3DSOA

Crystal structure of cu(i) bound copper resistance protein copk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
b'VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein copK
publication title Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography
pubmed doi rcsb
source organism Ralstonia metallidurans
molecule tags Metal binding protein
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dsoA00
3DSOA 3N7DA 3N7EA 3DSPA 2KM0A 2K0QA 2LELA
chains in the Genus database with same CATH superfamily
2HLDD 4CHAB 2VIVA 1ETTH 4TPYA 1GMDG 5T6GA 1JIRA 1AIXH 2FOEA 3PYHA 3SQHE 1O2PA 2PFEA 1IQNA 5ESBA 3K65B 1L4ZA 3SJKA 4R8TB 4HZHA 1LHEH 2BYAX 4UFDH 1VCQA 4A1XA 1UJ1A 5JB9S 5T6FA 4ZHAA 3CS0A 3ATMA 2OC0A 1LO6A 2GTBA 5JYIA 1YP9A 1KYNA 1ZGVA 2F9UA 4DURA 3E0PB 3ODFA 1TPOA 3I78A 3MNCA 2XBYA 2ZFFH 4AZ2B 1OWHA 2GZ7A 3GY6A 1FY1A 1ZPBA 3A8BA 2JH5D 5EU8A 3SUFA 5GCHF 3MOCA 1O5BB 1B5GH 1GI8B 1QY6A 2H5DA 5F03A 4CRAA 3PO1C 4K1TA 3OYPA 2VWMA 3VEQB 1Z71A 4E7RG 3RC6A 1EATA 3LGUA 1COWD 3NKKA 3UQVA 5L2ZH 3ZVBA 5L2YH 2BTCE 2ZU3A 2KX4A 1NFWA 1GBLA 7GCHF 1C5YB 3SV8A 3I29A 1EJNA 3TITA 2WUBA 5T6DA 2B8OH 1EB2A 2GDDA 3MNBA 1PYTD 2GZ9A 4I86A 4WWYA 4KKDA 2XTTB 1IAUA 5C1YA 3OU0A 1W8BH 1Y5UT 3Q77A 3OFND 5CDFE 1QHRB 2ESTE 2LNCA 1OWIA 3B23B 1P01A 3M61U 3B9FH 1QL7A 1Z6EA 2QAAA 1FPCH 1L4DA 2NU3E 2BB4A 1C2JA 2ZQ2A 1TALA 1NPMA 2ZCKP 1ETRH 5DP8A 3RXEA 5DP5A 1YCPM 1LKAA 2BLWA 1NC6A 3E1XB 3KN2A 3M3TA 1SLVB 5JBAS 1NRQH 2ZPQA 1AQ7A 1SVPA 1XVOA 3OSYA 3TJNA 3QWCH 1WU1A 1WDIA 3UQOA 3R0FA 4B6EA 1GI9B 1JXPA 1C5SA 1CGHA 3RUOA 1TGTA 4AN7A 3MU1A 1CQQA 1A5HA 3SNAA 3ZZ9A 3L33A 4M7GA 2FOFA 3BTME 2QGRA 4ZXYH 2FYQA 2WV9A 1D6WA 2KCYA 4IMQA 1DICA 3DHKH 5FPYA 1FIZA 3GS9A 4Y0YE 1ELCA 1NRPH 3RMLH 1P2MA 1GGDB 4U01A 2P95A 8ESTE 2GDEH 1PJPA 2ANYA 1TNJA 2VBCA 2VIDA 4NZLA 4LXBH 5DK1A 1TWXB 1UCYE 1ESAA 1O30A 4B75A 4NSYA 3K6ZA 2XW9A 1PPGE 1WUNH 4ZH8A 1BT7A 5TCCA 5GWZA 2PTNA 3PTBA 1BMLA 2ZF0H 4GHQA 4GHTA 2P8OB 4INLA 2IN2A 1F7ZA 1QZ8A 2KFWA 1XUGA 3MH5A 4VGCB 1ABIH 5ESTE 2ZCLP 2WPIS 3N7DA 1GDNA 1FLEE 3O8DA 3F68H 4F4OC 3T2NA 2BMGB 4X6NA 2HNTE 3RMMH 2OD3B 1Y3YA 3UAIC 1OWKA 3ODDA 2SGAA 1ZSJA 3CP7A 1EOJA 3TNSA 1BHXF 3EE7A 3GOVB 1WTGH 1O2GH 1A0JA 4F49A 3VXEH 3FN8A 1SGPE 8GCHF 1A61H 2B0FA 1CHOG 2OCVB 3SU4A 1HJAB 2NU1E 2SGQE 3UY9A 5A8XA 3F9FA 4Y79A 1TMBH 5K7RA 3SJIA 1O3BA 4FUGA 2WPDD 3SU2A 1MTWA 4M9FA 1BRUP 2G55A 2PKAB 1YYY1 1O3OA 1TGNA 5E2PA 4D9QA 1K1IA 4B6FA 1C5LH 1UCYH 2ZWLH 1TRYA 4JYTA 2BD4A 3ZZAA 3UNRA 2BLVA 3F2GA 1VJAU 3A88A 2VIQA 2VWOA 4ZCNA 4H6TA 2IJD1 3QGNB 5CHBA 4ZKRU 1O38A 5KEDA 1GG6B 1IQMA 5H4IB 3FAOA 3MU5A 1FAKH 3P8GA 1NM6A 3BTHE 3VB5A 2YNAA 3RXCA 1QCPA 5F53A 1N8OB 3W94A 2OTVA 1T32A 2THFB 2VIWA 4BAMB 1QQUA 3ENSB 4K1SA 3STIA 2GCHF 1INCA 2R3UA 5EPNA 2AGGX 3PB1E 1ZTLA 1DITH 1HIAB 4NWKA 1GJ8B 1GBAA 1E1QD 4P00A 2EEKA 4DY7B 1GDQA 3RLWH 2O8MA 3GY4A 2WPKS 1T8OA 2ZU4A 3RU4T 1HAHH 1V2MT 3FZDA 1NZQH 1O31A 4IGDA 1UCYK 1F0SA 3IITA 3LPRA 3DCLA 1AB9C 4JMYA 3A86A 2TBSA 1GCDA 2PKSC 1TX6A 3HGNA 3MU0A 3A7ZA 4FVBA 2FXRA 2OUAA 1MMJN 2AYWA 2TPIZ 2XWBI 1K1PA 4UFFH 4CREA 5HXFA 1SLWB 3TH2H 1E38B 1T8LA 1D3QB 2BDYA 2CMYA 2PUXB 4GCHF 1CA8B 5B6LA 2XBXA 3E90B 1GBJA 4XFQA 1HLTH 3ZZ7A 5IDKA 1TOMH 1C1WH 2B7DH 5E0GA 4I8KA 1S83A 1MTVA 2AEIH 2FI3E 3BEFB 4XBCA 1QL9A 1EZQA 3GY2A 4ZMAH 1SSXA 1J8AA 1F0UA 1GJ5H 1LHGH 2G4UA 4Q80A 1YPKH 3ATWA 4OS6A 1XMNB 1ZTJA 2GT7A 1H4WA 3OX7U 1P2NA 1QJ7B 2IOTA 3WWFA 2JKHA 1ZSLA 2VGCC 3PMHB 2V0BA 1GJ7B 3U69H 1WCZA 2FTLE 1LVOA 3PV5A 1A3EH 4J2YB 1MCVA 1G3BA 4B71A 2WYGA 4ACBA 1ANDA 1BMNH 1G3EA 1SOZA 5C0UA 3KIDU 1KXBA 3CS7A 4ABDA 1IQGA 1LPZB 2VNTA 2DUCA 1ELGA 4X6MA 1C5VA 1TONA 3GCOA 2BLOA 5TCAA 4K2YA 2VB0A 1S6LA 1XUIA 3LT3A 3Q3KA 3V13A 1O3GA 3NZIA 1WQVH 1QGFA 3UOUA 2UWOA 2BD5A 5DPAA 2QCYA 2I6SA 2LPRA 2UUJB 1UMAH 1UHBB 1GHBG 2K1QA 4KTCA 1GHXH 2NWNA 3A7YA 2ZGCA 3RXPA 6GCHG 1CT0E 5CMXH 1SGIB 1BHXB 1EZXC 3WW7A 7ESTE 2BD7A 2C90B 1O2KA 1DWCH 3UFAA 1QBVH 1P3CA 1FI8A 5FX6A 2BZ6H 5DJ7A 5DSFA 3M5OA 2Y80A 4NSVA 1KXCA 4JYVH 3RMNH 1AN1E 3KCGH 3H7TA 2FOBA 5JB8S 3JZ2B 3DFLA 1SPJA 3BEUA 2R0KA 5GPIB 1G32B 1O3NA 3PV4A 3ATIA 1GI3A 1Y3UA 3MO9A 1C5NH 1UK4A 1BMMH 1BDAA 4OS5A 4XSKU 2J97A 4Q7YA 2AHME 4ABFA 1O2VA 3M7UA 3VGCB 1SG8B 4CBNA 1Q31A 1G2LA 1B0EA 1E37B 4GUXA 1T7CA 4FUBA 4GLYA 1NROH 2G51A 4FXGH 1FN6A 1HAXB 4NIXA 3H5CB 3W1EA 3P95A 2WSSD 3MU4A 2IJOB 2ZGXH 4BAOB 1GBCA 2F83A 2AIPA 2WPJS 3UOPA 1GJBB 2UUFB 3AAVA 1BBRE 4ZHLU 1MABB 1XUHA 1Z8RA 5HIYA 1VGCB 4YO9A 1FUJA 4ISNA 3E3TA 1WQSA 3KHVA 2ZQ1A 1BTUA 3RXOA 1LKBA 1AUJA 1P2QA 4OS7A 4Y7AA 3GCTF 1IHSH 3P6ZB 4DG4A 1P9UA 2AS9A 3I77A 2A5IA 4SGAE 1Y8TA 1C1PA 2BY7X 1KIGH 2A7CA 2BOHB 1Y5BT 3GDVA 4BTUB 5E2OA 1KDQA 1K1JA 2QF0A 3W95A 4Y10E 3ZVEA 3RXIA 1G2MA 2XC4A 1GHYH 1DSTA 1EQ9A 1UVTH 1K1NA 1DUEA 5CHAB 4YXWD 1SI5H 4AC9A 2VU8E 1SQTA 1VITH 4MDSA 1WOFA 4FUJA 9ESTA 2RDLA 1RIWB 2XRCA 1GBBA 2ZZUH 2W5EA 4K5ZA 3P17H 2RFKC 4K1EA 2W7SA 1H9IE 2BM2A 3ZVDA 2PTCE 5FHTA 1LPKB 1O5FH 1LHCH 4H4FA 4P02A 1DE7H 1AKSB 3DA9B 4ABBA 1A2CH 2EC9H 1DS2E 1GMDF 3QO6A 3LU9B 4FETA 1TAWA 2ZC9H 3M35A 3RXGA 1CT4E 1O5EH 4ISHH 1C2GA 1SLUB 2JDID 1TNIA 2BD8A 5E0HA 1TIOA 1IHTH 1W0YH 4ABIA 3GICB 5I25A 3DSOA 5C20A 1TB6H 1SQAA 2GX4A 1L0ZA 1J15A 1C4Y2 1SKYE 2NU4E 3ELAH 4YESB 2ILNA 2CXVA 2W6JD 1AUTC 2C93B 1FZZA 1O2SA 3BTKE 4NA8A 3Q00A 1QR3E 3ZZ6A 4AFUA 4I31A 4YT6H 3EE0B 4MPVA 4X2YA 2V3HH 2BXUH 2R0LA 3ESTA 3UWJH 1KLTA 5HKKD 3JZ1B 3C27B 1OX1A 3BG4B 4NFFA 2FOHA 2JIZD 3ITIA 1HAOH 2P3UB 1ZJKA 2I6QA 5C2ZA 1FY8E 3LGVA 3TGIE 1GJ6A 2GMTB 2HVXA 5EIYA 4RKJB 3BIUH 4UEHH 1GCTC 2XBVA 1YY3A 3MMGA 1C2DA 3RXFA 1DANH 1QBNA 1GBFA 1HAGE 2BD2A 1EJMA 1YF4A 1H9LB 2ASUB 5AHGH 3F9EA 4H6SB 1QA7A 2Z7FE 1HV7A 4OM9A 3QN7A 2ZFTA 1O3KA 4Y76A 1QL8A 5B6OA 1TBRH 4AX9H 1C4V2 5C5NA 1DLEA 3QGJA 4TY6A 1V2NT 1T4VH 3ZVCA 2QXIA 3WY8A 