2QF3A

Structure of the delta pdz truncation of the degs protease
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
221
structure length
200
Chain Sequence
QFDSTDETPASYNLAVRRAAPAVVNVYNRGLHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRNFLQTDASINHGNSGGALVNSLGELMGINTLSFPEGIGFAIPFQLATKIMDKLIRDGRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric activation of DegS, a stress sensor PDZ protease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Protease degS
total genus 50
structure length 200
sequence length 221
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf3A02
1TBZH 1VCPA 4E7NA 4INKA 1NTPA 2FX4A 5E0GA 1GJAB 1GMCG 2IPHA 2BDBA 1GHXH 1GJ8B 2FLRH 2OC1A 2AYWA 1PPBH 2STAE 4X6NA 1FY4A 1ETRH 2ASUB 4K1SA 1YCPH 3BTTE 2TGTA 1C9TA 4BTTB 4K1EA 1O2ZA 5FBIA 3TJUA 1HFDA 2NU3E 2C3SA 1DFPA 4UFEH 1AVXA 2OBQA 1NS3A 1TRMA 3P8NA 1Y3XA 4YTAA 1N8OB 4DW2U 3UR6A 1IQGA 3SUGA 4YT7H 1Y3WA 2FDAA 2SFAA 1ELBA 1FN6A 1TOMH 5E2PA 2VH0A 1A0JA 3RXEA 1C1OA 4Q80A 1O3PB 2TPIZ 1MBQA 1SLWB 1XUHA 2ZDLA 4JZFH 4XBDA 1SQOA 1HAYB 1DE7H 1RTLA 2XCFA 1S82A 2ZFFH 2ZHDA 3E90B 4MTBA 1RIWC 3NWUA 1ELFA 2BD4A 1O2GH 2FYQA 3E6PH 1P04A 1V3XA 4OS4A 1JRTA 1O3DA 2XC0A 1ZHPA 1SHHB 1XMNB 2VNTA 2WUCA 1EPTC 2VU8E 1DLEA 5C67A 2B9LA 3FFGA 1ZHRA 3GY8A 2F83A 2OQUA 2OQ5A 1C9PA 1ANDA 2G51A 3SJ9A 3KL6A 2QIQA 4K2YA 4F49A 1HB0B 4INLA 2PUQH 1AKSB 4MNXA 1NFXA 2R2WU 4WXVA 3LU9B 1ZOMA 1O3HA 2HNTF 1DDJA 3MU4A 2QY0B 3IWMA 1YF4A 2IOTA 4MNVA 1ARBA 4B2CA 1TNHA 3P8GA 1YLDA 2AMPA 2ZGCA 1O30A 2ZI2H 3RM0H 2OUAA 4GHQA 1GJ5H 2H9TH 1G3BA 2ZGHA 5HM9A 1SGDE 2F9OA 3UIRA 5F03A 2EEKA 1O3IA 4NA7A 3E3TA 3TJOA 4ISIH 1O3AA 4DJZB 4A1VA 2NU4E 2FEQH 4X2XA 3EAJA 3ZZ8A 1HIAB 1SPJA 1PQ8A 3CP7A 4UFDH 2RCEA 2ALPA 3U8TH 4FUEA 1GVZA 1EB2A 2FOBA 2BXTH 4X1RU 3U8RH 1XVMA 1W0YH 1VITG 3LPRA 2BXUH 5C1UA 1FN8A 3F6UH 1SHYA 1BA8B 4BNRA 5EPYA 4BXSA 2ZDMA 3BTME 3MMGA 3M5OA 4X1QU 1GBMA 3VB5A 1MAXA 4KP0A 1O3EA 5TCAA 6GCHG 3JZ2B 4YT6H 5L2ZH 3GY7A 4AX9H 4X8TH 2IJOB 2NU2E 1GMDF 1DITH 2B0FA 3K65B 1RFNA 3RXUA 2TBSA 2ANMH 1FZZA 3TH3H 2H9EH 4Q2KA 6GCHF 5LPRA 3BTKE 1ZLRA 3QUMP 1EP6A 1T32A 2OBOA 1UHBA 1HXEH 1BMMH 1MKWK 1XXFA 1WOFA 3I78A 4Y10E 3RC4A 4AFQA 4DT7B 1SFIA 1AFQC 2WPHS 2Z9JA 2Y5GA 2CHAC 4CHAB 3A88A 1P3CA 1ANEA 5ESTE 3RXAA 2AH4X 3U1JB 1BUIA 3O8RA 1VJAU 3QZQA 3V13A 3SQHE 1TNLA 1FY1A 1GHBF 4AN7A 4UONA 2OINA 2OP9A 3MH4A 2V35A 4H6TA 4DIIH 2EI8A 3RXTA 1G37A 5GDSH 1C2JA 1UVTH 1T8MA 2BLWA 5EXNA 4ZMAH 1BITA 2V0BA 1JIRA 1NM6A 3QX5H 4I31A 5FPTA 4YM9A 1NY22 2ZCHP 3M37A 1JBUH 2ZG0H 4IMZA 1DX5M 2BDAA 3TNSA 1GMCF 1O5BB 4NA8A 2JKHA 1WYKA 1DOJA 3HK6B 3U98H 3MYWA 1GDUA 1V2OT 2BLQA 2A4RA 1DLKB 3EA8A 1H8DH 2ZP0H 2ZKSA 4XBCA 3M36A 1BTHH 4PROA 2YNAA 2GCHG 3A83A 3LJOA 1UTJA 4O9VA 4MG3A 2QXHA 2AIQA 1IQEA 1UCYH 4Z6AH 2VIQA 2VIVA 4JZIA 3L6PA 1J17T 2GZ9A 1P06A 3VGCB 3PYHA 3EA7A 1GI2A 1AZ8A 1BT7A 2PUXB 3BTHE 3RU4T 1AFQB 3E16B 1HNEE 2Z9GA 5LGOA 2Y5FA 4MDSA 1FMGA 1VJ9U 1HDTH 4K5ZA 1EAWA 3ZZ9A 1ETTH 1P10A 3URCA 1O33A 1J14A 2BVRH 5JBBS 5F6MA 3TGKE 1VCWA 1OXGA 4KTCA 1GI0A 2GV7A 3ZZ7A 3MO6A 2F9UA 2EC9H 1VZQH 2BD3A 4NFEA 4WH6A 1V2NT 4JYVH 3QN7A 1C1UH 3ZYEA 4AFUA 1ZRBA 3HGNA 5GPIB 7LPRA 1L4ZA 1CO7E 2P3TB 3LJJA 2PGBB 1GI8B 1AMHA 4I8JA 3WY8A 3PTNA 2G5VA 2Y5HA 1AN1E 1ZSLA 2G4TA 1O5CB 1LHCH 5EQRA 1DUAA 3UR9A 5T6FA 4B75A 1OWKA 1TFXA 1ELGA 1C1RA 3QGNB 4SGAE 2ZFPH 3RXVA 1EJNA 2Q6GA 4BAOB 1UK3A 2EI7A 2STBE 2VB0A 1F0SA 4FVDA 3PO1C 2HVXA 3PTBA 1DANH 1BRAA 1JIMA 2J95A 1GL0E 2XTTB 1HJAC 1MAYA 2FP7B 1YPKH 1C1PA 3SOSA 1XKAC 3RMMH 4Y11E 4NZLA 1NRRH 4I8HA 1GCDA 1XM1A 2VIWA 4NGAH 4WXIA 1C4Y2 1PPZA 1UVPA 4K8YA 1FJSA 1YPLH 1SGIB 3G01A 4JYUH 1MTVA 1H9LB 1ZTKA 3ZVGA 3OY6U 1LVYA 1GBFA 1AB9B 1O3MA 3GCOA 1C5YB 4NSYA 2LPRA 3MH7A 2H6MA 1YP9A 3MNXA 3Q00A 3EA9A 4CREA 2R0KA 1O2QA 1G3EA 3ENSB 5A2MH 1N6YA 1WUNH 1Y3YA 3GCNA 3A8AA 4O3TA 1HPGA 2WPIS 2R3UA 4AZ2B 4Y79A 4TYDA 1T8NA 1JRSA 2HLCA 2DE9A 2R2MB 1C1NA 1O2NA 1GBDA 3EDXB 5A0AE 1V2ST 2G4UA 2ZDKA 1D3DB 2WYGA 3NXPA 3TK5A 2BQ7B 4DY7B 1YPMH 3S0NA 4B1TA 2W3KA 3RXCA 1CT4E 1K1MA 1TPAE 1SBWA 3BTEE 2FODA 1EX3A 1HAGE 1GMHG 2PLXA 2PWXA 2ZNKH 1QL8A 3P6ZB 3SI3H 3MU5A 2D26C 2HWLB 5ETXA 3RLYH 1GI6A 3A87A 3PM3A 2GCTB 5DP9A 4DGJA 1LCYA 1HAOH 1LMWB 2BZ6H 4Y8XA 2OD3B 1TPOA 2ZHFH 1Y3VA 3M5NA 1BMLA 3T29A 2BLOA 1O38A 3KEEA 1HIAA 3VXEH 2PGQB 4JK6A 4NWLA 2P8OC 1IQNA 3U9AH 1E38B 1P2OA 4Y7BA 3H5CB 2BHGA 1O36A 3GY3A 2FMJA 1Z71A 4BAQB 8LPRA 1SFQB 2BYAX 1P2QA 2PKAB 1AO5A 2BMGB 5EU8A 1CGIE 2P95A 3PV4A 1B5GH 3UQOA 4IC6A 5JYIA 1TQ0B 1EZXC 1WBGB 2UWLA 2ZFQH 4AYYB 4MPUA 1NFYA 4JZDH 3MNCA 3SBKA 1DXWA 1JMOH 2JETB 1MZAA 1FDPA 4WF8A 1O2UA 2HRVA 3U8OH 3FP6E 3O8BA 4NG9H 2PSXA 5A8YA 2FWWA 1V2TT 1E0FD 1LHDH 1CT0E 3OSYA 1ETSH 3RXDA 2P59A 1Z8IB 3IITA 4Z0KA 4NIXA 4XE4A 1DWBH 1S84A 1CBWB 2CF8H 5T3HA 1BHXF 5A8ZA 1HGTH 3BEFB 2QN5T 8GCHF 1CGJE 5EW2H 4K3JA 2J2UA 1YPGH 2FI4E 4BXWA 2FIRH 1AWHB 1HAPH 2QF0A 3LGVA 3SU6A 1KIGH 3M3VA 1N6XA 3MO9A 3Q3KA 1UK2A 5AF9H 1K21H 1Y59T 3A85A 1OKXA 1LVBA 3VXFH 1NFUA 4INHA 4I8KA 3K2UA 2BVXH 2ZQ1A 1C5PA 3RXPA 1MCVA 3NZIA 4MPWA 1AUJA 1VCQA 1Z8JB 1ACBE 3U1IB 1P2JA 2RA3A 