3DSOA

Crystal structure of cu(i) bound copper resistance protein copk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein copK
publication title Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography
pubmed doi rcsb
source organism Ralstonia metallidurans
molecule tags Metal binding protein
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dsoA00
3N7DA 2K0QA 3DSPA 3DSOA 3N7EA 2LELA 2KM0A
chains in the Genus database with same CATH superfamily
1TMBH 4CHAC 2VVUA 5CMXH 1V2KT 1ELDE 4X1SU 2GJGA 4WXIA 2ODPA 3DT0H 2IJOB 2BDHA 3ZVCA 2QXIA 1QR3E 2LP6A 1Y8TA 3ODDA 3SBKA 2NU0E 1C1QA 4X0WU 1HAXB 2HPQH 3S7HB 2K0QA 1O2UA 3QZRA 2QY0B 2VWNA 2ZHFH 5GNDA 1C5ZB 1VJAU 2OQUA 2P8OC 4XRNA 4ABFA 5FHTA 3OTJE 1F0TA 4XBCA 1AIXH 3N7DA 2ZTYA 3SNDA 4FVBA 1AVWA 3TLOA 1AVXA 2QF4A 4CR9A 3RUOA 2WPHS 2OTVA 1QJ1B 4WJG2 2K8IA 5E2PA 4Z6AH 5HGGA 3VXEH 3TH2H 1SQRA 1DPOA 1HAZB 2QF0A 1VGCB 3RMNH 3TGIE 1ORFA 1GBEA 1MH0A 1HCGA 2J9NA 3F9FA 5LPEA 1EPTA 2ZU1A 2ZPQA 3Q3KA 2KZ4A 2A5IA 2ZU4A 3OSYA 3U1IB 2RFKC 2VGCC 4H4FA 2AGGX 1ZGIA 3ZZCA 1BTWA 1ETSH 1O2RA 3O8DA 2ZU3A 5FPTA 4MNXA 4ABIA 3EDXB 1V2RT 2KCOA 3BTTE 2ZFTA 2ZHDA 2FZZA 4JYUH 1KDQA 4KKDA 1C2MA 2C3SA 1SOTA 4NIYA 4AFQA 4X2YA 4UEHH 2ODQA 1GCTC 4OGXA 3E1XB 3ZYDA 3T62A 4OGYA 2G51A 2KCAA 3SJ8A 5F6MA 4RKJB 1QRZA 4FU7A 3SV2H 1O5BB 2BZ6H 1W0KD 5HYOA 2OC1A 2ZG0H 1SC8U 2Y5HA 3H7TA 1W2KH 1SMFE 1D3TB 2WUBA 3GCHC 4UD9H 2BB4A 3EA9A 4X1QU 1K1JA 1SGPE 2R3UA 3UTUH 2BHGA 1GJAB 2KM0A 1A3EH 1C5SA 1LPGB 1V3XA 1E1RD 1DLEA 2KX4A 1C2KA 3MYWA 1HIAB 2K1QA 3A7TA 3SZEA 3M37A 1ZHRA 4U01A 2ZU5A 3PLKA 3O8BA 2Z7FE 3O8RA 1AFQB 6ESTA 1GBIA 2B8OH 1MQ5A 1K28D 2A45B 1O3HA 3RU4T 1ZTJA 1GDNA 1TRNA 