4AB8A 4SGBE 1SLXB 1C2EA 5A8ZA 2FZZA 1H9HE 1O37A 4JK5A 1EPTC 2HALA 1TGCA 1O5GH 1IQFA 1S6FA 2UWLA 2ZPRA 2BVRH 4MQAA 3RM2H 2FIRH 3UR9A 2QV1A 3SNEA 1W7GH 1F0TA 4E7NA 3SU5A 3MO3A 1GMCG 5AFYH 4UFGH 1G3CA 1HCGA 1RJXB 1TPPA 2BDBA 2BOKA 1C9TA 2VINA 3VGCC 3GY8A 1RTKA 3VPKA 1VITG 5DN6D 3MFJA 2OK5A 2H6MA 1GJ4H 1E79D 2ZFRH 1A3BH 4WVPE 3ZYEA 2ZTYA 1SGYE 2FX6A 1UTOA 1C1NA 2AFQB 4WY3A 2ZFSA 2OC7A 2STAE 3FP7E 3TU7H 3TJOA 1ZSKA 1A46H 1GHAG 3A81A 3BN9A 1P3EA 1IQJA 4YLQH 2SGDE 3MYWA 3MU8A 1GL0E 1QBOA 2ZHQH 2GZ8A 3U1IB 2ZPSA 2PV9B 3V0XA 1AO5A 1GJAB 3D62A 1S81A 4Q63A 3UNQA 2UUKB 2FM2A 1YPJH 1QB6A 1P03A 1NN6A 3RXMA 1NY22 2GVFA 1C2IA 3SU0A 1D6RA 1BTZA 2HPQH 5K0HA 1A0HB 4HI3A 1GWAA 3LONA 1ACBE 1SL3A 1C1MA 3HK6B 3LKWA 5LPRA 3AAUA 5AF9H 2BXTH 3OY5U 2XOKD 2TIOA 4ABAA 1AVWA 1OP2A 1F5KU 1TE0A 1HAVA 2ZDNA 5EXMA 4NWLA 3O8CA 1CBWB 5SGAE 1P2OA 5A8YA 4X8SH 1C1SA 2D26C 4AFQA 5CHAC 1ANCA 1YPHC 1EP5A 1XKBC 1V3XA 1DXPA 4Y11E 1FX0B 1YLNA 4AORA 3M7TA 6CHAC 4XBDA 4ABJA 4BXWA 1MD7A 1HAPH 1C1UH 3RXTA 1D4PB 2NU2E 3F9GA 1CU1A 3KQEA 3WWBA 1O0DH 1CHOF 6ESTA 1QQ4A 2BDIA 3EA9A 3ZIAD 3QX5H 4AOQA 2BY5X 4LZ1H 2P3TB 2HPPH 2ZP0H 1O2JA 1GI4A 4Q7ZA 1KY9A 5DP6A 2R2WU 1V2OT 4OS1A 3QUMP 3SJ9A 1QB9A 2JJ2D 1GI1A 1O5DH 3SZNA 1TRMA 1GHVH 1L1NA 1G36A 2A4OA 4RT1A 1XUJA 1O35A 1O2NA 3F2HA 3GY5A 3C1KA 3PROA 1RTFB 3P70B 4UD9H 2CK3D 1P02A 1O2OA 4A7IB 3RXUA 4RSPA 2TGTA 3ZZBA 3GCHB 1K1MA 4K3JA 3S0NA 1Z8IB 4X1PU 4GVUA 1QRWA 1FQ3A 1BMAA 1M9UA 3DSPA 4BTTB 2WHXA 1E36B 1MTNC 1O2HA 1FNIA 3TH3H 4TWWA 5F8XA 2GV6A 5LPFA 1P57B 1NU7B 2QYIA 1CO7E 4I8HA 4NCYA 1A5IA 2ZNKH 3F0OA 1UTKA 1W13U 2BDAA 3TLOA 4ISOA 1YGCH 2F43B 3TNTA 1BJVA 5DO4H 3FKSD 3PMJA 1AZ8A 3E91A 1AFQC 5DP9A 2AIQA 1W7XH 5EGMA 3BTQE 2JJ1D 1BRBE 4IC5A 1BA8B 1C2LA 4H42U 3SI3H 3VB6A 4KP0A 2W7UA 4B76A 1EZUC 1K28D 1ZGIA 4Y6DA 3RM0H 2VWLA 1GVLA 1TQ0B 1RGQA 2IPQX 1CT2E 4FUHA 1V2KT 2ANWA 3ZZ5A 3A83A 3LGIA 1HRTH 4AB9A 2CJIA 1L2EA 3TVJB 4K8BA 1XXDA 2A4RA 4JK6A 1CA0B 1P09A 1G9IE 3RU4E 1V2PT 1HNEE 3S9CA 4JZDH 1GJDB 1XM1A 3NWUA 5EQRA 1SOTA 2Q6DA 1TMTH 2FI5E 2J9NA 4X0WU 1Y3XA 4AG2A 1FDPA 1QRXA 4CHAC 2HRVA 5FPSA 1V2WT 1DWEH 3SNDA 1SR5C 1FMGA 3PM3A 4XDEA 1Z7KA 4FUFA 3AW1A 2QXJA 1ZTKA 1MZAA 3SUEA 2C8ZB 4OGYA 1SFIA 5HIZA 4E06H 1W0ZU 3U9AH 1JRTA 1VJ9U 1P12E 2D8WA 5DP4A 2KZ4A 1OS8A 2EQNA 5DP7A 1FY3A 3A84A 1O2YA 4AYVB 1FY5A 2DE9A 4AGJA 1NT1A 1WBGB 1BOQA 2FODA 1HAYB 1MAYA 3CNRA 3GDUA 4YT7H 3CENA 2C4FH 1BUIA 2AERH 2HGTH 1Y3VA 4IN2A 1BIOA 1YBWA 2FP7B 4D8NA 2OQUA 1IQEA 4Y0ZE 1B7XB 1T8NA 2ZEBA 3N99A 3TGJE 4A6LA 3GYMA 1W11U 1MU8B 3F2FA 3NPSA 4MPXA 4DW2U 1ZRKA 5KGOA 2ALVA 3ZVFA 3F1SB 3F6UH 5JBTA 1IOEA 1P04A 1YM0A 2ZU2A 1UTMA 1F5RA 1JWTA 2Q6GA 2ZGHA 2A7HA 1K22H 1BTXA 4X2VA 4D7GA 1YLCA 1BRAA 3BTWE 2R2MB 2AMDA 5JBBS 2FX4A 2D1JA 2OC1A 3FP6E 1K1OA 1GHBF 7KMEH 3S9BA 1PPEE 6GCHF 1MD8A 1PQ5A 2SGPE 3VG8A 3ZV9A 5J4SA 2A1DB 1V2RT 3ZZDA 1DLKB 1CE5A 1XVMA 3MWIU 5EJLA 1TX8A 5EOKA 3OTJE 2BZAA 2JETB 2CHAB 2CV3A 1C5XB 1LMWB 1SMFE 1DY9A 4MPUA 3SN8A 4A92A 2ZU1A 1AVGH 1FONA 1GVZA 1C5ZB 2PGBB 1SGCA 2ALPA 2HNTF 3OEHD 2GGVB 2Z3CA 4ABGA 1LPGB 3PLKA 1DSUA 1ZOMA 3TJVA 4DJZB 4KTSA 4KGAA 1L1GA 1OKXA 2BVSH 1RXPA 2GKVE 2ZHDA 1T4UH 1AGJA 1TPAE 3U28C 3SUGA 4WH6A 5L6NH 1DWDH 2GP9B 2F9PA 2YMSD 3A8DA 1H8DH 4HG6A 4ABHA 4MNVA 3O8RA 1GJCB 4NGAH 5FCKA 1C5UA 2GCTB 1ETSH 1ZHMA 2PSXA 2P93A 2VIPA 2WV4A 5GIBA 1O2RA 1C5QA 2F9OA 2W6ID 1TX7A 2FESH 1O3IA 4OGXA 2VH6A 4I33A 1GI2A 5PTPA 3TJUA 2J34A 3SOSA 3LGTA 1GGDC 2P3FH 4Y8XA 1O2ZA 3UREA 1NRSH 3F9HA 5EQSA 2WPMS 3SV6A 1VKYA 3GDSA 1A1RA 1RRKA 3N7EA 1XUKA 5EQQA 4ZKSU 5F8ZA 4X1RU 1EKBB 5TJXA 4B73A 1QNJA 1Y59T 1LHDH 1NFYA 3E6PH 4IN1A 1UK2A 1KTTB 5HYOA 1DT2A 1V2QT 2EI7A 1TGSZ 4AFZA 4X2WA 3S7KB 2P94A 1P2IA 4FUEA 5EODA 2P8OC 2FYRA 1PPZA 4VGCC 4AYYB 3D23A 4XE4A 1O33A 1LTOA 1SB1H 1O2XA 5A0CA 1TRNA 9LPRA 1ID5H 5F8TA 3UB0A 1W10U 4JZ1A 1NRNH 1TNGA 4CH2B 1BITA 4DOQA 2A7JA 1TOCB 1C2MA 3TK5A 1BRCE 1F0RA 1MUEB 3EGKH 4X8UH 1W0KD 4D9RA 2LELA 3NK8A 3H7OA 3MH7A 2ZFPH 1DWBH 3QZRA 1KDQB 2AGEX 3KQ5A 1PQ8A 1HJAC 2A32A 4B1TA 2BX3A 3HKJB 3SU6A 3U8TH 5DGJA 3VFEA 2ZHFH 3TK9A 5A09A 1MQ5A 1C2FA 2CF9H 4BAKB 2H9TH 2G5NA 1THRH 2FPZA 1G30B 2G81E 2NU0E 3H09A 5BRRE 4WMEA 4UONA 1O39A 4AFSA 3OAAD 2HOBA 1C2KA 2BQ7B 3EDXB 3U8OH 4TSFD 3M5LA 3LJOA 2Y5GA 1DUAA 3T26A 1AHTH 3ATKA 1TPSA 2OXSA 2PWXA 3FANA 4J1YA 3ZV8A 3D49H 1NBME 3KQDA 2XCNA 1N6YA 1LCYA 3KEEA 4PROA 1PPFE 2VVUA 4ZKNU 2OLGA 2ANMH 1ESTA 1KLIH 3GCNA 3URCA 1GMHG 1FY4A 3PO1B 1E0FD 4JYUH 1GG6C 4Y7BA 3BSQA 1OP8A 4ZKOU 2Z9JA 1EAXA 1HUTH 2VH0A 2WV5A 5JBCS 1EAWA 1MKWH 3KL6A 2ZGBH 3BTTE 1IQIA 1N8OC 5FBIA 5A2MH 1BTWA 4ZUHA 3PTNA 4WXVA 4CR5A 2G8TA 1NS3A 4ASUD 5LH8A 1H1BA 5ABWA 1EPTA 1SQOA 3TGKE 3BTFE 2FLRH 1ELVA 1F2SE 1AZZA 3QDZB 3V7TA 1KLJH 1T31A 2B9LA 2QXHA 2Z6BD 3BF6H 3RC4A 3OTPA 2KAIB 2KM0A 3SYJA 2Z9KA 1JRSA 3MHWU 4BNRA 1ARCA 1YPEH 4O3UA 1ZMJA 1QA0A 1P0SH 1ELBA 1IQHA 4ESTE 1P2KA 1A5GH 2YNBA 2H1UA 2BY6X 3IWMA 2ZI2H 1TMUH 1SC8U 3BEIB 1THSH 2Q1JA 4X6PA 5AFZH 4FUCA 3RC5A 1BBRH 4GAWA 2JH0D 5FAHA 1ZR0A 4U2WA 1MAXA 2C8WB 1HFDA 2Z94A 5C1XA 2SNWA 3RXAA 4DGJA 3UUZA 1GBHA 2Y82A 4MNWA 4X8TH 2ZDKA 1SFQB 2F4LA 2CHAC 4UE7H 4YOIA 3Q3YA 1AU8A 1GL1A 1MKWK 1TYNA 1YLDA 4I8JA 1PFXC 2EY4C 1G37A 2A4QA 3RXDA 3UPEA 2J95A 3SU3A 4CRFA 1ORFA 2BDCA 1ZZZA 5GNDA 2ZA5A 1PYTC 4GSOA 3SQEE 1OP0A 1JOUB 3TIUA 3SV9A 1EASA 1OSSA 1GMCF 3LGYA 4AGKA 2OBOA 1EX3A 1XUFA 4IMZA 5T1VA 1C5WB 3ZVGA 5JPMH 1ZMNA 2B5TB 3MNSA 1VZQH 2KAIA 3RXBA 4CBOA 1VITF 3F3BA 3A85A 3M7QA 4BANB 3SV2H 5EXLA 3V3MA 3MQKC 3SU1A 1C5MD 4NG9H 1WV7H 2VJ1A 4MNXA 5IK2D 1GHAF 3PWBA 1EFRD 1SHYA 1ZJDA 4DCDA 1ABJH 4HTCH 5EW2H 1PPBH 2OQ5A 1A0LA 4ISIH 1BBRK 1V6DA 2RDEA 1K9OE 1O3HA 1O2IA 1AMHA 1BCUH 2W26A 2ZTZA 2EI8A 2A4GA 3ZZ4A 1GJ9B 1QFKH 3VB3A 1L1JA 2YMSB 1W0JD 2QN5T 4OS4A 2BHGA 2FS8A 2K8IA 3P8OA 1TA2A 1VCPA 3EYDA 1AWHB 