3DSOA

Crystal structure of cu(i) bound copper resistance protein copk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography
pubmed doi rcsb
source organism Ralstonia metallidurans
molecule tags Metal binding protein
molecule keywords Putative uncharacterized protein copK
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dsoA00
3DSOA 2LELA 3DSPA 2KM0A 3N7DA 2K0QA 3N7EA
chains in the Genus database with same CATH superfamily
1W3CA 3M36A 3RXVA 2QF3A 4P02A 2D26C 4Q7ZA 2PUQH 4K1TA 1ID5H 1TFXA 1ELEE 2IN2A 3EA7A 1ZSLA 5JBTA 2W7UA 1BRUP 3F2GA 1W14U 2H5DA 1CGHA 2YMSD 1JXPA 3SJ9A 2PTCE 1ZTJA 1PPCE 1WSSH 2K0QA 1GBCA 4U32A 1TGNA 4MG3A 5AHGH 1TMBH 2TGTA 5DP3A 1OHHD 1Y3YA 2XC4A 2BQ7B 1GBKA 1DSTA 2AMPA 1GI0A 4Y76A 1GHWH 2PKAA 5FBIA 1TIOA 1DXWA 1DWDH 2A2QH 3UB0A 4MPUA 3F0PA 2YNAA 3SU3A 1X7AC 1TYNA 3SV6A 1LHCH 1FY4A 5C5NA 1JMOH 1P2QA 1QR3E 2NU4E 3P70B 3V7TA 1Y8TA 1MKXH 3HKJB 4NA9H 1TABE 3RXHA 4BAMB 1GJ6A 1LPGB 3RMMH 1VITH 1KTSB 3GCHB 2PWXA 4ZKRU 3Q3XA 3QK1A 3FP7E 4X0WU 1HJ9A 4D8NA 2J34A 1O5BB 1YF4A 1ESAA 4GHQA 1H8DH 2F9NA 4HFPB 3TPIZ 2JJ1D 2GV7A 5EODA 5F8ZA 3K6ZA 1OWJA 4X1NU 5J4SA 1ZRBA 1LPKB 2ODQA 4ZHAA 5T6FA 4ACBA 1O2VA 3K9XB 3GISB 5DP9A 1CGJE 2EA3A 5A8XA 1BOQA 2Y5GA 4P00A 3LPRA 2FODA 4UE7H 1LVYA 2BD3A 1ABIH 3K2UA 1ZJDA 1DICA 3A7YA 3VGCC 5GDSH 3ITIA 4OS1A 1TAWA 2YNBA 2ZGJA 2PLXA 1YPHC 1F92A 3QGNB 3GDSA 4CH8B 2XXLA 1S85A 3LGYA 4NIWA 1CHOG 1N6YA 3SUFA 3F2HA 4O97A 1PFXC 3DFLA 2IJD1 3TH2H 2O8WA 3LOXA 3LT3A 1ZMNA 3HGNA 3E0NB 3GYMA 4WXIA 1D6WA 3ATIA 3UIRA 2F9UA 4AYYB 4JZDH 4CRFA 4B2CA 1L4DA 1XM1A 4INKA 3E16B 1YBWA 5C1YA 3MH5A 1KMHB 1COWD 1V2WT 1J8AA 2KCOA 1TPOA 2ZHFH 3T29A 1RIWC 1ZRKA 3E0PB 4NSVA 4X2YA 2WPJS 2Y82A 1P9UA 2ZTZA 2J92A 1SGYE 2VVVA 2Q6GA 1P3CA 1QGFA 2Y7ZA 4WMDA 2QC2A 1GI6A 1BQYA 4BAHB 2GCHF 3OFND 5E0GA 3U9AH 1QL9A 1G37A 2WV9A 2FLRH 2VIWA 1ZTKA 2CHAC 1C1MA 1SGTA 3LH1A 4E7RG 4I33A 1FY5A 2ZC9H 1KXBA 1O39A 2TIOA 1D9IA 1Z8IB 2P93A 1NFYA 3AAVA 1Q2WA 2ZHDA 4FOUC 1LDTT 1UTNA 5C20A 3WWFA 3LJJA 3PWBA 5DP5A 3D62A 3DCLA 4MNYA 1AB9C 1GJDB 1GVZA 1Z6EA 5DG6A 1UK4A 2CK3D 2OINA 2NU0E 2V3MA 1W7GH 1EXFA 3SGBE 1C5XB 1L1JA 1PPZA 3GYLB 1BJUA 4GHTA 1FIZA 2BD7A 3CS7A 1TRMA 3TGJE 2YOLA 3A81A 3TJNA 2AFQB 1P0SH 2ZFSA 3S0NA 2STBE 1WU1A 1Z8RA 1FDPA 1CBWC 1D3TB 2Y7XA 4JYTA 3A7WA 3ZZDA 4DVAU 4XD7D 1AFEH 3QO6A 3QTOH 3CNRA 1GBEA 2PKSB 1H4WA 2ZHQH 2VIPA 3MNBA 3OU0A 3F1SB 1F7ZA 1YLDA 1Y5AT 3BTGE 4Y10E 1TGSZ 5HYOA 1RS0A 2GV6A 3NWUA 1BMNH 1RJXB 1W2KH 4NIYA 4WF8A 1UW7A 5L2YH 3KNXA 2ZFQH 1AU8A 2KR7A 3M7UA 4I8LA 1AWHB 4CBOA 1FY3A 3M35A 1TE0A 5CHAB 2L6OA 1GJ9B 1FNIA 3PTBA 2OBQA 4DY7B 1ZSKA 4FUBA 1NFWA 2ZGHA 3DHKH 3PRDA 1O5EH 4RKJB 3MO6A 3M3TA 1EJNA 2H9TH 4OS4A 2Z9KA 5J4QA 1TNJA 2ALPA 2TGAA 3U1IB 2VH0A 1C5UA 2W26A 1GBAA 2KX4A 1GI5A 3KEEA 4RSPA 1UTOA 2FI5E 4Y8ZA 4B6EA 1TX7A 2VWNA 2ZECA 3D65E 3VB6A 3MU8A 5CE1A 5FAHA 3V13A 1ZPZA 1IAUA 2QGRA 3TNTA 3I77A 4E7NA 1NFUA 1TOCB 2WHXA 4INLA 2H2ZA 3SQHE 1FY1A 2GZ8A 1HJAB 1HPGA 2D2DA 4WMEA 3URCA 1OWIA 4I7YH 4K8BA 1OPHB 3RU4E 2EI8A 1V2UT 3P8OA 1KDQB 4AGKA 3PB1E 3SUGA 1ELTA 1DVAH 1AFQC 1XXFA 1NTPA 1UVUH 1C2HA 5HIZA 1K1OA 1V2MT 3P8NA 1EP6A 5EPNA 1GJ7B 2QAAA 2WPKS 1G3BA 1NRPH 3VG8A 2BVRH 2F9BH 1RTKA 1OOKB 1LQDB 1WAYB 4RKOB 2QA9E 1F5KU 3GDUA 1EPTA 1NT1A 1QQ4A 1YPHE 4TY6A 1SHHB 1FPHH 3BTME 3V0XA 1H8IH 3A87A 2SGEE 3H7OA 3S7KB 1O5CB 2WPLS 3Q00A 3QGJA 3GCNA 1C1RA 1O2ZA 1TONA 2DE8A 4K69A 3AASA 1BTWA 1C5ZB 2FOGA 4DJZB 1HAPH 1HJ8A 3UPEA 2OQ5A 3GY6A 3TK6A 2Q6FA 2FOCA 4ACAA 3BTTE 1GMDF 4LZ4B 7GCHG 5BRRE 1O38A 3ZYEA 4ABAA 1QB1A 4AG1A 5C3NA 2ZFFH 5K0HA 2GZ7A 3DUXH 1KXDA 3OSYA 2B9LA 2A7HA 1P2MA 2NU1E 3URDA 1NO9H 1SOZA 1AHTH 1F0RA 1DITH 1V3XA 2UUKB 1FX0B 1DM4B 1C1PA 2W7SA 2O8LA 3UWIA 3VB3A 1G3EA 6GCHG 1QB9A 1SMFE 1EOLA 1W11U 2GTBA 3TH4H 2Z9JA 4IGDA 4NIXA 1P2OA 4AORA 1QL8A 3O8RA 4CREA 1B5GH 4CR9A 4B75A 1NY22 1BTXA 1QY6A 1SGRE 5A0AE 3VGCB 5E0JA 7KMEH 2Y5FA 3ZIAD 2BD8A 2Z94A 2L74A 2Q1JA 1TGBA 1YGCH 4QT8C 3ZZ6A 4JZ1A 4DGJA 2AERH 4F48B 3SU1A 3U28C 5C0TA 1RRKA 2J4IA 3P6ZB 1HDTH 2VGCB 3T25A 2BY5X 1AN1E 1HUTH 3STJA 3SNDA 2A5KA 1OS8A 4K2YA 1C5SA 1NRSH 4I8HA 1MTNB 1DY9A 2RA3A 2AYWA 3VPKA 5T6DA 2KCPA 1BBRE 5FBEA 4NCYA 1O2YA 5HXFA 1BITA 4O3TA 1Y3UA 1DWBH 1EB2A 1EATA 3MO3A 3SV2H 2FTMA 3FZZA 2TPIZ 3ZZAA 5E2PA 3S9CA 4MLFB 1GCDA 1VZQH 2BY9X 1AUJA 1C1QA 1GJ5H 3ODDA 3SZNA 4RT1A 1P2KA 5LH8A 1HIAB 1P04A 3GOVB 2ANMH 2QF0A 1QIXB 1UVOA 3CP7A 2F3CE 3GY7A 1P09A 1A61H 2GP9B 3MNSA 2I6QA 3A7TA 1IQHA 1UK2A 3T26A 1EP5A 1SLXB 1EB1H 2ILNA 2FEQH 5ESBA 2R0KA 1H1BA 7GCHF 3BTFE 1AVGH 1C9PA 2SGQE 1KYNA 3SORA 2JH0D 1C5QA 2A0QB 2P8OB 1LHEH 1GBBA 2JDID 2VWMA 4F49A 4D76A 3LKWA 3EDXB 3PV5A 4MQAA 1O3MA 3N7DA 1KTTB 2HOBA 2JJ2D 1RTLA 3RXPA 2NWNA 1GBDA 3RXFA 4AB8A 1J15A 1ZPCA 3M37A 1MTVA 4A7IB 1V2QT 3FN8A 5KGOA 3SJ8A 2VWOA 1O2IA 4R0IA 4FUDA 1VKYA 3PV2A 1GMCF 3MYWA 1FAXA 4AOQA 4AZ2B 1DUEA 2F43B 4YZUA 3F9GA 1TX6A 4LZ1H 3QUMP 4BAKB 1O2KA 1O5FH 5EQRA 2R2WU 4HGCA 1UO6A 2YMSC 4FXGH 3MFJA 2QF4A 1YPLH 4BANB 1C5LH 2HLDD 2O8UA 2HVYB 4Z0KA 1L2EA 8ESTE 5IYTA 2ZPSA 1V2TT 3ATMA 4CRCA 4I8GA 3TH3H 3UFAA 3WY8A 3Q77A 3SW2B 3TK9A 1DANH 5JB9S 3OEED 5DGJA 3RM0H 1CSOE 3LC3A 2QXGA 1P9SA 1A3BH 5LPFA 4LK4A 1QJ1B 1TRNA 1B7XB 2J5UA 3VB4A 3ATLA 1GBTA 4XRNA 2R3YA 2ZIQH 2HRVA 4I31A 1U6QA 1YPGH 2OD3B 1AD8H 1C5RA 1IHTH 1SBWA 3RXLA 3LGWA 1C5WB 4JK5A 3RXIA 1OWDA 1VR1H 1HLTH 3L3TA 4D9RA 4VGCB 2Z9GA 1OWKA 4TPYA 4ZH8A 1FN6A 2FTLE 1GJBB 1MKWK 2BVSH 2GDDA 2CGAA 1TMUH 4NA8A 1HRTH 5C1XA 3HK6B 1AKSA 4PROA 3MU4A 1L1NA 2FM2A 2H9HA 2W3IA 2STAE 1GVLA 1KSNA 2V3HH 3EAJA 1YPMH 1AE8H 2M5TA 2ZO3H 4IMZA 1K0HA 1LCYA 2GKVE 3PWCA 2CV3A 3UOPA 3UTUH 1MQ5A 4ISNA 1O3FA 1FUJA 1O5DH 1SVPA 3B8JA 3E90B 2ZQ2A 2FOMB 1MTSA 1M9UA 1C1UH 2KCYA 3ZZ5A 4UFEH 2TGDA 4Z6AH 5HMAA 4NZQA 2QN5T 3PMHB 3SNAA 4X1SU 1O2PA 1SFQB 2VWLA 