3N7EA 1AE8H 2VIDA 4NSYA 4Y10E 2FOFA 4B71A 4RT1A 3RXQA 1JXPA 2FEQH 4ZKNU 1G32B 1SPJA 1MKWH 1DT2A 1O2TA 4HFPB 4OM9A 1E37B 1AZ8A 1AB9B 1UJ1A 5AHGH 2FOEA 1Z8IB 1Z8RA 3U28C 1XUGA 2H2ZA 4E7RG 5DO4H 1LQEA 4UONA 3AVZA 1EUFA 2SNWA 3SGQE 3QK1A 1DVAH 2FS9A 3QDZB 1LVOA 3V3MA 2STAE 3ZYEA 1C1RA 1JWTA 3D49H 1GI5A 1HFDA 1GBHA 2ZCKP 4FUDA 4U32A 3P8NA 1YBWA 2Q6DA 1B0FA 3O8CA 1PPHE 2A4GA 1VITF 2GDDA 4B2CA 4GPGA 1GJ9B 1BTHH 2A7HA 4ABAA 3SI4H 3PYHA 2F3CE 2LELA 3GY3A 1TOMH 1TWXB 2VIQA 2OC7A 5G4BA 1P2NA 5GWZA 3MTYA 5CHAB 3VEQB 4ZKSU 1VITG 1C2EA 1OWIA 2ZQ1A 3DSGA 1NRRH 1MCVA 1T8OA 3EQ0H 5FAHA 1IQKA 5GCHF 1GHYH 4RI0A 1GBTA 1MKWK 4CR5A 3A83A 1ARBA 5ABWA 1ANEA 2J92A 2O8LA 4TPIZ 1S82A 1GGDB 2BY5X 1WXRA 5GCHG 3V12A 1BTUA 2NWNA 4WMFA 1B0EA 2EI8A 1FAKH 1G2MA 4UFDH 3ZZ5A 5GXPA 2Y80A 5DJ7A 1PPZA 4E05H 1BQYA 2PUXB 3MI4A 1ZRBA 1OP2A 2F4LA 1TNIA 1QL7A 2FESH 2ZDNA 1V2QT 2QA9E 1EAUA 2ZKSA 1SGEE 2FDAA 3A7XA 5LPFA 1O3AA 1Y3XA 1NRNH 1TALA 4JZDH 2BM2A 1BRUP 1WYKA 4K3JA 1KXAA 3RXTA 2F9OA 1S85A 2OINA 2SGPE 1T32A 3GDVA 4AFZA 1Q2WA 2OBOA 1TBZH 1EJAA 1GJCB 3CP7A 1Y3VA 4JK5A 2VWOA 1P8VC 1MZAA 2ESTE 1TMUH 3ENSB 1O2GH 1G3CA 1G2LA 1ANDA 1VCWA 1NFUA 4UFFH 2W3IA 2PKSC 1O2SA 1O3FA 4OS6A 1GL0E 4A1TA 4IC6A 2G8TA 3LIWA 4UFEH 2OC0A 2G5NA 3EYDA 1E36B 1SHHB 3ZV8A 1O3CA 3GY6A 1C5XB 1QNJA 2BDYA 5CDFE 1SLVB 4CRFA 2G4UA 2JJ1D 5EJ1A 1VCQA 2WV4A 3VB6A 3D23A 3TNSA 3U8RH 1RGQA 4HGCA 3SI3H 2UWLA 5C5NA 1H4WA 3GISB 3PV5A 1BB0B 1TA2A 1FZZA 1XMNB 2AH4X 1DY8A 2H9EH 1YPJH 2A4QA 7GCHG 4GLYA 3SU4A 1FAXA 3A87A 3K6YA 3WWBA 4ZH8A 4MVNA 3ZZ7A 2XBXA 2ZO3H 1HIAA 4K2YA 5C0TA 2BY6X 3F1SB 1Q31A 2W7UA 4ISOA 4LK4A 3ZZDA 1D3DB 4BAMB 2HLCA 4BAKB 3UQVA 1HXEH 4JZEH 4Q80A 4X6PA 