1ELTA 2V3OH 1CVWH 2FO9A 2J98A 4GPGA 4BAHB 1GHWH 2ODPA 2ODQA 2WUCA 1SGFA 5GDSH 3STJA 2R3YA 1WSSH 1P06A 3A7VA 2KCPA 2EI6A 2G52A 2AGIX 3A87A 1C5OH 1GI0A 3V12A 4D7FA 1UW7A 1SGRE 5LGOA 2PHBA 2FLBH 3E0NB 1Y5AT 1BTHH 2O8LA 2Y7ZA 4JCNA 2BX4A 3KQBA 2Q6FA 2FOAA 4NIYA 4OS2A 2AMPA 2A2XH 2VIOA 1BTYA 3VXFH 2BY9X 4INKA 1HAVB 4X1SU 4BTIB 1C1QA 1AD8H 5ETXA 3EQ0H 3MNXA 4IBLH 3T28A 3FP8E 1E34B 1C5TA 4FUDA 3U8RH 1LVMA 2A31A 2GJGA 4CH8B 1DPOA 3B8JA 2OC8A 1GVKB 3RXSA 1Z8JB 1P05A 1O32A 1NTPA 2KCAA 1OXGA 4Z1MD 4WMFA 2HVYB 1NFUA 2WYJA 3R3GB 1OOKB 1YWUA 3DUXH 1SGDE 4TPIZ 2WZQA 2ANKH 1TNKA 1C5PA 2ZIQH 1H8ED 4NIVA 1N6XA 2J5UA 4TT3D 4I7YH 1LDTT 3NXPA 3LJJA 4ACAA 2RA0A 1NO9H 1VGCC 2H9HA 4K60A 2OP9A 1SHHB 1KMHB 1O2TA 3P8NA 4MLFB 2FOMB 2J38A 1C1RA 2C8XB 1EP6A 1YKTA 1O3JA 1D3TB 1HXFH 2WINI 2CF8H 4TWYA 1D3PB 2UUYA 1AE5A 3ZZ8A 1UTJA 1S0QA 2R9PA 5E0JA 4DVAU 5FX5A 2XXLA 3SGAE 1AB9B 2M2AA 4HFPB 2PKSB 1MKXH 2QF3A 3SV7A 4INHA 2SNVA 4B2AA 4MG3A 1HDTH 4KELA 1J9CH 1KTSB 3SUDA 3AK5A 2BDGA 1S5SA 1Z8GA 1S84A 1MTSA 5A0BA 1ANBA 4RKOB 4NZQA 1GBIA 1RIWC 2KCOA 2TGPZ 5I46H 4QT8C 1QURH 1GHZA 1EOLA 1XXFA 3K9XB 4U30A 2GV7A 1F5LA 3S7HB 1O3LA 5IYTA 2Y7XA 2HNTC 3SNCA 3NCLA 2AH4X 1AWFH 1TNLA 2TRMA 3BTGE 3UNSA 1K21H 5FCRA 5DKMA 3A7TA 4Z0KA 3GY3A 4I32A 1EZSC 1C1OA 3EA7A 4WF8A 2O9QA 3PRBA 3P92A 5EXNA 3FFGA 2ZFQH 3G01A 1HYLA 3A7WA 1K2I1 3FO8D 2VGCB 3AW0A 2IPHA 3GY7A 4DIHH 3M5NA 4FVDA 1ZHRA 4KTUA 1W2KH 1O2UA 2BD9A 5G4BA 1MKXK 1Q2WA 4DT4A 5GCHG 3D65E 1KXDA 2PUQH 4LOYH 3TH4H 2Y6TA 1LQEA 2HLCA 2Y81A 2YOLA 4LK4A 4BXSA 1BJUA 3SHAH 5C67A 3DT0H 3OY6U 7GCHG 3BG4C 2GT8A 4Z6AH 1HB0B 1SGQE 1C4U2 3HGPA 4I8GA 2A5AA 1FN8A 1GBDA 2SGEE 2GMTC 1EB1H 1MZDA 3AASA 1O34A 1O3CA 1YPHE 2XNIA 1O36A 3DFJA 3HATH 4JZFH 2Z3DA 1EXFA 2KR7A 2D2DA 4FU9A 2HWLB 1JIMA 3A80A 2A0QB 2QF5A 2G00A 2YMSC 2BQWB 2SGFE 1JBUH 4X1QU 3M36A 1HAIH 1QTFA 1S82A 2QF4A 1P8VC 3KYFA 1ZPZA 4XD7D 1EAUA 5J4QA 2H2ZA 3KNXA 1Z1IA 4WH8A 5C17A 2VWNA 2ZO3H 3EAJA 2PSYA 4O9VA 2P16A 1EJAA 1QB1A 1EAIA 2ZDVH 3PLBA 1ELEE 4JZIA 1YPMH 5AVDA 4NA7A 1S6HA 2WPLS 2F9BH 2ZU5A 4Y8YA 5DG6A 4XBBA 1MBQA 1CHGA 4YZUA 3SGQE 2PLXA 1KSNA 2ULLA 1OWJA 4RT0A 3MO6A 1S0RA 1OWDA 3M37A 2TGAA 1UTQA 1SGNE 3RMOH 1QRZA 5LPEA 1ESBA 3F0PA 2K0QA 4MVNA 3FZZA 3M3SA 3T5FH 5C1UA 1ANEA 1O3AA 1SBWA 2QY0B 3OEED 5EPYA 3UTUH 1PPHE 1ZYOA 3QTOH 1IQKA 2F9NA 1FV9A 3PMBB 4BOHA 1KXFA 1GDUA 1XX9A 4UDWH 1MH0A 1V2ST 2STBE 3TPIZ 3S9AA 2AMQA 3BG8A 4ZXXH 1HGTH 2ZGJA 1D9IA 2J92A 2Y5FA 2QC2A 3BTDE 4CRGA 3QK1A 2O8UA 2FMJA 1V2UT 1NU9A 3LC5A 4YOJA 3SORA 3RU4D 4TY7A 5EJ1A 1A4WH 1LHFH 3PRDA 1K0HA 1C2HA 2CGAA 2ZECA 1P2JA 2QXGA 2CN0H 2PKAA 4CRBA 3AVZA 3A8CA 3T25A 3L6PA 1DM4B 1V2LT 3FOAA 2O8WA 4IS5A 1TNHA 2XNDD 1NFXA 1OYTH 3DD2H 2V3MA 2V7QD 2C3SA 2XBWA 2GD4B 8GCHG 2C8YB 1C1VH 1OHHD 1WYKA 3K6YA 1ZHPA 1O2MA 3BTEE 3LDXH 1CBWC 1O3PB 2RA3A 1J14A 8LPRA 4NFEA 1GI5A 2FWWA 4O3TA 1UVSH 4K69A 2Z9LA 5HM2A 2ZDMA 1GBKA 1BTPA 3MI4A 1DVAH 1ZRBA 3RXKA 4ZHMU 3MTYA 1P10A 2QIQA 4RI0A 1N1LA 1UK3A 1UVPA 3KF2A 3RXJA 4YOGA 5BPEA 1UTNA 5A0AE 3PLPA 3QTVH 2Z9IA 1LQDB 4BAQB 2BLQA 2J4IA 3P8FA 1TA6A 1PQAA 1RD3B 2ZDLA 1E1RD 5FL7D 1WAYB 2H9EH 3Q76A 2OBQA 3ZZ3A 1KXEA 3RDZA 3N7OA 4THNH 3LOXA 4Q2KA 4WXIA 1TQ7B 1HIAA 2BQ6B 1GI7B 2FI4E 1GBMA 2L6OA 1MTUA 4UFEH 2ZKSA 4FU7A 1EUFA 2W3IA 3RP2A 3RXHA 4YM9A 5C3NA 3GCHC 1NESE 2M5TA 3UWIA 3BV9B 4O03A 2BVXH 3DSGA 1BMFD 2A2QH 5EW1H 2XCFA 1W14U 1HJ8A 3KGPA 3E16B 1ELFA 1GMHF 3A82A 4Q7XA 2GCHG 2XC5A 1V2TT 5E8EH 1JMOH 3K2UA 4WMDA 8KME2 2QA9E 3ATLA 1TABE 1GCTB 2PW8H 3SGBE 1RFNA 5F6MA 1Z6JH 1V2JT 3SHCH 4ABEA 3GISB 4Q4LA 1CGJE 1H8HD 1CSOE 2ZG0H 1MCTA 3HPTB 4MPWA 1AY6H 2Z3EA 3LGWA 4FUIA 3LIWA 1GPZA 3Q3XA 1THPB 5L30H 1OPHB 3QLPH 2ZTXA 1O2QA 3O8BA 3HKIB 4D76A 1ARBA 3E8LA 2ZHEH 1DFPA 1GBEA 4GCHG 3EA8A 4MTBA 4XRNA 1DDJA 1DOJA 2PP6A 5C0TA 2F3CE 1HPGA 1TFXA 1QJ1B 1W3CA 3LH1A 1CA0C 1EPTB 2ZDAH 1UTLM 1P9SA 2JH6D 5HMAA 5GXPA 1FPHH 4HGCA 2J94A 4IC6A 3VB4A 3FVFB 4FU8A 4RN6A 1RTLA 1SGFG 4O97A 1SGTA 4CRCA 2A5KA 4ISLA 3A7XA 3LH3A 3PMAB 1O5CB 1SGEE 2XWAA 2PR3A 2F91A 4CR9A 1O3EA 3URDA 1FJSA 3NRLA 1ZPCA 1IQLA 1Q3XA 1O2LA 1AE8H 1W12U 4B2CA 1O2WA 1LVYA 3A89A 2FEQH 1D3DB 2XYAA 1UVUH 3RXRA 1WXRA 2LP6A 1UHBA 2P59A 2W3KA 2FTMA 1DY8A 3KQCA 3RXQA 3OE7D 2BY8X 1F92A 1GBTA 1YPLH 2ZCHP 3PV2A 3VB7A 4DIIH 1J16A 2A45B 1T8MA 1FAXA 1O3FA 1QIXB 2L74A 3RXVA 4B2BA 4NA9H 1RS0A 1G3DA 3SZEA 1P11E 1AFEH 2H5CA 5FPTA 1LVBA 2Z9GA 3SW2B 2G5VA 1AVXA 4B74A 2FOCA 4Y71A 1TBQH 1BB0B 2J2UA 3RLYH 1ELDE 1FXYA 1E35B 3SI4H 2Y5HA 4NIWA 4FOUC 3SBKA 1J17T 1YC0A 1VR1H 5C5OA 1ZMLA 2FDAA 4K8YA 5GJ4B 4AG1A 1VCWA 3T62A 3KYGA 1MU6B 4A5TS 6CHAB 2RG3A 3IG6B 3ZZCA 4XOJA 1MBMA 4ZROA 4WJG2 5HGGA 1PPCE 2OINA 2V6NA 3T27A 1NBMD 2JETC 2EA3A 1TLDA 4U32A 5DP3A 3TK6A 2VVVA 1C9PA 1SQRA 4X2XA 2V35A 1CGIE 1Y3WA 1FIWA 4DT7B 4E05H 2J98B 1HBTH 4ASHA 1YCPH 6LPRA 2DE8A 1XKAC 1Z1JA 1ZLRA 4A1VA 1AI8H 2FS9A 4ZAEA 1UVOA 1YPGH 4X6OA 3U98H 2G4TA 4CRDA 4IW4E 1A7SA 2PGQB 5HM9A 1NRRH 3M5MA 1MQ6A 2GCTC 4JZEH 1MTNB 1K1LA 7LPRA 3U1JB 3UIRA 3MH6A 1TBZH 2O8TA 2WPHS 3GCTG 3RXLA 1U6QA 4Y8ZA 4F55A 1H8IH 1O5AB 3QZQA 1DXWA 4R0IA 3UR6A 1O3DA 1AFQB 2XC0A 3M3VA 1X7AC 1QJ6B 2ODYB 1UO6A 2UWPA 1TGBA 2ZHWH 3S69A 4X1NU 3SJ8A 1HJ9A 2FOGA 2TGDA 1OYQA 1WTHD 3SO3A 3LC3A 3NUMA 3SJOA 1OWEA 1KXAA 3PWCA 1DX5M 1GI6A 1BQYA 1HAZB 1AKSA 3L3TA 3MH4A 1C1TA 1C5RA 1UTPA 2SFAA 5FXLA 4A1TA 3T29A 4F48B 5T3HA 1V2VT 1B0FA 1YCPK 4MNYA 1ELAA 1PQ7A 5EJZA 1BZXE 2BDHA 2F9VA 5EG4A 4LZ4B 3HK3B 2QE7D 5JDUB 2BD3A 4I8LA 3SNBA 3ZYDA 4TYDA 5FBEA 3A8AA 1S85A 5CE1A 1HXEH 4YLUA 5KECA 4X8VH 1O3MA 3GYLB 3BIVH 2RCEA 3ZVAA 4YTAA 5C94A 2VVCA
chains in the Genus database with same CATH topology
