2QF3A

Structure of the delta pdz truncation of the degs protease
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
221
structure length
200
Chain Sequence
QFDSTDETPASYNLAVRRAAPAVVNVYNRGLHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRNFLQTDASINHGNSGGALVNSLGELMGINTLSFPEGIGFAIPFQLATKIMDKLIRDGRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Allosteric activation of DegS, a stress sensor PDZ protease.
pubmed doi rcsb
source organism Escherichia coli
total genus 50
structure length 200
sequence length 221
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf3A02
2FOGA 2ZU1A 4IN2A 3ZZ3A 4CBNA 1S83A 3DA9B 1K1IA 1O3MA 1GHVH 1FMGA 3RXJA 2RDLA 2Y7ZA 3AAUA 1ZYOA 3M3VA 2ANMH 3NZIA 5JDUB 3RXBA 4O3TA 4X2VA 4A1TA 1ACBE 4Y79A 1ZTKA 1C1TA 1AKSA 5ESBA 3D65E 1IQGA 2C3SA 1BRAA 2VGCC 1GJCB 2M5TA 4NA8A 4Q7ZA 2XC0A 3SQHE 2A5KA 1CGIE 4B1TA 4GCHF 4LK4A 3SNDA 1OYTH 1WTHD 3SJOA 2A5AA 2ZQ2A 2JH6D 3BF6H 4FUEA 5EPYA 1SGDE 1HBTH 5K0HA 5L30H 3RXTA 1W0YH 2BDYA 1YPJH 3RU4T 1Y5UT 1FLEE 1O2RA 2F9UA 1HFDA 2F3CE 3MO9A 1OS8A 4FU7A 2ALPA 2BY9X 1V2KT 3MU4A 1GI2A 4B75A 1EZXC 2FOFA 2CHAC 1FUJA 3PWCA 2VGCB 2HRVA 1O5BB 5DO4H 1BUIA 1Y59T 3A85A 2J9NA 1HUTH 1KXAA 2QXHA 5EW1H 1JBUH 3EDXB 2HLCA 1LQDB 4FUHA 1CT2E 4YT7H 3A7YA 4SGBE 4NCYA 1O5GH 1U6QA 1FY3A 1P2MA 4IMQA 4M7GA 1V2PT 1EUFA 1UHBA 5GDSH 1O2MA 2BLOA 2ZGXH 2ZU3A 3UOUA 2ANWA 1ZJKA 1JIRA 1AKSB 1ZGIA 3SU5A 5GXPA 3ATLA 5A0BA 2XW9A 1L1NA 1O2QA 1XUJA 2CHAB 4BAHB 4K1SA 1CVWH 2BD8A 2P3TB 5G4BA 1ELGA 3U8TH 4X8VH 2FS8A 1GWAA 2W5EA 1O3NA 1SHHB 3HPTB 4ISLA 4H4FA 4X1SU 1P9UA 1BCUH 2EC9H 2AMPA 3SU6A 1O2YA 3B23B 1MTVA 1A3BH 1V2MT 1GI4A 1PPCE 2QCYA 3A8DA 3BTKE 3M7UA 3Q00A 3RLWH 2BLWA 1O37A 2F83A 3ATIA 3P8OA 3RXMA 4FVDA 3EAJA 2ZHFH 1EAIA 4ABJA 1BTYA 1K1MA 5DP7A 1ANCA 1QB1A 1T8MA 5DPAA 2UUYA 2TBSA 7GCHG 1ZMNA 5HXFA 2ZCKP 1S0RA 2C4FH 1FAXA 2PWXA 2ZECA 3SV7A 1HB0B 1QRZA 5GCHG 5C20A 4NSVA 1UTNA 4NWLA 5E0GA 3M5MA 2OC1A 1H9LB 2EI7A 2OP9A 1E36B 1SSXA 1O2IA 4X1QU 2ZQ1A 2QIQA 4ISIH 1AVGH 2AERH 2W26A 2FMJA 3BG8A 3G01A 3E90B 2A1DB 2XXLA 3SO3A 5GIBA 2G4TA 1GJ7B 1OYQA 1TNIA 1GDUA 2FODA 3CENA 3MOCA 2ZDKA 1AO5A 4ZAEA 1QR3E 5T6DA 3BTME 2GCHF 4Y10E 3UNRA 2Y5GA 2GCTC 3C1KA 4YTAA 3TH2H 2BD2A 5A8YA 4RSPA 1EZQA 1SFQB 2FX4A 3ATKA 1NU9A 1YPKH 4MNYA 1HJAC 1Z1IA 2D2DA 1C1QA 3SGBE 4FXGH 1TNKA 2GZ9A 2NWNA 1SGPE 2G00A 1NROH 3P8GA 3TH4H 2EEKA 3BEUA 2ZZUH 3UQVA 1GG6C 2QXIA 1S82A 1WQSA 3BTWE 4K69A 1NY22 1XX9A 4MNXA 1WAYB 1D3DB 2BY6X 3RXVA 4JZEH 1FXYA 3SUDA 2ZCHP 4X2YA 2ZPRA 3EA8A 1QL7A 1THRH 3QLPH 2ZA5A 2OLGA 4MG3A 2TGTA 2OBOA 1OKXA 2Q6DA 1CSOE 3N7OA 1TRYA 1UVSH 1HIAA 1EP5A 1UO6A 1AZ8A 1TPPA 1K1NA 1KY9A 2BTCE 2VH0A 1V2WT 1Z7KA 1P3CA 3ESTA 3SU0A 3GICB 1AGJA 3LPRA 3ZVAA 1O3PB 1UVUH 1ZOMA 8ESTE 3DT0H 1GG6B 1RD3B 4JMYA 1FY1A 4O9VA 1DSTA 2VJ1A 2ZFSA 1F0SA 2OC0A 3T28A 3ZZDA 1ELEE 3EGKH 1O2VA 1GI6A 3VB3A 4AFUA 1IQKA 1H8IH 1GMDG 2FX6A 1GMCG 1VR1H 3PV4A 1B0EA 1O5EH 4CH2B 1YPGH 4YOJA 1AWFH 2IN2A 1NN6A 3M36A 1GVKB 2BB4A 4CHAB 2AEIH 2WPIS 1L1GA 2BYAX 1A0JA 4BAOB 3VB7A 3AVZA 3SGQE 3HATH 1ELFA 3RC4A 4B73A 1GJ8B 2XYAA 2FM2A 1FPHH 2J92A 2V0BA 2ZDMA 5ESTE 3H7TA 1C2HA 2PKSB 2G55A 3ZZCA 4I8LA 2ZFQH 1V2JT 1ELAA 3F9FA 1ELTA 3BTDE 1D6RA 2ZTXA 4AGKA 1LVOA 1XUFA 4Y7AA 2WYJA 1HIAB 1UJ1A 5EXNA 1GDNA 1O30A 3MTYA 4HGCA 1DDJA 3SV8A 1XXDA 3A81A 2A7CA 2Z9IA 3MMGA 2SGPE 3ZZ4A 1SB1H 3PLBA 3D49H 1NRSH 1C1VH 2A2QH 4JYVH 1OWDA 1HAOH 1TA2A 1AHTH 3P17H 1RRKA 1AFEH 2LPRA 2JH5D 1TE0A 2F9PA 2GVFA 1A1RA 1Y3YA 1YGCH 2ZCLP 1BT7A 1CHOG 3BTEE 1P05A 1TB6H 1A0HB 3LJJA 2XWBI 2ESTE 1QB9A 1Z8JB 3A82A 4NZLA 1DWCH 5E2PA 2PSYA 5EQSA 5I46H 3F6UH 1XUHA 3LDXH 1GBJA 2V35A 3LGUA 4WMDA 4AFZA 3PMBB 2HWLB 1MTNC 3GCHC 2Z9KA 3ZV9A 1O2TA 1J8AA 3LGIA 1WSSH 2BX3A 2R3YA 4YESB 1TOMH 1A4WH 1ARBA 1AY6H 1QRWA 3STJA 4CRFA 2HPQH 1C5LH 1YCPK 4LXBH 2ZGJA 4Y0YE 1O2PA 4B2BA 1P12E 1S0QA 2QA9E 4LOYH 1T31A 3M3TA 4IMZA 1OP8A 4X1RU 3P92A 4Z6AH 5FBIA 1V2NT 1VJAU 3W94A 1SGCA 2BX4A 1OPHB 4AOQA 2GMTC 4B2AA 5GWZA 2Q6FA 4NA7A 3Q77A 4DVAU 1W7GH 2ANKH 4GLYA 1ZPCA 1ZPZA 2H9TH 1VCPA 1Y3UA 1L0ZA 1A0LA 1Q2WA 2FYQA 4MTBA 1OXGA 1G9IE 2ZI2H 1GBDA 1PYTD 1QTFA 2R2MB 1Y3WA 1HAVA 1BJUA 1GMHG 1W12U 2ZGBH 3RLYH 3SJ9A 3VXEH 1RFNA 1GI8B 3TNTA 1WUNH 4WVPE 4HI3A 3B8JA 1C5YB 2B7DH 2PR3A 2GMTB 2J94A 2W3KA 4AFQA 1YC0A 2BDCA 3LGWA 1GHWH 2FLRH 5FCKA 1G3BA 1RS0A 2GGVB 1SPJA 2VIPA 1MZAA 1P2KA 4Y76A 2Q1JA 1T4VH 4TPYA 2XCFA 5C5OA 3GOVB 2JETC 1TAWA 3MH5A 7LPRA 1GI0A 4X6PA 4K1TA 2STAE 2CJIA 1BBRK 1THSH 1JWTA 5E0JA 3SUEA 1O0DH 4B76A 2TGAA 1J14A 5JB8S 1QJ6B 3OU0A 3RM2H 1MD7A 1DWBH 1GBKA 3QTVH 1V2RT 3B9FH 2SGAA 1P9SA 1TQ7B 2EI8A 2ZHWH 3GY3A 1XVMA 1EZUC 5EG4A 1INCA 4X8UH 3SI3H 2C8WB 2PTCE 1O3IA 1DS2E 3PM3A 1C4Y2 1B7XB 1E0FD 1GGDB 5F03A 3OX7U 3IWMA 1TBZH 1Z8RA 3S0NA 4XBDA 3L33A 1O34A 3BEIB 2JETB 2W7SA 1EJNA 1NPMA 3ZVDA 1O3OA 1VJ9U 1Y5BT 3FAOA 5A2MH 5AF9H 3A8CA 1FY4A 4JYTA 4ABBA 2ZG0H 2VVVA 2R3UA 2BHGA 2G5NA 1GHZA 4BXSA 1ZSLA 1DM4B 3L3TA 3RMOH 3SW2B 1FY5A 1OWHA 2WV5A 4NIVA 4ZXXH 3PTBA 5FHTA 1TABE 3D62A 3M61U 2THFB 4OS7A 4E05H 1LHFH 1TPOA 3BIUH 4XFQA 3RXSA 2AGIX 1O2LA 3MNXA 4FUJA 