1O3GA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
molecule tags Hydrolase
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA02
2UWPA 1W3CA 4KP0A 2R0KA 3RXIA 1F0UA 1KXEA 4ASHA 1A2CH 2OTVA 1C1VH 3BV9B 1PJPA 5DPAA 3UNSA 1NRRH 3ZZBA 1GJ8B 3SUEA 3LGVA 3A8DA 1ELEE 5GCHG 2OBQA 2AIPA 2Q6GA 5A09A 2ZNKH 4FVBA 1TX7A 1S0QA 1GG6C 2FEQH 1H8IH 1QA0A 4Y76A 2C8XB 2VWMA 1OPHB 4X6MA 5SGAE 4YO9A 4NWKA 1P2MA 1W7GH 4MQAA 1HYLA 1GBEA 1LDTT 2W3IA 2ZFRH 3RM0H 4CR5A 4Q7ZA 3FAOA 3RC5A 1O3AA 4JZ1A 1P06A 1YKTA 2HOBA 2ZA5A 4K5ZA 2AERH 3T27A 1EZUC 2Z7FE 3SV6A 4D9RA 1SPJA 3UR9A 2PR3A 3T25A 6ESTA 2ZFPH 2HPPH 4A5TS 4X8SH 1BB0B 5C5OA 3UOUA 4D76A 2ZFQH 1YCPK 3RDZA 3KIDU 2P94A 1N8OB 4FU9A 1GI7B 3H5CB 1T4VH 1S85A 2HRVA 4JYUH 3RMMH 1FONA 2VVCA 1YBWA 4CBNA 2VB0A 3PMAB 3URCA 1DY8A 3NXPA 3HATH 1F5RA 1Z6EA 3NPSA 1C2EA 1SQAA 1HXEH 1SG8B 4ESTE 5C2ZA 3DUXH 2HPQH 1F7ZA 3F6UH 8LPRA 1WBGB 1KTTB 1AY6H 2PGBB 1GHAF 1FY1A 4ISNA 4VGCC 3M35A 4X8TH 2PSYA 1AE5A 2SGPE 4IC6A 1YPEH 1D3QB 1MKWH 1THRH 1XKBC 4IN2A 4WXVA 2Z9LA 1TA2A 1SQOA 1KYNA 4Q80A 1EJMA 1SLWB 3UTUH 1G36A 3JZ1B 3PV4A 1K1MA 1C5UA 2RA0A 1LHFH 2ZF0H 3TK9A 1BTHH 2Z3DA 3MO3A 2WPIS 1GCDA 2BMGB 2CMYA 2FIRH 3A7ZA 1FI8A 5DP7A 2A0QB 2BXUH 3SNBA 1T8MA 4U30A 1GL1A 3TH4H 1V2VT 3F9HA 3SV7A 1ID5H 3KQDA 3MYWA 2WUCA 2OC8A 1O3KA 2BD4A 1LKBA 1JRSA 1QL8A 1GVZA 1P3CA 4ABBA 1BRAA 3SU0A 1P2JA 4R8TB 1ARCA 2A7CA 3E6PH 5C5NA 1P05A 4TWYA 3STJA 1DDJA 3O8CA 1O30A 1MD7A 1ESBA 4BOHA 1JWTA 1L0ZA 3K6YA 3R0FA 1V2UT 2BD2A 1GDNA 1C4Y2 1J17T 1UTKA 3H7TA 1AKSB 3MFJA 6GCHF 3FANA 5LPEA 1CBWC 1NFWA 1V2LT 2AYWA 1TNKA 1S0RA 2VIVA 3RXAA 2B5TB 2BOHB 2FOBA 1ELVA 3PB1E 3VB5A 3I77A 4ZKRU 1KXAA 4DVAU 2ZI2H 2H5CA 1H1BA 2QCYA 1AB9B 1GI3A 2BY8X 1TE0A 3A88A 1HRTH 3U69H 3T26A 2Y82A 4ABHA 3M3TA 1EZQA 3SI3H 2FWWA 3LJOA 1CVWH 2PSXA 5I46H 1O2KA 1C5MD 2ALVA 1GWAA 2A4RA 2XC0A 2ZECA 3MU4A 3EYDA 1LVBA 1CSOE 3T5FH 1O3MA 1HAGE 1RIWB 1SGFA 3RXCA 4Q7YA 1QA7A 3SJIA 1W10U 2BY7X 1L1GA 1N1LA 1VITF 2OC7A 2VVUA 4UONA 5J4SA 4DW2U 3R3GB 3KL6A 1YC0A 4BTTB 4I8HA 1HPGA 4JMYA 2XBWA 3SOSA 1ZSJA 3MH5A 1RRKA 1MKXK 1GJ6A 1ELCA 1EJAA 1UTJA 2XCNA 3GDVA 2V3OH 3MU5A 1MAYA 1O3PB 1VCWA 5L2YH 4K8YA 1GBCA 2Z9IA 2V3HH 2PTNA 2R3YA 5A0AE 4OS4A 4ABIA 2AMQA 1H9IE 3LJJA 1FLEE 3QX5H 2R2WU 4X1NU 3RXOA 1NS3A 2V35A 5JDUB 1GHXH 4AFSA 2WPHS 1HDTH 1PPBH 3ZZ6A 2HNTE 2OLGA 1AUJA 1TBZH 1GI4A 1C2HA 2QF3A 1GHYH 4BXSA 5EOKA 1YGCH 1QBVH 1EZSC 2AFQB 6CHAB 1SBWA 1PQ7A 1AB9C 3PROA 3A86A 2ZDLA 1EZXC 4ABJA 3OX7U 1ANDA 1D6RA 1TNLA 3A84A 3L33A 1FY8E 4AZ2B 3O8RA 1P0SH 2IN2A 3M3SA 1WU1A 5DKMA 1KSNA 1TPOA 1G2LA 1QY6A 1IHTH 1HAZB 2BZAA 4TY6A 2GT8A 2OD3B 3QN7A 2QN5T 3A7WA 1QQUA 1T4UH 2GCTB 1UCYK 2A31A 1BMNH 3ZZ7A 1G3BA 2GMTB 2CXVA 3BF6H 1GVKB 1XXDA 3B9FH 4LXBH 3MH7A 2VU8E 1AHTH 3EGKH 1DWCH 2ZGBH 4K1SA 3IITA 2A4GA 3VB6A 3CS7A 3ATIA 1D3TB 3BTDE 4MLFB 1OWHA 4FU7A 3UNQA 1HUTH 1V2NT 1Z8IB 3QUMP 1HFDA 2VWLA 3MNXA 1UVUH 4KELA 3TJUA 4GVUA 1P04A 3V3MA 1VCPA 1O2LA 4MG3A 1WQVH 5J4QA 2A2QH 1IQMA 2TIOA 1K1LA 4LOYH 3KQEA 1HCGA 4AGKA 5CE1A 2YOLA 4FU8A 5TJXA 1TOMH 1Z8JB 4CBOA 1O3HA 1NFYA 2FESH 3TIUA 2GGVB 2D26C 3BSQA 1P12E 1GI5A 3MWIU 4ZHLU 3QDZB 2XC5A 1W12U 1TBQH 1T8NA 3A80A 1BRBE 4YOGA 1AZZA 3E8LA 1K1JA 3SNDA 3GCTF 1FAXA 1O2OA 1O0DH 4INLA 8GCHG 1NU9A 4OS7A 1GBFA 1QQ4A 2ULLA 1QL9A 3GCHC 4ISIH 4ZKOU 1HLTH 1LHCH 2O8MA 2CJIA 2ZU5A 1X7AC 1DE7H 4TPYA 1QBOA 2BQ7B 1DY9A 3C1KA 1SOTA 1MKXH 2YNBA 1P02A 3PM3A 2D1JA 1ZMLA 5A0BA 9ESTA 2FOFA 1HBTH 1GMCG 5EW2H 4YOJA 1C1RA 2EEKA 1F2SE 2ZDMA 3V0XA 2XYAA 4CH8B 2JH0D 2QA9E 3SV9A 1DX5M 1O2GH 1P8VC 1C9PA 1BTUA 1RS0A 3MOCA 1ZJDA 2BVXH 2FYRA 2M5TA 3A83A 3A87A 1W8BH 3TITA 1YLDA 3PLPA 2BDAA 4YTAA 4ISOA 2BDCA 2P93A 3SO3A 3SNAA 3SNCA 1A0JA 2H5DA 4KTCA 1HXFH 1ZGVA 2Q1JA 1MZAA 2OC0A 2XC4A 2J2UA 1SGTA 2RCEA 1A3BH 1DFPA 2ZFFH 4CRFA 1SGYE 1QRZA 3RXSA 2SGFE 5FAHA 1EP6A 1E38B 1Z8GA 1EJNA 2A5AA 3U9AH 1SC8U 2ANMH 4NZLA 4CRCA 3P92A 3Q76A 1OP0A 1MCVA 1NRQH 4NGAH 1P9SA 1Y5UT 1OWDA 4RN6A 1LCYA 5FBEA 3AAVA 1W11U 4OS1A 1O5EH 3SGBE 1NRSH 3ODFA 1C5NH 1HJ9A 2IJOB 4HFPB 2PFEA 4NA9H 5GPIB 1C4V2 4M7GA 5LH8A 1MU8B 2O8WA 2GP9B 2VGCC 4JYTA 2BY6X 1PQ5A 1XX9A 5T6FA 1TWXB 1QB1A 4THNH 5DJ7A 4JZIA 1TQ7B 2BVSH 1HAYB 2KAIA 5F6MA 1QCPA 2Q6DA 1EAUA 1EB1H 4UD9H 1S6FA 3MH6A 1UCYH 1HAHH 4KTUA 1O2UA 1SFIA 4BAKB 3RXFA 1ZYOA 1A3EH 1C2IA 3PMBB 4A1VA 1N6XA 2G8TA 4D7FA 3SW2B 4AYVB 5EQQA 2ZPRA 4CRBA 4JK5A 1O2YA 1FV9A 3KF2A 2ZGHA 1GL0E 1O2TA 4B76A 4O3UA 1B0FA 1GBAA 1VGCB 4CHAB 1HNEE 4SGBE 1JOUB 1HAXB 1H9HE 1MKWK 1Y5AT 1AVGH 1AQ7A 6LPRA 4ABDA 7GCHG 2R2MB 3A81A 2XTTB 3W95A 1DOJA 2ZFSA 4X1PU 3BG4B 4NSVA 4Y6DA 2ZIQH 1O5DH 3TGJE 1O31A 2Z3EA 3OY5U 1ZTJA 2F9PA 2OQ5A 1K2I1 4DT7B 5L6NH 1FZZA 4WF8A 1Z71A 1GHBF 7ESTE 3MI4A 4IBLH 1UVSH 4MTBA 4BTUB 3K6ZA 2FODA 2BDHA 1O3IA 2ZHDA 3VGCB 2A5KA 4MPWA 1Y59T 1JXPA 2UUKB 1AE8H 3MNSA 2GCHG 4U2WA 3UFAA 4WWYA 2THFB 1CHGA 2XWBI 4AFQA 3MO9A 1CGHA 3QGJA 4LK4A 4CRGA 1HAOH 3RXKA 3ZVCA 1GJAB 3SUGA 1Y3VA 3MU1A 3OTJE 2P3UB 1LVMA 4HGCA 4JZDH 2AGEX 2H6MA 4JYVH 3EDXB 4AYYB 4MPXA 1C1QA 3MO6A 3GY8A 1P01A 