2BVXH 1GDUA 1SQAA 4UFGH 5HXFA 1CA8B 1EAIA 4HG6A 4HI3A 2HWLB 4B2AA 1G36A 2RA3A 3KGPA 2BLWA 1ZHMA 2A4OA 2FOCA 2TGTA 1GL1A 4NA8A 4Y8YA 4MPUA 4GHTA 2P3TB 3TJOA 3M5OA 1ELTA 3SHAH 2O9QA 1S5SA 4VGCC 1O2WA 1O38A 3MOCA 2FLRH 1HJAC 1J15A 1T8NA 2ZF0H 5EJLA 1O36A 1XXFA 3SO3A 1N6YA 2RA0A 4M9FA 1U6QA 2WPMS 2GGVB 2FXRA 4BTTB 3LU9B 1TBQH 1P01A 2WSSD 3LPRA 4I8HA 4UDWH 1YF4A 2PUQH 1QGFA 2FOHA 2CJIA 2P93A 4Y79A 5C3NA 1N8OB 3URCA 1L4DA 1Z1JA 1EB1H 4NA9H 1AVGH 2V35A 1H9LB 1WCZA 1J14A 1SFIA 4R0IA 2BD3A 2PR3A 1O2MA 3PWCA 1SOZA 1C1OA 1SGYE 3LONA 1TYNA 3PLPA 1C1VH 3SV9A 1NFWA 4Y8ZA 4JZFH 5L30H 1TABE 2QF5A 2EI7A 1DICA 1EKBB 1PYTC 4QT8C 4F48B 1UK2A 1UW7A 2J97A 2JETB 2VH0A 2ODYB 1L1JA 3RU4E 1O39A 1HNEE 2C93B 2B9LA 2R2MB 5C5OA 4CHAB 3ATKA 2B7DH 4INLA 1FN6A 1CT2E 4AB8A 5AF9H 3GY4A 1A46H 1KLTA 1QZ8A 2RDEA 1XUKA 2W6JD 2H1UA 1MAXA 3VB5A 1E1QD 1WTGH 2TGPZ 3LT3A 1EXFA 4MDSA 2W6ID 5FPSA 5DN6D 2XYAA 2V3HH 2ZNKH 5EGMA 3K9XB 1MTVA 3ZVAA 3BTHE 1O2ZA 4X6NA 5GDSH 3E3TA 1K1LA 4O3UA 4P00A 2ZP0H 3N99A 1YGCH 2F9VA 2P8OB 1SI5H 1H8HD 2VWMA 4J2YB 1KIGH 1VCPA 1HAPH 1UTPA 1VKYA 2PFEA 3C1KA 4X2VA 2FO9A 1YM0A 4IGDA 2SNVA 3LC3A 4CH8B 2Z3DA 1OWHA 2HRVA 4AFSA 2ZFPH 3KQ5A 3OYPA 1DM4B 5DP9A 1DSUA 1GHZA 4BTIB 5J4SA 1GJ5H 4XD7D 1K1MA 4AX9H 3RXGA 1THSH 3L3TA 1IQGA 3H09A 2NU2E 2SGEE 1O3OA 2ULLA 1EAWA 2BDIA 3MMGA 1H1BA 3SGAE 4CBNA 5IK2D 1XKAC 1O31A 2CHAC 5EXLA 1RFNA 1S6HA 4KTSA 1TGTA 1ELFA 2ZEBA 2FLBH 2B0FA 3JZ2B 1ETRH 1SGDE 5DP8A 4BTUB 1TIOA 2VGCB 3RXVA 4Y6DA 3T26A 4KELA 2G52A 3MU8A 2TBSA 4DVAU 1P2QA 3QTOH 1OSSA 4YT6H 4DY7B 4R8TB 4TSFD 2HPPH 5E0HA 4TY6A 1GCTB 3GOVB 1O2QA 1Y3UA 1K2I1 1TX7A 1T31A 2IOTA 3MU5A 4I8KA 4F55A 3BTKE 3F2FA 1KYNA 2GZ9A 