2CF9H 3MNCA 2ZKSA 4HZHA 1TGCA 1GHBF 1P09A 4NGAH 2BDHA 3TJNA 1KSNA 1ELBA 1V2ST 3UNSA 4UFFH 1ID5H 8GCHG 3KIDU 2PUQH 3DHKH 1T8LA 1NRPH 2Z7FE 3FANA 2OQUA 4XDEA 1GJ4H 3RXKA 5HMAA 4HFPB 4WWYA 1S5SA 2BDAA 1GBCA 1KIGH 1DY9A 1KDQB 1SVPA 2ZTZA 1TGBA 1QA0A 1O31A 5C1XA 3GCNA 3P6ZB 3EA9A 3O8CA 3DUXH 1JRTA 4H6TA 2VVUA 3MU8A 1EB1H 3BTFE 1MTWA 5EGMA 1BTXA 1MAXA 2FWWA 3RXEA 1J17T 4AZ2B 1Y5AT 1IQHA 1C1WH 1NRRH 1EOLA 2V3OH 3TPIZ 4CR9A 1DVAH 1UTQA 5EXLA 1ABIH 5LPEA 1BMMH 1PPEE 1WV7H 3SI4H 1HAZB 2ZDLA 3RXDA 3MNBA 4OS4A 4NG9H 2ZDAH 2PKAA 3WY8A 1ZRBA 4FUCA 2F91A 3SUFA 1RXPA 1IOEA 4UFEH 5T6GA 3LH1A 1GBLA 4X6OA 4TY6A 1GBBA 3OYPA 1D4PB 1D3PB 3PWBA 1KXCA 2FIRH 1ZJDA 1W11U 2FDAA 3GYLB 4U30A 1P2IA 1G2LA 2AGEX 2BVXH 9ESTA 3RMMH 2A4OA 1V2OT 4WF8A 1UMAH 2PUXB 2A31A 1BB0B 2Q6GA 1S85A 1BIOA 3T2NA 2ZDVH 1LO6A 3OSYA 1YLDA 1RJXB 1AIXH 1NZQH 3U98H 1EXFA 3NWUA 1DITH 2KAIB 4AB8A 7GCHF 2Z9GA 3ZZBA 3CP7A 1O3HA 2CV3A 1OWEA 2UUFB 2B0FA 2IJOB 4Y8ZA 3RXPA 2GV6A 3LOXA 4UEHH 2RG3A 3RXCA 4X6NA 2Z3CA 5LGOA 2Y80A 2OD3B 3SHCH 5B6OA 1TNLA 5DP4A 4A5TS 1IHSH 1C5PA 3ENSB 1QNJA 1XKBC 4WMEA 2SGQE 1KXFA 6CHAC 2OCVB 1L4ZA 2WPHS 3MHWU 3T26A 2GP9B 3ODDA 2FOAA 2QGRA 1GHAG 2G51A 7KMEH 1O3GA 1YPHC 3NXPA 2BY8X 1UCYH 1TX8A 1N1LA 1YPHE 1SGNE 2NU0E 3PYHA 3MU5A 1BHXF 3U9AH 5HM2A 1IQMA 2GX4A 1WTGH 1TMBH 1P2NA 4BAQB 1DSUA 4CRDA 3VPKA 1AVWA 1AFQC 1LHGH 1GPZA 1O3AA 1IAUA 2AGGX 1G36A 1BBRE 1GJDB 2ZP0H 4WXVA 6CHAB 4I33A 4IS5A 3VXFH 1AB9C 3LGTA 2GTBA 1TOCB 1Z6JH 3RXIA 1YYY1 1F0TA 3RXOA 1H1BA 1W3CA 3LKWA 5LPRA 1T7CA 5T6FA 3PO1B 4K8BA 1E38B 2GV7A 5F8XA 5DP8A 3UWJH 5J4QA 1ESBA 3UOPA 2WPMS 2ZC9H 2FESH 2WPLS 5A8XA 1RTKA 1UK2A 2PGBB 2XC4A 3QGNB 4ZKOU 1AFQB 4MDSA 1J15A 2PW8H 5BRRE 3CS0A 2F9VA 2G81E 2WV4A 3S69A 1QQ4A 1AB9B 1NFYA 4Q2KA 1GBMA 2BDBA 1MU6B 2A4GA 3ATWA 1AE8H 3VGCC 5FAHA 1PFXC 1GL1A 2PGQB 3ZZ9A 1BTUA 2PLXA 5IDKA 1YPEH 4ZH8A 1EJMA 2BDIA 1GMDF 2Z94A 1LCYA 5AFZH 4DG4A 4INLA 1V2QT 1GMCF 3FZDA 1EASA 1UTJA 1ZRKA 1ZGVA 1UTOA 2VIQA 1QB6A 4ABDA 1UHBB 5IYTA 4BAMB 4CBOA 1UTPA 1C5UA 1W8BH 1ZSKA 1P57B 2ZHDA 4ISNA 3RXQA 4INHA 3TJUA 1BMAA 4Q7YA 1Y3VA 3VGCB 2H9HA 2P94A 1X7AC 3TK5A 1O2HA 3FP6E 1MAYA 3TK6A 1PPHE 2VVCA 1C4U2 2CN0H 2D26C 3R0FA 1GDQA 2ZGHA 1NT1A 5C67A 2ZU5A 2J2UA 3STIA 4D7FA 1WCZA 5F6MA 1MTSA 2UWLA 1AD8H 4AFSA 1KXEA 1HJ8A 2FI3E 3VB4A 4UFGH 2SNVA 2OBQA 4O3UA 1TNJA 2V6NA 4DT7B 4NFFA 2BVRH 3TK9A 3MH6A 1QJ7B 1GJ9B 1OX1A 4ZMAH 2F9OA 3F9EA 3JZ1B 1PPFE 1DWEH 1TBQH 2C90B 3A88A 4UDWH 3TGJE 1GHYH 1SC8U 4U01A 1HXEH 3QX5H 2C8ZB 3MU0A 1FIZA 2ZWLH 2BLQA 4AG2A 1TX6A 1SGFG 1SLVB 4ISHH 4GHQA 2ODPA 5HYOA 4ZHAA 1CHOF 1QY6A 1W0ZU 3SJ8A 2J38A 5FPYA 1AQ7A 1VITH 5C2ZA 1DANH 1O3CA 4CRCA 4GUXA 1FJSA 2ZPQA 2A7HA 1QRXA 1GI7B 2BQ7B 4KTUA 1FN8A 3BEFB 3GY5A 4GPGA 3P70B 1ANBA 1P3EA 2VWMA 3BTHE 4J1YA 5L2YH 2A0QB 4CHAC 5GPIB 3FZZA 1O2UA 4YT6H 1LVYA 3SU4A 2H2ZA 1EP6A 1OWKA 3UFAA 4X2XA 1TONA 2FOHA 2IOTA 1NFUA 5FXLA 2ALVA 4RN6A 3M35A 2PKSC 4I8KA 1ZTJA 4FVBA 3LC3A 2H6MA 1HRTH 3Q76A 4NZQA 2SFAA 1EAWA 4H6SB 4YO9A 3SJIA 1XUKA 1HAPH 1IHTH 4HTCH 2VIOA 2ZDNA 4AYYB 1TRMA 4ESTE 1FZZA 1QA7A 2JKHA 1B5GH 3LH3A 1SOZA 4RKJB 3MWIU 1A5IA 1GJAB 2NU4E 1ZZZA 1MZDA 1MQ6A 1TGSZ 2FYRA 2GDEH 1C5RA 2G52A 2J4IA 3ATMA 2OXSA 1SLWB 4OS1A 1BA8B 1C5MD 5F8ZA 1EAXA 4UFDH 3A87A 2FOBA 1YP9A 1O2JA 1KYNA 2HGTH 1HAYB 1LVBA 1QBVH 1UK3A 1V6DA 1C2DA 2YOLA 1O3JA 4AG1A 1O36A 1S6HA 4WH6A 2ASUB 2DE8A 4K5ZA 3KQDA 1CBWB 4TPIZ 2GCHG 1NFWA 1SGYE 3SUGA 3VB6A 5EOKA 2A4QA 2O8TA 3KN2A 3NPSA 5CE1A 4GAWA 1GCDA 1D6WA 1C2LA 2BM2A 4QT8C 3HK3B 3V0XA 2Z6BD 3RU4D 5EQQA 1P01A 1Z71A 2O8LA 1F0RA 1TPSA 2ZGCA 3SBKA 1YCPM 1CA0C 1NRNH 3SHAH 1K1PA 1AI8H 1ZPBA 3HKJB 4D7GA 2BLVA 2C93B 3TLOA 3UREA 1JRSA 2ZO3H 3T27A 2BD5A 1ZLRA 5JBBS 1EOJA 1SHYA 3GCOA 3LGYA 4B74A 1GBHA 1EZSC 1HNEE 5CHAC 2A32A 3UPEA 4ZKSU 4YLUA 3CS7A 3ITIA 4X6MA 4GHTA 1N8OB 3KQCA 5C1UA 4OGYA 3GCTF 2WUBA 1F5LA 2FOEA 4D8NA 1L1JA 3TNSA 4IC6A 5I25A 3A80A 3MH7A 3PROA 1CA0B 3HK6B 3Q3YA 4XBCA 2G5VA 5FPSA 1O2KA 1W10U 3BV9B 2ILNA 4ABFA 2UUKB 2BOKA 2BMGB 1HPGA 2A7JA 5CHAB 3UR6A 3SORA 4E7RG 1Z8IB 1AUJA 1OOKB 2C8YB 3TGIE 4I32A 2ZU4A 2CMYA 3LU9B 4K2YA 1P04A 1V2VT 1FIWA 5C1YA 3LONA 1MUEB 1ANEA 1SLXB 3T29A 4A6LA 1BRCE 1AMHA 2DE9A 1PQ5A 1O2OA 1G2MA 3UQOA 3PLKA 3M3SA 1MBMA 4KKDA 1QIXB 4FUBA 2QYIA 4SGAE 4AN7A 1GI9B 2VH6A 3ZVFA 5C3NA 1PQAA 4NWKA 1RTFB 1K1OA 1HAHH 2FTLE 1AWHB 4A92A 5DJ7A 1QJ1B 3SNEA 4MPUA 3ZYDA 1UK4A 5JBAS 1A2CH 1GGDC 3ELAH 2AMDA 3SNBA 4MQAA 3SU3A 2C8XB 1HAXB 3QTOH 3M7TA 1MKWH 1C9TA 4KELA 1ETRH 1MD8A 4F49A 1VITF 1C5OH 1C5WB 1UVTH 4R0IA 4IBLH 3RXAA 3FFGA 5TJXA 2AYWA 4K3JA 3P8NA 3M7QA 4WMFA 5FX5A 3QWCH 4ISOA 2AMQA 1V2LT 2ZHQH 3I78A 3Q3KA 1CO7E 3PB1E 1P11E 2BDGA 3KEEA 2FI4E 4LZ1H 2UWPA 4A1XA 1Z1JA 1SQTA 1KTTB 1O33A 1T32A 1FI8A 1JOUB 4K8YA 4ABGA 1SGQE 1HAVB 1W7XH 1EPTA 2ULLA 4K1EA 4O97A 3U1IB 1QQUA 4NA9H 4OGXA 5E0HA 1O5FH 3BN9A 1BITA 4AGJA 2NU1E 6GCHG 1TLDA 1DLEA 3IG6B 3ZVGA 1IQNA 2A4RA 3F9HA 1HGTH 3QK1A 4MVNA 4MNWA 3TIUA 1PJPA 3FP7E 1ESAA 4DY7B 1LHCH 5AFYH 5A09A 2WPJS 1OSSA 1C1NA 5DGJA 1BRUP 1FN6A 3DFJA 1D3QB 1ETSH 2ODQA 3KQBA 3RC5A 2HNTF 2I6SA 3V7TA 3BTTE 