1FUJA 3K6YA 1Z8GA 2BDIA 4ISLA 3SHCH 2AMQA 1ZGVA 4WMDA 5L2YH 3A86A 2ZQ2A 1L0ZA 1J15A 1NO9H 3RXSA 2CJIA 4K1TA 1TNGA 3A84A 2ZHWH 1SGRE 1EAIA 2BM2A 5C2ZA 1S81A 2VWMA 4HI3A 1P2IA 1MTWA 4CRGA 1C2MA 1TWXB 2JH5D 3SJOA 2D2DA 3T25A 2OTVA 2FI3E 1PYTD 4R0IA 4OS5A 3E0PB 2SGEE 4YOGA 4IMQA 3SGQE 5EPNA 3NCLA 2OCVB 3HKIB 5FCRA 2BTCE 1YPEH 1H4WA 4DURA 2GT8A 3ZV9A 2OLGA 1LKAA 5F8XA 1FI8A 2BD2A 4X6MA 1ZMNA 1B7XB 4Y76A 3C1KA 1GBCA 1O2WA 2PR3A 1XUKA 3QGJA 1G3DA 2ZC9H 2M5TA 1G3CA 1Z6EA 1GJDB 3RP2A 2EI6A 4RN6A 1SVPA 4CRDA 1WU1A 1UJ1A 1CHOG 4FUDA 3ZZ5A 1FXYA 3O8CA 3NKKA 1C5ZB 1QB6A 1UHBB 4LOYH 1EOJA 4UDWH 3ODDA 2ZU4A 2W7SA 3SU1A 1QIXB 1HCGA 3FAOA 3LOXA 1HJ8A 1SMFE 1TB6H 4ABFA 1HUTH 2WUBA 4GVUA 2A5IA 3B9FH 4GAWA 1DUEA 1GBHA 3KHVA 5H4IB 1KY9A 1KXEA 1OPHB 2GTBA 1IQHA 1C5UA 1BCUH 2XWBI 3TK9A 3SJIA 1VITH 1GMHF 1ELCA 2FOEA 1GBLA 2J9NA 2QYIA 3V3MA 1SLVB 2I6SA 4CRFA 1GGDB 1CQQA 1HBTH 4BTUB 2XYAA 4ZXYH 1ELTA 1ZR0A 4DVAU 1RS0A 2ZO3H 3LC3A 1SGFG 4AB9A 3SU3A 2VIOA 4A7IB 4HZHA 4Y8ZA 5DGJA 1BBRK 1AE8H 2ZU3A 2AGGX 1NROH 2H5CA 2XBYA 1C5NH 3ZYDA 2C90B 1C1VH 1PYTC 2FS9A 1KXCA 4A5TS 3LGYA 1QTFA 4Y0ZE 5AFYH 1HLTH 2HNTE 2Q1JA 1VR1H 4YESB 3P95A 1BTXA 3OX7U 1LHEH 4HGCA 5CMXH 2BD5A 1MD7A 1DWCH 3LIWA 3FZZA 1MKXH 1C5QA 4B73A 3D23A 1TONA 6CHAC 1QQUA 2GZ7A 3NUMA 4OS2A 1W13U 2VINA 1YBWA 4I33A 4CH8B 1GHAF 2SGQE 5CHAC 2AS9A 1TNJA 1O2SA 1BJUA 3BTDE 3ZVCA 1QR3E 1V2KT 4XDEA 1J8AA 4A1TA 4H4FA 2Z9IA 3ZZAA 3LH1A 4ESTE 1UTPA 3ZZBA 1PPFE 1BIOA 1PQ5A 2PW8H 1TPSA 8ESTE 3MFJA 4OS6A 3ZZCA 3ELAH 3P70B 3QO6A 1G2LA 1C4V2 4IGDA 5FPSA 1KTTB 5DKMA 2J34A 1FPCH 2Z3DA 3LH3A 2G00A 2O8UA 1YGCH 1A3EH 1C1QA 1IHTH 1O3CA 1V2RT 2GMTC 1EB1H 1T31A 1Z1IA 4JMYA 2OC0A 1YCPM 1BOQA 3MU8A 1ESBA 1AB9C 1GL1A 1O2MA 2TGPZ 1VGCC 4I7YH 1FY5A 1BRCE 2Q6FA 3SV9A 1GHYH 3DA9B 2K1QA 1DY9A 1L4DA 3EGKH 4O97A 3SUEA 3SUDA 2CXVA 1S6HA 1EZUC 1MKWH 5DP5A 5AFZH 2F91A 4BTIB 4K69A 1SI5H 3VB7A 1K1LA 4J2YB 3EE0B 1TGBA 1RXPA 4AYVB 1XX9A 7ESTE 2W7UA 3AAUA 4K60A 4H42U 5HXFA 3PLBA 4ZKNU 3KNXA 1KYNA 1P03A 1UCYE 1C2EA 1C2FA 3RMOH 3SNDA 2A1DB 2Y80A 1QB9A 2Y7XA 2CF9H 1GVKB 1ZZZA 2VWNA 2ZDAH 2XWAA 1CHGA 4UFGH 1N8OC 1WCZA 3KQDA 3ATWA 3SV6A 1NU7B 4KKDA 3P92A 3RXMA 3KQBA 2GX4A 2WPLS 3SGBE 3UTUH 1PPHE 1GDNA 2W5EA 5EOKA 1ESAA 3ZVEA 2ZTXA 1V2QT 5C5NA 1TLDA 1TBQH 5I25A 1FONA 1A61H 1FV9A 1YC0A 2UUYA 4AFSA 3BIVH 1MKXK 1MTNC 2BOHB 3NPSA 1QGFA 2A4QA 3GOVB 4X8UH 1V2PT 1A0HB 2B5TB 2PKAA 4ZUHA 1SG8B 2XBVA 1B0EA 2FXRA 2J38A 1RTKA 3RXGA 1GG6B 1AZZA 1C2DA 1HAVA 1QRWA 5C1YA 9LPRA 5K0HA 1FY3A 2FTMA 4X2VA 1PJPA 1DWDH 1GJ9B 2HPQH 3MNSA 1QA7A 1KXDA 1EOLA 4TPYA 1QY6A 3DUXH 2QCYA 2FOGA 3GDVA 4BAMB 4BAKB 3I29A 3W95A 1OSSA 3KF2A 1W7GH 5GJ4B 2JH6D 4Y8YA 4B74A 3GY2A 4VGCB 3GICB 3QLPH 3KIDU 2FOMB 2ZZUH 2GP9B 4CRCA 1C2LA 3SI4H 3E0NB 1THRH 1O2VA 1C5RA 3MNBA 2Z3EA 1QJ1B 1UVSH 1GVLA 1EJAA 2F9VA 3GISB 3OTJE 1ZSKA 4ASHA 4FUJA 2QXGA 1H1BA 2GV6A 1AU8A 3VFEA 3RXBA 4BANB 1HXFH 5BPEA 4D7GA 1LHFH 1BTWA 2EA3A 3AW1A 3A82A 1GDQA 4IN1A 5DP8A 3B23B 4X1SU 3K9XB 1ZYOA 1QFKH 3RM2H 1S6FA 1D3TB 2WPMS 1O5FH 4MVNA 4A6LA 1KXBA 3ATKA 3LGTA 2BDYA 3UY9A 3RXLA 9ESTA 1S0RA 2BX4A 2F9PA 2GMTB 3AW0A 3STIA 4HTCH 1HYLA 1WSSH 2HOBA 2P3UB 2UWPA 2PKSB 2ODYB 1P09A 1YYY1 2FYRA 4TY6A 5ABWA 3MH6A 1W12U 1IHSH 1HAIH 1BMAA 4AG1A 3P8OA 2TGDA 5GWZA 4UE7H 3RXKA 2A5AA 2Z3CA 3ATMA 3E8LA 1A3BH 5I46H 1BHXB 4IS5A 3AASA 1S5SA 1L1JA 5T6DA 1F0RA 2XW9A 2GZ8A 2ZTZA 4ZAEA 1KXFA 3MWIU 2ZHEH 4E7RG 4DCDA 2F9BH 2HNTC 5IYTA 5EW1H 1NN6A 1N1LA 3JZ1B 1THPB 3E91A 1CBWC 1SGYE 5PTPA 1ESTA 1KLIH 2ALVA 1IQMA 3FP7E 4A92A 2QV1A 3M7TA 3GCHB 2UWOA 3RMNH 1ZPZA 1C5SA 1V2MT 3KGPA 3W94A 2BB4A 2PTNA 4I8GA 2ZF0H 1H9IE 3HATH 1DSTA 1GHVH 1MU8B 1WV7H 3L33A 4YZUA 4VGCC 1QBNA 1V2VT 3PMBB 2P94A 1UTNA 3UNRA 1SL3A 1GJBB 2UUKB 8KME2 1AE5A 3ZV8A 1SGPE 1SR5C 2WYJA 2YNBA 3F9FA 3V0XA 3QDZB 2ZGJA 1O3LA 1QL9A 1ZPBA 3CS7A 3RXQA 1RGQA 4Y0YE 5E2OA 4X2YA 1BRBE 3S7KB 2A2XH 1K1IA 1V6DA 2Z7FE 1F0UA 2FOCA 4KTSA 4NIYA 4TY7A 2WPJS 3SUFA 3GDSA 1NRNH 2FX6A 1C5MD 1KLJH 4FUCA 1OS8A 1SGNE 1W14U 3S9AA 1OOKB 2BDHA 2BX3A 2UUJB 1C5XB 3D62A 5T6GA 2XNIA 1C1WH 4HFPB 1BZXE 2ZFTA 3H7TA 2O8WA 1SGTA 1O35A 2C8ZB 2Z9KA 3PB1E 1PFXC 3EYDA 4FUFA 2FZZA 2BLVA 3MI4A 1TYNA 1AD8H 1O2TA 5FAHA 2AIPA 2XCNA 3P17H 4UEHH 1PQAA 1O2JA 2OC7A 2WV4A 3CENA 2O8MA 1EATA 1QURH 1Y5BT 1EASA 3F9GA 1TNKA 2XC4A 2HGTH 1DXPA 3RXFA 2ZGBH 1Z7KA 1GI5A 1V2LT 1Z6JH 4IW4E 3PWBA 1AUTC 1OYTH 3GY6A 1K22H 3FANA 3ITIA 4ZXXH 1C2GA 1C4U2 1DT2A 4CH2B 2R9PA 3F1SB 3OYPA 3PLKA 4NSVA 3LGWA 3V7TA 2VWOA 1S83A 1OWJA 3M3SA 2ZEBA 3SZNA 1O3GA 1BRUP 2A4GA 1BBRE 5L6NH 3PWCA 5A09A 5L30H 1CHOF 2XBWA 3LONA 1A46H 2G5NA 2GVFA 4XBBA 3TLOA 1M9UA 1SGQE 2ZU2A 1AVGH 1P9UA 4JZ1A 1LTOA 2ODQA 4D8NA 1TRNA 4YOJA 3RXHA 5F8ZA 4Y7AA 3AAVA 1JXPA 1TALA 1TGCA 4OGYA 2C93B 1IOEA 1W0ZU 2I6QA 3UREA 2QC2A 4X8VH 5CHAB 1C2KA 1AVWA 1QHRB 4IN2A 3TVJB 4RKJB 4OGXA 1BJVA 1TABE 1RRKA 2P8OB 3ZVFA 1GBTA 1ABIH 1L1GA 1A7SA 2F3CE 2XC5A 2G52A 1P11E 3RDZA 3SNEA 2BY9X 3URDA 1KTSB 3SGAE 1F0TA 2ZPQA 1D6RA 1ANBA 3TH4H 1OYQA 4GCHF 4FU9A 4ISHH 2CHAB 1UTLM 2HALA 1NRPH 4RKOB 5EQQA 5EQSA 5A0BA 3PROA 1ORFA 3VGCC 