1O3GA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA02
4R0IA 1HAOH 3RC5A 4BANB 1P02A 1A3BH 1GVLA 3SJ9A 3GY4A 3MFJA 2QXJA 5H4IB 3V7TA 1NRQH 2HNTE 1B5GH 1G3DA 1VJ9U 3F1SB 3JZ1B 1LVOA 3DFLA 3RMNH 2ZHFH 3A8CA 2VIPA 3L33A 4NZLA 7LPRA 4ASHA 5C1YA 4J1YA 3SV2H 1MKXH 1MZAA 1DOJA 1O3AA 5AVDA 1QRWA 4K60A 4DG4A 5EQRA 1J16A 1AMHA 1NRSH 3QZQA 3O8BA 4YOJA 1TNJA 3BEUA 1NFWA 1ZZZA 2WINI 1THPB 1SLVB 4JZDH 1GBDA 1P9SA 1B0FA 1LCYA 2CHAC 3GCNA 6GCHF 1C2GA 1CQQA 1FZZA 1SC8U 2ULLA 1MAXA 1EPTB 4YESB 3P6ZB 1WQSA 1C4U2 5C5OA 1UTJA 1MKWK 1GBCA 1Y3VA 2F3CE 7GCHG 5FPYA 2ZU3A 4OS4A 1UCYK 5JBTA 3OTJE 1GI0A 3NK8A 2XWBI 2ODQA 3M5NA 5DP5A 3ZZ5A 1QQUA 2W7UA 1GHYH 2A5AA 1L4DA 1SLXB 1UK3A 2SGEE 5GDSH 5FX5A 1YCPK 1D3DB 3BV9B 3KQBA 1SGRE 3M61U 3SU3A 3P8GA 4D7FA 1TWXB 4AG1A 3MO6A 1EAIA 2PHBA 4X6PA 2VVCA 4NWKA 1DSUA 1WYKA 2GP9B 3ZV9A 1MTWA 5GWZA 5JBCS 4I8JA 5EU8A 1MTVA 2FODA 3B23B 2Y5GA 1NFXA 2WPKS 3KQCA 3E8LA 1HJAB 4MNYA 3RXVA 1Y8TA 2G52A 1YPJH 4DT7B 2TIOA 4WMDA 4TWWA 2VH0A 1N6YA 5IYTA 6CHAB 2PKAA 2BVRH 1GHVH 2BLQA 3SZNA 2OBQA 4GAWA 1GDUA 1TGTA 5A2MH 1C9TA 3UTUH 1C5NH 3GCHC 1S0QA 1B0EA 1O3PB 2QF0A 1UTMA 2EA3A 3AW0A 4CRAA 4JZIA 1QTFA 5JYIA 4FXGH 4WMFA 1XXFA 4YM9A 4E06H 2NU4E 3LGWA 1V2ST 4DIIH 2FS8A 3TGIE 1MTNB 1QJ1B 2ZFTA 1C5SA 1OOKB 2GZ9A 2BXTH 3M5OA 3ZVDA 2FYQA 1FQ3A 4BAKB 4IGDA 1LQDB 2CN0H 3NUMA 3UWIA 1AFEH 2XBYA 2PV9B 1WAYB 3PV4A 1HAIH 2FOBA 1E37B 1O2NA 4ZXYH 1YPMH 2LNCA 1C5TA 1DT2A 4X6NA 1QA0A 4NFFA 3BTEE 3RU4T 4HZHA 1UVUH 3PWBA 3NKKA 4ZKRU 1EAXA 2SGDE 2ZA5A 3URCA 2F9BH 3ATLA 3U98H 1MU8B 1YKTA 2GMTB 1L1GA 3MU8A 3DD2H 2Z3CA 3VB7A 2AERH 4CR5A 1SFQB 3BTKE 3HKJB 3MH4A 5HM9A 1ZTLA 3U9AH 1SGYE 1TIOA 2CXVA 1QCPA 3MI4A 4AB9A 1TGBA 3ZVEA 1JRTA 4GSOA 3A89A 1MMJN 5GPIB 3BEIB 4NCYA 3E0NB 1Y5UT 3TITA 4WVPE 2SGQE 1NRRH 5AFYH 3TGJE 5L2ZH 1KDQB 2R0LA 2R2MB 1P9UA 1TAWA 2A7CA 4RKOB 1LVYA 1MTSA 1O3HA 2D2DA 1SLWB 1T4VH 3TH2H 3UQVA 1CA0B 4LOYH 1GVKB 1UHBB 1GI5A 1FY4A 3T25A 2ZU2A 3LJOA 3RXRA 3SUDA 3SHCH 4XE4A 1EQ9A 3U8OH 4F4OC 1HIAB 3T28A 5I25A 2BZAA 3MH6A 3AW1A 2ZC9H 3SNDA 1HDTH 2FI4E 4UFDH 3O8CA 2WPLS 1AUJA 4KELA 2ZFPH 2FDAA 3RC4A 6ESTA 1TMBH 2ODYB 3B8JA 1WQVH 3GCOA 1BRUP 2QXGA 1ELEE 1XUKA 2ZF0H 5EXNA 3V3MA 4FUBA 1O32A 1K28D 5DGJA 1K1PA 1TNIA 1GJBB 2OC1A 2SGPE 2XCNA 4K1TA 1BCUH 2VWOA 1HJ8A 5DKMA 1SSXA 3CP7A 1MBMA 4OGXA 5FCRA 4A7IB 2ZHQH 1DLEA 5J4SA 3NXPA 2ZO3H 3LKWA 5HYOA 2BD9A 3RM2H 4ZHLU 4X2WA 2J38A 3P95A 4WH8A 1ZGVA 4CRGA 1CT0E 2O8UA 4JYTA 1BTXA 5JPMH 2R3YA 1ZRBA 1O2MA 2FM2A 1HIAA 2F9PA 1GL1A 4INKA 1NROH 4GUXA 1YPHE 1NU9A 1S82A 4MPUA 5ESTE 1GHAG 4ABEA 3VB6A 3EA7A 4K5ZA 2UUKB 5PTPA 1P03A 3A7VA 1J9CH 1AB9B 1IQNA 3Q00A 4DOQA 1MTUA 1QA7A 1S6HA 2GCHF 3SV6A 2GX4A 1PPZA 3U69H 4UEHH 1PPCE 2OC8A 1QB6A 1FIZA 3ATWA 1O0DH 2C3SA 1JOUB 2WUBA 2V6NA 2FO9A 1Q2WA 2NU1E 2AEIH 3LH1A 1P2OA 1A4WH 1VR1H 1UTQA 1O3IA 5DP7A 1O5DH 4AYYB 1A0LA 5C1XA 1SQOA 1F0UA 2H9EH 1CE5A 1TNHA 1ZPBA 5FHTA 4BAQB 2GDDA 3QWCH 2XTTB 4WXIA 5DP8A 5BPEA 3MOCA 1XXDA 1GI9B 4B76A 3BTDE 2RA0A 4Y8YA 1BBRK 2QIQA 3EA8A 1IQLA 2FX4A 2FMJA 3MNBA 4ZXXH 1FLEE 5TCAA 2G4UA 2IJOB 4Y6DA 1BMLA 1GGDC 2QAAA 4MVNA 1C1VH 2OD3B 1C1OA 4I7YH 1KXAA 2VIQA 2XW9A 1HAVB 2BY5X 3TLOA 4ABIA 1JMOH 1LPZB 1DY9A 1W3CA 3STIA 3ITIA 3GY7A 5EODA 1LMWB 2CV3A 1CA8B 1SHHB 4U30A 2FOGA 1ZMJA 2O8WA 4Y76A 3UOPA 4ZHMU 1NS3A 2PTCE 5EW2H 2AMQA 1FNIA 2W7SA 2FOEA 3UFAA 1XUFA 4FU8A 3M36A 4OS7A 1SGIB 4U32A 4ZKSU 1FAKH 7KMEH 2JETC 4B2BA 2GZ8A 2VH6A 4H6TA 4GCHG 1Z6EA 3OYPA 1N1LA 2ZDMA 4FUGA 1P2JA 1L1NA 2W3IA 3RXHA 3PROA 1Y3WA 1E36B 3B9FH 2J2UA 4XBBA 2PWXA 2XBXA 1TBRH 4O97A 3SHAH 1P06A 1GJ6A 1ZJKA 4MPVA 2VWMA 1LHCH 1AU8A 3M5MA 4YOGA 1EP5A 1QFKH 2AGEX 3ZYDA 4FVDA 3AAUA 1T32A 2FXRA 1W10U 2CJIA 3A7YA 5LH8A 5JBAS 1W11U 1UVTH 1BIOA 4AB8A 2XC4A 2OQ5A 4GPGA 1PPHE 1MCTA 3TJVA 1XVOA 3CENA 1IAUA 1IHTH 1GCDA 5FAHA 1KXCA 2D1JA 1CGIE 2DE8A 2UUYA 5JB9S 2ZQ1A 1TFXA 4LK4A 4FUEA 3HK3B 4TYDA 1C2JA 1O35A 5HGGA 5F8XA 2JH6D 2WV4A 2J9NA 5FBIA 5JB8S 1P2KA 3VPKA 2BY7X 1EAWA 3S9AA 9LPRA 1C1QA 4Q7ZA 1GL0E 4Y7AA 3UQOA 1HV7A 1OPHB 3GOVB 1C2LA 1NN6A 3MHWU 4JZEH 3BN9A 3I77A 4NWLA 1O2IA 5FPSA 2BVXH 1O2ZA 3BTTE 1KTSB 3UR6A 2AS9A 1GMHF 1TBZH 2OQUA 1AD8H 2WPJS 5DP9A 1G30B 3GCHB 4CH2B 1CGHA 1GBTA 4Z0KA 3T5FH 1A5HA 1GBBA 4AGKA 2BLVA 4Z6AH 4ISOA 3RXAA 1PYTC 2Y5FA 5AF9H 2ZECA 1ZR0A 2GD4B 1AWHB 1UO6A 2ALVA 2Z9LA 1AN1E 1ZHRA 3BG8A 4UE7H 3MMGA 2FOAA 1C5QA 1HYLA 1TOCB 2B8OH 1IQIA 5F8ZA 3LIWA 1UTNA 1QJ6B 1PFXC 1TNGA 2PKSB 3LGYA 4U01A 1RS0A 2ZTZA 4CHAC 4YLQH 4KTSA 4I8HA 3RXGA 5DPAA 5HXFA 3FP7E 5GCHG 3RMLH 4I8KA 2Y6TA 1GG6C 1O3JA 1KTTB 3PLKA 3P17H 2Q6GA 3SU5A 3UNQA 5EW1H 1ZPCA 1GWAA 1XX9A 1PYTD 1UTOA 2QY0B 1ANBA 1OWEA 1T8NA 1ZHPA 3R3GB 4BAOB 5CHAC 1AUTC 2PTNA 3ZZBA 2ZGBH 1Z8GA 2F83A 4MDSA 3ZZ3A 1TA6A 2YNBA 4TWYA 3LGTA 2BHGA 1HUTH 3LDXH 3T26A 1O3BA 1HLTH 1GBJA 1YP9A 4WXVA 4VGCC 3SU1A 2XBVA 2AGGX 1GJDB 1EB2A 3D62A 2BM2A 3PMAB 1AVWA 2FTLE 1GBFA 1TMTH 5EPNA 3ZVGA 3A82A 1RIWB 1Z8JB 1H8DH 2STAE 5FBEA 1KXEA 3F6UH 2FOHA 1K1NA 2VJ1A 1Z8IB 2ZGXH 1GJ5H 2VB0A 1LO6A 4IMQA 3ZZ7A 2B5TB 