2HLDD 3LKWA 3PRDA 1H8ED 4K8BA 2OBOA 2A4RA 5T1VA 3PV5A 2XOKD 3F2GA 2J5UA 3H09A 4B6EA 4B71A 3OEHD 4TT3D 2GGVB 3O8BA 4NWLA 1JXPA 3O8CA 5C0UA 3OAAD 4ZCNA 5EQRA 5ESBA 3F3BA 2OINA 4TSFD 3M5LA 2IJD1 5CHBA 1NBMD 3L6PA 4R8TB 3FOAA 5C0TA 2XNDD 5H4IB 1DXPA 1KMHB 2XNIA 3P8NA 3SU1A 3SUGA 5FPSA 4WH6A 2FOMB 1FX0B 1W3CA 2KR7A 2V7QD 2YMSD 4OM9A 1NBME 4A1XA 2QF5A 2WV9A 5IK2D 2KCYA 2XCNA 5FPYA 1EFRD 5F53A 3GS9A 1CU1A 3KEEA 3WWBA 1S6LA 1OHHD 3O8RA 2YMSC 4YXWD 3SUEA 2OC0A 3SV9A 4U01A 3ZIAD 2QF4A 2F9UA 5EPNA 4XD7D 2A4GA 2VBCA 4A1VA 2W6ID 2K1QA 2M2AA 3KNXA 4KTCA 2YMSB 2KZ4A 4NWKA 1W0JD 1E1QD 4I33A 4WH8A 5C17A 3SV7A 3WW7A 1RTLA 4RI0A 1N1LA 2JJ2D 2O8MA 3KF2A 3SUFA 4B75A 3SUDA 4ASUD 1NS3A 2K8IA 3M5MA 3P8OA 3AK5A 3F2HA 1BT7A 2QV1A 5EQSA 3OYPA 3U1JB 2CK3D 3SV6A 3EYDA 3SU5A 3NRLA 3DCLA 3RC6A 4JMYA 1COWD 2KCOA 5DSFA 1A1RA 3M5OA 3N7EA 2FP7B 1E1RD 5EQQA 5FL7D 2KFWA 4F55A 2OBQA 4B73A 4FETA 3N99A 3RC4A 3N7DA 3OTPA 1WXRA 3DSPA 3LOXA 2KM0A 3O8DA 2P59A 2WHXA 3SYJA 1DXWA 3F2FA 5GPIB 3SV8A 5DN6D 1DY8A 3OE7D 2OK5A 2KCPA 2L6OA 2JDID 1E79D 3PV2A 5B6LA 3E90B 2AHME 3F0PA 2K0QA 3F0OA 2OC7A 3DSOA 2F43B 3FN8A 5IDKA 3RC5A 5CDFE 3OFND 4I32A 3FKSD 1SKYE 3SZEA 1BMFD 3SU4A 2XCFA 4WF8A 2W6JD 5FPTA 3UB0A 3PRBA 4A1TA 3U1IB 3OEED 2JJ1D 5EPYA 2WPDD 3SU2A 4M9FA 3FO8D 3W1EA 5ETXA 2OC1A 4I31A 4B76A 2WSSD 4B74A 1W0KD 2F9VA 2F4LA 2LELA 2IJOB 3M5NA 2QE7D 4Q63A 3VG8A 5HKKD 2FM2A 4TYDA 4B6FA 2OC8A 4DT4A 1MABB 2A4QA 2KCAA 2JIZD 3KN2A 4Q4LA 3SU6A 4Z1MD 1H8HD 3SU3A 1RGQA 2GVFA 3SU0A 5GNDA 2WZQA 5GJ4B 2YOLA 3WWFA 3LONA 1DY9A 4A92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSO A;  3N7D A;  3N7E A;  3DSP A;  2KM0 A;  2K0Q A;  2LEL A; 
#chains in the Genus database with same CATH topology
 2HLD D;  4CHA B;  2VIV A;  1ETT H;  4TPY A;  1GMD G;  5T6G A;  1JIR A;  1AIX H;  2FOE A;  3PYH A;  3SQH E;  1O2P A;  2PFE A;  1IQN A;  5ESB A;  3K65 B;  1L4Z A;  3SJK A;  4R8T B;  4HZH A;  1LHE H;  2BYA X;  4UFD H;  1VCQ A;  4A1X A;  1UJ1 A;  5JB9 S;  5T6F A;  4ZHA A;  3CS0 A;  3ATM A;  2OC0 A;  1LO6 A;  2GTB A;  5JYI A;  1YP9 A;  1KYN A;  1ZGV A;  2F9U A;  4DUR A;  3E0P B;  3ODF A;  1TPO A;  3I78 A;  3MNC A;  2XBY A;  2ZFF H;  4AZ2 B;  1OWH A;  2GZ7 A;  3GY6 A;  1FY1 A;  1ZPB A;  3A8B A;  2JH5 D;  5EU8 A;  3SUF A;  5GCH F;  3MOC A;  1O5B B;  1B5G H;  1GI8 B;  1QY6 A;  2H5D A;  5F03 A;  4CRA A;  3PO1 C;  4K1T A;  3OYP A;  2VWM A;  3VEQ B;  1Z71 A;  4E7R G;  3RC6 A;  1EAT A;  3LGU A;  1COW D;  3NKK A;  3UQV A;  5L2Z H;  3ZVB A;  5L2Y H;  2BTC E;  2ZU3 A;  2KX4 A;  1NFW A;  1GBL A;  7GCH F;  1C5Y B;  3SV8 A;  3I29 A;  1EJN A;  3TIT A;  2WUB A;  5T6D A;  2B8O H;  1EB2 A;  2GDD A;  3MNB A;  1PYT D;  2GZ9 A;  4I86 A;  4WWY A;  4KKD A;  2XTT B;  1IAU A;  5C1Y A;  3OU0 A;  1W8B H;  1Y5U T;  3Q77 A;  3OFN D;  5CDF E;  1QHR B;  2EST E;  2LNC A;  1OWI A;  3B23 B;  1P01 A;  3M61 U;  3B9F H;  1QL7 A;  1Z6E A;  2QAA A;  1FPC H;  1L4D A;  2NU3 E;  2BB4 A;  1C2J A;  2ZQ2 A;  1TAL A;  1NPM A;  2ZCK P;  1ETR H;  5DP8 A;  3RXE A;  5DP5 A;  1YCP M;  1LKA A;  2BLW A;  1NC6 A;  3E1X B;  3KN2 A;  3M3T A;  1SLV B;  5JBA S;  1NRQ H;  2ZPQ A;  1AQ7 A;  1SVP A;  1XVO A;  3OSY A;  3TJN A;  3QWC H;  1WU1 A;  1WDI A;  3UQO A;  3R0F A;  4B6E A;  1GI9 B;  1JXP A;  1C5S A;  1CGH A;  3RUO A;  1TGT A;  4AN7 A;  3MU1 A;  1CQQ A;  1A5H A;  3SNA A;  3ZZ9 A;  3L33 A;  4M7G A;  2FOF A;  3BTM E;  2QGR A;  4ZXY H;  2FYQ A;  2WV9 A;  1D6W A;  2KCY A;  4IMQ A;  1DIC A;  3DHK H;  5FPY A;  1FIZ A;  3GS9 A;  4Y0Y E;  1ELC A;  1NRP H;  3RML H;  1P2M A;  1GGD B;  4U01 A;  2P95 A;  8EST E;  2GDE H;  1PJP A;  2ANY A;  1TNJ A;  2VBC A;  2VID A;  4NZL A;  4LXB H;  5DK1 A;  1TWX B;  1UCY E;  1ESA A;  1O30 A;  4B75 A;  4NSY A;  3K6Z A;  2XW9 A;  1PPG E;  1WUN H;  4ZH8 A;  1BT7 A;  5TCC A;  5GWZ A;  2PTN A;  3PTB A;  1BML A;  2ZF0 H;  4GHQ A;  4GHT A;  2P8O B;  4INL A;  2IN2 A;  1F7Z A;  1QZ8 A;  2KFW A;  1XUG A;  3MH5 A;  4VGC B;  1ABI H;  5EST E;  2ZCL P;  2WPI S;  3N7D A;  1GDN A;  1FLE E;  3O8D A;  3F68 H;  4F4O C;  3T2N A;  2BMG B;  4X6N A;  2HNT E;  3RMM H;  2OD3 B;  1Y3Y A;  3UAI C;  1OWK A;  3ODD A;  2SGA A;  1ZSJ A;  3CP7 A;  1EOJ A;  3TNS A;  1BHX F;  3EE7 A;  3GOV B;  1WTG H;  1O2G H;  1A0J A;  4F49 A;  3VXE H;  3FN8 A;  1SGP E;  8GCH F;  1A61 H;  2B0F A;  1CHO G;  2OCV B;  3SU4 A;  1HJA B;  2NU1 E;  2SGQ E;  3UY9 A;  5A8X A;  3F9F A;  4Y79 A;  1TMB H;  5K7R A;  3SJI A;  1O3B A;  4FUG A;  2WPD D;  3SU2 A;  1MTW A;  4M9F A;  1BRU P;  2G55 A;  2PKA B;  1YYY 1;  1O3O A;  1TGN A;  5E2P A;  4D9Q A;  1K1I A;  4B6F A;  1C5L H;  1UCY H;  2ZWL H;  1TRY A;  4JYT A;  2BD4 A;  3ZZA A;  3UNR A;  2BLV A;  3F2G A;  1VJA U;  3A88 A;  2VIQ A;  2VWO A;  4ZCN A;  4H6T A;  2IJD 1;  3QGN B;  5CHB A;  4ZKR U;  1O38 A;  5KED A;  1GG6 B;  1IQM A;  5H4I B;  3FAO A;  3MU5 A;  1FAK H;  3P8G A;  1NM6 A;  3BTH E;  3VB5 A;  2YNA A;  3RXC A;  1QCP A;  5F53 A;  1N8O B;  3W94 A;  2OTV A;  1T32 A;  2THF B;  2VIW A;  4BAM B;  1QQU A;  3ENS B;  4K1S A;  3STI A;  2GCH F;  1INC A;  2R3U A;  5EPN A;  2AGG X;  3PB1 E;  1ZTL A;  1DIT H;  1HIA B;  4NWK A;  1GJ8 B;  1GBA A;  1E1Q D;  4P00 A;  2EEK A;  4DY7 B;  1GDQ A;  3RLW H;  2O8M A;  3GY4 A;  2WPK S;  1T8O A;  2ZU4 A;  3RU4 T;  1HAH H;  1V2M T;  3FZD A;  1NZQ H;  1O31 A;  4IGD A;  1UCY K;  1F0S A;  3IIT A;  3LPR A;  3DCL A;  1AB9 C;  4JMY A;  3A86 A;  2TBS A;  1GCD A;  2PKS C;  1TX6 A;  3HGN A;  3MU0 A;  3A7Z A;  4FVB A;  2FXR A;  2OUA A;  1MMJ N;  2AYW A;  2TPI Z;  2XWB I;  1K1P A;  4UFF H;  4CRE A;  5HXF A;  1SLW B;  3TH2 H;  1E38 B;  1T8L A;  1D3Q B;  2BDY A;  2CMY A;  2PUX B;  4GCH F;  1CA8 B;  5B6L A;  2XBX A;  3E90 B;  1GBJ A;  4XFQ A;  1HLT H;  3ZZ7 A;  5IDK A;  1TOM H;  1C1W H;  2B7D H;  5E0G A;  4I8K A;  1S83 A;  1MTV A;  2AEI H;  2FI3 E;  3BEF B;  4XBC A;  1QL9 A;  1EZQ A;  3GY2 A;  4ZMA H;  1SSX A;  1J8A A;  1F0U A;  1GJ5 H;  1LHG H;  2G4U A;  4Q80 