1KXAA 1SSXA 4U2WA 3DFJA 5J4QA 2FOHA 3MH5A 3M5MA 1SLXB 3IG6B 1C5LH 5EODA 1H8IH 1PPEE 3LKWA 1Y5UT 1MMJN 1SGFA 4ZKOU 1E36B 1GI3A 2JH0D 2AGIX 1F92A 1ZTLA 1FY8E 1GHAG 2F9NA 1WTHD 1NRSH 1SQAA 1QRZA 1OWIA 3K6ZA 3OY5U 4ZHLU 2JETC 2O8TA 3UOPA 2LNCA 1T8LA 1UTMA 1ZPCA 3FP8E 2PV9B 1E37B 2KAIA 1AKSA 4YLUA 2B7DH 1GJ7B 1P2NA 3FZDA 1O2PA 1GGDC 1Q2WA 3BV9B 4Y6DA 3T5FH 4D7FA 2PHBA 2FESH 3RLWH 1TMBH 2SGAA 1EJMA 1E35B 2SNWA 3BG4B 7GCHG 2HPPH 4Q7ZA 4R8TB 5GIBA 5J4SA 4LZ4B 1QBVH 3BG8A 1ANCA 1ABJH 1LQDB 4YO9A 2CN0H 5HYOA 1LVMA 1DWEH 2A32A 7GCHF 1UTQA 2D8WA 1EPTA 1E34B 3A7TA 1BTPA 4IBLH 2Z94A 4BAHB 2GGVB 1UTKA 2FLBH 3P8FA 4LZ1H 2Y82A 1G2MA 2GKVE 3OU0A 2BDGA 4FUGA 3A7VA 3I77A 1A5HA 3ZVAA 3C27B 1GJ4H 1TX6A 1O3OA 2C8YB 6CHAB 3UNQA 1QJ7B 1ZRKA 1MCTA 4XSKU 3F9HA 1HRTH 3VEQB 3MU0A 1O2HA 1FNIA 1THSH 1QCPA 3T2NA 1GHWH 3ESTA 1CSOE 3MHWU 2ZGXH 5LPFA 1WTGH 3A7ZA 1O32A 2BVSH 5FBEA 2H5DA 1TE0A 2DE8A 1AFEH 3TH2H 5JDUB 4AGKA 2WPKS 4CR9A 3H7OA 1O2IA 3BEIB 3S69A 2A5KA 3RXRA 5G4BA 1ZMJA 2Z6BD 3BTFE 4UD9H 2ANKH 3R0FA 1Q31A 3ODFA 3M5LA 1O5EH 1CA8B 3ZVDA 1P02A 4WVPE 3SN8A 1UVUH 1HV7A 1XVOA 4LK4A 3UFAA 3DD2H 2YOLA 3S7HB 3STJA 3UNSA 3SV2H 4MNWA 2Q6DA 3A7XA 3M7UA 3SORA 3UUZA 1TIOA 1QRXA 3Q3YA 2G81E 4YLQH 4TPIZ 1RIWB 1GI9B 4FXGH 3A7WA 1C5VA 1IAUA 2AEIH 1J9CH 5SGAE 5EG4A 1JWTA 1HAVB 2O8LA 1YCPK 1C1TA 2V3HH 1F5RA 1BQYA 1P12E 1O31A 3TPIZ 4D76A 2ZCKP 2H2ZA 1CE5A 1K1PA 3FVFB 2ZDNA 3O8DA 3T28A 3RUOA 1BTUA 5HM2A 1V2WT 4J1YA 1A4WH 1SLUB 3BEUA 3A8CA 3BG4C 2TIOA 1EPTB 1FQ3A 5EXLA 1GWAA 1W2KH 1QJ6B 3RMLH 1SGCA 4ABHA 1UTOA 1CA0B 1V2JT 5E0HA 2BY6X 1GMDG 1P3EA 1W10U 1GI4A 3F9EA 3MTYA 1Y5AT 3Q77A 1IQJA 4GLYA 5FX6A 5DP3A 1QBOA 4B76A 1SGEE 3LGIA 5C3NA 2XRCA 1EP5A 4B71A 1ELAA 2G8TA 3D65E 3ZZDA 3GY4A 1T4VH 1QL7A 1PPCE 4ZROA 3S9CA 1BB0B 5FPYA 1WQVH 3T27A 3M61U 4D9QA 2VVUA 1YPJH 1WQSA 1Z8RA 2A7CA 2FOFA 1LHGH 1TX8A 1OP0A 1LQEA 3GCHC 2H9HA 1CA0C 3TITA 1D9IA 1D4PB 1O5GH 1AHTH 2VGCC 1FIWA 2ZU1A 3PMHB 4ABEA 2ZPSA 5HMAA 1ZTJA 5LH8A 1O34A 2Z9LA 1C2IA 1C2HA 1VGCB 3A7YA 1NRQH 2BOKA 4OS7A 3BTQE 2A7JA 2H1UA 3TU7H 1P2MA 5AHGH 2PKSC 2P16A 1K28D 4GUXA 1NZQH 2ZU5A 4X6OA 4ZKSU 4GPGA 4KTUA 2ZA5A 4D9RA 3SO3A 3VB4A 4AORA 1FLEE 1TX7A 1EXFA 4NWKA 3GDUA 2A31A 4JK5A 1TMUH 1JOUB 4ABGA 2CGAA 3ATLA 1ZSJA 2ANYA 1K1NA 2A45B 1ID5H 4JYTA 3RXOA 5JBAS 4X1NU 3PMAB 2W3IA 1P2KA 3NK8A 4ISOA 1NC6A 1TBRH 4WH8A 1EZQA 2A7HA 4NIWA 5C5OA 5E8EH 1DSUA 2AMDA 3BTGE 4DG4A 1HAZB 2ESTE 1O3KA 5IDKA 1O3JA 1TA2A 5DPAA 3GYMA 5DK1A 2BD7A 1O3FA 5AVDA 1KLTA 2QF3A 1EAXA 1Y8TA 2NU0E 3DT0H 3QTOH 4XFQA 1CVWH 1MQ5A 2FI5E 1QNJA 2FO9A 8GCHG 1FIZA 1O3NA 4X2WA 4FU7A 2V6NA 1MUEB 2BZAA 1HAHH 2THFB 1QB1A 4DOQA 4X8SH 4WMFA 2CMYA 1GG6C 1T7CA 2VVCA 2AFQB 2Y7ZA 2SGDE 2RG3A 1TA6A 1W7XH 3BTWE 1XUIA 2UUFB 4FUHA 1TQ7B 3KCGH 1SB1H 2J92A 1YLCA 2BY5X 1TGNA 4JZEH 1A1RA 3M35A 2BQWB 1AWFH 1KDQA 3D49H 3PLPA 1PQ7A 1T4UH 4X0WU 4MPVA 1F7ZA 1PPGE 2VVVA 4OS1A 3PMJA 1MZDA 1FAXA 3RC6A 1P01A 4ISNA 1O2KA 1O5DH 2C8XB 3HPTB 3A8BA 2FM2A 3VPKA 1BTZA 4ABDA 1P0SH 1NPMA 4WJG2 1EQ9A 3SJ8A 3DHKH 1AY6H 2R3YA 4CR5A 3UWJH 1Z1JA 1GJCB 5LPEA 4E06H 5JBTA 1YKTA 1H9HE 1LKBA 1A0LA 6ESTA 1GBKA 2QXIA 1CU1A 4Q7XA 4ABAA 2VH6A 1L1NA 1ZGIA 2ZTYA 1P8VC 5DP7A 2GD4B 1ZJKA 2ZWLH 1YPHC 1F5KU 4B2AA 2G55A 1B0FA 2KAIB 4ABBA 1O2YA 1TNIA 1LDTT 3GYLB 2VJ1A 4FUIA 1MTSA 1G36A 2WV5A 1ARCA 5TJXA 1U6QA 3B8JA 3HGPA 4MPXA 4ABIA 1A5IA 4CBOA 2VWLA 2FS8A 1G32B 3RU4D 3LGUA 2J94A 1XKBC 2NWNA 3ATIA 5DG6A 3SNCA 1RD3B 1TGSZ 5DP4A 1TOCB 2RDLA 4U32A 3ZVBA 1P05A 1O2LA 2PTCE 1OWEA 1GBAA 1GBEA 1LO6A 4I8LA 3V12A 1MH0A 1AQ7A 5A8XA 2OC8A 4TWYA 5JBCS 4XOJA 3UQVA 4FVBA 3RXJA 2FOAA 4NFFA 3A89A 1MU6B 1MTUA 2VIPA 2Y6TA 1EAUA 3BIUH 1CGHA 3EQ0H 4YOIA 1IQFA 3KN2A 3GCTG 1K2I1 1GCTC 2ANWA 2IN2A 3E1XB 3TJNA 1GHZA 3SNAA 5BRRE 3UPEA 1GPZA 4CHAC 1SC8U 3N7OA 5ESBA 1UMAH 4FU8A 1Q3XA 4JCNA 4WMEA 1J16A 5GCHF 1HJAB 1XUJA 1NU9A 1G9IE 1DICA 3TJVA 2BDCA 1T8OA 1O2RA 3M7QA 1GHBG 2ZHQH 3A81A 1C1SA 1SOZA 4WY3A 1FPHH 1GBJA 2ZPRA 1GI1A 4GCHG 2PSYA 2TGAA 4QT8C 3S9BA 1DPOA 1W11U 1P57B 1NESE 4THNH 4SGBE 2BD8A 1AI8H 1O39A 5E0JA 2QA9E 3T62A 4AB8A 3AVZA 2VGCB 4GHTA 1YM0A 4U30A 4Q7YA 1BTYA 1RJXB 5CE1A 1OP2A 1ELVA 1ZJDA 4ZHAA 1W8BH 5DO4H 3LDXH 1KDQB 3Q76A 2A4OA 4I32A 1BMNH 2GDEH 4WWYA 5DJ7A 4Y71A 3SNBA 4CBNA 4KELA 3Q3XA 5GXPA 3SU0A 4FUBA 1INCA 5DP6A 1OP8A 1UO6A 1K1OA 1W3CA 1TPPA 1O0DH 3TK6A 1C5OH 4K8BA 2QGRA 2GCHF 1XUGA 1KSNA 4MQAA 4NZQA 5A0CA 3UOUA 3ZZ3A 1ZMLA 3RXIA 3ZZ6A 3R3GB 1WAYB 1DVAH 4ZHMU 2QXJA 4NCYA 1D6WA 4AG2A 5C1XA 1O2OA 4H6SB 2VIDA 2TRMA 1LPGB 4A1XA 1AIXH 1GCTB 1QQ4A 3QZRA 4O3UA 4E05H 3MO3A 3KQEA 2C4FH 1DM4B 2PFEA 1DY8A 1MTNB 1C5WB 5FX5A 3TNTA 1GBBA 1P9SA 1S85A 2ZECA 7KMEH 3T26A 3UWIA 2P3FH 1TMTH 3DFLA 6LPRA 4UFFH 3L3TA 1GBIA 2FPZA 2GCTC 1XXDA 1AGJA 1A2CH 1MBMA 2ULLA 2R0LA 2A0QB 1D3QB 4F4OC 1OWHA 1DS2E 4LXBH 4NIVA 2SNVA 3VB6A 3GY5A 5EGMA 1HAXB 3SQEE 2BY7X 3QWCH 4B2BA 2ODPA 4BOHA 2B8OH 4KGAA 1ZHMA 3TGJE 1K1JA 3A8DA 1L2EA 2WINI 4U01A 1LPKB 2V3OH 2ZCLP 4ABJA 1SOTA 3HKJB 1LVOA 4ZH8A 2O9QA 3M3TA 1GJ6A 5FHTA 5JB9S 4MNYA 1TAWA 2FTLE 4M7GA 4TWWA 1A5GH 1EZSC 1EUFA 1O2XA 3SU2A 2QAAA 