2PUQH 4MPXA 4NGAH 5DP3A 1O3CA 4O9VA 3SGBE 1JIRA 1LHGH 4I32A 3FAOA 4I33A 1H9LB 1S5SA 1C1UH 3TNSA 4SGBE 3QX5H 1T8LA 1DWDH 2QCYA 1THRH 2BTCE 4INHA 4YT6H 1C1MA 1V2JT 1W13U 3M35A 3ZZ6A 1TBQH 3RXUA 1OXGA 1A0HB 1DUAA 4A5TS 1GHWH 2PSYA 1KXDA 1BRCE 2J95A 1MAYA 1V2PT 1FY8E 4MTBA 5FXLA 4FUIA 4X1SU 1O2KA 2BZ6H 5GXPA 2AMPA 2BY6X 3SQEE 2PLXA 4DCDA 3S7HB 4AX9H 4UD9H 4GHTA 1AI8H 5SGAE 1KLJH 1C1WH 1BHXF 1TMUH 1C4Y2 3PM3A 2P59A 3A85A 4XDEA 1C2KA 5LPRA 1ZYOA 2V3OH 4AN7A 2Z3EA 4WJG2 1THSH 2PKAB 1SLUB 3EA9A 2BVSH 2DE9A 4A1XA 5IDKA 3M37A 3OY5U 4CREA 2GT7A 4M7GA 3LU9B 2P93A 4HGCA 2A32A 2FP7B 4MLFB 2VGCB 2TBSA 1SFIA 1DXWA 1KYNA 1O5BB 1GBMA 2YNAA 3T29A 2UWLA 1V2UT 3L3TA 5DP6A 1OP8A 1QIXB 3SORA 3BSQA 3EYDA 4X1PU 1QL9A 1SBWA 2NU3E 1VJAU 1SGPE 1C5MD 2QYIA 3P92A 1T4UH 2H9TH 4K3JA 1LPGB 1EZQA 4UFGH 3LT3A 1D4PB 4IC6A 3TVJB 3G01A 1GMDG 1GI4A 1G32B 5T6DA 1HBTH 1M9UA 3UREA 1TQ7B 4I31A 3LONA 1WCZA 1DANH 1BDAA 3QGJA 3GDUA 1EKBB 2UUJB 1IQGA 2WV5A 1OX1A 1Z1IA 3A7ZA 3FP8E 1P10A 2FLBH 3SU4A 1TONA 1V6DA 2FIRH 1J8AA 1MKXK 1Y3YA 3VGCC 1EP6A 1Y5AT 3LPRA 3E90B 1O36A 3GY3A 1ZJDA 1GBLA 3GDSA 3TK5A 4AG2A 3IWMA 1AQ7A 1GPZA 1T8OA 1TQ0B 2A7HA 1AE8H 1O2HA 2R0KA 3RLWH 1Y3XA 1H9IE 3GY6A 4Y7BA 2BD8A 5GJ4B 1ZLRA 3VFEA 2HPPH 2XBWA 1H4WA 1V2TT 2A4OA 1O5EH 5LPEA 3MO3A 4K1SA 1WBGB 3S7KB 3SI3H 5K7RA 5GIBA 1ZRKA 3GCTG 1LVBA 4YO9A 5AFZH 3VEQB 1JRSA 1CGJE 1HAGE 3ZZCA 4DY7B 5T3HA 1VITF 2R3UA 4FUCA 1GGDB 2ILNA 3CS7A 1P3EA 4DVAU 2GVFA 2G4TA 5A0AE 3TJNA 1WTGH 4WH6A 1JBUH 4CRCA 4CRDA 4NA7A 1EB1H 1PQ8A 1LKBA 2QC2A 2TGDA 1GHBG 1J14A 3JZ2B 3MU0A 4KKDA 3MYWA 2QGRA 1KY9A 1A5IA 3M7TA 1ANCA 5L2YH 2A4QA 2FOMB 2EEKA 3N7OA 1O2VA 3MTYA 1C5OH 3M7UA 3RM0H 2P8OC 1SOTA 2GTBA 5A8ZA 2RA3A 4Q7XA 1DWBH 5DP4A 2ZFRH 2P94A 3QGNB 1YGCH 3NWUA 4KTUA 2ASUB 6LPRA 3IITA 5EXLA 1XKBC 1FAXA 1ZOMA 4K1EA 1P12E 3ATIA 2OP9A 1VGCC 4D9QA 3MO9A 3V13A 4ISIH 1BTHH 2H5CA 1NZQH 1O38A 3W94A 3SUGA 1QY6A 2VWNA 4K69A 3ZV8A 2H2ZA 2UWPA 4X8VH 5FX6A 2VIVA 1YPLH 5AHGH 3T2NA 1DM4B 1GCTC 2BDGA 2BMGB 5TJXA 3O8RA 2ZPRA 3H5CB 1ABIH 1C2EA 3A8DA 1K9OE 1FJSA 3RXIA 2UWOA 2G5NA 1C5VA 2HLCA 1C5ZB 2OXSA 3RLYH 4XSKU 2BD2A 4JK5A 1Q3XA 2K1QA 1GMCG 3A8BA 4NIWA 2IOTA 3E91A 1O2GH 4YZUA 3RXBA 4ESTE 5L6NH 1C5PA 4X1QU 1OKXA 1ARCA 2ZGHA 2PGBB 3PO1C 2TPIZ 1HAPH 1F7ZA 2BDBA 1QHRB 1O39A 5EPYA 1N8OB 2ZGJA 3MNXA 1S6FA 3P8OA 3I29A 1SHYA 1AE5A 1RGQA 3FANA 3KGPA 1TPAE 4JZ1A 4FVBA 1DY8A 2A4GA 1IQEA 1V2RT 1WU1A 2JH5D 3LGUA 4BXWA 4GVUA 2BY9X 1F0RA 1GHZA 2C8YB 4K2YA 2B7DH 1Z7KA 1W2KH 2FOCA 3BG4C 2R9PA 8GCHG 3PMBB 2H9HA 3QLPH 1GJAB 1Y59T 1GJCB 1P8VC 2ZG0H 2BQ6B 5TCCA 1O5GH 1QNJA 2F9VA 1IQKA 4SGAE 1EPTC 3F9GA 2SGAA 2FI3E 3QDZB 1EXFA 3QZRA 4ABHA 1MZDA 1O34A 2XXLA 1SGEE 1TRYA 3MU1A 1O33A 4FUFA 3LC5A 1XUHA 5LPFA 3T62A 5EQQA 1E34B 3SUFA 5A8YA 1CSOE 2QA9E 4HI3A 4CHAB 1A0JA 2HNTC 3BF6H 7GCHF 3PTBA 1ORFA 1QR3E 5E0HA 2A5KA 2HOBA 1GG6B 2XCFA 2PR3A 2ANWA 4U2WA 4DW2U 2QXHA 1GBEA 3W95A 3A7XA 3QN7A 1NO9H 1UVSH 2Y81A 1AFQC 3HGPA 3UPEA 1B7XB 4Y71A 4PROA 1Z6JH 1G3BA 1O2OA 1TPPA 1NFYA 5JBBS 1C4V2 3DA9B 3GY2A 1HB0B 4MPWA 5CHAB 3K2UA 1DDJA 2O9QA 3Q77A 1C5LH 3BTGE 3KEEA 5JDUB 2FI5E 1ELTA 3TK6A 4XFQA 1GJ4H 2A45B 1S84A 3U8TH 2Y80A 1ESTA 4D8NA 4J2YB 4NIYA 1HFDA 2Z9JA 3D23A 4VGCB 3SU2A 3SQHE 3UUZA 2Q6FA 1G2LA 3S69A 1GJ9B 1Y3UA 2ZTYA 1G36A 1A61H 3RU4D 1XUJA 4X1NU 2F9OA 1BRBE 2RCEA 3ATMA 3DFJA 4A92A 3DHKH 1AVXA 1F5LA 1UK2A 3P70B 2FEQH 1ELVA 3M3TA 4YT7H 2BOKA 1P2QA 5G4BA 1WV7H 2ALPA 1SB1H 1XMNB 2ESTE 1O3DA 3RXTA 1QGFA 2FTMA 1IQMA 1AY6H 1GI3A 4X2VA 1K21H 1A46H 1P2NA 2ZCHP 2ZKSA 1KSNA 1QQ4A 3SJ8A 2AYWA 2NU2E 1G3CA 2AIQA 3GCTF 3NPSA 3H7OA 4OS5A 1HNEE 5C1UA 1TALA 1IHSH 2Q6DA 1BMAA 3SJIA 1C5WB 1PQAA 1ZSLA 3A7TA 3K6ZA 1SQAA 2I6QA 4QT8C 1G2MA 4BTTB 5F6MA 3SV7A 4IN2A 2C8WB 3BTFE 6GCHG 3RXSA 2TRMA 3OSYA 2CGAA 1C1PA 1F2SE 1JXPA 1DWCH 4NIVA 3EE0B 1A2CH 1FI8A 1Q31A 2GCTC 1WUNH 1MQ6A 1YLCA 1SI5H 1MBQA 2CHAB 1VCPA 4AORA 1EATA 2GMTC 4TY7A 2A7JA 3KN2A 3PMHB 3PYHA 3Q3KA 2TGAA 3RUOA 1QURH 2VNTA 9ESTA 3U8RH 3SJKA 2Z7FE 1ETTH 1C5YB 1O30A 3VB4A 1HGTH 1OP0A 3KF2A 3SU0A 2W5EA 5DJ7A 1DLKB 5DK1A 4BNRA 3S9CA 3A86A 3KCGH 3BTQE 1SPJA 2H6MA 3L6PA 1IQJA 4RKJB 1EJNA 1G9IE 1BMMH 1F5KU 3LC3A 1BJUA 2FYRA 4JK6A 5C20A 1MD8A 1TPOA 1GVZA 4GHQA 3A81A 4XOJA 2ZHWH 1NRNH 1CVWH 1C2IA 1AO5A 1ID5H 1W8BH 1IQHA 1CT4E 3UY9A 4OS2A 1GJ7B 2C8ZB 2JKHA 3U1IB 1GI2A 1NESE 3QK1A 1EUFA 1O3OA 1V2NT 3RXJA 2QXIA 1TB6H 1YM0A 3GYMA 1DICA 3ZVCA 4IMZA 4HFPB 1P09A 1KLIH 2EI8A 1D3QB 4D9RA 3FZZA 2PGQB 4ABDA 3VGCB 7ESTE 1HJ9A 2ZWLH 3RXOA 5BRRE 3R0FA 1HAHH 1QBVH 3MU4A 2KAIA 3PB1E 1ARBA 5HM2A 1SVPA 2XRCA 1V2MT 1O37A 2ZFSA 1BHXB 2HGTH 1A3EH 4CBNA 1EZSC 1ZGIA 1AIXH 3LOXA 2OCVB 1BQYA 1XVMA 3LGIA 2ZPQA 2HPQH 1F0TA 1BOQA 2Y7XA 1RJXB 5EOKA 3UR9A 2NU0E 3SBKA 1O5AB 4WY3A 4X6OA 2W3KA 2G51A 1LKAA 2JH0D 4LXBH 4YLUA 3I78A 1FONA 4O03A 1ELFA 3RXEA 1YPKH 1EOLA 1BRAA 3AAVA 2F91A 2BQ7B 1DXPA 5FPTA 1RFNA 1SGDE 2QF3A 1V2VT 4BAMB 1QB9A 1ZSJA 1OWHA 1QB1A 1ESAA 3KQDA 4A1TA 1O5CB 3TGKE 4JMYA 3PTNA 1O3NA 2A0QB 2GDEH 1ZMNA 1F0SA 1SGFG 2C4FH 