5C67A 1P11E 1SC8U 2FLBH 1MKXK 2QXJA 1ETTH 1JIMA 1YYY1 1ZMLA 2AGEX 3SBKA 1H8ED 9ESTA 1ELDE 2AMQA 5EXNA 1TLDA 3SZEA 1SG8B 5CMXH 3LONA 3OYPA 3RXDA 1C2IA 1VJ9U 1QHRB 4OS7A 3D23A 1YM0A 1HGTH 3M5OA 1QFKH 3FVFB 1BCUH 4K1EA 2BTCE 2XC0A 1MUEB 3OX7U 3RXAA 3SGAE 4WWYA 1A7SA 1SI5H 3M61U 2KZ4A 5F8TA 3ZVFA 5EIYA 1GBMA 1O2WA 1XVMA 2CHAB 4U30A 1C2GA 2RG3A 1O3GA 4Q63A 1LHDH 3M7QA 3A80A 3KF2A 1QCPA 3BN9A 3A88A 4FVDA 2WPIS 1TNGA 2QY0B 1GHAG 1MZAA 2G51A 3K6YA 5TCCA 1O32A 3E8LA 1GL0E 5C5OA 3MH4A 7LPRA 4IS5A 1A3EH 2CXVA 1VGCB 2ZF0H 2ZP0H 3ZZ7A 5CHAC 1WV7H 5GNDA 1QJ6B 4CHAC 2SFAA 2BQWB 1C2JA 3FO8D 4IN2A 2A7CA 1C9TA 1HAVB 4CRGA 1PQ5A 2BLOA 4K8YA 2C90B 3GCHC 3VB7A 1DLEA 4BNRA 5EXLA 3F68H 4BXWA 1DX5M 2C8WB 4FU7A 2EI7A 2A5IA 3BTHE 4TPIZ 1TPAE 1C5TA 3QZRA 1TPSA 1AIXH 1QJ7B 2ZU3A 1KXCA 1YCPH 4TSFD 2A2XH 2C8YB 4MTBA 4ABJA 4D7GA 2IOTA 1MD8A 3Q76A 1AO5A 1P02A 4B6FA 5ESTE 3UWJH 4ZXYH 3L33A 2HGTH 3A84A 3STIA 4I8KA 2ANYA 4ISOA 1GCTC 2PV9B 4AC9A 3RMNH 1VCQA 2BMGB 3E6PH 4JZFH 4ZKSU 1MU8B 3GCTG 4IC5A 4M9FA 1O3PB 3UNRA 5BPEA 1P06A 1HAIH 2VU8E 4TYDA 2QF5A 2ZDMA 1C4U2 1ZGVA 2EI6A 2Y5HA 1O33A 1BIOA 4X1RU 1BRCE 1SB1H 1O2OA 3M5LA 4FUJA 1O2UA 3NPSA 4U01A 5A8ZA 1MMJN 2F9VA 2F9PA 2BB4A 2GCHG 3ENSB 1HBTH 3A82A 3KHVA 3VXEH 1SGFG 4FVBA 3BTKE 1XKAC 1O3BA 1RFNA 1MD7A 4VGCC 1Y59T 1FZZA 1MH0A 1NRRH 1JIRA 3BF6H 2FS9A 2ZA5A 3PYHA 1GHAF 1GVKB 2WPHS 3ZZ4A 2C4FH 3LH3A 1AGJA 1P10A 3RXUA 3RXEA 4AG2A 1W0ZU 1O2TA 1JOUB 4Y0ZE 1O31A 4KTSA 3R3GB 1SGEE 4I32A 2ZQ1A 1CHOF 1D6RA 1FIWA 1DLKB 1UJ1A 2PGBB 3P8FA 1LMWB 4YO9A 2J98A 3OY6U 2PKSC 3T62A 1E36B 1YCPK 2J94A 3M3SA 5JBCS 4KELA 2OTVA 1GI4A 3MH6A 4GCHG 4XBDA 1ACBE 1LQEA 1Z1IA 4YOGA 2YMSB 3GCOA 1DT2A 3ZZCA 1O2GH 1EAUA 5L6NH 1MCVA 4O9VA 3KL6A 3T5FH 3RXBA 1TGTA 1GG6C 3RXOA 4YOJA 4NA7A 4X1QU 2OC7A 3EE0B 5AVDA 3KQDA 1HIAA 1NZQH 3F9FA 3V3MA 1TGCA 4DW2U 2VNTA 1GMHG 2XBVA 1GBIA 2UWOA 2ZKSA 5TCAA 1FXYA 4OS5A 2H9EH 2Z9LA 2XNDD 1THPB 2BD2A 2HPQH 3BEUA 5HIYA 2OP9A 1O2XA 3PROA 1TOMH 3RXRA 1C5YB 1OYTH 4UD9H 3ZZ9A 4X8UH 2H6MA 3E1XB 5FXLA 3GCTF 4TWYA 4X2XA 1YC0A 1ANEA 3ZVCA 4GAWA 2FOHA 2VIOA 1F0SA 2VIQA 1Q3XA 1ESBA 1QRWA 3BTWE 3EQ0H 1C2KA 1QBVH 1EJAA 1TBQH 1OKXA 4ZROA 1WOFA 1O3CA 1JWTA 4JZEH 2FPZA 2XOKD 1BMFD 4WH6A 5FPSA 4MVNA 1YLCA 1FN8A 4XE4A 1K1PA 1QA0A 5K7RA 5JB8S 1ORFA 4HG6A 2EEKA 3RMLH 1EQ9A 1S84A 3W94A 1K1IA 2G8TA 2A1DB 4J2YB 2GVFA 3GY4A 3PMBB 4ZAEA 1HFDA 1EX3A 1CHGA 4NSYA 1UCYE 2FYQA 1XX9A 2WPDD 4B74A 3F9EA 2KFWA 4H4FA 4ABBA 1HB0B 1IQEA 1LKBA 2BLWA 5EW1H 3F9HA 1F5RA 1VCPA 2IPQX 3WWBA 5FPTA 4DIIH 5LPRA 1ELFA 2XCFA 3AVZA 3MHWU 1TBRH 2ZU2A 2GMTB 1AVXA 1E38B 4SGBE 3SO3A 5GWZA 1VITG 2ZTYA 1ESTA 1GJ8B 1O2HA 1P2IA 4GCHF 4UEHH 1S6FA 3IWMA 4CRDA 1O3IA 4DT4A 1IHSH 3TGIE 1G2MA 1FV9A 2R3UA 1THSH 3V12A 1EFRD 3MNXA 4HZHA 2G55A 1ZYOA 2WUBA 1WCZA 2FIRH 4ABHA 4F55A 2VB0A 1D3PB 3NZIA 3TJVA 1PPBH 1ZZZA 5GCHF 5T1VA 4TWWA 4DURA 1UTPA 2HWLB 3N99A 4Q7YA 2ODPA 1G32B 1MKWH 1INCA 1EAIA 1FONA 2M2AA 1C5VA 2GZ9A 1Y3WA 2AGIX 2BY6X 2FP7B 5F03A 3W1EA 4GSOA 2TRMA 1SLWB 4DG4A 1AMHA 2GCTC 2PSYA 2F4LA 2FDAA 4MPXA 1QBOA 5ABWA 1SGIB 2HNTF 3MQKC 2TBSA 2UWLA 2SGAA 2ZDNA 2C3SA 1ELCA 2P8OC 1MBQA 1OX1A 3BIUH 3ATWA 1P12E 1O3NA 2G52A 3FKSD 8GCHG 2A7JA 4IBLH 2RDEA 1O2MA 2EC9H 1P03A 3WW7A 2G5VA 4OM9A 3ATKA 1VGCC 1A0JA 1GHZA 2BD9A 3RU4D 1PPEE 2J38A 4YLUA 1Z6JH 1C2EA 4XFQA 3SYJA 1DDJA 1Z8GA 4F4OC 5JYIA 5F6MA 3S7HB 1G3CA 1NU7B 2FYRA 4ZXXH 1TBZH 4D9QA 4A1VA 1MTUA 3FOAA 4KTCA 1W0KD 3VFEA 3PLKA 5B6LA 2XBXA 3MOCA 1NM6A 4BOHA 3EA8A 1XUFA 1IQGA 4YM9A 2W6ID 3PMJA 5EQQA 1YPJH 3RXCA 2FI4E 2ANWA 1ZOMA 3RU4T 1PPGE 4M7GA 4UFDH 3SHCH 1SR5C 1GGDC 5L2ZH 1ARBA 1N8OC 3HPTB 1V2LT 1FJSA 4JYVH 1A5GH 3DSOA 1F0TA 4X6MA 4CRBA 4H42U 2FOAA 1SLUB 1NPMA 2P94A 1NROH 1IQNA 4Y8YA 1L0ZA 2A5AA 5EG4A 2XBWA 4JZIA 1J16A 2Y80A 1BMMH 4Y7AA 2WUCA 5IDKA 1TA6A 4CHAB 3U98H 1TRYA 2BM2A 3P95A 1K1LA 4Y79A 4FU9A 1WYKA 1BTYA 3OY5U 2ZHWH 3BTQE 1BMAA 5C1UA 1E35B 1GL1A 1OYQA 1XUIA 3CENA 1V2PT 4ABIA 1MBMA 2SGDE 1ZHMA 1SSXA 2WINI 1B0EA 2CJIA 1EKBB 1SGPE 4ZUHA 4TT3D 2CF8H 2EQNA 1UVSH 1DPOA 3ZVBA 4GLYA 3AK5A 1E37B 1PPHE 1H9IE 3FFGA 1FPCH 1LTOA 1ELBA 2AHME 3HATH 1BTUA 3M5MA 3LGUA 2FESH 4Y11E 1YY3A 1EJMA 1UTMA 4ASHA 3MI4A 3GICB 1ARCA 2QIQA 2W5EA 5C17A 3DSGA 4Y71A 1Y3XA 4Q2KA 4J1YA 5EPYA 2ZTXA 5HM9A 2ZI2H 3A86A 3ZYDA 3BEFB 1TNLA 1GJAB 4ABFA 3A8DA 3TVJB 2OUAA 3SUEA 5B6OA 3M5NA 1AI8H 4RI0A 1GMCG 2W3KA 5DP4A 2A4GA 1W0JD 1K2I1 1WBGB 2NU3E 1O0DH 4B73A 1S0RA 1BBRK 3SUDA 4X2VA 2A32A 2G5NA 3EA9A 1G2LA 1UTKA 1OSSA 3FZDA 2C8ZB 2SGFE 2DE9A 1YWUA 1NS3A 3NUMA 2ZHEH 4X6OA 1XUJA 2J98B 2WSSD 3VB5A 2BDAA 1VCWA 3T27A 2BDHA 3F0OA 9LPRA 2BDIA 4Q4LA 4WH8A 3O8BA 2HVXA 1C4V2 4WMFA 1GDNA 1HAVA 4FUFA 1JRTA 4D7FA 5PTPA 5GXPA 2ZU4A 5EOKA 2FOFA 2GX4A 2BHGA 1L4ZA 2AIQA 3E3TA 3RXSA 1SLVB 2G4UA 3P8GA 3I78A 1O3LA 3RUOA 2KCAA 1EOJA 3UR6A 3RC6A 3SN8A 6LPRA 1EZQA 1P01A 1OXGA 1F0UA 3VEQB 1QURH 4AGJA 2PKAB 1C1WH 1H9HE 1GI3A 1GI2A 5CHBA 1YP9A 2SNVA 1MU6B 2VIVA 1AUTC 5T6GA 3SJKA 3QWCH 1RD3B 1TNIA 1DWEH 2AMDA 1F5LA 2BOKA 4OS6A 2B0FA 2ZPRA 1ZPBA 1EASA 1T4UH 2KAIB 4AFUA 1A0HB 1W7XH 2V7QD 1V2OT 1AKSB 1QZ8A 2AGGX 5F8XA 1NBMD 1QL7A 5DP8A 2LNCA 1Y5BT 5A0BA 2FZZA 1BZXE 1CVWH 3SI4H 4BAQB 1GBHA 2B7DH 1EZUC 4X2WA 3BG4C 5JBBS 3UR9A 3MU1A 4ZCNA 2BY8X 1C5NH 1O3DA 2JKHA 1C1OA 1TQ7B 2UUYA 1ETRH 1NN6A 4NG9H 2J9NA 1HAOH 1BDAA 3SU0A 1GI1A 4YOIA 1ETSH 2H5CA 2Z6BD 3QX5H 1A1RA 3EYDA 1HNEE 3A8AA 1QRZA 1CE5A 2FXRA 2GDEH 1UTLM 2OC8A 1ZJKA 1N8OB 3S9BA 1KLIH 3TGKE 2A31A 1PQ7A 3EGKH 1UHBA 2PGQB 1ZR0A 1EPTC 1A46H 4YT6H 4NFFA 3DSPA 4A5TS 2ZNKH 4WVPE 1OP0A 1C1VH 2D8WA 2F91A 2XCNA 2BD4A 6CHAC 4ASUD 5HKKD 1YPEH 1BRAA 3EE7A 1P2NA 5JPMH 2V0BA 1E0FD 1W12U 2VINA 2LP6A 1UK3A 4TY7A 5EQSA 1WQVH 1UVTH 2BX4A 3KQBA 3QLPH 2J95A 1GG6B 2P59A 5DSFA 2JH6D 3F6UH 2P3UB 3KQCA 1ZGIA 3M3VA 3U1JB 3UNSA 1LKAA 