5HGGA 3ZYEA 2PGQB 1GJ7B 3OY6U 1BTYA 1SGDE 3KGPA 4INKA 2ZQ1A 1DWBH 1XUKA 2G4UA 2FOEA 1XUHA 1LKAA 2RDLA 5DP8A 5JB9S 1BT7A 3SU3A 3GY7A 1V3XA 2QXIA 2ZPQA 2JETC 2F83A 4AFUA 5CMXH 2GZ9A 4XBDA 1K28D 2FOAA 1K9OE 3VB3A 1S6HA 4UFDH 1ELFA 4K2YA 2FX4A 3SQEE 5ESTE 5HM2A 5JBBS 1C1MA 1O36A 1GCTB 1L1JA 3RXDA 3QO6A 2FOCA 3F1SB 2VWNA 2A5IA 3OYPA 4I8LA 5GIBA 1FMGA 1HAIH 1EPTB 1KLIH 3E90B 1DT2A 3S9BA 1IHSH 4NG9H 2ZU2A 4Y8XA 1YF4A 1ZRKA 1HJAB 2XBVA 1SOZA 1NU7B 1W13U 1G37A 1S83A 1HV7A 4A7IB 3MU0A 1WYKA 1EP5A 2Z3CA 2ZCKP 1FPHH 1XUGA 2GV6A 3TVJB 2AMPA 2NU0E 3ZVEA 1GMDG 1UTLM 4DG4A 1ZSKA 3Q3XA 4OGYA 1EXFA 1QJ6B 2G81E 1FXYA 4NIYA 3AW0A 3T62A 4X1SU 2WV5A 1C5TA 4H6SB 1WUNH 1Y5BT 3DA9B 3L6PA 1N8OC 2QY0B 5EXLA 1T8LA 1FUJA 4BAMB 4BAOB 1MCTA 1L1NA 4AG2A 3U1IB 3K9XB 3ESTA 2QV1A 3M7TA 2GZ7A 3CENA 2J95A 3ZVGA 1E37B 3KQCA 1AGJA 4KKDA 1RIWC 1UTOA 1NPMA 1CGJE 5EU8A 3V13A 4GSOA 2ZHQH 4YOIA 1ZTKA 3HPTB 1CA0C 4IC5A 1OP8A 4H4FA 2EA3A 1HGTH 1ORFA 3RXMA 1CT2E 1TONA 3Q77A 4Y79A 1T31A 2EI7A 4O9VA 1HB0B 4X8VH 2J94A 2BY5X 3QZQA 4FUIA 2C4FH 4KTSA 1FIWA 3BTGE 2BVRH 2J92A 1T8OA 2A7HA 3BG4C 1D3PB 3A85A 4NA8A 3MNBA 2PKSC 1PFXC 1OKXA 1AUTC 2Y5GA 5FX6A 4AORA 5DG6A 4YESB 1RTKA 1BUIA 2BOKA 2PKSB 2W5EA 3T29A 1C5RA 1QRWA 5K7RA 4YLUA 1RFNA 1V2JT 3PMHB 2FS9A 2P8OC 3T2NA 1TX6A 3N7OA 3A8CA 1ZR0A 3RXEA 1GI8B 4NFEA 5LPRA 2LNCA 2RA3A 3IWMA 2P3FH 1MUEB 2CGAA 3HKJB 1F92A 1PPEE 4ZKNU 3SGAE 1O37A 2BD8A 3EA7A 5JBCS 5AFYH 3RC4A 2FDAA 3RMOH 3FP7E 1YCPH 1OS8A 1BJVA 5K0HA 2HNTF 4FUJA 1CE5A 1GCTC 3ZZAA 2BDIA 1HAVB 4YZUA 2TRMA 1CT4E 2AMDA 5EXNA 3NK8A 4PROA 5DP9A 1PPCE 1H9LB 1MTNC 5F8TA 1SGEE 2NU3E 1B0EA 1GBBA 1KLTA 1KLJH 1YCPM 1GDQA 1DSTA 1JBUH 7LPRA 1JMOH 1AIXH 3HK3B 5DP5A 5C1XA 2Y81A 3UWJH 1YYY1 3KCGH 5TCCA 4LZ1H 3ZYDA 1N6YA 3STIA 1O3OA 3NUMA 1SI5H 2VNTA 3VB4A 4AOQA 1MTVA 2JH6D 1FQ3A 1Z6JH 3GCNA 1ZRBA 2O9QA 3ZVFA 5AHGH 1SGQE 2ZWLH 3GCOA 3H7OA 4FUCA 1QIXB 4XOJA 3DT0H 1L4DA 1DS2E 1GBMA 1G32B 1O2RA 1EPTC 2H9EH 4MVNA 3ATWA 3UY9A 1TRNA 3TH3H 1D3DB 1QURH 4R0IA 1FY3A 2P8OB 4NCYA 5FPTA 4DIHH 1EKBB 4O97A 4AN7A 1TPAE 1GJ9B 1ZOMA 4RKOB 1CBWB 1KY9A 1ETRH 1K1IA 3ZVBA 1QBNA 4NSYA 4Y0ZE 7GCHF 1UCYE 2ZDVH 3PWCA 1G3CA 2WYJA 3SN8A 1GBKA 4I33A 1KXFA 1EAWA 2JKHA 3M5OA 2VINA 5DK1A 1S82A 3A7YA 4Q2KA 4Y8ZA 1O38A 2GT7A 3K65B 4JZEH 3EA8A 1OYQA 3QZRA 1KIGH 1VGCC 3A89A 1DITH 3ATMA 1H8DH 2F9VA 1WAYB 1MTNB 2F9OA 4WJG2 1UHBB 4LZ4B 2TGDA 5JPMH 1UTMA 5FCKA 3O8BA 3PO1C 1A46H 1LHDH 3SORA 2FTLE 2CV3A 1Z8RA 3TPIZ 1FY4A 2W3KA 4NIWA 3VXFH 2ANWA 3SU4A 3ZZ4A 2FLBH 5GCHF 5ABWA 1NROH 1WTHD 2Z9KA 4DGJA 2RG3A 1MQ6A 1SFQB 1EQ9A 3SNEA 3WY8A 2EI6A 3D65E 2Z9JA 3ITIA 1AWHB 5DP3A 1SGNE 3GCHB 1AO5A 1OWIA 2WINI 3P70B 3QGNB 5ESBA 2BD5A 5GDSH 1LPKB 3SJOA 4ABEA 1LVYA 2C90B 3LT3A 3ZVDA 4Q7XA 1TIOA 3BEUA 1K21H 4HI3A 4ZHAA 3RXBA 2GCTC 4MDSA 4TWWA 1GPZA 1ETTH 2ALPA 4K69A 3RXUA 2VJ1A 2XNIA 2OBOA 1C5SA 1GBTA 1P09A 2FXRA 2DUCA 2FOMB 2PTCE 2B0FA 2ANYA 4DCDA 5A2MH 1DPOA 4OS2A 1O3BA 2FX6A 2PWXA 2Y80A 1BTZA 1HAVA 2ZPSA 1SGIB 2TGAA 1SB1H 2FS8A 4ZH8A 1NT1A 3GDUA 2B8OH 3VXEH 2J34A 2ZTYA 1V2RT 3TJNA 3VPKA 1RTFB 2ESTE 1C2JA 3SI4H 2A7JA 1FN6A 4RKJB 1XXFA 3B8JA 2G5VA 2OUAA 1TMTH 4ISHH 2W26A 1P2IA 1IQEA 5AF9H 2TBSA 1O3NA 1O5BB 1KDQB 3EQ0H 1QJ1B 3UPEA 4U32A 3GY6A 2AS9A 2OC1A 2OINA 5IDKA 3TK5A 4INHA 3RU4E 2SGAA 3LPRA 3P6ZB 1NM6A 3BTME 3PMJA 1WV7H 3LGYA 5DO4H 3RM2H 4AB9A 1SLUB 3F9EA 1TGBA 4Y8YA 1FN8A 1OYTH 1AVXA 2W7SA 3M5NA 1BMAA 4B75A 4BNRA 1YPKH 3E3TA 1ANEA 1YM0A 3K2UA 4DURA 1UMAH 1DANH 2A4QA 4U01A 3LC3A 2AGIX 4ZUHA 1UK4A 1A1RA 1BJUA 1EOJA 1VITH 1ZJKA 8KME2 3MNCA 1ELBA 3VEQB 3P95A 1LQDB 2XWAA 1DLEA 1CHOG 5E0JA 4E05H 1YPMH 4JCNA 2J4IA 2ZGXH 3GCTG 1SL3A 3TNTA 1AWFH 1GJ5H 5DGJA 1A5IA 1IQGA 4WMDA 4ZROA 1NTPA 2VWOA 1TMUH 2B9LA 1GBLA 3KN2A 1JIMA 5E8EH 4NA7A 1O35A 4AGJA 4DJZB 6GCHG 1BQYA 3BTWE 1CA0B 2H9HA 1FY5A 5HXFA 3CS0A 1C5XB 1E35B 2VIPA 1P2QA 3A8BA 2ZDKA 3BIUH 2A4OA 2K1QA 2O8LA 2VH0A 1BMMH 1XMNB 5EGMA 3E1XB 4TPIZ 2BHGA 2ODQA 3PLKA 1TNJA 4GAWA 4YT7H 1TQ0B 3Q3YA 3TLOA 2ZU1A 1H4WA 2KAIB 4D8NA 5E2PA 1W0ZU 5T6DA 3RXVA 1NY22 1PQAA 3QTOH 1F0RA 2WUBA 4NZQA 1P57B 4I32A 2GD4B 3M7QA 4GHTA 1PPHE 3P8NA 3Q3KA 4IS5A 4Y71A 3TNSA 1C2DA 2UUYA 5T6GA 2G4TA 2CF9H 2FOGA 4UEHH 3M36A 1WSSH 1ESAA 2ZP0H 5A0CA 2LPRA 4HZHA 1ABIH 1GJDB 3L3TA 1BBRK 2BDGA 1HJAC 3EE0B 4ZHMU 3URDA 1NFXA 1S5SA 3BTEE 3OSYA 5JBTA 1BA8B 2BZ6H 1SVPA 3HK6B 1O2QA 1F5KU 4X6PA 4XBBA 4FUHA 1V2OT 4GUXA 2CN0H 3P8OA 2BM2A 4I31A 1THPB 4B1TA 1GHAG 4AB8A 4CH2B 1SHHB 5BRRE 4X1QU 1E36B 1V2ST 1MBMA 1OOKB 2VIDA 1O5AB 1LVOA 3RXJA 1V6DA 1LTOA 7KMEH 4YLQH 1GI1A 1CO7E 4XFQA 4ZKSU 2G51A 1Y8TA 1KTSB 1O2WA 1FPCH 2VVVA 1P2OA 1O5FH 4X8UH 2FYQA 1CQQA 4B73A 2YNAA 2GKVE 1IOEA 1ETSH 2ZEBA 1BRUP 2BTCE 3E91A 2ZGJA 2PV9B 5IYTA 1ZLRA 4B71A 1ZZZA 2XRCA 1O2MA 3PWBA 1AN1E 1ESTA 5FBIA 1AFQB 1NFUA 4FXGH 2ODPA 3GYLB 2ZHWH 1BTXA 1VITG 3I78A 3UNRA 1AU8A 4GPGA 1G3EA 5PTPA 1C2FA 2STAE 2UWOA 3BEFB 5TCAA 3GY4A 1GHVH 5A8XA 1J15A 2ILNA 1LHEH 1DWEH 2ZHEH 1C1OA 3AVZA 3UREA 5G4BA 4A1XA 3UQVA 3BIVH 2A45B 5C20A 3TK6A 1ZPZA 2FTMA 1PPGE 1XUFA 