8ESTE 1D6RA 2GKVE 2B9LA 1AB9C 1ABJH 3TU7H 3E1XB 1E38B 2XC0A 1OSSA 2IPHA 1ZPZA 1GHAF 2P8OB 5C3NA 1KXBA 1OWDA 2A2XH 5C2ZA 5ETXA 1H8IH 4IW4E 4UDWH 2IN2A 2BD5A 4X2YA 1TX7A 4ZMAH 1GBAA 1FUJA 3A84A 4XBCA 2BDHA 1DPOA 1P0SH 1V2OT 3ZZDA 1INCA 1VGCB 3P8NA 4NZQA 5E2PA 1AKSA 3RXDA 1C2HA 2Z3DA 2FWWA 1YC0A 2A31A 2VWLA 1SL3A 1F5RA 3GY5A 1CO7E 2C90B 2FS9A 1ETRH 1PJPA 1TA2A 1VITH 2ZP0H 4CBOA 3SJOA 2BX3A 2EI7A 3A8AA 3KNXA 3RP2A 1MKWH 1UTKA 1TABE 2Q1JA 2AH4X 2P95A 3PWCA 1UCYH 2CMYA 3DUXH 3IG6B 4UONA 4THNH 1SGTA 2FESH 1OYTH 3V0XA 1K1JA 1O2QA 3A7WA 2B0FA 3SV8A 1XM1A 1BTUA 2G81E 3P8FA 4Y0ZE 1LHFH 1DX5M 3FVFB 1MU6B 4AFQA 4MNVA 4AZ2B 3PO1B 1C9PA 3M3SA 2BYAX 3ZVFA 4NA9H 3AVZA 8LPRA 1FPHH 4LZ4B 3MWIU 3TK9A 2AGIX 4ABBA 1PPGE 2BB4A 3ZZ4A 4AYVB 3DT0H 1EAUA 4O3UA 4XBDA 2R2WU 2C8XB 1ACBE 2OUAA 2BD4A 1XKAC 3RU4E 1BB0B 3SV9A 5CE1A 1DSTA 1GHXH 4ZKNU 1AHTH 2I6SA 1D3PB 1TPSA 3KL6A 1HRTH 1OS8A 3EAJA 4YOIA 1CBWC 2GV6A 3TNTA 1WTHD 1Z1JA 1O2TA 4IS5A 1C1SA 2QN5T 1DWEH 3LH3A 5F8TA 4B71A 1FN6A 3UWJH 3WY8A 1DS2E 3BG4B 2ANKH 2C93B 4ZAEA 1BZXE 1NRPH 3RC6A 3RXQA 2BQWB 5EQSA 1RD3B 4K8YA 2GCHG 1C1RA 2G55A 2BOHB 2ZCLP 3V12A 4ZKOU 5A0CA 4GCHF 3URDA 1TYNA 2Z9KA 1LVMA 1S83A 3F9HA 4KGAA 1QBOA 3A87A 1AGJA 2Y82A 1XUGA 5A0BA 1UTPA 2GZ7A 2GGVB 3TH3H 1PQ5A 2SNVA 1P2IA 3F68H 4FUDA 2OINA 1SMFE 5F03A 1PPFE 3NZIA 3SO3A 2VVVA 1UJ1A 1GI7B 1V2KT 4FU9A 3SUEA 1AFQB 1BITA 2XYAA 2ZPSA 4AFSA 1EJMA 1O2PA 1BMNH 2V35A 3QTOH 1ELBA 4IBLH 1DE7H 3O8DA 2LPRA 4Y8XA 1IQFA 2J34A 1FPCH 1W0ZU 1BTZA 3UOUA 4E7NA 2VU8E 1SGFA 1EPTA 3ODDA 1O3LA 4ISNA 1AZ8A 1K1LA 4DIHH 1RRKA 1A5GH 1FY5A 1CHOG 1OYQA 4FU7A 1ETSH 1D3TB 1W12U 5ABWA 2XNIA 1FIWA 2ZEBA 5DG6A 4Y0YE 3SW2B 2BLOA 4DJZB 1ANEA 2TGPZ 1MUEB 2H1UA 2ZHEH 1LHDH 1ZMLA 3RXKA 1O3GA 1NY22 1GI6A 2SNWA 3SNAA 1ELDE 2WYGA 1W0YH 5DO4H 1RXPA 2XC5A 4KTCA 1BA8B 1DUEA 5C5NA 1VCQA 2PKSC 2V3HH 1FV9A 4IC5A 2GV7A 3FFGA 1CHGA 2PFEA 1C2FA 4ZROA 1UVPA 1O2SA 4Y8ZA 1MH0A 1D9IA 3SGAE 2BDCA 2FLRH 3SNBA 1SQTA 4ABFA 2TGTA 2HWLB 3F9EA 1W14U 4NFEA 3ZZ9A 1TGSZ 1H1BA 2JETB 5GCHF 1KXFA 2HALA 2P3UB 1IOEA 1SG8B 4B2CA 2GCTB 2HRVA 4B74A 4F49A 3MH5A 2WYJA 1YPGH 2BDAA 3BIVH 1CU1A 4NIXA 4E7RG 1HPGA 1LTOA 3MU5A 4INLA 4CRFA 3SN8A 1BT7A 1C1NA 5J4QA 1J15A 1LDTT 4OGYA 3CS0A 4H6SB 4IN1A 2HNTF 1SGCA 2AIPA 1J17T 1KIGH 1PPBH 1RIWC 1L4ZA 4Q2KA 2G5VA 1BJVA 2VIWA 1TNKA 3MNCA 2ZDVH 2O8MA 2BX4A 2ANMH 4X8TH 1HAYB 1FN8A 2CF8H 3UIRA 1SGQE 1ZHMA 1TGCA 2P3FH 3F9FA 4K8BA 1O3MA 1UMAH 2WUCA 4X0WU 5L30H 5C67A 3RXPA 1RTFB 1YBWA 2WPHS 3QUMP 3MH7A 3VXFH 5K0HA 1C5XB 4GLYA 1S85A 1G3EA 4KP0A 3EGKH 1O2YA 4OS1A 1XUIA 1GMHG 3PLBA 4R8TB 1QL8A 3BTHE 2ZIQH 3E6PH 1MD7A 2J92A 4JZFH 3T27A 4BOHA 2BD3A 1BBRE 2OBOA 4Y11E 2ZDAH 2VVUA 1ESBA 1VCWA 1X7AC 2G00A 3MNSA 4A6LA 1NPMA 4Q7YA 1L1JA 1P3CA 2Z94A 4NSYA 2ZDKA 1KDQA 5A8XA 4Y10E 3ZYEA 2RG3A 1S81A 3OU0A 1GDQA 1U6QA 3BTWE 2Z9GA 3M5LA 1K2I1 1LHEH 2ZFFH 4MNXA 1YCPM 3QTVH 1Z71A 4AOQA 1TOMH 1P57B 3D49H 1G37A 1UHBA 4B1TA 4B73A 1FXYA 3SU6A 1GBHA 1W7GH 2CF9H 2AFQB 1T8MA 1BBRH 2FX6A 1QRXA 2Z9IA 3SI4H 1TRNA 4D76A 2Z6BD 3FZDA 1UK4A 2VGCC 1DVAH 1WSSH 1AZZA 1GDNA 2ZGCA 1O3FA 2BD7A 3GISB 1NFUA 2YOLA 3LGVA 1HXFH 2VIDA 1C2DA 3TH4H 1H9HE 1HXEH 2A1DB 1V2WT 1ELCA 1T7CA 1V2QT 1HCGA 3AASA 1EZUC 1FY1A 2J4IA 1O2XA 3S0NA 1QBNA 1HJAC 1L0ZA 1FDPA 4WF8A 1WOFA 4TPIZ 1JWTA 1GMDF 2VINA 3E3TA 1ELGA 1O5FH 4HTCH 1NC6A 1C2MA 1E0FD 4B75A 3TJOA 6CHAC 1O2JA 1HAXB 2GT8A 5E8EH 3TJUA 1PQ7A 3KQEA 1P01A 2ANYA 1GBIA 2BDIA 2ZFQH 3KHVA 3A83A 4A1VA 2DUCA 3GY8A 3HPTB 3BTME 2PUXB 3GDVA 5T6FA 3M3VA 5T6GA 3LJJA 3S9BA 1BTPA 2PSXA 2AMDA 1EOJA 2ODPA 4RN6A 4ISLA 1O2UA 1MCVA 4ABGA 2A2QH 1MTNC 4CRBA 4X2XA 5LGOA 1NM6A 4JYVH 3ZVBA 5EG4A 4BXSA 1RTLA 1BTWA 3RXCA 1Z8RA 3PLPA 3NCLA 3OX7U 1SOZA 1A7SA 1C5RA 1CHOF 2Y7ZA 1P2MA 3HKIB 4D7GA 3RMOH 2Y5HA 4H42U 1TNLA 1SR5C 2BLWA 2J94A 2O8TA 3K65B 4NSVA 4BTIB 3ELAH 2OLGA 4MNWA 1GHBF 4LZ1H 3VXEH 1P11E 3ZVAA 2FPZA 1N6XA 1DITH 1Y5BT 5HMAA 2F9UA 3SOSA 1AWFH 1O2WA 2OTVA 2D26C 2EC9H 3STJA 2H5DA 1CBWB 3SNEA 1ZTJA 4WWYA 1BUIA 3FP6E 3ZZ8A 2BXUH 3E0PB 3BEFB 1UVOA 4E05H 1KLTA 5CMXH 2KAIB 1QL7A 2ZQ2A 3A88A 2WPIS 3ATKA 1FY3A 1TX8A 2ZTXA 3GICB 1TE0A 3A80A 1K1IA 1HAVA 8KME2 1CA0C 4X1RU 1ZTKA 4MG3A 4ABJA 4JCNA 2W26A 1V3XA 1GJ8B 3PMJA 1FMGA 4O3TA 1OWKA 1SGNE 1CT2E 1D6WA 4AFZA 1BTYA 3K6YA 5A09A 2BDYA 5FCKA 3RXLA 2D8WA 3RXMA 2ZDNA 1PPEE 2RDLA 2ZU4A 2V0BA 3QO6A 4OS6A 5ESBA 3C27B 3Q3XA 1YYY1 4H4FA 4CH8B 1JIMA 4ZHAA 2F9NA 4FUJA 1K22H 4NA8A 1UTLM 2OC0A 4MQAA 2O8LA 1A1RA 3ESTA 4I8LA 1N8OC 1DFPA 1GMCF 4Q80A 1W7XH 4Y79A 1GI1A 2ZNKH 4FUHA 1MQ5A 1O2RA 3BIUH 3HK6B 3ENSB 4X8SH 3RXFA 5EXMA 3ZZAA 2P3TB 1AVGH 1VITG 4TY6A 4ISHH 1E35B 5E0JA 2STBE 4BTUB 2THFB 1AKSB 1C1TA 2A4RA 1EASA 4X6MA 1K1OA 1NU7B 4NG9H 3GYLB 3HATH 2QV1A 2UUFB 1YF4A 4JYUH 2ZI2H 1QJ7B 2M5TA 1OWIA 1LPKB 3ODFA 4RSPA 3TPIZ 4AFUA 5B6OA 3RMMH 2HVXA 4CR9A 1P04A 1YPEH 1QRZA 4DGJA 2SGFE 1O3KA 3OY6U 8GCHF 3KIDU 1GI8B 1EX3A 1NT1A 4I8GA 1F92A 4YTAA 1O3EA 3VB5A 1TLDA 3C1KA 4ABAA 3EQ0H 2NWNA 3E16B 2FOFA 1TX6A 2PW8H 4UFEH 1EZXC 1RTKA 1NTPA 1UCYE 4TPYA 2OC7A 1L2EA 1T31A 2SFAA 3D65E 4BAHB 1TGNA 5E2OA 4WMEA 4AGJA 1V2LT 3U1JB 3M7QA 1YLDA 1HAZB 4B2AA 2BY8X 1C5UA 3UNSA 2ZCKP 1O2LA 2ZZUH 3TIUA 1ANDA 2ZU5A 3RDZA 1ZSKA 1K1MA 2XWAA 2VIOA 2EI6A 2G8TA 4ZH8A 2ZU1A 5I46H 1O31A 5E0GA 1GCTB 3SNCA 3K9XB 1YPHC 1VZQH 4UFFH 1OWJA 2P16A 1S0RA 1P05A 4X8UH 4ZUHA 4DURA 2A5IA 1EJAA 3Q76A 3SGQE 1LQEA 3VB3A 1TRMA 3EDXB 3UNRA 3HGNA 3H7TA 1ELAA 2ZHDA 2ZDLA 5EGMA 3Q3YA 2FZZA 2WPMS 1GBKA 1YCPH 1OP2A