3VB3A 5TCCA 1VITF 1FAKH 2CV3A 4X6PA 3U69H 3RU4E 3LT3A 1NT1A 5HGGA 4RSPA 4ZKRU 3SW2B 1IQKA 1BBRH 2ILNA 3CS0A 2Y81A 1HJ9A 3LC5A 4MLFB 3RC5A 2GT7A 2XXLA 3BSQA 3TGIE 3KQCA 3SJKA 2OXSA 1XUFA 2AERH 2ZFSA 1C5TA 1F5LA 3ZZ4A 1S0QA 1LPZB 1F2SE 1GI7B 1IQIA 1ELDE 2NU1E 2XBXA 3BF6H 3A80A 2J4IA 3SHAH 2RA0A 1MQ6A 3SU4A 3MU1A 1OX1A 1YPHE 4DIHH 2AGEX 3SV7A 1MD8A 1ELEE 1QA0A 2BD9A 3F68H 1UCYK 4X1PU 2P93A 3SU5A 1K9OE 1BDAA 1O37A 3PO1B 3QTVH 2ZIQH 1RTFB 2SGPE 4CRBA 2A2QH 5JB8S 2ZFRH 2W26A 5EXMA 5FCKA 4GSOA 5GCHG 1D3PB 2ZDVH 2DUCA 3MOCA 1O5AB 4O03A 4IC5A 1EKBB 2D1JA 3TIUA 4AOQA 2GDDA 4AFZA 3GCTF 4NA9H 4AGJA 3SV8A 1UK4A 2C8WB 5B6OA 5FXLA 1IQLA 1OWDA 5C20A 5F8TA 1TGTA 5JPMH 5K7RA 3QK1A 1O3BA 1TRYA 4CRAA 1UVOA 1Y3UA 1CT2E 2BQ6B 1C1MA 1X7AC 3BN9A 1G30B 1NFWA 3HK3B 1SQTA 2BY8X 1V2UT 2SGFE
chains in the Genus database with same CATH superfamily
1TBZH 1VCPA 3FO8D 4E7NA 4INKA 1NTPA 2FX4A 5E0GA 1GJAB 1GMCG 2IPHA 2BDBA 2QF4A 1GHXH 1GJ8B 2FLRH 2OC1A 2AYWA 1PPBH 2STAE 4X6NA 1FY4A 1ETRH 2ASUB 4K1SA 1YCPH 2WSSD 3BTTE 2TGTA 1C9TA 4BTTB 4K1EA 1O2ZA 5FBIA 3TJUA 1HFDA 2NU3E 2C3SA 1DFPA 4UFEH 1AVXA 2OBQA 1NS3A 1TRMA 3P8NA 1Y3XA 4YTAA 1N8OB 4DW2U 3UR6A 1IQGA 3SUGA 4YT7H 1Y3WA 2FDAA 2SFAA 1ELBA 1FN6A 1TOMH 5E2PA 2VH0A 1A0JA 3RXEA 1C1OA 4Q80A 1O3PB 2TPIZ 2WZQA 1MBQA 1SLWB 1XUHA 2ZDLA 4JZFH 4XBDA 1SQOA 1HAYB 1DE7H 1RTLA 1E1RD 2XCFA 1S82A 2ZFFH 2ZHDA 3E90B 4MTBA 1RIWC 3NWUA 1ELFA 2GJGA 2KZ4A 2BD4A 1O2GH 2FYQA 3E6PH 1P04A 1V3XA 4OS4A 1JRTA 1O3DA 2XC0A 1ZHPA 1SHHB 1XMNB 2VNTA 2WUCA 1EPTC 2VU8E 1DLEA 5C67A 2B9LA 3FFGA 5C0TA 1ZHRA 3GY8A 2F83A 2OQUA 2OQ5A 1C9PA 1ANDA 2G51A 3EE7A 3SJ9A 3KL6A 3OE7D 2QIQA 4K2YA 4F49A 1HB0B 4INLA 2PUQH 1AKSB 4MNXA 1NFXA 2R2WU 4WXVA 3LU9B 1ZOMA 1O3HA 2HNTF 1DDJA 3MU4A 2QY0B 3IWMA 1YF4A 2IOTA 4MNVA 1ARBA 4B2CA 1TNHA 3P8GA 1YLDA 2AMPA 2ZGCA 5EIYA 1O30A 2ZI2H 3RM0H 2OUAA 4GHQA 1GJ5H 2H9TH 1G3BA 2ZGHA 5HM9A 1SGDE 2F9OA 3UIRA 5F03A 1W0JD 2EEKA 5DSFA 1O3IA 4NA7A 3E3TA 3TJOA 4ISIH 1O3AA 4DJZB 4A1VA 2NU4E 2FEQH 4X2XA 3EAJA 3ZZ8A 1HIAB 1SPJA 1PQ8A 3CP7A 4UFDH 2RCEA 2ALPA 3U8TH 4FUEA 1GVZA 3PRDA 1EB2A 2FOBA 2BXTH 4X1RU 3U8RH 1XVMA 1W0YH 1VITG 3LPRA 2BXUH 5C1UA 1FN8A 3F6UH 1SHYA 1BA8B 4BNRA 5EPYA 4BXSA 2ZDMA 1S6LA 3BTME 3MMGA 3H09A 5FL7D 3M5OA 4X1QU 1GBMA 3VB5A 4RT1A 1MAXA 4P02A 4KP0A 1O3EA 5TCAA 6GCHG 3JZ2B 4YT6H 5L2ZH 3GY7A 4AX9H 4X8TH 2IJOB 2NU2E 1GMDF 1DITH 2B0FA 3K65B 1RFNA 3RXUA 2TBSA 5C0UA 2ANMH 1FZZA 3TH3H 2H9EH 4Q2KA 6GCHF 5LPRA 3BTKE 1ZLRA 3QUMP 1EP6A 1T32A 3F0PA 2OBOA 1UHBA 1HXEH 1BMMH 1MKWK 1XXFA 1WOFA 3I78A 4Y10E 3RC4A 2QE7D 4AFQA 4DT7B 1SFIA 1AFQC 2WPHS 2Z9JA 2Y5GA 2CHAC 4CHAB 3A88A 1P3CA 1ANEA 5ESTE 3RXAA 2AH4X 3U1JB 1BUIA 3O8RA 1VJAU 1SKYE 3QZQA 2KR7A 3V13A 3SQHE 1TNLA 1FY1A 1GHBF 4AN7A 4UONA 2OINA 2OP9A 3MH4A 2V35A 4H6TA 4DIIH 2EI8A 3RXTA 1G37A 4Z1MD 5GDSH 1C2JA 1UVTH 4ACBA 1T8MA 2BLWA 5EXNA 4ZMAH 1BITA 2V0BA 1JIRA 1NM6A 3QX5H 4I31A 5FPTA 4AC9A 4YM9A 1NY22 2ZCHP 3M37A 1JBUH 2ZG0H 4IMZA 1DX5M 2BDAA 3TNSA 1GMCF 1O5BB 3OFND 3F3BA 4NA8A 2JKHA 1WYKA 1DOJA 3HK6B 3KYFA 3U98H 3MYWA 1GDUA 1V2OT 2BLQA 2A4RA 1DLKB 3EA8A 1H8DH 2ZP0H 2ZKSA 4XBCA 3M36A 1BTHH 4PROA 2YNAA 2GCHG 3A83A 3LJOA 1UTJA 4O9VA 4MG3A 2QXHA 2AIQA 1IQEA 1UCYH 4Z6AH 2VIQA 2VIVA 4JZIA 3L6PA 1J17T 2GZ9A 1P06A 3VGCB 3PYHA 3EA7A 1GI2A 1AZ8A 1BT7A 2PUXB 2W6ID 3BTHE 3RU4T 1AFQB 3E16B 1HNEE 2Z9GA 5LGOA 2Y5FA 4MDSA 1FMGA 1VJ9U 1HDTH 4K5ZA 1EAWA 3ZZ9A 1ETTH 1P10A 3URCA 1O33A 1J14A 2BVRH 5JBBS 5F6MA 3TGKE 1VCWA 1OXGA 4KTCA 1GI0A 2GV7A 3ZZ7A 3MO6A 2F9UA 2EC9H 1VZQH 2BD3A 4NFEA 4WH6A 1V2NT 4JYVH 3QN7A 1C1UH 3ZYEA 4AFUA 1ZRBA 3HGNA 5GPIB 7LPRA 1L4ZA 1CO7E 1VKYA 2P3TB 2PGBB 3LJJA 1GI8B 1AMHA 4I8JA 3WY8A 3PTNA 2G5VA 2Y5HA 1AN1E 1ZSLA 2G4TA 1O5CB 1LHCH 5EQRA 1DUAA 3UR9A 5T6FA 4B75A 1OWKA 1TFXA 1ELGA 1C1RA 3QGNB 4SGAE 2ZFPH 3RXVA 1EJNA 2Q6GA 4BAOB 1UK3A 2EI7A 2STBE 2VB0A 1F0SA 4FVDA 3PO1C 2HVXA 3PTBA 1DANH 1BRAA 1JIMA 2J95A 1GL0E 2XTTB 1HJAC 1MAYA 2FP7B 1YPKH 1C1PA 3SOSA 1XKAC 2J98B 3RMMH 4Y11E 4NZLA 1NRRH 4I8HA 1GCDA 1XM1A 2VIWA 4NGAH 4WXIA 1C4Y2 1PPZA 1UVPA 4K8YA 1FJSA 1YPLH 1SGIB 3G01A 4JYUH 1MTVA 1H9LB 1ZTKA 3ZVGA 3OY6U 1LVYA 1GBFA 1AB9B 1O3MA 3GCOA 2M2AA 1C5YB 4NSYA 2LPRA 3MH7A 2H6MA 1YP9A 3MNXA 3Q00A 3EA9A 4CREA 2WPDD 2R0KA 1O2QA 2V3MA 1G3EA 3ENSB 5A2MH 1N6YA 1WUNH 1Y3YA 3GCNA 3A8AA 4O3TA 1HPGA 2WPIS 2R3UA 4AZ2B 4Y79A 4TYDA 1T8NA 1JRSA 2HLCA 2DE9A 2R2MB 1C1NA 1O2NA 1GBDA 3EDXB 5A0AE 1V2ST 2G4UA 2ZDKA 1D3DB 2WYGA 3NXPA 3TK5A 2BQ7B 4DY7B 1YPMH 3S0NA 5C94A 4B1TA 2W3KA 3DSOA 3RXCA 1CT4E 1K1MA 1TPAE 1SBWA 3BTEE 2FODA 1EX3A 1HAGE 1GMHG 2PLXA 2PWXA 2ZNKH 1QL8A 3P6ZB 3SI3H 3MU5A 2D26C 2HWLB 5ETXA 3RLYH 1GI6A 3A87A 3PM3A 2GCTB 5DP9A 4DGJA 1LCYA 1HAOH 1LMWB 2BZ6H 4RT0A 2OD3B 1TPOA 4Y8XA 2ZHFH 1Y3VA 3M5NA 1BMLA 3T29A 2BLOA 1O38A 3KEEA 1HIAA 5T1VA 5C17A 3VXEH 2PGQB 4JK6A 4NWLA 2P8OC 1IQNA 2J5UA 3U9AH 1E38B 1P2OA 4Y7BA 2KCYA 3H5CB 2BHGA 4F55A 1YWUA 1O36A 3GY3A 2FMJA 1Z71A 4BAQB 8LPRA 1SFQB 2BYAX 1P2QA 2PKAB 3F0OA 1AO5A 2BMGB 5EU8A 1CGIE 2P95A 3PV4A 1B5GH 3UQOA 4OM9A 4IC6A 5JYIA 1TQ0B 1EZXC 1WBGB 2UWLA 2ZFQH 4AYYB 4MPUA 