1VZQH 4X1RU 1TGSZ 4UDWH 3ATKA 1LQEA 2PW8H 1TABE 1YLCA 1EOLA 2O8TA 3HGPA 1A0LA 1ZPCA 3ELAH 1T7CA 1TGCA 2C93B 2HGTH 2JH5D 4K60A 1BTPA 1C1NA 1RD3B 3RXHA 1SGPE 1E0FD 3GICB 1WOFA 2AH4X 5I25A 1GGDB 3TGIE 1Z1IA 1O39A 2NU1E 1O2XA 1LMWB 1IQJA 4TYDA 3SJ9A 4ABFA 1TRYA 4WY3A 1A4WH 4UFFH 4BANB 4WXIA 1Z7KA 2F9NA 1GBIA 1AKSA 4FUDA 2AEIH 2QF0A 3RU4D 2GV7A 5FXLA 1TALA 4CR9A 1ABJH 1OX1A 1LPGB 5DP4A 5HMAA 1QL7A 3M37A 2OP9A 1AVWA 1Z1JA 2ZDAH 3MH4A 5ETXA 4X2WA 1T32A 1DICA 3SJKA 1QB9A 1FIZA 3D62A 4Z0KA 1LPZB 4MPUA 1BHXF 1F5LA 2Z94A 1XVMA 1G3DA 1YPLH 2G52A 2H1UA 5BPEA 3P8FA 1C2KA 1YPGH 2IPHA 2H2ZA 2C8YB 2DE9A 4IW4E 4MNYA 3OU0A 1EATA 1DXWA 1G30B 2GMTC 1P11E 3LIWA 3M7UA 4B2BA 5E2OA 4WH8A 2ZO3H 1GJ4H 5HM9A 1BTWA 1C1PA 2Y7ZA 3U8TH 1IQIA 1C1TA 1TBRH 3TJOA 3LGUA 4IN1A 1ELTA 3BEIB 1OSSA 6CHAC 1C1UH 4B2CA 5C1UA 1MTWA 3QLPH 1PYTC 4NIXA 1B5GH 4SGAE 3M3VA 1C2LA 1MAXA 4CRDA 2FMJA 2VIWA 1O2SA 1GI6A 3A8AA 3HGNA 3ZZ9A 2PKAB 4K8BA 1C5YB 4E7NA 1EUFA 1S81A 2FLRH 3ATLA 3RMLH 2Z9GA 1TA6A 1P2KA 1CGIE 1OWJA 2NWNA 2O8UA 4X6NA 3DFJA 4XDEA 3FP8E 3EA9A 4I8GA 3NWUA 2SGEE 2ANKH 3PTNA 3LU9B 2BD3A 3V7TA 2V6NA 3C27B 1UJ1A 2G00A 2XW9A 2XCFA 2TGTA 1ARBA 2Y7XA 1AD8H 2FPZA 2VGCB 2BLQA 2SGQE 5E0GA 4MNWA 3A82A 3FFGA 3LGWA 2P16A 1O2ZA 3I29A 1V2QT 2VH6A 3M5MA 1ANCA 4CREA 3FZDA 5LPFA 1INCA 1WCZA 1PQ8A 1OXGA 2TGPZ 4Y11E 3LC5A 3IG6B 3RP2A 1HIAB 2QC2A 2V0BA 4D9QA 3GYMA 5EXMA 3GY2A 2A2XH 1THSH 1F0TA 3GDSA 1L4ZA 1C1WH 1IQLA 1GI9B 2ODYB 3S7HB 1ANBA 3RC6A 4BAQB 1RGQA 1Y3WA 3D23A 1PYTD 3GOVB 2VIQA 2ZDNA 1EAXA 1C5ZB 5T3HA 3SU6A 1TX8A 3LONA 4UFGH 3UUZA 1IQFA 3ZZCA 1P9UA 5JYIA 3A7TA 2TPIZ 1ZHPA 1A0HB 3E16B 3BTQE 1KXBA 2P3TB 1GJBB 3SJ8A 1UHBA 5F8ZA 2G55A 1O2PA 4NFFA 3SHCH 2ZFTA 2FI4E 1KDQA 3NKKA 4NWLA 2B7DH 2ZU3A 1TNHA 3DFLA 1O5CB 1UVOA 3RLYH 1O2IA 3RXQA 4IMZA 1TLDA 1MQ5A 1G9IE 2R0LA 2ZCLP 3AASA 3QK1A 1CA8B 3W94A 5GWZA 1NC6A 1SLXB 3U1JB 2GCHF 1FDPA 5JB8S 3DD2H 1VJAU 1OP2A 4WH6A 1TNGA 1GMHF 3AAUA 3RLWH 3SUDA 2GDEH 1L2EA 1BBRH 1NO9H 2BX3A 3GY3A 1UK2A 4GCHG 3NZIA 1DVAH 1O33A 3E0PB 3TU7H 2BYAX 2J9NA 3M5LA 5EODA 3RMNH 2BD9A 1ZMJA 3ZZDA 2FZZA 1C5LH 2BQ6B 1Y3XA 4BXWA 1JRTA 3VGCC 1C9TA 4JK6A 5CHAB 4Y0YE 1O32A 3B23B 4FUFA 3MTYA 2A32A 1J8AA 2CHAB 1CHOF 2ZTZA 3P8GA 1O2VA 4AX9H 1O2NA 2SNVA 2H9TH 4DIIH 1C5QA 1MD8A 1A61H 3RXLA 3GY5A 1YPHC 2HALA 4A1TA 4CHAC 1SMFE 1NZQH 1K1NA 2F3CE 1O5GH 2PLXA 1G2MA 2R9PA 3BN9A 1SGRE 1BITA 2C8WB 1C2GA 4YT6H 4DOQA 3LKWA 1EPTA 3PO1B 1J16A 5EQRA 2Y6TA 1ELDE 1W7XH 4XSKU 8ESTE 1XVOA 1D6WA 3AW1A 5AFZH 1EB2A 2AIQA 1EAIA 1O3CA 1ZMNA 2FOHA 4H6TA 2G5NA 4QT8C 3ZVAA 4YM9A 1FNIA 1P10A 3MU8A 2SGDE 1VJ9U 2GZ8A 3UR6A 1ELGA 1UTNA 1XUJA 2ZKSA 4D7GA 4B74A 2XBXA 4J2YB 1QR3E 2PUXB 1IQKA 1Q2WA 1GHBG 2OCVB 1V2MT 4JZFH 1MMJN 1FJSA 1Q31A 4Y7AA 2PKAA 5E0HA 3UQOA 1QB6A 4ABGA 4X6OA 1ZSLA 1TOCB 3FVFB 3PLBA 2ZG0H 3MMGA 4ZMAH 1CT0E 4X0WU 4K3JA 5GJ4B 4J1YA 1PPFE 3BTHE 4ABAA 3PYHA 1WQSA 2GVFA 3RXTA 2WYGA 2WPLS 4X2VA 1GDUA 1UTQA 1ZTLA 1ZPBA 1QFKH 2F9UA 3LGTA 4UFEH 2SNWA 2BD7A 4OGXA 4FUEA 1GBJA 1UVTH 3SU2A 4O3TA 5C3NA 1OWKA 3T28A 2JETB 3PTBA 4E7RG 3D49H 1PPZA 1SLVB 4O03A 3TGKE 2UWLA 5DP6A 5EG4A 1AI8H 5C1YA 3NCLA 2J38A 1D9IA 2DE8A 2WPMS 2ZU4A 4A92A 4FUBA 1GMDF 1KXCA 1D4PB 2UUFB 1C5VA 3SHAH 1EX3A 1DM4B 2HNTC 4ISLA 1M9UA 5H4IB 3UOPA 3ZZ8A 1YP9A 4MNXA 5AVDA 1ACBE 1GMHG 2BX4A 3VFEA 4A6LA 4GLYA 2C3SA 2BB4A 1A5HA 2W7UA 3S0NA 1DUAA 3TJVA 1V2TT 1XM1A 1C4U2 3SV8A 2BY9X 3FZZA 4AFZA 5C67A 2QXJA 1WTGH 1Y3UA 3UWIA 5JBAS 2UUJB 1DSUA 2F9BH 3F68H 3RUOA 1NRPH 1J14A 5FCRA 2IOTA 2GTBA 4K1TA 1C1SA 1GG6B 3KHVA 1MH0A 3S69A 2PUQH 3SUFA 3CP7A 2QGRA 3ZZ3A 4AG1A 1YPJH 4Y10E 3M61U 3BTFE 5EPNA 1EASA 2XXLA 1TAWA 4K1EA 3RXPA 1BBRE 3SU1A 1O3EA 3SZNA 1J9CH 1O2HA 3SU5A 1GJCB 1B7XB 5LGOA 2ZQ2A 1TGTA 1C2MA 2WPKS 4BTIB 1W0YH 1P3EA 1UO6A 4I8JA 1VR1H 3E0NB 2C8ZB 4B2AA 1GMCF 4WVPE 3KQBA 3ZV9A 2ZZUH 1TFXA 1BIOA 5EQSA 1QRXA 5B6OA 4FUGA 3EAJA 1O3DA 3RXGA 4OS5A 1GBDA 1IQHA 3QTVH 2EC9H 2FM2A 1TB6H 4IGDA 3HKIB 3F9FA 3UIRA 2I6SA 3A7VA 1MBQA 1DLKB 1BHXB 3SGQE 2VIOA 3G01A 3LOXA 1XKAC 2BQWB 4H42U 1GHWH 5A8ZA 4ZXXH 2BDYA 1C5PA 1ELAA 1LHGH 2GX4A 1UVPA 1RXPA 2I6QA 3F9GA 5L30H 2Q6FA 2WPJS 1K22H 1GVLA 2QAAA 1K1PA 1MTUA 2CHAC 1O2JA 1O3LA 4X2XA 1TRMA 3RU4T 3BTTE 8GCHF 3A7XA 1VCQA 1ZHRA 1C5WB 1IQNA 4XE4A 5F03A 3GISB 3QWCH 3Q00A 2AGGX 2F91A 2WV4A 2BLWA 4HTCH 1BOQA 5L2ZH 1A7SA 2BXTH 2P59A 1BZXE 4GHQA 1BRCE 4RSPA 4I7YH 1TNIA 2Y5HA 3RXRA 1GHZA 1BDAA 4X2YA 3P17H 3SV2H 1FAKH 9LPRA 4WMFA 4UE7H 1QJ7B 2NU4E 1ZHMA 5EPYA 5A8YA 4VGCB 4I8KA 1W2KH 2GDDA 1W14U 5F8XA 3VB7A 3O8DA 1QGFA 3V12A 1JIRA 4DY7B 3U8OH 1V2WT 1MU6B 4ZAEA 1IAUA 1QNJA 1U6QA 1O3JA 1O3FA 3ENSB 1TMBH 3FP6E 1UTPA 4IMQA 4KGAA 2ZGCA 1P2NA 1QTFA 2HWLB 2D8WA 1LO6A 1SSXA 4F49A 1YPHE 3LH3A 4Y7BA 3KEEA 3U8RH 1P03A 1TYNA 2ZC9H 2R3UA 1AFEH 2NU2E 1GI0A 1MZDA 2CF8H 3LDXH 4WMEA 1HIAA 5EW1H 4ZXYH 4TY7A 1GGDC 1O34A 1SR5C 2PHBA 1MTSA 1BMLA 5HYOA 5FHTA 2QXHA 2FI5E 3KNXA 1SHYA 3S9AA 1DXPA 1GI2A 2BLOA 2HVXA 1AMHA 3DHKH 2ASUB 2SFAA 4XBCA 3BTKE 2FI3E 1ZGIA 2A1DB 2ZCHP 3SBKA 1XUIA 1HAPH 4Z6AH 2XBYA 4F4OC 3U98H 4OS6A 1TGNA 4BAHB 1A5GH 1KXDA 2EI8A 1V2KT 1UK3A 1AFQC 2ZTXA 3SQHE 2QIQA 3ZV8A 1S84A 5CHAC 1TPPA 5FPYA 2HLCA 2FO9A 1K1OA 1NRNH 2Z6BD 4NIVA 3TH2H 1HJ8A 1SQTA 3LH1A 5FX5A 1NESE 5FPSA 2OQUA 4MNVA 1DWDH 3LGIA 1RTLA 1CU1A 1SGCA 1V2PT 4E06H 3S9CA 4CRAA 1OWEA 4GCHF 1DUEA 2ZHFH 1AZ8A 2BLVA 1RJXB 2P95A 3MHWU 4FVDA 4MPVA 2QYIA 3JZ2B 3ODDA 2BDBA 2Y5FA 1C5OH 3S7KB 2FP7B 1BCUH 1E34B 1Q3XA 1O3GA 1GBHA 2D2DA 1NN6A 1TPSA 3ZZ5A 1F0SA 1SGFG 1Y3YA 2STBE 1QHRB 2OXSA 2QXGA 5GXPA 3BG8A
