3DSOA

Crystal structure of cu(i) bound copper resistance protein copk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Putative uncharacterized protein copK
publication title Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography
pubmed doi rcsb
source organism Ralstonia metallidurans
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dsoA00
3N7EA 2KM0A 3N7DA 2K0QA 3DSOA 2LELA 3DSPA
chains in the Genus database with same CATH superfamily
2VVUA 3MH4A 1NRRH 3MYWA 3ELAH 1JOUB 2OQUA 1B5GH 1Y5UT 1GDNA 2ZFQH 3ODFA 4WXIA 5JPMH 1GI0A 2ZECA 1OP8A 2WPJS 3EYDA 3P8OA 2OK5A 3UB0A 4UE7H 1CA0C 4ABJA 1EZSC 3U69H 1UTQA 4IN2A 1Y3XA 1PYTC 2M5TA 1KTSB 1S85A 3Q3KA 1QIXB 1THSH 3MH5A 4ACAA 3TJUA 1P03A 3LT3A 2G4TA 4WF8A 1A0LA 1LHCH 1GBFA 1EJNA 4AYYB 4DIIH 4DJZB 1O3GA 4ISNA 1K0HA 1P2JA 1UK3A 2ZU2A 1NFUA 2Y82A 4XRNA 1O3KA 2BDYA 1IQJA 4ZKRU 1ZLRA 2ZHWH 3BTEE 1GBKA 2YNAA 1BTYA 1AD8H 4YT6H 3U28C 4Y6DA 3RXEA 4ABFA 3DFLA 1UO6A 1ARBA 2XW9A 3M3SA 3U1IB 1C2LA 1AUJA 1DWBH 2SGFE 3R0FA 2XWBI 4FETA 1V2WT 4LXBH 1GBJA 1QR3E 5AFYH 1O5GH 1TMBH 2A45B 2WUCA 2A31A 4GHQA 1GI8B 4AB9A 1AE5A 2ZTXA 1D4PB 3RC4A 3F2HA 1CGJE 4U30A 5KEDA 1T4UH 2B7DH 1BRAA 1C5YB 5A8ZA 1PPEE 3O8CA 3MNSA 4I7YH 1VCPA 3AVZA 1BRBE 1XUIA 3STIA 2BM2A 1O39A 3SW2B 1NZQH 2WPDD 3AK5A 3KN2A 3GCHB 1RIWB 1A5IA 3RMNH 3URCA 3SNDA 1RGQA 1QJ6B 1GMDG 1LKBA 1Y3WA 1RFNA 2YNBA 1N6XA 2P59A 1OYTH 5DSFA 4M9FA 1O2YA 4D8NA 2FYRA 1A0HB 1BOQA 1C2EA 2Y5HA 1C1RA 3GY3A 1XVMA 1B0FA 3STJA 1S83A 2J2UA 1L1JA 1O3AA 4LOYH 1ANEA 2GCTB 3UR9A 2JDID 3LPRA 5IK2D 1ANCA 2F3CE 4JYUH 2HNTF 3FP8E 4E7RG 1ZOMA 4MPXA 1ZTJA 1H9HE 1BMFD 1C1OA 2SNVA 1QQ4A 2WPIS 3P95A 1SC8U 2KCOA 4I33A 1SGQE 3T27A 2VGCC 3RXOA 1MU8B 1K2I1 3LH1A 1G3BA 5C94A 5DGJA 3PWCA 1UVUH 4ASUD 1O3EA 1KSNA 1MTUA 1VITG 1XVOA 2WSSD 1O36A 1GI6A 2O8UA 2Z9JA 3VB7A 1AGJA 1AVXA 1MBQA 1G32B 2FOHA 5T6FA 2TGDA 1GJ9B 3LIWA 4CHAC 1Y3UA 4TPIZ 3UWIA 4OS6A 4CBOA 1W3CA 2PKSB 2FOEA 3EA9A 2QYIA 1OP2A 2P3TB 3B23B 1FQ3A 1DICA 4I8KA 2ZTYA 4X8SH 4IN1A 1P12E 5I25A 1Z8IB 3TK6A 3L6PA 1P2KA 1OS8A 2A4OA 1C4V2 4X2YA 4WMEA 2FI3E 1EZXC 2JETB 2WV5A 3RUOA 2ZU5A 5HIZA 1TQ0B 3A88A 1P0SH 3FP6E 1GI4A 4ISLA 1D3PB 1T8OA 4BOHA 1DE7H 3TLOA 1B0EA 2THFB 1V2MT 1ZMLA 2ZGXH 3RXIA 1HXEH 3QUMP 2W6JD 3A80A 4ABGA 2WPMS 1TRNA 4FU7A 3P8NA 1Y3VA 5CHAB 2GP9B 1BTZA 4ISHH 2ZKSA 4AFZA 5JBAS 1E1RD 3ODDA 1HJAB 6GCHF 3O8DA 1WXRA 1PPCE 1LQDB 1GBIA 1EUFA 2C93B 2L74A 3LU9B 3ENSB 4CRDA 4AORA 1UJ1A 1OWDA 2W7SA 4MNVA 3ZZDA 3O8BA 1BJVA 1BQYA 2A5IA 4NIWA 2A32A 1MQ5A 5FAHA 1SGCA 1JWTA 1O3FA 2A4GA 3A7VA 4YLQH 4A1TA 5F03A 2R3YA 1O2NA 2ZQ1A 1HJ9A 3DFJA 4X8TH 5BPEA 3GCHC 1WCZA 4DY7B 1HLTH 3MU5A 1O37A 5F53A 1EAIA 3ZZ8A 2OXSA 1VCWA 1LHGH 3E0PB 4K2YA 3RU4T 3PLKA 3TJOA 3NWUA 1AIXH 1OWEA 1F5RA 1OPHB 3ZV8A 5ETXA 3UOPA 4INHA 4NCYA 1C5MD 1EPTA 2F83A 3DSGA 1HAVA 3FZDA 3KF2A 2GCTC 5EPNA 3ZVGA 5DP8A 3ZVBA 1CGIE 4NA9H 3UNSA 3UR6A 3RXBA 1HAOH 3MQKC 3SV2H 4ZROA 4UD9H 1T8NA 4CRAA 2V35A 4XBDA 5FBIA 2JH6D 1YC0A 1TGBA 3PYHA 1CA8B 1HRTH 1OYQA 1TGCA 1K1NA 4X2WA 2GTBA 4YXWD 2YMSB 1GMDF 2FOFA 2OQ5A 1D3TB 1FY4A 3RXSA 3RU4D 1O5FH 2BLOA 1Q2WA 2FX6A 3BTKE 1ELBA 3HKIB 2TGTA 1DSUA 1AZ8A 1EPTC 1O2TA 1LO6A 1YCPK 4XOJA 4F4OC 1GJAB 1MZDA 2CMYA 4YT7H 5AF9H 5DK1A 1HUTH 3VB6A 2LPRA 1BMMH 3N99A 4INKA 2P93A 2Y7XA 3NXPA 2PKSC 3H7TA 4AN7A 2H6MA 2BVRH 6CHAC 2G5VA 3M36A 5GIBA 4UFEH 1GVZA 4TY6A 5JBBS 5T6DA 2G4UA 3C27B 1NU9A 2ANKH 1NFWA 1VITF 1V2KT 1ZGIA 4FUEA 1SGEE 1C1VH 3PMBB 3F9GA 3SGQE 1O2KA 1QGFA 1O2IA 1KLTA 3HGPA 1SSXA 2SNWA 3ZZ4A 2ZGBH 1QRWA 3PLPA 1NRQH 4Q2KA 2EA3A 3UUZA 1V3XA 1KYNA 1P10A 1L4DA 1S0QA 4NA7A 2V3HH 1HDTH 2EI8A 2BD7A 2BDBA 5CHAC 1TNHA 3RM2H 3A8CA 2Q6FA 2D26C 3PB1E 2UWPA 3QZQA 3GCTG 2BB4A 2HNTE 1SI5H 2A5KA 3I78A 3T28A 3K6ZA 1XUKA 2I6QA 3URDA 3SUFA 3E8LA 1CT0E 4DW2U 1SR5C 1TPAE 4MG3A 4OS1A 6LPRA 3PV2A 2AMPA 1BTXA 4P02A 3HKJB 1YLNA 3MOCA 1GL1A 4PROA 1AHTH 1P9SA 2HALA 2I6SA 1BB0B 1IOEA 1YPMH 2OD3B 1GGDC 2BZ6H 1GHBG 2J9NA 2ZI2H 1P9UA 2G5NA 1C2HA 4MPWA 1WQVH 3A8DA 3EQ0H 3AAVA 2EI6A 1ZJDA 3M7UA 1CSOE 2J97A 2CF9H 3EE0B 4U01A 1PQ8A 1AFEH 4XDEA 5DP5A 4ZHAA 1UVPA 1CGHA 4NFEA 3SGAE 2XTTB 3SJ9A 5DP6A 1Q3XA 2FESH 9LPRA 1FZZA 2ZHDA 3KL6A 3GDSA 2CF8H 4UFGH 1GDUA 1HAGE 3MU8A 3Q77A 1THPB 4CR9A 1SFIA 2WPLS 2P95A 3VFEA 2J98A 2C8YB 3BTDE 2P94A 4X8VH 4X1QU 4O3UA 3NPSA 2TGPZ 5EQRA 4X1RU 3PRDA 4X0WU 1TLDA 2QF0A 2M2AA 3GYLB 1FAKH 2SGQE 1ESTA 3BV9B 3AW0A 3S9AA 1ZZZA 2FI5E 4D9QA 5GPIB 3SJOA 2VIDA 1SKYE 1SGYE 5C20A 2CK3D 2PUQH 7LPRA 2HOBA 2VIOA 4XFQA 1MABB 1S84A 2VIQA 4CBNA 1UW7A 3BG4C 4GCHG 3TNTA 3BTME 1K1IA 4WWYA 5FPYA 1T8LA 4ESTE 1W7XH 1IQMA 2EEKA 1KDQB 1NROH 1HAXB 1HJ8A 1F92A 1LKAA 3EA7A 3MO3A 4MVNA 2STBE 1ZHRA 2F9NA 1ELTA 2HNTC 1ZSJA 2ZPRA 3LOXA 1GL0E 1MTNC 1RTLA 1GHXH 5B6LA 3F0PA 4JMYA 3OE7D 2GV6A 3D49H 1TQ7B 2A7HA 2IPQX 1O3DA 2FOMB 2TPIZ 4FUIA 1CA0B 2ZF0H 4XSKU 2ZU3A 1OKXA 2QV1A 1UHBB 5C0TA 2JH5D 1EJMA 5H4IB 2FXRA 2AIQA 2HPQH 2J92A 3F9EA 1TMTH 2R0LA 3CS7A 2ALPA 1S5SA 1QURH 1ELVA 2F9BH 1SHYA 2BDCA 1GPZA 4ISOA 1ZGVA 3SU6A 3PLBA 5HM2A 3GCOA 2A0QB 4D7GA 3DSPA 2K8IA 1BHXB 1DWDH 3E0NB 2YMSD 2J94A 1W0ZU 2OC8A 4ZXYH 1H8HD 4Y76A 1O3NA 1OWKA 2Z6BD 1G3EA 1ZTLA 1EQ9A 4XD7D 1LTOA 2O9QA 1TNLA 1O3CA 1E1QD 3S9BA 3NRLA 2QA9E 3D23A 1G30B 3OYPA 1TE0A 4ZMAH 2ZP0H 5A09A 2QF4A 2QXIA 3SNAA 3S69A 4IW4E 2BDGA 4KELA 4K1TA 4NA8A 4JK6A 1GJCB 1TPPA 2RA0A 1Q31A 2K0QA 3MNXA 1W0KD 1Z8RA 1QB1A 1HAIH 3GCTF 1MZAA 1KXFA 1BBRH 4LZ4B 1SOZA 4AX9H 2OTVA 2D8WA 3RLYH 2D2DA 2ZGJA 1ZPBA 5FCRA 1BCUH 5IYTA 2AGGX 1DS2E 5DN6D 1KTTB 1OWHA 2QY0B 1EXFA 1N6YA 2ZDMA 4X6PA 3FN8A 5DP4A 4FXGH 1AMHA 2C90B 3QN7A 2BVXH 1UK4A 1SMFE 3BTHE 1S6LA 3U8TH 3A84A 3UFAA 1AE8H 1GJ4H 1QA0A 1TOMH 1YPLH 4X8UH 5F6MA 2R9PA 2O8MA 3EA8A 3L33A 4LK4A 4F48B 3DCLA 1ZRBA 5GDSH 1GI1A 2BYAX 2F91A 4MDSA 2ZFRH 4CRFA 1EOJA 1IQKA 1BBRE 