A;  1YPK H;  3ATW A;  4OS6 A;  1XMN B;  1ZTJ A;  2GT7 A;  1H4W A;  3OX7 U;  1P2N A;  1QJ7 B;  2IOT A;  3WWF A;  2JKH A;  1ZSL A;  2VGC C;  3PMH B;  2V0B A;  1GJ7 B;  3U69 H;  1WCZ A;  2FTL E;  1LVO A;  3PV5 A;  1A3E H;  4J2Y B;  1MCV A;  1G3B A;  4B71 A;  2WYG A;  4ACB A;  1AND A;  1BMN H;  1G3E A;  1SOZ A;  5C0U A;  3KID U;  1KXB A;  3CS7 A;  4ABD A;  1IQG A;  1LPZ B;  2VNT A;  2DUC A;  1ELG A;  4X6M A;  1C5V A;  1TON A;  3GCO A;  2BLO A;  5TCA A;  4K2Y A;  2VB0 A;  1S6L A;  1XUI A;  3LT3 A;  3Q3K A;  3V13 A;  1O3G A;  3NZI A;  1WQV H;  1QGF A;  3UOU A;  2UWO A;  2BD5 A;  5DPA A;  2QCY A;  2I6S A;  2LPR A;  2UUJ B;  1UMA H;  1UHB B;  1GHB G;  2K1Q A;  4KTC A;  1GHX H;  2NWN A;  3A7Y A;  2ZGC A;  3RXP A;  6GCH G;  1CT0 E;  5CMX H;  1SGI B;  1BHX B;  1EZX C;  3WW7 A;  7EST E;  2BD7 A;  2C90 B;  1O2K A;  1DWC H;  3UFA A;  1QBV H;  1P3C A;  1FI8 A;  5FX6 A;  2BZ6 H;  5DJ7 A;  5DSF A;  3M5O A;  2Y80 A;  4NSV A;  1KXC A;  4JYV H;  3RMN H;  1AN1 E;  3KCG H;  3H7T A;  2FOB A;  5JB8 S;  3JZ2 B;  3DFL A;  1SPJ A;  3BEU A;  2R0K A;  5GPI B;  1G32 B;  1O3N A;  3PV4 A;  3ATI A;  1GI3 A;  1Y3U A;  3MO9 A;  1C5N H;  1UK4 A;  1BMM H;  1BDA A;  4OS5 A;  4XSK U;  2J97 A;  4Q7Y A;  2AHM E;  4ABF A;  1O2V A;  3M7U A;  3VGC B;  1SG8 B;  4CBN A;  1Q31 A;  1G2L A;  1B0E A;  1E37 B;  4GUX A;  1T7C A;  4FUB A;  4GLY A;  1NRO H;  2G51 A;  4FXG H;  1FN6 A;  1HAX B;  4NIX A;  3H5C B;  3W1E A;  3P95 A;  2WSS D;  3MU4 A;  2IJO B;  2ZGX H;  4BAO B;  1GBC A;  2F83 A;  2AIP A;  2WPJ S;  3UOP A;  1GJB B;  2UUF B;  3AAV A;  1BBR E;  4ZHL U;  1MAB B;  1XUH A;  1Z8R A;  5HIY A;  1VGC B;  4YO9 A;  1FUJ A;  4ISN A;  3E3T A;  1WQS A;  3KHV A;  2ZQ1 A;  1BTU A;  3RXO A;  1LKB A;  1AUJ A;  1P2Q A;  4OS7 A;  4Y7A A;  3GCT F;  1IHS H;  3P6Z B;  4DG4 A;  1P9U A;  2AS9 A;  3I77 A;  2A5I A;  4SGA E;  1Y8T A;  1C1P A;  2BY7 X;  1KIG H;  2A7C A;  2BOH B;  1Y5B T;  3GDV A;  4BTU B;  5E2O A;  1KDQ A;  1K1J A;  2QF0 A;  3W95 A;  4Y10 E;  3ZVE A;  3RXI A;  1G2M A;  2XC4 A;  1GHY H;  1DST A;  1EQ9 A;  1UVT H;  1K1N A;  1DUE A;  5CHA B;  4YXW D;  1SI5 H;  4AC9 A;  2VU8 E;  1SQT A;  1VIT H;  4MDS A;  1WOF A;  4FUJ A;  9EST A;  2RDL A;  1RIW B;  2XRC A;  1GBB A;  2ZZU H;  2W5E A;  4K5Z A;  3P17 H;  2RFK C;  4K1E A;  2W7S A;  1H9I E;  2BM2 A;  3ZVD A;  2PTC E;  5FHT A;  1LPK B;  1O5F H;  1LHC H;  4H4F A;  4P02 A;  1DE7 H;  1AKS B;  3DA9 B;  4ABB A;  1A2C H;  2EC9 H;  1DS2 E;  1GMD F;  3QO6 A;  3LU9 B;  4FET A;  1TAW A;  2ZC9 H;  3M35 A;  3RXG A;  1CT4 E;  1O5E H;  4ISH H;  1C2G A;  1SLU B;  2JDI D;  1TNI A;  2BD8 A;  5E0H A;  1TIO A;  1IHT H;  1W0Y H;  4ABI A;  3GIC B;  5I25 A;  3DSO A;  5C20 A;  1TB6 H;  1SQA A;  2GX4 A;  1L0Z A;  1J15 A;  1C4Y 2;  1SKY E;  2NU4 E;  3ELA H;  4YES B;  2ILN A;  2CXV A;  2W6J D;  1AUT C;  2C93 B;  1FZZ A;  1O2S A;  3BTK E;  4NA8 A;  3Q00 A;  1QR3 E;  3ZZ6 A;  4AFU A;  4I31 A;  4YT6 H;  3EE0 B;  4MPV A;  4X2Y A;  2V3H H;  2BXU H;  2R0L A;  3EST A;  3UWJ H;  1KLT A;  5HKK D;  3JZ1 B;  3C27 B;  1OX1 A;  3BG4 B;  4NFF A;  2FOH A;  2JIZ D;  3ITI A;  1HAO H;  2P3U B;  1ZJK A;  2I6Q A;  5C2Z A;  1FY8 E;  3LGV A;  3TGI E;  1GJ6 A;  2GMT B;  2HVX A;  5EIY A;  4RKJ B;  3BIU H;  4UEH H;  1GCT C;  2XBV A;  1YY3 A;  3MMG A;  1C2D A;  3RXF A;  1DAN H;  1QBN A;  1GBF A;  1HAG E;  2BD2 A;  1EJM A;  1YF4 A;  1H9L B;  2ASU B;  5AHG H;  3F9E A;  4H6S B;  1QA7 A;  2Z7F E;  1HV7 A;  4OM9 A;  3QN7 A;  2ZFT A;  1O3K A;  4Y76 A;  1QL8 A;  5B6O A;  1TBR H;  4AX9 H;  1C4V 2;  5C5N A;  1DLE A;  3QGJ A;  4TY6 A;  1V2N T;  1T4V H;  3ZVC A;  2QXI A;  3WY8 A;  4AB8 A;  4SGB E;  1SLX B;  1C2E A;  5A8Z A;  2FZZ A;  1H9H E;  1O37 A;  4JK5 A;  1EPT C;  2HAL A;  1TGC A;  1O5G H;  1IQF A;  1S6F A;  2UWL A;  2ZPR A;  2BVR H;  4MQA A;  3RM2 H;  2FIR H;  3UR9 A;  2QV1 A;  3SNE A;  1W7G H;  1F0T A;  4E7N A;  3SU5 A;  3MO3 A;  1GMC G;  5AFY H;  4UFG H;  1G3C A;  1HCG A;  1RJX B;  1TPP A;  2BDB A;  2BOK A;  1C9T A;  2VIN A;  3VGC C;  3GY8 A;  1RTK A;  3VPK A;  1VIT G;  5DN6 D;  3MFJ A;  2OK5 A;  2H6M A;  1GJ4 H;  1E79 D;  2ZFR H;  1A3B H;  4WVP E;  3ZYE A;  2ZTY A;  1SGY E;  2FX6 A;  1UTO A;  1C1N A;  2AFQ B;  4WY3 A;  2ZFS A;  2OC7 A;  2STA E;  3FP7 E;  3TU7 H;  3TJO A;  1ZSK A;  1A46 H;  1GHA G;  3A81 A;  3BN9 A;  1P3E A;  1IQJ A;  4YLQ H;  2SGD E;  3MYW A;  3MU8 A;  1GL0 E;  1QBO A;  2ZHQ H;  2GZ8 A;  3U1I B;  2ZPS A;  2PV9 B;  3V0X A;  1AO5 A;  1GJA B;  3D62 A;  1S81 A;  4Q63 A;  3UNQ A;  2UUK B;  2FM2 A;  1YPJ H;  1QB6 A;  1P03 A;  1NN6 A;  3RXM A;  1NY2 2;  2GVF A;  1C2I A;  3SU0 A;  1D6R A;  1BTZ A;  2HPQ H;  5K0H A;  1A0H B;  4HI3 A;  1GWA A;  3LON A;  1ACB E;  1SL3 A;  1C1M A;  3HK6 B;  3LKW A;  5LPR A;  3AAU A;  5AF9 H;  2BXT H;  3OY5 U;  2XOK D;  2TIO A;  4ABA A;  1AVW A;  1OP2 A;  1F5K U;  1TE0 A;  1HAV A;  2ZDN A;  5EXM A;  4NWL A;  3O8C A;  1CBW B;  5SGA E;  1P2O A;  5A8Y A;  4X8S H;  1C1S A;  2D26 C;  4AFQ A;  5CHA C;  1ANC A;  1YPH C;  1EP5 A;  1XKB C;  1V3X A;  1DXP A;  4Y11 E;  1FX0 B;  1YLN A;  4AOR A;  3M7T A;  6CHA C;  4XBD A;  4ABJ A;  4BXW A;  1MD7 A;  1HAP H;  1C1U H;  3RXT A;  1D4P B;  2NU2 E;  3F9G A;  1CU1 A;  3KQE A;  3WWB A;  1O0D H;  1CHO F;  6EST A;  1QQ4 A;  2BDI A;  3EA9 A;  3ZIA D;  3QX5 H;  4AOQ A;  2BY5 X;  4LZ1 H;  2P3T B;  2HPP H;  2ZP0 H;  1O2J A;  1GI4 A;  4Q7Z A;  1KY9 A;  5DP6 A;  2R2W U;  1V2O T;  4OS1 A;  3QUM P;  3SJ9 A;  1QB9 A;  2JJ2 D;  1GI1 A;  1O5D H;  3SZN A;  1TRM A;  1GHV H;  1L1N A;  1G36 A;  2A4O A;  4RT1 A;  1XUJ A;  1O35 A;  1O2N A;  3F2H A;  3GY5 A;  3C1K A;  3PRO A;  1RTF B;  3P70 B;  4UD9 H;  2CK3 D;  1P02 A;  1O2O A;  4A7I B;  3RXU A;  4RSP A;  2TGT A;  3ZZB A;  3GCH B;  1K1M A;  4K3J A;  3S0N A;  1Z8I