chains in the Genus database with same CATH superfamily
4R0IA 1HAOH 3RC5A 4BANB 1P02A 1A3BH 1GVLA 3SJ9A 3GY4A 3MFJA 2QXJA 5H4IB 3V7TA 1NRQH 2HNTE 1B5GH 1G3DA 1VJ9U 3F1SB 3JZ1B 1LVOA 3DFLA 3RMNH 2ZHFH 3A8CA 1OHHD 2VIPA 3L33A 4NZLA 7LPRA 4ASHA 5C1YA 5C17A 4J1YA 3SV2H 1MKXH 1MZAA 1DOJA 1O3AA 5AVDA 1QRWA 4K60A 4DG4A 5EQRA 1J16A 1AMHA 1NRSH 3ZIAD 3QZQA 3O8BA 4YOJA 1TNJA 3BEUA 1NFWA 1ZZZA 2WINI 1THPB 1SLVB 4JZDH 1GBDA 1P9SA 1B0FA 1LCYA 2CHAC 3GCNA 6GCHF 1C2GA 1CQQA 1FZZA 1SC8U 2ULLA 1MAXA 1EPTB 2YMSB 4YESB 3P6ZB 1WQSA 1C4U2 5C5OA 1UTJA 1MKWK 1GBCA 1Y3VA 2F3CE 7GCHG 5FPYA 2ZU3A 4OS4A 1UCYK 5JBTA 5KGOA 3OTJE 3KQ5A 1GI0A 3NK8A 2XWBI 2ODQA 3M5NA 5DP5A 3ZZ5A 3OFND 3FN8A 1QQUA 2W7UA 3PV2A 1GHYH 2A5AA 1L4DA 1SLXB 1UK3A 2SGEE 5GDSH 5FX5A 4B6EA 1YCPK 1D3DB 3BV9B 3KQBA 1SGRE 1SKYE 3M61U 3SU3A 3VG8A 3P8GA 3F2FA 4D7FA 1TWXB 4AG1A 3MO6A 1EAIA 2PHBA 4X6PA 2VVCA 4NWKA 1DSUA 1WYKA 2GP9B 3ZV9A 1MTWA 5GWZA 5JBCS 4I8JA 5EU8A 1MTVA 2FODA 3B23B 2Y5GA 1NFXA 1H8ED 2WPKS 3KQCA 3E8LA 1HJAB 4MNYA 3RXVA 1Y8TA 2G52A 1YPJH 4DT7B 2TIOA 4WMDA 4TWWA 2VH0A 1N6YA 5IYTA 6CHAB 2PKAA 2BVRH 2QE7D 1GHVH 2BLQA 3SZNA 2OBQA 4GAWA 1GDUA 1TGTA 5A2MH 1C9TA 3UTUH 1C5NH 3GCHC 1S0QA 4YXWD 1B0EA 1O3PB 2QF0A 1UTMA 5EJZA 2EA3A 3AW0A 4CRAA 4JZIA 1QTFA 5JYIA 4FXGH 4WMFA 1XXFA 4YM9A 4E06H 2NU4E 3LGWA 1V2ST 4DIIH 1E1QD 2FS8A 3TGIE 1MTNB 1QJ1B 2ZFTA 1C5SA 1OOKB 2GZ9A 2BXTH 3M5OA 3ZVDA 2FYQA 1FQ3A 4BAKB 4IGDA 1LQDB 2CN0H 3NUMA 3UWIA 1AFEH 2XBYA 2PV9B 1WAYB 3PV4A 1HAIH 2FOBA 1E37B 1O2NA 4ZXYH 1YPMH 2LNCA 1C5TA 1DT2A 4X6NA 1QA0A 4NFFA 3BTEE 3RU4T 4HZHA 1UVUH 3U28C 3PWBA 3NKKA 4ZKRU 1EAXA 2SGDE 2ZA5A 3OTPA 3URCA 2F9BH 3ATLA 3U98H 1MU8B 1YKTA 2GMTB 1L1GA 4P00A 3MU8A 3DD2H 2Z3CA 3VB7A 2AERH 4CR5A 1SFQB 3BTKE 3HKJB 3MH4A 5HM9A 1ZTLA 3U9AH 1SGYE 5CHBA 1TIOA 2CXVA 1QCPA 3MI4A 4AB9A 1TGBA 3ZVEA 1JRTA 4GSOA 3A89A 1MMJN 5GPIB 3BEIB 4NCYA 3E0NB 1Y5UT 3TITA 4WVPE 2SGQE 1NRRH 5AFYH 3TGJE 5L2ZH 1KDQB 2R0LA 2R2MB 1P9UA 1TAWA 2A7CA 4RKOB 1UW7A 1LVYA 1MTSA 1O3HA 2W6ID 2D2DA 1SLWB 1T4VH 3TH2H 3UQVA 1CA0B 4LOYH 1GVKB 1UHBB 1GI5A 1FY4A 3T25A 2ZU2A 3LJOA 2QF5A 3RXRA 3SUDA 3SHCH 4XE4A 1EQ9A 3U8OH 4F4OC 1HIAB 3T28A 5I25A 2BZAA 3MH6A 3AW1A 2ZC9H 3SNDA 1HDTH 2FI4E 4UFDH 3O8CA 2WPLS 1AUJA 4KELA 2ZFPH 2FDAA 3RC4A 5KEDA 6ESTA 1TMBH 2ODYB 3B8JA 1WQVH 3GCOA 1BRUP 2QXGA 1ELEE 1XUKA 2ZF0H 5EXNA 3V3MA 4FUBA 1O32A 1K28D 5DGJA 1K1PA 1TNIA 1GJBB 2OC1A 2W6JD 2SGPE 2XCNA 4K1TA 1BCUH 2VWOA 1HJ8A 5DKMA 1SSXA 3CP7A 1MBMA 4OGXA 5FCRA 4A7IB 3PRDA 2ZHQH 1DLEA 5J4SA 3NXPA 2ZO3H 3LKWA 4HG6A 5HYOA 2BD9A 3RM2H 4ZHLU 4X2WA 2J38A 3P95A 4WH8A 1ZGVA 4CRGA 1CT0E 2O8UA 4JYTA 1BTXA 5JPMH 2R3YA 1ZRBA 1O2MA 2FM2A 3AK5A 1HIAA 2F9PA 1GL1A 4FETA 4INKA 1NROH 4GUXA 1YPHE 1NU9A 1S82A 4MPUA 5ESTE 1GHAG 4ABEA 3VB6A 3EA7A 4K5ZA 2UUKB 5PTPA 1P03A 3A7VA 1J9CH 2JDID 1AB9B 1IQNA 3Q00A 4DOQA 1MTUA 1QA7A 1S6HA 2GCHF 3F0OA 3SV6A 2YMSD 2GX4A 1PPZA 5F53A 4UEHH 1PPCE 3U69H 2OC8A 1QB6A 1FIZA 5C94A 3ATWA 1O0DH 2C3SA 1JOUB 3PV5A 2WUBA 2V6NA 2FO9A 2KFWA 1Q2WA 3KYFA 2NU1E 2AEIH 3LH1A 1P2OA 1A4WH 1VR1H 1UTQA 1O3IA 5DP7A 1O5DH 4AYYB 1A0LA 5C1XA 1SQOA 1F0UA 2H9EH 1CE5A 1TNHA 1ZPBA 5FHTA 4BAQB 2GDDA 3QWCH 2XTTB 4WXIA 5DP8A 5BPEA 3MOCA 1XXDA 1GI9B 4B76A 3BTDE 2V3MA 2RA0A 4Y8YA 1BBRK 2QIQA 3EA8A 1IQLA 2FX4A 2FMJA 3MNBA 4ZXXH 1FLEE 5TCAA 2G4UA 2IJOB 4Y6DA 1BMLA 1GGDC 2QAAA 4MVNA 1C1VH 2OD3B 1C1OA 4I7YH 1KXAA 2VIQA 2XW9A 1HAVB 2BY5X 3TLOA 5CDFE 4ABIA 1JMOH 1LPZB 1DY9A 1W3CA 3STIA 3ITIA 3GY7A 5EODA 2RFKC 1LMWB 2CV3A 1CA8B 1SHHB 4U30A 2FOGA 1ZMJA 2O8WA 3NRLA 4Y76A 3UOPA 4ZHMU 1NS3A 2WHXA 2PTCE 5EW2H 2AMQA 1FNIA 2W7SA 2FOEA 3UFAA 1XUFA 4FU8A 3M36A 4OS7A 1SGIB 4U32A 4ZKSU 1FAKH 7KMEH 2JETC 4B2BA 2GZ8A 2VH6A 4H6TA 4GCHG 1Z6EA 3OYPA 1N1LA 2ZDMA 4FUGA 1P2JA 1L1NA 2W3IA 3RXHA 3PROA 1Y3WA 1E36B 3B9FH 2J2UA 4XBBA 2PWXA 2XBXA 1TBRH 4O97A 3SHAH 1P06A 1GJ6A 1ZJKA 4MPVA 2VWMA 1LHCH 1AU8A 3M5MA 4YOGA 1EP5A 1QFKH 2AGEX 3ZYDA 4FVDA 3AAUA 1T32A 2FXRA 1W10U 2CJIA 3A7YA 5LH8A 5JBAS 1W11U 1UVTH 1BIOA 4AB8A 2XC4A 2OQ5A 4GPGA 1PPHE 1MCTA 3TJVA 1XVOA 3CENA 1IAUA 1IHTH 1GCDA 5FAHA 1KXCA 2D1JA 1CGIE 2DE8A 2UUYA 5JB9S 2ZQ1A 1TFXA 1K0HA 2OK5A 4LK4A 4FUEA 4AC9A 3HK3B 4TYDA 1C2JA 1O35A 5HGGA 5F8XA 2JH6D 2WV4A 2J9NA 5FBIA 5JB8S 1P2KA 3VPKA 2BY7X 1EAWA 3S9AA 9LPRA 1C1QA 4Q7ZA 1GL0E 3F0PA 4Y7AA 3UQOA 1HV7A 1OPHB 3GOVB 1C2LA 1NN6A 3MHWU 4JZEH 3BN9A 3I77A 4NWLA 1O2IA 5FPSA 2BVXH 1O2ZA 3BTTE 1KTSB 3UR6A 2AS9A 1GMHF 1TBZH 2OQUA 1AD8H 2QF4A 2WPJS 5DP9A 1G30B 3GCHB 4CH2B 1CGHA 1GBTA 4Z0KA 3T5FH 1A5HA 1GBBA 4AGKA 2BLVA 4Z6AH 4ISOA 3RXAA 1PYTC 