1NFYA 4JZDH 3MNCA 3SBKA 1DXWA 1JMOH 2JETB 1MZAA 3DSGA 1FDPA 3VG8A 4WF8A 1O2UA 2HRVA 3U8OH 3CNRA 3FP6E 3O8BA 2YMSB 4NG9H 2PSXA 5A8YA 2FWWA 1V2TT 1E0FD 1LHDH 4RI0A 1CT0E 3OSYA 1ETSH 3RXDA 2P59A 1Z8IB 3IITA 4Z0KA 4NIXA 3N7EA 4XE4A 1DWBH 1S84A 1CBWB 2CF8H 5T3HA 1BHXF 5A8ZA 1HGTH 3BEFB 2QN5T 8GCHF 1CGJE 5EW2H 4HG6A 4K3JA 2J2UA 1YPGH 2FI4E 4BXWA 2FIRH 3F2FA 1AWHB 1HAPH 2QF0A 3LGVA 3SU6A 1KIGH 3M3VA 1N6XA 3MO9A 3Q3KA 1UK2A 5AF9H 1K21H 1Y59T 3A85A 1OKXA 1LVBA 3VXFH 1NFUA 4DT4A 4INHA 4I8KA 3K2UA 2YMSC 2BVXH 2ZQ1A 1C5PA 3RXPA 1MCVA 3NZIA 4MPWA 1AUJA 1VCQA 1Z8JB 1ACBE 3U1IB 1P2JA 2RA3A 1FUJA 3K6YA 1Z8GA 2BDIA 4ISLA 3SHCH 2AMQA 1ZGVA 4WMDA 5L2YH 3A86A 2ZQ2A 1L0ZA 1J15A 1NO9H 3RXSA 2CJIA 4K1TA 1TNGA 3A84A 2ZHWH 1SGRE 1EAIA 2BM2A 5C2ZA 1S81A 2VWMA 4HI3A 1P2IA 1MTWA 4CRGA 1C2MA 1TWXB 2JH5D 3SJOA 2D2DA 3T25A 2OTVA 2FI3E 1PYTD 3OEED 4R0IA 4OS5A 5CDFE 3E0PB 2SGEE 4YOGA 4IMQA 3SGQE 5EPNA 3NCLA 2OCVB 3HKIB 5FCRA 2BTCE 1YPEH 1H4WA 4DURA 2GT8A 3ZV9A 2OLGA 1LKAA 5F8XA 1FI8A 2BD2A 4X6MA 1ZMNA 1B7XB 4Y76A 3C1KA 1GBCA 1O2WA 2PR3A 1XUKA 3QGJA 1G3DA 2ZC9H 2M5TA 1G3CA 1Z6EA 1GJDB 3RP2A 2EI6A 4RN6A 1SVPA 4CRDA 1WU1A 1UJ1A 2CK3D 1CHOG 4FUDA 2J98A 3ZZ5A 1FXYA 3O8CA 3NKKA 1MABB 1C5ZB 1QB6A 1UHBB 4LOYH 1EOJA 4UDWH 3ODDA 2V7QD 2ZU4A 2W7SA 3SU1A 1QIXB 1HCGA 3FAOA 3LOXA 1HJ8A 1SMFE 1TB6H 4ABFA 1HUTH 2WUBA 4GVUA 2A5IA 2YMSD 3B9FH 4GAWA 1DUEA 1GBHA 3KHVA 5H4IB 1KY9A 1KXEA 1OPHB 2GTBA 1IQHA 1C5UA 1BCUH 2XWBI 3TK9A 3SJIA 1VITH 1GMHF 1ELCA 4ASUD 2FOEA 1GBLA 2J9NA 2QYIA 3V3MA 1SLVB 2I6SA 4CRFA 1GGDB 1CQQA 1HBTH 4BTUB 2XYAA 4ZXYH 1ELTA 1ZR0A 4DVAU 1RS0A 2ZO3H 3LC3A 1SGFG 4AB9A 1YY3A 3SU3A 2VIOA 3OTPA 4A7IB 4HZHA 4Y8ZA 5DGJA 1BBRK 1AE8H 2ZU3A 2AGGX 1NROH 2H5CA 2XBYA 1C5NH 3ZYDA 2C90B 1C1VH 1PYTC 2FS9A 1KXCA 4A5TS 3LGYA 1QTFA 4Y0ZE 5AFYH 1HLTH 2HNTE 2Q1JA 1VR1H 4YESB 3P95A 1BTXA 5KECA 3OX7U 3UB0A 1LHEH 4HGCA 5CMXH 2BD5A 1MD7A 1DWCH 3LIWA 3FZZA 1MKXH 2L74A 1C5QA 4B73A 3D23A 1TONA 6CHAC 1QQUA 2GZ7A 4FETA 3NUMA 4OS2A 1W13U 2VINA 1YBWA 4I33A 4CH8B 1GHAF 2SGQE 5CHAC 2AS9A 1TNJA 1O2SA 1BJUA 5B6LA 3BTDE 3ZVCA 1QR3E 1V2KT 4XDEA 1J8AA 4A1TA 4H4FA 2Z9IA 3ZZAA 3LH1A 4ESTE 1UTPA 3ZZBA 1PPFE 1BIOA 1PQ5A 2PW8H 1TPSA 8ESTE 3MFJA 4OS6A 3ZZCA 3ELAH 3P70B 3QO6A 1G2LA 1C4V2 4IGDA 5FPSA 1KTTB 5DKMA 2J34A 1FPCH 2Z3DA 3LH3A 2G00A 2O8UA 1YGCH 1A3EH 1C1QA 1IHTH 1O3CA 1V2RT 2GMTC 1EB1H 1T31A 1Z1IA 4JMYA 2OC0A 1YCPM 1BOQA 3MU8A 1ESBA 1AB9C 1GL1A 1O2MA 2TGPZ 1VGCC 4I7YH 1FY5A 1BRCE 2Q6FA 3SV9A 1GHYH 3DA9B 2K1QA 1DY9A 1L4DA 3EGKH 4O97A 3SUEA 3SUDA 2CXVA 1S6HA 1EZUC 1MKWH 5DP5A 5AFZH 3DSPA 2F91A 4BTIB 4K69A 1SI5H 3VB7A 1OHHD 1K1LA 4J2YB 3EE0B 1TGBA 1WXRA 1RXPA 4AYVB 1XX9A 2LP6A 7ESTE 2W7UA 3AAUA 1NBMD 4K60A 4H42U 2VBCA 2IJD1 5HXFA 2K8IA 3PLBA 4ZKNU 3KNXA 5F53A 1KYNA 1P03A 1UCYE 1C2EA 1C2FA 3RMOH 3SNDA 2A1DB 2HLDD 1QB9A 2Y80A 2Y7XA 2CF9H 1GVKB 1ZZZA 2VWNA 2ZDAH 2XWAA 1CHGA 4UFGH 1N8OC 1WCZA 3KQ5A 3KQDA 3ATWA 3SV6A 1NU7B 4KKDA 3P92A 3RXMA 3KQBA 2GX4A 2WPLS 3SGBE 3UTUH 1PPHE 1GDNA 2W5EA 5EOKA 1ESAA 3ZVEA 2ZTXA 1V2QT 5C5NA 1TLDA 1TBQH 5I25A 1FONA 1A61H 1FV9A 1YC0A 2UUYA 4AFSA 3BIVH 1MKXK 1MTNC 2BOHB 3NPSA 1QGFA 2A4QA 3GOVB 4X8UH 1V2PT 1A0HB 2B5TB 2PKAA 4ZUHA 1SG8B 2XBVA 1B0EA 2FXRA 2J38A 1RTKA 3RXGA 1GG6B 1AZZA 1C2DA 1HAVA 2EQNA 1QRWA 5C1YA 4YXWD 9LPRA 5K0HA 1FY3A 2L6OA 2FTMA 4X2VA 1PJPA 1DWDH 1GJ9B 2HPQH 3MNSA 1QA7A 1KXDA 1EOLA 4TPYA 3FKSD 1QY6A 3DUXH 2QCYA 2FOGA 3GDVA 4BAMB 4BAKB 3I29A 3W95A 2KX4A 1OSSA 3KF2A 3N99A 1W7GH 5GJ4B 2JH6D 4Y8YA 4B74A 3GY2A 4VGCB 3GICB 3QLPH 3KIDU 2FOMB 2ZZUH 2GP9B 4CRCA 1C2LA 3SI4H 3E0NB 1THRH 1O2VA 1C5RA 3MNBA 2Z3EA 1QJ1B 1UVSH 1GVLA 1EJAA 2F9VA 3GISB 3OTJE 1ZSKA 4ASHA 4FUJA 2QXGA 1H1BA 2GV6A 1AU8A 3VFEA 2F4LA 3RXBA 4BANB 1HXFH 5BPEA 4D7GA 1LHFH 1BTWA 2EA3A 3AW1A 3A82A 1GDQA 4IN1A 5DP8A 3B23B 4X1SU 3K9XB 1ZYOA 1QFKH 3RM2H 1S6FA 1D3TB 2WPMS 1O5FH 4MVNA 4A6LA 1KXBA 3ATKA 3LGTA 2BDYA 3UY9A 3RXLA 9ESTA 1S0RA 2BX4A 2F9PA 2GMTB 4ZCNA 3AW0A 3STIA 4HTCH 1HYLA 1WSSH 2HOBA 2P3UB 2UWPA 2PKSB 2ODYB 2PP6A 2JIZD 2EY4C 1P09A 1YYY1 2FYRA 4TY6A 5ABWA 3MH6A 1W12U 1IHSH 1HAIH 1BMAA 4AG1A 3P8OA 2TGDA 5GWZA 4UE7H 3RXKA 2A5AA 2Z3CA 3ATMA 3E8LA 1A3BH 5I46H 1BHXB 4IS5A 3AASA 1S5SA 1L1JA 5T6DA 1F0RA 2XW9A 2GZ8A 2ZTZA 5EJZA 4ZAEA 1KXFA 3MWIU 2JJ2D 2ZHEH 4E7RG 4DCDA 2F9BH 2HNTC 5IYTA 5EW1H 1NN6A 1N1LA 3JZ1B 1THPB 3E91A 1CBWC 1SGYE 5PTPA 1ESTA 1KLIH 2ALVA 1IQMA 3FP7E 4A92A 2QV1A 3M7TA 3GCHB 2UWOA 3RMNH 1ZPZA 3F2HA 1C5SA 1V2MT 1H8HD 3KGPA 3W94A 2BB4A 2PTNA 1E79D 4I8GA 2ZF0H 1H9IE 3HATH 1DSTA 1GHVH 1MU8B 1WV7H 3L33A 3F2GA 4YZUA 4VGCC 1QBNA 1V2VT 3PMBB 2RFKC 2P94A 1UTNA 3UNRA 1SL3A 1GJBB 2UUKB 8KME2 1AE5A 3ZV8A 1SGPE 1SR5C 2WYJA 2YNBA 3F9FA 3V0XA 3QDZB 2ZGJA 1O3LA 1QL9A 1ZPBA 3CS7A 3RXQA 1RGQA 4Y0YE 5E2OA 4X2YA 1BRBE 3S7KB 2A2XH 1K1IA 1V6DA 2Z7FE 1F0UA 2FOCA 4KTSA 4NIYA 4TY7A 2WPJS 3SUFA 3GDSA 1NRNH 1NBME 2FX6A 1C5MD 1KLJH 4FUCA 1OS8A 1SGNE 1YLNA 1W14U 3S9AA 1OOKB 2BDHA 2BX3A 2UUJB 2K0QA 1C5XB 3D62A 5T6GA 2XNIA 1C1WH 4HFPB 1BZXE 2ZFTA 2KCAA 3H7TA 2O8WA 1SGTA 1O35A 2C8ZB 2Z9KA 3PB1E 1PFXC 3EYDA 4FUFA 2FZZA 2RDEA 2BLVA 