B;  4X1P U;  4GVU A;  1QRW A;  1FQ3 A;  1BMA A;  1M9U A;  3DSP A;  4BTT B;  2WHX A;  1E36 B;  1MTN C;  1O2H A;  1FNI A;  3TH3 H;  4TWW A;  5F8X A;  2GV6 A;  5LPF A;  1P57 B;  1NU7 B;  2QYI A;  1CO7 E;  4I8H A;  4NCY A;  1A5I A;  2ZNK H;  3F0O A;  1UTK A;  1W13 U;  2BDA A;  3TLO A;  4ISO A;  1YGC H;  2F43 B;  3TNT A;  1BJV A;  5DO4 H;  3FKS D;  3PMJ A;  1AZ8 A;  3E91 A;  1AFQ C;  5DP9 A;  2AIQ A;  1W7X H;  5EGM A;  3BTQ E;  2JJ1 D;  1BRB E;  4IC5 A;  1BA8 B;  1C2L A;  4H42 U;  3SI3 H;  3VB6 A;  4KP0 A;  2W7U A;  4B76 A;  1EZU C;  1K28 D;  1ZGI A;  4Y6D A;  3RM0 H;  2VWL A;  1GVL A;  1TQ0 B;  1RGQ A;  2IPQ X;  1CT2 E;  4FUH A;  1V2K T;  2ANW A;  3ZZ5 A;  3A83 A;  3LGI A;  1HRT H;  4AB9 A;  2CJI A;  1L2E A;  3TVJ B;  4K8B A;  1XXD A;  2A4R A;  4JK6 A;  1CA0 B;  1P09 A;  1G9I E;  3RU4 E;  1V2P T;  1HNE E;  3S9C A;  4JZD H;  1GJD B;  1XM1 A;  3NWU A;  5EQR A;  1SOT A;  2Q6D A;  1TMT H;  2FI5 E;  2J9N A;  4X0W U;  1Y3X A;  4AG2 A;  1FDP A;  1QRX A;  4CHA C;  2HRV A;  5FPS A;  1V2W T;  1DWE H;  3SND A;  1SR5 C;  1FMG A;  3PM3 A;  4XDE A;  1Z7K A;  4FUF A;  3AW1 A;  2QXJ A;  1ZTK A;  1MZA A;  3SUE A;  2C8Z B;  4OGY A;  1SFI A;  5HIZ A;  4E06 H;  1W0Z U;  3U9A H;  1JRT A;  1VJ9 U;  1P12 E;  2D8W A;  5DP4 A;  2KZ4 A;  1OS8 A;  2EQN A;  5DP7 A;  1FY3 A;  3A84 A;  1O2Y A;  4AYV B;  1FY5 A;  2DE9 A;  4AGJ A;  1NT1 A;  1WBG B;  1BOQ A;  2FOD A;  1HAY B;  1MAY A;  3CNR A;  3GDU A;  4YT7 H;  3CEN A;  2C4F H;  1BUI A;  2AER H;  2HGT H;  1Y3V A;  4IN2 A;  1BIO A;  1YBW A;  2FP7 B;  4D8N A;  2OQU A;  1IQE A;  4Y0Z E;  1B7X B;  1T8N A;  2ZEB A;  3N99 A;  3TGJ E;  4A6L A;  3GYM A;  1W11 U;  1MU8 B;  3F2F A;  3NPS A;  4MPX A;  4DW2 U;  1ZRK A;  5KGO A;  2ALV A;  3ZVF A;  3F1S B;  3F6U H;  5JBT A;  1IOE A;  1P04 A;  1YM0 A;  2ZU2 A;  1UTM A;  1F5R A;  1JWT A;  2Q6G A;  2ZGH A;  2A7H A;  1K22 H;  1BTX A;  4X2V A;  4D7G A;  1YLC A;  1BRA A;  3BTW E;  2R2M B;  2AMD A;  5JBB S;  2FX4 A;  2D1J A;  2OC1 A;  3FP6 E;  1K1O A;  1GHB F;  7KME H;  3S9B A;  1PPE E;  6GCH F;  1MD8 A;  1PQ5 A;  2SGP E;  3VG8 A;  3ZV9 A;  5J4S A;  2A1D B;  1V2R T;  3ZZD A;  1DLK B;  1CE5 A;  1XVM A;  3MWI U;  5EJL A;  1TX8 A;  5EOK A;  3OTJ E;  2BZA A;  2JET B;  2CHA B;  2CV3 A;  1C5X B;  1LMW B;  1SMF E;  1DY9 A;  4MPU A;  3SN8 A;  4A92 A;  2ZU1 A;  1AVG H;  1FON A;  1GVZ A;  1C5Z B;  2PGB B;  1SGC A;  2ALP A;  2HNT F;  3OEH D;  2GGV B;  2Z3C A;  4ABG A;  1LPG B;  3PLK A;  1DSU A;  1ZOM A;  3TJV A;  4DJZ B;  4KTS A;  4KGA A;  1L1G A;  1OKX A;  2BVS H;  1RXP A;  2GKV E;  2ZHD A;  1T4U H;  1AGJ A;  1TPA E;  3U28 C;  3SUG A;  4WH6 A;  5L6N H;  1DWD H;  2GP9 B;  2F9P A;  2YMS D;  3A8D A;  1H8D H;  4HG6 A;  4ABH A;  4MNV A;  3O8R A;  1GJC B;  4NGA H;  5FCK A;  1C5U A;  2GCT B;  1ETS H;  1ZHM A;  2PSX A;  2P93 A;  2VIP A;  2WV4 A;  5GIB A;  1O2R A;  1C5Q A;  2F9O A;  2W6I D;  1TX7 A;  2FES H;  1O3I A;  4OGX A;  2VH6 A;  4I33 A;  1GI2 A;  5PTP A;  3TJU A;  2J34 A;  3SOS A;  3LGT A;  1GGD C;  2P3F H;  4Y8X A;  1O2Z A;  3URE A;  1NRS H;  3F9H A;  5EQS A;  2WPM S;  3SV6 A;  1VKY A;  3GDS A;  1A1R A;  1RRK A;  3N7E A;  1XUK A;  5EQQ A;  4ZKS U;  5F8Z A;  4X1R U;  1EKB B;  5TJX A;  4B73 A;  1QNJ A;  1Y59 T;  1LHD H;  1NFY A;  3E6P H;  4IN1 A;  1UK2 A;  1KTT B;  5HYO A;  1DT2 A;  1V2Q T;  2EI7 A;  1TGS Z;  4AFZ A;  4X2W A;  3S7K B;  2P94 A;  1P2I A;  4FUE A;  5EOD A;  2P8O C;  2FYR A;  1PPZ A;  4VGC C;  4AYY B;  3D23 A;  4XE4 A;  1O33 A;  1LTO A;  1SB1 H;  1O2X A;  5A0C A;  1TRN A;  9LPR A;  1ID5 H;  5F8T A;  3UB0 A;  1W10 U;  4JZ1 A;  1NRN H;  1TNG A;  4CH2 B;  1BIT A;  4DOQ A;  2A7J A;  1TOC B;  1C2M A;  3TK5 A;  1BRC E;  1F0R A;  1MUE B;  3EGK H;  4X8U H;  1W0K D;  4D9R A;  2LEL A;  3NK8 A;  3H7O A;  3MH7 A;  2ZFP H;  1DWB H;  3QZR A;  1KDQ B;  2AGE X;  3KQ5 A;  1PQ8 A;  1HJA C;  2A32 A;  4B1T A;  2BX3 A;  3HKJ B;  3SU6 A;  3U8T H;  5DGJ A;  3VFE A;  2ZHF H;  3TK9 A;  5A09 A;  1MQ5 A;  1C2F A;  2CF9 H;  4BAK B;  2H9T H;  2G5N A;  1THR H;  2FPZ A;  1G30 B;  2G81 E;  2NU0 E;  3H09 A;  5BRR E;  4WME A;  4UON A;  1O39 A;  4AFS A;  3OAA D;  2HOB A;  1C2K A;  2BQ7 B;  3EDX B;  3U8O H;  4TSF D;  3M5L A;  3LJO A;  2Y5G A;  1DUA A;  3T26 A;  1AHT H;  3ATK A;  1TPS A;  2OXS A;  2PWX A;  3FAN A;  4J1Y A;  3ZV8 A;  3D49 H;  1NBM E;  3KQD A;  2XCN A;  1N6Y A;  1LCY A;  3KEE A;  4PRO A;  1PPF E;  2VVU A;  4ZKN U;  2OLG A;  2ANM H;  1EST A;  1KLI H;  3GCN A;  3URC A;  1GMH G;  1FY4 A;  3PO1 B;  1E0F D;  4JYU H;  1GG6 C;  4Y7B A;  3BSQ A;  1OP8 A;  4ZKO U;  2Z9J A;  1EAX A;  1HUT H;  2VH0 A;  2WV5 A;  5JBC S;  1EAW A;  1MKW H;  3KL6 A;  2ZGB H;  3BTT E;  1IQI A;  1N8O C;  5FBI A;  5A2M H;  1BTW A;  4ZUH A;  3PTN A;  4WXV A;  4CR5 A;  2G8T A;  1NS3 A;  4ASU D;  5LH8 A;  1H1B A;  5ABW A;  1EPT A;  1SQO A;  3TGK E;  3BTF E;  2FLR H;  1ELV A;  1F2S E;  1AZZ A;  3QDZ B;  3V7T A;  1KLJ H;  1T31 A;  2B9L A;  2QXH A;  2Z6B D;  3BF6 H;  3RC4 A;  3OTP A;  2KAI B;  2KM0 A;  3SYJ A;  2Z9K A;  1JRS A;  3MHW U;  4BNR A;  1ARC A;  1YPE H;  4O3U A;  1ZMJ A;  1QA0 A;  1P0S H;  1ELB A;  1IQH A;  4EST E;  1P2K A;  1A5G H;  2YNB A;  2H1U A;  2BY6 X;  3IWM A;  2ZI2 H;  1TMU H;  1SC8 U;  3BEI B;  1THS H;  2Q1J A;  4X6P A;  5AFZ H;  4FUC A;  3RC5 A;  1BBR H;  4GAW A;  2JH0 D;  5FAH A;  1ZR0 A;  4U2W A;  1MAX A;  2C8W B;  1HFD A;  2Z94 A;  5C1X A;  2SNW A;  3RXA A;  4DGJ A;  3UUZ A;  1GBH A;  2Y82 A;  4MNW A;  4X8T H;  2ZDK A;  1SFQ B;  2F4L A;  2CHA C;  4UE7 H;  4YOI A;  3Q3Y A;  1AU8 A;  1GL1 A;  1MKW K;  1TYN A;  1YLD A;  4I8J A;  1PFX C;  2EY4 C;  1G37 A;  2A4Q A;  3RXD A;  3UPE A;  2J95 A;  3SU3 A;  4CRF A;  1ORF A;  2BDC A;  1ZZZ A;  5GND A;  2ZA5 A;  1PYT C;  4GSO A;  3SQE E;  1OP0 A;  1JOU