2Y5FA 5AF9H 2ZECA 1ZR0A 2GD4B 1AWHB 1UO6A 1KMHB 2ALVA 3DSOA 2Z9LA 1AN1E 1ZHRA 3BG8A 4UE7H 3MMGA 2FOAA 1C5QA 1HYLA 1TOCB 2B8OH 1IQIA 5F8ZA 3LIWA 1UTNA 1QJ6B 1PFXC 1TNGA 2PKSB 3LGYA 4U01A 1RS0A 2ZTZA 3F2GA 4CHAC 4YLQH 4KTSA 4I8HA 3RXGA 5DPAA 5HXFA 3FP7E 5GCHG 3RMLH 4I8KA 2Y6TA 1GG6C 1O3JA 1KTTB 3PLKA 3P17H 2Q6GA 3SU5A 4ACAA 3UNQA 5EW1H 1ZPCA 1GWAA 1XX9A 1PYTD 1UTOA 2QY0B 1ANBA 1OWEA 1T8NA 1ZHPA 3R3GB 4BAOB 5CHAC 1AUTC 2PTNA 3ZZBA 2ZGBH 1Z8GA 2F83A 4MDSA 3ZZ3A 1TA6A 5HIYA 2YNBA 1SQRA 4TWYA 3LGTA 2BHGA 1HUTH 3LDXH 3T26A 4FOUC 1O3BA 1HLTH 1GBJA 1YP9A 4WXVA 4VGCC 3SU1A 2XBVA 2AGGX 1GJDB 1EB2A 3D62A 2BM2A 2KCOA 3PMAB 1AVWA 2FTLE 1GBFA 1TMTH 5EPNA 3ZVGA 3A82A 1RIWB 1Z8JB 1H8DH 2STAE 5FBEA 3WW7A 1KXEA 3F6UH 2FOHA 1K1NA 2VJ1A 2XOKD 1Z8IB 2ZGXH 1GJ5H 2VB0A 1LO6A 4IMQA 3ZZ7A 2B5TB 2PUQH 4MPXA 4NGAH 5DP3A 1O3CA 4O9VA 3SGBE 1JIRA 1LHGH 4I32A 3FAOA 4I33A 1H9LB 1S5SA 4ASUD 1C1UH 3TNSA 4SGBE 3QX5H 1T8LA 1DWDH 2QCYA 1THRH 2BTCE 4INHA 4YT6H 1C1MA 1V2JT 1W13U 3M35A 3ZZ6A 1TBQH 3RXUA 1OXGA 1A0HB 1DUAA 4A5TS 1GHWH 2PSYA 1KXDA 4XD7D 1BRCE 2J95A 1MAYA 1V2PT 1FY8E 4MTBA 5FXLA 4FUIA 4X1SU 1O2KA 2BZ6H 2M2AA 5GXPA 2AMPA 2BY6X 3SQEE 2PLXA 4DCDA 3S7HB 4AX9H 4UD9H 4GHTA 1AI8H 2EY4C 1KLJH 1C1WH 5SGAE 1BHXF 1TMUH 1C4Y2 3PM3A 2P59A 3A85A 4XDEA 1C2KA 5LPRA 1ZYOA 2V3OH 4AN7A 2Z3EA 4WJG2 5T1VA 1THSH 2PKAB 1SLUB 3EA9A 2BVSH 2DE9A 4A1XA 5IDKA 3M37A 3OY5U 4CREA 2GT7A 4ACBA 4M7GA 3LU9B 2P93A 4HGCA 4TT3D 2A32A 2FP7B 4MLFB 2VGCB 2TBSA 1SFIA 1DXWA 4RT0A 1KYNA 1O5BB 1GBMA 2YNAA 3T29A 2UWLA 1V2UT 3L3TA 5DP6A 1OP8A 1QIXB 3SORA 3BSQA 3EYDA 4X1PU 1QL9A 1SBWA 2NU3E 1VJAU 3CNRA 1SGPE 1C5MD 2QYIA 3DCLA 3P92A 1T4UH 2H9TH 4RT1A 4K3JA 1LPGB 1EZQA 4UFGH 3LT3A 1D4PB 4IC6A 3TVJB 3G01A 1GMDG 1GI4A 1G32B 5T6DA 1HBTH 1M9UA 3UREA 1TQ7B 4I31A 3LONA 1WCZA 1DANH 1BDAA 3QGJA 3GDUA 1EKBB 2UUJB 1IQGA 2WV5A 1OX1A 1Z1IA 3A7ZA 3FP8E 1P10A 2FLBH 3SU4A 1TONA 1V6DA 2FIRH 1J8AA 4F48B 1MKXK 1Y3YA 3VGCC 1EP6A 1Y5AT 3LPRA 3E90B 1O36A 3WWFA 3GY3A 1ZJDA 1GBLA 3GDSA 3TK5A 4AG2A 3IWMA 1AQ7A 1GPZA 1T8OA 1TQ0B 2A7HA 1AE8H 1O2HA 2R0KA 3RLWH 1Y3XA 1H9IE 3GY6A 4Y7BA 2BD8A 5GJ4B 1ZLRA 3VFEA 2HPPH 2XBWA 1H4WA 1V2TT 2A4OA 1O5EH 5LPEA 3MO3A 4K1SA 1WBGB 3S7KB 3SI3H 5K7RA 5GIBA 1ZRKA 3GCTG 1LVBA 4YO9A 5AFZH 3VEQB 1JRSA 1CGJE 1HAGE 3ZZCA 4DY7B 2KCAA 5T3HA 1VITF 2R3UA 4FUCA 1GGDB 2ILNA 3CS7A 1P3EA 4DVAU 2GVFA 2G4TA 5A0AE 3TJNA 1WTGH 4WH6A 1JBUH 4CRCA 4CRDA 4NA7A 1EB1H 1PQ8A 1LKBA 2QC2A 2TGDA 1GHBG 1J14A 3JZ2B 3MU0A 4KKDA 3MYWA 2QGRA 1KY9A 1A5IA 3M7TA 1ANCA 5L2YH 2A4QA 2FOMB 2EEKA 3N7OA 1O2VA 3MTYA 1C5OH 3M7UA 3RM0H 2P8OC 1SOTA 2GTBA 5A8ZA 2RA3A 4Q7XA 1DWBH 5DP4A 2ZFRH 2P94A 3QGNB 1YGCH 3NWUA 4KTUA 2ASUB 6LPRA 3IITA 5EXLA 1XKBC 1FAXA 1ZOMA 4K1EA 1P12E 3ATIA 2OP9A 2PP6A 1VGCC 4D9QA 3MO9A 3V13A 4ISIH 1BTHH 2H5CA 1NZQH 1O38A 3W94A 3SUGA 1QY6A 2VWNA 4K69A 3ZV8A 2H2ZA 2UWPA 4X8VH 5FX6A 2VIVA 1YPLH 5AHGH 3T2NA 1DM4B 1GCTC 2BDGA 2BMGB 5TJXA 3O8RA 2ZPRA 3H5CB 1ABIH 1C2EA 3A8DA 1K9OE 1FJSA 3RXIA 2UWOA 2G5NA 1C5VA 2HLCA 1C5ZB 2OXSA 3RLYH 4XSKU 2BD2A 4JK5A 1Q3XA 2K1QA 1GMCG 3A8BA 4NIWA 2IOTA 3E91A 1O2GH 4YZUA 3RXBA 4ESTE 5L6NH 1C5PA 4X1QU 1OKXA 1ARCA 2ZGHA 2PGBB 3PO1C 2TPIZ 1HAPH 1F7ZA 2BDBA 1QHRB 1O39A 5EPYA 1N8OB 5HKKD 2ZGJA 3MNXA 1S6FA 3P8OA 3I29A 1SHYA 1AE5A 1RGQA 3FANA 3KGPA 1TPAE 4JZ1A 4FVBA 3MQKC 1DY8A 2A4GA 4Q63A 1IQEA 1V2RT 1WU1A 2JH5D 3LGUA 4BXWA 4GVUA 4Z1MD 2BY9X 1F0RA 1GHZA 2C8YB 4K2YA 2B7DH 1Z7KA 1W2KH 2FOCA 3BG4C 2R9PA 8GCHG 3PMBB 2H9HA 3QLPH 1GJAB 1Y59T 1GJCB 1P8VC 2ZG0H 2BQ6B 5TCCA 1O5GH 1QNJA 2K0QA 2F9VA 1IQKA 4SGAE 4XRNA 1EPTC 3F9GA 2SGAA 2FI3E 3QDZB 1EXFA 3QZRA 4ABHA 1MZDA 1O34A 2XXLA 1SGEE 1TRYA 3MU1A 1O33A 4FUFA 3LC5A 1XUHA 5LPFA 3T62A 5EQQA 1E34B 3SUFA 5A8YA 1CSOE 2QA9E 4HI3A 4CHAB 1A0JA 2HNTC 3BF6H 7GCHF 2IJD1 3PTBA 1ORFA 1QR3E 5E0HA 2A5KA 2HOBA 1GG6B 2XCFA 2PR3A 2ANWA 3FOAA 4U2WA 4DW2U 3WWBA 2QXHA 1GBEA 1YY3A 3W95A 3A7XA 3QN7A 1NO9H 1UVSH 2Y81A 1AFQC 3HGPA 3UPEA 1B7XB 4Y71A 4PROA 1Z6JH 1G3BA 1O2OA 1TPPA 1NFYA 5JBBS 1C4V2 3DA9B 3GY2A 1HB0B 4MPWA 5CHAB 3K2UA 1DDJA 2O9QA 3Q77A 1C5LH 3BTGE 3KEEA 5JDUB 2FI5E 1ELTA 3TK6A 3KYGA 4XFQA 1GJ4H 2A45B 1S84A 3U8TH 2Y80A 1ESTA 4D8NA 4J2YB 4NIYA 1HFDA 2Z9JA 3D23A 4VGCB 3SU2A 3SQHE 3UUZA 2Q6FA 1G2LA 3S69A 1GJ9B 2HVYB 1Y3UA 2ZTYA 1G36A 1A61H 3RU4D 1XUJA 4X1NU 2F9OA 1BRBE 2RCEA 3ATMA 3DFJA 4A92A 3DHKH 1AVXA 1F5LA 1UK2A 3P70B 2FEQH 1ELVA 3M3TA 4YT7H 2BOKA 1P2QA 5G4BA 1WV7H 2ALPA 1SB1H 1XMNB 2ESTE 1O3DA 3RXTA 1QGFA 2FTMA 1IQMA 1AY6H 1GI3A 4X2VA 1K21H 1A46H 1P2NA 2JJ1D 2ZCHP 2ZKSA 1KSNA 1QQ4A 3SJ8A 2AYWA 2NU2E 1G3CA 2AIQA 1QZ8A 3GCTF 3NPSA 3H7OA 4OS5A 1HNEE 5C1UA 1TALA 1IHSH 2Q6DA 1BMAA 2WV9A 3SJIA 1C5WB 1PQAA 1ZSLA 3A7TA 3F3BA 3K6ZA 1SQAA 2HLDD 2I6QA 1G2MA 4QT8C 4BTTB 5F6MA 3SV7A 4IN2A 2C8WB 3BTFE 5GNDA 3RXSA 6GCHG 2VBCA 2TRMA 3OSYA 2CGAA 1C1PA 1F2SE 1JXPA 1DWCH 2KZ4A 4NIVA 3EE0B 1A2CH 1FI8A 1Q31A 2GCTC 1WUNH 1MQ6A 1YLCA 1SI5H 1MBQA 2CHAB 1VCPA 4AORA 2JJ2D 1EATA 2GMTC 4TY7A 2A7JA 3KN2A 3PMHB 3PYHA 3Q3KA 2TGAA 3RUOA 1QURH 2VNTA 