3UQOA 2WYJA 3KGPA 3SV9A 1DSUA 4R8TB 5DK1A 2FWWA 1SGQE 1QA7A 1SFIA 4NZLA 2WPMS 3SU5A 4ABGA 2GD4B 2AIPA 2P16A 1O36A 2R0LA 3LIWA 1NC6A 8KME2 4GUXA 3PM3A 1T32A 4DT7B 2SNWA 1CGIE 4U2WA 2ZDVH 3SU4A 1GI8B 1NRQH 4X6NA 1MTWA 3VXFH 2BXTH 4NIVA 1FI8A 3MNCA 3E91A 1P57B 4NWKA 2ALVA 3ZVAA 2JETC 1E34B 2BD5A 2Z9IA 2Z7FE 1C5MD 3D49H 1BRBE 1O3AA 1C2DA 4JMYA 4UFFH 4YESB 2Q6DA 3ZVGA 2V6NA 5C2ZA 1Z1JA 5KECA 3FP8E 4E06H 1DXPA 3SNBA 5EXMA 1SQOA 5EU8A 1YLNA 3U8TH 2Z3CA 4NFEA 1ZHRA 2O9QA 1O2RA 3ZZ8A 2OXSA 2AS9A 2BQ6B 3SGQE 5FCKA 3LGIA 4CRAA 2GJGA 1NESE 1VJAU 2FOEA 4LOYH 1A5IA 1MABB 1SL3A 3SU2A 1OP8A 1J17T 2OBOA 1BJVA 1DFPA 1AZZA 1GHXH 2LPRA 4NGAH 1T4VH 4E05H 3KQ5A 2BYAX 3RXMA 2W6JD 2CN0H 3C1KA 1HXEH 5EW2H 3QN7A 4FUEA 2AH4X 3G01A 4XSKU 3FANA 1TNKA 1V6DA 3PO1B 2WV5A 1LVOA 3U8OH 4UFGH 1XKBC 2XTTB 4O03A 4Z1MD 1GHYH 2BDCA 3B23B 4I86A 2F83A 1J14A 4BTUB 3JZ2B 3H7TA 5FL7D 1RIWB 4X8VH 5E0HA 3UUZA 1WTHD 3NXPA 1AQ7A 1V2VT 2VJ1A 4KKDA 1MCTA 5GPIB 1K1JA 1C5PA 4YT7H 1S0QA 1TPPA 4B2AA 3N7EA 3H5CB 2ZCLP 3U69H 4FETA 1TX8A 4HTCH 1G36A 5FPYA 1K22H 1KLJH 5DJ7A 2FX6A 1PYTD 4HI3A 1SQTA 2BDGA 3GY2A 2B8OH 1QB6A 2PUXB 3IITA 4XBCA 1O5GH 3SU6A 1MQ6A 3K65B 3QZQA 1LVBA 4K1SA 1Y3VA 5CDFE 1LHFH 1UCYK 1WDIA 1SGCA 2GMTC 1JBUH 3T2NA 3ZV9A 1EZXC 5E8EH 5KEDA 4THNH 3GY5A 1Q31A 2UUJB 2HNTC 1MZDA 1CQQA 2ZEBA 1C4Y2 3KCGH 1BTZA 1HCGA 3MWIU 2K8IA 4BTTB 1UCYH 2C8XB 1MAYA 5DP6A 1TNHA 1BBRH 1P05A 2ZGCA 5DN6D 4YTAA 1SKYE 1GDQA 4LXBH 3ZV8A 1FQ3A 3RXKA 2PP6A 2BDYA 4Y8XA 1O3OA 1BUIA 3RXQA 3LGVA 3NRLA 2VVUA 5FHTA 4B76A 1ABJH 1GMHF 1SOTA 4Q7XA 2GT7A 3DT0H 1FLEE 3MO9A 4ISHH 1GHVH 1OWEA 2A45B 2PSXA 4K60A 1FY8E 4ZMAH 4DOQA 3S69A 2ZDLA 1AE5A 3GY3A 3TU7H 5T3HA 1EZSC 1XUHA 2XRCA 2JH5D 3L6PA 3LDXH 2A4RA 2PFEA 1GCTB 2QXIA 3QTVH 5H4IB 2K1QA 2KAIA 1A2CH 5FX5A 5DP7A 1HAHH 4ISIH 1CT0E 4INHA 5TJXA 3NK8A 6ESTA 4AFQA 2FOBA 4IMQA 2ZCHP 4CR5A 1EUFA 1ANDA 2XYAA 1GBFA 2RA0A 2ANKH 2PR3A 1O2JA 1O2NA 5EGMA 1S6LA 1O2QA 2G81E 5EJ1A 4CBNA 2P3TB 4IC6A 1PQAA 4JK6A 4KP0A 1BA8B 2FMJA 2HPPH 3UREA 1BHXF 5HM2A 3H09A 4Y0YE 1T8NA 3SOSA 5F53A 1THRH 3MTYA 3UY9A 4CH2B 3PLPA 3BTEE 1GI9B 1T8MA 2UWPA 1C2FA 4I8JA 1W8BH 3FAOA 3O8CA 4X1PU 1DOJA 5AF9H 1H9LB 1IQJA 5C0UA 1CT4E 3NCLA 1O2SA 3OTJE 1PYTC 1KXAA 2BOHB 4K3JA 1TWXB 3MU5A 3ZVDA 2G4TA 1ANCA 2DUCA 3BIVH 3BSQA 1Y5UT 4WXVA 1NU9A 4WY3A 2JETB 5EJLA 3RMOH 2O8MA 4BXSA 4ZHMU 3UAIC 3AW0A 2QYIA 3BEIB 4O3UA 1VITF 3JZ1B 3MMGA 3PRBA 2ODYB 1CA0C 1PPFE 5G4BA 1ELVA 2RFKC 1EAXA 1SPJA 2KM0A 2BX3A 2GCTB 3A89A 3MU0A 1A5HA 3A85A 1V2KT 3Q3YA 1HXFH 4Y7BA 1C2MA 1O3JA 4AYVB 1O35A 1XVOA 1KXEA 3I29A 2SGPE 2XNIA 3SQEE 3KYFA 2D1JA 3SJOA 1C2LA 5DPAA 4X6PA 1AB9B 5DO4H 2B5TB 2P95A 1SQRA 1DWCH 2OQUA 2EY4C 1O3KA 1UMAH 2ZGBH 2ZG0H 1C1NA 1ELAA 4ABDA 3HKIB 1T31A 5A8YA 4H6SB 2O8TA 4MPWA 5E2OA 1GJCB 1SGNE 3A8BA 3AAUA 3FP6E 1B0FA 5IK2D 1WXRA 2QXHA 4IN1A 4ESTE 4JYUH 2WZQA 1P8VC 8GCHF 3OEHD 2BDBA 4FUGA 2ZPQA 1CU1A 5EJZA 3PLBA 2ZFRH 1K1NA 1LO6A 2ULLA 1BHXB 1NBME 3PMAB 1XMNB 2ZFPH 2THFB 1IQKA 2CMYA 2BLVA 1ZHPA 3OAAD 1GGDB 2Z3DA 5FCRA 1IOEA 3AW1A 2IPHA 4B2BA 1GBJA 4FUIA 1KIGH 1G9IE 4K5ZA 2Y6TA 4FU8A 4ISLA 1D3DB 1GMDG 2A4OA 4MNXA 3CS0A 4DIHH 1RXPA 1DUAA 2Y81A 1O3EA 1E79D 4B1TA 4UDWH 4ABEA 3C27B 3RLWH 3SV7A 1AWFH 1GHBG 1CO7E 4OGYA 5GCHG 4FUHA 3ELAH 1Z8JB 4X8SH 1SQAA 2XC5A 3QDZB 2ASUB 1GWAA 3P92A 3TIUA 1W0YH 5L30H 2XWBI 1G30B 1WTGH 3LU9B 1V2RT 2BY7X 7ESTE 1CT2E 3TJOA 1KDQA 1GJ4H 2HNTE 3UQVA 1V2ST 3BG8A 3RC5A 3HK3B 3RC4A 1WUNH 3SI3H 1GDUA 3LGTA 2P3FH 3UNQA 1UTJA 3A7VA 2OC0A 4UONA 1ELGA 2R2MB 1OWHA 3RM2H 1KXFA 2XWAA 1LHGH 4MPVA 2ZDAH 1IQFA 3SV8A 4XOJA 2H1UA 3SNCA 4A92A 4AB9A 3RXTA 3LJOA 3MH7A 1KY9A 4MDSA 1L1GA 1O34A 1YCPM 2ZGXH 1BB0B 1E1QD 2AEIH 2ZU5A 1QRXA 2OCVB 1CA8B 2PW8H 2V3OH 3SNEA 1C5OH 1NFXA 1HV7A 1D3QB 1BTPA 3RLYH 1A4WH 4SGAE 3Q3KA 1RTFB 1H8HD 3OE7D 4AFZA 4RN6A 1G3DA 1K1MA 1O3HA 3DFJA 3DA9B 3ESTA 3UOUA 1SHYA 2WV4A 2BLQA 3KN2A 3GDVA 4KTUA 3TITA 3TK5A 1JRSA 4AN7A 4XBBA 3W95A 2I6SA 3TLOA 3O8DA 3GY8A 1AZ8A 1EAWA 1ANBA 5DKMA 2R9PA 3LC5A 1XXDA 1HAXB 2ZWLH 4A1TA 1Z71A 2VGCC 4YXWD 3BG4B 1ZSJA 3BV9B 4KGAA 4AFSA 1QBNA 1UTQA 4GVUA 1DE7H 1T7CA 1FMGA 1XUKA 3PO1C 3ODFA 4DCDA 2VH6A 1FAKH 2FO9A 1UVPA 2PHBA 2RDLA 1F2SE 1QNJA 1W13U 2UUFB 1J9CH 4OGXA 2FS8A 3GS9A 4MNWA 1S81A 1W10U 1ZLRA 5A0CA 1GHBF 1AY6H 1CBWB 2GT8A 4GPGA 4ZKNU 3ZZ3A 1K21H 1SGDE 1TALA 5A09A 1AFQB 1EPTB 2ZZUH 2G00A 2F9OA 3B9FH 3T28A 1ZTLA 1BT7A 4FUCA 4B71A 3HGPA 1NRNH 3F2FA 1P2JA 1K9OE 2VBCA 3KQEA 2OC1A 2ZFTA 1LVMA 2OK5A 3TJUA 1O37A 5FX6A 3F3BA 2WYGA 4BAOB 1DS2E 1HAZB 1BMLA 4XDEA 4A1XA 3A83A 3PTNA 3P17H 1GBLA 3ZZBA 2J97A 1LPZB 2QE7D 3TNSA 2VVCA 1TA2A 1AVWA 5LGOA 1UHBB 3RP2A 4MNVA 1S83A 5I25A 1N1LA 1C1SA 5I46H 1IQIA 3RDZA 1S5SA 1C1TA 3SJIA 1YKTA 1HAGE 5HGGA 2TGPZ 2GGVB 1D4PB 1TMTH 1MAXA 4Y6DA 1N6XA 3ZVEA 2Z3EA 4Q80A 2BZ6H 2CF9H 3R0FA 6GCHF 2VIDA 2RCEA 3A7ZA 3A7XA 2JIZD 5SGAE 2FX4A 4H6TA 2J2UA 1V2NT 1SGFA 4WJG2 1T8OA 2BZAA 1DY8A 4X8TH 5JBAS 1OP2A 1O2LA 1O30A 1PQ8A 1GI7B 3DD2H 2NU2E 1HJAC 2OLGA 2HLCA 5A2MH 3S9AA 3OTPA 1TB6H 4A6LA 5LPEA 1TQ0B 5ETXA 1WQSA 3IG6B 1S82A 1K28D 1HYLA 2A4QA 3SHAH 2C93B 3M7TA 3KYGA 1QTFA 1S6HA 2ESTE 1CA0B 5JDUB 1KLTA 2BVXH 2V35A 1IQLA 3BTDE 4YLQH 1V2JT 1P3EA 2ZCKP 4NWLA 1RGQA 6CHAB 1HAYB 3PV4A 1Z7KA 1BTHH 2HALA 3NKKA 5C94A 1XUGA 8LPRA 3N7OA 5AFYH 2XW9A 3RXGA 4ZHLU 5GJ4B 4ZKOU 2PTNA 2ZU1A 1PJPA 1E1RD 1GPZA 2BXUH 3KIDU 4AX9H 2LELA 1MTNC 2FI3E 3A8CA 1ZMJA 4IW4E 1O5AB 2QV1A 4OS2A 1A0LA 1T8LA 5AFZH 2QCYA 3U8RH 4RT0A 2IJOB 5GIBA 1QQUA 4JCNA 4BTIB 1YPKH 3RXJA 2XBYA 1IQMA 2ZDKA
chains in the Genus database with same CATH topology
