5QA 1DX5M 3ZZCA 3U1JB 1CU1A 4FUJA 5F6MA 1KLTA 1AFQB 1XUGA 2FYQA 2WPJS 1DS2E 3T28A 3ZVAA 1BTUA 1GL0E 2ZDVH 5FX6A 2PR3A 1RIWB 3QX5H 1LVYA 1OP8A 2P95A 1VCQA 1GBMA 3KQEA 4MNXA 3PLPA 1F7ZA 3MO6A 1SGNE 1SMFE 4Y8XA 4ISOA 1O5BB 1P2NA 2FP7B 4GCHG 3O8BA 1SGFG 2KAIA 2ZDKA 4A1VA 5IYTA 1GBIA 3FP8E 3QUMP 5DJ7A 3A8CA 5GDSH 4OS1A 1IAUA 1C5VA 1H8IH 3Q00A 5J4QA 2NU0E 2F9VA 2WINI 5HM9A 1O3IA 3ZZ6A 1PQ5A 1C1MA 3GOVB 1ABIH 1RTFB 1GHXH 5DP7A 1K28D 2QCYA 4YESB 3MNBA 1N8OB 1ELDE 1TGSZ 1QRWA 5E0HA 1RXPA 2BQ7B 4CRBA 2ANKH 3P8GA 2ZU1A 4ZKRU 1W14U 4JZEH 1PYTC 1BRUP 4I8KA 2C8ZB 3PROA 1O2UA 3DA9B 3I78A 1IQJA 1C9PA 3K65B 3DT0H 1MCTA 1QQ4A 1C5UA 1EB1H 1P9UA 2UUJB 1KLIH 1Z8GA 4NWLA 2W3KA 3LGUA 2C4FH 4B2CA 1QFKH 1C2JA 1SGFA 2BLWA 1DWDH 4BAMB 2ZNKH 4K1EA 1RGQA 3T62A 2GCTC 2FEQH 3G01A 1MKXK 3R3GB 3A85A 3F9EA 1MTSA 1S85A 1ZHPA 4NZLA 1MZDA 1EJAA 1TIOA 1ELEE 1C5MD 3MI4A 3TITA 1THSH 1DUAA 1HIAA 2ZPRA 1C1TA 4Y71A 4YLUA 1A5HA 1NFUA 2R2MB 3ZYEA 4BOHA 2ZCLP 3SU4A 3F1SB 3SN8A 1BCUH 1AFEH 2ZU4A 4XBDA 2Y82A 1LVMA 2A5KA 3ZVEA 1O37A 1JIMA 1SFIA 1TFXA 2FO9A 1GMDG 5TJXA 2ZQ1A 4ZKSU 1DXWA 3KIDU 1Q3XA 4LOYH 4THNH 4RN6A 1OOKB 1OSSA 1O2IA 2ZHQH 5A8XA 1TLDA 3SNEA 1WYKA 2B0FA 4BXSA 1NU7B 5ABWA 4WXVA 2BDCA 2GVFA 4I8JA 3N7OA 1GCDA 1SR5C 1T7CA 4QT8C 3MU4A 1DSTA 1ZR0A 1OWJA 5T3HA 1HRTH 2SGQE 3SJ9A 3UTUH 5JBCS 3RU4E 5AVDA 4DJZB 1RRKA 3ZZ8A 1AY6H 1GPZA 2O9QA 3NK8A 3S0NA 3FVFB 4K8YA 4MPUA 5DP9A 1NROH 4X8UH 4X2WA 1BRAA 1TOCB 5HYOA 1NRQH 3RXGA 2QAAA 1DOJA 3ATWA 3TJUA 3SV9A 1KDQA 2BQWB 1AN1E 1V2VT 3T29A 4TPIZ 3RC6A 1KTTB 1O3JA 3EDXB 4DGJA 1HAHH 2BHGA 3SHCH 1GI3A 3CS7A 4WMFA 1BMAA 3UOPA 2TBSA 2RA3A 4NA7A 2HVXA 4A5TS 1Y5UT 1GMCF 