1HV7A 1F5RA 1KXBA 4XBBA 4CRBA 4X0WU 3U69H 3ZZAA 3GY7A 3M37A 1NESE 3E6PH 1C5XB 4Y6DA 4I8HA 1SBWA 4BANB 3K6ZA 2XWAA 2J95A 3T62A 4B71A 1BMNH 4U32A 2XBXA 1UTKA 1GHAF 1O32A 2FI5E 2O8WA 2OUAA 1PQ7A 5JBCS 1UCYK 1SI5H 3KCGH 1EPTB 3P8FA 5DP3A 1LPGB 4ZHLU 1AVXA 1SMFE 2G4UA 1IQJA 4FUDA 2CGAA 5HM9A 2AS9A 1O5DH 2A2XH 4AYVB 1O2WA 2VIDA 1BDAA 3PMAB 2V3HH 3RUOA 1AE5A 2FEQH 2UWOA 1WU1A 3MYWA 3ZZ8A 1H4WA 2WPKS 3F68H 1C5ZB 2Z3EA 2F9NA 1HJ9A 2PSXA 4YLQH 1F2SE 2QN5T 4PROA 2TIOA 1HXFH 1TMTH 3D23A 4ZKNU 5AVDA 1GJ6A 4ABAA 1L2EA 2FTMA 3F9GA 1K1LA 1IQLA 3SU1A 1WQVH 1BHXB 4ABIA 4D76A 3KQEA 1AUTC 4TWWA 1N6XA 3P95A 4NIXA 3HGPA 1ORFA 4NIYA 2VINA 4DOQA 2D1JA 1A46H 3VEQB 4JZIA 1DY8A 1FONA 4ZROA 2FO9A 3I77A 3OY6U 4K60A 3RP2A 1P06A 1BTPA 5FX6A 1PPGE 3A89A 4JK5A 2OC8A 3SU2A 1BRBE 1S81A 3KF2A 1DOJA 5GCHF 2W3IA 4JZ1A 1DUAA 3A83A 1D3TB 1A5GH 2STBE 1IQFA 3U8RH 3QN7A 3UY9A 1PPZA 1C1PA 1MKXK 2ZFTA 4CR5A 1A61H 3MO3A 1S6FA 2VWOA 2G8TA 1K21H 2PKAB 1G30B 4IW4E 5L6NH 3A8BA 1C1MA 1BTHH 2WUCA 3H7OA 1RGQA 4E06H 4I31A 3AW0A 5TCCA 2P59A 1GHBG 1C9PA 4IGDA 1V2TT 5FCRA 3UWIA 2FLBH 4O03A 1G3DA 3PO1C 3V13A 2QY0B 2BY7X 5GJ4B 3TVJB 2AIPA 1C4V2 1O3DA 1K9OE 3SNCA 4Q7XA 5JBTA 1O2XA 3LT3A 1GI1A 1PQ8A 3BSQA 1SQAA 1QBOA 3A84A 4XOJA 5EQRA 1GVZA 3VB5A 4AX9H 8LPRA 1PPBH 3E0NB 5J4SA 3ZYEA 3UNQA 3SN8A 4Y8YA 1YPMH 1FAKH 2ZTYA 3S9CA 2B5TB 3LGVA 1NC6A 3RMLH 3ZZ5A 1SFIA 1JXPA 1TALA 1H9HE 1TYNA 4YM9A 4JYUH 2XRCA 4JK6A 5ETXA 3TJVA 3ZZ6A 4BTTB 2P3UB 1DXWA 1DE7H 1GI3A 4MPWA 4YZUA 1P02A 1TIOA 2QXJA 1P0SH 4OS6A 1GBTA 1SGIB 1Y3XA 1ABJH 1F92A 2BVSH 4A7IB 2W7UA 4U2WA 3TH3H 2UUJB 3SQEE 3ZZ7A 1VCQA 1O2SA 4DW2U 1NO9H 3S9AA 3EA7A 3GYMA 3RXRA 1C1SA 4KTCA 2GZ8A 1P2OA 3E16B 5E2OA 1DWDH 4DGJA 4D9QA 3I29A 3RDZA 5EODA 1XXFA 3T25A 2QF0A 5DP6A 2P8OC 3EQ0H 3QZQA 2IPHA 4D9RA 4AORA 2Z9LA 2QXGA 1C2EA 2XCNA 2FXRA 1MKXH 2Y81A 1WBGB 2XBVA 4JZFH 5ABWA 1TGNA 4ABEA 2B8OH 2VIWA 1C2MA 1C5QA 3PMHB 4GCHG 4KTSA 5CMXH 3MH4A 3A7ZA 1CQQA 5DK1A 4JCNA 5TCAA 5C5NA 4JZDH 4ZUHA 2H5DA 3NCLA 1F5KU 4MLFB 2P8OB 2SGDE 1C5TA 2TGPZ 3MU1A 1P2QA 2HVXA 1UCYE 3UR9A 5LH8A 3ZVBA 1THPB 4ZXYH 1LHDH 1O3EA 1WOFA 3F1SB 3GY6A 5FBEA 1QBNA 3W95A 1FPCH 1BTWA 4THNH 1T8OA 1TA6A 4TYDA 1C2FA 3GY2A 1NS3A 3T5FH 4UONA 4I7YH 2ZEBA 1K1JA 1A7SA 1K28D 1O2ZA 1GHXH 3A86A 1BOQA 3BIVH 5BPEA 2FZZA 3RXFA 8KME2 2QAAA 1C2GA 4INKA 2BQ6B 2SGEE 1GBEA 4BAKB 4CRAA 5H4IB 1YPLH 1TFXA 3EE0B 4YOIA 3MI4A 2OQ5A 2BD4A 1MU8B 2XBYA 1AU8A 2VNTA 1C2KA 2PFEA 3BTGE 1CE5A 1VZQH 2H5CA 3SJKA 3GISB 2PTNA 4I8GA 4ABHA 2BD3A 4CRGA 2H1UA 1CGHA 1CT0E 2GCTB 1FY8E 2Y6TA 1T4UH 2SNWA 1CHGA 4OS5A 1TPAE 4BOHA 2WINI 1HJAB 1UVOA 3BG4C 3NK8A 1ANDA 1GL0E 2DUCA 2R0LA 1G32B 2R9PA 5K7RA 3O8BA 1KLIH 2ANYA 2BD9A 1K2I1 1P8VC 1O3FA 4ZKRU 4KGAA 2Z3DA 1TMUH 4FU9A 4CREA 1ESTA 3QZRA 1SL3A 1ZR0A 1D9IA 1AZZA 1GJBB 1SGEE 1ELDE 1SG8B 4LZ4B 1O2NA 3OY5U 2YNBA 3RXGA 3E91A 2FOMB 1QL9A 1CBWC 3UTUH 3QO6A 1B0FA 2BXUH 1G3EA 2GT8A 1DICA 3BG4B 5T3HA 2TRMA 3KGPA 5A0AE 1CGJE 3E1XB 3HGNA 1JIMA 1ARCA 3K2UA 1LDTT 4BTIB 4WJG2 1MTUA 3IITA 5DP5A 1MBQA 1GMHF 2XBWA 3JZ2B 2VWNA 1TX7A 3RXUA 3TU7H 1OWIA 3EYDA 1QCPA 2Y5HA 1GVLA 1V2UT 1Z8GA 1ZTLA 2BOHB 2P93A 2ZF0H 4R8TB 1UTLM 2P16A 1W13U 4GSOA 1GJ5H 2ODYB 3GY8A 1L4DA 1W2KH 1C2IA 5JB9S 2R0KA 2HALA 2AIQA 3SOSA 3VFEA 1NRQH 2RCEA 1GBAA 1SGRE 1A3EH 1N8OC 3QGJA 5JYIA 3SV6A 2P3FH 3GY4A 4IN1A 5E8EH 4X2WA 5DG6A 1DFPA 3A7VA 1EAUA 2SGFE 3V3MA 4DIIH 3E0PB 1MKWK 1BJVA 1G37A 1H8DH 1EATA 1JMOH 1N6YA 7ESTE 1Q31A 3RM0H 1EQ9A 1CT4E 2HOBA 1V3XA 1W14U 2Y7XA 3M5OA 3RXHA 5A8ZA 1ETTH 5EXMA 1E35B 1DXPA 3NKKA 3RMNH 1IQEA 3H5CB 1FQ3A 1QURH 1Q3XA 1P10A 2GKVE 2Z9JA 4FU8A 2BD7A 4WY3A 2A5IA 1EJAA 1RIWC 1KXDA 1O5AB 1T8NA 3TJOA 3L6PA 4AB9A 3O8DA 3MNSA 6ESTA 5DP9A 1VGCC 1G3CA 1J16A 1ELCA 1KTSB 4FUIA 1P03A 4UD9H 5LPFA 3S7HB 1SGTA 6GCHF 1LVMA 2P95A 1O3BA 1HLTH 4WH8A 1SLUB 3TGKE 5EU8A 4X8TH 3UUZA 1LKAA 3A7XA 4MPXA 4NFEA 1EB2A 1LHEH 1M9UA 2H9EH 3QUMP 1OP0A 2VIVA 2FPZA 3AAVA 3S9BA 4BXWA 1RIWB 2VB0A 3A8AA 2F9BH 4ASHA 2EI6A 3R3GB 5EPNA 1BQYA 1VGCB 1QFKH 4X1PU 4A1VA 2GDDA 4KP0A 3S7KB 2HNTC 4F4OC 1ELVA 1CU1A 3E8LA 2HNTE 3AW1A 1C5SA 2NU2E 2OINA 3A7WA 2I6QA 3LIWA 4TY7A 2RA3A 1Y8TA 1IQIA 1UTMA 4Y71A 1YM0A 2O9QA 4VGCC 4IC5A 2RA0A 1KLTA 1OWJA 8GCHF 1MTNB 3GCHB 5JPMH 2WYGA 1TNGA 1O38A 1GBFA 4MNVA 3V12A 1TWXB 3DFLA 2GD4B 2GT7A 1Z6EA 2AH4X 1XM1A 3ZVCA 4DJZB 1VCWA 2BZ6H 1LPKB 4UE7H 3AASA 3SNAA 2VWLA 3QDZB 2Y82A 2CXVA 1KLJH 1WYKA 1CA8B 5A0CA 3MO6A 1TRNA 3BTQE 4Q80A 4OS2A 4VGCB 2NU3E 2FP7B 4NSYA 2ZFRH 1GBIA 3Q3XA 2QC2A 3OTJE 3SGAE 2OC7A 3ODFA 3URCA 1ZMJA 3PLPA 1O3LA 1RTLA 4X1NU 4ZHMU 1J9CH 1FNIA 1QHRB 2YNAA 1HYLA 4I8JA 4Y8XA 5DKMA 3SV9A 2AFQB 3K6YA 1TGTA 4H42U 3FP8E 2XTTB 1ZHMA 3U1JB 1FV9A 1YF4A 1NFXA 1XUGA 4Y11E 4BNRA 3U8OH 1O39A 1C1UH 4DCDA 1EX3A 1H9IE 1FDPA 2GZ7A 2LNCA 1TBRH 2B9LA 2ZFFH 3PTNA 2PV9B 2QF3A 6LPRA 1ZSJA 2R2WU 1MCTA 1MH0A 1O35A 2ZFPH 2BZAA 1GI5A 3RU4E 1SR5C 1NM6A 5EW2H 1YKTA 2ZHEH 3A7TA 4XSKU 1LMWB 4GVUA 2XC5A 5F8TA 3SV2H 2O8UA 2ZPSA 3MFJA 3GCTG 3NUMA 1KDQA 2BY5X 1SOTA 1LQEA 1BTZA 1MCVA 4FUGA 1XUIA 2QV1A 1DLKB 1YBWA 1C5VA 3UIRA 1F0UA 1YCPH 4E7NA 1ZHRA 