2QF3A

Structure of the delta pdz truncation of the degs protease
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
221
structure length
200
Chain Sequence
QFDSTDETPASYNLAVRRAAPAVVNVYNRGLHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRNFLQTDASINHGNSGGALVNSLGELMGINTLSFPEGIGFAIPFQLATKIMDKLIRDGRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allosteric activation of DegS, a stress sensor PDZ protease.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 50
structure length 200
sequence length 221
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qf3A02
1EAUA 1GBIA 4U32A 2H5CA 3SGAE 3SU0A 2QF3A 4K8YA 4NSYA 3Q00A 4Z6AH 1DSUA 3LGWA 4WMDA 4B71A 1VZQH 5E0GA 2XWBI 1OWDA 3LC5A 3UWJH 4BTTB 3KEEA 3P17H 5C5NA 1XUIA 1A0LA 2BZ6H 1C2GA 2VGCB 3RDZA 1SGFG 3V13A 1HGTH 3BTTE 3SGQE 3UOUA 1UVPA 1IQJA 3AW1A 5GJ4B 1YC0A 4DT7B 1GBKA 1O3KA 1OWJA 1P8VC 2SNWA 1L1JA 2WPHS 4GSOA 4D76A 3S9CA 5HGGA 5HM9A 3U8RH 2ZHFH 2AS9A 1BIOA 5A2MH 2G4TA 2Y5HA 3FP8E 2A7HA 3SQEE 3PMAB 4IBLH 2PLXA 1P9SA 3UQOA 1Q31A 1NRRH 3EYDA 1FXYA 1OS8A 2ZU3A 1JOUB 2AGIX 3MTYA 1O2SA 3BIVH 4TY6A 4H6SB 2WYJA 4JK6A 3TGIE 2BD9A 3PV4A 2WPMS 2XC5A 4Y10E 2XRCA 1CHGA 1FIZA 8GCHF 3AVZA 1QRXA 1C2LA 2WPKS 4HGCA 2Q6FA 3GOVB 1AWFH 1GI7B 1V2VT 3TJVA 2AEIH 4K3JA 2B9LA 4NA7A 1BITA 3E0NB 4AGKA 4K8BA 4WWYA 1BHXF 2C90B 4CRDA 1ZRKA 3GY5A 1SFIA 3PMBB 3LJJA 1GI1A 4DVAU 1EZUC 3A80A 3SNBA 4Y7AA 4IC6A 3A8BA 4WH8A 1GGDB 3D49H 3T62A 2TGDA 3ZZBA 2C3SA 1TYNA 1WAYB 2BY9X 2FO9A 1P9UA 3P8OA 2VJ1A 1J15A 1O3NA 3RMLH 1Z8IB 3MO9A 1Z71A 3OX7U 4I32A 3A7TA 1O2KA 2J2UA 1PPBH 3O8CA 4YLQH 3MI4A 5IDKA 4U01A 2C8WB 4CRBA 4XOJA 1KLIH 4E7RG 4CRGA 1MAXA 2PSXA 2A5IA 3PLPA 3IG6B 3DT0H 2ZI2H 1O2IA 1NRSH 4I7YH 3VXFH 3GDSA 3D65E 4AX9H 2V35A 2ZFFH 1BRBE 4XBDA 2ALVA 3LPRA 1GMCF 1V2LT 2W7SA 4LK4A 4O97A 3GY3A 2P8OC 3U1JB 3M5LA 2CXVA 1HAOH 2SGAA 1N6XA 1O5BB 1J14A 5EPYA 3U1IB 1WTGH 1TB6H 2R0KA 3CS7A 1BUIA 1QA7A 5FPSA 1K1MA 5A8ZA 1IQLA 1QJ1B 5CHAC 4Y0ZE 1GG6C 5LPRA 1YLDA 1KIGH 4ZROA 1ZLRA 1LMWB 1IHSH 1O3PB 1DLEA 3UY9A 1BA8B 1C4V2 3SNAA 1BZXE 1IOEA 1F0TA 1RFNA 1RJXB 2R0LA 5C20A 3GISB 1EB1H 1NU7B 4X8SH 1EPTB 4JYUH 1GVKB 2ZHQH 1PPHE 3HK3B 4ISIH 3K6YA 1QBNA 2FXRA 3VB5A 1FN8A 1YPKH 5JYIA 2BDHA 4INLA 3F1SB 1TX8A 1SLVB 4XFQA 1TX6A 1NT1A 1C1TA 2ZF0H 4DIHH 4Y6DA 1L1GA 3SV9A 1W3CA 1O2ZA 1BTWA 1XXFA 2ZHEH 1SQAA 3OU0A 5E2PA 1Z7KA 1WQSA 4FU9A 1TNIA 3UFAA 1LPZB 3VFEA 3A82A 4LOYH 1HFDA 2O8WA 2XWAA 3SU6A 1FQ3A 2ASUB 2C8YB 5L6NH 2BVXH 3A81A 5J4SA 2XC0A 1C5ZB 1MMJN 1TRNA 4BAHB 2DE8A 2TIOA 1D9IA 1ZJDA 3BTGE 2P93A 3KQCA 2Z9GA 1HAVB 4CBOA 1TONA 3RMNH 3K65B 3TJNA 4MPWA 5JB8S 2FTLE 2P59A 5A0AE 5HMAA 3LONA 3P8NA 2DUCA 1A3BH 1P02A 1UMAH 1L0ZA 1KTTB 4ESTE 2XNIA 1CT2E 1EPTA 3RXDA 3M61U 2GZ9A 1O3IA 3QGNB 3P95A 2GT8A 4NA8A 2FPZA 4UFEH 2ILNA 1TA6A 1QGFA 2FOHA 2IPHA 1GDUA 1MH0A 3KQDA 3T27A 1SGYE 2J92A 1EJMA 3DUXH 3O8DA 2WUCA 4XSKU 2BDAA 1JRTA 3UR9A 1NRPH 4FUBA 1AZZA 1MZAA 4THNH 1GDQA 3SJOA 1KDQB 2NU0E 1Z8RA 1NU9A 1ETTH 2VINA 2VIWA 4OS6A 5ABWA 3EQ0H 4AN7A 3GYLB 4A1VA 1EKBB 1RXPA 1TPAE 4KGAA 1DT2A 1C2KA 1G9IE 1PPGE 4AB8A 2WV4A 3L6PA 1VGCB 1D4PB 4NFEA 5LPFA 5GWZA 1YPLH 2ZPSA 1SBWA 3TJOA 2BVRH 1HAVA 1C9TA 3AASA 4RKJB 1TX7A 1Z1IA 1C2IA 1CA0B 1DM4B 4M7GA 2VWNA 1G2LA 3N7OA 1F7ZA 3R3GB 1EP6A 2GZ8A 2SGDE 3EE0B 2TRMA 1HCGA 2HOBA 1BQYA 1ABIH 4B1TA 2A2XH 2Y6TA 4ISHH 3HKIB 3MFJA 3RXFA 3VGCC 3SW2B 2GTBA 2AMPA 1F0UA 1O2VA 2YNAA 1YYY1 1D3QB 4ZKSU 4CRFA 2VIDA 2AMQA 5I46H 2R2MB 2Y7XA 4FUFA 3ZYDA 1BMMH 1TBRH 4WVPE 1THRH 1KDQA 4GCHF 2D1JA 3M37A 3RXEA 1MD8A 1RIWC 2A7JA 5DP6A 3SBKA 3SV6A 2G00A 1P2MA 1ELEE 1O3BA 4KELA 3GCHC 4GUXA 2OQUA 3ATMA 2UUJB 2VVVA 5AFZH 1TE0A 1C1QA 2D26C 2OC0A 4BAOB 2BLOA 1TGSZ 2A4RA 1LHFH 2OQ5A 3A86A 1Z8JB 3Q77A 1ZMJA 2A7CA 4K1TA 3MU8A 1O5DH 4OS2A 1HAXB 4NZQA 3TH2H 1MTUA 4CH2B 4ZXXH 4UEHH 3UNQA 1O2JA 4E05H 4AOQA 5DGJA 2BY6X 1H8DH 4R8TB 1UVSH 4KTSA 1GBAA 3ZZ3A 3U69H 1DY8A 3ODFA 1Y3XA 1XX9A 2JH0D 1P2NA 4OGYA 3BEUA 1SOTA 3QTOH 4Y76A 2VH0A 1KXDA 1P57B 3A88A 2AYWA 3BTDE 2BD3A 3KGPA 4A1TA 1ZOMA 1PPCE 1CGIE 3Q3XA 2PV9B 1Q3XA 3BEIB 3TITA 1DWBH 1ZSLA 3NUMA 5T6DA 1KY9A 6CHAB 1KYNA 1O2QA 4O3UA 3KNXA 2SFAA 2A1DB 1LHGH 3MU0A 3SU5A 3SUGA 1OXGA 3RXSA 4OS5A 2V0BA 3ZVAA 1C1NA 2ZDAH 4NIYA 2RG3A 1V2KT 1BMAA 5HXFA 1Z6JH 1K1NA 2RA0A 4DCDA 2ODYB 1ZR0A 2FOMB 4ABEA 1FI8A 1DICA 5EPNA 1N6YA 2Q1JA 2H9HA 3TLOA 1W0ZU 4FUHA 1UTOA 1E34B 5HM2A 3RXJA 2O9QA 5EU8A 4J2YB 3LT3A 2IOTA 2GT7A 2ZG0H 3RU4E 1GJ8B 3I29A 3T5FH 1PPZA 6ESTA 2RCEA 4TPYA 4TY7A 4X6MA 2ZGCA 2W5EA 1ELTA 3RXGA 1TNLA 1KXEA 3AAVA 2Z9LA 1IQGA 2Y7ZA 1BBRK 3GDUA 3T2NA 2V3HH 3FZZA 4I33A 1VCQA 3G01A 1MTWA 2AGEX 2C93B 4HI3A 1SGTA 4ZHLU 2ANWA 1C2JA 2J95A 3SU1A 3B8JA 3BV9B 1DX5M 4JZEH 1DUAA 1QA0A 2W7UA 3E1XB 1EOLA 2BD7A 2QC2A 4BTIB 1EB2A 1TNKA 1VITH 4ABGA 1FNIA 3M5OA 1SGCA 3HATH 4CHAB 4YESB 2GCTB 4I31A 3SNEA 3BTHE 4FVBA 2UWLA 3MHWU 1FZZA 1A7SA 1O2PA 3BG8A 2H9TH 4Q7ZA 1BTPA 2P8OB 3ZZ9A 1RD3B 1SQOA 7GCHF 4CR5A 1CO7E 2ANMH 4AYYB 1BOQA 1EZSC 2BY5X 4K69A 3QN7A 2AERH 1NESE 4DG4A 1FIWA 3UWIA 3LKWA 1ELGA 4A5TS 4H4FA 1IQMA 1OSSA 4FUJA 3STIA 1W12U 2XCNA 