1O3GA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3gA02
1KXFA 2BDGA 1A2CH 4BAHB 2VVCA 1GI3A 1V2OT 1BRCE 1D9IA 4Y79A 2FI5E 1QL9A 1ZMLA 3KF2A 1UVPA 1K22H 3KQDA 1A5IA 1GJ6A 5DP6A 5DK1A 5FHTA 1P2OA 3SU2A 5DG6A 2VH0A 4VGCB 3RXVA 3AVZA 3U8RH 1C5LH 1CQQA 4DW2U 1BZXE 4CBNA 5ESTE 1ZPBA 4VGCC 5GDSH 2H1UA 2OBQA 4KKDA 1IAUA 1V2QT 6CHAB 2ULLA 2A2XH 1HIAB 4KTCA 5FXLA 2BXUH 4AN7A 1O37A 4BOHA 5EW2H 1K9OE 2XRCA 4Q80A 4U30A 1GL1A 4WVPE 1AVXA 5C1XA 3SV9A 5JYIA 2EI8A 2OC8A 1MUEB 5EXNA 2BD9A 4DURA 2Y80A 3U69H 4ZUHA 3ATKA 1GHAF 3FZZA 3GY5A 5JDUB 1QL8A 1KTSB 2Y5GA 3PMJA 5DP3A 1C5QA 5EODA 1HJ8A 1EAIA 1C4Y2 2ZPRA 1LKBA 1AB9B 3GCTG 4DCDA 2J95A 1UTQA 5JPMH 7GCHG 1CHOG 3BG4C 7KMEH 1FN8A 3ZZBA 3GDVA 1T8LA 2ZQ1A 3Q77A 1G3BA 5HM9A 3RLYH 3ZVFA 1SBWA 3LJOA 1TBQH 1SI5H 1K1NA 1RTFB 1O2KA 2ZGBH 2FYRA 3SI4H 2OC1A 2GV6A 3M37A 1TB6H 3FP6E 3GOVB 3SV2H 4U01A 1G9IE 2PTCE 1IHSH 2BDHA 4Y71A 3VPKA 1O5CB 1V6DA 2Z7FE 3CP7A 1OWKA 1AVGH 4AX9H 1N1LA 2IPHA 5L6NH 1DLKB 1MKXK 1O3AA 3MU0A 1CO7E 1IQNA 1P0SH 2D8WA 3E91A 9ESTA 1O31A 4CH2B 5EPYA 2HWLB 1MTVA 4MPWA 3ZZ8A 3DA9B 1JMOH 2TGTA 2NU4E 1GI5A 2P59A 1N8OB 2JETC 4YT6H 2GDEH 1O3LA 3LDXH 4ZKNU 1KDQB 3W94A 3QTVH 3ZV9A 2P94A 4TWWA 3AAUA 1KXDA 4I32A 1DM4B 2FM2A 4TPIZ 3RXSA 2XYAA 1HJAB 2F9NA 3LJJA 3E8LA 1F0UA 1NU7B 1TALA 1C5OH 1V2PT 1C1WH 1ESAA 2OBOA 4GSOA 3SOSA 2XBVA 1C1PA 2Q1JA 1FI8A 4GAWA 3NZIA 3SUGA 1GGDC 1BB0B 1GMDF 3ZVBA 2HGTH 3P8FA 1HAGE 1NRPH 4A1XA 3M3TA 2DE9A 2KAIA 3UUZA 3RDZA 3G01A 2FMJA 1Y3VA 2W7SA 2ZDMA 3N7OA 2VU8E 1RXPA 3ZYDA 1H9IE 4ZHAA 3F68H 1GBBA 1RRKA 5F6MA 1O3MA 1P2QA 2XNIA 1GMDG 1O3BA 1C1TA 4TYDA 4ABHA 3PLKA 2PUQH 2FPZA 1Z6EA 2BY8X 5LPEA 2FXRA 4DVAU 3M5MA 2ZHWH 1AWHB 3MMGA 2BDAA 1CGHA 1FZZA 3D62A 1EZUC 1O39A 2HOBA 2Z3EA 2FX6A 4MLFB 3SNCA 4IN1A 1GHYH 2J94A 3TITA 2F9BH 1P8VC 5EXMA 1AZ8A 1KXBA 5HXFA 4JK6A 2SFAA 1MZDA 5JBBS 1P3CA 2G4TA 3TH4H 1G37A 1SLVB 5ABWA 1ZPZA 3SU3A 2THFB 1S6HA 1S84A 2HVXA 2P8OB 1A0HB 1LPKB 1O2WA 2XTTB 1V2KT 1N6YA 2TGDA 3M5LA 2BXTH 1WSSH 3LT3A 1L0ZA 3A86A 1QB6A 1HGTH 4I8JA 4IMZA 1HXEH 1QJ7B 1IQGA 1J14A 1SOZA 2OQUA 3SU0A 1LCYA 4AFUA 1WTHD 1FY3A 1GMHF 1W2KH 1SGPE 4JZDH 5EQSA 3RMNH 5JB8S 3BTWE 1W14U 1SGNE 3BV9B 2QXHA 3UR9A 3RXFA 4AFZA 4ISLA 1O5GH 2CN0H 4B2AA 1DS2E 2JH5D 3A8AA 4OS5A 4HTCH 1C2IA 1C9TA 4CH8B 4OS1A 1BRAA 2BDCA 4NIYA 1O5BB 1QQ4A 4FU8A 4NIXA 1P2IA 3R0FA 2GV7A 5C5OA 1OP8A 1Y8TA 1TMBH 5LPFA 2W7UA 3VB5A 2EI6A 2G52A 3CENA 2WYGA 4B74A 4ZKRU 2FYQA 1YPEH 5E8EH 5F8TA 2QYIA 3OX7U 1S83A 1BA8B 2AS9A 1EAXA 4FUCA 2UWLA 1ABJH 3DFLA 1ZOMA 2A1DB 2A32A 1GJ9B 1BRBE 1YPHC 1C4U2 2F9UA 1DLEA 2BVRH 1DOJA 4JK5A 1PQAA 4A92A 1P04A 3M3VA 2YNBA 2GCTB 4M7GA 2VIPA 1PJPA 4XBBA 4TY6A 1YCPK 3K9XB 3MOCA 3UWJH 4CRBA 1CGIE 1O2XA 1H9LB 2A7CA 1TPOA 4AFQA 4FUEA 2Q6GA 1TGCA 4OS7A 4JZ1A 1W0ZU 2G4UA 4NIVA 3RXGA 2V3HH 1ID5H 3M7QA 3R3GB 1MTNC 3M35A 3UOUA 2JH6D 1PFXC 4Y76A 3O8BA 3RU4D 5FCKA 1L1GA 2YNAA 2QCYA 2G8TA 4D9RA 3NPSA 4NFFA 3VB3A 1ZZZA 4YOGA 5HMAA 4CRCA 3KGPA 1HUTH 2ZGHA 4KGAA 1AO5A 1C5SA 1Y5BT 2AYWA 1FDPA 4B1TA 2ZWLH 4NFEA 1YF4A 2A4GA 1UO6A 1FJSA 2OTVA 1C2DA 1ETRH 3GYLB 1VITF 1GCTC 3KL6A 2BDYA 1LKAA 1GDUA 1V2MT 1V2NT 1GBAA 4K5ZA 3LIWA 1A4WH 3PMHB 4X2WA 1GCTB 5L2ZH 4RN6A 2TBSA 5A0BA 1ZJDA 2VWNA 2GCHG 5TCAA 2Y81A 2C4FH 4H4FA 4LZ1H 1C5PA 1EJMA 1K1IA 4YZUA 1O3CA 1VR1H 1NRQH 2H9EH 5A8YA 3PLPA 2ODQA 1PQ5A 3M5NA 4CRGA 1SG8B 2GT7A 1A0LA 1H8IH 2Y5HA 3LGVA 1K1LA 2XBYA 2P8OC 2GZ9A 3QN7A 1EPTA 2BM2A 2FOGA 4MNYA 1T4UH 1J16A 1BMLA 1P57B 4ZAEA 2XC0A 3ZZ7A 2Z9LA 1DSTA 3VXEH 2AMDA 2AEIH 3RXAA 4HFPB 1QR3E 1W3CA 4FUGA 1VCWA 2ZDLA 2Z3DA 1C1VH 2A45B 2W3KA 4A6LA 2V35A 2CF9H 4RKJB 1J15A 1FLEE 8LPRA 1EZXC 3NUMA 3QLPH 4MPVA 4HGCA 3SV6A 3PTBA 3LPRA 1GI7B 1O2MA 1RIWC 4MNWA 2FZZA 2RG3A 3NXPA 3QX5H 3E16B 1WQSA 5DKMA 2Y7XA 5L30H 1JRSA 1O33A 5FPTA 1AHTH 5F03A 1EP6A 1KLIH 1KTTB 1OOKB 4NA7A 2F91A 2RA0A 3P92A 2R3YA 5C1UA 1FAKH 2C8WB 4DJZB 2A31A 1QGFA 3OTJE 1PPBH 1HCGA 1EOLA 2GGVB 3UREA 1AI8H 1YPJH 2GX4A 3UWIA 2B5TB 1C1UH 1W11U 1N6XA 4NSYA 3A8CA 1AUTC 4RKOB 2VB0A 4WH8A 3GY4A 1ZGIA 3ENSB 4XBCA 7ESTE 3FAOA 3GDSA 2FDAA 5C67A 1S81A 4KP0A 1HJAC 1G32B 1EKBB 2GZ7A 4U32A 3SGAE 4CRDA 2WUCA 2ZU2A 1HAPH 3RXRA 4FU7A 3STJA 4Q7ZA 3L33A 2FTLE 8KME2 4WXIA 1AFQC 2BD7A 1ANEA 3LC5A 3SUEA 1T8OA 4H42U 1ELGA 1Z8RA 2OD3B 3PO1B 4D7FA 1P2JA 1ACBE 1GMHG 1GDQA 1P05A 5ETXA 4ZH8A 1SGEE 1QRXA 2AGIX 1C5RA 4J2YB 1O2LA 1NROH 5DP9A 1TYNA 3TVJB 1UMAH 3FP8E 2Y82A 4YESB 4Y10E 1V2UT 1S0QA 3P95A 4YOIA 1FAXA 1RGQA 5EG4A 2PGBB 3UR6A 1YPHE 2XW9A 4ZXYH 2AH4X 4BXSA 1CHGA 1GJ7B 1VCPA 2OC7A 3MU8A 2ZTYA 4AZ2B 1DVAH 4LXBH 4ISNA 1ELVA 1FY8E 1SGFA 1ZJKA 4F49A 1SLWB 2CXVA 1P9SA 2GCHF 2XWBI 1V2ST 1TMTH 4Y8XA 1SFIA 2IN2A 4BTIB 1GI6A 4ABAA 1O38A 2F9VA 1V2TT 1LVMA 4O03A 1VGCC 4IW4E 1EAWA 3IITA 4BNRA 2G5VA 2WUBA 3HATH 2AGEX 3L3TA 3KQCA 3QO6A 1ZSJA 1BTYA 2IJOB 2WPKS 4JZFH 1GL0E 1NRSH 4ABEA 3E90B 3D23A 4MDSA 3V3MA 1W7XH 4CRAA 1V2RT 1SMFE 3VEQB 4A1VA 3RXPA 1D3PB 3SQEE 1UVOA 1TPPA 4WXVA 3SNAA 2OINA 2C8ZB 2ZKSA 1GBFA 1H9HE 3PWBA 1J9CH 1CBWB 3SU5A 1AQ7A 1BMNH 