4MNYA 3KCGH 5GCHG 3CP7A 4FUBA 2VU8E 4BTUB 1O2QA 1SQOA 1RJXB 2BDHA 2JKHA 5EODA 4M7GA 2ZWLH 1DWCH 1PPFE 1JIRA 1IHTH 2Y6TA 3TK5A 1P2IA 2BZAA 1X7AC 8ESTE 1XM1A 2NU0E 3SJIA 4Q7YA 3KQCA 2GGVB 2ZHQH 4NIVA 3LGWA 2NU2E 3ATKA 1LVBA 3M5MA 3P8GA 1O33A 3ZVAA 2VGCB 1TYNA 3RXLA 3G01A 1GHWH 3NUMA 4K8YA 1TX6A 4NZQA 3M7QA 2CGAA 3NK8A 4H42U 4BANB 1OSSA 3MMGA 1C1PA 3SNEA 3EE7A 1LCYA 1ZHMA 3A7YA 4YOGA 1W7GH 4DT7B 3ZZ5A 4I31A 3JZ1B 1C5XB 4DURA 1SQTA 1TA6A 4BNRA 1O2JA 4O9VA 1SBWA 4BTTB 1C5PA 4CHAB 3FO8D 1NT1A 4GCHF 3A87A 1HNEE 1SHHB 4X1NU 1OWJA 5C1XA 2TBSA 2BQ6B 1SLWB 5LPRA 3LJOA 3BTTE 6GCHG 1UTMA 1GCDA 1GJ5H 1QZ8A 2BQ7B 2EI7A 1AWHB 4Y0YE 2LELA 1ABJH 1SFQB 3SUGA 5DG6A 1NY22 2H9EH 1DSTA 2G52A 3E90B 1KXCA 4GVUA 1XUHA 5EJ1A 1DDJA 1O3OA 4P00A 1S6FA 2XNIA 1C5RA 1D3QB 3VPKA 2AMQA 3W94A 5A2MH 1PPBH 2FIRH 2JIZD 1FI8A 2ULLA 1W2KH 2FOBA 1AUTC 1SG8B 2UWLA 1DPOA 1Z6JH 3CNRA 3RMOH 1P2MA 4RT0A 1V2PT 3DSOA 3GOVB 3L3TA 1QRZA 2HLCA 1IQGA 1G3CA 1LHDH 1YPJH 4ISIH 3SV7A 1GCTB 4VGCC 4FU8A 1DLKB 1GMCG 5EW1H 2KM0A 1TBZH 3M3VA 1OXGA 1C1TA 1MTWA 2SFAA 1ANBA 1CBWB 4NWLA 4IS5A 2FTLE 4AG1A 2AERH 2B8OH 3TJVA 5T6GA 3PWBA 3E3TA 1K1MA 1LPKB 1N1LA 3RXFA 1O3MA 2AGEX 2J34A 3RM0H 3QWCH 1HAPH 1QHRB 1PYTD 2VJ1A 1C2IA 2OLGA 5DO4H 1BDAA 1FV9A 1EP6A 3BTWE 2F4LA 1HAZB 1JIMA 5HXFA 7GCHG 1FMGA 3P70B 4U2WA 4XBBA 5EQQA 5CE1A 4CH8B 1A7SA 1XUGA 5K0HA 2PV9B 3U1JB 5HM9A 2PHBA 1EASA 1IQIA 1K1JA 1J8AA 4LZ1H 1ABIH 2XCFA 1ID5H 4B2BA 2ANYA 1F0SA 3Q00A 1BMAA 3H7OA 4B76A 2ZC9H 1W0YH 2D1JA 3N7OA 3SV8A 3PMHB 3OEHD 3SORA 1QB9A 5PTPA 3SYJA 3GISB 3BTFE 1E38B 3SBKA 2GDDA 4JK5A 4YOIA 2FYQA 3RXDA 5C17A 5E0GA 2C8XB 3T26A 2ZFPH 5GCHF 3RXAA 1EPTB 4FVDA 5JB8S 1HAVB 1F0UA 3LGTA 1UCYK 1V2UT 2W26A 1H8DH 2Y5FA 3CS0A 4RI0A 1NS3A 4ASHA 5A8XA 2ZHFH 3M5LA 2GMTC 1ZPCA 2V0BA 2VINA 3ZZ9A 3BSQA 1CHOG 4GLYA 1F7ZA 2BY7X 4MNXA 3MI4A 5AVDA 1AWFH 5C5OA 3RXQA 1J9CH 2GJGA 1P06A 4K1SA 1O35A 1DY9A 3E16B 1H4WA 3A7ZA 3M5OA 4YZUA 6CHAB 1SOTA 4I8LA 1ZHPA 3OEED 1V2ST 3LC3A 2RCEA 1GI3A 2FP7B 2QIQA 4R0IA 3RXGA 5TJXA 3VGCC 3FAOA 2J5UA 4HZHA 5B6OA 2Z3CA 4DIHH 2Q6GA 3F6UH 2VIPA 1BITA 2GZ7A 1QL7A 1HBTH 3SHAH 2FO9A 1TBQH 3F3BA 3ZZAA 1O3HA 2SGEE 1Y5BT 2H1UA 1AO5A 2QF3A 3HK6B 1F2SE 2J95A 1P3EA 2BX4A 2W7UA 3SZNA 4DG4A 2VH0A 3FVFB 1AVGH 2VIVA 4OS5A 2HVYB 2GKVE 5C0UA 4AZ2B 1BTPA 1FAXA 1L4ZA 3NZIA 4GHTA 1ESAA 1GCTC 3ZV9A 4BAKB 1E34B 2YOLA 3BIUH 4BXWA 4CRCA 1IQLA 1E36B 1E79D 3SU4A 4X6OA 1D3DB 1TFXA 4ZKOU 1N8OB 1JBUH 5C3NA 3T62A 1GBLA 1CBWC 2QN5T 1YKTA 3C1KA 1A5GH 1Z1JA 4X6NA 5J4SA 1YCPM 3KQ5A 4B71A 4DGJA 2CV3A 5C1YA 1AKSA 4TWWA 5KECA 1E37B 2BY9X 2PSXA 1T4VH 2CHAB 2EC9H 4D9RA 5G4BA 4JZIA 4HG6A 1WBGB 1O2LA 1GGDB 3DUXH 2JH0D 3MHWU 4A1XA 1NO9H 3SU2A 1ETTH 1TIOA 1GMCF 1P3CA 1KLIH 1TB6H 3P92A 4KTCA 1NFYA 1SGIB 3A86A 4B6EA 2PR3A 2KAIA 4ABAA 1Z6EA 1ESBA 3EGKH 4B73A 3LDXH 4WY3A 1O2SA 1K22H 1PFXC 2VVCA 1LHEH 1GHAG 2IJD1 2PGQB 1TGNA 3RXHA 3SGBE 5E8EH 1LPZB 3M5NA 4Y0ZE 4IMZA 2FODA 1GBEA 4FUHA 3TVJB 4BAMB 2ZDLA 3OTJE 1LVYA 3F2FA 2J38A 1O2XA 3VB4A 2H2ZA 5HMAA 1G36A 1P02A 1C1QA 1S0RA 2FWWA 2R2MB 4AG2A 4Y7BA 2AEIH 1GMHG 7GCHF 2ZDVH 4OGYA 1FDPA 4Y8YA 1UCYH 1A1RA 3MU4A 1QBNA 1ZSLA 1DX5M 4CR5A 1BHXF 4AGJA 3UWJH 1GG6C 3PMAB 1C5QA 2XNDD 3KYFA 1DT2A 3BG4B 2OC7A 2J98B 1YGCH 2R3UA 3RMMH 2AIPA 2FM2A 4HGCA 1G37A 3ITIA 4XBCA 2Z9GA 5T1VA 4B1TA 1FIZA 1QL8A 1V2TT 3BTGE 1MD8A 4TPYA 3PM3A 4FUFA 3F9HA 2G81E 3V7TA 1QCPA 2P3FH 3T2NA 5I46H 1O2HA 2FLBH 2FOGA 1K1PA 1BTHH 1UMAH 1MTNB 3KQBA 5JB9S 4TWYA 1GHYH 1BIOA 2BD2A 4Q7ZA 1W13U 2A7JA 3BF6H 5TCCA 1UCYE 1A3BH 1YWUA 1ZRKA 1CHOF 1O32A 3SOSA 1W11U 3RXRA 1MCTA 3FFGA 1BRUP 3HATH 1C5TA 2ASUB 1HIAA 2PSYA 4FOUC 4SGAE 2GCHG 3M3TA 5L6NH 2ANMH 3MTYA 1GVKB 4MTBA 4INLA 3E91A 2DE8A 2UUKB 3RXKA 3VG8A 5FL7D 1W12U 1QL9A 4WH8A 1OOKB 1J16A 1K1OA 1ELAA 4ABEA 1N8OC 1QFKH 1UVSH 2LNCA 3UY9A 1O5BB 2B9LA 3NKKA 3A7TA 1IQEA 1SGRE 1YYY1 5LPFA 2GV7A 3P17H 2KX4A 3HGNA 2FZZA 2H5CA 2OBOA 4MLFB 4RKJB 2CHAC 5T3HA 3NCLA 5L2ZH 2NWNA 7ESTE 3PV4A 3A89A 1G9IE 1A0JA 5EJZA 3D62A 2Z3DA 1O5CB 4FUGA 1XUFA 2ZO3H 1DITH 1NM6A 2ZZUH 3W95A 2Q1JA 1AQ7A 2L6OA 3RXVA 1C2FA 1GI9B 2W5EA 1PPGE 1FY3A 4JZFH 3RC5A 1EP5A 3MU0A 1GJ7B 3U98H 2OCVB 1P04A 1VCQA 1O2GH 2ZPSA 2A7CA 4IMQA 4WXVA 2PW8H 1ORFA 2WUBA 3SO3A 3SU1A 1TNIA 5FX5A 1NPMA 3SV9A 3A7XA 3OFND 1MQ6A 1WYKA 3B8JA 1TONA 2LP6A 1MAXA 2ZCLP 4YESB 2H9HA 4A92A 3U8RH 3TH4H 4AYVB 1P01A 4ZHMU 4E05H 2AH4X 3UREA 1S82A 2ANWA 1YCPH 3V12A 1JMOH 1KXBA 2AFQB 1XKAC 1YM0A 2V7QD 4CH2B 5LPEA 1J17T 2NU4E 1O38A 1GHAF 3Q3XA 1C1UH 4KP0A 3RXTA 1BJUA 1VZQH 4ZH8A 3SQHE 4UONA 2XBXA 3MU1A 1HYLA 1QJ1B 1Z8GA 3ZVCA 1C2DA 4NGAH 3DHKH 1H9LB 2BHGA 3TK9A 5EXNA 1AU8A 1VJAU 2G55A 2XXLA 1GMHF 2V3OH 3PTBA 1A61H 1T32A 4UDWH 2A2XH 1GJDB 3QO6A 4ZUHA 1QY6A 1PQAA 4K3JA 2XOKD 1XXDA 2H5DA 2PLXA 2Z9IA 2QXHA 3BIVH 3LGVA 4CREA 5K7RA 1C4Y2 4Z1MD 2FEQH 2ZCHP 3TU7H 1H8ED 1TNGA 3FOAA 1CE5A 2BLVA 1C5LH 1C1NA 2BD3A 5TCAA 5EQSA 1ZTKA 1F5KU 3MWIU 1VKYA 2NU1E 6ESTA 1P11E 2BD5A 1C1SA 2C8ZB 1GBDA 4JYVH 1E0FD 3ATLA 3VEQB 1FX0B 4CRBA 3VXEH 5ABWA 1G2MA 3FKSD 1FJSA 2GCHF 1XX9A 1DVAH 1KIGH 1C9TA 1O2UA 5L2YH 1V2NT 1O2MA 1PQ5A 4I86A 1C9PA 2J4IA 2ZDNA 3ATIA 2SGAA 1WU1A 1DXWA 3M61U 5EJLA 1L1GA 1YY3A 4VGCB 1YPKH 1DLEA 3PMJA 3OX7U 4AOQA 1GBBA 1Z7KA 3CENA 5L30H 2VWNA 3KEEA 1OP0A 5EG4A 5J4QA 1HGTH 2BXUH 2ZEBA 1CO7E 4GUXA 2VBCA 5F8XA 4ABDA 1WUNH 5JBCS 1P8VC 2FS8A 2BOKA 3BN9A 4B74A 1LMWB 3TH2H 4Y10E 4F49A 1LQEA 1TWXB 1NBMD 2PWXA 1CU1A 5A0AE 1QBOA 1V2OT 4JZDH 7KMEH 1KLJH 3V0XA 1H1BA 2W6ID 4KKDA 1ZMJA 1SQAA 1Y59T 1TAWA 2FOAA 1XKBC 1GJ6A 1ACBE 2FPZA 2PKAA 1BT7A 1MUEB 3GCNA 1HAHH 1UTLM 2GZ8A 3Q76A 1SGNE 3F0OA 3ZYDA 3MO6A 1F0TA 3KYGA 1KXEA 1DY8A 1EKBB 1O3IA 3IWMA 2K1QA 1THRH 1AFQC 1VGCC 1BRCE 2O8LA 2GD4B 4YTAA 2GDEH 1IAUA 2Z3EA 5LH8A 2QAAA 3MNBA 2FI4E 2AGIX 1SLVB 2FTMA 2ZIQH 3SHCH 3BEFB 