4BAKB 3T25A 3C27B 4D9QA 1GVLA 3FVFB 1L2EA 1W7XH 1Y3YA 3RXPA 1XUFA 4IMQA 4I8HA 2TGAA 1C1PA 4X1SU 2QAAA 1XUHA 2ZP0H 3P8FA 1TGBA 3UUZA 3S7HB 2PW8H 1CU1A 1GCTB 2Z9JA 4FUEA 5JBBS 1AB9C 1C1RA 1HJ8A 1MTNC 4X1NU 5JBAS 2CN0H 1PQAA 1T8OA 3A7VA 3P6ZB 4I8LA 2BDIA 1HXEH 1V2QT 5JBTA 1E0FD 1ZSJA 2ZTXA 1YKTA 2B8OH 1ESTA 2GX4A 3STJA 1S6FA 4KTUA 1VR1H 4ZXYH 1XKAC 1QR3E 1ESAA 2FI5E 2AFQB 3A87A 2VIVA 1MBQA 1Y3UA 1G3BA 4BXSA 2P3UB 3NZIA 4B75A 5A8YA 4YOIA 1RTLA 1UCYE 1F0RA 3BTFE 5EODA 1TGTA 1GBHA 2CMYA 3ATLA 4IN2A 2FDAA 4GHTA 2PKSC 3SQHE 1B7XB 3M3VA 2QV1A 1O32A 2F9PA 1EOJA 1DWEH 1C9PA 1P2KA 1YPHC 4JK5A 1Y5UT 1VITF 2JETB 5ESTE 4YLUA 2VWOA 2BDBA 1UJ1A 1BTXA 5JBCS 2ZTZA 3MYWA 3NKKA 1KLTA 2ZGJA 3F9EA 1M9UA 4B2BA 1P3CA 1EAIA 1SLXB 1S0QA 1TMTH 3PYHA 4IN1A 1GHXH 3WY8A 4ABFA 1TIOA 5E0HA 4X6PA 2GCHG 3NCLA 1L1NA 2F83A 1C5PA 3BEFB 3MNCA 5LPEA 1O2LA 2OC1A 1T31A 2Q6GA 1KXFA 2G8TA 1W0YH 2ZU5A 1Z6EA 1RGQA 1P3EA 2D8WA 1QFKH 1CBWB 1O2NA 1NN6A 1P03A 1UTNA 1UK2A 5F8ZA 2BB4A 1RRKA 4B73A 2OP9A 1LVBA 3SNDA 6GCHF 3S9BA 1UCYH 2C8ZB 1CE5A 3PTNA 4Y0YE 1P0SH 1GBLA 3UOPA 4AG1A 3MNBA 3PB1E 1BMLA 2Z3CA 1QL8A 1SFQB 2O8TA 1SGPE 3LOXA 3U98H 4ABDA 4FUDA 3SJIA 4DIIH 1SGIB 1P2OA 3TNTA 4I8GA 4MVNA 1LVOA 2BZAA 4U30A 3PTBA 2CHAC 4R0IA 1DOJA 1S0RA 1E36B 5T6FA 3U8OH 3BTQE 2NWNA 4LZ4B 2C8XB 1ANCA 1BTYA 2ZFPH 1GMDG 2ULLA 3PO1B 3ZZ6A 1DUEA 2FS8A 2TBSA 1G3DA 1F0SA 2EEKA 3QX5H 1QY6A 4DW2U 1GMHG 1E37B 3A8CA 2JH6D 3T28A 5DP3A 3ZV8A 1A1RA 4NGAH 2ZHDA 3M7TA 2WUBA 2WYGA 1DITH 1MD7A 3FP7E 1GJ5H 4MPVA 8ESTE 5CE1A 1OWHA 2Z9KA 2HLCA 4ISNA 5A09A 1PQ7A 1GJ4H 4OGXA 3VB3A 1GBCA 2HVXA 3DHKH 1AE5A 3K2UA 3RXTA 1C5TA 1C2FA 1C5OH 2ZDVH 1O3AA 1O31A 1AFQB 1QB1A 1V2NT 4A1XA 4K2YA 3RMMH 1FAKH 2BD8A 3RXOA 1GHZA 5E0JA 1AD8H 2Q6DA 3BTKE 4JYTA 4ZKRU 1NRNH 3D62A 3GYMA 3PWBA 3T26A 3BG4C 1K1OA 2BX4A 1OKXA 3ATWA 1SPJA 5GCHF 2PHBA 2LPRA 2IJOB 5B6OA 3RU4T 4GVUA 2GVFA 1MTVA 1QBOA 2Z3DA 5I25A 1FPCH 3KQEA 1ACBE 4YOGA 1O3EA 3FAOA 3S9AA 3ODDA 1IQIA 2RA3A 3F9HA 3KL6A 4CH8B 3BN9A 3MH7A 5JB9S 1U6QA 4NWLA 2HNTC 1HPGA 2A31A 4YM9A 1ETRH 4NIWA 1O5FH 2A0QB 1O2WA 1A0HB 2ZFTA 3E16B 2WPIS 9LPRA 4NWKA 1GDNA 2Z94A 5FBIA 4AYVB 1O5GH 1TPOA 1O35A 5E8EH 1V2UT 1MCVA 1S83A 1O5AB 1CT4E 4MG3A 1HAHH 1PPEE 3R0FA 2A2QH 5PTPA 1GHAG 3GCNA 1QTFA 1VJ9U 2GD4B 1N8OB 1XUGA 2FLBH 2G55A 4ABIA 1QIXB 3A7ZA 3I77A 1DVAH 1HJ9A 2FIRH 3LH1A 5TCCA 5L2YH 9ESTA 4DOQA 3A8DA 1TOCB 3MOCA 5EQRA 5A0CA 1CQQA 4Y79A 1YF4A 3BTEE 2M5TA 2ZPQA 1GHVH 3SN8A 5FBEA 4A6LA 2GCHF 2ZU2A 2G81E 2QF0A 2D2DA 1QJ6B 1GI2A 3M3SA 2VGCC 1GI0A 2BQWB 1W14U 4D8NA 2TPIZ 2GV6A 3ZZDA 1O2TA 1F5KU 1BJUA 4UFDH 4ZUHA 2BLWA 1EAXA 3ZZ7A 2AH4X 1SMFE 2FI3E 2EI8A 1JBUH 1AI8H 1IHTH 1ZRBA 3MH4A 1C5SA 4UD9H 2EA3A 2NU1E 3BIUH 3SHAH 3FFGA 2P94A 2O8MA 3F68H 3TK5A 4Q7YA 2Y5GA 1OOKB 2FOGA 1Z1JA 2GMTB 4WY3A 1ZJKA 2ZNKH 2EI7A 2XXLA 1KXAA 4ZHAA 1GI9B 4VGCB 3RUOA 1FY8E 1UK3A 1K2I1 3ZVDA 4BNRA 2LNCA 2A32A 1P04A 1T8LA 2FI4E 1ZTLA 1BHXB 3CENA 4ZHMU 1V2OT 3GY7A 4XBBA 3VXEH 2BMGB 2ZC9H 1KSNA 3M5MA 4F49A 2ZFSA 1HJAB 3QUMP 1SGDE 1Y5BT 1GJ7B 3CP7A 1J17T 4AGJA 2R2WU 1XMNB 1C2HA 1NZQH 2ESTE 3RMOH 2A4QA 1O30A 4CRCA 1D6WA 1GMHF 3UR6A 3SO3A 5CMXH 2OCVB 2FOFA 3S69A 1F92A 4K5ZA 1JXPA 4J1YA 1LVMA 1SGRE 1J8AA 3M7QA 1LKBA 4WXIA 2QXHA 4X1PU 1DXWA 1WQVH 3SU2A 1GGDC 4HFPB 4CR9A 1C5MD 4Y11E 5G4BA 2TGPZ 1SB1H 1FY5A 1ZGIA 1SC8U 3UNSA 1CHOG 1J9CH 1NRQH 4YZUA 1MZDA 4NIXA 1WTHD 1HAZB 3MO3A 3SUFA 1GJBB 1O37A 1ARBA 1C2EA 2FOCA 1XM1A 1P10A 3HGNA 1K1IA 2QY0B 4Y8YA 3QWCH 2J9NA 1F5RA 2HNTF 1K22H 4IW4E 5DP5A 1YPGH 1UTJA 2Z7FE 3UIRA 2B5TB 2OUAA 3AW0A 2ZPRA 3TK9A 4FUCA 2Z9IA 5F03A 1XKBC 1LO6A 1ORFA 1BRAA 1AUTC 1BJVA 1S82A 2ZFRH 3GY6A 1C4Y2 1ZHPA 3DFJA 1PPFE 1B0EA 1QRZA 1UVOA 4X2XA 3RXHA 3SJ9A 4ZH8A 1SR5C 4AFQA 5BPEA 4MDSA 2VH6A 2XYAA 1ZPCA 4WF8A 1K1JA 3RM0H 5AFYH 4MNWA 2GDDA 4NSVA 3U9AH 1UHBB 4X8UH 1QQ4A 2ALPA 3S0NA 1KLJH 3VB7A 5DG6A 4HZHA 1MBMA 1TRYA 4D7GA 1HLTH 1GI4A 3SGBE 1XVMA 4MQAA 4AFUA 1CVWH 5JPMH 1QURH 4IS5A 1HB0B 3RXCA 2RDLA 1MCTA 2J38A 1T4VH 2PUQH 1EQ9A 2XC4A 1OP2A 1AKSB 3H7OA 4BTUB 1EPTC 2OBQA 1PQ5A 1P01A 2OXSA 1SLWB 3M7UA 1C2MA 2Z3EA 1C5RA 3DA9B 1ZYOA 2I6QA 1LHCH 2BOKA 2ANYA 2THFB 2ZCLP 1DSTA 1MKXH 3JZ2B 3ELAH 1D3PB 3ZZ4A 4FUGA 1GL1A 1RTKA 1EXFA 1P2JA 4U2WA 2BLVA 3GCOA 4MNVA 1JIRA 4E06H 1W13U 3GY8A 1EX3A 2ODQA 3MH5A 2OD3B 5SGAE 2PSYA 1DS2E 4WH6A 3EDXB 2TGTA 3OY5U 1HXFH 1C1OA 4X2YA 1CSOE 4AB9A 2XTTB 3B9FH 4Y71A 4WMEA 4BAMB 3W94A 1AWHB 1H9LB 1EATA 2BQ7B 1UHBA 2A4GA 4JZIA 2BOHB 2BD2A 3RC5A 2NU4E 3TNSA 1TRMA 1BT7A 3M36A 3NK8A 3Q3YA 1BRCE 2WPLS 2G4UA 2IN2A 2R9PA 1SG8B 2WPJS 1NFWA 3S7KB 2BY7X 2VIOA 1DWCH 1CA8B 4HTCH 1A46H 1AKSA 2ZWLH 4MPXA 3PM3A 4GPGA 1S5SA 1QRWA 4NCYA 4RN6A 5TJXA 3EA8A 1QHRB 1TLDA 2DE9A 2VWMA 2QGRA 2A4OA 1C5UA 2QXIA 4Q80A 1IQEA 1QL9A 1SGFA 1ZZZA 4AFSA 2P95A 1CT0E 3ATIA 3SU4A 3FP6E 3MU4A 2H9EH 3H5CB 2UWOA 3NWUA 1HYLA 4UE7H 3RXVA 3ZYEA 4UONA 2BY8X 3ZZAA 1MU8B 1GI5A 3UPEA 3V7TA 1WSSH 2EC9H 1QB6A 4Z0KA 2VIQA 3SJKA 1FDPA 1OPHB 1G37A 1S81A 3SI4H 1GJDB 4X6NA 1AVWA 3QZRA 1NFYA 1FUJA 3LJOA 2OLGA 4F4OC 4FVDA 1MUEB 1CHOF 4AZ2B 1S84A 1TPPA 2BX3A 1VGCC 1GBDA 