chains in the Genus database with same CATH superfamily
2UWPA 1W3CA 4RT1A 3CNRA 4KP0A 2R0KA 3RXIA 1F0UA 1KXEA 3U28C 4ASHA 1A2CH 2W6JD 2EY4C 1C1VH 2OTVA 1PJPA 3BV9B 3FOAA 5DPAA 3UNSA 1NRRH 3ZZBA 1GJ8B 3SUEA 3LGVA 3A8DA 1ELEE 5GCHG 2OBQA 2AIPA 2Q6GA 5T1VA 5A09A 2ZNKH 4FVBA 1TX7A 1S0QA 1GG6C 2FEQH 1H8IH 1QA0A 4Y76A 2C8XB 2VWMA 1OPHB 4X6MA 5SGAE 4YO9A 4NWKA 5FL7D 1P2MA 1W7GH 4MQAA 1HYLA 1GBEA 1LDTT 2W3IA 2ZFRH 3RM0H 4CR5A 4Q7ZA 3WWFA 3FAOA 3RC5A 1O3AA 4JZ1A 1P06A 1YKTA 2HOBA 2ZA5A 4K5ZA 2AERH 3T27A 4TT3D 1EZUC 2Z7FE 3SV6A 4D9RA 3W1EA 1SPJA 3UR9A 2PR3A 3T25A 6ESTA 2ZFPH 2HPPH 4A5TS 4X8SH 1BB0B 5C5OA 3UOUA 4D76A 2ZFQH 1YCPK 3RDZA 3KIDU 5EJLA 2P94A 1N8OB 4FU9A 1GI7B 3H5CB 1T4VH 1S85A 2HRVA 4JYUH 3RMMH 1FONA 2VVCA 1YBWA 4CBNA 2VB0A 3PMAB 3URCA 1DY8A 3NXPA 4FETA 3HATH 1F5RA 1Z6EA 3NPSA 1C2EA 1SQAA 1HXEH 1SG8B 4ESTE 5C2ZA 3DUXH 2HPQH 1F7ZA 3F6UH 1OHHD 8LPRA 1WBGB 1KTTB 1AY6H 2PGBB 1GHAF 1FY1A 4ISNA 4VGCC 3M35A 4X8TH 2PSYA 1AE5A 2SGPE 4IC6A 1YPEH 1D3QB 3NRLA 2EQNA 1MKWH 1THRH 1XKBC 4IN2A 4WXVA 2Z9LA 1TA2A 1SQOA 1KYNA 4Q80A 1EJMA 1SLWB 3UTUH 1G36A 3JZ1B 3PV4A 1K1MA 1C5UA 2RA0A 1LHFH 2ZF0H 3TK9A 1BTHH 2Z3DA 3MO3A 2WPIS 1GCDA 2BMGB 2CMYA 2FIRH 3A7ZA 1FI8A 5DP7A 2A0QB 2BXUH 3SNBA 1T8MA 4U30A 1GL1A 3TH4H 1V2VT 3F9HA 3SV7A 1ID5H 3KQDA 3MYWA 2WUCA 2OC8A 1O3KA 2BD4A 5C0UA 1LKBA 1JRSA 1QL8A 1GVZA 1P3CA 4TSFD 4ABBA 1BRAA 2AHME 3SU0A 1P2JA 4R8TB 1ARCA 2A7CA 3E6PH 5C5NA 2WPDD 1P05A 4TWYA 3STJA 1DDJA 3O8CA 1O30A 1MD7A 1ESBA 4BOHA 1JWTA 1L0ZA 3K6YA 3R0FA 1V2UT 3PRBA 2BD2A 1GDNA 1C4Y2 1J17T 1UTKA 3H7TA 1AKSB 3MFJA 6GCHF 3FANA 5LPEA 1CBWC 1NFWA 1V2LT 2AYWA 1TNKA 1S0RA 2VIVA 3RXAA 2B5TB 2BOHB 2FOBA 1ELVA 3PB1E 3VB5A 3I77A 1YY3A 4XD7D 4ZKRU 1KXAA 4DVAU 2K0QA 2ZI2H 2H5CA 1H1BA 2QCYA 1AB9B 1GI3A 2BY8X 1TE0A 3A88A 1HRTH 3U69H 3T26A 2Y82A 4ABHA 3M3TA 1EZQA 3SI3H 3PRDA 2FWWA 3LJOA 1CVWH 2PSXA 5I46H 1O2KA 1C5MD 2ALVA 1GWAA 2A4RA 2XC0A 2ZECA 5HIYA 3MU4A 3EYDA 1LVBA 1CSOE 3T5FH 1O3MA 1HAGE 1RIWB 1SGFA 3RXCA 4Q7YA 1QA7A 3SJIA 1W10U 2BY7X 1L1GA 1N1LA 1VITF 2OC7A 2VVUA 4UONA 5J4SA 4DW2U 3R3GB 3KL6A 1YC0A 4BTTB 4I8HA 2OK5A 1HPGA 1UW7A 4JMYA 2XBWA 3SOSA 1ZSJA 3MH5A 1RRKA 1MKXK 1GJ6A 1ELCA 1EJAA 1UTJA 2XCNA 3GDVA 2V3OH 3MU5A 1MAYA 1O3PB 1VCWA 5L2YH 4K8YA 1GBCA 2Z9IA 2V3HH 2R3YA 2PTNA 5A0AE 4OS4A 4ABIA 2AMQA 1H9IE 3LJJA 1FLEE 3QX5H 2R2WU 4X1NU 3RXOA 3KYFA 1NS3A 2V35A 5JDUB 1GHXH 4AFSA 2WPHS 3OEHD 3FO8D 3UB0A 1HDTH 1PPBH 3ZZ6A 2HNTE 2OLGA 1AUJA 1TBZH 1GI4A 1C2HA 2KCYA 2QF3A 1GHYH 4BXSA 5EOKA 1YGCH 1QBVH 1EZSC 2AFQB 6CHAB 1SBWA 1PQ7A 1AB9C 3PROA 3A86A 2ZDLA 1EZXC 4ABJA 3OX7U 1ANDA 1D6RA 1QZ8A 1TNLA 3A84A 1FY8E 3L33A 4AZ2B 5DSFA 1P0SH 2IN2A 3M3SA 3O8RA 1WU1A 5DKMA 1KSNA 1TPOA 1G2LA 1QY6A 1IHTH 1HAZB 5C17A 2BZAA 4TY6A 2GT8A 2OD3B 3QN7A 2QN5T 3A7WA 1QQUA 1T4UH 2GCTB 1UCYK 2A31A 1BMNH 3ZZ7A 1G3BA 2GMTB 2CXVA 3BF6H 1GVKB 1XXDA 3B9FH 4LXBH 3MH7A 2YMSC 2VU8E 1AHTH 3EGKH 1DWCH 2ZGBH 4K1SA 3IITA 2A4GA 3VB6A 3CS7A 3ATIA 1D3TB 3BTDE 4MLFB 1OWHA 4FU7A 3UNQA 1HUTH 1V2NT 1Z8IB 3QUMP 1HFDA 2VWLA 3MNXA 1UVUH 4KELA 3TJUA 4GVUA 1P04A 3V3MA 1VCPA 1O2LA 4MG3A 1WQVH 5J4QA 2A2QH 1IQMA 2TIOA 1K1LA 4LOYH 3KQEA 1HCGA 4AGKA 5CE1A 2YOLA 4FU8A 5TJXA 1TOMH 1Z8JB 4CBOA 1O3HA 1NFYA 2FESH 3TIUA 2GGVB 2D26C 3BSQA 1P12E 1GI5A 3MWIU 4ZHLU 3QDZB 2XC5A 1W12U 1TBQH 1T8NA 3A80A 1BRBE 4YOGA 1AZZA 3E8LA 1K1JA 3SNDA 3GCTF 1FAXA 1O2OA 1O0DH 4INLA 8GCHG 1NU9A 4OS7A 1GBFA 1QQ4A 2ULLA 1QL9A 2RDEA 3GCHC 4ISIH 4ZKOU 1HLTH 1LHCH 2O8MA 2CJIA 3DSGA 2ZU5A 1X7AC 1DE7H 4TPYA 1QBOA 2BQ7B 1DY9A 3C1KA 1SOTA 1MKXH 2YNBA 1P02A 3PM3A 2D1JA 1ZMLA 5A0BA 9ESTA 2FOFA 1HBTH 1GMCG 5EW2H 2L74A 4YOJA 1C1RA 2EEKA 1F2SE 2ZDMA 3V0XA 2XYAA 4CH8B 2JH0D 2QA9E 3SV9A 3N99A 1DX5M 1O2GH 1P8VC 1C9PA 1BTUA 1RS0A 3MOCA 1ZJDA 2BVXH 2FYRA 2M5TA 3A83A 3A87A 1W8BH 3TITA 1YLDA 3PLPA 2BDAA 4YTAA 4ISOA 2BDCA 2P93A 4Q4LA 3SO3A 3SNAA 3SNCA 1A0JA 2H5DA 1H8ED 4KTCA 1HXFH 1ZGVA 2Q1JA 1MZAA 2OC0A 2XC4A 2J2UA 1SGTA 2RCEA 1A3BH 1DFPA 2ZFFH 4CRFA 1SGYE 1QRZA 3RXSA 2SGFE 5FAHA 1EP6A 1E38B 1Z8GA 1EJNA 2A5AA 3U9AH 1SC8U 2ANMH 4NZLA 2K8IA 4CRCA 3P92A 3Q76A 1OP0A 1MCVA 1NRQH 4NGAH 1P9SA 1Y5UT 1OWDA 4RN6A 1LCYA 5FBEA 3AAVA 1W11U 4OS1A 5CHBA 1O5EH 3SGBE 1NRSH 3ODFA 1C5NH 1HJ9A 2IJOB 4HFPB 2PFEA 4NA9H 5GPIB 3KYGA 1C4V2 4M7GA 5LH8A 1MU8B 2O8WA 2GP9B 2VGCC 4JYTA 2BY6X 1PQ5A 1XX9A 5T6FA 1TWXB 1QB1A 4THNH 5DJ7A 4JZIA 1TQ7B 2BVSH 1HAYB 2KAIA 5F6MA 1QCPA 2Q6DA 1EAUA 3KQ5A 1EB1H 4UD9H 1S6FA 3MH6A 1UCYH 1HAHH 4KTUA 1O2UA 1SFIA 4BAKB 3RXFA 1ZYOA 2XOKD 1A3EH 1C2IA 3PMBB 