5DKMA 3R3GB 2ODPA 1HPGA 4E06H 2KCYA 4QT8C 2WV4A 1NFXA 1C4U2 2PTCE 1WTHD 4IBLH 1WV7H 4O03A 1TRYA 4WMDA 1XXFA 2RDEA 1YPEH 1Y3YA 1TX8A 1DXPA 2GMTB 1RRKA 2FS9A 4GPGA 1MU6B 1SB1H 1L1NA 1DOJA 1BTWA 2O8TA 2UUJB 1W0JD 3GY8A 2QXGA 4X6MA 4Q4LA 1Y5AT 2C4FH 1ANDA 3OTPA 5EW2H 1FNIA 4HI3A 2W3KA 4J2YB 2QF5A 4D76A 1XUJA 3VGCB 2Z7FE 1K9OE 3S7KB 1O5EH 1O3JA 3ZZ3A 4E7NA 3Q3YA 1EJAA 2Y7ZA 1A46H 1EFRD 2ZHEH 4NWKA 3GY2A 1V2LT 4XE4A 1CQQA 3MNCA 2GT8A 2IPHA 2BDAA 3ZZ7A 1CVWH 2BLWA 8LPRA 1P09A 1SGFA 4NIXA 4AFSA 1PPHE 2P8OC 3TGIE 3RP2A 3DA9B 3QTVH 3RXCA 3RMLH 3SJKA 1GBMA 1GHZA 2ODYB 2FMJA 1H9IE 1OX1A 2KZ4A 1C5SA 1QBVH 2WYGA 1PPZA 3O8RA 4TY7A 1KY9A 2H9TH 1FY5A 5FPSA 3N7DA 4F55A 4H6TA 3SNBA 1GBCA 4YLUA 4SGBE 3SU0A 1T31A 3UNQA 5A0CA 1S81A 2ZGCA 2STAE 1ZPZA 1ELCA 2QC2A 2ZCKP 3QX5H 1WSSH 4KTSA 3SZEA 3TIUA 1C2GA 3LONA 1B7XB 1T7CA 1WTGH 5A8YA 1LVOA 1EAXA 3KQEA 4DT4A 1EB1H 4ABIA 3V3MA 1TOCB 2A2QH 3ZZBA 1GI5A 1UTNA 2FDAA 1O2RA 3SU5A 5AHGH 5ESTE 2KCPA 4MQAA 2HPPH 1EAWA 1GI7B 1EX3A 3BTQE 5SGAE 3RU4E 3K65B 2BD9A 4FUJA 1EB2A 1O5AB 1SPJA 1BMLA 1MCVA 2CXVA 2A4RA 1FLEE 2QGRA 1JXPA 3OAAD 2BY5X 2F9PA 3P8FA 1TBRH 2EY4C 3W1EA 3LC5A 3ESTA 5AFZH 1AKSB 2ODQA 3S9CA 5JBTA 3KNXA 1V2RT 2O8WA 1K28D 1YLDA 4ZKSU 1LDTT 3ATWA 4ZHLU 3MH6A 1NESE 1XMNB 2AS9A 1C2JA 2DE9A 1C1WH 1AN1E 1C2KA 5GNDA 2BDIA 2VH6A 2VVVA 3RXJA 3F68H 4D7FA 1TRMA 2ZTZA 5BRRE 3OSYA 1UTPA 1C1MA 1A2CH 4Y7AA 1CT4E 2FOCA 1TNJA 4MPVA 1G3DA 2JJ2D 2IN2A 2KAIB 2OC0A 1RD3B 2OUAA 2WYJA 2XBVA 1GBHA 2RDLA 1TA2A 1C5VA 3I77A 1GG6B 1K21H 2G8TA 1D6RA 1GI2A 1QA7A 5IDKA 1BTUA 1PJPA 4HTCH 5EXMA 4JCNA 1TGTA 4Y8XA 1L0ZA 1E35B 2B5TB 2V3MA 5JYIA 4A1VA 2SGPE 1SGFG 5KGOA 4AFQA 1BZXE 3T25A 3UNRA 1OWIA 4I8GA 1AY6H 4IGDA 1ETSH 1J15A 2KFWA 4IC5A 3RXMA 1P05A 3PO1B 1MAYA 1C5UA 3A83A 2VB0A 2IOTA 1NU7B 4RSPA 3SJ8A 4OGXA 5C1UA 1GJ8B 1SGDE 5HIYA 5E0JA 1A4WH 1NC6A 2SGDE 2BD4A 5FBEA 2P16A 2Y5GA 1ETRH 1Z1IA 2BOHB 1TALA 3PRBA 5CDFE 5CHBA 5HGGA 2OP9A 1WDIA 1L2EA 2ZU4A 1UVOA 2HWLB 2ZQ2A 3OY5U 1CHGA 3EAJA 1H8IH 3PROA 2XBWA 3KQDA 1ELGA 1SGTA 4H6SB 4RN6A 1O5DH 1QJ7B 3GS9A 2BX3A 2KR7A 3GICB 2ZG0H 3TH3H 3ATMA 1K1LA 3DT0H 1ZYOA 1FONA 1O3PB 1FXYA 2C3SA 5E2PA 1DUAA 1HIAB 2Z9LA 4RKOB 4YOJA 1O34A 1QQUA 2VWLA 1NN6A 2ZFTA 3EDXB 2DUCA 4NSYA 4B75A 4NFFA 1V2QT 2F43B 3QDZB 4O97A 4BXSA 1EZQA 1O3BA 1RXPA 1RIWC 2BD8A 2NU3E 3AASA 3AW1A 1QTFA 3PV5A 4WMFA 4X2XA 4AB8A 4MNWA 3ZVDA 1KXDA 1JRSA 2BVSH 1TPSA 5FCKA 1MD7A 4NSVA 3E1XB 2PFEA 5CMXH 4KGAA 4Q63A 3OU0A 1P2OA 3QGJA 3QGNB 4NIYA 1F5LA 1C5WB 1UTJA 4AFUA 5FX6A 1FN8A 4B6FA 4ABHA 1NRPH 2TIOA 4ACBA 2F9UA 2A4QA 3ZVEA 1YF4A 1ZR0A 1WQSA 3SUEA 2P3UB 2XC4A 5DJ7A 2BQWB 1AB9B 4BTIB 1M9UA 2VWMA 3BEUA 2WHXA 1F0RA 1GVLA 2OINA 1MKWK 2GX4A 4Y8ZA 3M7TA 4DVAU 2VWOA 3GY6A 2IJOB 4IC6A 2FLRH 4O3TA 5HYOA 2ALVA 1FPCH 1A3EH 2XWAA 3FZZA 5A0BA 2VNTA 5GWZA 1RS0A 8GCHG 3N7EA 4UEHH 2W3IA 1WAYB 2A1DB 4I8JA 2WV9A 2HRVA 2XRCA 1A5HA 1O2ZA 3SUDA 1MH0A 2ZFFH 1ELFA 2R2WU 1O31A 5FXLA 1FN6A 3TITA 1O30A 2ZDAH 3K2UA 5C67A 3PO1C 2TRMA 2RG3A 4YO9A 1P2NA 4Y79A 1O2VA 3ZYEA 2GT7A 3FANA 2PTNA 2QE7D 2TGAA 1HB0B 2JETC 5E0HA 3K6YA 3H5CB 1KXAA 4K60A 4NG9H 3WWFA 1UTKA 2ZGHA 3I29A 3ZIAD 5DP9A 1O2WA 1MTSA 3D65E 3P6ZB 1NRSH 2HGTH 1CT2E 4FVBA 1O2PA 3LGYA 1SLXB 3WY8A 2V6NA 2CJIA 2QCYA 3E6PH 1GWAA 3RC6A 3UIRA 4A6LA 3MH7A 4DOQA 1JRTA 2PP6A 2XC0A 1HJAC 1O3LA 2XCNA 3SI4H 3TJNA 2C8WB 4Q80A 1C5OH 1HCGA 2Z9KA 2GVFA 3LH3A 1V2JT 4Q7XA 9ESTA 1V2VT 1NBME 2ZPQA 2WPKS 3HPTB 4TSFD 1O0DH 1HAYB 1YPGH 1Z8JB 3A8AA 2BY6X 2ZNKH 2R0KA 3T5FH 4NZLA 1FY1A 3VB5A 2PGBB 3QLPH 1COWD 3UOUA 2CN0H 2VIWA 3AAUA 3WWBA 3H09A 1BMNH 2RA3A 4DCDA 4K8BA 4AGKA 4WJG2 2F9OA 1YP9A 1WOFA 2OBQA 4K1EA 2AHME 1BBRK 2WINI 3V13A 2BTCE 1BUIA 2HLDD 3JZ2B 4A7IB 2HVXA 5F8ZA 3K9XB 1FY8E 4OS2A 4ZCNA 4ZKNU 4Y11E 3GY5A 1J14A 1ELEE 1P57B 3T29A 1UTOA 1P2QA 1HV7A 4BAHB 4BAOB 2XYAA 4MPUA 1TGSZ 1ZMNA 3S0NA 1YPHE 3LJJA 2WZQA 1C5ZB 1VR1H 3A7WA 3BEIB 4GAWA 1DFPA 3SI3H 3A8BA 1G2LA 3PTNA 1ARCA 1DM4B 4X1PU 3S7HB 1SVPA 1EZUC 1ELDE 4A5TS 4OS7A 2BXTH 2AYWA 2YMSC 1AB9C 1MKXK 4JZ1A 1C2MA 4ZXXH 2BLQA 1MKWH 1LPGB 1YBWA 1AFQB 1VGCB 2ILNA 2A5AA 4OS4A 1EOLA 1Z71A 2WPHS 1PQ7A 5EIYA 2UUFB 4GSOA 4R8TB 5FHTA 5DP7A 2EQNA 3F9FA 4ZAEA 1HFDA 4AC9A 1LHFH 1DWEH 1KMHB 2PKAB 2ZA5A 3HK3B 1O2OA 1MTVA 3ZVFA 3LGUA 2B0FA 4UFDH 4THNH 3VB3A 2G00A 1OHHD 4K5ZA 1NRNH 3GDVA 3OY6U 1IHSH 3TGKE 4FUCA 3UPEA 4WH6A 3A85A 2XC5A 1GDQA 3GY4A 1AI8H 2JJ1D 1SQRA 2AMDA 1W14U 3M37A 2GZ9A 4Y71A 5JDUB 8GCHF 3MO9A 3KHVA 2BMGB 1GBTA 3SN8A 2Y81A 4RT1A 1TMUH 4OM9A 3IITA 3DD2H 1IQFA 4B2AA 2UWOA 5LGOA 5FPTA 3WW7A 4X1SU 8KME2 4K69A 1FPHH 1DUEA 5EGMA 1Y8TA 1EAUA 1SGPE 1D9IA 3SNCA 5HKKD 1ZJKA 2ESTE 3VXFH 1INCA 2OC1A 2BY8X 3GDUA 3UQVA 2UUYA 2G51A 2QXJA 3UTUH 3F2GA 4BAQB 4JYTA 2P8OB 3FP7E 3B9FH 2Z94A 2ZDKA 1VITH 4I8HA 4TT3D 2ZU1A 5EPYA 4Z6AH 1YPHC 1AVWA 1SLUB 3KGPA 3U9AH 5C5NA 3SV6A 1FUJA 3A82A 4FU9A 1TPOA 3TPIZ 1RTFB 1LVMA 5EOKA 3GY7A 1GBAA 3U8OH 2ZFSA 3A81A 4ABBA 4CRGA 3RXUA 1T8MA 3UQOA 1TX7A 1S6HA 2KCAA 3IG6B 1HXFH 5ESBA 4FUDA 4HFPB 2F9VA 3QTOH 4X2VA 1EATA 5DPAA 4KTUA 2RFKC 5DP3A 1IQHA 4U32A 1MMJN 4JZEH 5C2ZA 1QB6A 3MFJA 1UK2A 5F8TA 3F1SB 3TGJE 5EU8A 1VJ9U 1KDQA 1GHBF 1MKXH 1U6QA 2XBYA 1QNJA 4UFFH 1TABE 3GYMA 3SQEE 3RDZA 1GJBB 1W10U 4WVPE 3LKWA 1DANH 4TYDA 1GHVH 3TNSA 4B2CA 4J1YA 5EXLA 3RLWH 3RXPA 4YM9A 1QRXA 3BG8A 3SU3A 1BA8B 1D6WA 3KIDU 5GJ4B 1ZSKA 3ZZ6A 4H4FA 4I32A 1TNKA 3M35A 2Q6DA 1V6DA 5GXPA 1UHBA 2Y80A 1YLCA 3QK1A 3ZZCA 3LGIA 1W8BH 1IQNA 1SL3A 1MBMA 4Z0KA 1C5NH 1RTKA 2FX4A 1AZZA 1NTPA 2PUXB 1UVTH 3QZRA 3UAIC 5E2OA 1FIWA
chains in the Genus database with same CATH topology