1W3CA 4F55A 3RC6A 3SUFA 5CDFE 3F2HA 2O8MA 4A1XA 3RC5A 5T1VA 2IJD1 3RC4A 3LOXA 3KNXA 2FM2A 2JDID 2OC7A 2OC0A 2QE7D 3LKWA 5CHBA 2KR7A 3N99A 3PV5A 3PRBA 3N7DA 2F9UA 2JJ2D 1RTLA 3F2GA 2M2AA 2YMSD 1JXPA 2FP7B 3SU4A 3W1EA 3SV8A 1KMHB 1COWD 1N1LA 2KM0A 2L6OA 2K0QA 2KCOA 2OBQA 4TT3D 4TSFD 3E90B 2XNDD 2K8IA 4A92A 3FN8A 3PRDA 3AK5A 2F4LA 2FOMB 4NWKA 1FX0B 2GGVB 2AHME 2KCYA 2V7QD 3M5MA 1OHHD 3PV2A 5DN6D 1E1QD 4JMYA 4B6FA 1NBMD 1SKYE 3U1IB 2XNIA 5C17A 3OFND 2JIZD 3FKSD 1DXPA 3O8RA 2F43B 3KEEA 4B75A 1H8HD 3OE7D 3NRLA 2WV9A 1H8ED 4B76A 4B6EA 1DXWA 3UB0A 5EPYA 3WW7A 5EQRA 4M9FA 4ZCNA 4OM9A 3F0PA 1DY8A 2YMSC 4TYDA 3SU3A 2QF5A 3KN2A 3SZEA 3SYJA 3SU0A 3ZIAD 3SV6A 4I33A 2QF4A 3LONA 3OYPA 2WHXA 1A1RA 3EYDA 2HLDD 3O8DA 3SUEA 1MABB 3M5NA 3SU1A 3SU2A 5C0TA 3M5LA 2OBOA 2XOKD 3L6PA 4RI0A 2OC8A 4U01A 4A1VA 5IK2D 1BMFD 3FOAA 4KTCA 1W0KD 2A4GA 2A4RA 3OTPA 1W0JD 4WH6A 5FPSA 4K8BA 2F9VA 4A1TA 2W6JD 5H4IB 2K1QA 3WWFA 4YXWD 4B73A 5ETXA 5B6LA 2WZQA 3M5OA 3P8OA 3SUDA 3OEHD 3DCLA 3SUGA 1CU1A 2A4QA 1DY9A 3OEED 2CK3D 2JJ1D 2KZ4A 2OINA 1NBME 2GVFA 2KCPA 2W6ID 3DSPA 5EQQA 4Z1MD 3P8NA 1S6LA 3OAAD 4Q63A 1NS3A 4NWLA 1RGQA 2XCNA 5EPNA 2J5UA 4ASUD 2WSSD 2WPDD 3KF2A 4B74A 5HKKD 3VG8A 2KFWA 5FL7D 3H09A 3F0OA 5F53A 4Q4LA 5FPTA 5EQSA 4I31A 2YOLA 3GS9A 3DSOA 4WH8A 5GJ4B 3WWBA 3O8BA 3SU5A 2XCFA 5GPIB 4I32A 1E79D 1E1RD 2P59A 5DSFA 2LELA 3O8CA 3N7EA 3SV7A 4XD7D 3U1JB 5C0UA 2QV1A 1BT7A 4FETA 4B71A 4DT4A 3SV9A 5FPYA 4R8TB 3F2FA 5GNDA 5IDKA 2YMSB 2VBCA 3F3BA 2OC1A 2IJOB 1EFRD 3FO8D 5ESBA 2OK5A 3SU6A 4WF8A 1WXRA 2KCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSO A;  2LEL A;  3DSP A;  2KM0 A;  3N7D A;  2K0Q A;  3N7E A; 
#chains in the Genus database with same CATH topology
 1W3C A;  3M36 A;  3RXV A;  2QF3 A;  4P02 A;  2D26 C;  4Q7Z A;  2PUQ H;  4K1T A;  1ID5 H;  1TFX A;  1ELE E;  2IN2 A;  3EA7 A;  1ZSL A;  5JBT A;  2W7U A;  1BRU P;  3F2G A;  1W14 U;  2H5D A;  1CGH A;  2YMS D;  1JXP A;  3SJ9 A;  2PTC E;  1ZTJ A;  1PPC E;  1WSS H;  2K0Q A;  1GBC A;  4U32 A;  1TGN A;  4MG3 A;  5AHG H;  1TMB H;  2TGT A;  5DP3 A;  1OHH D;  1Y3Y A;  2XC4 A;  2BQ7 B;  1GBK A;  1DST A;  2AMP A;  1GI0 A;  4Y76 A;  1GHW H;  2PKA A;  5FBI A;  1TIO A;  1DXW A;  1DWD H;  2A2Q H;  3UB0 A;  4MPU A;  3F0P A;  2YNA A;  3SU3 A;  1X7A C;  1TYN A;  3SV6 A;  1LHC H;  1FY4 A;  5C5N A;  1JMO H;  1P2Q A;  1QR3 E;  2NU4 E;  3P70 B;  3V7T A;  1Y8T A;  1MKX H;  3HKJ B;  4NA9 H;  1TAB E;  3RXH A;  4BAM B;  1GJ6 A;  1LPG B;  3RMM H;  1VIT H;  1KTS B;  3GCH B;  2PWX A;  4ZKR U;  3Q3X A;  3QK1 A;  3FP7 E;  4X0W U;  1HJ9 A;  4D8N A;  2J34 A;  1O5B B;  1YF4 A;  1ESA A;  4GHQ A;  1H8D H;  2F9N A;  4HFP B;  3TPI Z;  2JJ1 D;  2GV7 A;  5EOD A;  5F8Z A;  3K6Z A;  1OWJ A;  4X1N U;  5J4S A;  1ZRB A;  1LPK B;  2ODQ A;  4ZHA A;  5T6F A;  4ACB A;  1O2V A;  3K9X B;  3GIS B;  5DP9 A;  1CGJ E;  2EA3 A;  5A8X A;  1BOQ A;  2Y5G A;  4P00 A;  3LPR A;  2FOD A;  4UE7 H;  1LVY A;  2BD3 A;  1ABI H;  3K2U A;  1ZJD A;  1DIC A;  3A7Y A;  3VGC C;  5GDS H;  3ITI A;  4OS1 A;  1TAW A;  2YNB A;  2ZGJ A;  2PLX A;  1YPH C;  1F92 A;  3QGN B;  3GDS A;  4CH8 B;  2XXL A;  1S85 A;  3LGY A;  4NIW A;  1CHO G;  1N6Y A;  3SUF A;  3F2H A;  4O97 A;  1PFX C;  3DFL A;  2IJD 1;  3TH2 H;  2O8W A;  3LOX A;  3LT3 A;  1ZMN A;  3HGN A;  3E0N B;  3GYM A;  4WXI A;  1D6W A;  3ATI A;  3UIR A;  2F9U A;  4AYY B;  4JZD H;  4CRF A;  4B2C A;  1L4D A;  1XM1 A;  4INK A;  3E16 B;  1YBW A;  5C1Y A;  3MH5 A;  1KMH B;  1COW D;  1V2W T;  1J8A A;  2KCO A;  1TPO A;  2ZHF H;  3T29 A;  1RIW C;  1ZRK A;  3E0P B;  4NSV A;  4X2Y A;  2WPJ S;  2Y82 A;  1P9U A;  2ZTZ A;  2J92 A;  1SGY E;  2VVV A;  2Q6G A;  1P3C A;  1QGF A;  2Y7Z A;  4WMD A;  2QC2 A;  1GI6 A;  1BQY A;  4BAH B;  2GCH F;  3OFN D;  5E0G A;  3U9A H;  1QL9 A;  1G37 A;  2WV9 A;  2FLR H;  2VIW A;  1ZTK A;  2CHA C;  1C1M A;  1SGT A;  3LH1 A;  4E7R G;  4I33 A;  1FY5 A;  2ZC9 H;  1KXB A;  1O39 A;  2TIO A;  1D9I A;  1Z8I B;  2P93 A;  1NFY A;  3AAV A;  1Q2W A;  2ZHD A;  4FOU C;  1LDT T;  1UTN A;  5C20 A;  3WWF A;  3LJJ A;  3PWB A;  5DP5 A;  3D62 A;  3DCL A;  4MNY A;  1AB9 C;  1GJD B;  1GVZ A;  1Z6E A;  5DG6 A;  1UK4 A;  2CK3 D;  2OIN A;  2NU0 E;  2V3M A;  1W7G H;  1EXF A;  3SGB E;  1C5X B;  1L1J A;  1PPZ A;  3GYL B;  1BJU A;  4GHT A;  1FIZ A;  2BD7 A;  3CS7 A;  1TRM A;  3TGJ E;  2YOL A;  3A81 A;  3TJN A;  2AFQ B;  1P0S H;  2ZFS A;  3S0N A;  2STB E;  1WU1 A;  1Z8R A;  1FDP A;  1CBW C;  1D3T B;  2Y7X A;  4JYT A;  3A7W A;  3ZZD A;  4DVA U;  4XD7 D;  1AFE H;  3QO6 A;  3QTO H;  3CNR A;  1GBE A;  2PKS B;  1H4W A;  2ZHQ H;  2VIP A;  3MNB A;  3OU0 A;  3F1S B;  1F7Z A;  1YLD A;  1Y5A T;  3BTG E;  4Y10 E;  1TGS Z;  5HYO A;  1RS0 A;  2GV6 A;  3NWU A;  1BMN H;  1RJX B;  1W2K H;  4NIY A;  4WF8 A;  1UW7 A;  5L2Y H;  3KNX A;  2ZFQ H;  1AU8 A;  2KR7 A;  3M7U A;  4I8L A;  1AWH B;  4CBO A;  1FY3 A;  3M35 A;  1TE0 A;  5CHA B;  2L6O A;  1GJ9 B;  1FNI A;  3PTB A;  2OBQ A;  4DY7 B;  1ZSK A;  4FUB A;  1NFW A;  2ZGH A;  3DHK H;  3PRD A;  1O5E H;  4RKJ B;  3MO6 A;  3M3T A;  1EJN A;  2H9T H;  4OS4 A;  2Z9K A;  5J4Q A;  1TNJ A;  2ALP A;  2TGA A;  3U1I B;  2VH0 A;  1C5U A;  2W26 A;  1GBA A;  2KX4 A;  1GI5 A;  3KEE A;  4RSP A;  1UTO A;  2FI5 E;  4Y8Z A;  4B6E A;  1TX7 A;  2VWN A;  2ZEC A;  3D65 E;  3VB6 A;  3MU8 A;  5CE1 A;  5FAH A;  3V13 A;  1ZPZ A;  1IAU A;  2QGR A;  3TNT A;  3I77 A;  4E7N A;  1NFU A;  1TOC B;  2WHX A;  4INL A;  2H2Z A;  3SQH E;  1FY1 A;  2GZ8 A;  1HJA B;  1HPG A;  2D2D A;  4WME A;  3URC A;  1OWI A;  4I7Y H;  4K8B A;  1OPH B;  3RU4 E;  2EI8 A;  1V2U T;  3P8O A;  1KDQ B;  4AGK A;  3PB1 E;  3SUG A;  1ELT A;  1DVA H;  1AFQ C;  1XXF A;  1NTP A;  1UVU H;  1C2H A;  5HIZ A;  1K1O A;  1V2M T;  3P8N A;  1EP6 A;  5EPN A;  1GJ7 B;  2QAA A;  2WPK S;  1G3B A;  1NRP H;  3VG8 A;  2BVR H;  2F9B H;  1RTK A;  1OOK B;  1LQD B;  1WAY B;  4RKO B;  2QA9 E;  1F5K U;  3GDU A;  1EPT A;  1NT1 A;  1QQ4 A;  1YPH E;  4TY6 A;  1SHH B;  1FPH H;  