1OP0A 4ZKNU 1O33A 1LHDH 5DO4H 5DP7A 1AU8A 1AZ8A 1TBQH 4O03A 1GBBA 1ELDE 1N1LA 2C4FH 3M5NA 4XBCA 1O38A 2FESH 3ZVBA 5CHAB 1CA0C 1GG6B 2SGFE 3M35A 1XUJA 1HBTH 2V3OH 1BTHH 1T32A 1DLKB 4ZAEA 4TPIZ 1GBMA 4LXBH 2UUKB 1EJAA 1DFPA 3F9GA 4X8VH 5T6GA 7LPRA 5FX5A 3RXAA 3ZVFA 1G3EA 1QQUA 2XCFA 5JDUB 1A4WH 1O5CB 1D6RA 1DANH 3E90B 1GL0E 1C5YB 1X7AC 4MNXA 1IQFA 1NPMA 1O3JA 2QXJA 2Z6BD 4MTBA 3SV2H 3TU7H 4FU7A 4RSPA 4Y8XA 1TABE 3ZV9A 5EW1H 3ESTA 5L2ZH 3TJUA 1TGNA 3EA7A 4ABBA 1G30B 2ZGHA 3SV7A 4GAWA 1K1LA 2OC8A 3A83A 1AO5A 2ZFQH 2F9NA 4YO9A 1HRTH 1GJ9B 4JZ1A 1T4UH 3M3TA 1SVPA 5DJ7A 1YPJH 2G52A 1F2SE 3W95A 2ZCKP 5BRRE 2F9OA 1AE8H 7ESTE 1SQTA 1S6HA 4QT8C 1O3FA 4MNYA 3RM2H 4K1SA 3VEQB 2BHGA 1V2ST 2G5NA 2ZDMA 3SHCH 1MQ5A 1E35B 1G3CA 1ELCA 3SOSA 3TGJE 3SUEA 1YPHE 5C67A 1DWDH 1V3XA 1IQNA 3PMJA 2VIPA 1KXBA 1BMNH 2K1QA 1W2KH 1ARCA 1P12E 3EA9A 1YCPM 1SGQE 3RXRA 4I8KA 4FU8A 1INCA 1O3OA 1O2MA 4X2WA 3LDXH 2ZA5A 3RXMA 2HPPH 3KHVA 3B23B 3SORA 1FY3A 1SGNE 1L4ZA 1T7CA 3GCTG 1V2WT 5LH8A 3H7TA 1B0FA 2FMJA 1UVUH 1GHWH 4JYVH 1IQHA 1C5LH 3GDVA 1O39A 3MMGA 4PROA 3K9XB 2BQ6B 2VWLA 3UREA 3QTVH 1FJSA 5K0HA 1ANDA 3RXKA 1SGEE 5J4QA 1BTZA 3F6UH 6CHAC 1PQ8A 2HGTH 3TH3H 2PR3A 3P8GA 1YCPH 3P92A 4NIVA 5C1UA 1YLCA 1ZPZA 1VCPA 2FZZA 2FX4A 1G36A 3ZVGA 3LGUA 1TA2A 4WJG2 3ZVCA 1THSH 3TK6A 3TVJB 1VJAU 1Y8TA 1ANEA 1O34A 2Y81A 4ABAA 3TGKE 4NA9H 4LZ1H 1RS0A 4SGAE 1C5WB 4A7IB 1MKXK 1A5HA 2ZU4A 1P2QA 2BM2A 5GIBA 5EQQA 1QNJA 5TCAA 1UTKA 1Z8GA 4Y8ZA 2R3YA 2ZZUH 1DPOA 1O3MA 1PJPA 1O2GH 3C1KA 1Y3WA 3RC6A 1F5LA 1GWAA 1W11U 4FXGH 4MPUA 4O9VA 4UFGH 1HNEE 1YPEH 1MKWH 1TNGA 1AN1E 2H1UA 3RLWH 1AHTH 1FN6A 4AFZA 3D23A 1QBVH 1JIMA 2QYIA 2GKVE 3FZDA 4ASHA 4SGBE 1TQ7B 2ODPA 2ZQ2A 3SJ8A 1TWXB 4Y7BA 2A5KA 5FXLA 1W10U 3VGCB 5ETXA 1E38B 1LQDB 1OX1A 2GGVB 3I78A 2H2ZA 4X1RU 2UUFB 4GHQA 3URDA 1L4DA 1ETSH 2O8LA 1ZHMA 1ZHRA 1FY1A 1TALA 2W3IA 1FLEE 1NTPA 1V2JT 1WUNH 3NXPA 4WXVA 4JCNA 1SSXA 1TMUH 3NPSA 2JKHA 1FAXA 1LQEA 1ZMLA 1RIWB 1SLUB 1HAIH 1O2HA 4ZMAH 1Y5AT 1KXCA 3VB4A 2QXGA 1GI3A 1GBEA 3GCHB 3BTME 2P3TB 1PFXC 2ZIQH 4CHAC 1UO6A 4OS1A 1DXPA 1EJNA 1ELBA 2OBOA 2GCTC 1MAYA 1S85A 1NC6A 1O3DA 5DKMA 2H6MA 4UDWH 1ZSKA 1Y59T 2HNTE 4B74A 4ISLA 5C1YA 1O2RA 2QCYA 2G51A 2W3KA 4GCHG 1ESBA 4K60A 3A7YA 3SZNA 2FWWA 2H5DA 2Y82A 2HALA 4X1QU 4BXWA 1FONA 1ZMNA 4CREA 3MWIU 1GHBG 2BTCE 3A85A 1BBRE 1H8IH 1NO9H 2OTVA 2AGGX 1OYQA 2F9VA 1DY9A 3MU5A 4YT6H 3Q76A 3Q3KA 1HV7A 2CF9H 1TAWA 1GCTC 4Q2KA 4AG2A 1YM0A 2GP9B 3GY4A 2ZHWH 1ANBA 5DP9A 5FPTA 2NU3E 1D3DB 1LTOA 2FYRA 4X2VA 1XUKA 2ZDKA 1DE7H 2HWLB 3BF6H 1OWEA 3E8LA 1WU1A 1H9IE 1MU6B 1LHEH 2SNVA 3KN2A 4RKOB 3T29A 1J16A 2XBXA 2ZU1A 1O2XA 1A5IA 1C1SA 1QJ7B 1B5GH 3HK6B 4OS7A 1SHHB 3FANA 3GCTF 2ZGBH 4D9RA 5FAHA 3HGPA 3V3MA 2CJIA 1O3GA 1DDJA 2BD4A 2BDCA 4XE4A 5C1XA 2W26A 1UTLM 4B2AA 3IITA 3TIUA 1C5NH 3EAJA 4DY7B 4TWYA 2GV7A 1BCUH 1BBRH 2KAIB 3A84A 1TQ0B 1QB9A 5GPIB 1ELFA 2PFEA 2JETC 3L3TA 2J94A 3JZ1B 3PWCA 2J4IA 1UTMA 2XBWA 1HIAB 3PMHB 4YT7H 3PLKA 5EGMA 2FYQA 4Q7XA 1P06A 5AHGH 2J34A 5AF9H 3RXQA 3EGKH 2P16A 1FMGA 2PGBB 2YOLA 1AVXA 2CV3A 2UWPA 1RTFB 2XBYA 4ABHA 2BYAX 3IWMA 3MU1A 1FPHH 5DPAA 4GLYA 2FLRH 1P09A 1FV9A 2ZKSA 3KIDU 4E7NA 1TOMH 1CBWC 4NG9H 2CF8H 4IGDA 5FCKA 5K7RA 3UNRA 2VB0A 1GMDF 1XVOA 4YTAA 3OY6U 5HYOA 4B2CA 8KME2 1O36A 5T3HA 1JMOH 3RLYH 3VPKA 1TFXA 2F9BH 4CRAA 1A2CH 3LGYA 4UFFH 4ISOA 1YCPK 4KTCA 3GY2A 2FM2A 2KAIA 2NU2E 2Y80A 1SHYA 3A7XA 1UCYK 1NFUA 4MLFB 5F8TA 2ZTYA 1KTSB 3F9FA 1SOZA 2FEQH 1T8MA 3PROA 5E2OA 1WV7H 2B0FA 5F6MA 4DJZB 2QN5T 1YPMH 2ZGXH 3SUDA 1HIAA 1C1UH 1C1VH 2F3CE 1H4WA 1H9HE 2PWXA 5ESBA 2Y5FA 3GICB 4TWWA 1OYTH 3PO1C 2G5VA 1NROH 1NFXA 4NFFA 2FTMA 1O3LA 5DP4A 2A45B 3ZZ8A 5FX6A 1LPGB 5FHTA 1LCYA 2FS9A 4X6OA 1MKWK 2BDGA 1YBWA 1AB9B 1MTNB 1TGCA 4JZDH 1CGHA 1C1WH 3ATKA 3LC3A 7GCHG 1GBFA 3SV8A 2BXTH 1A5GH 1EASA 2A5AA 1LKAA 2CGAA 3V0XA 3HKJB 4B76A 1V2RT 1V6DA 1LDTT 4INKA 2BD5A 2OC7A 2BLQA 1NS3A 2F91A 3L33A 2FOAA 3TPIZ 3SI3H 3QK1A 1FY4A 2I6SA 1GHBF 1V2TT 1ELVA 1AFQC 3ITIA 1ZTJA 5FPYA 3RXUA 3SU3A 1HDTH 2STBE 4H6TA 1TMBH 1IAUA 5FCRA 3DD2H 4X0WU 3ZZCA 1BDAA 4FUIA 2GDEH 3MO6A 3A89A 1NM6A 3K6ZA 1ZGVA 1ID5H 1TPSA 3SNCA 1AMHA 3DFLA 4XDEA 1C2DA 4ABJA 1GVZA 3PLBA 5EW2H 2PKSB 1MTSA 1GBTA 3OSYA 5L30H 1O5EH 3UQVA 1GHAF 4BOHA 2O8UA 4TYDA 1K28D 1MQ6A 1EAWA 3AAUA 4OS4A 1XXDA 2YNBA 1GI8B 1GJAB 3LGVA 5LGOA 1PYTD 4KKDA 1GJ6A 3E91A 4O3TA 1GI6A 4AORA 1HAGE 2JH5D 4D7FA 2HPQH 2WV5A 1BB0B 1BTUA 2AMDA 1C5VA 1O0DH 3A8AA 3QZQA 5EOKA 3RU4D 2PTNA 1A0JA 1TNHA 2PKAB 5C5OA 2V6NA 4JZFH 1D3TB 3QLPH 5EXNA 3RP2A 2GZ7A 1GPZA 1UK4A 3URCA 3V12A 1O3CA 2OINA 1O2UA 2ZO3H 1N8OC 2ZCHP 1UTQA 2BXUH 3O8BA 1VITG 2ZDNA 4IMZA 1TBZH 1EZQA 1WOFA 5EQSA 2VNTA 3E0PB 1P11E 5A8XA 4BAQB 2FP7B 1QL7A 1IQKA 2PUXB 6LPRA 1O2YA 2FODA 1T8NA 2PTCE 1W7GH 1O3HA 2VVCA 3RXLA 1WCZA 4A92A 1UTPA 3BSQA 1AFEH 2CHAB 5GXPA 1ABJH 1SI5H 1SL3A 1LPKB 2B7DH 2QIQA 4X8TH 5DK1A 5IYTA 5GDSH 5C2ZA 1G2MA 3LU9B 2F9UA 1W8BH 2EI6A 3HPTB 1Y3VA 1PYTC 2XW9A 2AIQA 3OYPA 8GCHG 2BDYA 3KQBA 3MH6A 2ZEBA 1ELAA 6GCHG 3LIWA 2AIPA 3TH4H 1A61H 1HUTH 3RXBA 2FX6A 1CGJE 1H1BA 1A3EH 1K9OE 