4A1VA 1N6XA 2G8TA 4D7FA 3SW2B 4AYVB 5EQQA 2ZPRA 4CRBA 4JK5A 1O2YA 1FV9A 3KF2A 2ZGHA 1GL0E 1O2TA 4B76A 4O3UA 1B0FA 1GBAA 1VGCB 4CHAB 1HNEE 4SGBE 1JOUB 1HAXB 1H9HE 1MKWK 1Y5AT 1AVGH 1AQ7A 6LPRA 4ABDA 7GCHG 2R2MB 3A81A 5HIZA 2XTTB 3W95A 1DOJA 2ZFSA 4X1PU 3BG4B 4NSVA 4Y6DA 2ZIQH 1O5DH 3TGJE 1O31A 2Z3EA 3OY5U 1ZTJA 2F9PA 2OQ5A 1K2I1 4DT7B 5L6NH 1FZZA 4WF8A 1Z71A 1GHBF 7ESTE 5CDFE 3MI4A 4IBLH 1UVSH 4MTBA 4BTUB 3K6ZA 2FODA 2BDHA 1O3IA 2ZHDA 3VGCB 2A5KA 4MPWA 1Y59T 1JXPA 2UUKB 1AE8H 3MNSA 2GCHG 4U2WA 3UFAA 4WWYA 2THFB 1CHGA 2XWBI 4AFQA 3MO9A 1CGHA 3QGJA 4LK4A 4CRGA 3N7EA 1HAOH 3RXKA 3ZVCA 1GJAB 3SUGA 1Y3VA 3MU1A 3OTJE 2P3UB 1LVMA 4HGCA 4JZDH 2AGEX 2H6MA 4JYVH 3EDXB 4AYYB 4MPXA 1C1QA 3MO6A 3GY8A 1P01A 5HGGA 3ZYEA 2PGQB 1GJ7B 2F43B 3OY6U 1BTYA 1SGDE 5B6LA 3KGPA 4INKA 2ZQ1A 1DWBH 5F53A 1XUKA 2G4UA 2FOEA 1XUHA 1LKAA 2RDLA 5DP8A 5JB9S 5EJ1A 1BT7A 3SU3A 3GY7A 1V3XA 2QXIA 2ZPQA 2JETC 2F83A 4AFUA 5CMXH 2GZ9A 4XBDA 1K28D 2FOAA 1K9OE 5C0TA 3VB3A 1S6HA 4UFDH 1ELFA 4K2YA 2FX4A 3SQEE 2V3MA 5ESTE 5HM2A 5JBBS 1C1MA 1O36A 1GCTB 1L1JA 3RXDA 3QO6A 2FOCA 3F1SB 2VWNA 2A5IA 3OYPA 4I8LA 5GIBA 1FMGA 1HAIH 1EPTB 1KLIH 3E90B 1DT2A 3S9BA 1IHSH 4NG9H 2ZU2A 4Y8XA 4F55A 3GS9A 1YF4A 1ZRKA 1HJAB 2XBVA 1SOZA 1NU7B 1W13U 1G37A 1S83A 1HV7A 4A7IB 3MU0A 1WYKA 1EP5A 2Z3CA 2ZCKP 1FPHH 1XUGA 2GV6A 3TVJB 2AMPA 2NU0E 3ZVEA 1GMDG 1UTLM 4DG4A 1ZSKA 3Q3XA 4OGYA 1EXFA 1QJ6B 2G81E 1FXYA 4NIYA 3AW0A 3T62A 4X1SU 2WV5A 1C5TA 4H6SB 1WUNH 1Y5BT 3DA9B 3L6PA 1N8OC 2QY0B 5EXLA 1T8LA 1FUJA 4BAMB 4BAOB 1MCTA 1L1NA 4AG2A 3U1IB 3K9XB 3ESTA 2QV1A 3M7TA 2GZ7A 3CENA 2J95A 3ZVGA 1E37B 3KQCA 1AGJA 4KKDA 4DT4A 1RIWC 1UTOA 1NPMA 1CGJE 2IJD1 1KMHB 5EU8A 3V13A 4GSOA 2ZHQH 2YMSD 4YOIA 4ASUD 1ZTKA 3HPTB 1CA0C 4IC5A 1OP8A 4H4FA 2EA3A 1HGTH 1ORFA 3RXMA 1CT2E 1TONA 2QE7D 3Q77A 4Y79A 1T31A 4ACBA 2EI7A 4O9VA 1HB0B 4X8VH 2J94A 2BY5X 3QZQA 4FUIA 2C4FH 4KTSA 1FIWA 3BTGE 2BVRH 2J92A 1T8OA 2A7HA 3BG4C 1D3PB 3A85A 4NA8A 3MNBA 2PKSC 1PFXC 1OKXA 1AUTC 2Y5GA 5FX6A 4AORA 5DG6A 4YESB 1RTKA 1BUIA 2BOKA 2PKSB 2W5EA 3T29A 1C5RA 1QRWA 5K7RA 4YLUA 1RFNA 1V2JT 3PMHB 2FS9A 2P8OC 3T2NA 1TX6A 3N7OA 3A8CA 1ZR0A 3RXEA 1GI8B 4NFEA 5LPRA 2LNCA 2RA3A 3MQKC 3IWMA 2P3FH 1MUEB 2CGAA 3HKJB 1F92A 1PPEE 4ZKNU 3SGAE 1O37A 2BD8A 3EA7A 3WWBA 5JBCS 5AFYH 3RC4A 2FDAA 3RMOH 3FP7E 1YCPH 1OS8A 1BJVA 3EE7A 5K0HA 2HNTF 4FUJA 1CE5A 1GCTC 3ZZAA 2BDIA 1HAVB 4YZUA 2TRMA 1CT4E 2AMDA 5EXNA 3NK8A 4PROA 5DP9A 1PPCE 1H9LB 1MTNC 5F8TA 1SGEE 2NU3E 1B0EA 1GBBA 1KLTA 1KLJH 1YCPM 1VKYA 1GDQA 1DSTA 1JBUH 7LPRA 1JMOH 1AIXH 3HK3B 5DP5A 5C1XA 2Y81A 3UWJH 1YYY1 3KCGH 5TCCA 4LZ1H 3ZYDA 1N6YA 3STIA 1O3OA 5DN6D 4B6FA 3NUMA 1SI5H 2VNTA 3VB4A 4AOQA 1MTVA 2JH6D 1FQ3A 1Z6JH 3GCNA 1ZRBA 2O9QA 3ZVFA 5AHGH 1SGQE 2ZWLH 3GCOA 3H7OA 4FUCA 3F0OA 1QIXB 4XOJA 3DT0H 1L4DA 1NBMD 1DS2E 1GBMA 1G32B 1O2RA 1EPTC 2H9EH 4MVNA 3ATWA 3UY9A 1TRNA 3TH3H 1D3DB 1QURH 4R0IA 1FY3A 2P8OB 4NCYA 5FPTA 4DIHH 1EKBB 4O97A 4AN7A 1TPAE 1GJ9B 1ZOMA 2KZ4A 4RKOB 1CBWB 1KY9A 1ETRH 1K1IA 3ZVBA 1QBNA 4NSYA 4Y0ZE 7GCHF 1UCYE 2ZDVH 3PWCA 1G3CA 2WYJA 3SN8A 1GBKA 4I33A 1KXFA 1EAWA 2JKHA 3M5OA 2VINA 5DK1A 1S82A 3A7YA 4Q2KA 4Y8ZA 1O38A 2GT7A 3K65B 4JZEH 3EA8A 1OYQA 3QZRA 1KIGH 1VGCC 3A89A 1DITH 3ATMA 1H8DH 2F9VA 1WAYB 1MTNB 2F9OA 4WJG2 1UHBB 4LZ4B 2TGDA 1H8HD 5JPMH 1UTMA 5FCKA 1E1RD 3O8BA 5KGOA 3PO1C 2KX4A 1A46H 3SZEA 1LHDH 3SORA 2FTLE 2CV3A 1Z8RA 3TPIZ 1FY4A 2W3KA 2V7QD 4NIWA 3VXFH 2ANWA 3SU4A 3ZZ4A 2FLBH 2YMSB 5GCHF 5ABWA 1NROH 1WTHD 2KCPA 2Z9KA 2RG3A 4DGJA 1MQ6A 1SFQB 1EQ9A 3SNEA 3WY8A 2EI6A 3D65E 2Z9JA 3ITIA 1AWHB 5DP3A 1SGNE 3GCHB 1AO5A 1OWIA 2WINI 3P70B 3QGNB 5ESBA 2BD5A 5GDSH 1LPKB 3SJOA 4ABEA 1LVYA 2C90B 3LT3A 3ZVDA 4Q7XA 1TIOA 3BEUA 1K21H 4HI3A 4ZHAA 3RXBA 2GCTC 4MDSA 4TWWA 1GPZA 1ETTH 2ALPA 4K69A 3RXUA 2VJ1A 2XNIA 2OBOA 1C5SA 3FN8A 1GBTA 1P09A 2FXRA 2DUCA 2FOMB 2PTCE 2B0FA 2ANYA 4DCDA 5A2MH 1DPOA 4OS2A 3VG8A 1O3BA 2FX6A 2PWXA 2Y80A 1BTZA 1HAVA 2ZPSA 1SGIB 2TGAA 1SB1H 2FS8A 2M2AA 4ZH8A 1NT1A 3GDUA 2B8OH 3VXEH 2J34A 2ZTYA 1V2RT 3TJNA 3VPKA 1RTFB 2ESTE 1C2JA 2WSSD 2A7JA 1FN6A 3SI4H 4RKJB 1XXFA 3B8JA 2JJ1D 1W0KD 2G5VA 2OUAA 1TMTH 4ISHH 2W26A 1P2IA 1IQEA 5AF9H 2TBSA 1O3NA 1O5BB 1KDQB 3EQ0H 1QJ1B 3UPEA 4U32A 3GY6A 2AS9A 2OC1A 2OINA 5IDKA 3TK5A 4INHA 3RU4E 2SGAA 3LPRA 3P6ZB 1NM6A 3BTME 3PMJA 1WV7H 3LGYA 5DO4H 3RM2H 4AB9A 1SLUB 3F9EA 1E79D 1TGBA 4Y8YA 1FN8A 1OYTH 1AVXA 2W7SA 3M5NA 1BMAA 4B75A 4BNRA 1YPKH 3E3TA 1ANEA 1YM0A 2WZQA 3K2UA 4DURA 1UMAH 1DANH 2A4QA 3ZIAD 4U01A 3LC3A 2AGIX 4ZUHA 1UK4A 1A1RA 1BJUA 1EOJA 1VITH 1ZJKA 8KME2 3MNCA 1ELBA 3VEQB 3P95A 1LQDB 2XWAA 1DLEA 1CHOG 5E0JA 4E05H 1YPMH 4JCNA 2J4IA 2ZGXH 3GCTG 1SL3A 1NBME 3TNTA 4OM9A 1AWFH 1GJ5H 5DGJA 1A5IA 4YXWD 1IQGA 4WMDA 4ZROA 1NTPA 2VWOA 1TMUH 2B9LA 1GBLA 3KN2A 1JIMA 1FX0B 4NA7A 5E8EH 1O35A 4AGJA 4DJZB 6GCHG 1BQYA 3BTWE 1CA0B 2H9HA 1FY5A 5HXFA 3CS0A 1C5XB 1E35B 2VIPA 3DSOA 2PP6A 1P2QA 3A8BA 2ZDKA 3BIUH 2A4OA 2K1QA 2O8LA 2VH0A 1BMMH 1XMNB 5EGMA 3E1XB 4TPIZ 2BHGA 2ODQA 3PLKA 1TNJA 4GAWA 4YT7H 1TQ0B 3Q3YA 3TLOA 2ZU1A 