3BTM E;  3V0X A;  1H8I H;  3A87 A;  2SGE E;  3H7O A;  3S7K B;  1O5C B;  2WPL S;  3Q00 A;  3QGJ A;  3GCN A;  1C1R A;  1O2Z A;  1TON A;  2DE8 A;  4K69 A;  3AAS A;  1BTW A;  1C5Z B;  2FOG A;  4DJZ B;  1HAP H;  1HJ8 A;  3UPE A;  2OQ5 A;  3GY6 A;  3TK6 A;  2Q6F A;  2FOC A;  4ACA A;  3BTT E;  1GMD F;  4LZ4 B;  7GCH G;  5BRR E;  1O38 A;  3ZYE A;  4ABA A;  1QB1 A;  4AG1 A;  5C3N A;  2ZFF H;  5K0H A;  2GZ7 A;  3DUX H;  1KXD A;  3OSY A;  2B9L A;  2A7H A;  1P2M A;  2NU1 E;  3URD A;  1NO9 H;  1SOZ A;  1AHT H;  1F0R A;  1DIT H;  1V3X A;  2UUK B;  1FX0 B;  1DM4 B;  1C1P A;  2W7S A;  2O8L A;  3UWI A;  3VB3 A;  1G3E A;  6GCH G;  1QB9 A;  1SMF E;  1EOL A;  1W11 U;  2GTB A;  3TH4 H;  2Z9J A;  4IGD A;  4NIX A;  1P2O A;  4AOR A;  1QL8 A;  3O8R A;  4CRE A;  1B5G H;  4CR9 A;  4B75 A;  1NY2 2;  1BTX A;  1QY6 A;  1SGR E;  5A0A E;  3VGC B;  5E0J A;  7KME H;  2Y5F A;  3ZIA D;  2BD8 A;  2Z94 A;  2L74 A;  2Q1J A;  1TGB A;  1YGC H;  4QT8 C;  3ZZ6 A;  4JZ1 A;  4DGJ A;  2AER H;  4F48 B;  3SU1 A;  3U28 C;  5C0T A;  1RRK A;  2J4I A;  3P6Z B;  1HDT H;  2VGC B;  3T25 A;  2BY5 X;  1AN1 E;  1HUT H;  3STJ A;  3SND A;  2A5K A;  1OS8 A;  4K2Y A;  1C5S A;  1NRS H;  4I8H A;  1MTN B;  1DY9 A;  2RA3 A;  2AYW A;  3VPK A;  5T6D A;  2KCP A;  1BBR E;  5FBE A;  4NCY A;  1O2Y A;  5HXF A;  1BIT A;  4O3T A;  1Y3U A;  1DWB H;  1EB2 A;  1EAT A;  3MO3 A;  3SV2 H;  2FTM A;  3FZZ A;  2TPI Z;  3ZZA A;  5E2P A;  3S9C A;  4MLF B;  1GCD A;  1VZQ H;  2BY9 X;  1AUJ A;  1C1Q A;  1GJ5 H;  3ODD A;  3SZN A;  4RT1 A;  1P2K A;  5LH8 A;  1HIA B;  1P04 A;  3GOV B;  2ANM H;  2QF0 A;  1QIX B;  1UVO A;  3CP7 A;  2F3C E;  3GY7 A;  1P09 A;  1A61 H;  2GP9 B;  3MNS A;  2I6Q A;  3A7T A;  1IQH A;  1UK2 A;  3T26 A;  1EP5 A;  1SLX B;  1EB1 H;  2ILN A;  2FEQ H;  5ESB A;  2R0K A;  1H1B A;  7GCH F;  3BTF E;  1AVG H;  1C9P A;  2SGQ E;  1KYN A;  3SOR A;  2JH0 D;  1C5Q A;  2A0Q B;  2P8O B;  1LHE H;  1GBB A;  2JDI D;  2VWM A;  4F49 A;  4D76 A;  3LKW A;  3EDX B;  3PV5 A;  4MQA A;  1O3M A;  3N7D A;  1KTT B;  2HOB A;  2JJ2 D;  1RTL A;  3RXP A;  2NWN A;  1GBD A;  3RXF A;  4AB8 A;  1J15 A;  1ZPC A;  3M37 A;  1MTV A;  4A7I B;  1V2Q T;  3FN8 A;  5KGO A;  3SJ8 A;  2VWO A;  1O2I A;  4R0I A;  4FUD A;  1VKY A;  3PV2 A;  1GMC F;  3MYW A;  1FAX A;  4AOQ A;  4AZ2 B;  1DUE A;  2F43 B;  4YZU A;  3F9G A;  1TX6 A;  4LZ1 H;  3QUM P;  4BAK B;  1O2K A;  1O5F H;  5EQR A;  2R2W U;  4HGC A;  1UO6 A;  2YMS C;  4FXG H;  3MFJ A;  2QF4 A;  1YPL H;  4BAN B;  1C5L H;  2HLD D;  2O8U A;  2HVY B;  4Z0K A;  1L2E A;  8EST E;  5IYT A;  2ZPS A;  1V2T T;  3ATM A;  4CRC A;  4I8G A;  3TH3 H;  3UFA A;  3WY8 A;  3Q77 A;  3SW2 B;  3TK9 A;  1DAN H;  5JB9 S;  3OEE D;  5DGJ A;  3RM0 H;  1CSO E;  3LC3 A;  2QXG A;  1P9S A;  1A3B H;  5LPF A;  4LK4 A;  1QJ1 B;  1TRN A;  1B7X B;  2J5U A;  3VB4 A;  3ATL A;  1GBT A;  4XRN A;  2R3Y A;  2ZIQ H;  2HRV A;  4I31 A;  1U6Q A;  1YPG H;  2OD3 B;  1AD8 H;  1C5R A;  1IHT H;  1SBW A;  3RXL A;  3LGW A;  1C5W B;  4JK5 A;  3RXI A;  1OWD A;  1VR1 H;  1HLT H;  3L3T A;  4D9R A;  4VGC B;  2Z9G A;  1OWK A;  4TPY A;  4ZH8 A;  1FN6 A;  2FTL E;  1GJB B;  1MKW K;  2BVS H;  2GDD A;  2CGA A;  1TMU H;  4NA8 A;  1HRT H;  5C1X A;  3HK6 B;  1AKS A;  4PRO A;  3MU4 A;  1L1N A;  2FM2 A;  2H9H A;  2W3I A;  2STA E;  1GVL A;  1KSN A;  2V3H H;  3EAJ A;  1YPM H;  1AE8 H;  2M5T A;  2ZO3 H;  4IMZ A;  1K0H A;  1LCY A;  2GKV E;  3PWC A;  2CV3 A;  3UOP A;  3UTU H;  1MQ5 A;  4ISN A;  1O3F A;  1FUJ A;  1O5D H;  1SVP A;  3B8J A;  3E90 B;  2ZQ2 A;  2FOM B;  1MTS A;  1M9U A;  1C1U H;  2KCY A;  3ZZ5 A;  4UFE H;  2TGD A;  4Z6A H;  5HMA A;  4NZQ A;  2QN5 T;  3PMH B;  3SNA A;  4X1S U;  1O2P A;  1SFQ B;  2VWL A;  5C67 A;  1P11 E;  1SC8 U;  2FLB H;  1MKX K;  2QXJ A;  1ETT H;  1JIM A;  1YYY 1;  1ZML A;  2AGE X;  3SBK A;  1H8E D;  9EST A;  1ELD E;  2AMQ A;  5EXN A;  1TLD A;  3SZE A;  1SG8 B;  5CMX H;  3LON A;  3OYP A;  3RXD A;  1C2I A;  1VJ9 U;  1QHR B;  4OS7 A;  3D23 A;  1YM0 A;  1HGT H;  3M5O A;  1QFK H;  3FVF B;  1BCU H;  4K1E A;  2BTC E;  2XC0 A;  1MUE B;  3OX7 U;  3RXA A;  3SGA E;  4WWY A;  1A7S A;  1SI5 H;  3M61 U;  2KZ4 A;  5F8T A;  3ZVF A;  5EIY A;  1GBM A;  1O2W A;  1XVM A;  2CHA B;  4U30 A;  1C2G A;  2RG3 A;  1O3G A;  4Q63 A;  1LHD H;  3M7Q A;  3A80 A;  3KF2 A;  1QCP A;  3BN9 A;  3A88 A;  4FVD A;  2WPI S;  1TNG A;  2QY0 B;  1GHA G;  1MZA A;  2G51 A;  3K6Y A;  5TCC A;  1O32 A;  3E8L A;  1GL0 E;  5C5O A;  3MH4 A;  7LPR A;  4IS5 A;  1A3E H;  2CXV A;  1VGC B;  2ZF0 H;  2ZP0 H;  3ZZ7 A;  5CHA C;  1WV7 H;  5GND A;  1QJ6 B;  4CHA C;  2SFA A;  2BQW B;  1C2J A;  3FO8 D;  4IN2 A;  2A7C A;  1C9T A;  1HAV B;  4CRG A;  1PQ5 A;  2BLO A;  4K8Y A;  2C90 B;  3GCH C;  3VB7 A;  1DLE A;  4BNR A;  5EXL A;  3F68 H;  4BXW A;  1DX5 M;  2C8W B;  4FU7 A;  2EI7 A;  2A5I A;  3BTH E;  4TPI Z;  1TPA E;  1C5T A;  3QZR A;  1TPS A;  1AIX H;  1QJ7 B;  2ZU3 A;  1KXC A;  1YCP H;  4TSF D;  2A2X H;  2C8Y B;  4MTB A;  4ABJ A;  4D7G A;  2IOT A;  1MD8 A;  3Q76 A;  1AO5 A;  1P02 A;  4B6F A;  5EST E;  3UWJ H;  4ZXY H;  3L33 A;  2HGT H;  3A84 A;  3STI A;  4I8K A;  2ANY A;  4ISO A;  1GCT C;  2PV9 B;  4AC9 A;  3RMN H;  1VCQ A;  2BMG B;  3E6P H;  4JZF H;  4ZKS U;  1MU8 B;  3GCT G;  4IC5 A;  4M9F A;  1O3P B;  3UNR A;  5BPE A;  1P06 A;  1HAI H;  2VU8 E;  4TYD A;  2QF5 A;  2ZDM A;  1C4U 2;  1ZGV A;  2EI6 A;  2Y5H A;  1O33 A;  1BIO A;  4X1R U;  1BRC E;  1SB1 H;  1O2O A;  3M5L A;  4FUJ A;  1O2U A;  3NPS A;  4U01 A;  5A8Z A;  1MMJ N;  2F9V A;  2F9P A;  2BB4 A;  2GCH G;  3ENS B;  1HBT H;  3A82 A;  3KHV A;  3VXE H;  1SGF G;  4FVB A;  3BTK E;  1XKA C;  1O3B A;  1RFN A;  1MD7 A;  4VGC C;  1Y59 T;  1FZZ A;  1MH0 A;  1NRR H;  1JIR A;  3BF6 H;  2FS9 A;  2ZA5 A;  3PYH A;  1GHA F;  