1MAXA 2UUKB 1NFXA 1QRWA 3ATIA 4NA9H 4NIWA 1TGSZ 3E0PB 5GWZA 1QY6A 2WPLS 2BY6X 2CF8H 1MH0A 1XKAC 2Y5FA 4BTTB 1IHTH 1GBEA 3VB7A 1XXDA 1DITH 4X8VH 3MU5A 2VH6A 4MPXA 5E0JA 1X7AC 4FVBA 2O8UA 2QXGA 1GMCG 4I8HA 4D76A 2VIVA 1G3CA 1OPHB 2VIQA 3ODFA 1C2KA 3B9FH 1L1NA 1YP9A 4Y11E 1WOFA 3CS7A 3TH2H 4OS2A 5A8ZA 4ZHLU 1OSSA 2FLBH 1C5MD 1T8NA 2Z9GA 3HPTB 5CHAC 2QA9E 3RC6A 1IQHA 2ZU4A 5LPRA 1DANH 2ZCLP 4CRFA 6GCHF 1O3PB 2BLWA 1IQEA 1GBIA 1HPGA 3AW0A 2R3UA 3A80A 2UUJB 5IDKA 2ZFTA 1HDTH 5ESBA 3BTGE 4YM9A 3Q00A 1MCVA 3Q3XA 1TMUH 2BZ6H 2ZPQA 2XWAA 1FPCH 4K60A 2I6QA 1GHWH 1XMNB 1BTWA 1SGCA 1W13U 4FVDA 1TX8A 1TX7A 1GVZA 2PKAA 2BD5A 1L4DA 1EX3A 1C2LA 1H8DH 2FOBA 2GDDA 2WV4A 3SQHE 1BTUA 5FPSA 1TABE 1Y3WA 1A1RA 3VB6A 4Y8ZA 1SFQB 3OYPA 1LQEA 1Y3YA 3RXHA 2AIPA 2C8XB 1VCQA 3GY2A 4NWKA 4AORA 1P10A 1SGYE 6LPRA 3NCLA 1MTNB 2WYJA 1YLCA 3HGPA 1NO9H 2ODPA 3PWCA 1UHBB 5EW1H 2OC0A 4CR5A 1Z1JA 1LHEH 1HXFH 1DY8A 1YPMH 2ZZUH 5FCRA 3SGQE 3FVFB 3K6ZA 2PKSB 1QJ6B 1C4V2 4WJG2 3A7TA 2F9PA 2BQ7B 5CMXH 3V0XA 8GCHF 1ZTKA 5EGMA 1CU1A 3QGNB 4YTAA 2PKSC 1QJ1B 4XFQA 4AB8A 3ATLA 2VINA 1D3TB 1GBJA 5T6FA 3UNQA 2ZFSA 2VVVA 1DFPA 2O9QA 3RMMH 3RXKA 2BYAX 1AD8H 4B71A 1G3DA 1NTPA 1THRH 2D26C 1S6FA 3SNEA 1KXEA 1WYKA 3EE0B 5A0CA 3OSYA 1FY5A 3RC4A 4ZHMU 1BMAA 5B6OA 2NU1E 3D49H 1GBHA 1T7CA 1H4WA 3KN2A 3TPIZ 1YC0A 1WTGH 2CV3A 2FS9A 3O8DA 1EZSC 1GG6C 4XBDA 2ALPA 1G36A 4X8TH 3SW2B 3T27A 1PPFE 3RXOA 2P16A 3U8TH 4D9QA 2BVXH 3MH4A 3F9FA 3H7TA 3VGCB 5F8XA 1QL7A 4A5TS 3M7UA 2BOKA 2R2MB 3SU4A 3GYMA 4I8LA 2ZCKP 3TGKE 1PQ7A 2XC4A 4DIHH 2HNTC 2BQ6B 3RLWH 4UE7H 1HV7A 2FIRH 2J34A 5E2OA 1XUKA 1CHOF 4MG3A 2STBE 1O34A 1O36A 1SGTA 3QZQA 1KLJH 1NU9A 4KTUA 1GHZA 4I8KA 2FODA 5DO4H 1CA0B 1HAXB 2ANWA 4K1TA 1FN6A 2TPIZ 4Z6AH 1QQUA 2CHAB 4YT7H 2SGQE 5K7RA 4Y0YE 3M36A 3PV4A 1BHXF 2HLCA 1EATA 1F2SE 1BTHH 1P2NA 2QXIA 3GISB 3AAVA 2VWLA 1EQ9A 1XXFA 2ZF0H 1FNIA 4X6PA 4CHAB 4K2YA 4K69A 3TJNA 2PTNA 1MD8A 2OXSA 1B7XB 1VITG 2W3IA 2BY5X 1W7GH 3S9AA 4LOYH 2PR3A 1ZRKA 1QBVH 1M9UA 1LO6A 2DE8A 2FTMA 4IC5A 1P02A 1C2MA 1Z1IA 5TCCA 2VGCB 1W0YH 3ITIA 3IWMA 3M3SA 4B2CA 1OWHA 1G2MA 1G30B 4XDEA 4JCNA 1WCZA 1F0SA 2J4IA 2J9NA 2WPMS 1SSXA 1UTKA 1DSUA 2GZ8A 4ZXXH 1CA8B 1C5ZB 1O3GA 2ANMH 1RS0A 1ZPCA 1LVBA 1BMMH 1C1SA 3EA9A 1AUJA 1E0FD 1Q31A 3K65B 4AGKA 1ZHMA 1JIMA 4I31A 1C2GA 2ZDVH 1SGDE 1QBNA 3MNXA 8ESTE 5AF9H 1SL3A 1QURH 1BOQA 1HAYB 2FOEA 5I25A 1TLDA 2FI4E 3SJ9A 2AMPA 4QT8C 4E06H 3BEUA 1DE7H 1YYY1 3BTTE 3ZVAA 1CE5A 2BVSH 2P93A 1Y3XA 4ASHA 4LK4A 1KLTA 2ZHFH 3E0NB 2ZEBA 3MNBA 3S7KB 1BIOA 2R9PA 4YO9A 1AZZA 1HAVA 1JOUB 2ZQ2A 1O2PA 1CGJE 1GI2A 2CMYA 4AGJA 5T3HA 1DPOA 2F9OA 3B23B 3RXMA 2QGRA 2W5EA 2J2UA 1G3EA 2A0QB 1BDAA 3FANA 1HAVB 4UEHH 3JZ1B 3MH6A 2P95A 1O3FA 4YLQH 3M61U 3SV7A 1F92A 4CHAC 1UTJA 1GHVH 1LVYA 1VJ9U 3ZZDA 3HK3B 3DD2H 3ZV8A 3O8CA 3SN8A 5EQRA 3TU7H 1AFQB 1GMCF 1B5GH 2A2QH 1YCPH 1O35A 4ZROA 1W8BH 1GJAB 1XVOA 4ABFA 5GCHG 1Z6JH 1EJNA 2ZFRH 3BIVH 4FUFA 5EU8A 1L1JA 2VGCC 1AIXH 1N8OC 1BCUH 1BBRE 2B0FA 2JETB 4Y8YA 1AWFH 3GCTF 4UFGH 4DT7B 1NZQH 1TIOA 3RXTA 3O8RA 4X1RU 4ABGA 3GY6A 3S7HB 4UDWH 2STAE 1B0EA 1O32A 3UTUH 2G51A 1EJAA 3MFJA 3RXEA 2OP9A 2BD2A 2J38A 3A84A 2CHAC 1D4PB 1F0TA 1GBDA 4DY7B 2ZI2H 3ZZ5A 1BHXB 3BSQA 3HKJB 1EPTB 1O2SA 5H4IB 2WPIS 3PTNA 2B7DH 3DFJA 4AB9A 3UIRA 1DX5M 2ZDNA 1OWEA 2WPHS 1TOMH 1TQ7B 4GCHF 5T6GA 2JKHA 1MAYA 1ESTA 3MO3A 1CVWH 1MD7A 1HAIH 3GDUA 2VJ1A 5FX6A 5A0AE 2ZA5A 1DXWA 1TRYA 4GCHG 1QB1A 1C5XB 2SGDE 2F3CE 1SC8U 1AKSA 4IN2A 2BB4A 1VZQH 3DHKH 3RMLH 2BOHB 1C5NH 5AFZH 1O30A 3A87A 2G5NA 1EZQA 2BLOA 2BY9X 1C9PA 4UONA 1DUEA 1FIWA 2TGAA 3EDXB 1GVLA 2Q6DA 9LPRA 1MQ6A 1OWIA 4K1EA 4X1NU 1IQIA 3SJIA 3BTFE 4YLUA 2H9TH 3RXQA 3SORA 4AOQA 3RXCA 1NFUA 3GY8A 3FFGA 1JXPA 1Z8JB 1GI4A 3MHWU 5BRRE 5G4BA 3U1JB 1SQTA 1ANBA 3FZDA 5DPAA 1NPMA 1F0RA 1GI8B 1DWEH 3A7WA 3MI4A 2AMQA 3GICB 3RM0H 1BUIA 3A85A 1CSOE 3LC3A 3SJ8A 4GLYA 4XE4A 1Y5UT 4B2BA 2PSXA 2H6MA 3UNRA 1UTLM 1IQKA 1FPHH 3MNSA 4OGXA 2QF0A 4MNVA 2H9HA 2R0LA 4LZ4B 1CA0C 1ELCA 1ZHRA 3A81A 1EP5A 1EPTC 2XBXA 4FXGH 5J4QA 3KCGH 1LTOA 3D65E 2GVFA 1UVTH 4INLA 2KAIB 1YPLH 5FBEA 1PQ8A 2QIQA 1RD3B 1AVWA 2PFEA 3ESTA 3UPEA 4TY7A 3AW1A 2ZGXH 2ZHEH 1DY9A 3QGJA 2G55A 4RSPA 2QY0B 1ZMNA 2W26A 1UTMA 3SHCH 2FEQH 4X0WU 2NU2E 1TOCB 1SHYA 1ZSLA 2UWOA 1GWAA 1XUGA 4DOQA 4U2WA 4MQAA 3RM2H 1K1PA 2A4OA 3ODDA 4FUHA 2BY7X 3KQBA 3M7TA 2AERH 2D2DA 2HNTE 4I8GA 5T6DA 5HYOA 1E35B 5JBAS 2ODYB 1A0JA 5GIBA 3I78A 4THNH 2QC2A 1MKWK 1ARBA 1SVPA 1MBQA 1UK4A 2O8MA 2HRVA 1TNGA 4Y7BA 3VFEA 4TWYA 4AYVB 2A5IA 5BPEA 3MH5A 1LHCH 1HJ9A 4X1QU 1EAUA 3V7TA 3L6PA 4INKA 2HPQH 5L2YH 1C2EA 4I7YH 4DIIH 1XUHA 4JYTA 4B73A 4ISIH 7GCHF 3P70B 3DUXH 3BTME 3BEIB 2FESH 1AKSB 1GI9B 1QA0A 3FP7E 3S69A 1DXPA 1SPJA 3K2UA 4NCYA 1AMHA 1HNEE 1GHBG 2ZNKH 1GJCB 2P3FH 2QN5T 1DUAA 3Q76A 3JZ2B 5EPNA 3KEEA 3P8GA 2FS8A 1UCYE 3U98H 3S9BA 1QRZA 1F5KU 1UK2A 2BD8A 1Z7KA 4X6NA 2FWWA 1E37B 5FPYA 1O2IA 1FY4A 3EA7A 3ELAH 4Q2KA 2Y6TA 1W10U 3C27B 4WWYA 1FONA 1DWDH 1CT0E 4E05H 3QZRA 1O3KA 1XUIA 2CJIA 1FY1A 3F9GA 3TJUA 