5HKKD 1N1LA 5F53A 4K8BA 5C0UA 4B74A 2OC1A 3LOXA 2F9UA 1RTLA 2A4QA 4A1VA 5B6LA 3F0PA 2OBQA 1NBMD 3EYDA 3F2GA 1CU1A 3P8OA 3OE7D 4JMYA 2AHME 2OK5A 3UB0A 2YOLA 3SUEA 2V7QD 2HLDD 1BMFD 1E79D 3SUFA 3SU4A 2FOMB 4ZCNA 2GGVB 2WHXA 4TT3D 2KZ4A 5ETXA 2OINA 2QV1A 2KCOA 2W6ID 4I33A 2F4LA 3PV2A 2KFWA 5EPYA 3O8RA 5C0TA 3M5MA 3KF2A 5EPNA 2IJOB 5FPSA 4ASUD 4B71A 3SV6A 2WSSD 4WF8A 3N7DA 5H4IB 4F55A 2WZQA 5EQQA 1BT7A 3SU0A 3N7EA 3U1JB 3SU6A 3VG8A 3DSPA 5FL7D 3SZEA 3F0OA 2WV9A 2K8IA 3LONA 4WH8A 4I31A 3PRBA 2YMSD 2YMSC 5CDFE 5CHBA 4DT4A 2OC8A 3SUDA 1H8HD 2XCFA 4YXWD 4A1XA 1DY8A 2YMSB 2KCAA 2K1QA 3FO8D 3SU2A 4XD7D 5ESBA 4B76A 1W3CA 1E1QD 3NRLA 2XOKD 3SU5A 4U01A 2KCPA 2F9VA 3U1IB 3OEHD 2OBOA 3OYPA 4KTCA 4B6EA 2QF4A 3SYJA 3GS9A 2KR7A 2QE7D 4FETA 4Z1MD 4R8TB 3L6PA 4B73A 5C17A 2A4RA 1H8ED 3FOAA 1JXPA 2K0QA 3WWFA 3OAAD 3ZIAD 2LELA 2KCYA 3W1EA 1W0KD 3SUGA 2IJD1 3RC4A 1KMHB 3F2HA 3KNXA 3N99A 4RI0A 3M5NA 5EQSA 1NS3A 3E90B 5EQRA 3M5LA 1OHHD 3PRDA 3O8CA 3LKWA 2M2AA 2XNIA 3F2FA 1DXPA 4TYDA 2W6JD 4B75A 3RC6A 2L6OA 1DY9A 2F43B 3M5OA 3P8NA 5GNDA 1FX0B 4WH6A 2JIZD 1W0JD 5DN6D 3OEED 4Q4LA 2XCNA 2WPDD 3AK5A 3RC5A 2FP7B 1E1RD 2JJ1D 3KN2A 3SU3A 3FN8A 5GJ4B 5GPIB 3OTPA 3FKSD 2GVFA 3O8DA 1SKYE 3PV5A 3DSOA 4I32A 1WXRA 2J5UA 2QF5A 2CK3D 1A1RA 2JJ2D 3SU1A 1RGQA 2OC0A 1MABB 1NBME 1S6LA 3SV7A 1DXWA 2P59A 4TSFD 3SV9A 5DSFA 2XNDD 4M9FA 3F3BA 3OFND 4OM9A 2OC7A 2KM0A 3O8BA 5FPYA 2O8MA 1EFRD 2FM2A 4NWKA 3KEEA 5IDKA 3DCLA 4Q63A 5T1VA 1COWD 5FPTA 4NWLA 2A4GA 3WW7A 4A1TA 2VBCA 4A92A 3WWBA 3H09A 4B6FA 3SV8A 2JDID 5IK2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7E A;  2KM0 A;  3N7D A;  2K0Q A;  3DSO A;  2LEL A;  3DSP A; 
#chains in the Genus database with same CATH topology
 2VVU A;  3MH4 A;  1NRR H;  3MYW A;  3ELA H;  1JOU B;  2OQU A;  1B5G H;  1Y5U T;  1GDN A;  2ZFQ H;  3ODF A;  4WXI A;  5JPM H;  1GI0 A;  2ZEC A;  1OP8 A;  2WPJ S;  3EYD A;  3P8O A;  2OK5 A;  3UB0 A;  4UE7 H;  1CA0 C;  4ABJ A;  1EZS C;  3U69 H;  1UTQ A;  4IN2 A;  1Y3X A;  1PYT C;  2M5T A;  1KTS B;  1S85 A;  3Q3K A;  1QIX B;  1THS H;  3MH5 A;  4ACA A;  3TJU A;  1P03 A;  3LT3 A;  2G4T A;  4WF8 A;  1A0L A;  1LHC H;  1GBF A;  1EJN A;  4AYY B;  4DII H;  4DJZ B;  1O3G A;  4ISN A;  1K0H A;  1P2J A;  1UK3 A;  2ZU2 A;  1NFU A;  2Y82 A;  4XRN A;  1O3K A;  2BDY A;  1IQJ A;  4ZKR U;  1ZLR A;  2ZHW H;  3BTE E;  1GBK A;  2YNA A;  1BTY A;  1AD8 H;  4YT6 H;  3U28 C;  4Y6D A;  3RXE A;  4ABF A;  3DFL A;  1UO6 A;  1ARB A;  2XW9 A;  3M3S A;  3U1I B;  1C2L A;  1AUJ A;  1DWB H;  2SGF E;  3R0F A;  2XWB I;  4FET A;  1V2W T;  4LXB H;  1GBJ A;  1QR3 E;  5AFY H;  1O5G H;  1TMB H;  2A45 B;  2WUC A;  2A31 A;  4GHQ A;  1GI8 B;  4AB9 A;  1AE5 A;  2ZTX A;  1D4P B;  3RC4 A;  3F2H A;  1CGJ E;  4U30 A;  5KED A;  1T4U H;  2B7D H;  1BRA A;  1C5Y B;  5A8Z A;  1PPE E;  3O8C A;  3MNS A;  4I7Y H;  1VCP A;  3AVZ A;  1BRB E;  1XUI A;  3STI A;  2BM2 A;  1O39 A;  3SW2 B;  1NZQ H;  2WPD D;  3AK5 A;  3KN2 A;  3GCH B;  1RIW B;  1A5I A;  3RMN H;  3URC A;  3SND A;  1RGQ A;  1QJ6 B;  1GMD G;  1LKB A;  1Y3W A;  1RFN A;  2YNB A;  1N6X A;  2P59 A;  1OYT H;  5DSF A;  4M9F A;  1O2Y A;  4D8N A;  2FYR A;  1A0H B;  1BOQ A;  1C2E A;  2Y5H A;  1C1R A;  3GY3 A;  1XVM A;  1B0F A;  3STJ A;  1S83 A;  2J2U A;  1L1J A;  1O3A A;  4LOY H;  1ANE A;  2GCT B;  3UR9 A;  2JDI D;  3LPR A;  5IK2 D;  1ANC A;  2F3C E;  4JYU H;  2HNT F;  3FP8 E;  4E7R G;  1ZOM A;  4MPX A;  1ZTJ A;  1H9H E;  1BMF D;  1C1O A;  2SNV A;  1QQ4 A;  2WPI S;  3P95 A;  1SC8 U;  2KCO A;  4I33 A;  1SGQ E;  3T27 A;  2VGC C;  3RXO A;  1MU8 B;  1K2I 1;  3LH1 A;  1G3B A;  5C94 A;  5DGJ A;  3PWC A;  1UVU H;  4ASU D;  1O3E A;  1KSN A;  1MTU A;  1VIT G;  1XVO A;  2WSS D;  1O36 A;  1GI6 A;  2O8U A;  2Z9J A;  3VB7 A;  1AGJ A;  1AVX A;  1MBQ A;  1G32 B;  2FOH A;  5T6F A;  2TGD A;  1GJ9 B;  3LIW A;  4CHA C;  1Y3U A;  4TPI Z;  3UWI A;  4OS6 A;  4CBO A;  1W3C A;  2PKS B;  2FOE A;  3EA9 A;  2QYI A;  1OP2 A;  2P3T B;  3B23 B;  1FQ3 A;  1DIC A;  4I8K A;  2ZTY A;  4X8S H;  4IN1 A;  1P12 E;  5I25 A;  1Z8I B;  3TK6 A;  3L6P A;  1P2K A;  1OS8 A;  2A4O A;  1C4V 2;  4X2Y A;  4WME A;  2FI3 E;  1EZX C;  2JET B;  2WV5 A;  3RUO A;  2ZU5 A;  5HIZ A;  1TQ0 B;  3A88 A;  1P0S H;  3FP6 E;  1GI4 A;  4ISL A;  1D3P B;  1T8O A;  4BOH A;  1DE7 H;  3TLO A;  1B0E A;  2THF B;  1V2M T;  1ZML A;  2ZGX H;  3RXI A;  1HXE H;  3QUM P;  2W6J D;  3A80 A;  4ABG A;  2WPM S;  1TRN A;  4FU7 A;  3P8N A;  1Y3V A;  5CHA B;  2GP9 B;  1BTZ A;  4ISH H;  2ZKS A;  4AFZ A;  5JBA S;  1E1R D;  3ODD A;  1HJA B;  6GCH F;  3O8D A;  1WXR A;  1PPC E;  1LQD B;  1GBI A;  1EUF A;  2C93 B;  2L74 A;  3LU9 B;  3ENS B;  4CRD A;  4AOR A;  1UJ1 A;  1OWD A;  2W7S A;  4MNV A;  3ZZD A;  3O8B A;  1BJV A;  1BQY A;  2A5I A;  4NIW A;  2A32 A;  1MQ5 A;  5FAH A;  1SGC A;  1JWT A;  1O3F A;  2A4G A;  3A7V A;  4YLQ H;  4A1T A;  5F03 A;  2R3Y A;  1O2N A;  2ZQ1 A;  1HJ9 A;  3DFJ A;  4X8T H;  5BPE A;  3GCH C;  1WCZ A;  4DY7 B;  1HLT H;  3MU5 A;  1O37 A;  5F53 A;  1EAI A;  3ZZ8 A;  2OXS A;  1VCW A;  1LHG H;  3E0P B;  4K2Y A;  3RU4 T;  3PLK A;  3TJO A;  3NWU A;  1AIX H;  1OWE A;  1F5R A;  1OPH B;  3ZV8 A;  5ETX A;  3UOP A;  4INH A;  4NCY A;  1C5M D;  1EPT A;  2F83 A;  3DSG A;  1HAV A;  3FZD A;  3KF2 A;  2GCT C;  5EPN A;  3ZVG A;  5DP8 A;  3ZVB A;  1CGI E;  4NA9 H;  3UNS A;  3UR6 A;  3RXB A;  1HAO H;  3MQK C;  3SV2 H;  4ZRO A;  4UD9 H;  1T8N A;  4CRA A;  2V35 A;  4XBD A;  5FBI A;  2JH6 D;  1YC0 A;  1TGB A;  3PYH A;  1CA8 B;  1HRT H;  1OYQ A;  1TGC A;  1K1N A;  4X2W A;  2GTB A;  4YXW D;  2YMS B;  1GMD F;  2FOF A;  2OQ5 A;  1D3T B;  1FY4 A;  3RXS A;  3RU4 D;  1O5F H;  2BLO A;  1Q2W A;  2FX6 A;  3BTK E;  1ELB A;  3HKI B;  2TGT A;  1DSU A;  1AZ8 A;  1EPT C;  1O2T A;  1LO6 A;  1YCP K;  4XOJ A;  4F4O C;  1GJA B;  1MZD A;  2CMY A;  4YT7 H;  5AF9 H;  5DK1 A;  1HUT H;  3VB6 A;  2LPR A;  1BMM H;  3N99 A;  4INK A;  2P93 A;  2Y7X A;  3NXP A;  2PKS C;  3H7T A;  4AN7 A;  