9ESTA 3U8RH 3SJKA 3N7DA 2Z7FE 1ETTH 1C5YB 1O30A 3VB4A 1HGTH 1OP0A 3KF2A 3SU0A 2W5EA 5DJ7A 1DLKB 5DK1A 4BNRA 3S9CA 3A86A 3KCGH 3BTQE 1SPJA 2H6MA 3L6PA 1IQJA 4RKJB 2K8IA 1EJNA 1G9IE 5HIZA 1BMMH 1F5KU 3LC3A 1BJUA 2FYRA 4JK6A 2F43B 5C20A 1MD8A 1TPOA 1GVZA 4GHQA 3A81A 4XOJA 2ZHWH 1NRNH 1CVWH 1C2IA 1AO5A 1ID5H 1W8BH 1IQHA 1CT4E 3UY9A 4OS2A 1GJ7B 2C8ZB 2JKHA 3U1IB 1GI2A 1NESE 3QK1A 2J98B 1EUFA 1O3OA 1V2NT 3RXJA 2QXIA 1TB6H 1YM0A 3GYMA 1DICA 3ZVCA 4IMZA 4HFPB 1P09A 1KLIH 2EI8A 1D3QB 4D9RA 3FZZA 2PGQB 4ABDA 3VGCB 7ESTE 1HJ9A 2ZWLH 3RXOA 5BRRE 3R0FA 1HAHH 1QBVH 3MU4A 2KAIA 3PB1E 1ARBA 5HM2A 1SVPA 2XRCA 1V2MT 1O37A 2ZFSA 1BHXB 2HGTH 1A3EH 4CBNA 1EZSC 1ZGIA 1AIXH 2JIZD 3LOXA 2OCVB 1BQYA 1XVMA 5EJ1A 3LGIA 2ZPQA 2HPQH 1F0TA 1BOQA 2Y7XA 1RJXB 5EOKA 3UR9A 2NU0E 3SBKA 1O5AB 4WY3A 4X6OA 2W3KA 2G51A 1LKAA 2WPDD 2JH0D 4LXBH 4YLUA 3I78A 1FONA 4O03A 1ELFA 3RXEA 1YPKH 1EOLA 2KCPA 1BRAA 3AAVA 4P02A 2F91A 2BQ7B 1DXPA 2J98A 5FPTA 1RFNA 1SGDE 2QF3A 1V2VT 5IK2D 4BAMB 1QB9A 1ZSJA 1OWHA 1QB1A 1ESAA 3KQDA 4A1TA 1O5CB 3TGKE 4JMYA 3PTNA 1O3NA 2A0QB 2GDEH 1ZMNA 1F0SA 1SGFG 2C4FH 8ESTE 1D6RA 2GKVE 2B9LA 1AB9C 1ABJH 3TU7H 3E1XB 1E38B 2XC0A 1OSSA 2IPHA 1ZPZA 1GHAF 2P8OB 5C3NA 1KXBA 1OWDA 2A2XH 5C2ZA 5FL7D 5ETXA 1H8IH 4IW4E 3OE7D 4UDWH 2IN2A 2BD5A 4X2YA 1TX7A 4ZMAH 1GBAA 1FUJA 3A84A 4XBCA 2BDHA 1DPOA 1P0SH 1V2OT 3ZZDA 4TSFD 3SZEA 1INCA 1VGCB 3P8NA 4NZQA 5E2PA 1AKSA 3RXDA 1C2HA 2Z3DA 2FWWA 1YC0A 2A31A 2VWLA 3PRBA 1SL3A 3EE7A 1F5RA 3GY5A 1CO7E 2C90B 2FS9A 1ETRH 1PJPA 1TA2A 1VITH 2ZP0H 4CBOA 3SJOA 2BX3A 2EI7A 3A8AA 3KNXA 3RP2A 1MKWH 1UTKA 1TABE 2Q1JA 2AH4X 2P95A 3PWCA 1UCYH 2CMYA 3DUXH 3IG6B 4UONA 4THNH 1SGTA 2FESH 1OYTH 1VKYA 3V0XA 1K1JA 1O2QA 3A7WA 2B0FA 3SV8A 1XM1A 1BTUA 2G81E 3P8FA 4Y0ZE 1LHFH 1DX5M 4M9FA 3FVFB 1MU6B 4AFQA 4MNVA 4AZ2B 3PO1B 1C9PA 3M3SA 3H09A 2BYAX 3ZVFA 4NA9H 3AVZA 8LPRA 1FPHH 2GJGA 4LZ4B 3MWIU 3TK9A 2AGIX 4ABBA 1PPGE 2BB4A 3ZZ4A 4AYVB 3DT0H 1EAUA 4O3UA 1YWUA 4XBDA 2R2WU 2C8XB 1ACBE 2OUAA 2BD4A 3F2HA 1XKAC 3RU4E 1BB0B 3SV9A 5CE1A 1DSTA 1GHXH 4ZKNU 1AHTH 2I6SA 1D3PB 1TPSA 3KL6A 1HRTH 1OS8A 3EAJA 4YOIA 1CBWC 2GV6A 3TNTA 1WTHD 1Z1JA 2LELA 1O2TA 4IS5A 1C1SA 2QN5T 1DWEH 3LH3A 5F8TA 4B71A 1FN6A 1E1RD 3UWJH 3WY8A 1DS2E 3BG4B 2ANKH 2C93B 4ZAEA 1BZXE 1NRPH 3RC6A 4ZCNA 3RXQA 2BQWB 5EQSA 1RD3B 4K8YA 2GCHG 1C1RA 2G55A 2BOHB 2ZCLP 3V12A 4ZKOU 5A0CA 4GCHF 3URDA 1TYNA 2Z9KA 1LVMA 1S83A 3F9HA 4KGAA 1QBOA 3A87A 1AGJA 2Y82A 1XUGA 5A0BA 1UTPA 2GZ7A 2GGVB 3TH3H 1PQ5A 2KM0A 2SNVA 1P2IA 3F68H 4FUDA 2OINA 1SMFE 5F03A 1PPFE 3NZIA 3SO3A 2VVVA 1COWD 1UJ1A 1GI7B 1V2KT 4FU9A 3SUEA 1AFQB 1BITA 2XYAA 2ZPSA 4AFSA 1EJMA 2LP6A 1O2PA 1BMNH 2V35A 3QTOH 1ELBA 4IBLH 1DE7H 3O8DA 3SYJA 2LPRA 4Y8XA 3W1EA 1IQFA 2J34A 5B6LA 1FPCH 1W0ZU 1BTZA 3UOUA 4E7NA 2VU8E 1SGFA 1EPTA 3ODDA 1O3LA 4ISNA 1AZ8A 1K1LA 4DIHH 3FO8D 1RRKA 1A5GH 1FY5A 1CHOG 1OYQA 4FU7A 1ETSH 1D3TB 1W12U 5ABWA 2XNIA 1FIWA 2ZEBA 5DG6A 4Y0YE 3SW2B 2BLOA 4DJZB 1ANEA 2TGPZ 1MUEB 2H1UA 2ZHEH 1LHDH 1ZMLA 3RXKA 1O3GA 1NY22 2XNDD 1GI6A 2SNWA 3SNAA 1ELDE 2WYGA 1W0YH 5DO4H 1RXPA 2XC5A 4KTCA 1BA8B 1DUEA 5C5NA 1VCQA 2PKSC 2V3HH 1FV9A 4IC5A 2GV7A 2WSSD 3FFGA 1CHGA 2PFEA 1C2FA 4ZROA 1UVPA 1O2SA 4Y8ZA 1MH0A 1D9IA 3SGAE 2BDCA 2FLRH 3SNBA 1SQTA 4ABFA 2TGTA 2HWLB 3N99A 3OEED 3F9EA 1W14U 4NFEA 2F4LA 3ZZ9A 1TGSZ 1H1BA 2JETB 5GCHF 1KXFA 2HALA 2P3UB 1IOEA 1SG8B 4B2CA 2GCTB 2HRVA 4B74A 4F49A 3MH5A 2WYJA 1YPGH 2BDAA 3BIVH 1CU1A 4NIXA 4E7RG 1HPGA 1LTOA 3MU5A 4INLA 4CRFA 1NBMD 3SN8A 1BT7A 1C1NA 2AHME 4DT4A 5J4QA 4Q4LA 1J15A 1LDTT 4OGYA 3CS0A 4H6SB 4IN1A 2HNTF 1SGCA 1YLNA 2AIPA 1J17T 1KIGH 1PPBH 1RIWC 1L4ZA 4Q2KA 2G5VA 1BJVA 2VIWA 1TNKA 3MNCA 2ZDVH 2O8MA 2BX4A 2ANMH 4X8TH 1HAYB 1FN8A 2CF8H 3UIRA 1SGQE 1ZHMA 1TGCA 5DSFA 2P3FH 3F9FA 4K8BA 4OM9A 5C0TA 1O3MA 1UMAH 2WUCA 4X0WU 5L30H 5C67A 3RXPA 3DSPA 1RTFB 1YBWA 2WPHS 3QUMP 3MH7A 3VXFH 5K0HA 1C5XB 4GLYA 1S85A 1G3EA 4KP0A 2KX4A 3EGKH 1O2YA 4OS1A 1XUIA 4I86A 1GMHG 3PLBA 2WZQA 4R8TB 1QL8A 3BTHE 2ZIQH 3E6PH 1MD7A 2J92A 4JZFH 5DN6D 3T27A 4BOHA 2BD3A 1BBRE 2OBOA 4Y11E 2ZDAH 2VVUA 1ESBA 1VCWA 1X7AC 2G00A 3MNSA 4A6LA 1NPMA 4Q7YA 1L1JA 1P3CA 2Z94A 4NSYA 2ZDKA 1KDQA 5A8XA 4Y10E 3ZYEA 2RG3A 1S81A 3OU0A 1GDQA 1U6QA 3BTWE 2Z9GA 3M5LA 1K2I1 1LHEH 2ZFFH 4MNXA 1YCPM 3QTVH 1Z71A 2YMSC 4RI0A 4AOQA 1FX0B 1TOMH 1P57B 3D49H 1G37A 1UHBA 4B1TA 4B73A 1FXYA 1WDIA 3SU6A 1GBHA 1W7GH 2CF9H 2AFQB 1BMFD 1T8MA 1BBRH 2FX6A 1QRXA 2Z9IA 3SI4H 1TRNA 4D76A 2Z6BD 3FZDA 1UK4A 2VGCC 1DVAH 1WSSH 1AZZA 1GDNA 2ZGCA 1O3FA 2BD7A 3GISB 3GS9A 1NFUA 1WXRA 2YOLA 3LGVA 1HXFH 2VIDA 1C2DA 3TH4H 2J5UA 1H9HE 1HXEH 1MABB 2A1DB 1V2WT 1ELCA 2IPQX 1T7CA 1V2QT 1HCGA 3AASA 1EZUC 1FY1A 2J4IA 1O2XA 3S0NA 1QBNA 1HJAC 1L0ZA 1FDPA 4WF8A 1WOFA 4TPIZ 5EJLA 1JWTA 1GMDF 2VINA 3E3TA 1ELGA 1O5FH 4HTCH 1NC6A 1C2MA 1E0FD 4B75A 3TJOA 6CHAC 1O2JA 1HAXB 2GT8A 5E8EH 3TJUA 1PQ7A 3KQEA 3UAIC 1P01A 2ANYA 1GBIA 2BDIA 2ZFQH 3KHVA 3A83A 4A1VA 1EFRD 2DUCA 3GY8A 3HPTB 3BTME 4B6FA 1E79D 2PUXB 3GDVA 5T6FA 3M3VA 5T6GA 3LJJA 3S9BA 1BTPA 2PSXA 