4FUDA 4D7GA 3LKWA 5LH8A 1ANCA 4BAMB 2LNCA 1GJDB 1P3EA 4Y6DA 3A7XA 5GXPA 4X6OA 1MU8B 4UFFH 2ZP0H 4H6SB 1A46H 1KXAA 1OYTH 1YPGH 1ELAA 2A5AA 4D8NA 2ZU5A 2TIOA 1BBRK 1O2YA 4GHQA 1THPB 5DJ7A 1Y5AT 2FX4A 1O3DA 3KQEA 1TA6A 1V2LT 5HM2A 5E0GA 3ZVGA 2PW8H 2C3SA 1DDJA 2XXLA 1BT7A 1D6WA 3VB4A 1J17T 2XBWA 1G2LA 3UY9A 3TNSA 6CHAC 3MH7A 2VWOA 3KNXA 5A09A 3BIUH 5EOKA 1BTZA 3A7YA 1GPZA 4X1PU 3TGJE 1MTUA 5GPIB 5K0HA 4E7NA 1UVSH 1SQOA 3MNCA 2WPJS 2P3TB 3HGNA 1KSNA 1NM6A 1GI1A 1GHXH 5FX5A 1UCYH 2K1QA 2M5TA 4WF8A 2ESTE 4DGJA 3LH1A 4ISHH 1TGTA 3A7ZA 1GJBB 2GT8A 2SNWA 3U9AH 4J1YA 4H6TA 2EC9H 1MTWA 3LGYA 3NK8A 3MO6A 1JBUH 5EQQA 1ETTH 3RP2A 3S9CA 3E1XB 1O3OA 1TNHA 1GBTA 2O8WA 4NA8A 2HPPH 4FUJA 3A89A 2ZGCA 2FOMB 1S5SA 1YLDA 3EGKH 1LHGH 1TNIA 3GY3A 3ZZ3A 2JH0D 6ESTA 1L4ZA 1UHBA 2OLGA 8GCHG 3IG6B 1O2TA 3CS0A 1VJAU 3ZVEA 1C5WB 1O2JA 4IBLH 1C5YB 1TPAE 1DWCH 1TRMA 2HNTF 5JBCS 1OWDA 2F83A 1NFWA 3GCOA 3ZZAA 5A2MH 2ZFQH 3A8BA 3LGWA 5A8XA 4A1TA 3EAJA 1QTFA 3VXFH 3NWUA 3EYDA 2PLXA 2GP9B 3LOXA 2A5KA 3GCHC 1TE0A 1Z8IB 1BTXA 2TGPZ 3WY8A 3U1IB 2PKAB 1C1QA 2FI3E 2BD4A 4DG4A 3H5CB 4SGBE 1S85A 1FQ3A 4UFEH 5FBIA 1IQLA 1TA2A 5DP8A 3QK1A 1OKXA 4GVUA 1UJ1A 1RFNA 2Y7ZA 4NZQA 1C2HA 2SNVA 7LPRA 3SHAH 1TRNA 4INHA 3E3TA 4K8BA 1KXCA 3RU4T 1BJVA 3A8DA 3QWCH 1HIAA 1O2NA 2A7JA 2C8YB 3ZZCA 3Q3KA 1NT1A 1K21H 2WV5A 2A7HA 3PMBB 1EASA 4AG2A 3RMOH 2GMTB 2VNTA 1DT2A 2OCVB 4ABJA 4NSVA 3URCA 1WUNH 1TQ0B 2H5CA 4FUBA 1PPEE 4GUXA 3Q3YA 1K1JA 2PUXB 3HK6B 3SUFA 1J8AA 3PB1E 3F9HA 4IGDA 1KIGH 1TWXB 1SGIB 3HKIB 3GY7A 1AY6H 1MTSA 4HZHA 4TPYA 3QUMP 4BAOB 2GKVE 4R8TB 2TRMA 1LHDH 1T4VH 4ZMAH 1H1BA 1EUFA 2AGGX 4O3UA 2UUFB 4F4OC 1O2HA 4MTBA 1NY22 1ZTJA 2V6NA 3BTKE 2B9LA 2OQ5A 1ARCA 4R0IA 2PWXA 1P12E 3SI3H 1O3HA 1O5FH 2ZHQH 1QHRB 4BANB 2FOCA 3GCHB 1CT4E 1MZAA 1XX9A 1SLXB 1QIXB 4FU9A 3K6YA 1E34B 2XC5A 3LH3A 5CE1A 2VIDA 4IS5A 1GVKB 1WQVH 1C1OA 1FUJA 5FAHA 1SGFG 1O2QA 2A4QA 1F7ZA 1VITH 1ZYOA 1O3IA 2RCEA 1CT2E 3BEFB 3LGUA 1MKXH 2QAAA 1RIWB 4ESTE 1C2JA 1NC6A 3P6ZB 4O9VA 2Z6BD 2XCNA 4X1SU 4WMFA 1ELBA 1LVOA 3BTDE 3W95A 1B0FA 1SB1H 2WINI 2BLVA 2ZC9H 3C1KA 3A83A 1SLUB 3RU4E 5HGGA 2GMTC 1NS3A 1O5EH 3DT0H 2DUCA 4MVNA 2SGEE 2I6SA 3ATWA 1UCYK 2VVUA 4ZKOU 1HLTH 1OWJA 3SBKA 4SGAE 1GBLA 3AASA 4XSKU 1C2FA 1P09A 3T29A 2D1JA 2LPRA 1A61H 1RTKA 1TBRH 1TFXA 1QCPA 1QFKH 1WU1A 3RXUA 1P03A 1RJXB 1ELEE 2GTBA 1XM1A 2BX4A 1MCTA 1ANDA 3UQVA 1P2MA 4Y0ZE 3PROA 1HB0B 1AN1E 2ZHDA 2EEKA 2V0BA 4OS6A 1Q3XA 3SJKA 2Z9IA 2V3OH 3TH3H 1BITA 1LPGB 5JBTA 2RDLA 3EA8A 3BF6H 1W12U 1YBWA 4WMDA 3UQOA 5JB9S 2ILNA 1GBCA 1Z8GA 1A3EH 2FP7B 1ZR0A 1ZLRA 2Q6FA 2YOLA 3LU9B 4X6MA 1QBOA 2PHBA 2R0KA 2FOHA 2BX3A 2ZTZA 3PMAB 5AHGH 4E7RG 1ELDE 2BQWB 1ABIH 1PPHE 3OY6U 2ZFPH 3SZNA 4WH6A 3BG8A 4AYYB 5E0HA 1CBWC 1K1MA 3KHVA 1KYNA 4X8UH 2SGAA 2ZU3A 4JYVH 3RXIA 5DGJA 4ABBA 1NFYA 3PYHA 4Q7XA 1ZRBA 3U8OH 1O3EA 3OY5U 1EB1H 1O2OA 1SGQE 3NKKA 1A7SA 1MU6B 1ZMJA 5E2PA 3P8NA 2PV9B 1T31A 4K8YA 1ZSKA 1A3BH 2ANYA 4KTSA 3H7OA 2Z3CA 4JYUH 2AIQA 1QNJA 3BTEE 1GJ8B 3PLBA 3PM3A 1TPSA 1QA7A 3I77A 3ZZ6A 2ZCHP 3SNBA 1E36B 2PSYA 2BZAA 2BDBA 1INCA 1O2GH 4A7IB 1P11E 4Y7AA 3F9EA 2A4RA 5C3NA 5C1YA 1ZGVA 3TJVA 1XKBC 3F1SB 1HAZB 1SOTA 5I46H 4AFSA 4CR9A 1LPZB 1FXYA 3GCNA 2H5DA 1TBZH 3T25A 3P17H 1VGCB 3T5FH 2SGFE 1PPCE 1O2UA 1PPGE 2G81E 2SGPE 1HRTH 1GI0A 5F8ZA 4BTUB 1KDQA 2ZDAH 1HBTH 2ZIQH 1OP2A 1Z71A 3SU6A 1O5DH 3TK9A 4JZIA 4BAQB 1AFEH 3ZVDA 3ZZ9A 1GHAG 1O0DH 3M5OA 4ZKSU 3TLOA 3RXJA 1GJ4H 2BMGB 2BHGA 1NN6A 1EXFA 3RUOA 1F5LA 3A7VA 3SGBE 1NESE 2P3UB 1GHBF 1S82A 3MWIU 1OXGA 2B8OH 1TNKA 2ALVA 3SV8A 4CREA 3BTHE 3RXDA 3RXLA 1E38B 5DP5A 3MU4A 1SR5C 2NU3E 3QTOH 4NZLA 3MTYA 3V13A 1UK3A 4GPGA 1BTPA 4BXWA 3ATMA 3SUDA 1P2KA 2XCFA 4OS4A 1IOEA 1WV7H 1O5AB 2VIOA 1ZHPA 4OGYA 1LMWB 4XOJA 3SJOA 2ZECA 1D3QB 1MBMA 1A5HA 2Z9KA 1YCPM 2GD4B 1AE5A 3UNSA 1PYTD 2O8LA 1GDNA 3E6PH 1WBGB 2BDIA 1FIZA 2IOTA 1PPZA 1IQMA 3SU1A 4ABIA 2FO9A 1FMGA 1YM0A 2VWMA 1HYLA 1TGBA 4K3JA 1NRRH 1UVUH 2BD3A 4NG9H 2PGQB 1AE8H 4B75A 4JMYA 2FLRH 3T62A 5C2ZA 2UUYA 4CBOA 1GBKA 1XUJA 3TIUA 1BJUA 3TK6A 2H2ZA 2EA3A 1LHFH 1WAYB 1Y59T 4WMEA 1JWTA 1OS8A 2OUAA 2R2WU 5SGAE 3P8OA 3T28A 5DP7A 2GCTC 2QXJA 3SNDA 1C1RA 2BLQA 1EB2A 1EOJA 2HALA 4O3TA 2ZDKA 4GHTA 1TX6A 3LGTA 1O2RA 2Z9JA 1U6QA 1S0RA 1LQDB 2NU0E 3EQ0H 1THSH 3QDZB 1ESBA 2ANKH 3T26A 3OU0A 3T2NA 1AU8A 4Q7YA 1C5TA 1GCDA 1A5GH 1GG6B 1O3JA 1OYQA 1C5VA 2FOFA 1SQAA 3TGIE 1AGJA 1V2WT 2ZU1A 1Y3UA 3V12A 1MQ5A 4ISOA 3URDA 1BQYA 1K28D 1MMJN 1P06A 1SGRE 5AFYH 3VGCC 4ABDA 1YGCH 1O2ZA 1TGNA 1ELTA 1UTPA 3BN9A 5CHAB 1V3XA 6GCHG 1BBRH 4MPUA 3F6UH 1D3DB 1D6RA 3PO1C 5DP4A 4YOJA 2ZFFH 1LDTT 2BTCE 2ZG0H 2C93B 1HAOH 1HFDA 1OP0A 1O2VA 5J4SA 1IQFA 3MO9A 5IYTA 5C5NA 2VIWA 1L2EA 4X8SH 1TNJA 4BAKB 1FV9A 1C5UA 2G00A 2ZGJA 4UFDH 1Q2WA 4MNXA 3TJOA 1P9UA 1TONA 4PROA 3RC5A 4X2XA 2EI7A 4I33A 5AVDA 5GCHF 4X2VA 1XUFA 1QB9A 1KY9A 1OX1A 1T32A 5EXLA 1DICA 2QV1A 1C1MA 1GJ5H 4AG1A 1T8MA 4UD9H 4X2YA 1YPKH 3I29A 2QF3A 4IMQA 3KIDU 3A88A 1JIRA 4WY3A 3UFAA 1DWBH 1GGDB 1GBMA 3ZZ4A 4B76A 1K1OA 1ETSH 1XVMA 3LONA 4JZEH 1TNLA 1ORFA 2J92A 4KELA 1P01A 3BTQE 1JRTA 2NWNA 3LGIA 1MKWH 3STIA 1PYTC 1V2JT 4IC6A 1HAHH 3TNTA 2ZPSA 4NGAH 1IQJA 3B8JA 5C20A 2Z94A 1YKTA 1K2I1 2C90B 3RXBA 5PTPA 1V2VT 2O8TA 3BG4B 1F5RA 3ZVCA 3TK5A 5TJXA 5GJ4B 4Z0KA 2ZTXA 2ASUB 1O3NA 1ZTLA 2FOAA 3S0NA 2UWPA 1TAWA 4NWLA 1SHHB 1ELFA 2ZO3H 3A82A 3UOPA 3MU1A 1C1NA 3SO3A 4K1SA 1AB9C 1UTNA 3ZYEA 1UTOA 4O97A 2RA3A 5LGOA 1NRNH 4FUIA 2CGAA 4HI3A 2AFQB 3MYWA 1BRUP 1RTLA