1MBQA 3GY5A 1OOKB 1O3MA 1YLDA 5DPAA 3GCHB 4IN2A 5HKKD 1Z7KA 2TPIZ 2Y5GA 8ESTE 4SGBE 1KTSB 4NZQA 1VR1H 1VZQH 4DG4A 2VB0A 1BJUA 1A0JA 1TFXA 1O37A 1QRWA 2ZDAH 1IQIA 3L33A 4WH6A 3TVJB 5C0UA 3SU1A 1V2TT 4RSPA 1O5FH 1W7GH 2C8XB 1P12E 2WPIS 1UVTH 1L0ZA 1WU1A 1ZSKA 1Y3YA 1UVOA 3D62A 1K1IA 1NU9A 2BVRH 1G37A 5KECA 3NUMA 3STJA 3MQKC 3PM3A 1CBWC 2L6OA 2XC4A 1YLCA 1CA0C 3BEFB 1GHWH 3DCLA 3PMAB 3T27A 3P8FA 4E7NA 5GJ4B 3SV8A 1K21H 4OS2A 2CV3A 3QN7A 3A7VA 3U9AH 2FOAA 1SLWB 2XW9A 4MNYA 1DANH 3RXOA 3TJNA 1H8ED 4I31A 3MNCA 2D26C 1FIZA 2QF3A 1XUIA 4ISNA 1PPEE 1BRBE 4ASUD 2J95A 2PKAB 4YM9A 3NKKA 2OXSA 4E06H 3KHVA 3U98H 2H6MA 2O8TA 3E6PH 4NWKA 3STIA 1GVZA 5FX5A 3M5NA 3DSPA 1ZGVA 1C1UH 5FXLA 5JBAS 1T4VH 5DK1A 1GI6A 1KXCA 3TH4H 2ZTXA 1V2UT 3CENA 3FAOA 3UB0A 1NRPH 5DP5A 4F4OC 4WH8A 2J98B 2A32A 2PWXA 3A81A 2W5EA 1GBLA 3E0NB 2TGDA 1TRMA 3MH6A 2PGBB 4D76A 1TQ0B 1GI8B 2QXGA 3OTPA 1KXEA 3VPKA 1C5YB 1BCUH 1ABIH 1S0RA 1WBGB 1A0LA 2QE7D 4K69A 1D3PB 1CHOF 1TNLA 1LQDB 5C1UA 1OYQA 3VGCC 2GMTC 1X7AC 1GBDA 1IAUA 1CGIE 1ID5H 1UTLM 5GPIB 6LPRA 1FDPA 2CF9H 3UQOA 1XVOA 1RS0A 1CHOG 5A2MH 1LO6A 1FMGA 1YPKH 4ABBA 2UUYA 4ZCNA 4YZUA 2F9UA 5DP7A 1A1RA 1SLUB 3LJOA 2A1DB 1W8BH 3CS0A 3FP7E 2QC2A 1SGFG 3K2UA 4TWYA 1FNIA 5GIBA 3ATMA 2KCPA 5E0GA 3PTNA 4MPWA 3K65B 3RXFA 1BBRE 1ETTH 5F8ZA 3BTME 1Y3WA 2J94A 4B1TA 3MO3A 2C8ZB 2ZDMA 3IITA 3FZZA 1DE7H 1SKYE 4B75A 3PO1B 2XCFA 3KQEA 4FU9A 3A85A 1NTPA 1P2KA 1QCPA 2V6NA 5DP4A 2L74A 1ZRKA 4I8LA 5FPYA 3LGYA 3SHCH 1T8MA 1RTKA 1MABB 1THPB 1LHGH 3WW7A 3RC6A 3RMMH 1JIMA 1ACBE 1WDIA 7ESTE 1C2GA 2WZQA 2PKSB 2ANWA 1LVBA 4FVDA 1ELVA 1MKXH 4XOJA 1FY4A 4ZHAA 3T25A 1MD7A 1TNKA 3SQHE 3FFGA 1TGBA 5JDUB 2P3UB 