3O8RA 1ZHPA 4XE4A 1EPTC 1NU7B 1UVPA 4Y0ZE 1DPOA 4NIWA 2FOCA 1HAIH 3E3TA 5FPTA 3K65B 1DT2A 1O2GH 1C5NH 1ZMLA 1MQ5A 1GCTC 2VU8E 1K22H 1C1RA 1LTOA 1P2JA 2TPIZ 1EKBB 1TQ0B 4J2YB 2J34A 4X8SH 1HCGA 5PTPA 3GDUA 1MMJN 1O5CB 1TNHA 2EA3A 4WXIA 1XVOA 1HAGE 4Z0KA 3LC5A 4YOGA 2TGDA 1BZXE 2OTVA 3KHVA 1AN1E 1BMLA 4TWYA 3K9XB 1SGFA 2K1QA 1NTPA 5HGGA 1OP2A 4BTUB 2PHBA 5L2ZH 1C2JA 3TITA 1S84A 3C27B 1LKBA 2BQWB 3FVFB 1C1OA 1GCTB 3HKIB 1F7ZA 1PYTC 3M5LA 1YLCA 4Y7BA 3SZNA 3DD2H 1DUEA 1QL8A 2O8MA 3LJOA 1HDTH 1O3KA 2ZIQH 3ZVEA 2KAIA 2BXTH 2ZNKH 5SGAE 2A45B 1SQOA 4MPVA 2XNIA 4FUFA 1XMNB 2D8WA 9LPRA 1BBRH 3KNXA 3RXLA 1VITG 4DURA 1E34B 1QGFA 3ZV8A 2JH0D 3KL6A 1DX5M 4CH8B 4B2CA 4DIHH 5AHGH 2HPPH 3GDSA 1E37B 2Y5FA 3PMJA 3GDVA 3RC6A 1LPZB 2CF8H 2FS9A 1A5HA 2ZU2A 1XKAC 3M5NA 4RKOB 3URDA
chains in the Genus database with same CATH superfamily
2FOGA 2ZU1A 4IN2A 3ZZ3A 4CBNA 1S83A 3DA9B 1K1IA 1O3MA 1GHVH 1FMGA 4TT3D 3RXJA 2RDLA 2Y7ZA 3AAUA 1ZYOA 3M3VA 2ANMH 3NZIA 5JDUB 2LELA 3RXBA 4O3TA 4X2VA 1OHHD 4A1TA 1ACBE 4Y79A 1ZTKA 1C1TA 1AKSA 5ESBA 3D65E 1IQGA 2C3SA 1BRAA 2VGCC 1GJCB 2M5TA 4NA8A 4Q7ZA 2XC0A 3SQHE 2A5KA 1CGIE 4B1TA 4GCHF 4LK4A 3SNDA 1OYTH 1WTHD 3SJOA 2A5AA 2ZQ2A 2JH6D 3BF6H 4FUEA 5EJ1A 5EPYA 1SGDE 1HBTH 5K0HA 5L30H 3RXTA 1W0YH 2BDYA 1YPJH 3RU4T 1Y5UT 1FLEE 1O2RA 2F9UA 1HFDA 2F3CE 3MO9A 5C0UA 1OS8A 4FU7A 2ALPA 2BY9X 1V2KT 3MU4A 2EY4C 1GI2A 5EJZA 4B75A 3H09A 1EZXC 2FOFA 2CHAC 1FUJA 3PWCA 2VGCB 2HRVA 1O5BB 5DO4H 1BUIA 2IJD1 1Y59T 1E1QD 3A85A 2J9NA 1HUTH 1KXAA 2QXHA 5EW1H 1JBUH 3EDXB 2HLCA 1LQDB 4FUHA 1CT2E 4YT7H 3A7YA 2HVYB 4SGBE 4NCYA 1O5GH 1U6QA 1FY3A 1P2MA 4IMQA 4M7GA 1V2PT 1EUFA 1UHBA 5GDSH 1O2MA 2BLOA 2ZGXH 2ZU3A 3UOUA 2ANWA 1ZJKA 1JIRA 4YXWD 1AKSB 1ZGIA 3SU5A 5GXPA 3ATLA 5A0BA 2XW9A 1L1NA 1O2QA 1KMHB 1XUJA 2CHAB 4BAHB 4K1SA 1CVWH 2BD8A 2P3TB 5G4BA 1ELGA 3U8TH 4X8VH 2FS8A 1GWAA 2W5EA 1O3NA 1SHHB 3HPTB 3DSOA 4ISLA 1WDIA 4H4FA 4ZCNA 4X1SU 1P9UA 1BCUH 2EC9H 2AMPA 3SU6A 1O2YA 3B23B 1MTVA 3PV2A 1A3BH 1V2MT 1GI4A 1PPCE 2QCYA 3A8DA 3BTKE 3M7UA 3Q00A 3RLWH 2BLWA 1O37A 2F83A 3ATIA 3P8OA 3RXMA 4FVDA 3EAJA 2ZHFH 1EAIA 4ABJA 1BTYA 1K1MA 5DP7A 1ANCA 1QB1A 1T8MA 5DPAA 2KCOA 2UUYA 2TBSA 7GCHG 1ZMNA 5HXFA 2ZCKP 1S0RA 2C4FH 1FAXA 2PWXA 2ZECA 3SV7A 1HB0B 1QRZA 3OTPA 5GCHG 5C20A 4NSVA 1UTNA 4NWLA 5E0GA 3M5MA 2OC1A 1H9LB 2EI7A 2OP9A 1E36B 1SSXA 1O2IA 4X1QU 2ZQ1A 2QIQA 4ISIH 1AVGH 2AERH 2W26A 2FMJA 3BG8A 3G01A 3E90B 2A1DB 2XXLA 3SO3A 5GIBA 2G4TA 1GJ7B 1OYQA 1TNIA 1GDUA 2FODA 3CENA 3MOCA 2ZDKA 1AO5A 4ZAEA 1QR3E 5T6DA 3BTME 2GCHF 3SYJA 4Y10E 3UNRA 2Y5GA 2GCTC 3C1KA 4YTAA 3TH2H 2BD2A 5A8YA 4RSPA 1EZQA 1SFQB 2FX4A 3ATKA 1NU9A 1YPKH 4MNYA 1HJAC 1Z1IA 2D2DA 1C1QA 3SGBE 4FXGH 1TNKA 2GZ9A 2NWNA 1SGPE 2G00A 1NROH 3P8GA 3TH4H 2EEKA 3BEUA 2ZZUH 3UQVA 1GG6C 2QXIA 1S82A 1WQSA 3BTWE 4K69A 1NY22 1XX9A 4MNXA 1WAYB 1D3DB 2BY6X 3RXVA 3OEED 4JZEH 2QF5A 1FXYA 3SUDA 2ZCHP 4X2YA 2ZPRA 3EA8A 1QL7A 1THRH 3QLPH 2K0QA 2ZA5A 2OLGA 4MG3A 2TGTA 2OBOA 1OKXA 2Q6DA 1CSOE 3N7OA 1TRYA 1UVSH 1HIAA 1EP5A 1UO6A 1AZ8A 1TPPA 1K1NA 1KY9A 2BTCE 2VH0A 1V2WT 1Z7KA 1P3CA 3ESTA 3SU0A 3GICB 1AGJA 3LPRA 3ZVAA 1O3PB 1UVUH 1ZOMA 8ESTE 3DT0H 1BMFD 1GG6B 1RD3B 4JMYA 1FY1A 4O9VA 1DSTA 2VJ1A 2ZFSA 1F0SA 2OC0A 3T28A 3ZZDA 1ELEE 3EGKH 1O2VA 1GI6A 3VB3A 4AFUA 1IQKA 1H8IH 2AHME 1GMDG 2FX6A 4P02A 1GMCG 1VR1H 3PV4A 1B0EA 1O5EH 4CH2B 1YPGH 4YOJA 1AWFH 2IN2A 1NN6A 2L6OA 1GVKB 3M36A 2BB4A 4CHAB 2AEIH 2WPIS 1L1GA 2BYAX 1A0JA 4BAOB 3VB7A 3AVZA 3SGQE 3HATH 1ELFA 3RC4A 4B73A 1GJ8B 2XYAA 2FM2A 1FPHH 2J92A 2V0BA 2ZDMA 5ESTE 3H7TA 1C2HA 3WWBA 2PKSB 2G55A 5FL7D 3ZZCA 4I8LA 2ZFQH 5DSFA 1V2JT 1ELAA 3F9FA 1ELTA 3BTDE 1D6RA 2ZTXA 4AGKA 1LVOA 1XUFA 4Y7AA 2WYJA 1HIAB 1UJ1A 5EXNA 1GDNA 1O30A 3MTYA 4HGCA 1DDJA 3SV8A 1XXDA 3A81A 2A7CA 2Z9IA 3MMGA 2JJ2D 2SGPE 3ZZ4A 1SB1H 3PLBA 2JJ1D 3D49H 1NRSH 1C1VH 2A2QH 4JYVH 1OWDA 1HAOH 1TA2A 1AHTH 3P17H 1NBMD 3F3BA 1RRKA 1AFEH 2LPRA 2JH5D 1TE0A 2M2AA 2F9PA 2GVFA 2K8IA 1UW7A 1A1RA 1Y3YA 1YGCH 2ZCLP 1BT7A 1CHOG 3BTEE 1P05A 1TB6H 1A0HB 2KFWA 3LJJA 2XWBI 2ESTE 1QB9A 1Z8JB 3A82A 4NZLA 1DWCH 5E2PA 2PSYA 5EQSA 5I46H 3F6UH 1XUHA 3LDXH 1GBJA 2V35A 3LGUA 4WMDA 4AFZA 3PMBB 2HWLB 1MTNC 3GCHC 2Z9KA 3ZV9A 1O2TA 1J8AA 3LGIA 1WSSH 2BX3A 2R3YA 4YESB 1TOMH 1A4WH 1ARBA 1AY6H 1QRWA 3STJA 4CRFA 3DSGA 2HPQH 1C5LH 1YCPK 4LXBH 2ZGJA 4Y0YE 1O2PA 4B2BA 1P12E 1S0QA 2QA9E 4LOYH 1T31A 2QF4A 3M3TA 4IMZA 1OP8A 4X1RU 3P92A 4Z6AH 5FBIA 1V2NT 1VJAU 3W94A 1SGCA 2BX4A 1OPHB 4AOQA 2GMTC 4B2AA 3ZIAD 5GWZA 2KCYA 2Q6FA 4NA7A 4F55A 3Q77A 4DVAU 1W7GH 2ANKH 3F2HA 4GLYA 1ZPCA 1ZPZA 2H9TH 1VCPA 1Y3UA 1L0ZA 1A0LA 1Q2WA 2FYQA 4MTBA 1OXGA 1G9IE 2ZI2H 1GBDA 1PYTD 1QTFA 2R2MB 1Y3WA 1HAVA 1BJUA 1GMHG 1W12U 2ZGBH 3RLYH 3SJ9A 3VXEH 1RFNA 1GI8B 3TNTA 1WUNH 4WVPE 4HI3A 3B8JA 1C5YB 2B7DH 2PR3A 2GMTB 2J94A 2W3KA 4AFQA 1YC0A 2BDCA 3LGWA 1GHWH 2FLRH 5FCKA 1G3BA 1RS0A 2GGVB 1SPJA 2VIPA 1MZAA 1P2KA 4Y76A 2Q1JA 1T4VH 4TPYA 3UB0A 2XCFA 5C5OA 2W6JD 3GOVB 2JETC 1TAWA 3MH5A 7LPRA 1GI0A 4X6PA 4K1TA 2STAE 2CJIA 1BBRK 1THSH 1JWTA 5E0JA 3SUEA 1O0DH 4B76A 2TGAA 4M9FA 1J14A 5JB8S 1QJ6B 3OU0A 