chains in the Genus database with same CATH superfamily
1KXFA 2BDGA 1A2CH 4BAHB 2VVCA 1GI3A 1V2OT 1BRCE 1D9IA 4Y79A 2FI5E 1QL9A 1ZMLA 3KF2A 1UVPA 1K22H 3KQDA 1A5IA 1GJ6A 5DP6A 4B6EA 5DK1A 5FHTA 1P2OA 3SU2A 2J5UA 5DG6A 2VH0A 4VGCB 3RXVA 3AVZA 3U8RH 5B6LA 1C5LH 1CQQA 4DW2U 1BZXE 4CBNA 5ESTE 1ZPBA 4VGCC 5GDSH 2H1UA 2OBQA 4KKDA 1IAUA 1V2QT 6CHAB 2ULLA 2A2XH 1HIAB 4KTCA 5FXLA 2BXUH 4AN7A 1O37A 4BOHA 5EW2H 1K9OE 2XRCA 4Q80A 4U30A 1GL1A 4WVPE 1AVXA 5C1XA 3SV9A 5JYIA 2EI8A 2OC8A 1MUEB 5EXNA 2BD9A 4DURA 2Y80A 3U69H 4ZUHA 3ATKA 1GHAF 3FZZA 3GY5A 5JDUB 1QL8A 1KTSB 2Y5GA 3PMJA 5DP3A 1C5QA 5EODA 1HJ8A 4RT1A 1EAIA 2QF5A 1C4Y2 2ZPRA 1LKBA 1AB9B 2GJGA 3GCTG 4DCDA 2J95A 1UTQA 2IJD1 5JPMH 7GCHG 1CHOG 3BG4C 7KMEH 1FN8A 3ZZBA 3N7EA 3GDVA 3OE7D 1T8LA 2ZQ1A 3Q77A 1G3BA 5HM9A 3RLYH 3ZVFA 1SBWA 3LJOA 1TBQH 1SI5H 1K1NA 1RTFB 1O2KA 2ZGBH 2FYRA 1EFRD 3SI4H 2OC1A 2GV6A 3M37A 1TB6H 3FP6E 3GOVB 3SV2H 4U01A 1G9IE 2PTCE 1IHSH 2BDHA 4Y71A 3VPKA 1O5CB 1V6DA 2Z7FE 3CP7A 1OWKA 1AVGH 4AX9H 1N1LA 2IPHA 5L6NH 1DLKB 1MKXK 1O3AA 3MU0A 1CO7E 1IQNA 1P0SH 2D8WA 3E91A 9ESTA 1O31A 4CH2B 5EPYA 2HWLB 1MTVA 4MPWA 3ZZ8A 3DA9B 1JMOH 2TGTA 2NU4E 1GI5A 2P59A 1N8OB 2JETC 4TSFD 4YT6H 2GDEH 1O3LA 3LDXH 4ZKNU 1KDQB 3W94A 3QTVH 3ZV9A 2P94A 4TWWA 3AAUA 1KXDA 4I32A 1DM4B 2FM2A 4TPIZ 3RXSA 2XYAA 1HJAB 3FKSD 2F9NA 3LJJA 3E8LA 1F0UA 1NU7B 1TALA 1C5OH 1V2PT 1C1WH 1ESAA 2OBOA 3KYGA 4GSOA 1WDIA 3SOSA 2XBVA 1C1PA 2Q1JA 1FI8A 4GAWA 3NZIA 2JJ1D 3SUGA 1GGDC 1BB0B 1GMDF 3ZVBA 5KGOA 2HGTH 3P8FA 1HAGE 1NRPH 4A1XA 3M3TA 2DE9A 3FO8D 5C17A 2KAIA 3UUZA 3RDZA 5EJLA 3G01A 2FMJA 1Y3VA 2W7SA 2ZDMA 3N7OA 2VU8E 1RXPA 3ZYDA 1H9IE 4ZHAA 3F68H 1K0HA 1GBBA 1RRKA 5F6MA 1O3MA 1P2QA 2XNIA 1GMDG 1O3BA 1C1TA 4TYDA 4ABHA 3PLKA 2PUQH 2FPZA 1Z6EA 2BY8X 5LPEA 2FXRA 4DVAU 3M5MA 2ZHWH 1AWHB 3MMGA 2BDAA 1CGHA 1FZZA 3D62A 1EZUC 1O39A 2HOBA 2Z3EA 2FX6A 2KZ4A 4MLFB 3SNCA 4IN1A 1GHYH 2J94A 3TITA 2F9BH 1P8VC 5EXMA 1AZ8A 1KXBA 5HXFA 4JK6A 2SFAA 1MZDA 5JBBS 1P3CA 2G4TA 3TH4H 1G37A 1SLVB 5ABWA 1ZPZA 5DSFA 3SU3A 2THFB 1S6HA 1S84A 2HVXA 4Q4LA 2P8OB 1A0HB 1LPKB 1O2WA 2XTTB 1V2KT 1N6YA 2TGDA 3M5LA 2BXTH 1WSSH 3LT3A 1L0ZA 3A86A 1QB6A 1HGTH 4I8JA 2JDID 4IMZA 1HXEH 1QJ7B 1IQGA 1J14A 1SOZA 2OQUA 3SU0A 1LCYA 4AFUA 1WTHD 1FY3A 1GMHF 1W2KH 1SGPE 4JZDH 5EQSA 3RMNH 5JB8S 3BTWE 1W14U 1SGNE 3FOAA 3BV9B 2QXHA 3UR9A 3RXFA 4AFZA 4ISLA 1O5GH 2CN0H 4B2AA 1DS2E 2JH5D 3A8AA 4OS5A 4HTCH 1C2IA 1C9TA 4CH8B 4OS1A 1BRAA 2BDCA 4NIYA 1O5BB 1QQ4A 4FU8A 4NIXA 1P2IA 3R0FA 1OHHD 2GV7A 5C5OA 1OP8A 1Y8TA 1TMBH 5LPFA 2W7UA 3VB5A 2EI6A 2G52A 1E1QD 3CENA 2WYGA 4B74A 4ZKRU 2FYQA 1YPEH 5E8EH 5F8TA 2QYIA 3OX7U 1S83A 1BA8B 2AS9A 1EAXA 4FUCA 2UWLA 1ABJH 3DFLA 1ZOMA 2A1DB 2A32A 1GJ9B 1BRBE 1YPHC 1C4U2 2F9UA 1DLEA 2BVRH 1DOJA 4JK5A 1PQAA 4A92A 2HLDD 1P04A 3M3VA 2YNBA 2GCTB 4M7GA 2VIPA 1PJPA 4XBBA 4TY6A 1YCPK 3K9XB 3MOCA 3UWJH 4CRBA 1CGIE 1W0JD 1O2XA 1H9LB 2A7CA 1TPOA 3KYFA 4AFQA 4FUEA 2Q6GA 1TGCA 4OS7A 4JZ1A 1W0ZU 2G4UA 4NIVA 2K0QA 3RXGA 2V3HH 1ID5H 3M7QA 3R3GB 1MTNC 3M35A 3UOUA 2JH6D 1PFXC 4Y76A 3O8BA 3RU4D 5FCKA 1L1GA 2YNAA 2QCYA 2QE7D 2G8TA 2WHXA 4D9RA 3NPSA 4NFFA 3VB3A 1ZZZA 4YOGA 5HMAA 4CRCA 3KGPA 1HUTH 2ZGHA 4KGAA 1AO5A 1C5SA 1Y5BT 2AYWA 1FDPA 4B1TA 2ZWLH 4NFEA 1YF4A 2A4GA 1UO6A 5CHBA 1FJSA 2OTVA 1C2DA 1ETRH 3GYLB 1VITF 3F2GA 1GCTC 3KL6A 2BDYA 1LKAA 1GDUA 1V2MT 1V2NT 1GBAA 4K5ZA 3LIWA 4DT4A 1A4WH 3PMHB 4X2WA 1GCTB 5L2ZH 4RN6A 2TBSA 5A0BA 1ZJDA 2VWNA 2GCHG 5TCAA 2Y81A 2C4FH 4H4FA 4LZ1H 1C5PA 1EJMA 1K1IA 4YZUA 2V7QD 1O3CA 1VR1H 1NRQH 2H9EH 5A8YA 3PLPA 2ODQA 1PQ5A 3M5NA 4CRGA 1SG8B 1COWD 2GT7A 1A0LA 1H8IH 2Y5HA 3LGVA 1K1LA 2XBYA 2P8OC 2GZ9A 3QN7A 1EPTA 2BM2A 2FOGA 4MNYA 1T4UH 1J16A 1BMLA 1P57B 4ZAEA 2XC0A 3ZZ7A 2Z9LA 1DSTA 3VXEH 2AMDA 2AEIH 3RXAA 4HFPB 1QR3E 1W3CA 4FUGA 1VCWA 3OEED 2ZDLA 2Z3DA 1C1VH 2A45B 2W3KA 4A6LA 2V35A 2CF9H 4RKJB 1J15A 1FLEE 8LPRA 1EZXC 3NUMA 3QLPH 4MPVA 4HGCA 3SV6A 3PTBA 3LPRA 3CNRA 1GI7B 1O2MA 1RIWC 4MNWA 2FZZA 2RG3A 2KCOA 3NXPA 3QX5H 3E16B 1NBME 1WQSA 5DKMA 2Y7XA 5L30H 1JRSA 1O33A 2CK3D 5FPTA 1AHTH 5F03A 1EP6A 1KLIH 1KTTB 1OOKB 4NA7A 2F91A 2RA0A 3P92A 2R3YA 5C1UA 2F4LA 1FAKH 2C8WB 2WSSD 4DJZB 2A31A 1QGFA 3OTJE 5EJZA 1PPBH 1HCGA 1EOLA 2GGVB 3UREA 1AI8H 1YPJH 2GX4A 3UWIA 2B5TB 1C1UH 1W11U 1N6XA 4NSYA 3A8CA 1AUTC 4RKOB 2VB0A 4WH8A 3GY4A 3UAIC 1ZGIA 3ENSB 4XBCA 7ESTE 3FAOA 3GDSA 2FDAA 5C67A 1S81A 4KP0A 1HJAC 1G32B 1EKBB 2GZ7A 4U32A 3SGAE 4CRDA 2WUCA 2ZU2A 1HAPH 3RXRA 4FU7A 3STJA 4Q7ZA 3L33A 2FTLE 8KME2 4WXIA 1AFQC 2BD7A 1ANEA 3LC5A 3SUEA 1T8OA 4H42U 1ELGA 1Z8RA 2OD3B 3PO1B 4D7FA 