1H4WA 2KAIB 4D8NA 5E2PA 1W0ZU 5T6DA 3RXVA 1NY22 1PQAA 3QTOH 1F0RA 3F0PA 2WUBA 4NZQA 1P57B 4I32A 2GD4B 3M7QA 4GHTA 1PPHE 3P8NA 3Q3KA 4IS5A 4Y71A 3TNSA 4ACAA 1C2DA 2UUYA 5T6GA 2G4TA 2CF9H 2FOGA 4UEHH 3M36A 1WSSH 1ESAA 2ZP0H 2QF5A 5A0CA 2LPRA 4HZHA 1ABIH 1GJDB 3L3TA 1BBRK 2BDGA 1HJAC 3EE0B 4ZHMU 3URDA 4HG6A 1NFXA 3DCLA 1S5SA 3BTEE 3OSYA 2QF4A 5JBTA 1BA8B 2BZ6H 3OFND 2HVYB 1SVPA 3HK6B 1O2QA 2L6OA 1F5KU 4X6PA 4XBBA 4FUHA 1V2OT 4GUXA 2CN0H 3P8OA 2BM2A 4I31A 1THPB 2LP6A 4B1TA 1GHAG 4AB8A 3OTPA 4CH2B 1SHHB 5BRRE 4X1QU 1E36B 1V2ST 1MBMA 1OOKB 2VIDA 1O5AB 1LVOA 3RXJA 1V6DA 1LTOA 7KMEH 4YLQH 1GI1A 1CO7E 4XFQA 4ZKSU 2G51A 1Y8TA 1KTSB 1O2WA 1FPCH 2VVVA 3FKSD 1P2OA 1O5FH 4X8UH 2FYQA 1CQQA 4B73A 2YNAA 2GKVE 1IOEA 1ETSH 2ZEBA 1BRUP 2BTCE 3E91A 2ZGJA 2PV9B 5IYTA 1ZLRA 4B71A 1ZZZA 2XRCA 1O2MA 3PWBA 1AN1E 1ESTA 5FBIA 1AFQB 1NFUA 4FXGH 2ODPA 3GYLB 2ZHWH 1BTXA 1VITG 3I78A 3UNRA 1AU8A 4GPGA 1G3EA 5PTPA 1C2FA 2STAE 2J5UA 2UWOA 3BEFB 5TCAA 3GY4A 1GHVH 5A8XA 1J15A 2ILNA 1LHEH 1DWEH 2ZHEH 1C1OA 3AVZA 3UREA 5G4BA 4A1XA 3UQVA 3BIVH 2A45B 5C20A 3TK6A 1ZPZA 2FTMA 1PPGE 1XUFA 1VZQH 4X1RU 1TGSZ 4UDWH 3ATKA 1LQEA 2PW8H 1TABE 1YLCA 1EOLA 5HKKD 2O8TA 3HGPA 1A0LA 1ZPCA 3ELAH 1T7CA 1TGCA 2C93B 2HGTH 2JH5D 4K60A 1BTPA 1WXRA 1C1NA 1RD3B 3RXHA 1SGPE 1E0FD 3GICB 1WOFA 2AH4X 5I25A 1GGDB 3TGIE 1Z1IA 1O39A 2NU1E 1O2XA 1LMWB 1IQJA 4TYDA 3SJ9A 4ABFA 1TRYA 4WY3A 1A4WH 4UFFH 4BANB 3OAAD 4WXIA 1Z7KA 2F9NA 1GBIA 1AKSA 4FUDA 2AEIH 2QF0A 3RU4D 1K0HA 2GV7A 2JJ2D 5FXLA 1TALA 4ZCNA 4CR9A 1ABJH 4RI0A 1OX1A 1LPGB 5DP4A 5HMAA 1QL7A 3M37A 2OP9A 1AVWA 1Z1JA 2ZDAH 3MH4A 5ETXA 4X2WA 3SYJA 2W6ID 1T32A 1DICA 3SJKA 1QB9A 1FIZA 3D62A 4Z0KA 1LPZB 4MPUA 1BHXF 1F5LA 2Z94A 1XVMA 1G3DA 1YPLH 2G52A 2H1UA 3F2FA 5BPEA 3P8FA 1C2KA 1YPGH 2IPHA 2H2ZA 2C8YB 2DE9A 2RFKC 4IW4E 4MNYA 3OU0A 1EATA 1DXWA 1G30B 2GMTC 1P11E 3LIWA 3M7UA 4B2BA 5E2OA 4WH8A 2ZO3H 1GJ4H 2JDID 5HM9A 1BTWA 1C1PA 2Y7ZA 3U8TH 1IQIA 2F4LA 1C1TA 1TBRH 3TJOA 3LGUA 4IN1A 1ELTA 3BEIB 1OSSA 6CHAC 1C1UH 4B2CA 5C1UA 1MTWA 3QLPH 1PYTC 4NIXA 1B5GH 4SGAE 3M3VA 1C2LA 1MAXA 4CRDA 2FMJA 2VIWA 1O2SA 1GI6A 3A8AA 3HGNA 3ZZ9A 2PKAB 4K8BA 1C5YB 4E7NA 1EUFA 1S81A 2FLRH 3ATLA 3RMLH 2Z9GA 1TA6A 3OE7D 1P2KA 1CGIE 1OWJA 2NWNA 2O8UA 4X6NA 3DFJA 4XDEA 3FP8E 3EA9A 4I8GA 3NWUA 2SGEE 2ANKH 3PTNA 3LU9B 2BD3A 3V7TA 2V6NA 3C27B 1UJ1A 2G00A 2XW9A 2XCFA 2TGTA 1ARBA 2Y7XA 1AD8H 2FPZA 2VGCB 2BLQA 2SGQE 5E0GA 4MNWA 3A82A 3FFGA 3LGWA 2P16A 1O2ZA 3I29A 1V2QT 2VH6A 3M5MA 1ANCA 4CREA 3FZDA 5LPFA 1INCA 3AK5A 1WCZA 1PQ8A 1OXGA 2TGPZ 4Y11E 3LC5A 3IG6B 3RP2A 1HIAB 2QC2A 2V0BA 4D9QA 3GYMA 5EXMA 3GY2A 1YLNA 2A2XH 1THSH 1F0TA 3GDSA 1L4ZA 1C1WH 1IQLA 1GI9B 2ODYB 3S7HB 1ANBA 3RC6A 4BAQB 1RGQA 2J97A 2KFWA 1Y3WA 3D23A 1PYTD 3GOVB 2VIQA 2ZDNA 2KM0A 1EAXA 1C5ZB 5T3HA 3SU6A 1SQRA 1TX8A 3LONA 4UFGH 3UUZA 1IQFA 3ZZCA 1P9UA 5JYIA 3A7TA 2TPIZ 1ZHPA 1A0HB 3E16B 3BTQE 1KXBA 2P3TB 1GJBB 3SJ8A 1UHBA 5F8ZA 3OEED 2G55A 1O2PA 2IPQX 4NFFA 3SHCH 2ZFTA 2FI4E 2KCOA 1KDQA 3NKKA 4NWLA 2B7DH 2CK3D 2ZU3A 1TNHA 3DFLA 1O5CB 1UVOA 3RLYH 1O2IA 3RXQA 4IMZA 1TLDA 1E1QD 1G9IE 1MQ5A 2R0LA 2ZCLP 3AASA 3QK1A 1CA8B 3W94A 5GWZA 1NC6A 1SLXB 3U1JB 2GCHF 1FDPA 5JB8S 3DD2H 1VJAU 1OP2A 4WH6A 1TNGA 1GMHF 3AAUA 3RLWH 3SUDA 2GDEH 1L2EA 1BBRH 1NO9H 2BX3A 3GY3A 1UK2A 4GCHG 3NZIA 1DVAH 1O33A 3E0PB 3TU7H 2BYAX 2J9NA 3M5LA 5EODA 3RMNH 2BD9A 2J98A 1ZMJA 3ZZDA 2FZZA 2GJGA 1C5LH 2BQ6B 1Y3XA 4BXWA 1JRTA 3VGCC 1C9TA 4JK6A 5CHAB 4F48B 4Y0YE 1O32A 3B23B 4FUFA 3MTYA 2A32A 1J8AA 2CHAB 1CHOF 2ZTZA 3P8GA 1O2VA 4AX9H 1O2NA 3PV2A 2SNVA 2H9TH 4DIIH 1C5QA 1MD8A 1A61H 3RXLA 3GY5A 1YPHC 2HALA 4A1TA 4CHAC 1SMFE 1NZQH 1K1NA 2F3CE 1O5GH 2PLXA 1G2MA 4Q63A 2R9PA 3BN9A 1SGRE 1BITA 2C8WB 1C2GA 4YT6H 4DOQA 3LKWA 1EPTA 3PO1B 1J16A 5EQRA 2Y6TA 1ELDE 1W7XH 4XSKU 8ESTE 1XVOA 1D6WA 3AW1A 3DSPA 5AFZH 1EB2A 2AIQA 1EAIA 1O3CA 1ZMNA 2FOHA 4H6TA 2G5NA 4QT8C 3ZVAA 4YM9A 1FNIA 1P10A 3MU8A 4B6EA 2SGDE 1VJ9U 2GZ8A 3UR6A 1ELGA 1UTNA 1XUJA 2ZKSA 4D7GA 4B74A 2XBXA 4J2YB 1QR3E 2PUXB 1IQKA 1Q2WA 1GHBG 2OCVB 1V2MT 4JZFH 1MMJN 1FJSA 1Q31A 4Y7AA 2PKAA 4M9FA 5E0HA 3UQOA 1QB6A 4P02A 4ABGA 4X6OA 3F2GA 1ZSLA 1TOCB 3FVFB 3PLBA 2ZG0H 1WDIA 3MMGA 1CT0E 4ZMAH 4X0WU 4K3JA 5GJ4B 4J1YA 1PPFE 3BTHE 4ABAA 3PYHA 1WQSA 2GVFA 3RXTA 2WYGA 2WPLS 4X2VA 1GDUA 1UTQA 1ZTLA 1ZPBA 1QFKH 2F9UA 3LGTA 4UFEH 2SNWA 2BD7A 4OGXA 4FUEA 1GBJA 1UVTH 3SU2A 4O3TA 5C3NA 1OWKA 3T28A 2JETB 3PTBA 4E7RG 3D49H 1PPZA 1SLVB 4O03A 3TGKE 2UWLA 5DP6A 5EG4A 1AI8H 5C1YA 3NCLA 2J38A 2XNDD 1D9IA 2DE8A 2WPMS 2ZU4A 4A92A 4FUBA 5KEDA 1GMDF 1KXCA 1D4PB 2UUFB 1C5VA 3SHAH 1EX3A 1DM4B 2HNTC 4ISLA 1M9UA 5H4IB 3UOPA 3ZZ8A 4RT0A 1YP9A 4MNXA 5AVDA 1ACBE 1GMHG 2BX4A 3VFEA 4A6LA 4GLYA 2C3SA 4AC9A 2BB4A 1A5HA 2W7UA 3S0NA 1DUAA 2HLDD 3TJVA 1V2TT 1XM1A 1C4U2 3N7DA 3SV8A 2BY9X 5C94A 3FZZA 4AFZA 5C67A 2QXJA 1WTGH 1Y3UA 3UWIA 5JBAS 2UUJB 1DSUA 2F9BH 3F68H 3RUOA 1NRPH 1J14A 3WW7A 5FCRA 2IOTA 2GTBA 4K1TA 1C1SA 1GG6B 3KHVA 2KCAA 1MH0A 3S69A 1W0JD 2PUQH 3SUFA 3CP7A 2QGRA 3ZZ3A 4AG1A 5GNDA 1YPJH 4Y10E 3M61U 5EIYA 