3RM2H 1MD7A 1DWBH 1GBKA 3QTVH 1V2RT 3B9FH 4Z1MD 2SGAA 1P9SA 1TQ7B 2EI8A 2ZHWH 3GY3A 1XVMA 1EZUC 5EG4A 1INCA 4X8UH 3SI3H 2C8WB 2PTCE 1O3IA 1DS2E 3PM3A 1C4Y2 3F0PA 1B7XB 1E0FD 1GGDB 1S6LA 2KZ4A 3OX7U 3IWMA 5F03A 1TBZH 1Z8RA 3S0NA 4XBDA 3L33A 1O34A 4RT0A 3BEIB 2JETB 2W7SA 1EJNA 1NPMA 3ZVDA 1O3OA 1VJ9U 1Y5BT 2V7QD 1MABB 3FAOA 5A2MH 5AF9H 3A8CA 1FY4A 4JYTA 4ABBA 2ZG0H 2VVVA 3N7EA 2R3UA 2BHGA 2G5NA 1GHZA 4BXSA 1ZSLA 1DM4B 3L3TA 3RMOH 3SW2B 1FY5A 1OWHA 2WV5A 4NIVA 4ZXXH 3PTBA 5FHTA 1TABE 3D62A 3M61U 2THFB 4OS7A 4E05H 1LHFH 1TPOA 3BIUH 4XFQA 3RXSA 2AGIX 1O2LA 3MNXA 4FUJA 2CF9H 3MNCA 2ZKSA 4HZHA 2J98B 1TGCA 1GHBF 1P09A 4NGAH 2BDHA 3TJNA 1KSNA 1ELBA 1V2ST 3UNSA 4UFFH 1ID5H 8GCHG 3KIDU 2PUQH 3DHKH 1T8LA 1NRPH 2Z7FE 3FANA 2OQUA 4XDEA 1GJ4H 1EFRD 3RXKA 5HMAA 4HFPB 4WWYA 1S5SA 2BDAA 1GBCA 1KIGH 1DY9A 1KDQB 1SVPA 2ZTZA 1TGBA 1QA0A 1O31A 5C1XA 3GCNA 3P6ZB 3EA9A 3O8CA 3DUXH 1JRTA 4H6TA 2VVUA 3MU8A 1EB1H 3BTFE 4RT1A 1MTWA 5EGMA 1BTXA 1MAXA 2FWWA 3RXEA 1J17T 4AZ2B 1Y5AT 1IQHA 1C1WH 1NRRH 1EOLA 2V3OH 3TPIZ 4CR9A 1DVAH 1UTQA 5EXLA 1ABIH 5LPEA 1BMMH 1PPEE 1WV7H 3SI4H 1HAZB 2ZDLA 3RXDA 3MNBA 4OS4A 4NG9H 2ZDAH 2PKAA 3WY8A 2V3MA 1ZRBA 4B6FA 4FUCA 2F91A 3SUFA 1RXPA 1IOEA 4UFEH 5T6GA 3LH1A 1GBLA 4X6OA 4TY6A 1GBBA 3OYPA 1D4PB 4ACAA 1D3PB 3PWBA 1KXCA 2FIRH 1ZJDA 1W11U 2FDAA 3GYLB 3NRLA 4U30A 1P2IA 1G2LA 2AGEX 2BVXH 9ESTA 3RMMH 2A4OA 1V2OT 4WF8A 1UMAH 2PUXB 2A31A 1BB0B 3F2GA 2Q6GA 1S85A 1BIOA 3T2NA 2ZDVH 1LO6A 5KEDA 3OSYA 1YLDA 5B6LA 1RJXB 1AIXH 1NZQH 3U98H 3SZEA 1EXFA 3NWUA 4OM9A 1DITH 2KAIB 4AB8A 7GCHF 2Z9GA 3ZZBA 3CP7A 1O3HA 5C17A 2CV3A 1OWEA 2UUFB 2WV9A 2B0FA 2IJOB 4Y8ZA 3RXPA 2GV6A 3LOXA 4UEHH 2RG3A 3RXCA 4X6NA 2Z3CA 5LGOA 2Y80A 2OD3B 2QE7D 3SHCH 5B6OA 1TNLA 5DP4A 4A5TS 1IHSH 1QZ8A 1C5PA 3ENSB 1QNJA 1XKBC 4HG6A 4WMEA 2SGQE 1KXFA 6CHAC 2OCVB 1L4ZA 2WPHS 3MHWU 3T26A 2GP9B 3ODDA 2FOAA 2QGRA 1GHAG 2G51A 7KMEH 1O3GA 1YPHC 3NXPA 2BY8X 1UCYH 1TX8A 1N1LA 1YPHE 1SGNE 2NU0E 3PYHA 3MU5A 1BHXF 3U9AH 5HM2A 1IQMA 2GX4A 1WTGH 3VG8A 1TMBH 1P2NA 1VKYA 4BAQB 1DSUA 4CRDA 3VPKA 1AVWA 1AFQC 1LHGH 1GPZA 1O3AA 1IAUA 2YMSD 2AGGX 1G36A 1BBRE 1GJDB 2ZP0H 4WXVA 6CHAB 4I33A 4IS5A 3VXFH 1AB9C 3LGTA 2GTBA 1TOCB 1Z6JH 3RXIA 1YYY1 1F0TA 3RXOA 1H1BA 1W3CA 3LKWA 5LPRA 2HLDD 1T7CA 5T6FA 3PO1B 4K8BA 1E38B 2GV7A 5F8XA 5DP8A 3FO8D 3UWJH 5J4QA 1ESBA 3UOPA 2WPMS 2ZC9H 2FESH 2WPLS 5A8XA 1RTKA 1UK2A 2PGBB 2XC4A 3QGNB 4ZKOU 3DCLA 1AFQB 4MDSA 1J15A 2PW8H 5BRRE 3CS0A 2F9VA 2G81E 2WV4A 3S69A 1QQ4A 1AB9B 1NFYA 4Q2KA 1GBMA 2BDBA 1MU6B 2A4GA 3ATWA 1AE8H 3VGCC 3WW7A 5FAHA 1PFXC 4Q4LA 1GL1A 2PGQB 3ZZ9A 1BTUA 2PLXA 5IDKA 1YPEH 4ZH8A 1EJMA 2BDIA 1GMDF 2Z94A 1LCYA 5AFZH 4DG4A 4INLA 1V2QT 1GMCF 3FZDA 1EASA 1UTJA 1ZRKA 1ZGVA 1UTOA 2VIQA 1QB6A 4ABDA 1UHBB 5IYTA 4BAMB 4CBOA 1UTPA 1C5UA 1W8BH 1ZSKA 4ASUD 1P57B 2ZHDA 4ISNA 3RXQA 4INHA 3TJUA 1BMAA 4Q7YA 1COWD 1Y3VA 3VGCB 2H9HA 2P94A 1X7AC 3TK5A 1O2HA 3FP6E 1MAYA 3TK6A 1PPHE 2VVCA 1C4U2 2CN0H 2D26C 3R0FA 1GDQA 2ZGHA 1NT1A 5C67A 2ZU5A 2J2UA 3STIA 4D7FA 1WCZA 5F6MA 1MTSA 2UWLA 1AD8H 4AFSA 1KXEA 1HJ8A 2FI3E 3VB4A 2JDID 4UFGH 2SNVA 2OBQA 5C94A 4O3UA 1TNJA 2V6NA 4DT7B 4NFFA 3FN8A 2BVRH 3TK9A 2VBCA 3MH6A 1QJ7B 4TSFD 1GJ9B 1OX1A 4ZMAH 2F9OA 3F9EA 3JZ1B 1PPFE 1DWEH 1TBQH 2C90B 3A88A 4UDWH 3TGJE 1GHYH 1SC8U 4U01A 1HXEH 3QX5H 2C8ZB 3MU0A 5T1VA 1FIZA 2ZWLH 2BLQA 4AG2A 1TX6A 1SGFG 1SLVB 5GNDA 4ISHH 4GHQA 2ODPA 5HYOA 4ZHAA 1CHOF 1QY6A 1W0ZU 3SJ8A 2J38A 5FPYA 1K0HA 1AQ7A 2WPDD 1VITH 5C2ZA 1DANH 1O3CA 4CRCA 4GUXA 1FJSA 2F43B 2ZPQA 2A7HA 1QRXA 1GI7B 2BQ7B 4KTUA 1FN8A 3BEFB 3GY5A 4GPGA 3P70B 1ANBA 1P3EA 2VWMA 3BTHE 4J1YA 5L2YH 2A0QB 1SKYE 4CHAC 5GPIB 3FZZA 1O2UA 4YT6H 1LVYA 3SU4A 2H2ZA 1EP6A 1OWKA 3UFAA 4X2XA 1TONA 2FOHA 2IOTA 1NFUA 5FXLA 2ALVA 4RN6A 3M35A 2PKSC 4I8KA 5IK2D 1ZTJA 4FVBA 3LC3A 2H6MA 1HRTH 2RFKC 3Q76A 4NZQA 2SFAA 1EAWA 4H6SB 4YO9A 3SJIA 1XUKA 1HAPH 1IHTH 4HTCH 2VIOA 2ZDNA 4AYYB 1TRMA 4ESTE 1FZZA 1QA7A 2JKHA 5DN6D 1B5GH 3LH3A 2KR7A 1SOZA 4RKJB 3MWIU 1A5IA 1GJAB 2NU4E 1ZZZA 1MZDA 1MQ6A 1TGSZ 2FYRA 2GDEH 1C5RA 2G52A 2J4IA 3ATMA 2OXSA 1SLWB 4OS1A 1BA8B 1C5MD 5F8ZA 1EAXA 4UFDH 3A87A 2FOBA 1YP9A 1O2JA 1KYNA 2HGTH 1HAYB 1LVBA 1QBVH 1UK3A 1V6DA 1C2DA 2YOLA 1O3JA 4AG1A 1O36A 1S6HA 4WH6A 2ASUB 2DE8A 4K5ZA 3KQDA 1CBWB 4TPIZ 2GCHG 1NFWA 1SGYE 3SUGA 3VB6A 5EOKA 2A4QA 2O8TA 3KN2A 3NPSA 5CE1A 4GAWA 1GCDA 1D6WA 1C2LA 2BM2A 4QT8C 3HK3B 3V0XA 2Z6BD 3RU4D 5EQQA 1P01A 1Z71A 2O8LA 1F0RA 1TPSA 2ZGCA 3SBKA 1YCPM 1CA0C 1NRNH 3SHAH 1K1PA 1AI8H 1ZPBA 3HKJB 4D7GA 2BLVA 2C93B 3TLOA 3UREA 1JRSA 2ZO3H 2KX4A 3T27A 2BD5A 1ZLRA 5JBBS 1EOJA 1SHYA 3GCOA 3LGYA 4B74A 1GBHA 1EZSC 1HNEE 5CHAC 2A32A 3UPEA 4ZKSU 4YLUA 3CS7A 3ITIA 4X6MA 4GHTA 1N8OB 3KQCA 5C1UA 4OGYA 3GCTF 2WUBA 3OEHD 1F5LA 2FOEA 4D8NA 2JIZD 1L1JA 3TNSA 4IC6A 3UAIC 5I25A 3A80A 3MH7A 3PROA 1W0JD 1CA0B 3HK6B 3Q3YA 4XBCA 2G5VA 5FPSA 1O2KA 1W10U 3BV9B 2ILNA 4ABFA 2UUKB 2BOKA 2BMGB 1HPGA 2A7JA 5CHAB 3UR6A 3SORA 4E7RG 1Z8IB 1AUJA 1OOKB 2C8YB 3TGIE 4I32A 2ZU4A 2CMYA 3LU9B 4K2YA 1P04A 1V2VT 1FIWA 5C1YA 3LONA 1MUEB 1ANEA 1SLXB 3T29A 4A6LA 1BRCE 1AMHA 2DE9A 