1P2JA 1ACBE 1GMHG 1GDQA 1P05A 5ETXA 4ZH8A 1SGEE 1QRXA 2AGIX 1C5RA 4J2YB 1O2LA 1NROH 5DP9A 1TYNA 3TVJB 1UMAH 3FP8E 2Y82A 4YESB 4Y10E 1V2UT 1S0QA 3P95A 4YOIA 1FAXA 1RGQA 5EG4A 2PGBB 3UR6A 1YPHE 2XW9A 4ZXYH 2AH4X 4BXSA 1CHGA 3DCLA 1GJ7B 1VCPA 2OC7A 3MU8A 2ZTYA 4AZ2B 1DVAH 4LXBH 2KR7A 5HKKD 4ISNA 4Z1MD 1ELVA 1FY8E 1SGFA 1ZJKA 4F49A 1SLWB 2CXVA 1H8HD 1P9SA 2GCHF 2XWBI 1V2ST 1TMTH 4Y8XA 1SFIA 2IN2A 4BTIB 1GI6A 4ABAA 1O38A 2F9VA 1V2TT 1LVMA 4O03A 1VGCC 4IW4E 1EAWA 3IITA 4ZCNA 4BNRA 2G5VA 2WUBA 3HATH 5EIYA 2AGEX 3L3TA 3KQCA 3QO6A 1ZSJA 1BTYA 2IJOB 2WPKS 4JZFH 1GL0E 1NRSH 4ABEA 3E90B 5C94A 3D23A 4MDSA 3V3MA 1W7XH 4CRAA 1V2RT 1SMFE 3VEQB 4A1VA 3RXPA 1D3PB 3SQEE 1UVOA 1TPPA 4WXVA 3SNAA 2OINA 2C8ZB 5C0TA 2ZKSA 1GBFA 1H9HE 3PWBA 1J9CH 1CBWB 3SU5A 1AQ7A 1BMNH 1MAXA 2UUKB 1NFXA 1QRWA 3ATIA 2YMSB 4NA9H 4NIWA 1TGSZ 3E0PB 5GWZA 1QY6A 2WPLS 2BY6X 2CF8H 1MH0A 1XKAC 2Y5FA 4BTTB 1IHTH 1GBEA 3VB7A 1XXDA 1DITH 4X8VH 3MU5A 2VH6A 4MPXA 5E0JA 1X7AC 4FVBA 2O8UA 2QXGA 1GMCG 4I8HA 4D76A 2VIVA 3EE7A 1G3CA 2KX4A 1OPHB 2VIQA 3ODFA 1C2KA 3B9FH 1L1NA 1YP9A 4Y11E 1WOFA 3CS7A 3PV2A 4OS2A 3TH2H 5A8ZA 4ZHLU 1OSSA 2FLBH 3OFND 1C5MD 1T8NA 2Z9GA 3HPTB 5CHAC 2QA9E 3RC6A 1IQHA 2ZU4A 5LPRA 1DANH 2ZCLP 4CRFA 6GCHF 1O3PB 2BLWA 1IQEA 1GBIA 1HPGA 3AW0A 2R3UA 3A80A 2UUJB 5IDKA 2ZFTA 1HDTH 5ESBA 3BTGE 4YM9A 3Q00A 1MCVA 3Q3XA 1TMUH 2BZ6H 2ZPQA 2XWAA 1FPCH 4K60A 2I6QA 1GHWH 1XMNB 1BTWA 1SGCA 1W13U 4FVDA 1TX8A 1TX7A 1GVZA 2PKAA 2KCYA 3ZIAD 2BD5A 1L4DA 1EX3A 1C2LA 1H8DH 2FOBA 2GDDA 2WV4A 3SQHE 1BTUA 5FPSA 1TABE 1Y3WA 1A1RA 3VB6A 4Y8ZA 1SFQB 3OYPA 1LQEA 1Y3YA 3RXHA 2AIPA 2C8XB 1VCQA 3GY2A 4NWKA 4AORA 1P10A 1SGYE 6LPRA 3U28C 3NCLA 1MTNB 2WYJA 1YLCA 3F2HA 3HGPA 1NO9H 2ODPA 3PWCA 1UHBB 5EW1H 2OC0A 4CR5A 1Z1JA 1LHEH 1HXFH 1DY8A 1YPMH 2ZZUH 5FCRA 3SGQE 3H09A 3FVFB 3K6ZA 2PKSB 1QJ6B 1C4V2 2J98A 4WJG2 3A7TA 2F9PA 2BQ7B 5CMXH 3V0XA 8GCHF 1ZTKA 5EGMA 1CU1A 3QGNB 4YTAA 2PKSC 1QJ1B 4XFQA 4AB8A 3ATLA 2VINA 1D3TB 1GBJA 5T6FA 2EY4C 3GS9A 2ZFSA 3UNQA 2VVVA 1DFPA 2O9QA 3RMMH 3RXKA 2BYAX 1AD8H 4B71A 1G3DA 1NTPA 1THRH 2D26C 1S6FA 3SNEA 1KXEA 1WYKA 3EE0B 5A0CA 3OSYA 1FY5A 3RC4A 1MABB 4ZHMU 1BMAA 5B6OA 2NU1E 3D49H 1GBHA 1T7CA 1H4WA 3KN2A 3TPIZ 1YC0A 1WTGH 3F0OA 2CV3A 2FS9A 3O8DA 3VG8A 1EZSC 1VKYA 1GG6C 4XBDA 2ALPA 1G36A 4X8TH 3SW2B 3T27A 1PPFE 3RXOA 2P16A 3U8TH 4D9QA 2BVXH 3MH4A 3F9FA 3H7TA 3VGCB 5F8XA 1QL7A 4A5TS 3M7UA 2BOKA 2R2MB 3SU4A 3GYMA 4I8LA 2ZCKP 3TGKE 1PQ7A 2XC4A 4DIHH 2HNTC 2AHME 2BQ6B 3RLWH 4UE7H 1HV7A 2L6OA 2FIRH 2J34A 2K8IA 5E2OA 1SQRA 5C0UA 1XUKA 1CHOF 4MG3A 2STBE 1O34A 2WZQA 5CDFE 1O36A 1SGTA 3QZQA 1KLJH 1NU9A 4KTUA 1GHZA 4I8KA 2FODA 5DO4H 1CA0B 1HAXB 2ANWA 4K1TA 1FN6A 4B6FA 2TPIZ 4Z6AH 3SYJA 1QQUA 2CHAB 4YT7H 2SGQE 5K7RA 4Y0YE 4ACAA 3M36A 3PV4A 1BHXF 2HLCA 1EATA 1F2SE 1BTHH 1P2NA 2QXIA 3GISB 3AAVA 2VWLA 1EQ9A 1XXFA 2ZF0H 1FNIA 4X6PA 1QZ8A 4CHAB 4K2YA 4K69A 3TJNA 2PTNA 1MD8A 3AK5A 2OXSA 1B7XB 1VITG 2W3IA 2BY5X 2QF4A 1W7GH 3S9AA 4LOYH 2PR3A 1ZRKA 1QBVH 4XD7D 1M9UA 1LO6A 2DE8A 2FTMA 4IC5A 1P02A 1C2MA 1Z1IA 5TCCA 2VGCB 1W0YH 3ITIA 3IWMA 3M3SA 4B2CA 3SZEA 1OWHA 1G2MA 1G30B 4XDEA 4JCNA 1WCZA 1F0SA 2J4IA 2J9NA 2WPMS 1SSXA 1UTKA 1DSUA 2GZ8A 4ZXXH 1CA8B 1C5ZB 1O3GA 2ANMH 1RS0A 1ZPCA 1LVBA 1BMMH 1KMHB 1C1SA 3EA9A 1AUJA 1E0FD 1Q31A 3K65B 4AGKA 1ZHMA 1JIMA 4I31A 1C2GA 1YWUA 2ZDVH 1SGDE 1QBNA 3MNXA 8ESTE 5AF9H 1SL3A 1QURH 2IPQX 1BOQA 1HAYB 2FOEA 5I25A 1TLDA 2FI4E 2WV9A 3SJ9A 2AMPA 4QT8C 4E06H 3BEUA 1DE7H 1YYY1 3BTTE 3ZVAA 1CE5A 2BVSH 2P93A 1Y3XA 4ASHA 4LK4A 1KLTA 2ZHFH 3WW7A 3E0NB 5HIZA 2ZEBA 3MNBA 3S7KB 1BIOA 2R9PA 4YO9A 1AZZA 1HAVA 1JOUB 2ZQ2A 1O2PA 1CGJE 1GI2A 2CMYA 4AGJA 5T3HA 1DPOA 2F9OA 3B23B 3RXMA 2QGRA 2W5EA 2J2UA 1G3EA 2A0QB 1BDAA 3FANA 1HAVB 1YLNA 3JZ1B 4UEHH 3MH6A 2P95A 1O3FA 4YLQH 4AC9A 5KECA 3M61U 3SV7A 1F92A 4CHAC 1UTJA 1GHVH 1LVYA 1VJ9U 3ZZDA 3HK3B 3DD2H 3ZV8A 3O8CA 3SN8A 5EQRA 3TU7H 1AFQB 1GMCF 2W6JD 1B5GH 2A2QH 1YCPH 1O35A 4ZROA 1W8BH 1GJAB 1XVOA 4ABFA 2LELA 2JJ2D 5GCHG 1Z6JH 1EJNA 2ZFRH 3BIVH 4FUFA 5EU8A 1L1JA 2VGCC 1AIXH 1N8OC 1BCUH 1BBRE 2B0FA 2JETB 4Y8YA 1AWFH 3GCTF 4UFGH 4DT7B 2YMSD 1NZQH 1TIOA 3RXTA 3O8RA 4X1RU 4ABGA 3GY6A 3S7HB 4UDWH 2STAE 1B0EA 1O32A 3UTUH 2G51A 1EJAA 1H8ED 3MFJA 3RXEA 2OP9A 2BD2A 2J38A 3A84A 2CHAC 1D4PB 1F0TA 1GBDA 4DY7B 2ZI2H 3ZZ5A 1BHXB 3BSQA 3HKJB 1EPTB 1O2SA 5H4IB 2WPIS 3PTNA 2B7DH 3DFJA 4AB9A 3UIRA 1DX5M 2ZDNA 1OWEA 2WPHS 1TOMH 1TQ7B 4GCHF 5T6GA 2JKHA 1MAYA 1ESTA 3MO3A 1CVWH 1MD7A 1HAIH 3GDUA 2VJ1A 5FX6A 5A0AE 2ZA5A 1DXWA 1TRYA 4GCHG 1QB1A 1C5XB 2J97A 2SGDE 2F3CE 1SC8U 1AKSA 4IN2A 2BB4A 1VZQH 3DHKH 3RMLH 2BOHB 2F43B 1C5NH 5AFZH 1O30A 3A87A 2G5NA 1EZQA 4Q63A 2BLOA 2BY9X 1C9PA 4UONA 1DUEA 1FIWA 2TGAA 3EDXB 1GVLA 2Q6DA 9LPRA 1MQ6A 4P00A 1OWIA 4K1EA 4X1NU 1IQIA 3SJIA 3BTFE 4YLUA 2H9TH 3RXQA 3SORA 4AOQA 3RXCA 1NFUA 3GY8A 3FFGA 1JXPA 1Z8JB 1GI4A 3MHWU 5BRRE 5G4BA 3U1JB 1SQTA 4OM9A 5GNDA 1ANBA 3FZDA 5DPAA 1NPMA 1F0RA 1GI8B 1DWEH 3A7WA 3F2FA 3MI4A 2AMQA 3GICB 3RM0H 1BUIA 3A85A 1CSOE 3LC3A 3SJ8A 4GLYA 4XE4A 