3R0FA 4AB9A 1HXFH 1EB2A 4X8SH 5KEDA 1BOQA 2FOMB 1XUHA 1F0UA 1G3BA 2ZIQH 3ATWA 2ZFFH 1GHXH 2BD4A 3P8OA 3S9BA 2FODA 1ZJKA 1YPLH 1SGTA 5HIYA 1MMJN 3M61U 1YCPK 3OEED 3M7TA 4NA7A 1C1WH 4X1PU 5AVDA 3TGJE 3UFAA 2P95A 2O8MA 2PGQB 1O2HA 1FIWA 1E35B 3MHWU 1INCA 4JMYA 3DA9B 1K1NA 1NM6A 1HDTH 2FI5E 4OS1A 5TCAA 4MNWA 3SV7A 2G4TA 3UNSA 2PW8H 3EE7A 1IQHA 1XXDA 4B6EA 4X8VH 5B6OA 1HYLA 1EJNA 7LPRA 5JPMH 2XRCA 4U2WA 4YO9A 1HLTH 2P16A 4CRBA 2QV1A 2O8WA 4NFEA 1SGRE 1BHXF 4Q7ZA 1MZDA 1C1TA 1P04A 1MKXK 3EGKH 3DSOA 2V3OH 2GP9B 2OBQA 3TPIZ 1AWFH 1HAOH 4DJZB 1DWBH 2VWLA 3RXRA 1QB9A 3MU4A 1IHTH 4INKA 1ZYOA 1B5GH 5FCRA 1UTQA 1AI8H 1UO6A 3B9FH 2WINI 2FOBA 4MLFB 2QIQA 4Q2KA 1MU6B 1GBMA 4VGCB 1YPGH 2I6QA 1NRQH 1O33A 5FBEA 4ABDA 3A7WA 1HJAB 3TK5A 1P11E 1BTXA 2A5KA 1O3BA 1KXBA 1V2WT 2GV7A 1ELCA 2PKAA 3A86A 3PMHB 4ZKRU 1UMAH 1XM1A 1AHTH 3ITIA 2BQ6B 3KQCA 2GDEH 4H6TA 1QBVH 1YYY1 2BXUH 1O32A 1LDTT 1OS8A 1PQ5A 2CN0H 2D8WA 3SORA 2SGDE 5F53A 1P2JA 1ZMLA 3ZVGA 3RXBA 2BVSH 1CT0E 1GJ4H 1N1LA 1LHDH 2IPHA 2J98A 2BY9X 1A61H 5EPNA 3NCLA 3LOXA 4ZKOU 1XKBC 3LKWA 4WY3A 1NC6A 5LPRA 3RXIA 4TYDA 2BQWB 3RXCA 3F0OA 4AYYB 1QURH 1ZTKA 2BD8A 4ASHA 1QY6A 1BMAA 1UCYE 4Y71A 3S9CA 1QQ4A 4DGJA 1O35A 3A8DA 1C4Y2 1ZZZA 1Z6JH 1MU8B 1B7XB 2A7CA 4AG1A 6GCHF 4BXSA 1EZSC 1TGNA 1QBOA 4H6SB 1DDJA 1FONA 1NS3A 1QRXA 2VIPA 3SU0A 1HAGE 1C5MD 3DFLA 4AZ2B 4DT7B 5HIZA 1W11U 4CRAA 2FX4A 2WV9A 4Z0KA 1DWCH 1NT1A 1QL8A 1JRSA 6GCHG 1NFXA 2BX4A 1OWDA 2ZDLA 3PV4A 2UUKB 2Y7ZA 3ATIA 4WXVA 4AGKA 1TPAE 1C5WB 1QA7A 3GY8A 1JRTA 1IQJA 3LH3A 1LCYA 3P17H 4GCHF 1JOUB 2ZHWH 2BD9A 5K0HA 2XOKD 4X2XA 3TJVA 3FO8D 4ACAA 4XE4A 1GWAA 3TIUA 2IPQX 4ZAEA 3PO1C 3RXLA 5JYIA 1TPPA 3FP6E 