1PQ5A 4XRNA 1O2OA 1G2MA 3UQOA 2J5UA 3PLKA 3M3SA 3OAAD 1MBMA 4KKDA 1QIXB 4FUBA 2QYIA 4SGAE 4AN7A 3MQKC 1GI9B 2VH6A 3ZVFA 4AC9A 5C3NA 1PQAA 4NWKA 1RTFB 1K1OA 1HAHH 2FTLE 1AWHB 4A92A 5DJ7A 1QJ1B 3SNEA 4MPUA 3ZYDA 1UK4A 5JBAS 1A2CH 1GGDC 3ELAH 2AMDA 3SNBA 4MQAA 3SU3A 2C8XB 1HAXB 3QTOH 3M7TA 1MKWH 2PP6A 1C9TA 4KELA 1ETRH 1MD8A 4F49A 1VITF 1C5OH 1C5WB 1UVTH 4R0IA 4IBLH 3RXAA 3FFGA 5TJXA 2AYWA 4K3JA 3P8NA 3M7QA 4WMFA 5FX5A 3QWCH 4ISOA 2AMQA 1V2LT 2ZHQH 3I78A 3Q3KA 1CO7E 3PB1E 1P11E 2BDGA 3KEEA 2FI4E 4LZ1H 2UWPA 4A1XA 1Z1JA 1SQTA 1KTTB 1O33A 1T32A 1FI8A 1JOUB 4K8YA 4ABGA 1SGQE 1HAVB 1NBME 5CHBA 1W7XH 1EPTA 2ULLA 4K1EA 4O97A 3U1IB 1QQUA 4NA9H 4OGXA 5E0HA 1O5FH 3BN9A 1BITA 4AGJA 2F4LA 2NU1E 6GCHG 2XOKD 1TLDA 1DLEA 3IG6B 3ZVGA 1IQNA 2A4RA 3F9HA 1HGTH 3QK1A 4MVNA 4MNWA 3TIUA 1PJPA 3FP7E 5HKKD 1ESAA 3FOAA 4DY7B 1LHCH 5AFYH 5A09A 2WPJS 1OSSA 1C1NA 5DGJA 1BRUP 1FN6A 3DFJA 1D3QB 1ETSH 4FOUC 2ODQA 3KQBA 3RC5A 2HNTF 2I6SA 3V7TA 3BTTE 1HV7A 1F5RA 1KXBA 4XBBA 4CRBA 5HIYA 4X0WU 3U69H 3ZZAA 3GY7A 3M37A 1NESE 3E6PH 1C5XB 2EQNA 4Y6DA 4I8HA 1SBWA 4BANB 3K6ZA 2XWAA 2J95A 3T62A 3GS9A 4B71A 1BMNH 4I86A 4U32A 2XBXA 1UTKA 1GHAF 1O32A 2FI5E 2O8WA 2OUAA 4RI0A 1PQ7A 5JBCS 1UCYK 1SI5H 3KCGH 1EPTB 3P8FA 5DP3A 1LPGB 4ZHLU 1AVXA 1SMFE 2G4UA 1IQJA 4FUDA 2CGAA 5HM9A 2AS9A 1O5DH 2A2XH 4AYVB 1O2WA 2VIDA 1BDAA 3PMAB 2V3HH 3RUOA 1AE5A 2FEQH 2UWOA 1WU1A 3MYWA 3ZZ8A 1H4WA 2WPKS 3F68H 1C5ZB 2Z3EA 2F9NA 1HJ9A 2PSXA 4YLQH 1F2SE 2QN5T 4PROA 2TIOA 1HXFH 1TMTH 3D23A 4ZKNU 5AVDA 1GJ6A 4ABAA 1L2EA 2FTMA 3F9GA 1K1LA 1IQLA 3SU1A 1WQVH 1BHXB 5KGOA 4ABIA 4D76A 3KQEA 1AUTC 4TWWA 1N6XA 3P95A 1YY3A 4NIXA 3HGPA 1ORFA 4NIYA 2VINA 4DOQA 2D1JA 1A46H 3VEQB 4JZIA 1DY8A 1FONA 4ZROA 2FO9A 2LP6A 3I77A 3OY6U 4K60A 3RP2A 1P06A 1BTPA 5FX6A 1PPGE 3A89A 4JK5A 2OC8A 3SU2A 1BRBE 1S81A 3KF2A 1DOJA 5GCHF 2W3IA 4JZ1A 1DUAA 3A83A 1D3TB 1A5GH 2STBE 1IQFA 3U8RH 3QN7A 3UY9A 1PPZA 1C1PA 1MKXK 2ZFTA 4CR5A 1A61H 3MO3A 1S6FA 2VWOA 2G8TA 1K21H 2PKAB 1G30B 2KM0A 4IW4E 5L6NH 1YLNA 3A8BA 1C1MA 1BTHH 2WUCA 3H7OA 1RGQA 4E06H 4P00A 4I31A 3AW0A 5TCCA 2P59A 1GHBG 1C9PA 4IGDA 1V2TT 5FCRA 3UWIA 2FLBH 4O03A 1G3DA 3PO1C 3V13A 2QY0B 2BY7X 5GJ4B 3TVJB 2AIPA 1C4V2 1O3DA 2GJGA 1K9OE 3SNCA 4Q7XA 5JBTA 1O2XA 3LT3A 3OFND 1GI1A 1PQ8A 4B6EA 3AK5A 5CDFE 1SQRA 3BSQA 1SQAA 1QBOA 3A84A 4XOJA 5EQRA 1GVZA 3VB5A 4AX9H 8LPRA 1PPBH 1FX0B 3E0NB 5J4SA 3ZYEA 3UNQA 3WWFA 1W0KD 4Y8YA 3SN8A 1YPMH 1FAKH 2ZTYA 4XD7D 3S9CA 2B5TB 3LGVA 1NC6A 3RMLH 3ZZ5A 1SFIA 1JXPA 1TALA 1H9HE 1TYNA 4YM9A 4JYUH 2XRCA 4JK6A 5ETXA 3TJVA 3ZZ6A 3PRDA 4BTTB 2P3UB 1DXWA 3U28C 1DE7H 1GI3A 4MPWA 4YZUA 1P02A 1TIOA 2QXJA 1P0SH 4OS6A 1GBTA 1SGIB 1Y3XA 1ABJH 1F92A 2BVSH 4A7IB 2W7UA 4U2WA 3TH3H 2UUJB 3SQEE 3ZZ7A 1VCQA 1O2SA 4DW2U 1NO9H 3S9AA 3EA7A 3GYMA 3RXRA 1C1SA 4KTCA 2GZ8A 1P2OA 3E16B 5E2OA 1DWDH 4DGJA 4D9QA 3I29A 3RDZA 5EODA 1XXFA 3T25A 2QF0A 5DP6A 2P8OC 3EQ0H 3QZQA 2IPHA 4D9RA 4AORA 2Z9LA 1WXRA 2QXGA 1C2EA 2XCNA 2FXRA 1MKXH 2Y81A 1WBGB 3N7DA 2XBVA 4JZFH 5ABWA 1TGNA 4ABEA 3W1EA 2B8OH 2VIWA 1C2MA 1C5QA 2IPQX 3PMHB 4GCHG 4KTSA 5CMXH 3MH4A 3A7ZA 1CQQA 5DK1A 4JCNA 5TCAA 5C5NA 4JZDH 4ZUHA 2H5DA 3NCLA 1F5KU 4MLFB 2P8OB 2SGDE 1C5TA 2TGPZ 3MU1A 3PRBA 1P2QA 2HVXA 1UCYE 3UR9A 5LH8A 3ZVBA 1THPB 4ZXYH 1LHDH 1O3EA 1WOFA 3F1SB 3GY6A 5FBEA 1QBNA 3W95A 1FPCH 5HIZA 1BTWA 4THNH 1T8OA 1TA6A 4TYDA 1C2FA 3GY2A 1NS3A 3T5FH 4UONA 4I7YH 2ZEBA 1K1JA 1A7SA 1K28D 1O2ZA 1GHXH 3A86A 1BOQA 3BIVH 5BPEA 2FZZA 3RXFA 8KME2 2QAAA 1C2GA 4INKA 2BQ6B 2SGEE 1GBEA 4BAKB 4CRAA 2OK5A 5H4IB 1YPLH 1TFXA 3EE0B 4YOIA 3MI4A 2OQ5A 2BD4A 1MU8B 2XBYA 1AU8A 2VNTA 1C2KA 2PFEA 3BTGE 1CE5A 1VZQH 2H5CA 3FKSD 3SJKA 3GISB 2PTNA 4I8GA 4ABHA 2BD3A 4CRGA 2H1UA 1CGHA 1CT0E 2GCTB 1FY8E 2Y6TA 1T4UH 3F2FA 2SNWA 1CHGA 2YMSC 4OS5A 1TPAE 4BOHA 2WINI 1HJAB 1UVOA 3BG4C 3NK8A 1ANDA 1GL0E 2DUCA 2R0LA 1G32B 2R9PA 5K7RA 3O8BA 1KLIH 2ANYA 2BD9A 1K2I1 1P8VC 1O3FA 4ZKRU 4KGAA 2Z3DA 1TMUH 4FU9A 4CREA 1ESTA 3QZRA 1SL3A 1ZR0A 1D9IA 1AZZA 1GJBB 1SGEE 1YWUA 1ELDE 1SG8B 4LZ4B 1O2NA 3OY5U 2YNBA 3RXGA 3E91A 2FOMB 1QL9A 1CBWC 3N99A 3UTUH 3QO6A 2RDEA 2YMSB 1B0FA 2BXUH 1G3EA 2GT8A 1DICA 3BG4B 5T3HA 2CK3D 2L74A 2TRMA 3KGPA 5A0AE 1CGJE 3E1XB 3HGNA 1JIMA 1ARCA 3K2UA 1LDTT 4BTIB 4WJG2 1MTUA 3F0OA 3IITA 5DP5A 1MBQA 2KCAA 1GMHF 2XBWA 3JZ2B 2VWNA 1TX7A 3RXUA 3TU7H 1OWIA 3EYDA 1QCPA 2Y5HA 1GVLA 1V2UT 1Z8GA 1ZTLA 2BOHB 2P93A 2ZF0H 4R8TB 1UTLM 2P16A 1W13U 4GSOA 1GJ5H 2ODYB 3GY8A 1L4DA 1W2KH 1C2IA 4F48B 5JB9S 2R0KA 2HALA 2AIQA 3SOSA 3VFEA 1NRQH 2RCEA 1GBAA 1SGRE 1A3EH 1N8OC 3QGJA 5JYIA 3SV6A 2P3FH 3GY4A 4IN1A 5E8EH 4X2WA 5DG6A 1DFPA 3A7VA 1EAUA 2SGFE 1E1RD 2J97A 3V3MA 4DIIH 3E0PB 1MKWK 1BJVA 1G37A 1H8DH 1EATA 1JMOH 1N6YA 3DSPA 7ESTE 1Q31A 3RM0H 1EQ9A 1CT4E 2HOBA 1V3XA 1W14U 2Y7XA 3M5OA 3RXHA 5A8ZA 1ETTH 5EXMA 1E35B 1DXPA 3NKKA 3RMNH 1IQEA 3H5CB 1FQ3A 1QURH 1Q3XA 1P10A 2GKVE 2Z9JA 4FU8A 2BD7A 4WY3A 2A5IA 2XNDD 1EJAA 1RIWC 1KXDA 1O5AB 1T8NA 3TJOA 3L6PA 4AB9A 3O8DA 3MNSA 6ESTA 5DP9A 1VGCC 2WHXA 1G3CA 1J16A 1ELCA 1KTSB 4FUIA 1P03A 4UD9H 5LPFA 3S7HB 1SGTA 6GCHF 1LVMA 2P95A 1O3BA 1HLTH 