1Y5UT 4B2BA 2PSXA 2H6MA 3UNRA 1UTLM 1IQKA 1FPHH 3MNSA 4OGXA 2QF0A 3PRBA 4MNVA 2H9HA 2R0LA 4LZ4B 1CA0C 1ELCA 1ZHRA 3A81A 1EP5A 1EPTC 2XBXA 4FXGH 5J4QA 3KCGH 1LTOA 3D65E 2GVFA 1UVTH 4INLA 2KAIB 1YPLH 5FBEA 5T1VA 1PQ8A 2QIQA 1RD3B 1AVWA 2PFEA 3ESTA 3UPEA 4TY7A 3AW1A 2ZGXH 2ZHEH 1DY9A 3QGJA 3F3BA 2G55A 4RSPA 2QY0B 1ZMNA 2W26A 1UTMA 3SHCH 2FEQH 4X0WU 1WXRA 2NU2E 1TOCB 1SHYA 5EJ1A 1ZSLA 2UWOA 3MQKC 1GWAA 1XUGA 4DOQA 4U2WA 4MQAA 3RM2H 1K1PA 2A4OA 3ODDA 4FUHA 2BY7X 3KQBA 5IK2D 3M7TA 4ASUD 2AERH 2D2DA 2HNTE 4I8GA 5T6DA 5HYOA 1E35B 5JBAS 2ODYB 1A0JA 5GIBA 3I78A 3PV5A 4THNH 2QC2A 1MKWK 3F0PA 1ARBA 1SVPA 1MBQA 1UK4A 2O8MA 2HRVA 2YMSC 1TNGA 4Y7BA 4YXWD 3VFEA 4TWYA 4AYVB 2A5IA 5BPEA 3MH5A 1LHCH 1BMFD 1HJ9A 4X1QU 1EAUA 3V7TA 3L6PA 4INKA 2HPQH 5L2YH 2HVYB 1C2EA 4I7YH 4DIIH 1XUHA 4JYTA 4B73A 4ISIH 7GCHF 3P70B 3DUXH 3BTME 3BEIB 2FESH 1AKSB 1GI9B 1QA0A 3FP7E 3S69A 1DXPA 1SPJA 3K2UA 4NCYA 1AMHA 1HNEE 1GHBG 2XOKD 1GJCB 2P3FH 2QN5T 1DUAA 2ZNKH 3Q76A 4I86A 3JZ2B 5EPNA 3KEEA 2PP6A 3P8GA 2FS8A 1UCYE 3U98H 3S9BA 1QRZA 3NRLA 1F5KU 1UK2A 2BD8A 1Z7KA 4X6NA 2FWWA 1E37B 5FPYA 1O2IA 1FY4A 3EA7A 3ELAH 4Q2KA 2Y6TA 1W10U 3C27B 4WWYA 1FONA 1DWDH 1CT0E 4E05H 3QZRA 1O3KA 1XUIA 2CJIA 1FY1A 3F9GA 3TJUA 4FUDA 4D7GA 3LKWA 5LH8A 1ANCA 4BAMB 2LNCA 1GJDB 1P3EA 4Y6DA 3A7XA 5GXPA 4X6OA 1MU8B 4UFFH 2ZP0H 4H6SB 1A46H 1KXAA 1OYTH 1YPGH 1ELAA 2A5AA 4D8NA 2ZU5A 2TIOA 1BBRK 1O2YA 4GHQA 1THPB 5DJ7A 1Y5AT 2FX4A 1O3DA 3KQEA 1TA6A 1V2LT 5HM2A 5E0GA 3ZVGA 2PW8H 2C3SA 4ACBA 1DDJA 2XXLA 5FL7D 1BT7A 1YY3A 1D6WA 3VB4A 1J17T 2XBWA 1G2LA 3UY9A 3TNSA 6CHAC 3MH7A 2VWOA 3KNXA 5A09A 3BIUH 5EOKA 5HIYA 3FN8A 2OK5A 1BTZA 3A7YA 1GPZA 4X1PU 3TGJE 1MTUA 5GPIB 5K0HA 4E7NA 1UVSH 2L74A 1SQOA 3MNCA 2WPJS 2P3TB 3HGNA 1KSNA 1NM6A 3KQ5A 1GI1A 1GHXH 5FX5A 1UCYH 3N99A 2K1QA 2M5TA 4WF8A 2ESTE 4DGJA 3LH1A 4ISHH 1TGTA 3A7ZA 1GJBB 2GT8A 2SNWA 3U9AH 3UB0A 4J1YA 4H6TA 2EC9H 1MTWA 3LGYA 3NK8A 3MO6A 1JBUH 5EQQA 1ETTH 3RP2A 3S9CA 3E1XB 1O3OA 1TNHA 1GBTA 2O8WA 4NA8A 2HPPH 4FUJA 3A89A 2ZGCA 2FOMB 1S5SA 1YLDA 3EGKH 1LHGH 1TNIA 3GY3A 3ZZ3A 2JH0D 6ESTA 2RDEA 1L4ZA 1UHBA 2OLGA 8GCHG 4HG6A 3IG6B 1O2TA 3CS0A 1VJAU 3ZVEA 1C5WB 3WWBA 1O2JA 4IBLH 1C5YB 1TPAE 1DWCH 1TRMA 2HNTF 5JBCS 1OWDA 2F83A 1NFWA 3GCOA 3ZZAA 5A2MH 2ZFQH 3A8BA 3LGWA 5A8XA 4A1TA 3EAJA 1QTFA 3VXFH 3NWUA 3EYDA 2PLXA 2GP9B 3LOXA 2A5KA 3GCHC 1TE0A 1Z8IB 1BTXA 2TGPZ 3WY8A 3U1IB 2PKAB 1C1QA 2FI3E 2BD4A 4DG4A 3H5CB 4SGBE 1S85A 1FQ3A 4UFEH 5FBIA 1IQLA 1TA2A 5DP8A 3QK1A 1OKXA 4GVUA 1UJ1A 1RFNA 2Y7ZA 4NZQA 1C2HA 2SNVA 7LPRA 3SHAH 1TRNA 3DSPA 4INHA 3E3TA 4K8BA 1KXCA 3RU4T 1BJVA 3A8DA 3QWCH 1HIAA 1O2NA 2A7JA 2C8YB 3ZZCA 3Q3KA 1NT1A 1K21H 2WV5A 2A7HA 3PMBB 1EASA 4AG2A 3RMOH 2GMTB 4XRNA 2VNTA 1DT2A 2OCVB 4ABJA 4NSVA 3URCA 1WUNH 1TQ0B 2H5CA 4FUBA 1PPEE 2JIZD 4GUXA 3Q3YA 1K1JA 2PUXB 3HK6B 3SUFA 1J8AA 3PB1E 3F9HA 4IGDA 1KIGH 1TWXB 1SGIB 3HKIB 3GY7A 1AY6H 1MTSA 4HZHA 4TPYA 3QUMP 4BAOB 2GKVE 4R8TB 2TRMA 1LHDH 1T4VH 4ZMAH 4FOUC 1S6LA 1H1BA 1EUFA 2AGGX 4O3UA 2UUFB 4F4OC 1O2HA 4MTBA 1NY22 1ZTJA 2V6NA 3BTKE 2B9LA 2OQ5A 1ARCA 4R0IA 1W0KD 2PWXA 1P12E 3SI3H 1O3HA 1O5FH 2ZHQH 1QHRB 4BANB 2FOCA 3GCHB 1CT4E 1MZAA 1XX9A 1SLXB 1QIXB 4FU9A 3K6YA 1E34B 2XC5A 3LH3A 5CE1A 2VIDA 3OAAD 4IS5A 1GVKB 1WQVH 1C1OA 1FUJA 5FAHA 1SGFG 1O2QA 2A4QA 1F7ZA 1VITH 1ZYOA 1O3IA 2RCEA 1CT2E 3BEFB 3LGUA 1MKXH 2QAAA 1RIWB 4ESTE 1C2JA 1NC6A 3P6ZB 4O9VA 2Z6BD 2XCNA 4X1SU 4WMFA 1ELBA 1LVOA 3BTDE 3W95A 1B0FA 1SB1H 4FETA 2WINI 3N7DA 2KM0A 2BLVA 2ZC9H 3C1KA 3A83A 4P02A 1SLUB 3RU4E 5HGGA 2GMTC 1NS3A 1O5EH 3DT0H 2DUCA 4MVNA 2SGEE 2I6SA 3ATWA 1UCYK 2VVUA 4ZKOU 1HLTH 1OWJA 3DSGA 3SBKA 4SGAE 1GBLA 3AASA 4XSKU 1C2FA 1P09A 3T29A 2D1JA 2LPRA 1A61H 2M2AA 1RTKA 1TBRH 1TFXA 1QCPA 1QFKH 1WU1A 3RXUA 1P03A 1RJXB 1ELEE 2GTBA 1XM1A 2BX4A 1MCTA 1ANDA 3UQVA 1P2MA 1SKYE 4Y0ZE 3PROA 1HB0B 1AN1E 2ZHDA 2EEKA 2V0BA 4OS6A 1Q3XA 3SJKA 2Z9IA 2V3OH 3TH3H 1BITA 1LPGB 5JBTA 2RDLA 3EA8A 3BF6H 1W12U 1YBWA 4WMDA 3UQOA 5JB9S 2ILNA 1GBCA 1Z8GA 1A3EH 2FP7B 1ZR0A 1ZLRA 2Q6FA 2YOLA 3LU9B 4X6MA 1QBOA 2PHBA 2R0KA 2FOHA 2BX3A 2ZTZA 3PMAB 5AHGH 4E7RG 1ELDE 2BQWB 1ABIH 1PPHE 3OY6U 2ZFPH 3SZNA 4WH6A 3BG8A 4AYYB 5E0HA 1CBWC 1K1MA 3KHVA 1KYNA 4X8UH 2SGAA 2VBCA 2ZU3A 4JYVH 3RXIA 5DGJA 4ABBA 1NFYA 3PYHA 4Q7XA 1ZRBA 3U8OH 1O3EA 3OY5U 1EB1H 1O2OA 1SGQE 3NKKA 1A7SA 1MU6B 1ZMJA 1E79D 5E2PA 3P8NA 2PV9B 1T31A 4K8YA 1ZSKA 1A3BH 2ANYA 4KTSA 3H7OA 2Z3CA 4JYUH 2AIQA 1QNJA 3BTEE 1GJ8B 3PLBA 3PM3A 1E1RD 1TPSA 1QA7A 3I77A 3ZZ6A 2ZCHP 3SNBA 1E36B 2PSYA 2BZAA 2BDBA 1INCA 1O2GH 4A7IB 1P11E 4Y7AA 2WPDD 3F9EA 2A4RA 5C3NA 5C1YA 1ZGVA 3TJVA 1XKBC 3F1SB 1HAZB 1SOTA 5I46H 4AFSA 4CR9A 1LPZB 1FXYA 3GCNA 2H5DA 1TBZH 4RI0A 4TT3D 3T25A 3P17H 1VGCB 3T5FH 2SGFE 1PPCE 1O2UA 1PPGE 2G81E 2SGPE 1HRTH 1GI0A 5F8ZA 4BTUB 1KDQA 2ZDAH 1HBTH 2ZIQH 1OP2A 1Z71A 3SU6A 1O5DH 3TK9A 4JZIA 4BAQB 1AFEH 3ZVDA 3ZZ9A 1GHAG 1O0DH 3M5OA 4ZKSU 3TLOA 3RXJA 1GJ4H 2BMGB 2BHGA 1NN6A 1EXFA 2XNDD 3RUOA 1F5LA 3A7VA 3SGBE 1NESE 2P3UB 1GHBF 1S82A 3MWIU 1OXGA 2B8OH 1TNKA 2ALVA 