1GVK B;  2WPH S;  3ZZ4 A;  2C4F H;  3LH3 A;  1AGJ A;  1P10 A;  3RXU A;  3RXE A;  4AG2 A;  1W0Z U;  1O2T A;  1JOU B;  4Y0Z E;  1O31 A;  4KTS A;  3R3G B;  1SGE E;  4I32 A;  2ZQ1 A;  1CHO F;  1D6R A;  1FIW A;  1DLK B;  1UJ1 A;  2PGB B;  3P8F A;  1LMW B;  4YO9 A;  2J98 A;  3OY6 U;  2PKS C;  3T62 A;  1E36 B;  1YCP K;  2J94 A;  3M3S A;  5JBC S;  4KEL A;  2OTV A;  1GI4 A;  3MH6 A;  4GCH G;  4XBD A;  1ACB E;  1LQE A;  1Z1I A;  4YOG A;  2YMS B;  3GCO A;  1DT2 A;  3ZZC A;  1O2G H;  1EAU A;  5L6N H;  1MCV A;  4O9V A;  3KL6 A;  3T5F H;  3RXB A;  1TGT A;  1GG6 C;  3RXO A;  4YOJ A;  4NA7 A;  4X1Q U;  2OC7 A;  3EE0 B;  5AVD A;  3KQD A;  1HIA A;  1NZQ H;  3F9F A;  3V3M A;  1TGC A;  4DW2 U;  2VNT A;  1GMH G;  2XBV A;  1GBI A;  2UWO A;  2ZKS A;  5TCA A;  1FXY A;  4OS5 A;  2H9E H;  2Z9L A;  2XND D;  1THP B;  2BD2 A;  2HPQ H;  3BEU A;  5HIY A;  2OP9 A;  1O2X A;  3PRO A;  1TOM H;  3RXR A;  1C5Y B;  1OYT H;  4UD9 H;  3ZZ9 A;  4X8U H;  2H6M A;  3E1X B;  5FXL A;  3GCT F;  4TWY A;  4X2X A;  1YC0 A;  1ANE A;  3ZVC A;  4GAW A;  2FOH A;  2VIO A;  1F0S A;  2VIQ A;  1Q3X A;  1ESB A;  1QRW A;  3BTW E;  3EQ0 H;  1C2K A;  1QBV H;  1EJA A;  1TBQ H;  1OKX A;  4ZRO A;  1WOF A;  1O3C A;  1JWT A;  4JZE H;  2FPZ A;  2XOK D;  1BMF D;  4WH6 A;  5FPS A;  4MVN A;  1YLC A;  1FN8 A;  4XE4 A;  1K1P A;  1QA0 A;  5K7R A;  5JB8 S;  1ORF A;  4HG6 A;  2EEK A;  3RML H;  1EQ9 A;  1S84 A;  3W94 A;  1K1I A;  2G8T A;  2A1D B;  4J2Y B;  2GVF A;  3GY4 A;  3PMB B;  4ZAE A;  1HFD A;  1EX3 A;  1CHG A;  4NSY A;  1UCY E;  2FYQ A;  1XX9 A;  2WPD D;  4B74 A;  3F9E A;  2KFW A;  4H4F A;  4ABB A;  1HB0 B;  1IQE A;  1LKB A;  2BLW A;  5EW1 H;  3F9H A;  1F5R A;  1VCP A;  2IPQ X;  3WWB A;  5FPT A;  4DII H;  5LPR A;  1ELF A;  2XCF A;  3AVZ A;  3MHW U;  1TBR H;  2ZU2 A;  2GMT B;  1AVX A;  1E38 B;  4SGB E;  3SO3 A;  5GWZ A;  1VIT G;  2ZTY A;  1EST A;  1GJ8 B;  1O2H A;  1P2I A;  4GCH F;  4UEH H;  1S6F A;  3IWM A;  4CRD A;  1O3I A;  4DT4 A;  1IHS H;  3TGI E;  1G2M A;  1FV9 A;  2R3U A;  1THS H;  3V12 A;  1EFR D;  3MNX A;  4HZH A;  2G55 A;  1ZYO A;  2WUB A;  1WCZ A;  2FIR H;  4ABH A;  4F55 A;  2VB0 A;  1D3P B;  3NZI A;  3TJV A;  1PPB H;  1ZZZ A;  5GCH F;  5T1V A;  4TWW A;  4DUR A;  1UTP A;  2HWL B;  3N99 A;  4Q7Y A;  2ODP A;  1G32 B;  1MKW H;  1INC A;  1EAI A;  1FON A;  2M2A A;  1C5V A;  2GZ9 A;  1Y3W A;  2AGI X;  2BY6 X;  2FP7 B;  5F03 A;  3W1E A;  4GSO A;  2TRM A;  1SLW B;  4DG4 A;  1AMH A;  2GCT C;  2PSY A;  2F4L A;  2FDA A;  4MPX A;  1QBO A;  5ABW A;  1SGI B;  2HNT F;  3MQK C;  2TBS A;  2UWL A;  2SGA A;  2ZDN A;  2C3S A;  1ELC A;  2P8O C;  1MBQ A;  1OX1 A;  3BIU H;  3ATW A;  1P12 E;  1O3N A;  2G52 A;  3FKS D;  8GCH G;  2A7J A;  4IBL H;  2RDE A;  1O2M A;  2EC9 H;  1P03 A;  3WW7 A;  2G5V A;  4OM9 A;  3ATK A;  1VGC C;  1A0J A;  1GHZ A;  2BD9 A;  3RU4 D;  1PPE E;  2J38 A;  4YLU A;  1Z6J H;  1C2E A;  4XFQ A;  3SYJ A;  1DDJ A;  1Z8G A;  4F4O C;  5JYI A;  5F6M A;  3S7H B;  1G3C A;  1NU7 B;  2FYR A;  4ZXX H;  1TBZ H;  4D9Q A;  4A1V A;  1MTU A;  3FOA A;  4KTC A;  1W0K D;  3VFE A;  3PLK A;  5B6L A;  2XBX A;  3MOC A;  1NM6 A;  4BOH A;  3EA8 A;  1XUF A;  1IQG A;  4YM9 A;  2W6I D;  3PMJ A;  5EQQ A;  1YPJ H;  3RXC A;  2FI4 E;  2ANW A;  1ZOM A;  3RU4 T;  1PPG E;  4M7G A;  4UFD H;  3SHC H;  1SR5 C;  1GGD C;  5L2Z H;  1ARB A;  1N8O C;  3HPT B;  1V2L T;  1FJS A;  4JYV H;  1A5G H;  3DSO A;  1F0T A;  4X6M A;  4CRB A;  4H42 U;  2FOA A;  1SLU B;  1NPM A;  2P94 A;  1NRO H;  1IQN A;  4Y8Y A;  1L0Z A;  2A5A A;  5EG4 A;  2XBW A;  4JZI A;  1J16 A;  2Y80 A;  1BMM H;  4Y7A A;  2WUC A;  5IDK A;  1TA6 A;  4CHA B;  3U98 H;  1TRY A;  2BM2 A;  3P95 A;  1K1L A;  4Y79 A;  4FU9 A;  1WYK A;  1BTY A;  3OY5 U;  2ZHW H;  3BTQ E;  1BMA A;  5C1U A;  1E35 B;  1GL1 A;  1OYQ A;  1XUI A;  3CEN A;  1V2P T;  4ABI A;  1MBM A;  2SGD E;  1ZHM A;  1SSX A;  2WIN I;  1B0E A;  2CJI A;  1EKB B;  1SGP E;  4ZUH A;  4TT3 D;  2CF8 H;  2EQN A;  1UVS H;  1DPO A;  3ZVB A;  4GLY A;  3AK5 A;  1E37 B;  1PPH E;  1H9I E;  3FFG A;  1FPC H;  1LTO A;  1ELB A;  2AHM E;  3HAT H;  1BTU A;  3M5M A;  3LGU A;  2FES H;  4Y11 E;  1YY3 A;  1EJM A;  1UTM A;  4ASH A;  3MI4 A;  3GIC B;  1ARC A;  2QIQ A;  2W5E A;  5C17 A;  3DSG A;  4Y71 A;  1Y3X A;  4Q2K A;  4J1Y A;  5EPY A;  2ZTX A;  5HM9 A;  2ZI2 H;  3A86 A;  3ZYD A;  3BEF B;  1TNL A;  1GJA B;  4ABF A;  3A8D A;  3TVJ B;  2OUA A;  3SUE A;  5B6O A;  3M5N A;  1AI8 H;  4RI0 A;  1GMC G;  2W3K A;  5DP4 A;  2A4G A;  1W0J D;  1K2I 1;  1WBG B;  2NU3 E;  1O0D H;  4B73 A;  1S0R A;  1BBR K;  3SUD A;  4X2V A;  2A32 A;  2G5N A;  3EA9 A;  1G2L A;  1UTK A;  1OSS A;  3FZD A;  2C8Z B;  2SGF E;  2DE9 A;  1YWU A;  1NS3 A;  3NUM A;  2ZHE H;  4X6O A;  1XUJ A;  2J98 B;  2WSS D;  3VB5 A;  2BDA A;  1VCW A;  3T27 A;  2BDH A;  3F0O A;  9LPR A;  2BDI A;  4Q4L A;  4WH8 A;  3O8B A;  2HVX A;  1C4V 2;  4WMF A;  1GDN A;  1HAV A;  4FUF A;  1JRT A;  4D7F A;  5PTP A;  5GXP A;  2ZU4 A;  5EOK A;  2FOF A;  2GX4 A;  2BHG A;  1L4Z A;  2AIQ A;  3E3T A;  3RXS A;  1SLV B;  2G4U A;  3P8G A;  3I78 A;  1O3L A;  3RUO A;  2KCA A;  1EOJ A;  3UR6 A;  3RC6 A;  3SN8 A;  6LPR A;  1EZQ A;  1P01 A;  1OXG A;  1F0U A;  3VEQ B;  1QUR H;  4AGJ A;  2PKA B;  1C1W H;  1H9H E;  1GI3 A;  1GI2 A;  5CHB A;  1YP9 A;  2SNV A;  1MU6 B;  2VIV A;  1AUT C;  5T6G A;  3SJK A;  3QWC H;  1RD3 B;  1TNI A;  1DWE H;  2AMD A;  1F5L A;  2BOK A;  4OS6 A;  2B0F A;  2ZPR A;  1ZPB A;  1EAS A;  1T4U H;  2KAI B;  4AFU A;  1A0H B;  1W7X H;  2V7Q D;  1V2O T;  1AKS B;  1QZ8 A;  2AGG X;  5F8X A;  1NBM D;  1QL7 A;  5DP8 A;  2LNC A;  1Y5B T;  5A0B A;  2FZZ A;  1BZX E;  1CVW H;  3SI4 H;  4BAQ B;  1GBH A;  2B7D H;  1EZU C;  4X2W A;  3BG4 C;  5JBB S;  3UR9 A;  3MU1 A;  4ZCN A;  2BY8 