2H6M A;  2BVR H;  6CHA C;  2G5V A;  3M36 A;  5GIB A;  4UFE H;  1GVZ A;  4TY6 A;  5JBB S;  5T6D A;  2G4U A;  3C27 B;  1NU9 A;  2ANK H;  1NFW A;  1VIT F;  1V2K T;  1ZGI A;  4FUE A;  1SGE E;  1C1V H;  3PMB B;  3F9G A;  3SGQ E;  1O2K A;  1QGF A;  1O2I A;  1KLT A;  3HGP A;  1SSX A;  2SNW A;  3ZZ4 A;  2ZGB H;  1QRW A;  3PLP A;  1NRQ H;  4Q2K A;  2EA3 A;  3UUZ A;  1V3X A;  1KYN A;  1P10 A;  1L4D A;  1S0Q A;  4NA7 A;  2V3H H;  1HDT H;  2EI8 A;  2BD7 A;  2BDB A;  5CHA C;  1TNH A;  3RM2 H;  3A8C A;  2Q6F A;  2D26 C;  3PB1 E;  2UWP A;  3QZQ A;  3GCT G;  2BB4 A;  2HNT E;  1SI5 H;  2A5K A;  3I78 A;  3T28 A;  3K6Z A;  1XUK A;  2I6Q A;  3URD A;  3SUF A;  3E8L A;  1CT0 E;  4DW2 U;  1SR5 C;  1TPA E;  4MG3 A;  4OS1 A;  6LPR A;  3PV2 A;  2AMP A;  1BTX A;  4P02 A;  3HKJ B;  1YLN A;  3MOC A;  1GL1 A;  4PRO A;  1AHT H;  1P9S A;  2HAL A;  2I6S A;  1BB0 B;  1IOE A;  1YPM H;  2OD3 B;  1GGD C;  2BZ6 H;  1GHB G;  2J9N A;  2ZI2 H;  1P9U A;  2G5N A;  1C2H A;  4MPW A;  1WQV H;  3A8D A;  3EQ0 H;  3AAV A;  2EI6 A;  1ZJD A;  3M7U A;  1CSO E;  2J97 A;  2CF9 H;  3EE0 B;  4U01 A;  1PQ8 A;  1AFE H;  4XDE A;  5DP5 A;  4ZHA A;  1UVP A;  1CGH A;  4NFE A;  3SGA E;  2XTT B;  3SJ9 A;  5DP6 A;  1Q3X A;  2FES H;  9LPR A;  1FZZ A;  2ZHD A;  3KL6 A;  3GDS A;  2CF8 H;  4UFG H;  1GDU A;  1HAG E;  3MU8 A;  3Q77 A;  1THP B;  4CR9 A;  1SFI A;  2WPL S;  2P95 A;  3VFE A;  2J98 A;  2C8Y B;  3BTD E;  2P94 A;  4X8V H;  4X1Q U;  4O3U A;  3NPS A;  2TGP Z;  5EQR A;  4X1R U;  3PRD A;  4X0W U;  1TLD A;  2QF0 A;  2M2A A;  3GYL B;  1FAK H;  2SGQ E;  1EST A;  3BV9 B;  3AW0 A;  3S9A A;  1ZZZ A;  2FI5 E;  4D9Q A;  5GPI B;  3SJO A;  2VID A;  1SKY E;  1SGY E;  5C20 A;  2CK3 D;  2PUQ H;  7LPR A;  2HOB A;  2VIO A;  4XFQ A;  1MAB B;  1S84 A;  2VIQ A;  4CBN A;  1UW7 A;  3BG4 C;  4GCH G;  3TNT A;  3BTM E;  1K1I A;  4WWY A;  5FPY A;  1T8L A;  4EST E;  1W7X H;  1IQM A;  2EEK A;  1KDQ B;  1NRO H;  1HAX B;  1HJ8 A;  1F92 A;  1LKA A;  3EA7 A;  3MO3 A;  4MVN A;  2STB E;  1ZHR A;  2F9N A;  1ELT A;  2HNT C;  1ZSJ A;  2ZPR A;  3LOX A;  1GL0 E;  1MTN C;  1RTL A;  1GHX H;  5B6L A;  3F0P A;  4JMY A;  3OE7 D;  2GV6 A;  3D49 H;  1TQ7 B;  2A7H A;  2IPQ X;  1O3D A;  2FOM B;  2TPI Z;  4FUI A;  1CA0 B;  2ZF0 H;  4XSK U;  2ZU3 A;  1OKX A;  2QV1 A;  1UHB B;  5C0T A;  2JH5 D;  1EJM A;  5H4I B;  2FXR A;  2AIQ A;  2HPQ H;  2J92 A;  3F9E A;  1TMT H;  2R0L A;  3CS7 A;  2ALP A;  1S5S A;  1QUR H;  1ELV A;  2F9B H;  1SHY A;  2BDC A;  1GPZ A;  4ISO A;  1ZGV A;  3SU6 A;  3PLB A;  5HM2 A;  3GCO A;  2A0Q B;  4D7G A;  3DSP A;  2K8I A;  1BHX B;  1DWD H;  3E0N B;  2YMS D;  2J94 A;  1W0Z U;  2OC8 A;  4ZXY H;  1H8H D;  4Y76 A;  1O3N A;  1OWK A;  2Z6B D;  1G3E A;  1ZTL A;  1EQ9 A;  4XD7 D;  1LTO A;  2O9Q A;  1TNL A;  1O3C A;  1E1Q D;  3S9B A;  3NRL A;  2QA9 E;  3D23 A;  1G30 B;  3OYP A;  1TE0 A;  4ZMA H;  2ZP0 H;  5A09 A;  2QF4 A;  2QXI A;  3SNA A;  3S69 A;  4IW4 E;  2BDG A;  4KEL A;  4K1T A;  4NA8 A;  4JK6 A;  1GJC B;  1TPP A;  2RA0 A;  1Q31 A;  2K0Q A;  3MNX A;  1W0K D;  1Z8R A;  1QB1 A;  1HAI H;  3GCT F;  1MZA A;  1KXF A;  1BBR H;  4LZ4 B;  1SOZ A;  4AX9 H;  2OTV A;  2D8W A;  3RLY H;  2D2D A;  2ZGJ A;  1ZPB A;  5FCR A;  1BCU H;  5IYT A;  2AGG X;  1DS2 E;  5DN6 D;  1KTT B;  1OWH A;  2QY0 B;  1EXF A;  1N6Y A;  2ZDM A;  4X6P A;  3FN8 A;  5DP4 A;  4FXG H;  1AMH A;  2C90 B;  3QN7 A;  2BVX H;  1UK4 A;  1SMF E;  3BTH E;  1S6L A;  3U8T H;  3A84 A;  3UFA A;  1AE8 H;  1GJ4 H;  1QA0 A;  1TOM H;  1YPL H;  4X8U H;  5F6M A;  2R9P A;  2O8M A;  3EA8 A;  3L33 A;  4LK4 A;  4F48 B;  3DCL A;  1ZRB A;  5GDS H;  1GI1 A;  2BYA X;  2F91 A;  4MDS A;  2ZFR H;  4CRF A;  1EOJ A;  1IQK A;  1BBR E;  4MNY A;  3KCG H;  5GCH G;  3CP7 A;  4FUB A;  2VU8 E;  4BTU B;  1O2Q A;  1SQO A;  1RJX B;  2BDH A;  2JKH A;  5EOD A;  4M7G A;  2ZWL H;  1DWC H;  1PPF E;  1JIR A;  1IHT H;  2Y6T A;  3TK5 A;  1P2I A;  2BZA A;  1X7A C;  8EST E;  1XM1 A;  2NU0 E;  3SJI A;  4Q7Y A;  3KQC A;  2GGV B;  2ZHQ H;  4NIV A;  3LGW A;  2NU2 E;  3ATK A;  1LVB A;  3M5M A;  3P8G A;  1O33 A;  3ZVA A;  2VGC B;  1TYN A;  3RXL A;  3G01 A;  1GHW H;  3NUM A;  4K8Y A;  1TX6 A;  4NZQ A;  3M7Q A;  2CGA A;  3NK8 A;  4H42 U;  4BAN B;  1OSS A;  3MMG A;  1C1P A;  3SNE A;  3EE7 A;  1LCY A;  1ZHM A;  3A7Y A;  4YOG A;  1W7G H;  4DT7 B;  3ZZ5 A;  4I31 A;  3JZ1 B;  1C5X B;  4DUR A;  1SQT A;  1TA6 A;  4BNR A;  1O2J A;  4O9V A;  1SBW A;  4BTT B;  1C5P A;  4CHA B;  3FO8 D;  1NT1 A;  4GCH F;  3A87 A;  1HNE E;  1SHH B;  4X1N U;  1OWJ A;  5C1X A;  2TBS A;  2BQ6 B;  1SLW B;  5LPR A;  3LJO A;  3BTT E;  6GCH G;  1UTM A;  1GCD A;  1GJ5 H;  1QZ8 A;  2BQ7 B;  2EI7 A;  1AWH B;  4Y0Y E;  2LEL A;  1ABJ H;  1SFQ B;  3SUG A;  5DG6 A;  1NY2 2;  2H9E H;  1DST A;  2G52 A;  3E90 B;  1KXC A;  4GVU A;  1XUH A;  5EJ1 A;  1DDJ A;  1O3O A;  4P00 A;  1S6F A;  2XNI A;  1C5R A;  1D3Q B;  3VPK A;  2AMQ A;  3W94 A;  5A2M H;  1PPB H;  2FIR H;  2JIZ D;  1FI8 A;  2ULL A;  1W2K H;  2FOB A;  1AUT C;  1SG8 B;  2UWL A;  1DPO A;  1Z6J H;  3CNR A;  3RMO H;  1P2M A;  4RT0 A;  1V2P T;  3DSO A;  3GOV B;  3L3T A;  1QRZ A;  2HLC A;  1IQG A;  1G3C A;  1LHD H;  1YPJ H;  4ISI H;  3SV7 A;  1GCT B;  4VGC C;  4FU8 A;  1DLK B;  1GMC G;  5EW1 H;  2KM0 A;  1TBZ H;  3M3V A;  1OXG A;  1C1T A;  1MTW A;  2SFA A;  1ANB A;  1CBW B;  4NWL A;  4IS5 A;  2FTL E;  4AG1 A;  2AER H;  2B8O H;  3TJV A;  5T6G A;  3PWB A;  3E3T A;  1K1M A;  1LPK B;  1N1L A;  3RXF A;  1O3M A;  2AGE X;  2J34 A;  3RM0 H;  3QWC H;  1HAP H;  1QHR B;  1PYT D;  2VJ1 A;  1C2I A;  2OLG A;  5DO4 H;  1BDA A;  1FV9 A;  1EP6 A;  3BTW E;  2F4L A;  1HAZ B;  1JIM A;  5HXF A;  7GCH G;  1FMG A;  3P70 B;  4U2W A;  4XBB A;  5EQQ A;  5CE1 A;  4CH8 B;  1A7S A;  1XUG A;  5K0H A;  2PV9 B;  