1COWD 3BTFE 5EPNA 1EASA 2XXLA 1TAWA 4K1EA 3RXPA 1BBRE 3SU1A 1O3EA 3SZNA 1J9CH 1O2HA 3SU5A 1GJCB 1B7XB 5LGOA 2ZQ2A 1TGTA 1C2MA 2WPKS 4BTIB 1W0YH 1P3EA 1UO6A 4I8JA 1VR1H 3E0NB 2WV9A 2C8ZB 4B2AA 1GMCF 4WVPE 3KQBA 3ZV9A 2ZZUH 4XRNA 1TFXA 1BIOA 5EQSA 1QRXA 5B6OA 4FUGA 3EAJA 1EFRD 1O3DA 3RXGA 4OS5A 1SKYE 1GBDA 1IQHA 3QTVH 2EC9H 2FM2A 1TB6H 4IGDA 3HKIB 4Z1MD 3F9FA 3UIRA 2I6SA 3A7VA 1MBQA 1DLKB 1BHXB 3SGQE 2VIOA 3G01A 3LOXA 1XKAC 2BQWB 4H42U 1GHWH 5A8ZA 4ZXXH 2BDYA 1C5PA 1ELAA 1LHGH 2GX4A 1UVPA 1RXPA 2I6QA 4P00A 3F9GA 5L30H 2Q6FA 2WPJS 1K22H 3H09A 2QAAA 1GVLA 1K1PA 1MTUA 2CHAC 1O2JA 1O3LA 4X2XA 1TRMA 3RU4T 3BTTE 8GCHF 3A7XA 1VCQA 1ZHRA 1C5WB 1IQNA 4XE4A 5F03A 3GISB 3QWCH 3Q00A 2AGGX 2F91A 2WV4A 2BLWA 4HTCH 1BOQA 5L2ZH 1A7SA 2BXTH 5KECA 2P59A 1BZXE 4GHQA 1BRCE 4RSPA 4I7YH 1TNIA 1MABB 2Y5HA 3RXRA 1GHZA 1BDAA 4X2YA 3P17H 3SV2H 1FAKH 9LPRA 4WMFA 4UE7H 1QJ7B 2NU4E 1ZHMA 5EPYA 5A8YA 4VGCB 1YWUA 4I8KA 1W2KH 2GDDA 1W14U 5F8XA 3VB7A 3O8DA 1QGFA 3V12A 1JIRA 4DY7B 3U8OH 1V2WT 1MU6B 4ZAEA 1IAUA 1QNJA 1U6QA 1O3JA 1O3FA 3ENSB 1TMBH 3PV5A 3FP6E 1UTPA 3F2HA 4IMQA 4FOUC 4KGAA 2ZGCA 1P2NA 1QTFA 2HWLB 2D8WA 1LO6A 1SSXA 4F49A 1YPHE 3LH3A 4Y7BA 3KEEA 3U8RH 1P03A 1TYNA 2LELA 2R3UA 1AFEH 2NU2E 1GI0A 2ZC9H 1MZDA 2CF8H 2VBCA 3LDXH 4WMEA 1HIAA 5EW1H 4ZXYH 5EJZA 4I86A 4TY7A 1GGDC 1O34A 1SR5C 2PHBA 1MTSA 1BMLA 5HYOA 5FHTA 2QXHA 2FI5E 3KNXA 1SHYA 1S6LA 3S9AA 1DXPA 1GI2A 2BLOA 2WHXA 2HVXA 1AMHA 3DHKH 2ASUB 5IK2D 2SFAA 4XBCA 3BTKE 2FI3E 1ZGIA 2A1DB 2ZCHP 3SBKA 1XUIA 1HAPH 4Z6AH 2XBYA 4F4OC 3U98H 4OS6A 1TGNA 4BAHB 1A5GH 1KXDA 2EI8A 1V2KT 1UK3A 1AFQC 2ZTXA 3SQHE 2QIQA 3ZV8A 1S84A 1BMFD 5CHAC 1TPPA 5FPYA 2HLCA 2FO9A 1K1OA 1NRNH 2Z6BD 4NIVA 3TH2H 1HJ8A 1SQTA 3LH1A 5FX5A 1NESE 5FPSA 2OQUA 4MNVA 1DWDH 3LGIA 1RTLA 1CU1A 1SGCA 1V2PT 4E06H 3S9CA 4CRAA 3UAIC 1OWEA 2JIZD 4GCHF 1DUEA 2ZHFH 1AZ8A 2P95A 1RJXB 2BLVA 3MHWU 4FVDA 4MPVA 2QYIA 3JZ2B 3ODDA 2BDBA 2Y5FA 1C5OH 3S7KB 2FP7B 3F3BA 1BCUH 2J98B 1E34B 1Q3XA 1O3GA 1GBHA 2D2DA 1NN6A 1TPSA 3ZZ5A 1F0SA 1SGFG 1Y3YA 2STBE 1QHRB 2OXSA 2KR7A 2QXGA 5GXPA 3BG8A
chains in the Genus database with same CATH topology
2UWPA 1W3CA 4KP0A 2R0KA 3RXIA 1F0UA 1KXEA 4ASHA 1A2CH 2OTVA 1C1VH 3BV9B 1PJPA 5DPAA 3UNSA 1NRRH 3ZZBA 1GJ8B 3SUEA 3LGVA 3A8DA 1ELEE 5GCHG 2OBQA 2AIPA 2Q6GA 5A09A 2ZNKH 4FVBA 1TX7A 1S0QA 1GG6C 2FEQH 1H8IH 1QA0A 4Y76A 2C8XB 2VWMA 1OPHB 4X6MA 5SGAE 4YO9A 4NWKA 1P2MA 1W7GH 4MQAA 1HYLA 1GBEA 1LDTT 2W3IA 2ZFRH 3RM0H 4CR5A 4Q7ZA 3FAOA 3RC5A 1O3AA 4JZ1A 1P06A 1YKTA 2HOBA 2ZA5A 4K5ZA 2AERH 3T27A 1EZUC 2Z7FE 3SV6A 4D9RA 1SPJA 3UR9A 2PR3A 3T25A 6ESTA 2ZFPH 2HPPH 4A5TS 4X8SH 1BB0B 5C5OA 3UOUA 4D76A 2ZFQH 1YCPK 3RDZA 3KIDU 2P94A 1N8OB 4FU9A 1GI7B 3H5CB 1T4VH 1S85A 2HRVA 4JYUH 3RMMH 1FONA 2VVCA 1YBWA 4CBNA 2VB0A 3PMAB 3URCA 1DY8A 3NXPA 3HATH 1F5RA 1Z6EA 3NPSA 1C2EA 1SQAA 1HXEH 1SG8B 4ESTE 5C2ZA 3DUXH 2HPQH 1F7ZA 3F6UH 8LPRA 1WBGB 1KTTB 1AY6H 2PGBB 1GHAF 1FY1A 4ISNA 4VGCC 3M35A 4X8TH 2PSYA 1AE5A 2SGPE 4IC6A 1YPEH 1D3QB 1MKWH 1THRH 1XKBC 4IN2A 4WXVA 2Z9LA 1TA2A 1SQOA 1KYNA 4Q80A 1EJMA 1SLWB 3UTUH 1G36A 3JZ1B 3PV4A 1K1MA 1C5UA 2RA0A 1LHFH 2ZF0H 3TK9A 1BTHH 2Z3DA 3MO3A 2WPIS 1GCDA 2BMGB 2CMYA 2FIRH 3A7ZA 1FI8A 5DP7A 2A0QB 2BXUH 3SNBA 1T8MA 4U30A 1GL1A 3TH4H 1V2VT 3F9HA 3SV7A 1ID5H 3KQDA 3MYWA 2WUCA 2OC8A 1O3KA 2BD4A 1LKBA 1JRSA 1QL8A 1GVZA 1P3CA 4ABBA 1BRAA 3SU0A 1P2JA 4R8TB 1ARCA 2A7CA 3E6PH 5C5NA 1P05A 4TWYA 3STJA 1DDJA 3O8CA 1O30A 1MD7A 1ESBA 4BOHA 1JWTA 1L0ZA 3K6YA 3R0FA 1V2UT 2BD2A 1GDNA 1C4Y2 1J17T 1UTKA 3H7TA 1AKSB 3MFJA 6GCHF 3FANA 5LPEA 1CBWC 1NFWA 1V2LT 2AYWA 1TNKA 1S0RA 2VIVA 3RXAA 2B5TB 2BOHB 2FOBA 1ELVA 3PB1E 3VB5A 3I77A 4ZKRU 1KXAA 4DVAU 2ZI2H 2H5CA 1H1BA 2QCYA 1AB9B 1GI3A 2BY8X 1TE0A 3A88A 1HRTH 3U69H 3T26A 2Y82A 4ABHA 3M3TA 1EZQA 3SI3H 2FWWA 3LJOA 1CVWH 2PSXA 5I46H 1O2KA 1C5MD 2ALVA 1GWAA 2A4RA 2XC0A 2ZECA 3MU4A 3EYDA 1LVBA 1CSOE 3T5FH 1O3MA 1HAGE 1RIWB 1SGFA 3RXCA 4Q7YA 1QA7A 3SJIA 1W10U 2BY7X 1L1GA 1N1LA 1VITF 2OC7A 2VVUA 4UONA 5J4SA 4DW2U 3R3GB 3KL6A 1YC0A 4BTTB 4I8HA 1HPGA 4JMYA 2XBWA 3SOSA 1ZSJA 3MH5A 1RRKA 1MKXK 1GJ6A 1ELCA 1EJAA 1UTJA 2XCNA 3GDVA 2V3OH 3MU5A 1MAYA 1O3PB 1VCWA 5L2YH 4K8YA 1GBCA 2Z9IA 2V3HH 2PTNA 2R3YA 5A0AE 4OS4A 4ABIA 2AMQA 1H9IE 3LJJA 1FLEE 3QX5H 2R2WU 4X1NU 3RXOA 1NS3A 2V35A 5JDUB 1GHXH 4AFSA 2WPHS 1HDTH 1PPBH 3ZZ6A 2HNTE 2OLGA 1AUJA 1TBZH 1GI4A 1C2HA 2QF3A 1GHYH 4BXSA 5EOKA 1YGCH 1QBVH 1EZSC 2AFQB 6CHAB 1SBWA 1PQ7A 1AB9C 3PROA 3A86A 2ZDLA 1EZXC 4ABJA 3OX7U 1ANDA 1D6RA 1TNLA 3A84A 3L33A 1FY8E 4AZ2B 3O8RA 1P0SH 2IN2A 3M3SA 1WU1A 5DKMA 1KSNA 1TPOA 1G2LA 1QY6A 1IHTH 1HAZB 2BZAA 4TY6A 2GT8A 2OD3B 3QN7A 2QN5T 3A7WA 1QQUA 1T4UH 2GCTB 1UCYK 2A31A 1BMNH 3ZZ7A 1G3BA 2GMTB 2CXVA 3BF6H 1GVKB 1XXDA 3B9FH 4LXBH 3MH7A 2VU8E 1AHTH 3EGKH 1DWCH 2ZGBH 4K1SA 3IITA 2A4GA 3VB6A 3CS7A 3ATIA 1D3TB 3BTDE 4MLFB 1OWHA 4FU7A 3UNQA 1HUTH 1V2NT 1Z8IB 3QUMP 1HFDA 2VWLA 3MNXA 1UVUH 4KELA 3TJUA 4GVUA 1P04A 3V3MA 1VCPA 1O2LA 4MG3A 1WQVH 5J4QA 2A2QH 1IQMA 2TIOA 1K1LA 4LOYH 3KQEA 1HCGA 4AGKA 