1S6LA 4GCHG 3KYFA 3SUDA 3TNTA 5TCCA 1OX1A 1WTHD 3KN2A 2YMSC 4Q7XA 1KY9A 2Z9KA 1PQ7A 2CHAB 3KCGH 1RTFB 4DCDA 3GDUA 2EC9H 2JH0D 5A09A 2AGIX 4IS5A 4DIHH 5AFYH 4MG3A 4FUEA 1PJPA 1RIWC 5HM9A 3TK9A 1TA6A 1BJVA 4PROA 4NWLA 3UY9A 1FLEE 5T6DA 3VG8A 2ZHEH 1O5EH 1LTOA 1AY6H 4NZLA 3DHKH 3P92A 4A6LA 1C5LH 2ZPRA 1TGSZ 1IQNA 1KTTB 1OKXA 2F83A 2ZTZA 4O03A 3MFJA 2HVXA 1F92A 4BOHA 4YXWD 2BLQA 2BX3A 1GI1A 1CE5A 2OCVB 3OFND 1P10A 1P03A 3PMJA 2PP6A 4J1YA 3SNEA 2AIPA 1MCTA 1HAYB 3B23B 1EASA 2BY8X 2IJD1 3SW2B 1Y59T 3BTDE 4YOJA 1EQ9A 2FTMA 2Z6BD 5JB9S 5K7RA 2Z9GA 1AKSB 4GSOA 1ZSJA 2JH6D 5CHBA 3RU4D 4ISHH 3AAVA 4A5TS 4Y8XA 2F9BH 1G9IE 2JKHA 3P6ZB 3SU3A 3HPTB 5A8YA 3UIRA 2Y5FA 4FUIA 3TK6A 1OP8A 3RDZA 2OP9A 2ANYA 1F5KU 1V2VT 1Y5UT 1G3DA 1CBWB 1CA0B 1YPEH 5C1YA 3I77A 4WF8A 4YESB 3MH7A 1C9PA 3AAUA 3RLYH 1NFYA 1O3DA 4MQAA 3U69H 4SGAE 4WMEA 1O3GA 3GY7A 4NCYA 1AUJA 1HJ8A 1O2IA 4AFUA 3BIVH 1NROH 3EA8A 1S6FA 1YPMH 4CRDA 5JBCS 5T6GA 2HGTH 2TIOA 2ZQ2A 4LZ4B 1FN8A 3SU5A 2FYRA 5BPEA 1TQ7B 3PV2A 4Y11E 1C5PA 3GY2A 3PRBA 1C1PA 4CBOA 2KFWA 1LPKB 2SGFE 2C4FH 5PTPA 2WYJA 2GTBA 1TGCA 3QUMP 1SVPA 2ZCLP 3RXSA 1D4PB 1CSOE 1RRKA 2BD5A 4RT0A 3OX7U 2UUJB 2ZWLH 6CHAC 2JJ2D 4JCNA 1SQOA 4TY7A 2HVYB 1QB6A 1TE0A 5HMAA 1OWKA 2UWPA 1ESTA 3OE7D 1UTKA 3C27B 4X1RU 1W7XH 4AGJA 1HV7A 1H9HE 1O3LA 3A88A 3ESTA 4ZMAH 2VH6A 3UOUA 1ZMJA 1MAYA 1TNJA 1MQ6A 1M9UA 2P94A 3VGCB 1SGQE 5I46H 1P0SH 2GMTB 1XX9A 2GKVE 4X8UH 5ESTE 1KMHB 1W12U 1NPMA 2FI3E 3WWFA 1O2XA 3U1JB 2THFB 4KTCA 2ZFSA 1XUFA 4K1TA 4I86A 4TWWA 2ANMH 4ISIH 1TNHA 1HGTH 2VIWA 1F5RA 3S69A 2QN5T 1C5NH 1PPCE 4B73A 5A0CA 4FUHA 3RXDA 3BN9A 1DITH 2I6SA 5EJZA 5LGOA 4AN7A 1DS2E 3LGWA 2LNCA 4TPYA 3T28A 