3SV8A 4CREA 3BTHE 3RXDA 3RXLA 1E38B 5DP5A 3MU4A 1SR5C 2NU3E 3QTOH 4NZLA 2KCPA 3MTYA 3V13A 1UK3A 4GPGA 1BTPA 4BXWA 3ATMA 3SUDA 1P2KA 4M9FA 2XCFA 4OS4A 1IOEA 1WV7H 1O5AB 2VIOA 1ZHPA 4OGYA 1LMWB 4XOJA 3SJOA 2ZECA 1D3QB 1MBMA 1A5HA 2Z9KA 1YCPM 2GD4B 2J98B 1AE5A 3UNSA 1PYTD 2O8LA 1GDNA 3E6PH 1WBGB 2BDIA 1FIZA 2IOTA 1PPZA 1IQMA 3SU1A 4ABIA 2FO9A 1FMGA 1YM0A 2VWMA 1HYLA 2EQNA 1TGBA 4K3JA 4F48B 1NRRH 1UVUH 2BD3A 4NG9H 2PGQB 1AE8H 2LP6A 4B75A 4JMYA 2FLRH 3T62A 5C2ZA 2UUYA 4CBOA 1GBKA 1XUJA 3TIUA 1BJUA 3TK6A 1FX0B 2H2ZA 2EA3A 1LHFH 1WAYB 1Y59T 4WMEA 1JWTA 1OS8A 2OUAA 2R2WU 5SGAE 3P8OA 3T28A 5DP7A 2GCTC 2QXJA 3SNDA 1C1RA 2BLQA 1EB2A 1EOJA 2HALA 4O3TA 2ZDKA 4GHTA 1TX6A 3LGTA 1O2RA 2Z9JA 3OTPA 1U6QA 1S0RA 1LQDB 2NU0E 3EQ0H 1THSH 3QDZB 1ESBA 2ANKH 3T26A 3DSOA 3OU0A 3T2NA 1AU8A 4Q7YA 1C5TA 1GCDA 1A5GH 1GG6B 1O3JA 1OYQA 1C5VA 2KFWA 2FOFA 1SQAA 3TGIE 1AGJA 1V2WT 2ZU1A 1Y3UA 3V12A 1MQ5A 4ISOA 3URDA 1BQYA 1K28D 1MMJN 1P06A 1SGRE 5AFYH 3VGCC 4ABDA 3PRDA 1YGCH 1O2ZA 1TGNA 1ELTA 1UTPA 3BN9A 5CHAB 1V3XA 6GCHG 1BBRH 4MPUA 3F6UH 1D3DB 1D6RA 3PO1C 5DP4A 4YOJA 2ZFFH 1LDTT 2BTCE 2ZG0H 2C93B 1HAOH 1HFDA 1OP0A 1O2VA 5DN6D 5J4SA 1IQFA 3MO9A 5IYTA 3W1EA 5C5NA 2VIWA 1L2EA 4X8SH 1TNJA 4BAKB 1FV9A 1C5UA 2G00A 2ZGJA 4UFDH 1Q2WA 4MNXA 3TJOA 1P9UA 1TONA 4PROA 3RC5A 4X2XA 2EI7A 4I33A 4RT0A 5AVDA 5GCHF 4X2VA 1XUFA 5F53A 1QB9A 1NBMD 1KY9A 1OX1A 1T32A 5EXLA 1DICA 2QV1A 1C1MA 1GJ5H 4AG1A 1T8MA 4UD9H 4X2YA 1YPKH 3I29A 2QF3A 4IMQA 3KIDU 3A88A 1JIRA 4WY3A 3UFAA 2RFKC 4F55A 1DWBH 1GGDB 1GBMA 3ZZ4A 2W6ID 4B76A 1K1OA 1ETSH 1XVMA 3LONA 4JZEH 1TNLA 1ORFA 2J92A 3WWFA 4KELA 1P01A 3BTQE 1JRTA 2NWNA 5KEDA 3LGIA 1MKWH 3STIA 1PYTC 1V2JT 4IC6A 1HAHH 3TNTA 2ZPSA 4NGAH 2KCAA 1IQJA 3B8JA 5C20A 2Z94A 1YKTA 1K2I1 2C90B 3RXBA 5PTPA 1V2VT 2O8TA 3BG4B 1F5RA 3ZVCA 3TK5A 5TJXA 5GJ4B 3OEHD 4Z0KA 2ZTXA 2ASUB 1O3NA 1ZTLA 2FOAA 3S0NA 2UWPA 1TAWA 4NWLA 1SHHB 1ELFA 2ZO3H 3A82A 3UOPA 3MU1A 1C1NA 2V3MA 3SO3A 4K1SA 1AB9C 1UTNA 3ZYEA 1UTOA 4O97A 2RA3A 5LGOA 1UW7A 1NRNH 4FUIA 2CGAA 4HI3A 2AFQB 3MYWA 1BRUP 1RTLA
chains in the Genus database with same CATH topology
1KXFA 2BDGA 1A2CH 4BAHB 2VVCA 1GI3A 1V2OT 1BRCE 1D9IA 4Y79A 2FI5E 1QL9A 1ZMLA 3KF2A 1UVPA 1K22H 3KQDA 1A5IA 1GJ6A 5DP6A 5DK1A 5FHTA 1P2OA 3SU2A 5DG6A 2VH0A 4VGCB 3RXVA 3AVZA 3U8RH 1C5LH 1CQQA 4DW2U 1BZXE 4CBNA 5ESTE 1ZPBA 4VGCC 5GDSH 2H1UA 2OBQA 4KKDA 1IAUA 1V2QT 6CHAB 2ULLA 2A2XH 1HIAB 4KTCA 5FXLA 2BXUH 4AN7A 1O37A 4BOHA 5EW2H 1K9OE 2XRCA 4Q80A 4U30A 1GL1A 4WVPE 1AVXA 5C1XA 3SV9A 5JYIA 2EI8A 2OC8A 1MUEB 5EXNA 2BD9A 4DURA 2Y80A 3U69H 4ZUHA 3ATKA 1GHAF 3FZZA 3GY5A 5JDUB 1QL8A 1KTSB 2Y5GA 3PMJA 5DP3A 1C5QA 5EODA 1HJ8A 1EAIA 1C4Y2 2ZPRA 1LKBA 1AB9B 3GCTG 4DCDA 2J95A 1UTQA 5JPMH 7GCHG 1CHOG 3BG4C 7KMEH 1FN8A 3ZZBA 3GDVA 1T8LA 2ZQ1A 3Q77A 1G3BA 5HM9A 3RLYH 3ZVFA 1SBWA 3LJOA 1TBQH 1SI5H 1K1NA 1RTFB 1O2KA 2ZGBH 2FYRA 3SI4H 2OC1A 2GV6A 3M37A 1TB6H 3FP6E 3GOVB 3SV2H 4U01A 1G9IE 2PTCE 1IHSH 2BDHA 4Y71A 3VPKA 1O5CB 1V6DA 2Z7FE 3CP7A 1OWKA 1AVGH 4AX9H 1N1LA 2IPHA 5L6NH 1DLKB 1MKXK 1O3AA 3MU0A 1CO7E 1IQNA 1P0SH 2D8WA 3E91A 9ESTA 1O31A 4CH2B 5EPYA 2HWLB 1MTVA 4MPWA 3ZZ8A 3DA9B 1JMOH 2TGTA 2NU4E 1GI5A 2P59A 1N8OB 2JETC 4YT6H 2GDEH 1O3LA 3LDXH 4ZKNU 1KDQB 3W94A 3QTVH 3ZV9A 2P94A 4TWWA 3AAUA 1KXDA 4I32A 1DM4B 2FM2A 4TPIZ 3RXSA 2XYAA 1HJAB 2F9NA 3LJJA 3E8LA 1F0UA 1NU7B 1TALA 1C5OH 1V2PT 1C1WH 1ESAA 2OBOA 4GSOA 3SOSA 2XBVA 1C1PA 2Q1JA 1FI8A 4GAWA 3NZIA 3SUGA 1GGDC 1BB0B 1GMDF 3ZVBA 2HGTH 3P8FA 1HAGE 1NRPH 4A1XA 3M3TA 2DE9A 2KAIA 3UUZA 3RDZA 3G01A 2FMJA 1Y3VA 2W7SA 2ZDMA 3N7OA 2VU8E 1RXPA 3ZYDA 1H9IE 4ZHAA 3F68H 1GBBA 1RRKA 5F6MA 1O3MA 1P2QA 2XNIA 1GMDG 1O3BA 1C1TA 4TYDA 4ABHA 3PLKA 2PUQH 2FPZA 1Z6EA 2BY8X 5LPEA 2FXRA 4DVAU 3M5MA 2ZHWH 1AWHB 3MMGA 2BDAA 1CGHA 1FZZA 3D62A 1EZUC 1O39A 2HOBA 2Z3EA 2FX6A 4MLFB 3SNCA 4IN1A 1GHYH 2J94A 3TITA 2F9BH 1P8VC 5EXMA 1AZ8A 1KXBA 5HXFA 4JK6A 2SFAA 1MZDA 5JBBS 1P3CA 2G4TA 3TH4H 1G37A 1SLVB 5ABWA 1ZPZA 3SU3A 2THFB 1S6HA 1S84A 2HVXA 2P8OB 1A0HB 1LPKB 1O2WA 2XTTB 1V2KT 1N6YA 2TGDA 3M5LA 2BXTH 1WSSH 3LT3A 1L0ZA 3A86A 1QB6A 1HGTH 4I8JA 4IMZA 1HXEH 1QJ7B 1IQGA 1J14A 1SOZA 2OQUA 3SU0A 1LCYA 4AFUA 1WTHD 1FY3A 1GMHF 1W2KH 1SGPE 4JZDH 5EQSA 3RMNH 5JB8S 3BTWE 1W14U 1SGNE 3BV9B 2QXHA 3UR9A 3RXFA 4AFZA 4ISLA 1O5GH 2CN0H 4B2AA 1DS2E 2JH5D 3A8AA 4OS5A 4HTCH 1C2IA 1C9TA 4CH8B 4OS1A 1BRAA 2BDCA 4NIYA 1O5BB 1QQ4A 4FU8A 4NIXA 1P2IA 3R0FA 2GV7A 5C5OA 1OP8A 1Y8TA 1TMBH 5LPFA 2W7UA 3VB5A 2EI6A 2G52A 3CENA 2WYGA 4B74A 4ZKRU 2FYQA 1YPEH 5E8EH 5F8TA 2QYIA 3OX7U 1S83A 1BA8B 2AS9A 1EAXA 4FUCA 2UWLA 1ABJH 3DFLA 1ZOMA 2A1DB 2A32A 1GJ9B 1BRBE 1YPHC 1C4U2 2F9UA 1DLEA 2BVRH 1DOJA 4JK5A 1PQAA 4A92A 1P04A 3M3VA 2YNBA 2GCTB 4M7GA 2VIPA 1PJPA 4XBBA 4TY6A 1YCPK 3K9XB 3MOCA 3UWJH 4CRBA 1CGIE 1O2XA 1H9LB 2A7CA 1TPOA 4AFQA 4FUEA 2Q6GA 1TGCA 4OS7A 4JZ1A 1W0ZU 2G4UA 4NIVA 3RXGA 2V3HH 1ID5H 3M7QA 3R3GB 1MTNC 3M35A 3UOUA 2JH6D 1PFXC 4Y76A 3O8BA 3RU4D 5FCKA 1L1GA 2YNAA 2QCYA 2G8TA 4D9RA 3NPSA 4NFFA 3VB3A 1ZZZA 4YOGA 5HMAA 