3O8RA 1AY6H 1GBJA 2PKAA 5EG4A 2SGQE 1G32B 5H4IB 3BTWE 2BVSH 5C3NA 3ENSB 2GMTC 2ZDLA 2STAE 3U8TH 2ZECA 3RC4A 3VB6A 2ANKH 4VGCC 3QO6A 1TNJA 1AIXH 2SGEE 5A0BA 5AVDA 3A7WA 4NZLA 2FOEA 1YGCH 1AQ7A 1QCPA 8LPRA 1JWTA 1P05A 3KCGH 1HJAC 3MNXA 5EXLA 4DURA 3ZVEA 1OWKA 1HAPH 1V2MT 1ZTKA 2UUYA 3MNSA 4INHA 1K21H 4BANB 1C1MA 3BG4B 1K1PA 3KF2A 4H42U 1BRUP 4DGJA 4I8JA 3LGIA 1LVYA 2WINI 1WBGB 2ZQ1A 1C5XB 4YOJA 2FOBA 2PGQB 1OWIA 1EZXC 3LH3A 4IC5A 1YP9A 2VU8E 3E3TA 1GHYH 5F8XA 3QDZB 1UVTH 1GMCG 1NY22 1VCWA 3P70B 2HRVA 3QGJA 2P3FH 1AGJA 4WMFA 4JMYA 4CBNA 1V2PT 1Q2WA 3E6PH 3LGTA 2VVUA 1OP8A 1EUFA 2XBVA 4K1EA 1THPB 1O2OA 3ZZ5A 2SGPE 1GCDA 5GCHG 1HAYB 3UTUH 1ZPBA 4KP0A 1WYKA 4ZKOU 1P2IA 7KMEH 1C5QA 1EP5A 1C4U2 3CS0A 3RXIA 2QA9E 5DP8A 1JRSA 1AUJA 2R3UA 1AVGH 5EXMA 3OTJE 1GJCB
chains in the Genus database with same CATH superfamily
1EAUA 1GBIA 4U32A 2H5CA 3SGAE 3OAAD 3SU0A 2QF3A 4K8YA 4NSYA 3Q00A 2CK3D 4Z6AH 1DSUA 3LGWA 4WMDA 4B71A 1VZQH 5E0GA 2XWBI 1OWDA 3LC5A 3UWJH 4BTTB 3KEEA 3P17H 5C5NA 1XUIA 1A0LA 2BZ6H 1C2GA 2VGCB 3RDZA 2WHXA 1SGFG 3V13A 1HGTH 3BTTE 3SGQE 3UOUA 1OHHD 1BMFD 1UVPA 1IQJA 3AW1A 5GJ4B 1YC0A 4DT7B 3H09A 1GBKA 1O3KA 1OWJA 1P8VC 2SNWA 1L1JA 2WPHS 4GSOA 4D76A 3S9CA 5HGGA 4ACBA 5HM9A 3U8RH 2ZHFH 2AS9A 1BIOA 5A2MH 2G4TA 2Y5HA 3FP8E 2A7HA 3SQEE 3PMAB 4IBLH 2PLXA 1P9SA 3UQOA 1Q31A 1NRRH 3EYDA 1FXYA 1OS8A 2ZU3A 1JOUB 1SQRA 2AGIX 3MTYA 1O2SA 3BIVH 2J5UA 4TY6A 4H6SB 2WYJA 4JK6A 3TGIE 2BD9A 4OM9A 3PV4A 2WPMS 2XC5A 4Y10E 2XRCA 1CHGA 1FIZA 8GCHF 3AVZA 1QRXA 1C2LA 2WPKS 4HGCA 2Q6FA 3GOVB 1AWFH 1GI7B 1V2VT 3TJVA 2AEIH 4K3JA 2B9LA 2KCOA 4NA7A 2J98B 2GJGA 1BITA 3E0NB 4AGKA 4K8BA 4WWYA 1BHXF 2C90B 3GS9A 2J97A 4CRDA 1ZRKA 3GY5A 1SFIA 3PMBB 3LJJA 1GI1A 2W6ID 4DVAU 1EZUC 3A80A 3SNBA 4Y7AA 4IC6A 1WDIA 3A8BA 4WH8A 1GGDB 3D49H 3T62A 2TGDA 3ZZBA 2C3SA 1TYNA 1WAYB 2BY9X 2FO9A 3F0PA 1P9UA 3P8OA 2VJ1A 1J15A 1O3NA 3RMLH 1Z8IB 3MO9A 1Z71A 3OX7U 4I32A 3A7TA 1O2KA 2J2UA 1PPBH 3O8CA 4YLQH 3MI4A 5IDKA 4U01A 2C8WB 4CRBA 4XOJA 1KLIH 4E7RG 2KM0A 4CRGA 1MAXA 2KR7A 4M9FA 2PSXA 2A5IA 3PLPA 3IG6B 3DT0H 2ZI2H 5EJLA 1O2IA 1NRSH 4I7YH 3VXFH 3GDSA 3D65E 5C0UA 4AX9H 1MABB 2V35A 2ZFFH 1BRBE 4XBDA 2ALVA 3LPRA 1GMCF 1V2LT 2W7SA 4LK4A 4O97A 3GY3A 2P8OC 3U1JB 3M5LA 2CXVA 1HAOH 2SGAA 1N6XA 1O5BB 1J14A 2J98A 5EPYA 3U1IB 1WTGH 1TB6H 2R0KA 3CS7A 1BUIA 5DSFA 1QA7A 5FPSA 1K1MA 5A8ZA 1IQLA 1QJ1B 5CHAC 4Y0ZE 1GG6C 5LPRA 1YLDA 4F55A 1KIGH 4ZROA 1ZLRA 1LMWB 1IHSH 1O3PB 1DLEA 3UY9A 1BA8B 1C4V2 3SNAA 1BZXE 1IOEA 1F0TA 1RFNA 1RJXB 2R0LA 5C20A 3ZIAD 3GISB 1EB1H 1NU7B 4X8SH 2EY4C 1EPTB 4JYUH 1GVKB 2ZHQH 1PPHE 3HK3B 4ISIH 3K6YA 1QBNA 2FXRA 3VB5A 1FN8A 3N7EA 1YPKH 5JYIA 2BDHA 4INLA 3F1SB 1TX8A 1SLVB 4XFQA 1TX6A 1NT1A 1C1TA 2ZF0H 4DIHH 4Y6DA 1L1GA 3SV9A 1W3CA 1O2ZA 1BTWA 1XXFA 2ZHEH 1SQAA 3OU0A 5E2PA 1Z7KA 1WQSA 4FU9A 1TNIA 3UFAA 1LPZB 3VFEA 3A82A 4LOYH 2JDID 1HFDA 2O8WA 2XWAA 3SU6A 1FQ3A 2ASUB 2C8YB 5L6NH 2BVXH 3A81A 5J4SA 2XC0A 1C5ZB 1MMJN 1TRNA 4BAHB 2DE8A 2TIOA 1D9IA 1ZJDA 3BTGE 2P93A 3KQCA 2Z9GA 1HAVB 4CBOA 1TONA 3RMNH 3K65B 3TJNA 4MPWA 5JB8S 2FTLE 2P59A 5A0AE 5HMAA 3LONA 3P8NA 2DUCA 1A3BH 1P02A 1UMAH 1L0ZA 1KTTB 4ESTE 2XNIA 1CT2E 1EPTA 2JIZD 3EE7A 3RXDA 3M61U 2GZ9A 1O3IA 3QGNB 3P95A 2GT8A 4NA8A 2FPZA 4UFEH 2ILNA 1TA6A 1QGFA 2FOHA 2IPHA 1GDUA 1MH0A 3KQDA 3T27A 1SGYE 2J92A 1EJMA 3DUXH 3O8DA 2WUCA 4XSKU 2BDAA 1JRTA 3UR9A 1NRPH 4FUBA 1AZZA 1MZAA 4THNH 1GDQA 3SJOA 3WWBA 1KDQB 2NU0E 1Z8RA 1NU9A 1ETTH 2VINA 2VIWA 4OS6A 5ABWA 3EQ0H 4AN7A 3GYLB 4A1VA 1EKBB 2M2AA 1RXPA 1TPAE 4KGAA 1DT2A 1C2KA 1G9IE 1PPGE 2K0QA 4AB8A 2WV4A 3L6PA 1VGCB 1D4PB 4NFEA 5LPFA 5GWZA 4B6EA 1YPLH 2ZPSA 1SBWA 3TJOA 2BVRH 3FOAA 1HAVA 1C9TA 3AASA 4RKJB 1TX7A 1Z1IA 1C2IA 1CA0B 1DM4B 4M7GA 2VWNA 2W6JD 1G2LA 3N7OA 1F7ZA 3R3GB 1EP6A 1QZ8A 2GZ8A 2SGDE 3EE0B 2TRMA 1HCGA 2HOBA 1BQYA 1ABIH 4B1TA 2A2XH 2Y6TA 4ISHH 3HKIB 3MFJA 3RXFA 3VGCC 3SW2B 2GTBA 2AMPA 1F0UA 1O2VA 2YNAA 1YYY1 1D3QB 4ZKSU 4CRFA 2VIDA 2AMQA 5I46H 2R2MB 2Y7XA 4FUFA 3ZYDA 1BMMH 1TBRH 4WVPE 1THRH 1KDQA 4GCHF 2D1JA 3M37A 3RXEA 1MD8A 1RIWC 2A7JA 5DP6A 3SBKA 3SV6A 5HIZA 2G00A 1P2MA 1NBMD 1ELEE 1O3BA 4KELA 3GCHC 4GUXA 2PP6A 2OQUA 3ATMA 2KCYA 2UUJB 2VVVA 5AFZH 1TE0A 1C1QA 2D26C 2OC0A 4BAOB 2BLOA 1W0JD 1TGSZ 2A4RA 1LHFH 2OQ5A 3A86A 1Z8JB 3PV2A 3Q77A 1ZMJA 2A7CA 4K1TA 1YWUA 1O5DH 3MU8A 4OS2A 1HAXB 4NZQA 3TH2H 1MTUA 4CH2B 4ZXXH 5DN6D 4UEHH 1FX0B 3UNQA 1O2JA 4E05H 4AOQA 5DGJA 2BY6X 1H8DH 4R8TB 1UVSH 4KTSA 1GBAA 3ZZ3A 3U69H 1COWD 1DY8A 1S6LA 3DSOA 3ODFA 1Y3XA 1XX9A 2JH0D 1P2NA 4OGYA 3BEUA 1SOTA 3QTOH 4Y76A 2VH0A 1KXDA 1P57B 3A88A 2AYWA 3BTDE 2BD3A 3KGPA 4A1TA 1ZOMA 3SYJA 1PPCE 4TSFD 1CGIE 3Q3XA 2PV9B 1Q3XA 3BEIB 3TITA 1DWBH 1ZSLA 3NUMA 5T6DA 1KY9A 6CHAB 1KYNA 1O2QA 4O3UA 3KNXA 2SFAA 2A1DB 1LHGH 3MU0A 3SU5A 3SUGA 1OXGA 3RXSA 4OS5A 2V0BA 3ZVAA 1C1NA 2ZDAH 4NIYA 2RG3A 1V2KT 1BMAA 5HXFA 1Z6JH 1K1NA 2RA0A 4DCDA 2ODYB 1ZR0A 2FOMB 4ABEA 1FI8A 1DICA 5EPNA 1N6YA 2Q1JA 2H9HA 3TLOA 2WV9A 1W0ZU 4FUHA 1UTOA 1E34B 5HM2A 4B6FA 3RXJA 2O9QA 5EU8A 4J2YB 3LT3A 2IOTA 2GT7A 2ZG0H 3RU4E 1GJ8B 3I29A 3T5FH 1PPZA 6ESTA 2RCEA 