3U1J B;  5HM9 A;  2PHB A;  1EAS A;  1IQI A;  1K1J A;  1J8A A;  4LZ1 H;  1ABI H;  2XCF A;  1ID5 H;  4B2B A;  2ANY A;  1F0S A;  3Q00 A;  1BMA A;  3H7O A;  4B76 A;  2ZC9 H;  1W0Y H;  2D1J A;  3N7O A;  3SV8 A;  3PMH B;  3OEH D;  3SOR A;  1QB9 A;  5PTP A;  3SYJ A;  3GIS B;  3BTF E;  1E38 B;  3SBK A;  2GDD A;  4JK5 A;  4YOI A;  2FYQ A;  3RXD A;  5C17 A;  5E0G A;  2C8X B;  3T26 A;  2ZFP H;  5GCH F;  3RXA A;  1EPT B;  4FVD A;  5JB8 S;  1HAV B;  1F0U A;  3LGT A;  1UCY K;  1V2U T;  2W26 A;  1H8D H;  2Y5F A;  3CS0 A;  4RI0 A;  1NS3 A;  4ASH A;  5A8X A;  2ZHF H;  3M5L A;  2GMT C;  1ZPC A;  2V0B A;  2VIN A;  3ZZ9 A;  3BSQ A;  1CHO G;  4GLY A;  1F7Z A;  2BY7 X;  4MNX A;  3MI4 A;  5AVD A;  1AWF H;  5C5O A;  3RXQ A;  1J9C H;  2GJG A;  1P06 A;  4K1S A;  1O35 A;  1DY9 A;  3E16 B;  1H4W A;  3A7Z A;  3M5O A;  4YZU A;  6CHA B;  1SOT A;  4I8L A;  1ZHP A;  3OEE D;  1V2S T;  3LC3 A;  2RCE A;  1GI3 A;  2FP7 B;  2QIQ A;  4R0I A;  3RXG A;  5TJX A;  3VGC C;  3FAO A;  2J5U A;  4HZH A;  5B6O A;  2Z3C A;  4DIH H;  2Q6G A;  3F6U H;  2VIP A;  1BIT A;  2GZ7 A;  1QL7 A;  1HBT H;  3SHA H;  2FO9 A;  1TBQ H;  3F3B A;  3ZZA A;  1O3H A;  2SGE E;  1Y5B T;  2H1U A;  1AO5 A;  2QF3 A;  3HK6 B;  1F2S E;  2J95 A;  1P3E A;  2BX4 A;  2W7U A;  3SZN A;  4DG4 A;  2VH0 A;  3FVF B;  1AVG H;  2VIV A;  4OS5 A;  2HVY B;  2GKV E;  5C0U A;  4AZ2 B;  1BTP A;  1FAX A;  1L4Z A;  3NZI A;  4GHT A;  1ESA A;  1GCT C;  3ZV9 A;  4BAK B;  1E34 B;  2YOL A;  3BIU H;  4BXW A;  4CRC A;  1IQL A;  1E36 B;  1E79 D;  3SU4 A;  4X6O A;  1D3D B;  1TFX A;  4ZKO U;  1N8O B;  1JBU H;  5C3N A;  3T62 A;  1GBL A;  1CBW C;  2QN5 T;  1YKT A;  3C1K A;  1A5G H;  1Z1J A;  4X6N A;  5J4S A;  1YCP M;  3KQ5 A;  4B71 A;  4DGJ A;  2CV3 A;  5C1Y A;  1AKS A;  4TWW A;  5KEC A;  1E37 B;  2BY9 X;  2PSX A;  1T4V H;  2CHA B;  2EC9 H;  4D9R A;  5G4B A;  4JZI A;  4HG6 A;  1WBG B;  1O2L A;  1GGD B;  3DUX H;  2JH0 D;  3MHW U;  4A1X A;  1NO9 H;  3SU2 A;  1ETT H;  1TIO A;  1GMC F;  1P3C A;  1KLI H;  1TB6 H;  3P92 A;  4KTC A;  1NFY A;  1SGI B;  3A86 A;  4B6E A;  2PR3 A;  2KAI A;  4ABA A;  1Z6E A;  1ESB A;  3EGK H;  4B73 A;  3LDX H;  4WY3 A;  1O2S A;  1K22 H;  1PFX C;  2VVC A;  1LHE H;  1GHA G;  2IJD 1;  2PGQ B;  1TGN A;  3RXH A;  3SGB E;  5E8E H;  1LPZ B;  3M5N A;  4Y0Z E;  4IMZ A;  2FOD A;  1GBE A;  4FUH A;  3TVJ B;  4BAM B;  2ZDL A;  3OTJ E;  1LVY A;  3F2F A;  2J38 A;  1O2X A;  3VB4 A;  2H2Z A;  5HMA A;  1G36 A;  1P02 A;  1C1Q A;  1S0R A;  2FWW A;  2R2M B;  4AG2 A;  4Y7B A;  2AEI H;  1GMH G;  7GCH F;  2ZDV H;  4OGY A;  1FDP A;  4Y8Y A;  1UCY H;  1A1R A;  3MU4 A;  1QBN A;  1ZSL A;  1DX5 M;  4CR5 A;  1BHX F;  4AGJ A;  3UWJ H;  1GG6 C;  3PMA B;  1C5Q A;  2XND D;  3KYF A;  1DT2 A;  3BG4 B;  2OC7 A;  2J98 B;  1YGC H;  2R3U A;  3RMM H;  2AIP A;  2FM2 A;  4HGC A;  1G37 A;  3ITI A;  4XBC A;  2Z9G A;  5T1V A;  4B1T A;  1FIZ A;  1QL8 A;  1V2T T;  3BTG E;  1MD8 A;  4TPY A;  3PM3 A;  4FUF A;  3F9H A;  2G81 E;  3V7T A;  1QCP A;  2P3F H;  3T2N A;  5I46 H;  1O2H A;  2FLB H;  2FOG A;  1K1P A;  1BTH H;  1UMA H;  1MTN B;  3KQB A;  5JB9 S;  4TWY A;  1GHY H;  1BIO A;  2BD2 A;  4Q7Z A;  1W13 U;  2A7J A;  3BF6 H;  5TCC A;  1UCY E;  1A3B H;  1YWU A;  1ZRK A;  1CHO F;  1O32 A;  3SOS A;  1W11 U;  3RXR A;  1MCT A;  3FFG A;  1BRU P;  3HAT H;  1C5T A;  2ASU B;  1HIA A;  2PSY A;  4FOU C;  4SGA E;  2GCH G;  3M3T A;  5L6N H;  2ANM H;  3MTY A;  1GVK B;  4MTB A;  4INL A;  3E91 A;  2DE8 A;  2UUK B;  3RXK A;  3VG8 A;  5FL7 D;  1W12 U;  1QL9 A;  4WH8 A;  1OOK B;  1J16 A;  1K1O A;  1ELA A;  4ABE A;  1N8O C;  1QFK H;  1UVS H;  2LNC A;  3UY9 A;  1O5B B;  2B9L A;  3NKK A;  3A7T A;  1IQE A;  1SGR E;  1YYY 1;  5LPF A;  2GV7 A;  3P17 H;  2KX4 A;  3HGN A;  2FZZ A;  2H5C A;  2OBO A;  4MLF B;  4RKJ B;  2CHA C;  5T3H A;  3NCL A;  5L2Z H;  2NWN A;  7EST E;  3PV4 A;  3A89 A;  1G9I E;  1A0J A;  5EJZ A;  3D62 A;  2Z3D A;  1O5C B;  4FUG A;  1XUF A;  2ZO3 H;  1DIT H;  1NM6 A;  2ZZU H;  3W95 A;  2Q1J A;  1AQ7 A;  2L6O A;  3RXV A;  1C2F A;  1GI9 B;  2W5E A;  1PPG E;  1FY3 A;  4JZF H;  3RC5 A;  1EP5 A;  3MU0 A;  1GJ7 B;  3U98 H;  2OCV B;  1P04 A;  1VCQ A;  1O2G H;  2ZPS A;  2A7C A;  4IMQ A;  4WXV A;  2PW8 H;  1ORF A;  2WUB A;  3SO3 A;  3SU1 A;  1TNI A;  5FX5 A;  1NPM A;  3SV9 A;  3A7X A;  3OFN D;  1MQ6 A;  1WYK A;  3B8J A;  1TON A;  2LP6 A;  1MAX A;  2ZCL P;  4YES B;  2H9H A;  4A92 A;  3U8R H;  3TH4 H;  4AYV B;  1P01 A;  4ZHM U;  4E05 H;  2AH4 X;  3URE A;  1S82 A;  2ANW A;  1YCP H;  3V12 A;  1JMO H;  1KXB A;  2AFQ B;  1XKA C;  1YM0 A;  2V7Q D;  4CH2 B;  5LPE A;  1J17 T;  2NU4 E;  1O38 A;  1GHA F;  3Q3X A;  1C1U H;  4KP0 A;  3RXT A;  1BJU A;  1VZQ H;  4ZH8 A;  3SQH E;  4UON A;  2XBX A;  3MU1 A;  1HYL A;  1QJ1 B;  1Z8G A;  3ZVC A;  1C2D A;  4NGA H;  3DHK H;  1H9L B;  2BHG A;  3TK9 A;  5EXN A;  1AU8 A;  1VJA U;  2G55 A;  2XXL A;  1GMH F;  2V3O H;  3PTB A;  1A61 H;  1T32 A;  4UDW H;  2A2X H;  1GJD B;  3QO6 A;  4ZUH A;  1QY6 A;  1PQA A;  4K3J A;  2XOK D;  1XXD A;  2H5D A;  2PLX A;  2Z9I A;  2QXH A;  3BIV H;  3LGV A;  4CRE A;  5K7R A;  1C4Y 2;  4Z1M D;  2FEQ H;  2ZCH P;  3TU7 H;  1H8E D;  1TNG A;  3FOA A;  1CE5 A;  2BLV A;  1C5L H;  1C1N A;  2BD3 A;  5TCA A;  5EQS A;  1ZTK A;  1F5K U;  3MWI U;  1VKY A;  2NU1 E;  6EST A;  1P11 E;  2BD5 A;  1C1S A;  2C8Z B;  1GBD A;  4JYV H;  1E0F D;  3ATL A;  3VEQ B;  1FX0 B;  4CRB A;  3VXE H;  5ABW A;  1G2M A;  3FKS D;  1FJS A;  2GCH F;  1XX9 A;  1DVA H;  1KIG H;  1C9T A;  1O2U A;  5L2Y H;  1V2N T;  1O2M A;  1PQ5 A;  4I86 A;  1C9P A;  2J4I A;  2ZDN A;  3ATI A;  2SGA A;  1WU1 A;  1DXW A;  3M61 U;  5EJL A;  1L1G A;  1YY3 A;  4VGC B;  1YPK H;  1DLE A;  3PMJ A;  3OX7 U;  4AOQ A;  1GBB A;  1Z7K A;  3CEN A;  5L30 H;  2VWN A;  3KEE