4WH8A 1SLUB 3TGKE 5EU8A 4X8TH 3UUZA 1LKAA 3A7XA 4MPXA 4NFEA 1EB2A 1LHEH 1M9UA 2H9EH 3QUMP 1OP0A 2VIVA 2FPZA 3AAVA 3S9BA 1E79D 4BXWA 1RIWB 2VB0A 3A8AA 2F9BH 4ASHA 2EI6A 3R3GB 5EPNA 1BQYA 1VGCB 1QFKH 4X1PU 4A1VA 2GDDA 4KP0A 3S7KB 2HNTC 4F4OC 1ELVA 1CU1A 2WZQA 3E8LA 5C0TA 2HNTE 3AW1A 1C5SA 2NU2E 2OINA 3A7WA 2I6QA 3LIWA 4TY7A 2RA3A 1Y8TA 1IQIA 1UTMA 4Y71A 1YM0A 2O9QA 4VGCC 4IC5A 2RA0A 1KLTA 1OWJA 8GCHF 1MTNB 3GCHB 5JPMH 2WYGA 1TNGA 1O38A 1GBFA 4MNVA 3V12A 1TWXB 4Q63A 3DFLA 2GD4B 1H8HD 2GT7A 1Z6EA 2AH4X 1XM1A 3ZVCA 4DJZB 1VCWA 2BZ6H 1LPKB 4UE7H 3AASA 3SNAA 2VWLA 3QDZB 2Y82A 2CXVA 1KLJH 1WYKA 1CA8B 5A0CA 3MO6A 1TRNA 3BTQE 4Q80A 4OS2A 4VGCB 2NU3E 2FP7B 4NSYA 2ZFRH 1GBIA 3Q3XA 2QC2A 3OTJE 3SGAE 2OC7A 3ODFA 3URCA 3CNRA 1ZMJA 3PLPA 1O3LA 1RTLA 4X1NU 4ZHMU 1J9CH 1FNIA 1QHRB 2YNAA 1HYLA 4I8JA 4Y8XA 5DKMA 3SV9A 2AFQB 3K6YA 1TGTA 4H42U 3FP8E 2XTTB 2J98A 1ZHMA 3U1JB 1FV9A 1YF4A 1NFXA 1XUGA 4Y11E 2WSSD 4BNRA 3U8OH 1O39A 1C1UH 4DCDA 1EX3A 1H9IE 1FDPA 2GZ7A 2LNCA 1TBRH 5EJLA 2B9LA 2ZFFH 3PTNA 2PV9B 2QF3A 6LPRA 1ZSJA 2R2WU 1MCTA 1MH0A 3KYFA 1O35A 2ZFPH 2BZAA 1GI5A 3RU4E 1SR5C 1NM6A 5EW2H 1YKTA 2ZHEH 3A7TA 4XSKU 1LMWB 4GVUA 2XC5A 5F8TA 3SV2H 2O8UA 2ZPSA 3EE7A 3MFJA 3GCTG 3NUMA 1KDQA 2BY5X 1SOTA 1LQEA 1BTZA 1MCVA 4FETA 4FUGA 1XUIA 2QV1A 5EIYA 1DLKB 1YBWA 1C5VA 3UIRA 1F0UA 3KYGA 1YCPH 4E7NA 1ZHRA 3O8RA 1ZHPA 4XE4A 1EPTC 1NU7B 1UVPA 4Y0ZE 1DPOA 4NIWA 2FOCA 1HAIH 3E3TA 5FPTA 3K65B 1DT2A 1O2GH 1C5NH 1ZMLA 1MQ5A 4ACBA 1GCTC 2VU8E 1K22H 1C1RA 1LTOA 1P2JA 2TPIZ 1EKBB 1TQ0B 4J2YB 2J34A 4X8SH 1HCGA 5PTPA 3GDUA 1MMJN 1O5CB 1TNHA 2EA3A 4WXIA 1XVOA 1HAGE 4Z0KA 3LC5A 4YOGA 2TGDA 1BZXE 1H8ED 5F53A 2OTVA 3KHVA 1AN1E 1BMLA 4TWYA 3K9XB 1SGFA 2K1QA 1NTPA 3PV5A 5HGGA 1OP2A 4BTUB 2PHBA 5L2ZH 1C2JA 3TITA 1S84A 3C27B 1LKBA 2BQWB 3FVFB 3KQ5A 1C1OA 1GCTB 3HKIB 1F7ZA 1PYTC 3M5LA 1YLCA 4Y7BA 3SZNA 3DD2H 1DUEA 1QL8A 2O8MA 3LJOA 1HDTH 1O3KA 2ZIQH 3ZVEA 2KAIA 2BXTH 2ZNKH 5SGAE 2A45B 1SQOA 4MPVA 2XNIA 4FUFA 1XMNB 2D8WA 9LPRA 1BBRH 3KNXA 3RXLA 1VITG 4DURA 1E34B 1QGFA 3ZV8A 2JH0D 3KL6A 1DX5M 2W6ID 4CH8B 4B2CA 4DIHH 5AHGH 2HPPH 3GDSA 1E37B 2Y5FA 4DT4A 3PMJA 3GDVA 3OE7D 3RC6A 1LPZB 2CF8H 2FS9A 1A5HA 2ZU2A 1XKAC 3M5NA 4RKOB 3URDA 5KECA 2KCPA
chains in the Genus database with same CATH topology
2FOGA 2ZU1A 4IN2A 3ZZ3A 4CBNA 1S83A 3DA9B 1K1IA 1O3MA 1GHVH 1FMGA 3RXJA 2RDLA 2Y7ZA 3AAUA 1ZYOA 3M3VA 2ANMH 3NZIA 5JDUB 3RXBA 4O3TA 4X2VA 4A1TA 1ACBE 4Y79A 1ZTKA 1C1TA 1AKSA 5ESBA 3D65E 1IQGA 2C3SA 1BRAA 2VGCC 1GJCB 2M5TA 4NA8A 4Q7ZA 2XC0A 3SQHE 2A5KA 1CGIE 4B1TA 4GCHF 4LK4A 3SNDA 1OYTH 1WTHD 3SJOA 2A5AA 2ZQ2A 2JH6D 3BF6H 4FUEA 5EPYA 1SGDE 1HBTH 5K0HA 5L30H 3RXTA 1W0YH 2BDYA 1YPJH 3RU4T 1Y5UT 1FLEE 1O2RA 2F9UA 1HFDA 2F3CE 3MO9A 1OS8A 4FU7A 2ALPA 2BY9X 1V2KT 3MU4A 1GI2A 4B75A 1EZXC 2FOFA 2CHAC 1FUJA 3PWCA 2VGCB 2HRVA 1O5BB 5DO4H 1BUIA 1Y59T 3A85A 2J9NA 1HUTH 1KXAA 2QXHA 5EW1H 1JBUH 3EDXB 2HLCA 1LQDB 4FUHA 1CT2E 4YT7H 3A7YA 4SGBE 4NCYA 1O5GH 1U6QA 1FY3A 1P2MA 4IMQA 4M7GA 1V2PT 1EUFA 1UHBA 5GDSH 1O2MA 2BLOA 2ZGXH 2ZU3A 3UOUA 2ANWA 1ZJKA 1JIRA 1AKSB 1ZGIA 3SU5A 5GXPA 3ATLA 5A0BA 2XW9A 1L1NA 1O2QA 1XUJA 2CHAB 4BAHB 4K1SA 1CVWH 2BD8A 2P3TB 5G4BA 1ELGA 3U8TH 4X8VH 2FS8A 1GWAA 2W5EA 1O3NA 1SHHB 3HPTB 4ISLA 4H4FA 4X1SU 1P9UA 1BCUH 2EC9H 2AMPA 3SU6A 1O2YA 3B23B 1MTVA 1A3BH 1V2MT 1GI4A 1PPCE 2QCYA 3A8DA 3BTKE 3M7UA 3Q00A 3RLWH 2BLWA 1O37A 2F83A 3ATIA 3P8OA 3RXMA 4FVDA 3EAJA 2ZHFH 1EAIA 4ABJA 1BTYA 1K1MA 5DP7A 1ANCA 1QB1A 1T8MA 5DPAA 2UUYA 2TBSA 7GCHG 1ZMNA 5HXFA 2ZCKP 1S0RA 2C4FH 1FAXA 2PWXA 2ZECA 3SV7A 1HB0B 1QRZA 5GCHG 5C20A 4NSVA 1UTNA 4NWLA 5E0GA 3M5MA 2OC1A 1H9LB 2EI7A 2OP9A 1E36B 1SSXA 1O2IA 4X1QU 2ZQ1A 2QIQA 4ISIH 1AVGH 2AERH 2W26A 2FMJA 3BG8A 3G01A 3E90B 2A1DB 2XXLA 3SO3A 5GIBA 2G4TA 1GJ7B 1OYQA 1TNIA 1GDUA 2FODA 3CENA 3MOCA 2ZDKA 1AO5A 4ZAEA 1QR3E 5T6DA 3BTME 2GCHF 4Y10E 3UNRA 2Y5GA 2GCTC 3C1KA 4YTAA 3TH2H 2BD2A 5A8YA 4RSPA 1EZQA 1SFQB 2FX4A 3ATKA 1NU9A 1YPKH 4MNYA 1HJAC 1Z1IA 2D2DA 1C1QA 3SGBE 4FXGH 1TNKA 2GZ9A 2NWNA 1SGPE 2G00A 1NROH 3P8GA 3TH4H 2EEKA 3BEUA 2ZZUH 3UQVA 1GG6C 2QXIA 1S82A 1WQSA 3BTWE 4K69A 1NY22 1XX9A 4MNXA 1WAYB 1D3DB 2BY6X 3RXVA 4JZEH 1FXYA 3SUDA 2ZCHP 4X2YA 2ZPRA 3EA8A 1QL7A 1THRH 3QLPH 2ZA5A 2OLGA 4MG3A 2TGTA 2OBOA 1OKXA 2Q6DA 1CSOE 3N7OA 1TRYA 1UVSH 1HIAA 1EP5A 1UO6A 1AZ8A 1TPPA 1K1NA 1KY9A 2BTCE 2VH0A 1V2WT 1Z7KA 1P3CA 3ESTA 3SU0A 3GICB 1AGJA 3LPRA 3ZVAA 1O3PB 1UVUH 1ZOMA 8ESTE 3DT0H 1GG6B 1RD3B 4JMYA 1FY1A 4O9VA 1DSTA 2VJ1A 2ZFSA 1F0SA 2OC0A 3T28A 3ZZDA 1ELEE 3EGKH 1O2VA 1GI6A 3VB3A 4AFUA 1IQKA 1H8IH 1GMDG 2FX6A 1GMCG 1VR1H 3PV4A 1B0EA 1O5EH 4CH2B 1YPGH 4YOJA 1AWFH 2IN2A 1NN6A 3M36A 1GVKB 2BB4A 4CHAB 2AEIH 2WPIS 1L1GA 2BYAX 1A0JA 4BAOB 3VB7A 3AVZA 3SGQE 3HATH 1ELFA 3RC4A 4B73A 1GJ8B 2XYAA 2FM2A 1FPHH 2J92A 2V0BA 2ZDMA 5ESTE 3H7TA 1C2HA 2PKSB 2G55A 3ZZCA 4I8LA 2ZFQH 1V2JT 1ELAA 3F9FA 1ELTA 3BTDE 1D6RA 2ZTXA 4AGKA 1LVOA 1XUFA 4Y7AA 2WYJA 1HIAB 1UJ1A 5EXNA 1GDNA 1O30A 3MTYA 4HGCA 1DDJA 3SV8A 1XXDA 3A81A 2A7CA 2Z9IA 3MMGA 2SGPE 3ZZ4A 1SB1H 3PLBA 3D49H 1NRSH 1C1VH 2A2QH 4JYVH 1OWDA 1HAOH 