4CRCA 3KGPA 1HUTH 2ZGHA 4KGAA 1AO5A 1C5SA 1Y5BT 2AYWA 1FDPA 4B1TA 2ZWLH 4NFEA 1YF4A 2A4GA 1UO6A 1FJSA 2OTVA 1C2DA 1ETRH 3GYLB 1VITF 1GCTC 3KL6A 2BDYA 1LKAA 1GDUA 1V2MT 1V2NT 1GBAA 4K5ZA 3LIWA 1A4WH 3PMHB 4X2WA 1GCTB 5L2ZH 4RN6A 2TBSA 5A0BA 1ZJDA 2VWNA 2GCHG 5TCAA 2Y81A 2C4FH 4H4FA 4LZ1H 1C5PA 1EJMA 1K1IA 4YZUA 1O3CA 1VR1H 1NRQH 2H9EH 5A8YA 3PLPA 2ODQA 1PQ5A 3M5NA 4CRGA 1SG8B 2GT7A 1A0LA 1H8IH 2Y5HA 3LGVA 1K1LA 2XBYA 2P8OC 2GZ9A 3QN7A 1EPTA 2BM2A 2FOGA 4MNYA 1T4UH 1J16A 1BMLA 1P57B 4ZAEA 2XC0A 3ZZ7A 2Z9LA 1DSTA 3VXEH 2AMDA 2AEIH 3RXAA 4HFPB 1QR3E 1W3CA 4FUGA 1VCWA 2ZDLA 2Z3DA 1C1VH 2A45B 2W3KA 4A6LA 2V35A 2CF9H 4RKJB 1J15A 1FLEE 8LPRA 1EZXC 3NUMA 3QLPH 4MPVA 4HGCA 3SV6A 3PTBA 3LPRA 1GI7B 1O2MA 1RIWC 4MNWA 2FZZA 2RG3A 3NXPA 3QX5H 3E16B 1WQSA 5DKMA 2Y7XA 5L30H 1JRSA 1O33A 5FPTA 1AHTH 5F03A 1EP6A 1KLIH 1KTTB 1OOKB 4NA7A 2F91A 2RA0A 3P92A 2R3YA 5C1UA 1FAKH 2C8WB 4DJZB 2A31A 1QGFA 3OTJE 1PPBH 1HCGA 1EOLA 2GGVB 3UREA 1AI8H 1YPJH 2GX4A 3UWIA 2B5TB 1C1UH 1W11U 1N6XA 4NSYA 3A8CA 1AUTC 4RKOB 2VB0A 4WH8A 3GY4A 1ZGIA 3ENSB 4XBCA 7ESTE 3FAOA 3GDSA 2FDAA 5C67A 1S81A 4KP0A 1HJAC 1G32B 1EKBB 2GZ7A 4U32A 3SGAE 4CRDA 2WUCA 2ZU2A 1HAPH 3RXRA 4FU7A 3STJA 4Q7ZA 3L33A 2FTLE 8KME2 4WXIA 1AFQC 2BD7A 1ANEA 3LC5A 3SUEA 1T8OA 4H42U 1ELGA 1Z8RA 2OD3B 3PO1B 4D7FA 1P2JA 1ACBE 1GMHG 1GDQA 1P05A 5ETXA 4ZH8A 1SGEE 1QRXA 2AGIX 1C5RA 4J2YB 1O2LA 1NROH 5DP9A 1TYNA 3TVJB 1UMAH 3FP8E 2Y82A 4YESB 4Y10E 1V2UT 1S0QA 3P95A 4YOIA 1FAXA 1RGQA 5EG4A 2PGBB 3UR6A 1YPHE 2XW9A 4ZXYH 2AH4X 4BXSA 1CHGA 1GJ7B 1VCPA 2OC7A 3MU8A 2ZTYA 4AZ2B 1DVAH 4LXBH 4ISNA 1ELVA 1FY8E 1SGFA 1ZJKA 4F49A 1SLWB 2CXVA 1P9SA 2GCHF 2XWBI 1V2ST 1TMTH 4Y8XA 1SFIA 2IN2A 4BTIB 1GI6A 4ABAA 1O38A 2F9VA 1V2TT 1LVMA 4O03A 1VGCC 4IW4E 1EAWA 3IITA 4BNRA 2G5VA 2WUBA 3HATH 2AGEX 3L3TA 3KQCA 3QO6A 1ZSJA 1BTYA 2IJOB 2WPKS 4JZFH 1GL0E 1NRSH 4ABEA 3E90B 3D23A 4MDSA 3V3MA 1W7XH 4CRAA 1V2RT 1SMFE 3VEQB 4A1VA 3RXPA 1D3PB 3SQEE 1UVOA 1TPPA 4WXVA 3SNAA 2OINA 2C8ZB 2ZKSA 1GBFA 1H9HE 3PWBA 1J9CH 1CBWB 3SU5A 1AQ7A 1BMNH 1MAXA 2UUKB 1NFXA 1QRWA 3ATIA 4NA9H 4NIWA 1TGSZ 3E0PB 5GWZA 1QY6A 2WPLS 2BY6X 2CF8H 1MH0A 1XKAC 2Y5FA 4BTTB 1IHTH 1GBEA 3VB7A 1XXDA 1DITH 4X8VH 3MU5A 2VH6A 4MPXA 5E0JA 1X7AC 4FVBA 2O8UA 2QXGA 1GMCG 4I8HA 4D76A 2VIVA 1G3CA 1OPHB 2VIQA 3ODFA 1C2KA 3B9FH 1L1NA 1YP9A 4Y11E 1WOFA 3CS7A 3TH2H 4OS2A 5A8ZA 4ZHLU 1OSSA 2FLBH 1C5MD 1T8NA 2Z9GA 3HPTB 5CHAC 2QA9E 3RC6A 1IQHA 2ZU4A 5LPRA 1DANH 2ZCLP 4CRFA 6GCHF 1O3PB 2BLWA 1IQEA 1GBIA 1HPGA 3AW0A 2R3UA 3A80A 2UUJB 5IDKA 2ZFTA 1HDTH 5ESBA 3BTGE 4YM9A 3Q00A 1MCVA 3Q3XA 1TMUH 2BZ6H 2ZPQA 2XWAA 1FPCH 4K60A 2I6QA 1GHWH 1XMNB 1BTWA 1SGCA 1W13U 4FVDA 1TX8A 1TX7A 1GVZA 2PKAA 2BD5A 1L4DA 1EX3A 1C2LA 1H8DH 2FOBA 2GDDA 2WV4A 3SQHE 1BTUA 5FPSA 1TABE 1Y3WA 1A1RA 3VB6A 4Y8ZA 1SFQB 3OYPA 1LQEA 1Y3YA 3RXHA 2AIPA 2C8XB 1VCQA 3GY2A 4NWKA 4AORA 1P10A 1SGYE 6LPRA 3NCLA 1MTNB 2WYJA 1YLCA 3HGPA 1NO9H 2ODPA 3PWCA 1UHBB 5EW1H 2OC0A 4CR5A 1Z1JA 1LHEH 1HXFH 1DY8A 1YPMH 2ZZUH 5FCRA 3SGQE 3FVFB 3K6ZA 2PKSB 1QJ6B 1C4V2 4WJG2 3A7TA 2F9PA 2BQ7B 5CMXH 3V0XA 8GCHF 1ZTKA 5EGMA 1CU1A 3QGNB 4YTAA 2PKSC 1QJ1B 4XFQA 4AB8A 3ATLA 2VINA 1D3TB 1GBJA 5T6FA 3UNQA 2ZFSA 2VVVA 1DFPA 2O9QA 3RMMH 3RXKA 2BYAX 1AD8H 4B71A 1G3DA 1NTPA 1THRH 2D26C 1S6FA 3SNEA 1KXEA 1WYKA 3EE0B 5A0CA 3OSYA 1FY5A 3RC4A 4ZHMU 1BMAA 5B6OA 2NU1E 3D49H 1GBHA 1T7CA 1H4WA 3KN2A 3TPIZ 1YC0A 1WTGH 2CV3A 2FS9A 3O8DA 1EZSC 1GG6C 4XBDA 2ALPA 1G36A 4X8TH 3SW2B 3T27A 1PPFE 3RXOA 2P16A 3U8TH 4D9QA 2BVXH 3MH4A 3F9FA 3H7TA 3VGCB 5F8XA 1QL7A 4A5TS 3M7UA 2BOKA 2R2MB 3SU4A 3GYMA 4I8LA 2ZCKP 3TGKE 1PQ7A 2XC4A 4DIHH 2HNTC 2BQ6B 3RLWH 4UE7H 1HV7A 2FIRH 2J34A 5E2OA 1XUKA 1CHOF 4MG3A 2STBE 1O34A 1O36A 1SGTA 3QZQA 1KLJH 1NU9A 4KTUA 1GHZA 4I8KA 2FODA 5DO4H 1CA0B 1HAXB 2ANWA 4K1TA 1FN6A 2TPIZ 4Z6AH 1QQUA 2CHAB 4YT7H 2SGQE 5K7RA 4Y0YE 3M36A 3PV4A 1BHXF 2HLCA 1EATA 1F2SE 1BTHH 1P2NA 2QXIA 3GISB 3AAVA 2VWLA 1EQ9A 1XXFA 2ZF0H 1FNIA 4X6PA 4CHAB 4K2YA 4K69A 3TJNA 2PTNA 1MD8A 2OXSA 1B7XB 1VITG 2W3IA 2BY5X 1W7GH 3S9AA 4LOYH 2PR3A 1ZRKA 1QBVH 1M9UA 1LO6A 2DE8A 2FTMA 4IC5A 1P02A 1C2MA 1Z1IA 5TCCA 2VGCB 1W0YH 3ITIA 3IWMA 3M3SA 4B2CA 1OWHA 1G2MA 1G30B 4XDEA 4JCNA 1WCZA 1F0SA 2J4IA 2J9NA 2WPMS 1SSXA 1UTKA 1DSUA 2GZ8A 4ZXXH 1CA8B 1C5ZB 1O3GA 2ANMH 1RS0A 1ZPCA 1LVBA 1BMMH 1C1SA 3EA9A 1AUJA 1E0FD 1Q31A 3K65B 4AGKA 1ZHMA 1JIMA 4I31A 1C2GA 2ZDVH 1SGDE 1QBNA 3MNXA 8ESTE 5AF9H 1SL3A 1QURH 1BOQA 1HAYB 2FOEA 5I25A 1TLDA 2FI4E 3SJ9A 2AMPA 4QT8C 4E06H 3BEUA 1DE7H 1YYY1 3BTTE 3ZVAA 1CE5A 2BVSH 2P93A 1Y3XA 4ASHA 4LK4A 1KLTA 2ZHFH 3E0NB 2ZEBA 3MNBA 3S7KB 1BIOA 2R9PA 4YO9A 1AZZA 1HAVA 1JOUB 2ZQ2A 1O2PA 1CGJE 1GI2A 2CMYA 4AGJA 5T3HA 1DPOA 2F9OA 3B23B 3RXMA 2QGRA 2W5EA 2J2UA 1G3EA 2A0QB 1BDAA 3FANA 1HAVB 4UEHH 3JZ1B 3MH6A 2P95A 1O3FA 4YLQH 3M61U 3SV7A 1F92A 4CHAC 1UTJA 1GHVH 1LVYA 1VJ9U 3ZZDA 3HK3B 3DD2H 3ZV8A 3O8CA 3SN8A 5EQRA 3TU7H 1AFQB 1GMCF 1B5GH 2A2QH 1YCPH 1O35A 4ZROA 1W8BH 1GJAB 1XVOA 4ABFA 5GCHG 1Z6JH 1EJNA 2ZFRH 3BIVH 4FUFA 5EU8A 1L1JA