2WSSD 4TPYA 4TY7A 4X6MA 2ZGCA 2W5EA 1ELTA 2WPDD 3RXGA 1TNLA 1KXEA 3AAVA 2Z9LA 1IQGA 2Y7ZA 1BBRK 3GDUA 3T2NA 2V3HH 3FZZA 4I33A 1VCQA 3G01A 1MTWA 2YMSD 3N7DA 2AGEX 2C93B 5KEDA 4HI3A 1SGTA 4ZHLU 2ANWA 1C2JA 2J95A 3SU1A 3B8JA 3BV9B 1DX5M 4JZEH 1DUAA 1QA0A 2W7UA 3E1XB 1EOLA 2BD7A 1H8ED 2QC2A 4BTIB 1EB2A 1TNKA 1VITH 4ABGA 1FNIA 3M5OA 1SGCA 3HATH 4CHAB 4YESB 2GCTB 3KQ5A 4I31A 3SNEA 3BTHE 4FVBA 2UWLA 3MHWU 4F48B 1FZZA 1A7SA 1O2PA 3BG8A 4Z1MD 2H9TH 4Q7ZA 1BTPA 2P8OB 3ZZ9A 1RD3B 1SQOA 7GCHF 4CR5A 1CO7E 2ANMH 4AYYB 1BOQA 1EZSC 2BY5X 4K69A 3QN7A 2AERH 1NESE 4DG4A 1FIWA 3UWIA 3LKWA 1ELGA 4A5TS 4H4FA 1IQMA 1OSSA 4FUJA 3STIA 1W12U 3U28C 2XCNA 4BAKB 3T25A 3C27B 4D9QA 1GVLA 3FVFB 1L2EA 1W7XH 1Y3YA 3RXPA 2AHME 1XUFA 4IMQA 4I8HA 2TGAA 1C1PA 2YMSC 4X1SU 2QAAA 1XUHA 2ZP0H 3P8FA 1TGBA 3UUZA 3S7HB 2PW8H 1CU1A 1GCTB 2Z9JA 4FUEA 5JBBS 1AB9C 1C1RA 1HJ8A 1MTNC 4X1NU 5JBAS 2CN0H 1PQAA 1T8OA 3A7VA 3P6ZB 1E79D 4I8LA 2BDIA 1HXEH 1V2QT 5JBTA 1E0FD 1ZSJA 2ZTXA 4ASUD 1YKTA 2B8OH 1ESTA 2GX4A 3STJA 1S6FA 4KTUA 1VR1H 4ZXYH 1XKAC 1QR3E 1ESAA 2FI5E 2AFQB 3A87A 2VIVA 1MBQA 1Y3UA 1G3BA 4BXSA 2P3UB 3NZIA 4B75A 5A8YA 4YOIA 1RTLA 1UCYE 3AK5A 1F0RA 3BTFE 5EODA 1TGTA 5HIYA 1GBHA 2CMYA 3ATLA 4IN2A 2FDAA 4GHTA 2PKSC 3SQHE 1B7XB 3M3VA 2QV1A 1O32A 2F9PA 1EOJA 1DWEH 1C9PA 1P2KA 1YPHC 4JK5A 1Y5UT 1VITF 2JETB 5ESTE 3FO8D 2VWOA 4YLUA 2BDBA 1UJ1A 1BTXA 5JBCS 2QF4A 2ZTZA 3MYWA 3NKKA 1KLTA 2ZGJA 3F9EA 1M9UA 4B2BA 1P3CA 1EAIA 1SLXB 1S0QA 1TMTH 3PYHA 4IN1A 1GHXH 3WY8A 4ABFA 1TIOA 5E0HA 4X6PA 2GCHG 3NCLA 1L1NA 2F83A 1C5PA 3BEFB 3MNCA 3KYFA 5LPEA 1O2LA 2OC1A 1T31A 2Q6GA 1KXFA 2G8TA 1W0YH 2ZU5A 1Z6EA 1RGQA 1P3EA 2D8WA 2KZ4A 1QFKH 1CBWB 1O2NA 1NN6A 1P03A 1UTNA 1UK2A 5F8ZA 2BB4A 5IK2D 1RRKA 4B73A 2OP9A 1LVBA 3SNDA 6GCHF 3S9BA 1UCYH 2C8ZB 1CE5A 3PTNA 4Y0YE 1P0SH 1GBLA 3UOPA 4AG1A 3MNBA 3PB1E 3DCLA 1BMLA 2Z3CA 1QL8A 1SFQB 2O8TA 1SGPE 3LOXA 3U98H 4ABDA 4FUDA 3N99A 3SJIA 4DIIH 1SGIB 1YLNA 1P2OA 3TNTA 4I8GA 4MVNA 3PRDA 1LVOA 2BZAA 2KFWA 4U30A 2RFKC 3PTBA 2CHAC 4R0IA 1DOJA 1S0RA 1E36B 5T6FA 3U8OH 3BTQE 2NWNA 4LZ4B 2C8XB 1ANCA 1BTYA 5EJZA 2ZFPH 1GMDG 2ULLA 3PO1B 3ZZ6A 1DUEA 2FS8A 2TBSA 1G3DA 1F0SA 2EEKA 3QX5H 1QY6A 4DW2U 1GMHG 1E37B 3A8CA 2JH6D 3T28A 5DP3A 3ZV8A 1A1RA 4NGAH 1EFRD 2ZHDA 2WUBA 3M7TA 2WYGA 1DITH 4YXWD 1MD7A 3FP7E 1GJ5H 4MPVA 8ESTE 5CE1A 1OWHA 2Z9KA 2HLCA 4ISNA 5A09A 1PQ7A 1GJ4H 4OGXA 3VB3A 1GBCA 2HVXA 3DHKH 1AE5A 3K2UA 3RXTA 1C5TA 1C2FA 1C5OH 2ZDVH 1O3AA 1O31A 1AFQB 1QB1A 1V2NT 4A1XA 4K2YA 3RMMH 1FAKH 2BD8A 3RXOA 1GHZA 5E0JA 1AD8H 2Q6DA 3BTKE 4JYTA 4ZKRU 1NRNH 3D62A 3GYMA 3PWBA 3T26A 3BG4C 1K1OA 2BX4A 1OKXA 3ATWA 1SPJA 5GCHF 2PHBA 2LPRA 2V7QD 2IJOB 5B6OA 3RU4T 4GVUA 2GVFA 1MTVA 1QBOA 2Z3DA 3PRBA 1FPCH 3KQEA 5I25A 1ACBE 4YOGA 1O3EA 3FAOA 3S9AA 3ODDA 1IQIA 2RA3A 3F9HA 3KL6A 4CH8B 3BN9A 3MH7A 5JB9S 1U6QA 4NWLA 2HNTC 1HPGA 2A31A 4YM9A 1ETRH 4NIWA 1O5FH 2A0QB 1O2WA 1A0HB 2ZFTA 3E16B 2WPIS 9LPRA 4NWKA 1GDNA 2Z94A 5FBIA 4AYVB 1O5GH 1TPOA 1O35A 5E8EH 1V2UT 1MCVA 1S83A 1O5AB 1CT4E 4MG3A 1HAHH 1PPEE 3R0FA 2A2QH 5PTPA 1GHAG 3GCNA 1QTFA 1VJ9U 2GD4B 1N8OB 1XUGA 2FLBH 2G55A 4ABIA 1QIXB 3A7ZA 3I77A 1DVAH 1HJ9A 2FIRH 3LH1A 5TCCA 5L2YH 3NRLA 9ESTA 4DOQA 3A8DA 1TOCB 3MOCA 5EQRA 5A0CA 1CQQA 4Y79A 1YF4A 3BTEE 2M5TA 2ZPQA 1GHVH 3SN8A 5FBEA 4A6LA 2GCHF 2ZU2A 2G81E 2QF0A 2D2DA 1QJ6B 1GI2A 3M3SA 2VGCC 1GI0A 2BQWB 1W14U 4D8NA 2TPIZ 2GV6A 3ZZDA 1O2TA 1F5KU 1BJUA 4UFDH 4ZUHA 3FN8A 2BLWA 1EAXA 3ZZ7A 2AH4X 1SMFE 2FI3E 4HG6A 2EI8A 1JBUH 1AI8H 1IHTH 1ZRBA 3MH4A 1C5SA 4UD9H 2EA3A 2NU1E 3BIUH 3SHAH 3FFGA 2P94A 2O8MA 3F68H 3TK5A 2L6OA 4Q7YA 2Y5GA 1OOKB 2FOGA 1Z1JA 2GMTB 4WY3A 1ZJKA 2ZNKH 2EI7A 2XXLA 1KXAA 4ZHAA 1GI9B 4VGCB 3RUOA 1FY8E 1UK3A 1K2I1 3ZVDA 4BNRA 2A32A 2LNCA 1P04A 1T8LA 2FI4E 1ZTLA 1BHXB 3CENA 4ZHMU 1V2OT 3GY7A 4XBBA 3VXEH 2BMGB 2ZC9H 1KSNA 3M5MA 4F49A 2ZFSA 1HJAB 3QUMP 1SGDE 1Y5BT 1GJ7B 3CP7A 1J17T 5B6LA 4AGJA 2R2WU 1XMNB 1C2HA 1NZQH 2LELA 2ESTE 3DSPA 3RMOH 2A4QA 4I86A 1O30A 4CRCA 1D6WA 1GMHF 3UR6A 3SO3A 5CMXH 2OCVB 2FOFA 3S69A 1F92A 4K5ZA 1JXPA 4J1YA 3FKSD 4FOUC 1LVMA 1SGRE 1J8AA 3M7QA 1LKBA 4WXIA 2QXHA 4X1PU 1DXWA 1WQVH 3SU2A 1GGDC 4HFPB 4CR9A 1C5MD 4Y11E 5G4BA 2TGPZ 1SB1H 1FY5A 1ZGIA 1SC8U 3UNSA 1CHOG 3DSGA 1J9CH 1NRQH 4YZUA 1MZDA 4NIXA 1WTHD 1HAZB 3MO3A 5F53A 3SUFA 1GJBB 2L74A 1O37A 1ARBA 1C2EA 1YY3A 2FOCA 1XM1A 1P10A 3HGNA 1K1IA 2QY0B 4Y8YA 3QWCH 2J9NA 1F5RA 2HNTF 1K22H 4IW4E 5DP5A 1YPGH 1UTJA 2Z7FE 3UIRA 2B5TB 2OUAA 3AW0A 2ZPRA 3TK9A 4FUCA 2Z9IA 5F03A 1XKBC 1LO6A 1ORFA 1BRAA 1AUTC 1BJVA 1S82A 2ZFRH 3GY6A 1C4Y2 1ZHPA 3DFJA 1PPFE 5C0TA 1B0EA 1QRZA 1UVOA 4X2XA 3RXHA 3SJ9A 4ZH8A 1SR5C 4AFQA 5BPEA 4MDSA 2VH6A 2XYAA 1ZPCA 4WF8A 1K1JA 3RM0H 5T1VA 5AFYH 4MNWA 2GDDA 4NSVA 3U9AH 1UHBB 4X8UH 1QQ4A 2ALPA 3F2FA 3S0NA 1KLJH 3VB7A 5DG6A 4HZHA 1MBMA 1TRYA 4D7GA 1HLTH 2KCPA 1GI4A 3SGBE 1XVMA 4MQAA 4AFUA 1CVWH 3UB0A 5JPMH 3VG8A 1QURH 2VBCA 4IS5A 1VKYA 1HB0B 3RXCA 2RDLA 1MCTA 2J38A 1T4VH 2PUQH 1EQ9A 2XC4A 1NBME 1OP2A 1AKSB 3H7OA 4BTUB 1EPTC 2OBQA 1PQ5A 1P01A 2OXSA 1SLWB 3M7UA 3OEHD 1C2MA 2Z3EA 1C5RA 3DA9B 1ZYOA 2XNDD 2I6QA 