1TA2A 1AHTH 3P17H 1RRKA 1AFEH 2LPRA 2JH5D 1TE0A 2F9PA 2GVFA 1A1RA 1Y3YA 1YGCH 2ZCLP 1BT7A 1CHOG 3BTEE 1P05A 1TB6H 1A0HB 3LJJA 2XWBI 2ESTE 1QB9A 1Z8JB 3A82A 4NZLA 1DWCH 5E2PA 2PSYA 5EQSA 5I46H 3F6UH 1XUHA 3LDXH 1GBJA 2V35A 3LGUA 4WMDA 4AFZA 3PMBB 2HWLB 1MTNC 3GCHC 2Z9KA 3ZV9A 1O2TA 1J8AA 3LGIA 1WSSH 2BX3A 2R3YA 4YESB 1TOMH 1A4WH 1ARBA 1AY6H 1QRWA 3STJA 4CRFA 2HPQH 1C5LH 1YCPK 4LXBH 2ZGJA 4Y0YE 1O2PA 4B2BA 1P12E 1S0QA 2QA9E 4LOYH 1T31A 3M3TA 4IMZA 1OP8A 4X1RU 3P92A 4Z6AH 5FBIA 1V2NT 1VJAU 3W94A 1SGCA 2BX4A 1OPHB 4AOQA 2GMTC 4B2AA 5GWZA 2Q6FA 4NA7A 3Q77A 4DVAU 1W7GH 2ANKH 4GLYA 1ZPCA 1ZPZA 2H9TH 1VCPA 1Y3UA 1L0ZA 1A0LA 1Q2WA 2FYQA 4MTBA 1OXGA 1G9IE 2ZI2H 1GBDA 1PYTD 1QTFA 2R2MB 1Y3WA 1HAVA 1BJUA 1GMHG 1W12U 2ZGBH 3RLYH 3SJ9A 3VXEH 1RFNA 1GI8B 3TNTA 1WUNH 4WVPE 4HI3A 3B8JA 1C5YB 2B7DH 2PR3A 2GMTB 2J94A 2W3KA 4AFQA 1YC0A 2BDCA 3LGWA 1GHWH 2FLRH 5FCKA 1G3BA 1RS0A 2GGVB 1SPJA 2VIPA 1MZAA 1P2KA 4Y76A 2Q1JA 1T4VH 4TPYA 2XCFA 5C5OA 3GOVB 2JETC 1TAWA 3MH5A 7LPRA 1GI0A 4X6PA 4K1TA 2STAE 2CJIA 1BBRK 1THSH 1JWTA 5E0JA 3SUEA 1O0DH 4B76A 2TGAA 1J14A 5JB8S 1QJ6B 3OU0A 3RM2H 1MD7A 1DWBH 1GBKA 3QTVH 1V2RT 3B9FH 2SGAA 1P9SA 1TQ7B 2EI8A 2ZHWH 3GY3A 1XVMA 1EZUC 5EG4A 1INCA 4X8UH 3SI3H 2C8WB 2PTCE 1O3IA 1DS2E 3PM3A 1C4Y2 1B7XB 1E0FD 1GGDB 5F03A 3OX7U 3IWMA 1TBZH 1Z8RA 3S0NA 4XBDA 3L33A 1O34A 3BEIB 2JETB 2W7SA 1EJNA 1NPMA 3ZVDA 1O3OA 1VJ9U 1Y5BT 3FAOA 5A2MH 5AF9H 3A8CA 1FY4A 4JYTA 4ABBA 2ZG0H 2VVVA 2R3UA 2BHGA 2G5NA 1GHZA 4BXSA 1ZSLA 1DM4B 3L3TA 3RMOH 3SW2B 1FY5A 1OWHA 2WV5A 4NIVA 4ZXXH 3PTBA 5FHTA 1TABE 3D62A 3M61U 2THFB 4OS7A 4E05H 1LHFH 1TPOA 3BIUH 4XFQA 3RXSA 2AGIX 1O2LA 3MNXA 4FUJA 2CF9H 3MNCA 2ZKSA 4HZHA 1TGCA 1GHBF 1P09A 4NGAH 2BDHA 3TJNA 1KSNA 1ELBA 1V2ST 3UNSA 4UFFH 1ID5H 8GCHG 3KIDU 2PUQH 3DHKH 1T8LA 1NRPH 2Z7FE 3FANA 2OQUA 4XDEA 1GJ4H 3RXKA 5HMAA 4HFPB 4WWYA 1S5SA 2BDAA 1GBCA 1KIGH 1DY9A 1KDQB 1SVPA 2ZTZA 1TGBA 1QA0A 1O31A 5C1XA 3GCNA 3P6ZB 3EA9A 3O8CA 3DUXH 1JRTA 4H6TA 2VVUA 3MU8A 1EB1H 3BTFE 1MTWA 5EGMA 1BTXA 1MAXA 2FWWA 3RXEA 1J17T 4AZ2B 1Y5AT 1IQHA 1C1WH 1NRRH 1EOLA 2V3OH 3TPIZ 4CR9A 1DVAH 1UTQA 5EXLA 1ABIH 5LPEA 1BMMH 1PPEE 1WV7H 3SI4H 1HAZB 2ZDLA 3RXDA 3MNBA 4OS4A 4NG9H 2ZDAH 2PKAA 3WY8A 1ZRBA 4FUCA 2F91A 3SUFA 1RXPA 1IOEA 4UFEH 5T6GA 3LH1A 1GBLA 4X6OA 4TY6A 1GBBA 3OYPA 1D4PB 1D3PB 3PWBA 1KXCA 2FIRH 1ZJDA 1W11U 2FDAA 3GYLB 4U30A 1P2IA 1G2LA 2AGEX 2BVXH 9ESTA 3RMMH 2A4OA 1V2OT 4WF8A 1UMAH 2PUXB 2A31A 1BB0B 2Q6GA 1S85A 1BIOA 3T2NA 2ZDVH 1LO6A 3OSYA 1YLDA 1RJXB 1AIXH 1NZQH 3U98H 1EXFA 3NWUA 1DITH 2KAIB 4AB8A 7GCHF 2Z9GA 3ZZBA 3CP7A 1O3HA 2CV3A 1OWEA 2UUFB 2B0FA 2IJOB 4Y8ZA 3RXPA 2GV6A 3LOXA 4UEHH 2RG3A 3RXCA 4X6NA 2Z3CA 5LGOA 2Y80A 2OD3B 3SHCH 5B6OA 1TNLA 5DP4A 4A5TS 1IHSH 1C5PA 3ENSB 1QNJA 1XKBC 4WMEA 2SGQE 1KXFA 6CHAC 2OCVB 1L4ZA 2WPHS 3MHWU 3T26A 2GP9B 3ODDA 2FOAA 2QGRA 1GHAG 2G51A 7KMEH 1O3GA 1YPHC 3NXPA 2BY8X 1UCYH 1TX8A 1N1LA 1YPHE 1SGNE 2NU0E 3PYHA 3MU5A 1BHXF 3U9AH 5HM2A 1IQMA 2GX4A 1WTGH 1TMBH 1P2NA 4BAQB 1DSUA 4CRDA 3VPKA 1AVWA 1AFQC 1LHGH 1GPZA 1O3AA 1IAUA 2AGGX 1G36A 1BBRE 1GJDB 2ZP0H 4WXVA 6CHAB 4I33A 4IS5A 3VXFH 1AB9C 3LGTA 2GTBA 1TOCB 1Z6JH 3RXIA 1YYY1 1F0TA 3RXOA 1H1BA 1W3CA 3LKWA 5LPRA 1T7CA 5T6FA 3PO1B 4K8BA 1E38B 2GV7A 5F8XA 5DP8A 3UWJH 5J4QA 1ESBA 3UOPA 2WPMS 2ZC9H 2FESH 2WPLS 5A8XA 1RTKA 1UK2A 2PGBB 2XC4A 3QGNB 4ZKOU 1AFQB 4MDSA 1J15A 2PW8H 5BRRE 3CS0A 2F9VA 2G81E 2WV4A 3S69A 1QQ4A 1AB9B 1NFYA 4Q2KA 1GBMA 2BDBA 1MU6B 2A4GA 3ATWA 1AE8H 3VGCC 5FAHA 1PFXC 1GL1A 2PGQB 3ZZ9A 1BTUA 2PLXA 5IDKA 1YPEH 4ZH8A 1EJMA 2BDIA 1GMDF 2Z94A 1LCYA 5AFZH 4DG4A 4INLA 1V2QT 1GMCF 3FZDA 1EASA 1UTJA 1ZRKA 1ZGVA 1UTOA 2VIQA 1QB6A 4ABDA 1UHBB 5IYTA 4BAMB 4CBOA 1UTPA 1C5UA 1W8BH 1ZSKA 1P57B 2ZHDA 4ISNA 3RXQA 4INHA 3TJUA 1BMAA 4Q7YA 1Y3VA 3VGCB 2H9HA 2P94A 1X7AC 3TK5A 1O2HA 3FP6E 1MAYA 3TK6A 1PPHE 2VVCA 1C4U2 2CN0H 2D26C 3R0FA 1GDQA 2ZGHA 1NT1A 5C67A 2ZU5A 2J2UA 3STIA 4D7FA 1WCZA 5F6MA 1MTSA 2UWLA 1AD8H 4AFSA 1KXEA 1HJ8A 2FI3E 3VB4A 4UFGH 2SNVA 2OBQA 4O3UA 1TNJA 2V6NA 4DT7B 4NFFA 2BVRH 3TK9A 3MH6A 1QJ7B 1GJ9B 1OX1A 4ZMAH 2F9OA 3F9EA 3JZ1B 1PPFE 1DWEH 1TBQH 2C90B 3A88A 4UDWH 3TGJE 1GHYH 1SC8U 4U01A 1HXEH 3QX5H 2C8ZB 3MU0A 1FIZA 2ZWLH 2BLQA 4AG2A 1TX6A 1SGFG 1SLVB 4ISHH 4GHQA 2ODPA 5HYOA 4ZHAA 1CHOF 1QY6A 1W0ZU 3SJ8A 2J38A 5FPYA 1AQ7A 1VITH 5C2ZA 1DANH 1O3CA 4CRCA 4GUXA 1FJSA 2ZPQA 2A7HA 1QRXA 1GI7B 2BQ7B 4KTUA 1FN8A 3BEFB 3GY5A 4GPGA 3P70B 1ANBA 1P3EA 2VWMA 3BTHE 4J1YA 5L2YH 2A0QB 4CHAC 5GPIB 3FZZA 1O2UA 4YT6H 1LVYA 3SU4A 2H2ZA 1EP6A 1OWKA 3UFAA 4X2XA 1TONA 2FOHA 2IOTA 1NFUA 5FXLA 2ALVA 4RN6A 3M35A 2PKSC 4I8KA 1ZTJA 4FVBA 3LC3A 2H6MA 1HRTH 3Q76A 4NZQA 2SFAA 1EAWA 4H6SB 4YO9A 3SJIA 1XUKA 1HAPH 1IHTH 4HTCH 2VIOA 2ZDNA 4AYYB 1TRMA 4ESTE 1FZZA 1QA7A 2JKHA 1B5GH 3LH3A 1SOZA 4RKJB 3MWIU 1A5IA 1GJAB 2NU4E 1ZZZA 1MZDA 1MQ6A 1TGSZ 2FYRA 2GDEH 1C5RA 2G52A 2J4IA 3ATMA 2OXSA 1SLWB 4OS1A 1BA8B 1C5MD 5F8ZA 1EAXA 4UFDH 3A87A 2FOBA 1YP9A 1O2JA 1KYNA 2HGTH 1HAYB 1LVBA 1QBVH 1UK3A 1V6DA 1C2DA 2YOLA 1O3JA 4AG1A 1O36A 1S6HA 4WH6A 2ASUB 2DE8A 4K5ZA 3KQDA 1CBWB 4TPIZ 2GCHG