X;  1C5N H;  1O3D A;  2JKH A;  1C1O A;  1TQ7 B;  2UUY A;  1ETR H;  1NN6 A;  4NG9 H;  2J9N A;  1HAO H;  1BDA A;  3SU0 A;  1GI1 A;  4YOI A;  1ETS H;  2H5C A;  2Z6B D;  3QX5 H;  1A1R A;  3EYD A;  1HNE E;  3A8A A;  1QRZ A;  1CE5 A;  2FXR A;  2GDE H;  1UTL M;  2OC8 A;  1ZJK A;  1N8O B;  3S9B A;  1KLI H;  3TGK E;  2A31 A;  1PQ7 A;  3EGK H;  1UHB A;  2PGQ B;  1ZR0 A;  1EPT C;  1A46 H;  4YT6 H;  4NFF A;  3DSP A;  4A5T S;  2ZNK H;  4WVP E;  1OP0 A;  1C1V H;  2D8W A;  2F91 A;  2XCN A;  2BD4 A;  6CHA C;  4ASU D;  5HKK D;  1YPE H;  1BRA A;  3EE7 A;  1P2N A;  5JPM H;  2V0B A;  1E0F D;  1W12 U;  2VIN A;  2LP6 A;  1UK3 A;  4TY7 A;  5EQS A;  1WQV H;  1UVT H;  2BX4 A;  3KQB A;  3QLP H;  2J95 A;  1GG6 B;  2P59 A;  5DSF A;  2JH6 D;  3F6U H;  2P3U B;  3KQC A;  1ZGI A;  3M3V A;  3U1J B;  3UNS A;  1LKA A;  3UQO A;  2WYJ A;  3KGP A;  3SV9 A;  1DSU A;  4R8T B;  5DK1 A;  2FWW A;  1SGQ E;  1QA7 A;  1SFI A;  4NZL A;  2WPM S;  3SU5 A;  4ABG A;  2GD4 B;  2AIP A;  2P16 A;  1O36 A;  2R0L A;  3LIW A;  1NC6 A;  8KME 2;  4GUX A;  3PM3 A;  1T32 A;  4DT7 B;  2SNW A;  1CGI E;  4U2W A;  2ZDV H;  3SU4 A;  1GI8 B;  1NRQ H;  4X6N A;  1MTW A;  3VXF H;  2BXT H;  4NIV A;  1FI8 A;  3MNC A;  3E91 A;  1P57 B;  4NWK A;  2ALV A;  3ZVA A;  2JET C;  1E34 B;  2BD5 A;  2Z9I A;  2Z7F E;  1C5M D;  3D49 H;  1BRB E;  1O3A A;  1C2D A;  4JMY A;  4UFF H;  4YES B;  2Q6D A;  3ZVG A;  2V6N A;  5C2Z A;  1Z1J A;  5KEC A;  3FP8 E;  4E06 H;  1DXP A;  3SNB A;  5EXM A;  1SQO A;  5EU8 A;  1YLN A;  3U8T H;  2Z3C A;  4NFE A;  1ZHR A;  2O9Q A;  1O2R A;  3ZZ8 A;  2OXS A;  2AS9 A;  2BQ6 B;  3SGQ E;  5FCK A;  3LGI A;  4CRA A;  2GJG A;  1NES E;  1VJA U;  2FOE A;  4LOY H;  1A5I A;  1MAB B;  1SL3 A;  3SU2 A;  1OP8 A;  1J17 T;  2OBO A;  1BJV A;  1DFP A;  1AZZ A;  1GHX H;  2LPR A;  4NGA H;  1T4V H;  4E05 H;  3KQ5 A;  2BYA X;  3RXM A;  2W6J D;  2CN0 H;  3C1K A;  1HXE H;  5EW2 H;  3QN7 A;  4FUE A;  2AH4 X;  3G01 A;  4XSK U;  3FAN A;  1TNK A;  1V6D A;  3PO1 B;  2WV5 A;  1LVO A;  3U8O H;  4UFG H;  1XKB C;  2XTT B;  4O03 A;  4Z1M D;  1GHY H;  2BDC A;  3B23 B;  4I86 A;  2F83 A;  1J14 A;  4BTU B;  3JZ2 B;  3H7T A;  5FL7 D;  1RIW B;  4X8V H;  5E0H A;  3UUZ A;  1WTH D;  3NXP A;  1AQ7 A;  1V2V T;  2VJ1 A;  4KKD A;  1MCT A;  5GPI B;  1K1J A;  1C5P A;  4YT7 H;  1S0Q A;  1TPP A;  4B2A A;  3N7E A;  3H5C B;  2ZCL P;  3U69 H;  4FET A;  1TX8 A;  4HTC H;  1G36 A;  5FPY A;  1K22 H;  1KLJ H;  5DJ7 A;  2FX6 A;  1PYT D;  4HI3 A;  1SQT A;  2BDG A;  3GY2 A;  2B8O H;  1QB6 A;  2PUX B;  3IIT A;  4XBC A;  1O5G H;  3SU6 A;  1MQ6 A;  3K65 B;  3QZQ A;  1LVB A;  4K1S A;  1Y3V A;  5CDF E;  1LHF H;  1UCY K;  1WDI A;  1SGC A;  2GMT C;  1JBU H;  3T2N A;  3ZV9 A;  1EZX C;  5E8E H;  5KED A;  4THN H;  3GY5 A;  1Q31 A;  2UUJ B;  2HNT C;  1MZD A;  1CQQ A;  2ZEB A;  1C4Y 2;  3KCG H;  1BTZ A;  1HCG A;  3MWI U;  2K8I A;  4BTT B;  1UCY H;  2C8X B;  1MAY A;  5DP6 A;  1TNH A;  1BBR H;  1P05 A;  2ZGC A;  5DN6 D;  4YTA A;  1SKY E;  1GDQ A;  4LXB H;  3ZV8 A;  1FQ3 A;  3RXK A;  2PP6 A;  2BDY A;  4Y8X A;  1O3O A;  1BUI A;  3RXQ A;  3LGV A;  3NRL A;  2VVU A;  5FHT A;  4B76 A;  1ABJ H;  1GMH F;  1SOT A;  4Q7X A;  2GT7 A;  3DT0 H;  1FLE E;  3MO9 A;  4ISH H;  1GHV H;  1OWE A;  2A45 B;  2PSX A;  4K60 A;  1FY8 E;  4ZMA H;  4DOQ A;  3S69 A;  2ZDL A;  1AE5 A;  3GY3 A;  3TU7 H;  5T3H A;  1EZS C;  1XUH A;  2XRC A;  2JH5 D;  3L6P A;  3LDX H;  2A4R A;  2PFE A;  1GCT B;  2QXI A;  3QTV H;  5H4I B;  2K1Q A;  2KAI A;  1A2C H;  5FX5 A;  5DP7 A;  1HAH H;  4ISI H;  1CT0 E;  4INH A;  5TJX A;  3NK8 A;  6EST A;  4AFQ A;  2FOB A;  4IMQ A;  2ZCH P;  4CR5 A;  1EUF A;  1AND A;  2XYA A;  1GBF A;  2RA0 A;  2ANK H;  2PR3 A;  1O2J A;  1O2N A;  5EGM A;  1S6L A;  1O2Q A;  2G81 E;  5EJ1 A;  4CBN A;  2P3T B;  4IC6 A;  1PQA A;  4JK6 A;  4KP0 A;  1BA8 B;  2FMJ A;  2HPP H;  3URE A;  1BHX F;  5HM2 A;  3H09 A;  4Y0Y E;  1T8N A;  3SOS A;  5F53 A;  1THR H;  3MTY A;  3UY9 A;  4CH2 B;  3PLP A;  3BTE E;  1GI9 B;  1T8M A;  2UWP A;  1C2F A;  4I8J A;  1W8B H;  3FAO A;  3O8C A;  4X1P U;  1DOJ A;  5AF9 H;  1H9L B;  1IQJ A;  5C0U A;  1CT4 E;  3NCL A;  1O2S A;  3OTJ E;  1PYT C;  1KXA A;  2BOH B;  4K3J A;  1TWX B;  3MU5 A;  3ZVD A;  2G4T A;  1ANC A;  2DUC A;  3BIV H;  3BSQ A;  1Y5U T;  4WXV A;  1NU9 A;  4WY3 A;  2JET B;  5EJL A;  3RMO H;  2O8M A;  4BXS A;  4ZHM U;  3UAI C;  3AW0 A;  2QYI A;  3BEI B;  4O3U A;  1VIT F;  3JZ1 B;  3MMG A;  3PRB A;  2ODY B;  1CA0 C;  1PPF E;  5G4B A;  1ELV A;  2RFK C;  1EAX A;  1SPJ A;  2KM0 A;  2BX3 A;  2GCT B;  3A89 A;  3MU0 A;  1A5H A;  3A85 A;  1V2K T;  3Q3Y A;  1HXF H;  4Y7B A;  1C2M A;  1O3J A;  4AYV B;  1O35 A;  1XVO A;  1KXE A;  3I29 A;  2SGP E;  2XNI A;  3SQE E;  3KYF A;  2D1J A;  3SJO A;  1C2L A;  5DPA A;  4X6P A;  1AB9 B;  5DO4 H;  2B5T B;  2P95 A;  1SQR A;  1DWC H;  2OQU A;  2EY4 C;  1O3K A;  1UMA H;  2ZGB H;  2ZG0 H;  1C1N A;  1ELA A;  4ABD A;  3HKI B;  1T31 A;  5A8Y A;  4H6S B;  2O8T A;  4MPW A;  5E2O A;  1GJC B;  1SGN E;  3A8B A;  3AAU A;  3FP6 E;  1B0F A;  5IK2 D;  1WXR A;  2QXH A;  4IN1 A;  4EST E;  4JYU H;  2WZQ A;  1P8V C;  8GCH F;  3OEH D;  2BDB A;  4FUG A;  2ZPQ A;  1CU1 A;  5EJZ A;  3PLB A;  2ZFR H;  1K1N A;  1LO6 A;  2ULL A;  1BHX B;  1NBM E;  3PMA B;  1XMN B;  2ZFP H;  2THF B;  1IQK A;  2CMY A;  2BLV A;  1ZHP A;  3OAA D;  1GGD B;  2Z3D A;  5FCR A;  1IOE A;  3AW1 A;  2IPH A;  4B2B A;  1GBJ A;  4FUI A;  1KIG H;  1G9I E;  4K5Z A;  2Y6T A;  4FU8 A;  4ISL A;  1D3D B;  1GMD G;  2A4O A;  4MNX A;  3CS0 A;  4DIH H;  1RXP A;  1DUA A;  2Y81 A;  1O3E A;  1E79 D;  4B1T A;  4UDW H;  4ABE A;  3C27 B;  3RLW H;  3SV7 A;  1AWF H;  1GHB G;  1CO7 E;  4OGY A;  5GCH G;  4FUH A;  3ELA H;  1Z8J B;  4X8S H;  1SQA A;  2XC5 A;  3QDZ B;  2ASU