1LHCH 2BOKA 2ANYA 2THFB 2ZCLP 1DSTA 1MKXH 3JZ2B 3UAIC 3ELAH 1D3PB 3ZZ4A 4FUGA 4DT4A 1GL1A 1RTKA 4RI0A 1EXFA 1P2JA 4U2WA 2BLVA 3GCOA 4MNVA 1JIRA 4E06H 1W13U 3GY8A 1EX3A 2ODQA 3MH5A 2OD3B 5SGAE 2PSYA 1DS2E 4WH6A 3EDXB 2TGTA 3OY5U 1HXFH 1C1OA 4X2YA 1CSOE 4AB9A 2F4LA 2XTTB 3B9FH 4Y71A 4WMEA 4BAMB 3W94A 1AWHB 1H9LB 1EATA 2BQ7B 1UHBA 2A4GA 4JZIA 2BOHB 2BD2A 3RC5A 2NU4E 3TNSA 1TRMA 1BT7A 4TT3D 3M36A 3NK8A 3Q3YA 1BRCE 2WPLS 2G4UA 2IN2A 2R9PA 1SG8B 2WPJS 1NFWA 3S7KB 2BY7X 2VIOA 1DWCH 1CA8B 4HTCH 1A46H 1AKSA 2ZWLH 2EQNA 4MPXA 3PM3A 4GPGA 1S5SA 1QRWA 4NCYA 4RN6A 5TJXA 3EA8A 1QHRB 1TLDA 2DE9A 2VWMA 2QGRA 2A4OA 1C5UA 2QXIA 4Q80A 1IQEA 1QL9A 3OE7D 1SGFA 1ZZZA 4AFSA 2P95A 1CT0E 3ATIA 3SU4A 3FP6E 3MU4A 2H9EH 3H5CB 2UWOA 3NWUA 1HYLA 4UE7H 3RXVA 3ZYEA 4UONA 2BY8X 3ZZAA 1MU8B 1GI5A 3UPEA 3V7TA 1WSSH 2EC9H 1QB6A 4Z0KA 2VIQA 3SJKA 1FDPA 1OPHB 1G37A 1S81A 3SI4H 1GJDB 4X6NA 1AVWA 3QZRA 1NFYA 1FUJA 3LJOA 2OLGA 4F4OC 4FVDA 1MUEB 3WW7A 1CHOF 4AZ2B 1S84A 1TPPA 2BX3A 1VGCC 1GBDA 1H8HD 1OP0A 4ZKNU 1O33A 1LHDH 5DO4H 5DP7A 1AU8A 1AZ8A 1TBQH 4O03A 1GBBA 1ELDE 1N1LA 2C4FH 3M5NA 2IPQX 1O38A 2FESH 4XBCA 3F2GA 3ZVBA 5CHAB 1CA0C 1GG6B 2SGFE 3M35A 1XUJA 1HBTH 2V3OH 1BTHH 1T32A 1DLKB 4ZAEA 4TPIZ 3WWFA 1GBMA 4LXBH 2UUKB 1EJAA 1DFPA 3F9GA 4X8VH 5T6GA 7LPRA 5FX5A 3RXAA 3ZVFA 1G3EA 1QQUA 2XCFA 5JDUB 1A4WH 1O5CB 4AC9A 1D6RA 1DANH 3E90B 1GL0E 1UW7A 1C5YB 1X7AC 4MNXA 1IQFA 1NPMA 1O3JA 2QXJA 2Z6BD 4MTBA 3SV2H 3TU7H 4FU7A 4RSPA 4XD7D 4Y8XA 1TABE 3ZV9A 5EW1H 3ESTA 5L2ZH 3TJUA 1TGNA 3EA7A 4ABBA 1G30B 2ZGHA 5EJ1A 3SV7A 4GAWA 1K1LA 2OC8A 3A83A 1AO5A 2ZFQH 2F9NA 4YO9A 1HRTH 1GJ9B 4JZ1A 1T4UH 3M3TA 1SVPA 5DJ7A 1YPJH 2G52A 1F2SE 3W95A 2ZCKP 5BRRE 2F9OA 1AE8H 7ESTE 1SQTA 1S6HA 4QT8C 1O3FA 4MNYA 3RM2H 4K1SA 3VEQB 2BHGA 1V2ST 2G5NA 2ZDMA 3SHCH 2JJ1D 1MQ5A 1E35B 1G3CA 1ELCA 4RT0A 3SOSA 3TGJE 3SUEA 1YPHE 5C67A 1DWDH 1V3XA 1IQNA 3PMJA 2VIPA 1KXBA 1BMNH 2K1QA 1W2KH 1ARCA 1P12E 3EA9A 3MQKC 1YCPM 1SGQE 3RXRA 4I8KA 4FU8A 1INCA 1O3OA 1O2MA 4X2WA 3LDXH 2ZA5A 3RXMA 2HPPH 3KHVA 3B23B 3SORA 1FY3A 1SGNE 1L4ZA 1T7CA 3GCTG 1V2WT 5LH8A 5CDFE 3H7TA 1B0FA 2FMJA 1UVUH 1GHWH 4JYVH 1IQHA 2K8IA 1C5LH 3GDVA 1O39A 3MMGA 4PROA 3K9XB 2BQ6B 2VWLA 3UREA 3QTVH 1FJSA 5K0HA 1ANDA 3RXKA 1SGEE 5J4QA 1BTZA 3F6UH 6CHAC 1PQ8A 2HGTH 3TH3H 2PR3A 3P8GA 1YCPH 3P92A 4NIVA 5C1UA 1YLCA 1ZPZA 1VCPA 2FZZA 2FX4A 1G36A 3ZVGA 3LGUA 1TA2A 4WJG2 3ZVCA 1THSH 3TK6A 3TVJB 1VJAU 1Y8TA 1ANEA 1O34A 2Y81A 4ABAA 3TGKE 4NA9H 4LZ1H 1RS0A 4SGAE 1C5WB 4A7IB 1MKXK 2V3MA 1A5HA 5C94A 2ZU4A 1P2QA 2BM2A 5GIBA 5EQQA 1QNJA 5TCAA 1UTKA 1Z8GA 4Y8ZA 2R3YA 2ZZUH 2KCAA 1DPOA 1O3MA 1PJPA 4Q4LA 1O2GH 3C1KA 1Y3WA 3RC6A 1F5LA 1GWAA 1W11U 4FXGH 4MPUA 4O9VA 4UFGH 1HNEE 1YPEH 1MKWH 1TNGA 1AN1E 2H1UA 3RLWH 1AHTH 1FN6A 4AFZA 3D23A 1QBVH 1JIMA 2QYIA 2GKVE 2HLDD 3FZDA 4ASHA 4SGBE 1TQ7B 2ODPA 2ZQ2A 3SJ8A 1TWXB 4Y7BA 2A5KA 5FXLA 1W10U 3VGCB 5ETXA 1E38B 1LQDB 1OX1A 2GGVB 3I78A 2H2ZA 4X1RU 2UUFB 4GHQA 3URDA 1L4DA 1ETSH 1ZHMA 2O8LA 1ZHRA 1FY1A 4FETA 1TALA 2W3IA 1FLEE 1NTPA 1V2JT 1WUNH 3NXPA 4WXVA 4JCNA 1SSXA 1TMUH 3NPSA 3KYGA 2JKHA 1FAXA 1LQEA 1ZMLA 1RIWB 1SLUB 1HAIH 1O2HA 4ZMAH 1Y5AT 1KXCA 3VB4A 2QXGA 1GI3A 1GBEA 3GCHB 3BTME 2P3TB 1PFXC 2ZIQH 4CHAC 1UO6A 4OS1A 1DXPA 1EJNA 1ELBA 2OBOA 2GCTC 1MAYA 1S85A 1NC6A 1O3DA 5DKMA 2H6MA 4UDWH 1ZSKA 1Y59T 2HNTE 4RT1A 3F2HA 3SZEA 4B74A 4ISLA 5C1YA 1O2RA 2QCYA 2G51A 2W3KA 4GCHG 1ESBA 4XRNA 4K60A 3A7YA 3SZNA 2FWWA 2H5DA 2Y82A 2HALA 4X1QU 4BXWA 1FONA 1ZMNA 4CREA 3MWIU 1GHBG 2BTCE 3A85A 1BBRE 1H8IH 1NO9H 2OTVA 2AGGX 1OYQA 2F9VA 1DY9A 3MU5A 4YT6H 3Q76A 3Q3KA 1HV7A 2CF9H 1TAWA 1GCTC 4Q2KA 4AG2A 1YM0A 2GP9B 3GY4A 2ZHWH 1ANBA 5DP9A 5FPTA 2NU3E 1D3DB 1LTOA 2FYRA 4X2VA 1XUKA 2ZDKA 1DE7H 2HWLB 3BF6H 1E1QD 1OWEA 3E8LA 1WU1A 1H9IE 1MU6B 1LHEH 2SNVA 3KN2A 4RKOB 3T29A 1J16A 2XBXA 2ZU1A 1O2XA 1A5IA 1C1SA 1QJ7B 1B5GH 3HK6B 1E1RD 4OS7A 1SHHB 3FANA 3GCTF 2ZGBH 3OEED 4D9RA 5FAHA 3HGPA 3V3MA 2CJIA 1O3GA 1DDJA 2BD4A 2BDCA 4XE4A 5C1XA 2W26A 2LP6A 1UTLM 4B2AA 3IITA 3TIUA 1C5NH 3EAJA 4DY7B 4TWYA 2GV7A 1BCUH 1BBRH 2KAIB 2HVYB 3A84A 5C17A 1TQ0B 1QB9A 5GPIB 1ELFA 2PFEA 2JETC 3L3TA 2J94A 3JZ1B 3PWCA 2J4IA 1UTMA 2XBWA 1HIAB 3PMHB 4P00A 4YT7H 3PLKA 5EGMA 2FYQA 4Q7XA 5HKKD 1P06A 5AHGH 2J34A 5AF9H 3RXQA 3EGKH 2P16A 1FMGA 2PGBB 2YOLA 1AVXA 2IJD1 2CV3A 2UWPA 1RTFB 2XBYA 4ABHA 2BYAX 3IWMA 3MU1A 1FPHH 5DPAA 4GLYA 5EIYA 2FLRH 5CHBA 1P09A 1FV9A 2ZKSA 3KIDU 4E7NA 1TOMH 1CBWC 4NG9H 2CF8H 4IGDA 5FCKA 5K7RA 3UNRA 2VB0A 4P02A 1GMDF 1XVOA 4YTAA 3OY6U 5HYOA 4B2CA 1SKYE 8KME2 1O36A 5T3HA 1JMOH 3RLYH 3VPKA 1TFXA 2F9BH 4CRAA 1A2CH 3LGYA 4UFFH 4ISOA 1YCPK 4KTCA 3GY2A 2FM2A 2KAIA 2NU2E 2Y80A 1SHYA 3A7XA 1UCYK 1NFUA 4MLFB 5F8TA 2ZTYA 1KTSB 3F9FA 1SOZA 2FEQH 1T8MA 3PROA 5E2OA 1WV7H 2B0FA 5F6MA 4DJZB 2QN5T 1YPMH 2ZGXH 3SUDA 1W0KD 1HIAA 1C1UH 2F3CE 1C1VH 1H4WA 1H9HE 2PWXA 5ESBA 2Y5FA 3GICB 3PV5A 2YMSB 4TWWA 1OYTH 3PO1C 2G5VA 1NROH 1NFXA 4NFFA 2FTMA 1O3LA 5DP4A 2A45B 3ZZ8A 5FX6A 1LPGB 5FHTA 1LCYA 2FS9A 4X6OA 1MKWK 2BDGA 1YBWA 5KGOA 1AB9B 4ACAA 1MTNB 1TGCA 4JZDH 1CGHA 1C1WH 3ATKA 3LC3A 5FL7D 7GCHG 