A;  1OP0 A;  5EG4 A;  5J4Q A;  1HGT H;  2BXU H;  2ZEB A;  1CO7 E;  4GUX A;  2VBC A;  5F8X A;  4ABD A;  1WUN H;  5JBC S;  1P8V C;  2FS8 A;  2BOK A;  3BN9 A;  4B74 A;  1LMW B;  3TH2 H;  4Y10 E;  4F49 A;  1LQE A;  1TWX B;  1NBM D;  2PWX A;  1CU1 A;  5A0A E;  1QBO A;  1V2O T;  4JZD H;  7KME H;  1KLJ H;  3V0X A;  1H1B A;  2W6I D;  4KKD A;  1ZMJ A;  1SQA A;  1Y59 T;  1TAW A;  2FOA A;  1XKB C;  1GJ6 A;  1ACB E;  2FPZ A;  2PKA A;  1BT7 A;  1MUE B;  3GCN A;  1HAH H;  1UTL M;  2GZ8 A;  3Q76 A;  1SGN E;  3F0O A;  3ZYD A;  3MO6 A;  1F0T A;  3KYG A;  1KXE A;  1DY8 A;  1EKB B;  1O3I A;  3IWM A;  2K1Q A;  1THR H;  1AFQ C;  1VGC C;  1BRC E;  2O8L A;  2GD4 B;  4YTA A;  2GDE H;  1IAU A;  2Z3E A;  5LH8 A;  2QAA A;  3MNB A;  2FI4 E;  2AGI X;  1SLV B;  2FTM A;  2ZIQ H;  3SHC H;  3BEF B;  5DKM A;  3R3G B;  2ODP A;  1HPG A;  4E06 H;  2KCY A;  4QT8 C;  2WV4 A;  1NFX A;  1C4U 2;  2PTC E;  1WTH D;  4IBL H;  1WV7 H;  4O03 A;  1TRY A;  4WMD A;  1XXF A;  2RDE A;  1YPE H;  1Y3Y A;  1TX8 A;  1DXP A;  2GMT B;  1RRK A;  2FS9 A;  4GPG A;  1MU6 B;  1SB1 H;  1L1N A;  1DOJ A;  1BTW A;  2O8T A;  2UUJ B;  1W0J D;  3GY8 A;  2QXG A;  4X6M A;  4Q4L A;  1Y5A T;  2C4F H;  1AND A;  3OTP A;  5EW2 H;  1FNI A;  4HI3 A;  2W3K A;  4J2Y B;  2QF5 A;  4D76 A;  1XUJ A;  3VGC B;  2Z7F E;  1K9O E;  3S7K B;  1O5E H;  1O3J A;  3ZZ3 A;  4E7N A;  3Q3Y A;  1EJA A;  2Y7Z A;  1A46 H;  1EFR D;  2ZHE H;  4NWK A;  3GY2 A;  1V2L T;  4XE4 A;  1CQQ A;  3MNC A;  2GT8 A;  2IPH A;  2BDA A;  3ZZ7 A;  1CVW H;  2BLW A;  8LPR A;  1P09 A;  1SGF A;  4NIX A;  4AFS A;  1PPH E;  2P8O C;  3TGI E;  3RP2 A;  3DA9 B;  3QTV H;  3RXC A;  3RML H;  3SJK A;  1GBM A;  1GHZ A;  2ODY B;  2FMJ A;  1H9I E;  1OX1 A;  2KZ4 A;  1C5S A;  1QBV H;  2WYG A;  1PPZ A;  3O8R A;  4TY7 A;  1KY9 A;  2H9T H;  1FY5 A;  5FPS A;  3N7D A;  4F55 A;  4H6T A;  3SNB A;  1GBC A;  4YLU A;  4SGB E;  3SU0 A;  1T31 A;  3UNQ A;  5A0C A;  1S81 A;  2ZGC A;  2STA E;  1ZPZ A;  1ELC A;  2QC2 A;  2ZCK P;  3QX5 H;  1WSS H;  4KTS A;  3SZE A;  3TIU A;  1C2G A;  3LON A;  1B7X B;  1T7C A;  1WTG H;  5A8Y A;  1LVO A;  1EAX A;  3KQE A;  4DT4 A;  1EB1 H;  4ABI A;  3V3M A;  1TOC B;  2A2Q H;  3ZZB A;  1GI5 A;  1UTN A;  2FDA A;  1O2R A;  3SU5 A;  5AHG H;  5EST E;  2KCP A;  4MQA A;  2HPP H;  1EAW A;  1GI7 B;  1EX3 A;  3BTQ E;  5SGA E;  3RU4 E;  3K65 B;  2BD9 A;  4FUJ A;  1EB2 A;  1O5A B;  1SPJ A;  1BML A;  1MCV A;  2CXV A;  2A4R A;  1FLE E;  2QGR A;  1JXP A;  3OAA D;  2BY5 X;  2F9P A;  3P8F A;  1TBR H;  2EY4 C;  3W1E A;  3LC5 A;  3EST A;  5AFZ H;  1AKS B;  2ODQ A;  3S9C A;  5JBT A;  3KNX A;  1V2R T;  2O8W A;  1K28 D;  1YLD A;  4ZKS U;  1LDT T;  3ATW A;  4ZHL U;  3MH6 A;  1NES E;  1XMN B;  2AS9 A;  1C2J A;  2DE9 A;  1C1W H;  1AN1 E;  1C2K A;  5GND A;  2BDI A;  2VH6 A;  2VVV A;  3RXJ A;  3F68 H;  4D7F A;  1TRM A;  2ZTZ A;  5BRR E;  3OSY A;  1UTP A;  1C1M A;  1A2C H;  4Y7A A;  1CT4 E;  2FOC A;  1TNJ A;  4MPV A;  1G3D A;  2JJ2 D;  2IN2 A;  2KAI B;  2OC0 A;  1RD3 B;  2OUA A;  2WYJ A;  2XBV A;  1GBH A;  2RDL A;  1TA2 A;  1C5V A;  3I77 A;  1GG6 B;  1K21 H;  2G8T A;  1D6R A;  1GI2 A;  1QA7 A;  5IDK A;  1BTU A;  1PJP A;  4HTC H;  5EXM A;  4JCN A;  1TGT A;  4Y8X A;  1L0Z A;  1E35 B;  2B5T B;  2V3M A;  5JYI A;  4A1V A;  2SGP E;  1SGF G;  5KGO A;  4AFQ A;  1BZX E;  3T25 A;  3UNR A;  1OWI A;  4I8G A;  1AY6 H;  4IGD A;  1ETS H;  1J15 A;  2KFW A;  4IC5 A;  3RXM A;  1P05 A;  3PO1 B;  1MAY A;  1C5U A;  3A83 A;  2VB0 A;  2IOT A;  1NU7 B;  4RSP A;  3SJ8 A;  4OGX A;  5C1U A;  1GJ8 B;  1SGD E;  5HIY A;  5E0J A;  1A4W H;  1NC6 A;  2SGD E;  2BD4 A;  5FBE A;  2P16 A;  2Y5G A;  1ETR H;  1Z1I A;  2BOH B;  1TAL A;  3PRB A;  5CDF E;  5CHB A;  5HGG A;  2OP9 A;  1WDI A;  1L2E A;  2ZU4 A;  1UVO A;  2HWL B;  2ZQ2 A;  3OY5 U;  1CHG A;  3EAJ A;  1H8I H;  3PRO A;  2XBW A;  3KQD A;  1ELG A;  1SGT A;  4H6S B;  4RN6 A;  1O5D H;  1QJ7 B;  3GS9 A;  2BX3 A;  2KR7 A;  3GIC B;  2ZG0 H;  3TH3 H;  3ATM A;  1K1L A;  3DT0 H;  1ZYO A;  1FON A;  1O3P B;  1FXY A;  2C3S A;  5E2P A;  1DUA A;  1HIA B;  2Z9L A;  4RKO B;  4YOJ A;  1O34 A;  1QQU A;  2VWL A;  1NN6 A;  2ZFT A;  3EDX B;  2DUC A;  4NSY A;  4B75 A;  4NFF A;  1V2Q T;  2F43 B;  3QDZ B;  4O97 A;  4BXS A;  1EZQ A;  1O3B A;  1RXP A;  1RIW C;  2BD8 A;  2NU3 E;  3AAS A;  3AW1 A;  1QTF A;  3PV5 A;  4WMF A;  4X2X A;  4AB8 A;  4MNW A;  3ZVD A;  1KXD A;  1JRS A;  2BVS H;  1TPS A;  5FCK A;  1MD7 A;  4NSV A;  3E1X B;  2PFE A;  5CMX H;  4KGA A;  4Q63 A;  3OU0 A;  1P2O A;  3QGJ A;  3QGN B;  4NIY A;  1F5L A;  1C5W B;  1UTJ A;  4AFU A;  5FX6 A;  1FN8 A;  4B6F A;  4ABH A;  1NRP H;  2TIO A;  4ACB A;  2F9U A;  2A4Q A;  3ZVE A;  1YF4 A;  1ZR0 A;  1WQS A;  3SUE A;  2P3U B;  2XC4 A;  5DJ7 A;  2BQW B;  1AB9 B;  4BTI B;  1M9U A;  2VWM A;  3BEU A;  2WHX A;  1F0R A;  1GVL A;  2OIN A;  1MKW K;  2GX4 A;  4Y8Z A;  3M7T A;  4DVA U;  2VWO A;  3GY6 A;  2IJO B;  4IC6 A;  2FLR H;  4O3T A;  5HYO A;  2ALV A;  1FPC H;  1A3E H;  2XWA A;  3FZZ A;  5A0B A;  2VNT A;  5GWZ A;  1RS0 A;  8GCH G;  3N7E A;  4UEH H;  2W3I A;  1WAY B;  2A1D B;  4I8J A;  2WV9 A;  2HRV A;  2XRC A;  1A5H A;  1O2Z A;  3SUD A;  1MH0 A;  2ZFF H;  1ELF A;  2R2W U;  1O31 A;  5FXL A;  1FN6 A;  3TIT A;  1O30 A;  2ZDA H;  3K2U A;  5C67 A;  3PO1 C;  2TRM A;  2RG3 A;  4YO9 A;  1P2N A;  4Y79 A;  1O2V A;  3ZYE A;  2GT7 A;  3FAN A;  2PTN A;  2QE7 D;  2TGA A;  1HB0 B;  2JET C;  5E0H A;  3K6Y A;  3H5C B;  1KXA A;  4K60 A;  4NG9 H;  3WWF A;  1UTK A;  2ZGH A;  3I29 A;  3ZIA D;  5DP9 A;  1O2W A;  1MTS A;  3D65 E;  3P6Z B;  1NRS H;  2HGT H;  1CT2 E;  4FVB A;  1O2P A;  3LGY A;  1SLX B;  3WY8 A;  2V6N A;  2CJI A;  2QCY A;  3E6P H;  1GWA A;  3RC6 A;  3UIR A;  4A6L A;  3MH7 A;  4DOQ A;  1JRT A;  2PP6 A;  2XC0 