1LCYA 1K1OA 5GIBA 7GCHF 1EP6A 2A32A 4Y0ZE 3ELAH 3PTBA 3KN2A 1B0FA 2XBYA 2IPHA 1A5GH 3TGIE 2ZHFH 3EQ0H 1VCPA 5EPYA 2ZTZA 1EASA 3QTOH 4LXBH 6GCHF 1QBVH 2TGTA 1VITH 1XUHA 3OSYA 4H42U 7LPRA 2Y6TA 5FBEA 3OY5U 1H4WA 3SU2A 3LJOA 4YOJA 1A7SA 1OYTH 3E3TA 1FUJA 1C2IA 4CRCA 4Y10E 3ZVCA 3RXVA 1A0LA 1DSUA 4B71A 1MCVA 4NG9H 4KTUA 2ZGBH 3SQEE 3M3SA 2BD2A 2B8OH 4ISIH 2ZFFH 2C8WB 4K69A 4X0WU 1V2JT 5DP4A 3I29A 3SV7A 3V3MA 1SQOA 2VIOA 3SJKA 5HMAA 2YOLA 1G3EA 4GUXA 1YPJH 3TPIZ 1NRRH 2R9PA 2ZU3A 4M7GA 2PKSC 1HJAC 5EG4A 3M7TA 3GY3A 4ESTE 3WY8A 1CT2E 3AAVA 1TMUH 3LPRA 4WF8A 4UFFH 4MPWA 2BVXH 1FDPA 1AVWA 3LC3A 1CA0C 3SNAA 3PMHB 2I6QA 3M5NA 5JBAS 4FU9A 1F5RA 4AFZA 2OC8A 1NRPH 1J8AA 2ANWA 3GY8A 4FUDA 3SNDA 1ELGA 1SLVB 1JRSA 2OCVB 1ZMJA 1XM1A 1GJBB 2R0KA 4NFEA 4Q7ZA 2OD3B 5T6GA 4Y6DA 4AYYB 1F2SE 2Q1JA 2FOMB 1TA2A 2A31A 2XYAA 3PO1C 5GJ4B 3TNSA 1C1SA 3CENA 3ESTA 2TPIZ 2V0BA 5E8EH 4WMEA 3CP7A 4H6TA 2PW8H 1WOFA 2SGFE 1ZRKA 2A4GA 4LZ4B 1AUTC 1B0EA 1EZQA 4UONA 5DP3A 1ZTKA 4MPXA 1E38B 2UUKB 5LPRA 3LH1A 1Z71A 5AHGH 2VVUA 2PKSB 4RSPA 4E05H 2FWWA 3SI4H 4KTCA 3ATIA 1EOJA 1F92A 2G81E 1T32A 1OXGA 5LGOA 1SSXA 2G52A 3NZIA 1FZZA 3ZV9A 5F03A 1EUFA 2BX4A 1CA0B 2D2DA 1NO9H 5C1UA 3QTVH 1O2QA 3BTKE 1LPGB 2GV7A 1IQKA 4IC5A 4K1TA 3MO9A 5EQSA 1L1NA 1L4DA 1ZTJA 2ZTYA 1O2MA 1NY22 2P93A 4CR9A 5FPTA 4BAOB 4DIHH 2GD4B 3F9FA 5J4SA 2XBXA 1L1JA 4ABEA 2F9BH 3SV8A 2ZU2A 1XVOA 1NFXA 1GI4A 2FS9A 3MNCA 1BITA 4RKOB 5DP5A 2BLVA 2J38A 4UDWH 1O3CA 2A45B 1O3DA 3TNTA 2OUAA 2ZHDA 2O8WA 2STBE 2R2WU 2YNBA 3M35A 3URDA 3GCTF 2PKAB 3MFJA 3SQHE 3SZNA 1C1OA 1KTSB 4YO9A 2WPHS 2NU2E 3ODDA 1MMJN 1XXFA 1QCPA 5PTPA 4ABIA 1SVPA 3E0NB 1AI8H 1GMCG 