1GBFA 3SV8A 2BXTH 1A5GH 1EASA 2A5AA 1LKAA 2CGAA 3V0XA 3HKJB 4B76A 1V2RT 1V6DA 1LDTT 4INKA 3W1EA 2BD5A 2BLQA 2OC7A 1NS3A 2F91A 3L33A 2FOAA 2QF5A 3TPIZ 3SI3H 4ZCNA 3QK1A 1FY4A 2I6SA 1GHBF 1V2TT 1ELVA 2QE7D 1AFQC 3ITIA 1ZTJA 5FPYA 3RXUA 3SU3A 1HDTH 2STBE 4H6TA 1TMBH 1IAUA 5FCRA 3DD2H 4X0WU 1WXRA 3ZZCA 1BDAA 4FUIA 2GDEH 3MO6A 3A89A 1NM6A 3K6ZA 3OTPA 1ZGVA 1ID5H 1TPSA 3SNCA 1AMHA 3DFLA 4XDEA 1C2DA 4ABJA 1GVZA 3F0OA 3PLBA 5EW2H 2PKSB 1MTSA 1GBTA 3OSYA 5L30H 1O5EH 3UQVA 1GHAF 4BOHA 2O8UA 2WZQA 4TYDA 1K28D 1MQ6A 1EAWA 3AAUA 4OS4A 5GNDA 1XXDA 2YNBA 1GI8B 1GJAB 3LGVA 5LGOA 1PYTD 4KKDA 2OK5A 1GJ6A 3E91A 4O3TA 1GI6A 4AORA 1HAGE 2JH5D 4D7FA 2HPQH 2WV5A 1BB0B 2RDEA 1BTUA 2AMDA 1C5VA 1O0DH 3A8AA 3QZQA 5EOKA 3RU4D 2PTNA 1A0JA 1TNHA 2PKAB 5C5OA 2V6NA 4JZFH 1D3TB 3QLPH 5EXNA 3RP2A 2GZ7A 1GPZA 2JJ2D 1UK4A 3URCA 3V12A 4Q63A 1O3CA 2OINA 1O2UA 2ZO3H 1N8OC 2ZCHP 1UTQA 2BXUH 3O8BA 1VITG 2ZDNA 4IMZA 1TBZH 1EZQA 1WOFA 5EQSA 2VNTA 3E0PB 1P11E 5A8XA 4BAQB 2FP7B 1QL7A 1IQKA 2PUXB 6LPRA 1O2YA 2FODA 1T8NA 2PTCE 1W7GH 1O3HA 2VVCA 3RXLA 1WCZA 4A92A 1UTPA 3BSQA 1AFEH 2CHAB 5GXPA 1ABJH 2F43B 1SI5H 1SL3A 1LPKB 2B7DH 2QIQA 4X8TH 5DK1A 5IYTA 5GDSH 5C2ZA 1G2MA 3CNRA 3LU9B 2F9UA 1W8BH 2EI6A 2KX4A 5KECA 3HPTB 1Y3VA 1PYTC 2XW9A 2AIQA 3OYPA 8GCHG 2XOKD 2BDYA 3KQBA 3MH6A 2ZEBA 1ELAA 6GCHG 3LIWA 2AIPA 3TH4H 1A61H 1HUTH 3RXBA 2FX6A 1CGJE 1H1BA 1A3EH 1K9OE 3O8RA 1AY6H 1GBJA 2PKAA 5EG4A 2SGQE 1G32B 5H4IB 3BTWE 2BVSH 5C3NA 3ENSB 2GMTC 2ZDLA 2STAE 3U8TH 2ZECA 3RC4A 3VB6A 2ANKH 4VGCC 3QO6A 1TNJA 1AIXH 2SGEE 5A0BA 5AVDA 3A7WA 4NZLA 1KMHB 1YGCH 1AQ7A 2FOEA 1QCPA 8LPRA 1JWTA 1P05A 3KCGH 1HJAC 3MNXA 5EXLA 4DURA 3ZVEA 1OWKA 1HAPH 1V2MT 1ZTKA 2UUYA 3MNSA 4INHA 1K21H 4BANB 1C1MA 3BG4B 1K1PA 3KF2A 4H42U 1BRUP 4DGJA 4I8JA 3LGIA 1LVYA 2WINI 1WBGB 2ZQ1A 1C5XB 4YOJA 2FOBA 2PGQB 1OWIA 1EZXC 3LH3A 4IC5A 1YP9A 2VU8E 3E3TA 1GHYH 5F8XA 3QDZB 1UVTH 1GMCG 1NY22 1VCWA 3P70B 2HRVA 3QGJA 2P3FH 1AGJA 4WMFA 4JMYA 4CBNA 1V2PT 1Q2WA 3E6PH 3LGTA 2VVUA 1OP8A 1EUFA 2XBVA 4K1EA 3OFND 1THPB 1O2OA 3ZZ5A 2SGPE 1GCDA 5GCHG 1HAYB 3UTUH 1ZPBA 4KP0A 1WYKA 4ZKOU 1P2IA 7KMEH 1C5QA 1EP5A 1C4U2 3F3BA 3CS0A 3RXIA 2QA9E 5DP8A 1JRSA 1AUJA 1K0HA 2R3UA 1AVGH 5EXMA 3OTJE 1GJCB
chains in the Genus database with same CATH topology
1EAUA 1GBIA 4U32A 2H5CA 3SGAE 3SU0A 2QF3A 4K8YA 4NSYA 3Q00A 4Z6AH 1DSUA 3LGWA 4WMDA 4B71A 1VZQH 5E0GA 2XWBI 1OWDA 3LC5A 3UWJH 4BTTB 3KEEA 3P17H 5C5NA 1XUIA 1A0LA 2BZ6H 1C2GA 2VGCB 3RDZA 1SGFG 3V13A 1HGTH 3BTTE 3SGQE 3UOUA 1UVPA 1IQJA 3AW1A 5GJ4B 1YC0A 4DT7B 1GBKA 1O3KA 1OWJA 1P8VC 2SNWA 1L1JA 2WPHS 4GSOA 4D76A 3S9CA 5HGGA 5HM9A 3U8RH 2ZHFH 2AS9A 1BIOA 5A2MH 2G4TA 2Y5HA 3FP8E 2A7HA 3SQEE 3PMAB 4IBLH 2PLXA 1P9SA 3UQOA 1Q31A 1NRRH 3EYDA 1FXYA 1OS8A 2ZU3A 1JOUB 2AGIX 3MTYA 1O2SA 3BIVH 4TY6A 4H6SB 2WYJA 4JK6A 3TGIE 2BD9A 3PV4A 2WPMS 2XC5A 4Y10E 2XRCA 1CHGA 1FIZA 8GCHF 3AVZA 1QRXA 1C2LA 2WPKS 4HGCA 2Q6FA 3GOVB 1AWFH 1GI7B 1V2VT 3TJVA 2AEIH 4K3JA 2B9LA 4NA7A 1BITA 3E0NB 4AGKA 4K8BA 4WWYA 1BHXF 2C90B 4CRDA 1ZRKA 3GY5A 1SFIA 3PMBB 3LJJA 1GI1A 4DVAU 1EZUC 3A80A 3SNBA 4Y7AA 4IC6A 3A8BA 4WH8A 1GGDB 3D49H 3T62A 2TGDA 3ZZBA 2C3SA 1TYNA 1WAYB 2BY9X 2FO9A 1P9UA 3P8OA 2VJ1A 1J15A 1O3NA 3RMLH 1Z8IB 3MO9A 1Z71A 3OX7U 4I32A 3A7TA 1O2KA 2J2UA 1PPBH 3O8CA 4YLQH 3MI4A 5IDKA 4U01A 2C8WB 4CRBA 4XOJA 1KLIH 4E7RG 4CRGA 1MAXA 2PSXA 2A5IA 3PLPA 3IG6B 3DT0H 2ZI2H 1O2IA 1NRSH 4I7YH 3VXFH 3GDSA 3D65E 4AX9H 2V35A 2ZFFH 1BRBE 4XBDA 2ALVA 3LPRA 1GMCF 1V2LT 2W7SA 4LK4A 4O97A 3GY3A 2P8OC 3U1JB 3M5LA 2CXVA 1HAOH 2SGAA 1N6XA 1O5BB 1J14A 5EPYA 3U1IB 1WTGH 1TB6H 2R0KA 3CS7A 1BUIA 1QA7A 5FPSA 1K1MA 5A8ZA 1IQLA 1QJ1B 5CHAC 4Y0ZE 1GG6C 5LPRA 1YLDA 1KIGH 4ZROA 1ZLRA 1LMWB 1IHSH 1O3PB 1DLEA 3UY9A 1BA8B 1C4V2 3SNAA 1BZXE 1IOEA 1F0TA 1RFNA 1RJXB 2R0LA 5C20A 3GISB 1EB1H 1NU7B 4X8SH 1EPTB 4JYUH 1GVKB 2ZHQH 1PPHE 3HK3B 4ISIH 3K6YA 1QBNA 2FXRA 3VB5A 1FN8A 1YPKH 5JYIA 2BDHA 4INLA 3F1SB 1TX8A 1SLVB 4XFQA 1TX6A 1NT1A 1C1TA 2ZF0H 4DIHH 4Y6DA 1L1GA 3SV9A 1W3CA 1O2ZA 1BTWA 1XXFA 2ZHEH 1SQAA 3OU0A 5E2PA 1Z7KA 1WQSA 4FU9A 1TNIA 3UFAA 1LPZB 3VFEA 3A82A 4LOYH 1HFDA 2O8WA 2XWAA 3SU6A 1FQ3A 2ASUB 2C8YB 5L6NH 2BVXH 3A81A 5J4SA 2XC0A 1C5ZB 1MMJN 1TRNA 4BAHB 2DE8A 2TIOA 1D9IA 1ZJDA 3BTGE 2P93A 3KQCA 2Z9GA 1HAVB 4CBOA 1TONA 3RMNH 3K65B 3TJNA 4MPWA 5JB8S 2FTLE 2P59A 5A0AE 5HMAA 3LONA 3P8NA 2DUCA 1A3BH 1P02A 1UMAH 1L0ZA 1KTTB 4ESTE 2XNIA 1CT2E 1EPTA 3RXDA 3M61U 2GZ9A 1O3IA 3QGNB 3P95A 2GT8A 4NA8A 2FPZA 4UFEH 2ILNA 1TA6A 1QGFA 2FOHA 2IPHA 1GDUA 1MH0A 3KQDA 3T27A 1SGYE 2J92A 1EJMA 3DUXH 3O8DA 2WUCA 4XSKU 2BDAA 1JRTA 3UR9A 1NRPH 4FUBA 1AZZA 1MZAA 4THNH 1GDQA 3SJOA 1KDQB 2NU0E 1Z8RA 1NU9A 1ETTH 2VINA 2VIWA 4OS6A 5ABWA 3EQ0H 4AN7A 3GYLB 4A1VA 1EKBB 1RXPA 1TPAE 4KGAA 1DT2A 1C2KA 1G9IE 1PPGE 4AB8A 2WV4A 3L6PA 1VGCB 1D4PB 4NFEA 5LPFA 5GWZA 1YPLH 2ZPSA 1SBWA 3TJOA 2BVRH 1HAVA 1C9TA 3AASA 4RKJB 1TX7A 1Z1IA 1C2IA 1CA0B 1DM4B 4M7GA 2VWNA 1G2LA 3N7OA 1F7ZA 3R3GB 1EP6A 2GZ8A 2SGDE 3EE0B 2TRMA 1HCGA 2HOBA 1BQYA 1ABIH 4B1TA 2A2XH 2Y6TA 4ISHH 3HKIB 3MFJA 3RXFA 3VGCC 3SW2B 2GTBA 2AMPA 1F0UA 