3MI4A 1TYNA 1AD8H 1O2TA 5FAHA 2AIPA 2XCNA 3P17H 4UEHH 1PQAA 1O2JA 2OC7A 2WV4A 3CENA 2O8MA 3KYGA 1EATA 1QURH 1Y5BT 1EASA 3F9GA 1TNKA 2XC4A 2HGTH 1DXPA 3RXFA 2QF5A 2ZGBH 1Z7KA 1GI5A 1V2LT 1Z6JH 4IW4E 3PWBA 1AUTC 1OYTH 3GY6A 1K22H 3FANA 3ITIA 4ZXXH 1C2GA 1C4U2 1DT2A 4CH2B 2R9PA 3F1SB 3OYPA 3PLKA 4NSVA 3LGWA 3V7TA 2VWOA 1S83A 1OWJA 3M3SA 2ZEBA 3SZNA 1O3GA 1BRUP 2A4GA 1BBRE 5L6NH 3PWCA 5A09A 5L30H 1CHOF 2XBWA 3LONA 1A46H 2G5NA 2GVFA 4XBBA 3TLOA 1M9UA 1SGQE 2ZU2A 1AVGH 1P9UA 4JZ1A 1LTOA 2ODQA 4D8NA 1TRNA 4YOJA 3RXHA 5F8ZA 4Y7AA 3AAVA 1JXPA 1TALA 1TGCA 4OGYA 2C93B 1IOEA 1W0ZU 2I6QA 3UREA 2QC2A 4X8VH 5CHAB 1C2KA 1AVWA 1QHRB 4IN2A 3TVJB 4RKJB 4OGXA 1BJVA 1TABE 2WHXA 1RRKA 2P8OB 3ZVFA 1GBTA 1ABIH 1L1GA 1A7SA 2F3CE 2XC5A 2IPQX 2G52A 1P11E 3RDZA 3SNEA 2BY9X 3URDA 1KTSB 3SGAE 1F0TA 2ZPQA 1D6RA 1ANBA 3TH4H 1OYQA 4GCHF 4FU9A 4ISHH 2CHAB 1UTLM 4B6EA 2HALA 1NRPH 4RKOB 5EQQA 5EQSA 5A0BA 3PROA 1ORFA 3VGCC 1KXAA 1SSXA 4U2WA 3DFJA 5J4QA 3AK5A 2FOHA 3SZEA 3MH5A 3M5MA 3PV5A 1SLXB 3IG6B 1C5LH 5EODA 1H8IH 1PPEE 3LKWA 1Y5UT 1MMJN 1SGFA 4ZKOU 1E36B 1GI3A 2JH0D 2AGIX 5DN6D 1F92A 1ZTLA 1FY8E 1GHAG 2F9NA 1WTHD 1NRSH 1SQAA 4P00A 1QRZA 1OWIA 3K6ZA 3OY5U 4ZHLU 2JETC 2O8TA 3UOPA 2LNCA 1T8LA 1UTMA 1ZPCA 3FP8E 2PV9B 3W1EA 1E37B 2KAIA 1AKSA 4YLUA 2B7DH 1GJ7B 1P2NA 3FZDA 1O2PA 1GGDC 1Q2WA 3BV9B 4Y6DA 3T5FH 4D7FA 2PHBA 2FESH 3RLWH 1TMBH 2SGAA 1EJMA 1E35B 2SNWA 3BG4B 7GCHG 2HPPH 4Q7ZA 4R8TB 5GIBA 5J4SA 4LZ4B 1QBVH 3BG8A 1ANCA 1ABJH 1QZ8A 1LQDB 4YO9A 2CN0H 5HYOA 1LVMA 1DWEH 2A32A 7GCHF 1UTQA 2D8WA 1EPTA 1E34B 3A7TA 1BTPA 3PRBA 2Z94A 4IBLH 3UAIC 4BAHB 2GGVB 1UTKA 2FLBH 3P8FA 4LZ1H 2Y82A 1G2MA 2GKVE 3OU0A 2BDGA 3WWFA 4FUGA 3A7VA 3I77A 1A5HA 3ZVAA 3C27B 1COWD 1GJ4H 1TX6A 1O3OA 2C8YB 6CHAB 3UNQA 1QJ7B 1ZRKA 1MCTA 4XSKU 3F9HA 1HRTH 3VEQB 3MU0A 3DCLA 1O2HA 1FNIA 1THSH 4TSFD 1QCPA 3T2NA 1GHWH 3ESTA 1CSOE 3MHWU 5IK2D 1UW7A 2ZGXH 5LPFA 1WTGH 3A7ZA 1O32A 2BVSH 2KM0A 5FBEA 2H5DA 1TE0A 2DE8A 1AFEH 5HIZA 3TH2H 5JDUB 4AGKA 1K0HA 2J97A 2WPKS 4CR9A 3H7OA 1O2IA 3BEIB 3S69A 2A5KA 3RXRA 5G4BA 1ZMJA 2Z6BD 3BTFE 4UD9H 2ANKH 3R0FA 1Q31A 3ODFA 3M5LA 1O5EH 1CA8B 3ZVDA 1P02A 4WVPE 3SN8A 1UVUH 1HV7A 1XVOA 4LK4A 3UFAA 3DD2H 2YOLA 3S7HB 3STJA 3UNSA 3SV2H 4MNWA 2Q6DA 3A7XA 3M7UA 3SORA 4ACAA 3UUZA 1TIOA 1QRXA 1KMHB 3Q3YA 2G81E 4YLQH 4TPIZ 1RIWB 1GI9B 4FXGH 3A7WA 1C5VA 3OAAD 1IAUA 2AEIH 1J9CH 5SGAE 5EG4A 1JWTA 1HAVB 2O8LA 1YCPK 1C1TA 2V3HH 1F5RA 1BQYA 1P12E 1O31A 3TPIZ 4D76A 2ZCKP 2H2ZA 1CE5A 1K1PA 3FVFB 2ZDNA 3O8DA 3T28A 3RUOA 1BTUA 5HM2A 1V2WT 4J1YA 1A4WH 4Q4LA 1SLUB 3BEUA 3A8CA 3BG4C 2KCOA 2TIOA 1EPTB 3WW7A 1FQ3A 5EXLA 1GWAA 1W2KH 1QJ6B 2XOKD 3RMLH 1SGCA 4ABHA 1UTOA 1CA0B 1V2JT 5E0HA 2BY6X 1GMDG 1P3EA 1W10U 1GI4A 3F9EA 3MTYA 1Y5AT 3Q77A 1IQJA 4GLYA 5FX6A 5DP3A 1FX0B 1QBOA 4B76A 1SGEE 3LGIA 5C3NA 2XRCA 1EP5A 4B71A 1ELAA 5EJ1A 2G8TA 3D65E 3ZZDA 3GY4A 1T4VH 1QL7A 1PPCE 4ZROA 3S9CA 1BB0B 5FPYA 1WQVH 3T27A 3M61U 4D9QA 2A7CA 1YPJH 1WQSA 1Z8RA 2VVUA 2FOFA 1LHGH 1TX8A 1OP0A 1LQEA 3GCHC 2H9HA 1CA0C 3TITA 1D9IA 1D4PB 1O5GH 1AHTH 2VGCC 1FIWA 2ZU1A 3PMHB 4ABEA 2ZPSA 3N7DA 5HMAA 5CHBA 1ZTJA 5LH8A 1O34A 2Z9LA 1C2IA 1BMFD 1C2HA 1VGCB 3A7YA 1NRQH 2BOKA 4OS7A 3BTQE 2A7JA 2H1UA 3TU7H 1P2MA 5AHGH 2PKSC 2P16A 1K28D 4GUXA 1NZQH 2ZU5A 4X6OA 4ZKSU 4GPGA 4KTUA 2ZA5A 3GS9A 4D9RA 3SO3A 3VB4A 4AORA 1FLEE 1TX7A 1EXFA 4NWKA 3GDUA 2A31A 4JK5A 1TMUH 1JOUB 1WDIA 4ABGA 2CGAA 3ATLA 1ZSJA 2ANYA 1K1NA 2A45B 1ID5H 4JYTA 3RXOA 5JBAS 4X1NU 3PMAB 2W3IA 1P2KA 3NK8A 4ISOA 1NC6A 1TBRH 4WH8A 1EZQA 2A7HA 4NIWA 5C5OA 3SYJA 5E8EH 1DSUA 2AMDA 3BTGE 4DG4A 3NRLA 1HAZB 2ESTE 1O3KA 5IDKA 1O3JA 1TA2A 5DPAA 3GYMA 5DK1A 2BD7A 1O3FA 5AVDA 1KLTA 2QF3A 1EAXA 1Y8TA 2NU0E 3DT0H 3QTOH 4XFQA 1CVWH 1MQ5A 2FI5E 1QNJA 2FO9A 8GCHG 1FIZA 1O3NA 4X2WA 4FU7A 2V6NA 1MUEB 2BZAA 1HAHH 4M9FA 2THFB 1QB1A 4DOQA 4X8SH 4WMFA 2CMYA 1GG6C 1T7CA 2VVCA 2AFQB 2Y7ZA 2SGDE 2RG3A 1TA6A 1W7XH 3BTWE 1XUIA 2UUFB 4FUHA 1TQ7B 3KCGH 5HKKD 1SB1H 2J92A 1YLCA 2BY5X 1TGNA 4JZEH 1A1RA 3M35A 5EJLA 2BQWB 1AWFH 1KDQA 3D49H 3PLPA 1H8ED 1PQ7A 1T4UH 4X0WU 4MPVA 1F7ZA 1PPGE 2VVVA 4OS1A 3PMJA 1MZDA 1FAXA 3RC6A 4F48B 1P01A 4ISNA 1O2KA 1O5DH 2C8XB 3HPTB 3A8BA 2FM2A 3VPKA 1BTZA 4ABDA 1P0SH 1NPMA 4WJG2 1EQ9A 3SJ8A 2OK5A 3DHKH 1AY6H 3FN8A 2R3YA 4CR5A 3UWJH 1Z1JA 1GJCB 5LPEA 4E06H 5JBTA 1YKTA 1H9HE 1LKBA 1A0LA 6ESTA 1GBKA 2QXIA 1CU1A 4Q7XA 4ABAA 2VH6A 1L1NA 1ZGIA 2ZTYA 1P8VC 5DP7A 2JDID 2GD4B 1ZJKA 2ZWLH 1YPHC 1F5KU 4B2AA 2G55A 1B0FA 2KAIB 4ABBA 1O2YA 1TNIA 1LDTT 3PV2A 3GYLB 2VJ1A 4FUIA 1MTSA 1G36A 2WV5A 1ARCA 5TJXA 1U6QA 3B8JA 4FOUC 3HGPA 4MPXA 4ABIA 1A5IA 4CBOA 2VWLA 2FS8A 1G32B 3RU4D 3LGUA 2J94A 1XKBC 2KFWA 2NWNA 3ATIA 5DG6A 3SNCA 1RD3B 1TGSZ 5DP4A 1TOCB 2RDLA 1EFRD 4U32A 3ZVBA 1P05A 1O2LA 2PTCE 1OWEA 1GBAA 1GBEA 1LO6A 4I8LA 3V12A 1MH0A 1AQ7A 5A8XA 4XRNA 4TT3D 2OC8A 4TWYA 5JBCS 4XOJA 3UQVA 4FVBA 3RXJA 2FOAA 4NFFA 3A89A 1MU6B 1MTUA 2VIPA 2WV9A 2Y6TA 1EAUA 3BIUH 1CGHA 3EQ0H 4YOIA 1IQFA 3KN2A 3GCTG 1K2I1 1GCTC 2ANWA 2IN2A 3E1XB 3TJNA 1GHZA 3SNAA 5BRRE 4I86A 3UPEA 1GPZA 4CHAC 1SC8U 3N7OA 5ESBA 1UMAH 4FU8A 1Q3XA 