5CE1A 2YOLA 4FU8A 5TJXA 1TOMH 1Z8JB 4CBOA 1O3HA 1NFYA 2FESH 3TIUA 2GGVB 2D26C 3BSQA 1P12E 1GI5A 3MWIU 4ZHLU 3QDZB 2XC5A 1W12U 1TBQH 1T8NA 3A80A 1BRBE 4YOGA 1AZZA 3E8LA 1K1JA 3SNDA 3GCTF 1FAXA 1O2OA 1O0DH 4INLA 8GCHG 1NU9A 4OS7A 1GBFA 1QQ4A 2ULLA 1QL9A 3GCHC 4ISIH 4ZKOU 1HLTH 1LHCH 2O8MA 2CJIA 2ZU5A 1X7AC 1DE7H 4TPYA 1QBOA 2BQ7B 1DY9A 3C1KA 1SOTA 1MKXH 2YNBA 1P02A 3PM3A 2D1JA 1ZMLA 5A0BA 9ESTA 2FOFA 1HBTH 1GMCG 5EW2H 4YOJA 1C1RA 2EEKA 1F2SE 2ZDMA 3V0XA 2XYAA 4CH8B 2JH0D 2QA9E 3SV9A 1DX5M 1O2GH 1P8VC 1C9PA 1BTUA 1RS0A 3MOCA 1ZJDA 2BVXH 2FYRA 2M5TA 3A83A 3A87A 1W8BH 3TITA 1YLDA 3PLPA 2BDAA 4YTAA 4ISOA 2BDCA 2P93A 3SO3A 3SNAA 3SNCA 1A0JA 2H5DA 4KTCA 1HXFH 1ZGVA 2Q1JA 1MZAA 2OC0A 2XC4A 2J2UA 1SGTA 2RCEA 1A3BH 1DFPA 2ZFFH 4CRFA 1SGYE 1QRZA 3RXSA 2SGFE 5FAHA 1EP6A 1E38B 1Z8GA 1EJNA 2A5AA 3U9AH 1SC8U 2ANMH 4NZLA 4CRCA 3P92A 3Q76A 1OP0A 1MCVA 1NRQH 4NGAH 1P9SA 1Y5UT 1OWDA 4RN6A 1LCYA 5FBEA 3AAVA 1W11U 4OS1A 1O5EH 3SGBE 1NRSH 3ODFA 1C5NH 1HJ9A 2IJOB 4HFPB 2PFEA 4NA9H 5GPIB 1C4V2 4M7GA 5LH8A 1MU8B 2O8WA 2GP9B 2VGCC 4JYTA 2BY6X 1PQ5A 1XX9A 5T6FA 1TWXB 1QB1A 4THNH 5DJ7A 4JZIA 1TQ7B 2BVSH 1HAYB 2KAIA 5F6MA 1QCPA 2Q6DA 1EAUA 1EB1H 4UD9H 1S6FA 3MH6A 1UCYH 1HAHH 4KTUA 1O2UA 1SFIA 4BAKB 3RXFA 1ZYOA 1A3EH 1C2IA 3PMBB 4A1VA 1N6XA 2G8TA 4D7FA 3SW2B 4AYVB 5EQQA 2ZPRA 4CRBA 4JK5A 1O2YA 1FV9A 3KF2A 2ZGHA 1GL0E 1O2TA 4B76A 4O3UA 1B0FA 1GBAA 1VGCB 4CHAB 1HNEE 4SGBE 1JOUB 1HAXB 1H9HE 1MKWK 1Y5AT 1AVGH 1AQ7A 6LPRA 4ABDA 7GCHG 2R2MB 3A81A 2XTTB 3W95A 1DOJA 2ZFSA 4X1PU 3BG4B 4NSVA 4Y6DA 2ZIQH 1O5DH 3TGJE 1O31A 2Z3EA 3OY5U 1ZTJA 2F9PA 2OQ5A 1K2I1 4DT7B 5L6NH 1FZZA 4WF8A 1Z71A 1GHBF 7ESTE 3MI4A 4IBLH 1UVSH 4MTBA 4BTUB 3K6ZA 2FODA 2BDHA 1O3IA 2ZHDA 3VGCB 2A5KA 4MPWA 1Y59T 1JXPA 2UUKB 1AE8H 3MNSA 2GCHG 4U2WA 3UFAA 4WWYA 2THFB 1CHGA 2XWBI 4AFQA 3MO9A 1CGHA 3QGJA 4LK4A 4CRGA 1HAOH 3RXKA 3ZVCA 1GJAB 3SUGA 1Y3VA 3MU1A 3OTJE 2P3UB 1LVMA 4HGCA 4JZDH 2AGEX 2H6MA 4JYVH 3EDXB 4AYYB 4MPXA 1C1QA 3MO6A 3GY8A 1P01A 5HGGA 3ZYEA 2PGQB 1GJ7B 3OY6U 1BTYA 1SGDE 3KGPA 4INKA 2ZQ1A 1DWBH 1XUKA 2G4UA 2FOEA 1XUHA 1LKAA 2RDLA 5DP8A 5JB9S 1BT7A 3SU3A 3GY7A 1V3XA 2QXIA 2ZPQA 2JETC 2F83A 4AFUA 5CMXH 2GZ9A 4XBDA 1K28D 2FOAA 1K9OE 3VB3A 1S6HA 4UFDH 1ELFA 4K2YA 2FX4A 3SQEE 5ESTE 5HM2A 5JBBS 1C1MA 1O36A 1GCTB 1L1JA 3RXDA 3QO6A 2FOCA 3F1SB 2VWNA 2A5IA 3OYPA 4I8LA 5GIBA 1FMGA 1HAIH 1EPTB 1KLIH 3E90B 1DT2A 3S9BA 1IHSH 4NG9H 2ZU2A 4Y8XA 1YF4A 1ZRKA 1HJAB 2XBVA 1SOZA 1NU7B 1W13U 1G37A 1S83A 1HV7A 4A7IB 3MU0A 1WYKA 1EP5A 2Z3CA 2ZCKP 1FPHH 1XUGA 2GV6A 3TVJB 2AMPA 2NU0E 3ZVEA 1GMDG 1UTLM 4DG4A 1ZSKA 3Q3XA 4OGYA 1EXFA 1QJ6B 2G81E 1FXYA 4NIYA 3AW0A 3T62A 4X1SU 2WV5A 1C5TA 4H6SB 1WUNH 1Y5BT 3DA9B 3L6PA 1N8OC 2QY0B 5EXLA 1T8LA 1FUJA 4BAMB 4BAOB 1MCTA 1L1NA 4AG2A 3U1IB 3K9XB 3ESTA 2QV1A 3M7TA 2GZ7A 3CENA 2J95A 3ZVGA 1E37B 3KQCA 1AGJA 4KKDA 1RIWC 1UTOA 1NPMA 1CGJE 5EU8A 3V13A 4GSOA 2ZHQH 4YOIA 1ZTKA 3HPTB 1CA0C 4IC5A 1OP8A 4H4FA 2EA3A 1HGTH 1ORFA 3RXMA 1CT2E 1TONA 3Q77A 4Y79A 1T31A 2EI7A 4O9VA 1HB0B 4X8VH 2J94A 2BY5X 3QZQA 4FUIA 2C4FH 4KTSA 1FIWA 3BTGE 2BVRH 2J92A 1T8OA 2A7HA 3BG4C 1D3PB 3A85A 4NA8A 3MNBA 2PKSC 1PFXC 1OKXA 1AUTC 2Y5GA 5FX6A 4AORA 5DG6A 4YESB 1RTKA 1BUIA 2BOKA 2PKSB 2W5EA 3T29A 1C5RA 1QRWA 5K7RA 4YLUA 1RFNA 1V2JT 3PMHB 2FS9A 2P8OC 3T2NA 1TX6A 3N7OA 3A8CA 1ZR0A 3RXEA 1GI8B 4NFEA 5LPRA 2LNCA 2RA3A 3IWMA 2P3FH 1MUEB 2CGAA 3HKJB 1F92A 1PPEE 4ZKNU 3SGAE 1O37A 2BD8A 3EA7A 5JBCS 5AFYH 3RC4A 2FDAA 3RMOH 3FP7E 1YCPH 1OS8A 1BJVA 5K0HA 2HNTF 4FUJA 1CE5A 1GCTC 3ZZAA 2BDIA 1HAVB 4YZUA 2TRMA 1CT4E 2AMDA 5EXNA 3NK8A 4PROA 5DP9A 1PPCE 1H9LB 1MTNC 5F8TA 1SGEE 2NU3E 1B0EA 1GBBA 1KLTA 1KLJH 1YCPM 1GDQA 1DSTA 1JBUH 7LPRA 1JMOH 1AIXH 3HK3B 5DP5A 5C1XA 2Y81A 3UWJH 1YYY1 3KCGH 5TCCA 4LZ1H 3ZYDA 1N6YA 3STIA 1O3OA 3NUMA 1SI5H 2VNTA 3VB4A 4AOQA 1MTVA 2JH6D 1FQ3A 1Z6JH 3GCNA 1ZRBA 2O9QA 3ZVFA 5AHGH 1SGQE 2ZWLH 3GCOA 3H7OA 4FUCA 1QIXB 4XOJA 3DT0H 1L4DA 1DS2E 1GBMA 1G32B 1O2RA 1EPTC 2H9EH 4MVNA 3ATWA 3UY9A 1TRNA 3TH3H 1D3DB 1QURH 4R0IA 1FY3A 2P8OB 4NCYA 5FPTA 4DIHH 1EKBB 4O97A 4AN7A 1TPAE 1GJ9B 1ZOMA 4RKOB 1CBWB 1KY9A 1ETRH 1K1IA 3ZVBA 1QBNA 4NSYA 4Y0ZE 7GCHF 1UCYE 2ZDVH 3PWCA 1G3CA 2WYJA 3SN8A 1GBKA 4I33A 1KXFA 1EAWA 2JKHA 3M5OA 2VINA 5DK1A 1S82A 3A7YA 4Q2KA 4Y8ZA 1O38A 2GT7A 3K65B 4JZEH 3EA8A 1OYQA 3QZRA 1KIGH 1VGCC 3A89A 1DITH 3ATMA 1H8DH 2F9VA 1WAYB 1MTNB 2F9OA 4WJG2 1UHBB 4LZ4B 2TGDA 5JPMH 1UTMA 5FCKA 3O8BA 3PO1C 1A46H 1LHDH 3SORA 2FTLE 2CV3A 1Z8RA 3TPIZ 1FY4A 2W3KA 4NIWA 3VXFH 2ANWA 3SU4A 3ZZ4A 2FLBH 5GCHF 5ABWA 1NROH 1WTHD 2Z9KA 4DGJA 2RG3A 1MQ6A 1SFQB 1EQ9A 3SNEA 3WY8A 2EI6A 3D65E 2Z9JA 3ITIA 1AWHB 5DP3A 1SGNE 3GCHB 1AO5A 1OWIA 2WINI 3P70B 3QGNB 5ESBA 2BD5A 5GDSH 1LPKB 3SJOA 4ABEA 1LVYA 2C90B 3LT3A 3ZVDA 4Q7XA 1TIOA 3BEUA 1K21H 4HI3A 4ZHAA 3RXBA 2GCTC 4MDSA 4TWWA 1GPZA 1ETTH 2ALPA 4K69A 3RXUA 2VJ1A 2XNIA 2OBOA 1C5SA 1GBTA 1P09A 2FXRA 2DUCA 2FOMB 2PTCE 2B0FA 2ANYA 4DCDA 5A2MH 1DPOA 4OS2A 1O3BA 2FX6A 2PWXA 2Y80A 1BTZA 1HAVA 2ZPSA 1SGIB 2TGAA 1SB1H 2FS8A 4ZH8A 1NT1A 3GDUA