A;  1HJA C;  1O3L A;  2XCN A;  3SI4 H;  3TJN A;  2C8W B;  4Q80 A;  1C5O H;  1HCG A;  2Z9K A;  2GVF A;  3LH3 A;  1V2J T;  4Q7X A;  9EST A;  1V2V T;  1NBM E;  2ZPQ A;  2WPK S;  3HPT B;  4TSF D;  1O0D H;  1HAY B;  1YPG H;  1Z8J B;  3A8A A;  2BY6 X;  2ZNK H;  2R0K A;  3T5F H;  4NZL A;  1FY1 A;  3VB5 A;  2PGB B;  3QLP H;  1COW D;  3UOU A;  2CN0 H;  2VIW A;  3AAU A;  3WWB A;  3H09 A;  1BMN H;  2RA3 A;  4DCD A;  4K8B A;  4AGK A;  4WJG 2;  2F9O A;  1YP9 A;  1WOF A;  2OBQ A;  4K1E A;  2AHM E;  1BBR K;  2WIN I;  3V13 A;  2BTC E;  1BUI A;  2HLD D;  3JZ2 B;  4A7I B;  2HVX A;  5F8Z A;  3K9X B;  1FY8 E;  4OS2 A;  4ZCN A;  4ZKN U;  4Y11 E;  3GY5 A;  1J14 A;  1ELE E;  1P57 B;  3T29 A;  1UTO A;  1P2Q A;  1HV7 A;  4BAH B;  4BAO B;  2XYA A;  4MPU A;  1TGS Z;  1ZMN A;  3S0N A;  1YPH E;  3LJJ A;  2WZQ A;  1C5Z B;  1VR1 H;  3A7W A;  3BEI B;  4GAW A;  1DFP A;  3SI3 H;  3A8B A;  1G2L A;  3PTN A;  1ARC A;  1DM4 B;  4X1P U;  3S7H B;  1SVP A;  1EZU C;  1ELD E;  4A5T S;  4OS7 A;  2BXT H;  2AYW A;  2YMS C;  1AB9 C;  1MKX K;  4JZ1 A;  1C2M A;  4ZXX H;  2BLQ A;  1MKW H;  1LPG B;  1YBW A;  1AFQ B;  1VGC B;  2ILN A;  2A5A A;  4OS4 A;  1EOL A;  1Z71 A;  2WPH S;  1PQ7 A;  5EIY A;  2UUF B;  4GSO A;  4R8T B;  5FHT A;  5DP7 A;  2EQN A;  3F9F A;  4ZAE A;  1HFD A;  4AC9 A;  1LHF H;  1DWE H;  1KMH B;  2PKA B;  2ZA5 A;  3HK3 B;  1O2O A;  1MTV A;  3ZVF A;  3LGU A;  2B0F A;  4UFD H;  4THN H;  3VB3 A;  2G00 A;  1OHH D;  4K5Z A;  1NRN H;  3GDV A;  3OY6 U;  1IHS H;  3TGK E;  4FUC A;  3UPE A;  4WH6 A;  3A85 A;  2XC5 A;  1GDQ A;  3GY4 A;  1AI8 H;  2JJ1 D;  1SQR A;  2AMD A;  1W14 U;  3M37 A;  2GZ9 A;  4Y71 A;  5JDU B;  8GCH F;  3MO9 A;  3KHV A;  2BMG B;  1GBT A;  3SN8 A;  2Y81 A;  4RT1 A;  1TMU H;  4OM9 A;  3IIT A;  3DD2 H;  1IQF A;  4B2A A;  2UWO A;  5LGO A;  5FPT A;  3WW7 A;  4X1S U;  8KME 2;  4K69 A;  1FPH H;  1DUE A;  5EGM A;  1Y8T A;  1EAU A;  1SGP E;  1D9I A;  3SNC A;  5HKK D;  1ZJK A;  2EST E;  3VXF H;  1INC A;  2OC1 A;  2BY8 X;  3GDU A;  3UQV A;  2UUY A;  2G51 A;  2QXJ A;  3UTU H;  3F2G A;  4BAQ B;  4JYT A;  2P8O B;  3FP7 E;  3B9F H;  2Z94 A;  2ZDK A;  1VIT H;  4I8H A;  4TT3 D;  2ZU1 A;  5EPY A;  4Z6A H;  1YPH C;  1AVW A;  1SLU B;  3KGP A;  3U9A H;  5C5N A;  3SV6 A;  1FUJ A;  3A82 A;  4FU9 A;  1TPO A;  3TPI Z;  1RTF B;  1LVM A;  5EOK A;  3GY7 A;  1GBA A;  3U8O H;  2ZFS A;  3A81 A;  4ABB A;  4CRG A;  3RXU A;  1T8M A;  3UQO A;  1TX7 A;  1S6H A;  2KCA A;  3IG6 B;  1HXF H;  5ESB A;  4FUD A;  4HFP B;  2F9V A;  3QTO H;  4X2V A;  1EAT A;  5DPA A;  4KTU A;  2RFK C;  5DP3 A;  1IQH A;  4U32 A;  1MMJ N;  4JZE H;  5C2Z A;  1QB6 A;  3MFJ A;  1UK2 A;  5F8T A;  3F1S B;  3TGJ E;  5EU8 A;  1VJ9 U;  1KDQ A;  1GHB F;  1MKX H;  1U6Q A;  2XBY A;  1QNJ A;  4UFF H;  1TAB E;  3GYM A;  3SQE E;  3RDZ A;  1GJB B;  1W10 U;  4WVP E;  3LKW A;  1DAN H;  4TYD A;  1GHV H;  3TNS A;  4B2C A;  4J1Y A;  5EXL A;  3RLW H;  3RXP A;  4YM9 A;  1QRX A;  3BG8 A;  3SU3 A;  1BA8 B;  1D6W A;  3KID U;  5GJ4 B;  1ZSK A;  3ZZ6 A;  4H4F A;  4I32 A;  1TNK A;  3M35 A;  2Q6D A;  1V6D A;  5GXP A;  1UHB A;  2Y80 A;  1YLC A;  3QK1 A;  3ZZC A;  3LGI A;  1W8B H;  1IQN A;  1SL3 A;  1MBM A;  4Z0K A;  1C5N H;  1RTK A;  2FX4 A;  1AZZ A;  1NTP A;  2PUX B;  1UVT H;  3QZR A;  3UAI C;  5E2O A;  1FIW A; 
#chains in the Genus database with same CATH homology
 5HKK D;  1N1L A;  5F53 A;  4K8B A;  5C0U A;  4B74 A;  2OC1 A;  3LOX A;  2F9U A;  1RTL A;  2A4Q A;  4A1V A;  5B6L A;  3F0P A;  2OBQ A;  1NBM D;  3EYD A;  3F2G A;  1CU1 A;  3P8O A;  3OE7 D;  4JMY A;  2AHM E;  2OK5 A;  3UB0 A;  2YOL A;  3SUE A;  2V7Q D;  2HLD D;  1BMF D;  1E79 D;  3SUF A;  3SU4 A;  2FOM B;  4ZCN A;  2GGV B;  2WHX A;  4TT3 D;  2KZ4 A;  5ETX A;  2OIN A;  2QV1 A;  2KCO A;  2W6I D;  4I33 A;  2F4L A;  3PV2 A;  2KFW A;  5EPY A;  3O8R A;  5C0T A;  3M5M A;  3KF2 A;  5EPN A;  2IJO B;  5FPS A;  4ASU D;  4B71 A;  3SV6 A;  2WSS D;  4WF8 A;  3N7D A;  5H4I B;  4F55 A;  2WZQ A;  5EQQ A;  1BT7 A;  3SU0 A;  3N7E A;  3U1J B;  3SU6 A;  3VG8 A;  3DSP A;  5FL7 D;  3SZE A;  3F0O A;  2WV9 A;  2K8I A;  3LON A;  4WH8 A;  4I31 A;  3PRB A;  2YMS D;  2YMS C;  5CDF E;  5CHB A;  4DT4 A;  2OC8 A;  3SUD A;  1H8H D;  2XCF A;  4YXW D;  4A1X A;  1DY8 A;  2YMS B;  2KCA A;  2K1Q A;  3FO8 D;  3SU2 A;  4XD7 D;  5ESB A;  4B76 A;  1W3C A;  1E1Q D;  3NRL A;  2XOK D;  3SU5 A;  4U01 A;  2KCP A;  2F9V A;  3U1I B;  3OEH D;  2OBO A;  3OYP A;  4KTC A;  4B6E A;  2QF4 A;  3SYJ A;  3GS9 A;  2KR7 A;  2QE7 D;  4FET A;  4Z1M D;  4R8T B;  3L6P A;  4B73 A;  5C17 A;  2A4R A;  1H8E D;  3FOA A;  1JXP A;  2K0Q A;  3WWF A;  3OAA D;  3ZIA D;  2LEL A;  2KCY A;  3W1E A;  1W0K D;  3SUG A;  2IJD 1;  3RC4 A;  1KMH B;  3F2H A;  3KNX A;  3N99 A;  4RI0 A;  3M5N A;  5EQS A;  1NS3 A;  3E90 B;  5EQR A;  3M5L A;  1OHH D;  3PRD A;  3O8C A;  3LKW A;  2M2A A;  2XNI A;  3F2F A;  1DXP A;  4TYD A;  2W6J D;  4B75 A;  3RC6 A;  2L6O A;  1DY9 A;  2F43 B;  3M5O A;  3P8N A;  5GND A;  1FX0 B;  4WH6 A;  2JIZ D;  1W0J D;  5DN6 D;  3OEE D;  4Q4L A;  2XCN A;  2WPD D;  3AK5 A;  3RC5 A;  2FP7 B;  1E1R D;  2JJ1 D;  3KN2 A;  3SU3 A;  3FN8 A;  5GJ4 B;  5GPI B;  3OTP A;  3FKS D;  2GVF A;  3O8D A;  1SKY E;  3PV5 A;  3DSO A;  4I32 A;  1WXR A;  2J5U A;  2QF5 A;  2CK3 D;  1A1R A;  2JJ2 D;  3SU1 A;  1RGQ A;  2OC0 A;  1MAB B;  1NBM E;  1S6L A;  3SV7 A;  1DXW A;  2P59 A;  4TSF D;  3SV9 A;  5DSF A;  2XND D;  4M9F A;  3F3B A;  3OFN D;  4OM9 A;  2OC7 A;  2KM0 A;  3O8B A;  5FPY A;  2O8M A;  1EFR D;  2FM2 A;  4NWK A;  3KEE A;  5IDK A;  3DCL A;  4Q63 A;  5T1V A;  1COW D;  5FPT A;  4NWL A;  2A4G A;  3WW7 A;  4A1T A;  2VBC A;  4A92 A;  3WWB A;  3H09 A;  4B6F A;  3SV8 A;  2JDI D;  5IK2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...