2AMDA 1EOJA 2ODPA 4RN6A 4ISLA 1O2UA 1MCVA 4ABGA 2A2QH 1MTNC 4CRBA 4X2XA 5LGOA 1NM6A 4JYVH 3ZVBA 5EG4A 4BXSA 1RTLA 1BTWA 3RXCA 1Z8RA 3PLPA 3NCLA 3OX7U 1SOZA 1A7SA 1C5RA 1CHOF 2Y7ZA 1P2MA 3HKIB 4D7GA 3RMOH 2Y5HA 4H42U 1TNLA 1SR5C 2BLWA 2J94A 3FKSD 2O8TA 3K65B 4NSVA 4BTIB 1W0KD 2OLGA 3ELAH 4MNWA 1GHBF 2RDEA 4LZ1H 3VXEH 1P11E 3ZVAA 2FPZA 1N6XA 1DITH 1Y5BT 5HMAA 2F9UA 3SOSA 1AWFH 1O2WA 2D26C 2EC9H 2OTVA 3STJA 2H5DA 1CBWB 3SNEA 1ZTJA 4WWYA 1BUIA 3FP6E 3ZZ8A 2BXUH 3E0PB 3BEFB 1UVOA 4E05H 1KLTA 5CMXH 2KAIB 1QL7A 2ZQ2A 5EIYA 3A88A 2WPIS 3ATKA 1FY3A 1TX8A 2ZTXA 3GICB 3OAAD 1TE0A 3A80A 1K1IA 1HAVA 8KME2 1CA0C 4X1RU 1ZTKA 4MG3A 4ABJA 4JCNA 2W26A 1V3XA 1GJ8B 3PMJA 1FMGA 4O3TA 1OWKA 1SGNE 1CT2E 1D6WA 4AFZA 1BTYA 3K6YA 5A09A 2BDYA 1H8HD 5FCKA 3RXLA 2D8WA 3RXMA 2ZDNA 1PPEE 2RDLA 2ZU4A 2V0BA 3QO6A 4OS6A 5ESBA 2L74A 3C27B 3Q3XA 1YYY1 4H4FA 4CH8B 1JIMA 4ZHAA 3DSGA 2F9NA 4FUJA 1K22H 4NA8A 1UTLM 2OC0A 4MQAA 2O8LA 1A1RA 3ESTA 4I8LA 1N8OC 1DFPA 1GMCF 1NBME 4Q80A 1W7XH 4Y79A 3UB0A 1GI1A 2ZNKH 4FUHA 1MQ5A 1O2RA 3BIUH 3HK6B 3ENSB 4X8SH 2KCYA 3RXFA 5EXMA 3ZZAA 2P3TB 2V7QD 1AVGH 1VITG 4TY6A 4ISHH 1E35B 5E0JA 2KR7A 2STBE 4BTUB 2THFB 1AKSB 1C1TA 2A4RA 1EASA 4X6MA 1K1OA 1NU7B 4NG9H 3GYLB 3HATH 2QV1A 2UUFB 1YF4A 4JYUH 2ZI2H 1QJ7B 2M5TA 1OWIA 1LPKB 3ODFA 2EQNA 4RSPA 3TPIZ 5KECA 4AFUA 3OEHD 5B6OA 3RMMH 2HVXA 4CR9A 1P04A 1S6LA 1YPEH 1QRZA 4DGJA 2SGFE 1O3KA 3OY6U 8GCHF 3KIDU 2L6OA 1GI8B 1EX3A 1NT1A 4I8GA 1F92A 4YTAA 1O3EA 3VB5A 1TLDA 3C1KA 4ABAA 3EQ0H 2J97A 2NWNA 3E16B 2FOFA 1TX6A 2PW8H 4UFEH 1EZXC 1RTKA 1NTPA 1UCYE 4TPYA 2OC7A 1L2EA 1T31A 2SFAA 3D65E 4BAHB 1TGNA 5E2OA 4WMEA 4AGJA 1V2LT 3U1JB 3M7QA 1YLDA 1HAZB 4B2AA 2BY8X 4F55A 1C5UA 3UNSA 1W0JD 1O2LA 2ZCKP 2ZZUH 3TIUA 1ANDA 2ZU5A 3RDZA 1ZSKA 1K1MA 2XWAA 2VIOA 2EI6A 2G8TA 4ZH8A 2CK3D 2ZU1A 5I46H 5C0UA 3N7EA 1O31A 5E0GA 1GCTB 3SNCA 3K9XB 1YPHC 1VZQH 4UFFH 1OWJA 2P16A 1S0RA 1P05A 4X8UH 4ZUHA 4DURA 2A5IA 1EJAA 3Q76A 3SGQE 1LQEA 3VB3A 1TRMA 3EDXB 3UNRA 3HGNA 3H7TA 1ELAA 2ZHDA 2ZDLA 5EGMA 3Q3YA 2FZZA 2WPMS 1GBKA 1YCPH 1OP2A
chains in the Genus database with same CATH topology
4R0IA 1HAOH 3RC5A 4BANB 1P02A 1A3BH 1GVLA 3SJ9A 3GY4A 3MFJA 2QXJA 5H4IB 3V7TA 1NRQH 2HNTE 1B5GH 1G3DA 1VJ9U 3F1SB 3JZ1B 1LVOA 3DFLA 3RMNH 2ZHFH 3A8CA 2VIPA 3L33A 4NZLA 7LPRA 4ASHA 5C1YA 4J1YA 3SV2H 1MKXH 1MZAA 1DOJA 1O3AA 5AVDA 1QRWA 4K60A 4DG4A 5EQRA 1J16A 1AMHA 1NRSH 3QZQA 3O8BA 4YOJA 1TNJA 3BEUA 1NFWA 1ZZZA 2WINI 1THPB 1SLVB 4JZDH 1GBDA 1P9SA 1B0FA 1LCYA 2CHAC 3GCNA 6GCHF 1C2GA 1CQQA 1FZZA 1SC8U 2ULLA 1MAXA 1EPTB 4YESB 3P6ZB 1WQSA 1C4U2 5C5OA 1UTJA 1MKWK 1GBCA 1Y3VA 2F3CE 7GCHG 5FPYA 2ZU3A 4OS4A 1UCYK 5JBTA 3OTJE 1GI0A 3NK8A 2XWBI 2ODQA 3M5NA 5DP5A 3ZZ5A 1QQUA 2W7UA 1GHYH 2A5AA 1L4DA 1SLXB 1UK3A 2SGEE 5GDSH 5FX5A 1YCPK 1D3DB 3BV9B 3KQBA 1SGRE 3M61U 3SU3A 3P8GA 4D7FA 1TWXB 4AG1A 3MO6A 1EAIA 2PHBA 4X6PA 2VVCA 4NWKA 1DSUA 1WYKA 2GP9B 3ZV9A 1MTWA 5GWZA 5JBCS 4I8JA 5EU8A 1MTVA 2FODA 3B23B 2Y5GA 1NFXA 2WPKS 3KQCA 3E8LA 1HJAB 4MNYA 3RXVA 1Y8TA 2G52A 1YPJH 4DT7B 2TIOA 4WMDA 4TWWA 2VH0A 1N6YA 5IYTA 6CHAB 2PKAA 2BVRH 1GHVH 2BLQA 3SZNA 2OBQA 4GAWA 1GDUA 1TGTA 5A2MH 1C9TA 3UTUH 1C5NH 3GCHC 1S0QA 1B0EA 1O3PB 2QF0A 1UTMA 2EA3A 3AW0A 4CRAA 4JZIA 1QTFA 5JYIA 4FXGH 4WMFA 1XXFA 4YM9A 4E06H 2NU4E 3LGWA 1V2ST 4DIIH 2FS8A 3TGIE 1MTNB 1QJ1B 2ZFTA 1C5SA 1OOKB 2GZ9A 2BXTH 3M5OA 3ZVDA 2FYQA 1FQ3A 4BAKB 4IGDA 1LQDB 2CN0H 3NUMA 3UWIA 1AFEH 2XBYA 2PV9B 1WAYB 3PV4A 1HAIH 2FOBA 1E37B 1O2NA 4ZXYH 1YPMH 2LNCA 1C5TA 1DT2A 4X6NA 1QA0A 4NFFA 3BTEE 3RU4T 4HZHA 1UVUH 3PWBA 3NKKA 4ZKRU 1EAXA 2SGDE 2ZA5A 3URCA 2F9BH 3ATLA 3U98H 1MU8B 1YKTA 2GMTB 1L1GA 3MU8A 3DD2H 2Z3CA 3VB7A 2AERH 4CR5A 1SFQB 3BTKE 3HKJB 3MH4A 5HM9A 1ZTLA 3U9AH 1SGYE 1TIOA 2CXVA 1QCPA 3MI4A 4AB9A 1TGBA 3ZVEA 1JRTA 4GSOA 3A89A 1MMJN 5GPIB 3BEIB 4NCYA 3E0NB 1Y5UT 3TITA 4WVPE 2SGQE 1NRRH 5AFYH 3TGJE 5L2ZH 1KDQB 2R0LA 2R2MB 1P9UA 1TAWA 2A7CA 4RKOB 1LVYA 1MTSA 1O3HA 2D2DA 1SLWB 1T4VH 3TH2H 3UQVA 1CA0B 4LOYH 1GVKB 1UHBB 1GI5A 1FY4A 3T25A 2ZU2A 3LJOA 3RXRA 3SUDA 3SHCH 4XE4A 1EQ9A 3U8OH 4F4OC 1HIAB 3T28A 5I25A 2BZAA 3MH6A 3AW1A 2ZC9H 3SNDA 1HDTH 2FI4E 4UFDH 3O8CA 2WPLS 1AUJA 4KELA 2ZFPH 2FDAA 3RC4A 6ESTA 1TMBH 2ODYB 3B8JA 1WQVH 3GCOA 1BRUP 2QXGA 1ELEE 1XUKA 2ZF0H 5EXNA 3V3MA 4FUBA 1O32A 1K28D 5DGJA 1K1PA 1TNIA 1GJBB 2OC1A 2SGPE 2XCNA 4K1TA 1BCUH 2VWOA 1HJ8A 5DKMA 1SSXA 3CP7A 1MBMA 4OGXA 5FCRA 4A7IB 2ZHQH 1DLEA 5J4SA 3NXPA 2ZO3H 3LKWA 5HYOA 2BD9A 3RM2H 4ZHLU 4X2WA 2J38A 3P95A 4WH8A 1ZGVA 4CRGA 1CT0E 2O8UA 4JYTA 1BTXA 5JPMH 2R3YA 1ZRBA 1O2MA 2FM2A 1HIAA 2F9PA 1GL1A 4INKA 1NROH 4GUXA 1YPHE 1NU9A 1S82A 4MPUA 5ESTE 1GHAG 4ABEA 3VB6A 3EA7A 4K5ZA 2UUKB 5PTPA 1P03A 3A7VA 1J9CH 1AB9B 1IQNA 3Q00A 4DOQA 1MTUA 1QA7A 1S6HA 2GCHF 3SV6A 2GX4A 1PPZA 3U69H 4UEHH 1PPCE 2OC8A 1QB6A 1FIZA 3ATWA 1O0DH 2C3SA 1JOUB 2WUBA 2V6NA 2FO9A 1Q2WA 2NU1E 2AEIH 3LH1A 1P2OA 1A4WH 1VR1H 1UTQA 1O3IA 5DP7A 1O5DH 4AYYB 1A0LA 5C1XA 1SQOA 1F0UA 2H9EH 1CE5A 1TNHA 1ZPBA 5FHTA 4BAQB 2GDDA 3QWCH 2XTTB 4WXIA 5DP8A 