4JCNA 4WMEA 1J16A 5GCHF 1HJAB 1XUJA 2JJ1D 3WWBA 1NU9A 1G9IE 1DICA 3TJVA 2BDCA 1T8OA 1O2RA 3M7QA 1GHBG 2ZHQH 3A81A 1C1SA 1SOZA 4WY3A 1FPHH 1GBJA 2ZPRA 1GI1A 4GCHG 2PSYA 2TGAA 4QT8C 3S9BA 1DPOA 2F43B 1W11U 1P57B 1NESE 4THNH 4SGBE 2BD8A 1AI8H 1O39A 5E0JA 2QA9E 3T62A 4AB8A 3AVZA 2VGCB 4GHTA 1YM0A 4U30A 2KCPA 4Q7YA 1BTYA 1RJXB 5CE1A 3MQKC 1OP2A 5KEDA 1ELVA 2LELA 3U28C 1ZJDA 4ZHAA 1W8BH 5DO4H 3LDXH 1KDQB 3Q76A 2A4OA 4I32A 1BMNH 2GDEH 4WWYA 5DJ7A 4Y71A 3SNBA 4CBNA 4KELA 3Q3XA 5GXPA 3SU0A 4FUBA 1INCA 5DP6A 1OP8A 1UO6A 1K1OA 1W3CA 1TPPA 1O0DH 3TK6A 1C5OH 4K8BA 2QGRA 2GCHF 1XUGA 1KSNA 4MQAA 4NZQA 5A0CA 3UOUA 3ZZ3A 1ZMLA 3RXIA 3ZZ6A 4XD7D 3R3GB 1WAYB 1DVAH 4ZHMU 2QXJA 4NCYA 1D6WA 4AG2A 5C1XA 1O2OA 4H6SB 2VIDA 2TRMA 1LPGB 4A1XA 1AIXH 1GCTB 1QQ4A 3QZRA 4O3UA 4E05H 3MO3A 3KQEA 2C4FH 1DM4B 2PFEA 1DY8A 1MTNB 1C5WB 5FX5A 3TNTA 1GBBA 1P9SA 1S85A 2ZECA 7KMEH 3T26A 3UWIA 2P3FH 1TMTH 3DFLA 6LPRA 4UFFH 4B6FA 3L3TA 1GBIA 2FPZA 2GCTC 1XXDA 1AGJA 1A2CH 1MBMA 2ULLA 2R0LA 2A0QB 1D3QB 4F4OC 1OWHA 1DS2E 4LXBH 4NIVA 2SNVA 3VB6A 3GY5A 5EGMA 1HAXB 2XNDD 3SQEE 2HVYB 2BY7X 3QWCH 5HIYA 2ODPA 4B2BA 4BOHA 3ZIAD 2B8OH 4KGAA 1ZHMA 3OEHD 3TGJE 1K1JA 3A8DA 1L2EA 2WINI 4U01A 1LPKB 2V3OH 2ZCLP 4ABJA 1SOTA 3HKJB 1LVOA 4ZH8A 2O9QA 3M3TA 1GJ6A 5FHTA 5JB9S 4MNYA 1TAWA 2FTLE 4M7GA 4TWWA 1A5GH 1EZSC 3FOAA 1E1QD 1EUFA 1O2XA 3SU2A 2QAAA 3VB3A 5TCCA 1VITF 1FAKH 2CV3A 4X6PA 3U69H 3RU4E 3LT3A 1NT1A 5HGGA 4RSPA 4ZKRU 3SW2B 1IQKA 1BBRH 2ILNA 3CS0A 2Y81A 1HJ9A 3LC5A 4MLFB 3RC5A 2GT7A 2XXLA 3BSQA 3TGIE 3KQCA 3SJKA 2OXSA 1XUFA 2AERH 2ZFSA 1C5TA 2AHME 1F5LA 3ZZ4A 1S0QA 1LPZB 1F2SE 1GI7B 1IQIA 1ELDE 2NU1E 2XBXA 3BF6H 1SQRA 3A80A 2J4IA 3SHAH 2RA0A 1MQ6A 4Q63A 3SU4A 3MU1A 1OX1A 1YPHE 4DIHH 2AGEX 3SV7A 1MD8A 1ELEE 1QA0A 2BD9A 3F68H 1UCYK 4X1PU 2P93A 3SU5A 1K9OE 1BDAA 1O37A 3PO1B 3QTVH 2ZIQH 1RTFB 2SGPE 4CRBA 2A2QH 5JB8S 2ZFRH 2W26A 5EXMA 5FCKA 5KGOA 4GSOA 5GCHG 1D3PB 2ZDVH 2DUCA 3MOCA 1O5AB 4O03A 4IC5A 1EKBB 2D1JA 1W0KD 3TIUA 4AOQA 2GDDA 4AFZA 3GCTF 4NA9H 4AGJA 3SV8A 1UK4A 2C8WB 5B6OA 5FXLA 1IQLA 1OWDA 5C20A 5F8TA 1TGTA 5GNDA 5JPMH 5K7RA 3QK1A 1O3BA 1TRYA 4CRAA 1UVOA 1Y3UA 1CT2E 2BQ6B 2W6JD 1C1MA 1X7AC 3BN9A 1G30B 1NFWA 3HK3B 1SQTA 2BY8X 1V2UT 2SGFE
chains in the Genus database with same CATH topology
1TBZH 1VCPA 4E7NA 4INKA 1NTPA 2FX4A 5E0GA 1GJAB 1GMCG 2IPHA 2BDBA 1GHXH 1GJ8B 2FLRH 2OC1A 2AYWA 1PPBH 2STAE 4X6NA 1FY4A 1ETRH 2ASUB 4K1SA 1YCPH 3BTTE 2TGTA 1C9TA 4BTTB 4K1EA 1O2ZA 5FBIA 3TJUA 1HFDA 2NU3E 2C3SA 1DFPA 4UFEH 1AVXA 2OBQA 1NS3A 1TRMA 3P8NA 1Y3XA 4YTAA 1N8OB 4DW2U 3UR6A 1IQGA 3SUGA 4YT7H 1Y3WA 2FDAA 2SFAA 1ELBA 1FN6A 1TOMH 5E2PA 2VH0A 1A0JA 3RXEA 1C1OA 4Q80A 1O3PB 2TPIZ 1MBQA 1SLWB 1XUHA 2ZDLA 4JZFH 4XBDA 1SQOA 1HAYB 1DE7H 1RTLA 2XCFA 1S82A 2ZFFH 2ZHDA 3E90B 4MTBA 1RIWC 3NWUA 1ELFA 2BD4A 1O2GH 2FYQA 3E6PH 1P04A 1V3XA 4OS4A 1JRTA 1O3DA 2XC0A 1ZHPA 1SHHB 1XMNB 2VNTA 2WUCA 1EPTC 2VU8E 1DLEA 5C67A 2B9LA 3FFGA 1ZHRA 3GY8A 2F83A 2OQUA 2OQ5A 1C9PA 1ANDA 2G51A 3SJ9A 3KL6A 2QIQA 4K2YA 4F49A 1HB0B 4INLA 2PUQH 1AKSB 4MNXA 1NFXA 2R2WU 4WXVA 3LU9B 1ZOMA 1O3HA 2HNTF 1DDJA 3MU4A 2QY0B 3IWMA 1YF4A 2IOTA 4MNVA 1ARBA 4B2CA 1TNHA 3P8GA 1YLDA 2AMPA 2ZGCA 1O30A 2ZI2H 3RM0H 2OUAA 4GHQA 1GJ5H 2H9TH 1G3BA 2ZGHA 5HM9A 1SGDE 2F9OA 3UIRA 5F03A 2EEKA 1O3IA 4NA7A 3E3TA 3TJOA 4ISIH 1O3AA 4DJZB 4A1VA 2NU4E 2FEQH 4X2XA 3EAJA 3ZZ8A 1HIAB 1SPJA 1PQ8A 3CP7A 4UFDH 2RCEA 2ALPA 3U8TH 4FUEA 1GVZA 1EB2A 2FOBA 2BXTH 4X1RU 3U8RH 1XVMA 1W0YH 1VITG 3LPRA 2BXUH 5C1UA 1FN8A 3F6UH 1SHYA 1BA8B 4BNRA 5EPYA 4BXSA 2ZDMA 3BTME 3MMGA 3M5OA 4X1QU 1GBMA 3VB5A 1MAXA 4KP0A 1O3EA 5TCAA 6GCHG 3JZ2B 4YT6H 5L2ZH 3GY7A 4AX9H 4X8TH 2IJOB 2NU2E 1GMDF 1DITH 2B0FA 3K65B 1RFNA 3RXUA 2TBSA 2ANMH 1FZZA 3TH3H 2H9EH 4Q2KA 6GCHF 5LPRA 3BTKE 1ZLRA 3QUMP 1EP6A 1T32A 2OBOA 1UHBA 1HXEH 1BMMH 1MKWK 1XXFA 1WOFA 3I78A 4Y10E 3RC4A 4AFQA 4DT7B 1SFIA 1AFQC 2WPHS 2Z9JA 2Y5GA 2CHAC 4CHAB 3A88A 1P3CA 1ANEA 5ESTE 3RXAA 2AH4X 3U1JB 1BUIA 3O8RA 1VJAU 3QZQA 3V13A 3SQHE 1TNLA 1FY1A 1GHBF 4AN7A 4UONA 2OINA 2OP9A 3MH4A 2V35A 4H6TA 4DIIH 2EI8A 3RXTA 1G37A 5GDSH 1C2JA 1UVTH 1T8MA 2BLWA 5EXNA 4ZMAH 1BITA 2V0BA 1JIRA 1NM6A 3QX5H 4I31A 5FPTA 4YM9A 1NY22 2ZCHP 3M37A 1JBUH 2ZG0H 4IMZA 1DX5M 2BDAA 3TNSA 1GMCF 1O5BB 4NA8A 2JKHA 1WYKA 1DOJA 3HK6B 3U98H 3MYWA 1GDUA 1V2OT 2BLQA 2A4RA 1DLKB 3EA8A 1H8DH 2ZP0H 2ZKSA 4XBCA 3M36A 1BTHH 4PROA 2YNAA 2GCHG 3A83A 3LJOA 1UTJA 4O9VA 4MG3A 2QXHA 2AIQA 1IQEA 1UCYH 4Z6AH 2VIQA 2VIVA 4JZIA 3L6PA 1J17T 2GZ9A 1P06A 3VGCB 3PYHA 3EA7A 1GI2A 1AZ8A 1BT7A 2PUXB 3BTHE 3RU4T 1AFQB 3E16B 1HNEE 2Z9GA 5LGOA 2Y5FA 4MDSA 1FMGA 1VJ9U 1HDTH 4K5ZA 1EAWA 3ZZ9A 1ETTH 1P10A 3URCA 1O33A 1J14A 2BVRH 5JBBS 5F6MA 3TGKE 1VCWA 1OXGA 4KTCA 1GI0A 2GV7A 3ZZ7A 3MO6A 2F9UA 2EC9H 1VZQH 2BD3A 4NFEA 4WH6A 1V2NT 4JYVH 3QN7A 1C1UH 3ZYEA 4AFUA 1ZRBA 3HGNA 5GPIB 7LPRA 1L4ZA 1CO7E 2P3TB 3LJJA 2PGBB 1GI8B 1AMHA 4I8JA 3WY8A 3PTNA 2G5VA 2Y5HA 1AN1E 1ZSLA 2G4TA 1O5CB 1LHCH 5EQRA 1DUAA 3UR9A 5T6FA 4B75A 1OWKA 1TFXA 1ELGA 1C1RA 3QGNB 4SGAE 2ZFPH 3RXVA 1EJNA 2Q6GA 4BAOB 1UK3A 2EI7A 2STBE 2VB0A 1F0SA 4FVDA 