B;  3TIU A;  3SV9 A;  1EAS A;  1OSS A;  1GMC F;  3LGY A;  4AGK A;  2OBO A;  1EX3 A;  1XUF A;  4IMZ A;  5T1V A;  1C5W B;  3ZVG A;  5JPM H;  1ZMN A;  2B5T B;  3MNS A;  1VZQ H;  2KAI A;  3RXB A;  4CBO A;  1VIT F;  3F3B A;  3A85 A;  3M7Q A;  4BAN B;  3SV2 H;  5EXL A;  3V3M A;  3MQK C;  3SU1 A;  1C5M D;  4NG9 H;  1WV7 H;  2VJ1 A;  4MNX A;  5IK2 D;  1GHA F;  3PWB A;  1EFR D;  1SHY A;  1ZJD A;  4DCD A;  1ABJ H;  4HTC H;  5EW2 H;  1PPB H;  2OQ5 A;  1A0L A;  4ISI H;  1BBR K;  1V6D A;  2RDE A;  1K9O E;  1O3H A;  1O2I A;  1AMH A;  1BCU H;  2W26 A;  2ZTZ A;  2EI8 A;  2A4G A;  3ZZ4 A;  1GJ9 B;  1QFK H;  3VB3 A;  1L1J A;  2YMS B;  1W0J D;  2QN5 T;  4OS4 A;  2BHG A;  2FS8 A;  2K8I A;  3P8O A;  1TA2 A;  1VCP A;  3EYD A;  1AWH B;  1ELT A;  2V3O H;  1CVW H;  2FO9 A;  2J98 A;  4GPG A;  4BAH B;  1GHW H;  2ODP A;  2ODQ A;  2WUC A;  1SGF A;  5GDS H;  3STJ A;  2R3Y A;  1WSS H;  1P06 A;  3A7V A;  2KCP A;  2EI6 A;  2G52 A;  2AGI X;  3A87 A;  1C5O H;  1GI0 A;  3V12 A;  4D7F A;  1UW7 A;  1SGR E;  5LGO A;  2PHB A;  2FLB H;  3E0N B;  1Y5A T;  1BTH H;  2O8L A;  2Y7Z A;  4JCN A;  2BX4 A;  3KQB A;  2Q6F A;  2FOA A;  4NIY A;  4OS2 A;  2AMP A;  2A2X H;  2VIO A;  1BTY A;  3VXF H;  2BY9 X;  4INK A;  1HAV B;  4X1S U;  4BTI B;  1C1Q A;  1AD8 H;  5ETX A;  3EQ0 H;  3MNX A;  4IBL H;  3T28 A;  3FP8 E;  1E34 B;  1C5T A;  4FUD A;  3U8R H;  1LVM A;  2A31 A;  2GJG A;  4CH8 B;  1DPO A;  3B8J A;  2OC8 A;  1GVK B;  3RXS A;  1Z8J B;  1P05 A;  1O32 A;  1NTP A;  2KCA A;  1OXG A;  4Z1M D;  4WMF A;  2HVY B;  1NFU A;  2WYJ A;  3R3G B;  1OOK B;  1YWU A;  3DUX H;  1SGD E;  4TPI Z;  2WZQ A;  2ANK H;  1TNK A;  1C5P A;  2ZIQ H;  1H8E D;  4NIV A;  1N6X A;  2J5U A;  4TT3 D;  4I7Y H;  1LDT T;  3NXP A;  3LJJ A;  4ACA A;  2RA0 A;  1NO9 H;  1VGC C;  2H9H A;  4K60 A;  2OP9 A;  1SHH B;  1KMH B;  1O2T A;  3P8N A;  4MLF B;  2FOM B;  2J38 A;  1C1R A;  2C8X B;  1EP6 A;  1YKT A;  1O3J A;  1D3T B;  1HXF H;  2WIN I;  2CF8 H;  4TWY A;  1D3P B;  2UUY A;  1AE5 A;  3ZZ8 A;  1UTJ A;  1S0Q A;  2R9P A;  5E0J A;  4DVA U;  5FX5 A;  2XXL A;  3SGA E;  1AB9 B;  2M2A A;  4HFP B;  2PKS B;  1MKX H;  2QF3 A;  3SV7 A;  4INH A;  2SNV A;  4B2A A;  4MG3 A;  1HDT H;  4KEL A;  1J9C H;  1KTS B;  3SUD A;  3AK5 A;  2BDG A;  1S5S A;  1Z8G A;  1S84 A;  1MTS A;  5A0B A;  1ANB A;  4RKO B;  4NZQ A;  1GBI A;  1RIW C;  2KCO A;  2TGP Z;  5I46 H;  4QT8 C;  1QUR H;  1GHZ A;  1EOL A;  1XXF A;  3K9X B;  4U30 A;  2GV7 A;  1F5L A;  3S7H B;  1O3L A;  5IYT A;  2Y7X A;  2HNT C;  3SNC A;  3NCL A;  2AH4 X;  1AWF H;  1TNL A;  2TRM A;  3BTG E;  3UNS A;  1K21 H;  5FCR A;  5DKM A;  3A7T A;  4Z0K A;  3GY3 A;  4I32 A;  1EZS C;  1C1O A;  3EA7 A;  4WF8 A;  2O9Q A;  3PRB A;  3P92 A;  5EXN A;  3FFG A;  2ZFQ H;  3G01 A;  1HYL A;  3A7W A;  1K2I 1;  3FO8 D;  2VGC B;  3AW0 A;  2IPH A;  3GY7 A;  4DIH H;  3M5N A;  4FVD A;  1ZHR A;  4KTU A;  1W2K H;  1O2U A;  2BD9 A;  5G4B A;  1MKX K;  1Q2W A;  4DT4 A;  5GCH G;  3D65 E;  1KXD A;  2PUQ H;  4LOY H;  3TH4 H;  2Y6T A;  1LQE A;  2HLC A;  2Y81 A;  2YOL A;  4LK4 A;  4BXS A;  1BJU A;  3SHA H;  5C67 A;  3DT0 H;  3OY6 U;  7GCH G;  3BG4 C;  2GT8 A;  4Z6A H;  1HB0 B;  1SGQ E;  1C4U 2;  3HGP A;  4I8G A;  2A5A A;  1FN8 A;  1GBD A;  2SGE E;  2GMT C;  1EB1 H;  1MZD A;  3AAS A;  1O34 A;  1O3C A;  1YPH E;  2XNI A;  1O36 A;  3DFJ A;  3HAT H;  4JZF H;  2Z3D A;  1EXF A;  2KR7 A;  2D2D A;  4FU9 A;  2HWL B;  1JIM A;  3A80 A;  2A0Q B;  2QF5 A;  2G00 A;  2YMS C;  2BQW B;  2SGF E;  1JBU H;  4X1Q U;  3M36 A;  1HAI H;  1QTF A;  1S82 A;  2QF4 A;  1P8V C;  3KYF A;  1ZPZ A;  4XD7 D;  1EAU A;  5J4Q A;  2H2Z A;  3KNX A;  1Z1I A;  4WH8 A;  5C17 A;  2VWN A;  2ZO3 H;  3EAJ A;  2PSY A;  4O9V A;  2P16 A;  1EJA A;  1QB1 A;  1EAI A;  2ZDV H;  3PLB A;  1ELE E;  4JZI A;  1YPM H;  5AVD A;  4NA7 A;  1S6H A;  2WPL S;  2F9B H;  2ZU5 A;  4Y8Y A;  5DG6 A;  4XBB A;  1MBQ A;  1CHG A;  4YZU A;  3SGQ E;  2PLX A;  1KSN A;  2ULL A;  1OWJ A;  4RT0 A;  3MO6 A;  1S0R A;  1OWD A;  3M37 A;  2TGA A;  1UTQ A;  1SGN E;  3RMO H;  1QRZ A;  5LPE A;  1ESB A;  3F0P A;  2K0Q A;  4MVN A;  3FZZ A;  3M3S A;  3T5F H;  5C1U A;  1ANE A;  1O3A A;  1SBW A;  2QY0 B;  3OEE D;  5EPY A;  3UTU H;  1PPH E;  1ZYO A;  3QTO H;  1IQK A;  2F9N A;  1FV9 A;  3PMB B;  4BOH A;  1KXF A;  1GDU A;  1XX9 A;  4UDW H;  1MH0 A;  1V2S T;  2STB E;  3TPI Z;  3S9A A;  2AMQ A;  3BG8 A;  4ZXX H;  1HGT H;  2ZGJ A;  1D9I A;  2J92 A;  2Y5F A;  2QC2 A;  3BTD E;  4CRG A;  3QK1 A;  2O8U A;  2FMJ A;  1V2U T;  1NU9 A;  3LC5 A;  4YOJ A;  3SOR A;  3RU4 D;  4TY7 A;  5EJ1 A;  1A4W H;  1LHF H;  3PRD A;  1K0H A;  1C2H A;  2CGA A;  2ZEC A;  1P2J A;  2QXG A;  2CN0 H;  2PKA A;  4CRB A;  3AVZ A;  3A8C A;  3T25 A;  3L6P A;  1DM4 B;  1V2L T;  3FOA A;  2O8W A;  4IS5 A;  1TNH A;  2XND D;  1NFX A;  1OYT H;  3DD2 H;  2V3M A;  2V7Q D;  2C3S A;  2XBW A;  2GD4 B;  8GCH G;  2C8Y B;  1C1V H;  1OHH D;  1WYK A;  3K6Y A;  1ZHP A;  1O2M A;  3BTE E;  3LDX H;  1CBW C;  1O3P B;  2RA3 A;  1J14 A;  8LPR A;  4NFE A;  1GI5 A;  2FWW A;  4O3T A;  1UVS H;  4K69 A;  2Z9L A;  5HM2 A;  2ZDM A;  1GBK A;  1BTP A;  3MI4 A;  1DVA H;  1ZRB A;  3RXK A;  4ZHM U;  3MTY A;  1P10 A;  2QIQ A;  4RI0 A;  1N1L A;  1UK3 A;  1UVP A;  3KF2 A;  3RXJ A;  4YOG A;  5BPE A;  1UTN A;  5A0A E;  3PLP A;  3QTV H;  2Z9I A;  1LQD B;  4BAQ B;  2BLQ A;  2J4I A;  3P8F A;  1TA6 A;  1PQA A;  1RD3 B;  2ZDL A;  1E1R D;  5FL7 D;  1WAY B;  2H9E H;  3Q76 A;  2OBQ A;  3ZZ3 A;  1KXE A;  3RDZ A;  3N7O A;  4THN H;  3LOX A;  4Q2K A;  4WXI A;  1TQ7 B;  1HIA A;  2BQ6 B;  1GI7 B;  2FI4 E;  1GBM A;  2L6O A;  1MTU A;  4UFE H;  2ZKS A;  4FU7 A;  1EUF A;  2W3I A;  3RP2 A;  3RXH A;  4YM9 A;  5C3N A;  3GCH C;  1NES E;  2M5T A;  3UWI A;  3BV9 B;  4O03 A;  2BVX H;  3DSG A;  1BMF