1O2VA 2YNAA 1YYY1 1D3QB 4ZKSU 4CRFA 2VIDA 2AMQA 5I46H 2R2MB 2Y7XA 4FUFA 3ZYDA 1BMMH 1TBRH 4WVPE 1THRH 1KDQA 4GCHF 2D1JA 3M37A 3RXEA 1MD8A 1RIWC 2A7JA 5DP6A 3SBKA 3SV6A 2G00A 1P2MA 1ELEE 1O3BA 4KELA 3GCHC 4GUXA 2OQUA 3ATMA 2UUJB 2VVVA 5AFZH 1TE0A 1C1QA 2D26C 2OC0A 4BAOB 2BLOA 1TGSZ 2A4RA 1LHFH 2OQ5A 3A86A 1Z8JB 3Q77A 1ZMJA 2A7CA 4K1TA 3MU8A 1O5DH 4OS2A 1HAXB 4NZQA 3TH2H 1MTUA 4CH2B 4ZXXH 4UEHH 3UNQA 1O2JA 4E05H 4AOQA 5DGJA 2BY6X 1H8DH 4R8TB 1UVSH 4KTSA 1GBAA 3ZZ3A 3U69H 1DY8A 3ODFA 1Y3XA 1XX9A 2JH0D 1P2NA 4OGYA 3BEUA 1SOTA 3QTOH 4Y76A 2VH0A 1KXDA 1P57B 3A88A 2AYWA 3BTDE 2BD3A 3KGPA 4A1TA 1ZOMA 1PPCE 1CGIE 3Q3XA 2PV9B 1Q3XA 3BEIB 3TITA 1DWBH 1ZSLA 3NUMA 5T6DA 1KY9A 6CHAB 1KYNA 1O2QA 4O3UA 3KNXA 2SFAA 2A1DB 1LHGH 3MU0A 3SU5A 3SUGA 1OXGA 3RXSA 4OS5A 2V0BA 3ZVAA 1C1NA 2ZDAH 4NIYA 2RG3A 1V2KT 1BMAA 5HXFA 1Z6JH 1K1NA 2RA0A 4DCDA 2ODYB 1ZR0A 2FOMB 4ABEA 1FI8A 1DICA 5EPNA 1N6YA 2Q1JA 2H9HA 3TLOA 1W0ZU 4FUHA 1UTOA 1E34B 5HM2A 3RXJA 2O9QA 5EU8A 4J2YB 3LT3A 2IOTA 2GT7A 2ZG0H 3RU4E 1GJ8B 3I29A 3T5FH 1PPZA 6ESTA 2RCEA 4TPYA 4TY7A 4X6MA 2ZGCA 2W5EA 1ELTA 3RXGA 1TNLA 1KXEA 3AAVA 2Z9LA 1IQGA 2Y7ZA 1BBRK 3GDUA 3T2NA 2V3HH 3FZZA 4I33A 1VCQA 3G01A 1MTWA 2AGEX 2C93B 4HI3A 1SGTA 4ZHLU 2ANWA 1C2JA 2J95A 3SU1A 3B8JA 3BV9B 1DX5M 4JZEH 1DUAA 1QA0A 2W7UA 3E1XB 1EOLA 2BD7A 2QC2A 4BTIB 1EB2A 1TNKA 1VITH 4ABGA 1FNIA 3M5OA 1SGCA 3HATH 4CHAB 4YESB 2GCTB 4I31A 3SNEA 3BTHE 4FVBA 2UWLA 3MHWU 1FZZA 1A7SA 1O2PA 3BG8A 2H9TH 4Q7ZA 1BTPA 2P8OB 3ZZ9A 1RD3B 1SQOA 7GCHF 4CR5A 1CO7E 2ANMH 4AYYB 1BOQA 1EZSC 2BY5X 4K69A 3QN7A 2AERH 1NESE 4DG4A 1FIWA 3UWIA 3LKWA 1ELGA 4A5TS 4H4FA 1IQMA 1OSSA 4FUJA 3STIA 1W12U 2XCNA 4BAKB 3T25A 3C27B 4D9QA 1GVLA 3FVFB 1L2EA 1W7XH 1Y3YA 3RXPA 1XUFA 4IMQA 4I8HA 2TGAA 1C1PA 4X1SU 2QAAA 1XUHA 2ZP0H 3P8FA 1TGBA 3UUZA 3S7HB 2PW8H 1CU1A 1GCTB 2Z9JA 4FUEA 5JBBS 1AB9C 1C1RA 1HJ8A 1MTNC 4X1NU 5JBAS 2CN0H 1PQAA 1T8OA 3A7VA 3P6ZB 4I8LA 2BDIA 1HXEH 1V2QT 5JBTA 1E0FD 1ZSJA 2ZTXA 1YKTA 2B8OH 1ESTA 2GX4A 3STJA 1S6FA 4KTUA 1VR1H 4ZXYH 1XKAC 1QR3E 1ESAA 2FI5E 2AFQB 3A87A 2VIVA 1MBQA 1Y3UA 1G3BA 4BXSA 2P3UB 3NZIA 4B75A 5A8YA 4YOIA 1RTLA 1UCYE 1F0RA 3BTFE 5EODA 1TGTA 1GBHA 2CMYA 3ATLA 4IN2A 2FDAA 4GHTA 2PKSC 3SQHE 1B7XB 3M3VA 2QV1A 1O32A 2F9PA 1EOJA 1DWEH 1C9PA 1P2KA 1YPHC 4JK5A 1Y5UT 1VITF 2JETB 5ESTE 4YLUA 2VWOA 2BDBA 1UJ1A 1BTXA 5JBCS 2ZTZA 3MYWA 3NKKA 1KLTA 2ZGJA 3F9EA 1M9UA 4B2BA 1P3CA 1EAIA 1SLXB 1S0QA 1TMTH 3PYHA 4IN1A 1GHXH 3WY8A 4ABFA 1TIOA 5E0HA 4X6PA 2GCHG 3NCLA 1L1NA 2F83A 1C5PA 3BEFB 3MNCA 5LPEA 1O2LA 2OC1A 1T31A 2Q6GA 1KXFA 2G8TA 1W0YH 2ZU5A 1Z6EA 1RGQA 1P3EA 2D8WA 1QFKH 1CBWB 1O2NA 1NN6A 1P03A 1UTNA 1UK2A 5F8ZA 2BB4A 1RRKA 4B73A 2OP9A 1LVBA 3SNDA 6GCHF 3S9BA 1UCYH 2C8ZB 1CE5A 3PTNA 4Y0YE 1P0SH 1GBLA 3UOPA 4AG1A 3MNBA 3PB1E 1BMLA 2Z3CA 1QL8A 1SFQB 2O8TA 1SGPE 3LOXA 3U98H 4ABDA 4FUDA 3SJIA 4DIIH 1SGIB 1P2OA 3TNTA 4I8GA 4MVNA 1LVOA 2BZAA 4U30A 3PTBA 2CHAC 4R0IA 1DOJA 1S0RA 1E36B 5T6FA 3U8OH 3BTQE 2NWNA 4LZ4B 2C8XB 1ANCA 1BTYA 2ZFPH 1GMDG 2ULLA 3PO1B 3ZZ6A 1DUEA 2FS8A 2TBSA 1G3DA 1F0SA 2EEKA 3QX5H 1QY6A 4DW2U 1GMHG 1E37B 3A8CA 2JH6D 3T28A 5DP3A 3ZV8A 1A1RA 4NGAH 2ZHDA 3M7TA 2WUBA 2WYGA 1DITH 1MD7A 3FP7E 1GJ5H 4MPVA 8ESTE 5CE1A 1OWHA 2Z9KA 2HLCA 4ISNA 5A09A 1PQ7A 1GJ4H 4OGXA 3VB3A 1GBCA 2HVXA 3DHKH 1AE5A 3K2UA 3RXTA 1C5TA 1C2FA 1C5OH 2ZDVH 1O3AA 1O31A 1AFQB 1QB1A 1V2NT 4A1XA 4K2YA 3RMMH 1FAKH 2BD8A 3RXOA 1GHZA 5E0JA 1AD8H 2Q6DA 3BTKE 4JYTA 4ZKRU 1NRNH 3D62A 3GYMA 3PWBA 3T26A 3BG4C 1K1OA 2BX4A 1OKXA 3ATWA 1SPJA 5GCHF 2PHBA 2LPRA 2IJOB 5B6OA 3RU4T 4GVUA 2GVFA 1MTVA 1QBOA 2Z3DA 5I25A 1FPCH 3KQEA 1ACBE 4YOGA 1O3EA 3FAOA 3S9AA 3ODDA 1IQIA 2RA3A 3F9HA 3KL6A 4CH8B 3BN9A 3MH7A 5JB9S 1U6QA 4NWLA 2HNTC 1HPGA 2A31A 4YM9A 1ETRH 4NIWA 1O5FH 2A0QB 1O2WA 1A0HB 2ZFTA 3E16B 2WPIS 9LPRA 4NWKA 1GDNA 2Z94A 5FBIA 4AYVB 1O5GH 1TPOA 1O35A 5E8EH 1V2UT 1MCVA 1S83A 1O5AB 1CT4E 4MG3A 1HAHH 1PPEE 3R0FA 2A2QH 5PTPA 1GHAG 3GCNA 1QTFA 1VJ9U 2GD4B 1N8OB 1XUGA 2FLBH 2G55A 4ABIA 1QIXB 3A7ZA 3I77A 1DVAH 1HJ9A 2FIRH 3LH1A 5TCCA 5L2YH 9ESTA 4DOQA 3A8DA 1TOCB 3MOCA 5EQRA 5A0CA 1CQQA 4Y79A 1YF4A 3BTEE 2M5TA 2ZPQA 1GHVH 3SN8A 5FBEA 4A6LA 2GCHF 2ZU2A 2G81E 2QF0A 2D2DA 1QJ6B 1GI2A 3M3SA 2VGCC 1GI0A 2BQWB 1W14U 4D8NA 2TPIZ 2GV6A 3ZZDA 1O2TA 1F5KU 1BJUA 4UFDH 4ZUHA 2BLWA 1EAXA 3ZZ7A 2AH4X 1SMFE 2FI3E 2EI8A 1JBUH 1AI8H 1IHTH 1ZRBA 3MH4A 1C5SA 4UD9H 2EA3A 2NU1E 3BIUH 3SHAH 3FFGA 2P94A 2O8MA 3F68H 3TK5A 4Q7YA 2Y5GA 1OOKB 2FOGA 1Z1JA 2GMTB 4WY3A 1ZJKA 2ZNKH 2EI7A 2XXLA 1KXAA 4ZHAA 1GI9B 4VGCB 3RUOA 1FY8E 1UK3A 1K2I1 3ZVDA 4BNRA 2LNCA 2A32A 1P04A 1T8LA 2FI4E 1ZTLA 1BHXB 3CENA 4ZHMU 1V2OT 3GY7A 4XBBA 3VXEH 2BMGB 2ZC9H 1KSNA 3M5MA 4F49A 2ZFSA 1HJAB 3QUMP 1SGDE 1Y5BT 1GJ7B 3CP7A 1J17T 4AGJA 2R2WU 1XMNB 1C2HA 1NZQH 2ESTE 3RMOH 2A4QA 1O30A 4CRCA 1D6WA 1GMHF 3UR6A 3SO3A 5CMXH 2OCVB 2FOFA 3S69A 1F92A 4K5ZA 1JXPA 4J1YA 1LVMA 1SGRE 1J8AA 3M7QA 1LKBA 4WXIA 2QXHA 4X1PU 1DXWA 1WQVH 3SU2A 1GGDC 4HFPB 4CR9A 1C5MD 4Y11E 5G4BA 2TGPZ 1SB1H 1FY5A 1ZGIA 1SC8U 3UNSA 1CHOG 1J9CH 1NRQH 4YZUA 1MZDA 4NIXA 1WTHD 1HAZB 3MO3A 3SUFA