3PO1C 2HVXA 3PTBA 1DANH 1BRAA 1JIMA 2J95A 1GL0E 2XTTB 1HJAC 1MAYA 2FP7B 1YPKH 1C1PA 3SOSA 1XKAC 3RMMH 4Y11E 4NZLA 1NRRH 4I8HA 1GCDA 1XM1A 2VIWA 4NGAH 4WXIA 1C4Y2 1PPZA 1UVPA 4K8YA 1FJSA 1YPLH 1SGIB 3G01A 4JYUH 1MTVA 1H9LB 1ZTKA 3ZVGA 3OY6U 1LVYA 1GBFA 1AB9B 1O3MA 3GCOA 1C5YB 4NSYA 2LPRA 3MH7A 2H6MA 1YP9A 3MNXA 3Q00A 3EA9A 4CREA 2R0KA 1O2QA 1G3EA 3ENSB 5A2MH 1N6YA 1WUNH 1Y3YA 3GCNA 3A8AA 4O3TA 1HPGA 2WPIS 2R3UA 4AZ2B 4Y79A 4TYDA 1T8NA 1JRSA 2HLCA 2DE9A 2R2MB 1C1NA 1O2NA 1GBDA 3EDXB 5A0AE 1V2ST 2G4UA 2ZDKA 1D3DB 2WYGA 3NXPA 3TK5A 2BQ7B 4DY7B 1YPMH 3S0NA 4B1TA 2W3KA 3RXCA 1CT4E 1K1MA 1TPAE 1SBWA 3BTEE 2FODA 1EX3A 1HAGE 1GMHG 2PLXA 2PWXA 2ZNKH 1QL8A 3P6ZB 3SI3H 3MU5A 2D26C 2HWLB 5ETXA 3RLYH 1GI6A 3A87A 3PM3A 2GCTB 5DP9A 4DGJA 1LCYA 1HAOH 1LMWB 2BZ6H 4Y8XA 2OD3B 1TPOA 2ZHFH 1Y3VA 3M5NA 1BMLA 3T29A 2BLOA 1O38A 3KEEA 1HIAA 3VXEH 2PGQB 4JK6A 4NWLA 2P8OC 1IQNA 3U9AH 1E38B 1P2OA 4Y7BA 3H5CB 2BHGA 1O36A 3GY3A 2FMJA 1Z71A 4BAQB 8LPRA 1SFQB 2BYAX 1P2QA 2PKAB 1AO5A 2BMGB 5EU8A 1CGIE 2P95A 3PV4A 1B5GH 3UQOA 4IC6A 5JYIA 1TQ0B 1EZXC 1WBGB 2UWLA 2ZFQH 4AYYB 4MPUA 1NFYA 4JZDH 3MNCA 3SBKA 1DXWA 1JMOH 2JETB 1MZAA 1FDPA 4WF8A 1O2UA 2HRVA 3U8OH 3FP6E 3O8BA 4NG9H 2PSXA 5A8YA 2FWWA 1V2TT 1E0FD 1LHDH 1CT0E 3OSYA 1ETSH 3RXDA 2P59A 1Z8IB 3IITA 4Z0KA 4NIXA 4XE4A 1DWBH 1S84A 1CBWB 2CF8H 5T3HA 1BHXF 5A8ZA 1HGTH 3BEFB 2QN5T 8GCHF 1CGJE 5EW2H 4K3JA 2J2UA 1YPGH 2FI4E 4BXWA 2FIRH 1AWHB 1HAPH 2QF0A 3LGVA 3SU6A 1KIGH 3M3VA 1N6XA 3MO9A 3Q3KA 1UK2A 5AF9H 1K21H 1Y59T 3A85A 1OKXA 1LVBA 3VXFH 1NFUA 4INHA 4I8KA 3K2UA 2BVXH 2ZQ1A 1C5PA 3RXPA 1MCVA 3NZIA 4MPWA 1AUJA 1VCQA 1Z8JB 1ACBE 3U1IB 1P2JA 2RA3A 1FUJA 3K6YA 1Z8GA 2BDIA 4ISLA 3SHCH 2AMQA 1ZGVA 4WMDA 5L2YH 3A86A 2ZQ2A 1L0ZA 1J15A 1NO9H 3RXSA 2CJIA 4K1TA 1TNGA 3A84A 2ZHWH 1SGRE 1EAIA 2BM2A 5C2ZA 1S81A 2VWMA 4HI3A 1P2IA 1MTWA 4CRGA 1C2MA 1TWXB 2JH5D 3SJOA 2D2DA 3T25A 2OTVA 2FI3E 1PYTD 4R0IA 4OS5A 3E0PB 2SGEE 4YOGA 4IMQA 3SGQE 5EPNA 3NCLA 2OCVB 3HKIB 5FCRA 2BTCE 1YPEH 1H4WA 4DURA 2GT8A 3ZV9A 2OLGA 1LKAA 5F8XA 1FI8A 2BD2A 4X6MA 1ZMNA 1B7XB 4Y76A 3C1KA 1GBCA 1O2WA 2PR3A 1XUKA 3QGJA 1G3DA 2ZC9H 2M5TA 1G3CA 1Z6EA 1GJDB 3RP2A 2EI6A 4RN6A 1SVPA 4CRDA 1WU1A 1UJ1A 1CHOG 4FUDA 3ZZ5A 1FXYA 3O8CA 3NKKA 1C5ZB 1QB6A 1UHBB 4LOYH 1EOJA 4UDWH 3ODDA 2ZU4A 2W7SA 3SU1A 1QIXB 1HCGA 3FAOA 3LOXA 1HJ8A 1SMFE 1TB6H 4ABFA 1HUTH 2WUBA 4GVUA 2A5IA 3B9FH 4GAWA 1DUEA 1GBHA 3KHVA 5H4IB 1KY9A 1KXEA 1OPHB 2GTBA 1IQHA 1C5UA 1BCUH 2XWBI 3TK9A 3SJIA 1VITH 1GMHF 1ELCA 2FOEA 1GBLA 2J9NA 2QYIA 3V3MA 1SLVB 2I6SA 4CRFA 1GGDB 1CQQA 1HBTH 4BTUB 2XYAA 4ZXYH 1ELTA 1ZR0A 4DVAU 1RS0A 2ZO3H 3LC3A 1SGFG 4AB9A 3SU3A 2VIOA 4A7IB 4HZHA 4Y8ZA 5DGJA 1BBRK 1AE8H 2ZU3A 2AGGX 1NROH 2H5CA 2XBYA 1C5NH 3ZYDA 2C90B 1C1VH 1PYTC 2FS9A 1KXCA 4A5TS 3LGYA 1QTFA 4Y0ZE 5AFYH 1HLTH 2HNTE 2Q1JA 1VR1H 4YESB 3P95A 1BTXA 3OX7U 1LHEH 4HGCA 5CMXH 2BD5A 1MD7A 1DWCH 3LIWA 3FZZA 1MKXH 1C5QA 4B73A 3D23A 1TONA 6CHAC 1QQUA 2GZ7A 3NUMA 4OS2A 1W13U 2VINA 1YBWA 4I33A 4CH8B 1GHAF 2SGQE 5CHAC 2AS9A 1TNJA 1O2SA 1BJUA 3BTDE 3ZVCA 1QR3E 1V2KT 4XDEA 1J8AA 4A1TA 4H4FA 2Z9IA 3ZZAA 3LH1A 4ESTE 1UTPA 3ZZBA 1PPFE 1BIOA 1PQ5A 2PW8H 1TPSA 8ESTE 3MFJA 4OS6A 3ZZCA 3ELAH 3P70B 3QO6A 1G2LA 1C4V2 4IGDA 5FPSA 1KTTB 5DKMA 2J34A 1FPCH 2Z3DA 3LH3A 2G00A 2O8UA 1YGCH 1A3EH 1C1QA 1IHTH 1O3CA 1V2RT 2GMTC 1EB1H 1T31A 1Z1IA 4JMYA 2OC0A 1YCPM 1BOQA 3MU8A 1ESBA 1AB9C 1GL1A 1O2MA 2TGPZ 1VGCC 4I7YH 1FY5A 1BRCE 2Q6FA 3SV9A 1GHYH 3DA9B 2K1QA 1DY9A 1L4DA 3EGKH 4O97A 3SUEA 3SUDA 2CXVA 1S6HA 1EZUC 1MKWH 5DP5A 5AFZH 2F91A 4BTIB 4K69A 1SI5H 3VB7A 1K1LA 4J2YB 3EE0B 1TGBA 1RXPA 4AYVB 1XX9A 7ESTE 2W7UA 3AAUA 4K60A 4H42U 5HXFA 3PLBA 4ZKNU 3KNXA 1KYNA 1P03A 1UCYE 1C2EA 1C2FA 3RMOH 3SNDA 2A1DB 2Y80A 1QB9A 2Y7XA 2CF9H 1GVKB 1ZZZA 2VWNA 2ZDAH 2XWAA 1CHGA 4UFGH 1N8OC 1WCZA 3KQDA 3ATWA 3SV6A 1NU7B 4KKDA 3P92A 3RXMA 3KQBA 2GX4A 2WPLS 3SGBE 3UTUH 1PPHE 1GDNA 2W5EA 5EOKA 1ESAA 3ZVEA 2ZTXA 1V2QT 5C5NA 1TLDA 1TBQH 5I25A 1FONA 1A61H 1FV9A 1YC0A 2UUYA 4AFSA 3BIVH 1MKXK 1MTNC 2BOHB 3NPSA 1QGFA 2A4QA 3GOVB 4X8UH 1V2PT 1A0HB 2B5TB 2PKAA 4ZUHA 1SG8B 2XBVA 1B0EA 2FXRA 2J38A 1RTKA 3RXGA 1GG6B 1AZZA 1C2DA 1HAVA 1QRWA 5C1YA 9LPRA 5K0HA 1FY3A 2FTMA 4X2VA 1PJPA 1DWDH 1GJ9B 2HPQH 3MNSA 1QA7A 1KXDA 1EOLA 4TPYA 1QY6A 3DUXH 2QCYA 2FOGA 3GDVA 4BAMB 4BAKB 3I29A 3W95A 1OSSA 3KF2A 1W7GH 5GJ4B 2JH6D 4Y8YA 4B74A 3GY2A 4VGCB 3GICB 3QLPH 3KIDU 2FOMB 2ZZUH 2GP9B 4CRCA 1C2LA 3SI4H 3E0NB 1THRH 1O2VA 1C5RA 3MNBA 2Z3EA 1QJ1B 1UVSH 1GVLA 1EJAA 2F9VA 3GISB 3OTJE 1ZSKA 4ASHA 4FUJA 2QXGA 1H1BA 2GV6A 1AU8A 3VFEA 3RXBA 4BANB 1HXFH 5BPEA 4D7GA 1LHFH 1BTWA 2EA3A 3AW1A 3A82A 1GDQA 4IN1A 5DP8A 3B23B 4X1SU 3K9XB 1ZYOA 1QFKH 3RM2H 1S6FA 1D3TB 2WPMS 1O5FH 4MVNA 4A6LA 1KXBA 3ATKA 3LGTA 2BDYA 3UY9A 3RXLA 9ESTA 1S0RA 2BX4A 2F9PA 2GMTB 3AW0A 3STIA 4HTCH 1HYLA 1WSSH 2HOBA 2P3UB 2UWPA 2PKSB 2ODYB 1P09A 1YYY1 2FYRA 4TY6A 5ABWA 3MH6A 1W12U 1IHSH 1HAIH 1BMAA 4AG1A 3P8OA 2TGDA 5GWZA 4UE7H 3RXKA 2A5AA 2Z3CA 3ATMA 3E8LA 1A3BH 5I46H 1BHXB 4IS5A 3AASA 1S5SA 1L1JA 5T6DA 1F0RA 2XW9A 2GZ8A 2ZTZA 4ZAEA 1KXFA 3MWIU 2ZHEH