2BOKA 3RXJA 1YCPH 4OS6A 1C5LH 3RXBA 2VJ1A 3RDZA 2PV9B 2OC7A 3P8FA 4DVAU 1GG6C 1AE8H 2W5EA 3D23A 2BY5X 1K1JA 3V12A 3BTME 2PGQB 1A1RA 6GCHG 1SL3A 1O5DH 2A7HA 1NFWA 3IWMA 4DURA 2GCHF 3A7VA 1TPAE 3RC5A 3RU4D 5I25A 5FPSA 3AVZA 1IQEA 4ZXXH 1KXDA 2UWLA 3BV9B 1VJ9U 3QZRA 3L6PA 1OPHB 4OS7A 1TONA 3EAJA 1OP2A 3P70B 1O3PB 3MH5A 2H9TH 4D8NA 2ZWLH 2BVSH 4GVUA 3TIUA 3ATMA 4WJG2 2O8UA 1GJ5H 1QBNA 2VWOA 1B5GH 1TB6H 1EX3A 2FX6A 2F9NA 2ANYA 4XFQA 1V2MT 2ZQ2A 1FPHH 1D3QB 1YLDA 6LPRA 1S0RA 3UWJH 5HXFA 3TH4H 2AGIX 4IMQA 4FUCA 3DFLA 4X2VA 4Z6AH 1GG6B 4H6SB 1QRZA 1NRNH 4X2YA 1VCWA 3RXSA 2VVCA 2OC1A 3LGIA 2G51A 1FJSA 4JZDH 3SOSA 1UTNA 2VINA 2FOBA 1QIXB 1Z1JA 2Y7XA 3KCGH 1TA6A 1P0SH 4B1TA 3VFEA 2WPMS 1T8MA 1JWTA 1RD3B 1O36A 1BRBE 4BAKB 2THFB 3KQBA 1T31A 3Q77A 3P95A 5AFYH 1NTPA 3HGNA 2GP9B 1UVPA 4NA9H 4U01A 4ZHMU 1AIXH 4AYVB 3UFAA 1NFYA 3A89A 1BBRE 1N6XA 1W2KH 2VIQA 2HPQH 4B2AA 4XE4A 1GBJA 1O2LA 3ZVBA 2QYIA 3QN7A 1UJ1A 5FX5A 4CH8B 2ZFSA 3URCA 1O5EH 3GDVA 1FY8E 2H1UA 2D26C 4Q7XA 1C2LA 1UTPA 3SJOA 2VGCC 6CHAC 5A0CA 1P05A 1EP5A 3LDXH 4IN1A 2ZI2H 2EI7A 2BDYA 3M37A 5FPYA 4DW2U 1O2WA 1H9IE 2F91A 3V0XA 1Z6JH 1JMOH 2DUCA 3FZZA 4TY7A 2PGBB 4AB9A 2G4UA 1Y8TA 1SGTA 3A86A 1WV7H 4CH2B 1XUJA 1O5GH 3D49H 4SGBE 1IHTH 4B2BA 4D76A 1LHFH 1ZOMA 1CBWC 5GPIB 1J17T 1GBLA 1MAYA 1Y3VA 1MTWA 1P11E 4FUEA 2J95A 1O2OA 2UUYA 5ESTE 4AFUA 1G30B 1TNIA 2RDLA 3AW1A 1IQIA 1GVZA 1Y5AT 3GDUA 5EXNA 3BEUA 4YM9A 1H9HE 2BD9A 3GCTG 3K9XB 1AUJA 2ZPSA 5F8ZA 4ABBA 2ALVA 4BAQB 1C2HA 2QXGA 2A7CA 2P3FH 5DP8A 9LPRA 3HKJB 2F9OA 3VB5A 1YBWA 2ZDLA 1C4U2 1EB2A 1Z8JB 2ZF0H 4BNRA 1O5CB 2FOCA 1PJPA 3U1IB 2VGCB 1KYNA 2Y81A 4Q80A 4WY3A 5A0AE 6CHAB