D;  2A2Q H;  5EW1 H;  2XCF A;  1W14 U;  1HJ8 A;  3KGP A;  3E16 B;  1ELF A;  1GMH F;  3A82 A;  4Q7X A;  2GCH G;  2XC5 A;  1V2T T;  5E8E H;  1JMO H;  3K2U A;  4WMD A;  8KME 2;  2QA9 E;  3ATL A;  1TAB E;  1GCT B;  2PW8 H;  3SGB E;  1RFN A;  5F6M A;  1Z6J H;  1V2J T;  3SHC H;  4ABE A;  3GIS B;  4Q4L A;  1CGJ E;  1H8H D;  1CSO E;  2ZG0 H;  1MCT A;  3HPT B;  4MPW A;  1AY6 H;  2Z3E A;  3LGW A;  4FUI A;  3LIW A;  1GPZ A;  3Q3X A;  1THP B;  5L30 H;  1OPH B;  3QLP H;  2ZTX A;  1O2Q A;  3O8B A;  3HKI B;  4D76 A;  1ARB A;  3E8L A;  2ZHE H;  1DFP A;  1GBE A;  4GCH G;  3EA8 A;  4MTB A;  4XRN A;  1DDJ A;  1DOJ A;  2PP6 A;  5C0T A;  2F3C E;  1HPG A;  1TFX A;  1QJ1 B;  1W3C A;  3LH1 A;  1CA0 C;  1EPT B;  2ZDA H;  1UTL M;  1P9S A;  2JH6 D;  5HMA A;  5GXP A;  1FPH H;  4HGC A;  2J94 A;  4IC6 A;  3VB4 A;  3FVF B;  4FU8 A;  4RN6 A;  1RTL A;  1SGF G;  4O97 A;  1SGT A;  4CRC A;  2A5K A;  4ISL A;  3A7X A;  3LH3 A;  3PMA B;  1O5C B;  1SGE E;  2XWA A;  2PR3 A;  2F91 A;  4CR9 A;  1O3E A;  3URD A;  1FJS A;  3NRL A;  1ZPC A;  1IQL A;  1Q3X A;  1O2L A;  1AE8 H;  1W12 U;  4B2C A;  1O2W A;  1LVY A;  3A89 A;  2FEQ H;  1D3D B;  2XYA A;  1UVU H;  3RXR A;  1WXR A;  2LP6 A;  1UHB A;  2P59 A;  2W3K A;  2FTM A;  1DY8 A;  3KQC A;  3RXQ A;  3OE7 D;  2BY8 X;  1F92 A;  1GBT A;  1YPL H;  2ZCH P;  3PV2 A;  3VB7 A;  4DII H;  1J16 A;  2A45 B;  1T8M A;  1FAX A;  1O3F A;  1QIX B;  2L74 A;  3RXV A;  4B2B A;  4NA9 H;  1RS0 A;  1G3D A;  3SZE A;  1P11 E;  1AFE H;  2H5C A;  5FPT A;  1LVB A;  2Z9G A;  3SW2 B;  2G5V A;  1AVX A;  4B74 A;  2FOC A;  4Y71 A;  1TBQ H;  1BB0 B;  2J2U A;  3RLY H;  1ELD E;  1FXY A;  1E35 B;  3SI4 H;  2Y5H A;  4NIW A;  4FOU C;  3SBK A;  1J17 T;  1YC0 A;  1VR1 H;  5C5O A;  1ZML A;  2FDA A;  4K8Y A;  5GJ4 B;  4AG1 A;  1VCW A;  3T62 A;  3KYG A;  1MU6 B;  4A5T S;  6CHA B;  2RG3 A;  3IG6 B;  3ZZC A;  4XOJ A;  1MBM A;  4ZRO A;  4WJG 2;  5HGG A;  1PPC E;  2OIN A;  2V6N A;  3T27 A;  1NBM D;  2JET C;  2EA3 A;  1TLD A;  4U32 A;  5DP3 A;  3TK6 A;  2VVV A;  1C9P A;  1SQR A;  4X2X A;  2V35 A;  1CGI E;  1Y3W A;  1FIW A;  4DT7 B;  4E05 H;  2J98 B;  1HBT H;  4ASH A;  1YCP H;  6LPR A;  2DE8 A;  1XKA C;  1Z1J A;  1ZLR A;  4A1V A;  1AI8 H;  2FS9 A;  4ZAE A;  1UVO A;  1YPG H;  4X6O A;  3U98 H;  2G4T A;  4CRD A;  4IW4 E;  1A7S A;  2PGQ B;  5HM9 A;  1NRR H;  3M5M A;  1MQ6 A;  2GCT C;  4JZE H;  1MTN B;  1K1L A;  7LPR A;  3U1J B;  3UIR A;  3MH6 A;  1TBZ H;  2O8T A;  2WPH S;  3GCT G;  3RXL A;  1U6Q A;  4Y8Z A;  4F55 A;  1H8I H;  1O5A B;  3QZQ A;  1DXW A;  4R0I A;  3UR6 A;  1O3D A;  1AFQ B;  2XC0 A;  3M3V A;  1X7A C;  1QJ6 B;  2ODY B;  1UO6 A;  2UWP A;  1TGB A;  2ZHW H;  3S69 A;  4X1N U;  3SJ8 A;  1HJ9 A;  2FOG A;  2TGD A;  1OYQ A;  1WTH D;  3SO3 A;  3LC3 A;  3NUM A;  3SJO A;  1OWE A;  1KXA A;  3PWC A;  1DX5 M;  1GI6 A;  1BQY A;  1HAZ B;  1AKS A;  3L3T A;  3MH4 A;  1C1T A;  1C5R A;  1UTP A;  2SFA A;  5FXL A;  4A1T A;  3T29 A;  4F48 B;  5T3H A;  1V2V T;  1B0F A;  1YCP K;  4MNY A;  1ELA A;  1PQ7 A;  5EJZ A;  1BZX E;  2BDH A;  2F9V A;  5EG4 A;  4LZ4 B;  3HK3 B;  2QE7 D;  5JDU B;  2BD3 A;  4I8L A;  3SNB A;  3ZYD A;  4TYD A;  5FBE A;  3A8A A;  1S85 A;  5CE1 A;  1HXE H;  4YLU A;  5KEC A;  4X8V H;  1O3M A;  3GYL B;  3BIV H;  2RCE A;  3ZVA A;  4YTA A;  5C94 A;  2VVC A; 
#chains in the Genus database with same CATH homology
 2HLD D;  3LKW A;  3PRD A;  1H8E D;  4K8B A;  2OBO A;  2A4R A;  5T1V A;  3PV5 A;  2XOK D;  3F2G A;  2J5U A;  3H09 A;  4B6E A;  4B71 A;  3OEH D;  4TT3 D;  2GGV B;  3O8B A;  4NWL A;  1JXP A;  3O8C A;  5C0U A;  3OAA D;  4ZCN A;  5EQR A;  5ESB A;  3F3B A;  2OIN A;  4TSF D;  3M5L A;  2IJD 1;  5CHB A;  1NBM D;  3L6P A;  4R8T B;  3FOA A;  5C0T A;  2XND D;  5H4I B;  1DXP A;  1KMH B;  2XNI A;  3P8N A;  3SU1 A;  3SUG A;  5FPS A;  4WH6 A;  2FOM B;  1FX0 B;  1W3C A;  2KR7 A;  2V7Q D;  2YMS D;  4OM9 A;  1NBM E;  4A1X A;  2QF5 A;  2WV9 A;  5IK2 D;  2KCY A;  2XCN A;  5FPY A;  1EFR D;  5F53 A;  3GS9 A;  1CU1 A;  3KEE A;  3WWB A;  1S6L A;  1OHH D;  3O8R A;  2YMS C;  4YXW D;  3SUE A;  2OC0 A;  3SV9 A;  4U01 A;  3ZIA D;  2QF4 A;  2F9U A;  5EPN A;  4XD7 D;  2A4G A;  2VBC A;  4A1V A;  2W6I D;  2K1Q A;  2M2A A;  3KNX A;  4KTC A;  2YMS B;  2KZ4 A;  4NWK A;  1W0J D;  1E1Q D;  4I33 A;  4WH8 A;  5C17 A;  3SV7 A;  3WW7 A;  1RTL A;  4RI0 A;  1N1L A;  2JJ2 D;  2O8M A;  3KF2 A;  3SUF A;  4B75 A;  3SUD A;  4ASU D;  1NS3 A;  2K8I A;  3M5M A;  3P8O A;  3AK5 A;  3F2H A;  1BT7 A;  2QV1 A;  5EQS A;  3OYP A;  3U1J B;  2CK3 D;  3SV6 A;  3EYD A;  3SU5 A;  3NRL A;  3DCL A;  3RC6 A;  4JMY A;  1COW D;  2KCO A;  5DSF A;  1A1R A;  3M5O A;  3N7E A;  2FP7 B;  1E1R D;  5EQQ A;  5FL7 D;  2KFW A;  4F55 A;  2OBQ A;  4B73 A;  4FET A;  3N99 A;  3RC4 A;  3N7D A;  3OTP A;  1WXR A;  3DSP A;  3LOX A;  2KM0 A;  3O8D A;  2P59 A;  2WHX A;  3SYJ A;  1DXW A;  3F2F A;  5GPI B;  3SV8 A;  5DN6 D;  1DY8 A;  3OE7 D;  2OK5 A;  2KCP A;  2L6O A;  2JDI D;  1E79 D;  3PV2 A;  5B6L A;  3E90 B;  2AHM E;  3F0P A;  2K0Q A;  3F0O A;  2OC7 A;  3DSO A;  2F43 B;  3FN8 A;  5IDK A;  3RC5 A;  5CDF E;  3OFN D;  4I32 A;  3FKS D;  1SKY E;  3SZE A;  1BMF D;  3SU4 A;  2XCF A;  4WF8 A;  2W6J D;  5FPT A;  3UB0 A;  3PRB A;  4A1T A;  3U1I B;  3OEE D;  2JJ1 D;  5EPY A;  2WPD D;  3SU2 A;  4M9F A;  3FO8 D;  3W1E A;  5ETX A;  2OC1 A;  4I31 A;  4B76 A;  2WSS D;  4B74 A;  1W0K D;  2F9V A;  2F4L A;  2LEL A;  2IJO B;  3M5N A;  2QE7 D;  4Q63 A;  3VG8 A;  5HKK D;  2FM2 A;  4TYD A;  4B6F A;  2OC8 A;  4DT4 A;  1MAB B;  2A4Q A;  2KCA A;  2JIZ D;  3KN2 A;  4Q4L A;  3SU6 A;  4Z1M D;  1H8H D;  3SU3 A;  1RGQ A;  2GVF A;  3SU0 A;  5GND A;  2WZQ A;  5GJ4 B;  2YOL A;  3WWF A;  3LON A;  1DY9 A;  4A92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...