B;  1GWA A;  3P92 A;  3TIU A;  1W0Y H;  5L30 H;  2XWB I;  1G30 B;  1WTG H;  3LU9 B;  1V2R T;  2BY7 X;  7EST E;  1CT2 E;  3TJO A;  1KDQ A;  1GJ4 H;  2HNT E;  3UQV A;  1V2S T;  3BG8 A;  3RC5 A;  3HK3 B;  3RC4 A;  1WUN H;  3SI3 H;  1GDU A;  3LGT A;  2P3F H;  3UNQ A;  1UTJ A;  3A7V A;  2OC0 A;  4UON A;  1ELG A;  2R2M B;  1OWH A;  3RM2 H;  1KXF A;  2XWA A;  1LHG H;  4MPV A;  2ZDA H;  1IQF A;  3SV8 A;  4XOJ A;  2H1U A;  3SNC A;  4A92 A;  4AB9 A;  3RXT A;  3LJO A;  3MH7 A;  1KY9 A;  4MDS A;  1L1G A;  1O34 A;  1YCP M;  2ZGX H;  1BB0 B;  1E1Q D;  2AEI H;  2ZU5 A;  1QRX A;  2OCV B;  1CA8 B;  2PW8 H;  2V3O H;  3SNE A;  1C5O H;  1NFX A;  1HV7 A;  1D3Q B;  1BTP A;  3RLY H;  1A4W H;  4SGA E;  3Q3K A;  1RTF B;  1H8H D;  3OE7 D;  4AFZ A;  4RN6 A;  1G3D A;  1K1M A;  1O3H A;  3DFJ A;  3DA9 B;  3EST A;  3UOU A;  1SHY A;  2WV4 A;  2BLQ A;  3KN2 A;  3GDV A;  4KTU A;  3TIT A;  3TK5 A;  1JRS A;  4AN7 A;  4XBB A;  3W95 A;  2I6S A;  3TLO A;  3O8D A;  3GY8 A;  1AZ8 A;  1EAW A;  1ANB A;  5DKM A;  2R9P A;  3LC5 A;  1XXD A;  1HAX B;  2ZWL H;  4A1T A;  1Z71 A;  2VGC C;  4YXW D;  3BG4 B;  1ZSJ A;  3BV9 B;  4KGA A;  4AFS A;  1QBN A;  1UTQ A;  4GVU A;  1DE7 H;  1T7C A;  1FMG A;  1XUK A;  3PO1 C;  3ODF A;  4DCD A;  2VH6 A;  1FAK H;  2FO9 A;  1UVP A;  2PHB A;  2RDL A;  1F2S E;  1QNJ A;  1W13 U;  2UUF B;  1J9C H;  4OGX A;  2FS8 A;  3GS9 A;  4MNW A;  1S81 A;  1W10 U;  1ZLR A;  5A0C A;  1GHB F;  1AY6 H;  1CBW B;  2GT8 A;  4GPG A;  4ZKN U;  3ZZ3 A;  1K21 H;  1SGD E;  1TAL A;  5A09 A;  1AFQ B;  1EPT B;  2ZZU H;  2G00 A;  2F9O A;  3B9F H;  3T28 A;  1ZTL A;  1BT7 A;  4FUC A;  4B71 A;  3HGP A;  1NRN H;  3F2F A;  1P2J A;  1K9O E;  2VBC A;  3KQE A;  2OC1 A;  2ZFT A;  1LVM A;  2OK5 A;  3TJU A;  1O37 A;  5FX6 A;  3F3B A;  2WYG A;  4BAO B;  1DS2 E;  1HAZ B;  1BML A;  4XDE A;  4A1X A;  3A83 A;  3PTN A;  3P17 H;  1GBL A;  3ZZB A;  2J97 A;  1LPZ B;  2QE7 D;  3TNS A;  2VVC A;  1TA2 A;  1AVW A;  5LGO A;  1UHB B;  3RP2 A;  4MNV A;  1S83 A;  5I25 A;  1N1L A;  1C1S A;  5I46 H;  1IQI A;  3RDZ A;  1S5S A;  1C1T A;  3SJI A;  1YKT A;  1HAG E;  5HGG A;  2TGP Z;  2GGV B;  1D4P B;  1TMT H;  1MAX A;  4Y6D A;  1N6X A;  3ZVE A;  2Z3E A;  4Q80 A;  2BZ6 H;  2CF9 H;  3R0F A;  6GCH F;  2VID A;  2RCE A;  3A7Z A;  3A7X A;  2JIZ D;  5SGA E;  2FX4 A;  4H6T A;  2J2U A;  1V2N T;  1SGF A;  4WJG 2;  1T8O A;  2BZA A;  1DY8 A;  4X8T H;  5JBA S;  1OP2 A;  1O2L A;  1O30 A;  1PQ8 A;  1GI7 B;  3DD2 H;  2NU2 E;  1HJA C;  2OLG A;  2HLC A;  5A2M H;  3S9A A;  3OTP A;  1TB6 H;  4A6L A;  5LPE A;  1TQ0 B;  5ETX A;  1WQS A;  3IG6 B;  1S82 A;  1K28 D;  1HYL A;  2A4Q A;  3SHA H;  2C93 B;  3M7T A;  3KYG A;  1QTF A;  1S6H A;  2EST E;  1CA0 B;  5JDU B;  1KLT A;  2BVX H;  2V35 A;  1IQL A;  3BTD E;  4YLQ H;  1V2J T;  1P3E A;  2ZCK P;  4NWL A;  1RGQ A;  6CHA B;  1HAY B;  3PV4 A;  1Z7K A;  1BTH H;  2HAL A;  3NKK A;  5C94 A;  1XUG A;  8LPR A;  3N7O A;  5AFY H;  2XW9 A;  3RXG A;  4ZHL U;  5GJ4 B;  4ZKO U;  2PTN A;  2ZU1 A;  1PJP A;  1E1R D;  1GPZ A;  2BXU H;  3KID U;  4AX9 H;  2LEL A;  1MTN C;  2FI3 E;  3A8C A;  1ZMJ A;  4IW4 E;  1O5A B;  2QV1 A;  4OS2 A;  1A0L A;  1T8L A;  5AFZ H;  2QCY A;  3U8R H;  4RT0 A;  2IJO B;  5GIB A;  1QQU A;  4JCN A;  4BTI B;  1YPK H;  3RXJ A;  2XBY A;  1IQM A;  2ZDK A; 
#chains in the Genus database with same CATH homology
 1W3C A;  4F55 A;  3RC6 A;  3SUF A;  5CDF E;  3F2H A;  2O8M A;  4A1X A;  3RC5 A;  5T1V A;  2IJD 1;  3RC4 A;  3LOX A;  3KNX A;  2FM2 A;  2JDI D;  2OC7 A;  2OC0 A;  2QE7 D;  3LKW A;  5CHB A;  2KR7 A;  3N99 A;  3PV5 A;  3PRB A;  3N7D A;  2F9U A;  2JJ2 D;  1RTL A;  3F2G A;  2M2A A;  2YMS D;  1JXP A;  2FP7 B;  3SU4 A;  3W1E A;  3SV8 A;  1KMH B;  1COW D;  1N1L A;  2KM0 A;  2L6O A;  2K0Q A;  2KCO A;  2OBQ A;  4TT3 D;  4TSF D;  3E90 B;  2XND D;  2K8I A;  4A92 A;  3FN8 A;  3PRD A;  3AK5 A;  2F4L A;  2FOM B;  4NWK A;  1FX0 B;  2GGV B;  2AHM E;  2KCY A;  2V7Q D;  3M5M A;  1OHH D;  3PV2 A;  5DN6 D;  1E1Q D;  4JMY A;  4B6F A;  1NBM D;  1SKY E;  3U1I B;  2XNI A;  5C17 A;  3OFN D;  2JIZ D;  3FKS D;  1DXP A;  3O8R A;  2F43 B;  3KEE A;  4B75 A;  1H8H D;  3OE7 D;  3NRL A;  2WV9 A;  1H8E D;  4B76 A;  4B6E A;  1DXW A;  3UB0 A;  5EPY A;  3WW7 A;  5EQR A;  4M9F A;  4ZCN A;  4OM9 A;  3F0P A;  1DY8 A;  2YMS C;  4TYD A;  3SU3 A;  2QF5 A;  3KN2 A;  3SZE A;  3SYJ A;  3SU0 A;  3ZIA D;  3SV6 A;  4I33 A;  2QF4 A;  3LON A;  3OYP A;  2WHX A;  1A1R A;  3EYD A;  2HLD D;  3O8D A;  3SUE A;  1MAB B;  3M5N A;  3SU1 A;  3SU2 A;  5C0T A;  3M5L A;  2OBO A;  2XOK D;  3L6P A;  4RI0 A;  2OC8 A;  4U01 A;  4A1V A;  5IK2 D;  1BMF D;  3FOA A;  4KTC A;  1W0K D;  2A4G A;  2A4R A;  3OTP A;  1W0J D;  4WH6 A;  5FPS A;  4K8B A;  2F9V A;  4A1T A;  2W6J D;  5H4I B;  2K1Q A;  3WWF A;  4YXW D;  4B73 A;  5ETX A;  5B6L A;  2WZQ A;  3M5O A;  3P8O A;  3SUD A;  3OEH D;  3DCL A;  3SUG A;  1CU1 A;  2A4Q A;  1DY9 A;  3OEE D;  2CK3 D;  2JJ1 D;  2KZ4 A;  2OIN A;  1NBM E;  2GVF A;  2KCP A;  2W6I D;  3DSP A;  5EQQ A;  4Z1M D;  3P8N A;  1S6L A;  3OAA D;  4Q63 A;  1NS3 A;  4NWL A;  1RGQ A;  2XCN A;  5EPN A;  2J5U A;  4ASU D;  2WSS D;  2WPD D;  3KF2 A;  4B74 A;  5HKK D;  3VG8 A;  2KFW A;  5FL7 D;  3H09 A;  3F0O A;  5F53 A;  4Q4L A;  5FPT A;  5EQS A;  4I31 A;  2YOL A;  3GS9 A;  3DSO A;  4WH8 A;  5GJ4 B;  3WWB A;  3O8B A;  3SU5 A;  2XCF A;  5GPI B;  4I32 A;  1E79 D;  1E1R D;  2P59 A;  5DSF A;  2LEL A;  3O8C A;  3N7E A;  3SV7 A;  4XD7 D;  3U1J B;  5C0U A;  2QV1 A;  1BT7 A;  4FET A;  4B71 A;  4DT4 A;  3SV9 A;  5FPY A;  4R8T B;  3F2F A;  5GND A;  5IDK A;  2YMS B;  2VBC A;  3F3B A;  2OC1 A;  2IJO B;  1EFR D;  3FO8 D;  5ESB A;  2OK5 A;  3SU6 A;  4WF8 A;  1WXR A;  2KCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...