5BPEA 3MOCA 1XXDA 1GI9B 4B76A 3BTDE 2RA0A 4Y8YA 1BBRK 2QIQA 3EA8A 1IQLA 2FX4A 2FMJA 3MNBA 4ZXXH 1FLEE 5TCAA 2G4UA 2IJOB 4Y6DA 1BMLA 1GGDC 2QAAA 4MVNA 1C1VH 2OD3B 1C1OA 4I7YH 1KXAA 2VIQA 2XW9A 1HAVB 2BY5X 3TLOA 4ABIA 1JMOH 1LPZB 1DY9A 1W3CA 3STIA 3ITIA 3GY7A 5EODA 1LMWB 2CV3A 1CA8B 1SHHB 4U30A 2FOGA 1ZMJA 2O8WA 4Y76A 3UOPA 4ZHMU 1NS3A 2PTCE 5EW2H 2AMQA 1FNIA 2W7SA 2FOEA 3UFAA 1XUFA 4FU8A 3M36A 4OS7A 1SGIB 4U32A 4ZKSU 1FAKH 7KMEH 2JETC 4B2BA 2GZ8A 2VH6A 4H6TA 4GCHG 1Z6EA 3OYPA 1N1LA 2ZDMA 4FUGA 1P2JA 1L1NA 2W3IA 3RXHA 3PROA 1Y3WA 1E36B 3B9FH 2J2UA 4XBBA 2PWXA 2XBXA 1TBRH 4O97A 3SHAH 1P06A 1GJ6A 1ZJKA 4MPVA 2VWMA 1LHCH 1AU8A 3M5MA 4YOGA 1EP5A 1QFKH 2AGEX 3ZYDA 4FVDA 3AAUA 1T32A 2FXRA 1W10U 2CJIA 3A7YA 5LH8A 5JBAS 1W11U 1UVTH 1BIOA 4AB8A 2XC4A 2OQ5A 4GPGA 1PPHE 1MCTA 3TJVA 1XVOA 3CENA 1IAUA 1IHTH 1GCDA 5FAHA 1KXCA 2D1JA 1CGIE 2DE8A 2UUYA 5JB9S 2ZQ1A 1TFXA 4LK4A 4FUEA 3HK3B 4TYDA 1C2JA 1O35A 5HGGA 5F8XA 2JH6D 2WV4A 2J9NA 5FBIA 5JB8S 1P2KA 3VPKA 2BY7X 1EAWA 3S9AA 9LPRA 1C1QA 4Q7ZA 1GL0E 4Y7AA 3UQOA 1HV7A 1OPHB 3GOVB 1C2LA 1NN6A 3MHWU 4JZEH 3BN9A 3I77A 4NWLA 1O2IA 5FPSA 2BVXH 1O2ZA 3BTTE 1KTSB 3UR6A 2AS9A 1GMHF 1TBZH 2OQUA 1AD8H 2WPJS 5DP9A 1G30B 3GCHB 4CH2B 1CGHA 1GBTA 4Z0KA 3T5FH 1A5HA 1GBBA 4AGKA 2BLVA 4Z6AH 4ISOA 3RXAA 1PYTC 2Y5FA 5AF9H 2ZECA 1ZR0A 2GD4B 1AWHB 1UO6A 2ALVA 2Z9LA 1AN1E 1ZHRA 3BG8A 4UE7H 3MMGA 2FOAA 1C5QA 1HYLA 1TOCB 2B8OH 1IQIA 5F8ZA 3LIWA 1UTNA 1QJ6B 1PFXC 1TNGA 2PKSB 3LGYA 4U01A 1RS0A 2ZTZA 4CHAC 4YLQH 4KTSA 4I8HA 3RXGA 5DPAA 5HXFA 3FP7E 5GCHG 3RMLH 4I8KA 2Y6TA 1GG6C 1O3JA 1KTTB 3PLKA 3P17H 2Q6GA 3SU5A 3UNQA 5EW1H 1ZPCA 1GWAA 1XX9A 1PYTD 1UTOA 2QY0B 1ANBA 1OWEA 1T8NA 1ZHPA 3R3GB 4BAOB 5CHAC 1AUTC 2PTNA 3ZZBA 2ZGBH 1Z8GA 2F83A 4MDSA 3ZZ3A 1TA6A 2YNBA 4TWYA 3LGTA 2BHGA 1HUTH 3LDXH 3T26A 1O3BA 1HLTH 1GBJA 1YP9A 4WXVA 4VGCC 3SU1A 2XBVA 2AGGX 1GJDB 1EB2A 3D62A 2BM2A 3PMAB 1AVWA 2FTLE 1GBFA 1TMTH 5EPNA 3ZVGA 3A82A 1RIWB 1Z8JB 1H8DH 2STAE 5FBEA 1KXEA 3F6UH 2FOHA 1K1NA 2VJ1A 1Z8IB 2ZGXH 1GJ5H 2VB0A 1LO6A 4IMQA 3ZZ7A 2B5TB 2PUQH 4MPXA 4NGAH 5DP3A 1O3CA 4O9VA 3SGBE 1JIRA 1LHGH 4I32A 3FAOA 4I33A 1H9LB 1S5SA 1C1UH 3TNSA 4SGBE 3QX5H 1T8LA 1DWDH 2QCYA 1THRH 2BTCE 4INHA 4YT6H 1C1MA 1V2JT 1W13U 3M35A 3ZZ6A 1TBQH 3RXUA 1OXGA 1A0HB 1DUAA 4A5TS 1GHWH 2PSYA 1KXDA 1BRCE 2J95A 1MAYA 1V2PT 1FY8E 4MTBA 5FXLA 4FUIA 4X1SU 1O2KA 2BZ6H 5GXPA 2AMPA 2BY6X 3SQEE 2PLXA 4DCDA 3S7HB 4AX9H 4UD9H 4GHTA 1AI8H 5SGAE 1KLJH 1C1WH 1BHXF 1TMUH 1C4Y2 3PM3A 2P59A 3A85A 4XDEA 1C2KA 5LPRA 1ZYOA 2V3OH 4AN7A 2Z3EA 4WJG2 1THSH 2PKAB 1SLUB 3EA9A 2BVSH 2DE9A 4A1XA 5IDKA 3M37A 3OY5U 4CREA 2GT7A 4M7GA 3LU9B 2P93A 4HGCA 2A32A 2FP7B 4MLFB 2VGCB 2TBSA 1SFIA 1DXWA 1KYNA 1O5BB 1GBMA 2YNAA 3T29A 2UWLA 1V2UT 3L3TA 5DP6A 1OP8A 1QIXB 3SORA 3BSQA 3EYDA 4X1PU 1QL9A 1SBWA 2NU3E 1VJAU 1SGPE 1C5MD 2QYIA 3P92A 1T4UH 2H9TH 4K3JA 1LPGB 1EZQA 4UFGH 3LT3A 1D4PB 4IC6A 3TVJB 3G01A 1GMDG 1GI4A 1G32B 5T6DA 1HBTH 1M9UA 3UREA 1TQ7B 4I31A 3LONA 1WCZA 1DANH 1BDAA 3QGJA 3GDUA 1EKBB 2UUJB 1IQGA 2WV5A 1OX1A 1Z1IA 3A7ZA 3FP8E 1P10A 2FLBH 3SU4A 1TONA 1V6DA 2FIRH 1J8AA 1MKXK 1Y3YA 3VGCC 1EP6A 1Y5AT 3LPRA 3E90B 1O36A 3GY3A 1ZJDA 1GBLA 3GDSA 3TK5A 4AG2A 3IWMA 1AQ7A 1GPZA 1T8OA 1TQ0B 2A7HA 1AE8H 1O2HA 2R0KA 3RLWH 1Y3XA 1H9IE 3GY6A 4Y7BA 2BD8A 5GJ4B 1ZLRA 3VFEA 2HPPH 2XBWA 1H4WA 1V2TT 2A4OA 1O5EH 5LPEA 3MO3A 4K1SA 1WBGB 3S7KB 3SI3H 5K7RA 5GIBA 1ZRKA 3GCTG 1LVBA 4YO9A 5AFZH 3VEQB 1JRSA 1CGJE 1HAGE 3ZZCA 4DY7B 5T3HA 1VITF 2R3UA 4FUCA 1GGDB 2ILNA 3CS7A 1P3EA 4DVAU 2GVFA 2G4TA 5A0AE 3TJNA 1WTGH 4WH6A 1JBUH 4CRCA 4CRDA 4NA7A 1EB1H 1PQ8A 1LKBA 2QC2A 2TGDA 1GHBG 1J14A 3JZ2B 3MU0A 4KKDA 3MYWA 2QGRA 1KY9A 1A5IA 3M7TA 1ANCA 5L2YH 2A4QA 2FOMB 2EEKA 3N7OA 1O2VA 3MTYA 1C5OH 3M7UA 3RM0H 2P8OC 1SOTA 2GTBA 5A8ZA 2RA3A 4Q7XA 1DWBH 5DP4A 2ZFRH 2P94A 3QGNB 1YGCH 3NWUA 4KTUA 2ASUB 6LPRA 3IITA 5EXLA 1XKBC 1FAXA 1ZOMA 4K1EA 1P12E 3ATIA 2OP9A 1VGCC 4D9QA 3MO9A 3V13A 4ISIH 1BTHH 2H5CA 1NZQH 1O38A 3W94A 3SUGA 1QY6A 2VWNA 4K69A 3ZV8A 2H2ZA 2UWPA 4X8VH 5FX6A 2VIVA 1YPLH 5AHGH 3T2NA 1DM4B 1GCTC 2BDGA 2BMGB 5TJXA 3O8RA 2ZPRA 3H5CB 1ABIH 1C2EA 3A8DA 1K9OE 1FJSA 3RXIA 2UWOA 2G5NA 1C5VA 2HLCA 1C5ZB 2OXSA 3RLYH 4XSKU 2BD2A 4JK5A 1Q3XA 2K1QA 1GMCG 3A8BA 4NIWA 2IOTA 3E91A 1O2GH 4YZUA 3RXBA 4ESTE 5L6NH 1C5PA 4X1QU 1OKXA 1ARCA 2ZGHA 2PGBB 3PO1C 2TPIZ 1HAPH 1F7ZA 2BDBA 1QHRB 1O39A 5EPYA 1N8OB 2ZGJA 3MNXA 1S6FA 3P8OA 3I29A 1SHYA 1AE5A 1RGQA 3FANA 3KGPA 1TPAE 4JZ1A 4FVBA 1DY8A 2A4GA 1IQEA 1V2RT 1WU1A 2JH5D 3LGUA 4BXWA 4GVUA 2BY9X 1F0RA 1GHZA 2C8YB 4K2YA 2B7DH 1Z7KA 1W2KH 2FOCA 3BG4C 2R9PA 8GCHG 3PMBB 2H9HA 3QLPH 1GJAB 1Y59T 1GJCB 1P8VC 2ZG0H 2BQ6B 5TCCA 1O5GH 1QNJA 2F9VA 1IQKA 4SGAE 1EPTC 3F9GA 2SGAA 2FI3E 3QDZB 1EXFA 3QZRA 4ABHA 1MZDA 1O34A 2XXLA 1SGEE 1TRYA 3MU1A 1O33A 4FUFA 3LC5A 1XUHA 5LPFA 3T62A 5EQQA 1E34B 3SUFA 5A8YA 1CSOE 2QA9E 4HI3A 4CHAB 1A0JA 2HNTC 3BF6H 7GCHF 3PTBA 1ORFA 1QR3E 5E0HA 2A5KA 2HOBA 1GG6B 2XCFA 2PR3A 2ANWA 4U2WA 4DW2U 2QXHA 1GBEA 3W95A 3A7XA 3QN7A 1NO9H 1UVSH 2Y81A