1AD8H 5T1VA 3ZZ8A 1KXDA 2WPLS 3BTQE 1OXGA 2HNTF 2ZDKA 2VVVA 2WYGA 3KIDU 5DKMA 1C9TA 4NIVA 5DGJA 1HAVB 1MTUA 2ZCHP 3SUFA 2ALPA 1O2OA 1FPCH 1SB1H 3FVFB 1DOJA 3ATLA 3PTBA 2R3YA 4FETA 1BIOA 1C2IA 1P06A 1SGFA 3BTWE 3OY5U 2EEKA 5C94A 2SGQE 4KTUA 1SGIB 1BA8B 1YCPM 1F7ZA 1J8AA 2STBE 1AQ7A 3CNRA 1BTPA 1P2IA 2A31A 3ZZ4A 1UK4A 4NG9H 4CREA 5IYTA 2ZFQH 3M5MA 1F0RA 2RG3A 3OEHD 3ZVFA 3ZV9A 3SUGA 1GVLA 1TB6H 3M7UA 3RXJA 3SV6A 1QQUA 1C5QA 3DUXH 1QHRB 1AKSA 2NU1E 3UUZA 4MNVA 4LOYH 1DWEH 1LVMA 1PYTD 1P2OA 1AN1E 1RXPA 4O9VA 2W3KA 1K0HA 1PPGE 3EAJA 1NZQH 3LGVA 1C2JA 1O5GH 1TX8A 2M2AA 3PWBA 4F49A 1BTZA 3A80A 5FCKA 1DFPA 3SNAA 1BTYA 2KR7A 1HRTH 4LXBH 5EW1H 1RTLA 2QXHA 3PB1E 2JH5D 1NRSH 1S83A 1ELEE 2VU8E 2VIVA 4IN1A 1GG6C 1GMHF 1PFXC 2IN2A 1O5DH 1Y5BT 2AERH 1NBMD 3FOAA 1DUEA 2CXVA 4X2WA 1C2LA 1GBKA 1KXFA 4WMDA 3TU7H 3SN8A 1C5OH 3W94A 5L6NH 3A8BA 1AMHA 2AHME 4FOUC 1JBUH 2PLXA 3CS7A 1ZR0A 3BTFE 4Q63A 4D9QA 3KF2A 5JB8S 1V2JT 2KAIB 3NK8A 1L4ZA 2TGAA 2Z3CA 2CMYA 2DE8A 1BBRH 4DOQA 1FUJA 1LKBA 4IC5A 1OWJA 2F9PA 2Q1JA 2H5CA 1GI4A 1DXPA 3HK6B 1O2LA 4ZROA 2ZFRH 1O2NA 2F91A 1IOEA 3TH3H 1XUJA 2GT7A 1EAXA 2EI6A 3TGKE 1Z8GA 3TJUA 1IQLA 3UWIA 3W95A 3E8LA 1NY22 3EA7A 4CRGA 2AMPA 3MO9A 4ZXXH 4BAQB 5E2OA 1YKTA 3LJJA 3R3GB 3RXKA 1BUIA 3UR9A 3QGNB 2SGAA 5DP6A 1ARCA 1GCDA 1UTMA 1O2KA 2J5UA 9ESTA 1E79D 5IDKA 2CF8H 3RXUA 2V0BA 3MU1A 1ZJDA 2Z9JA 3ZVEA 5B6LA 2ZGJA 5EIYA 2KCYA 2ZZUH 3Q77A 3SU6A 1BBRK 2C8WB 2XTTB 3V7TA 2XCNA 2JDID 3MNXA 2J2UA 1ZMNA 2QXJA 3V13A 5CE1A 1Z71A 3SJOA 1QFKH 5E0JA 1GHVH 1IQEA 3KNXA 4NIWA 1NBME 2CK3D 1C2DA 1EP6A 3E16B 4NGAH 1S84A 4ISLA 4DT4A 2Q6GA 3PROA 1OHHD 1C4V2 3F9HA 4Q4LA 1K1PA 5EOKA 1BDAA 3GYMA 1CU1A 1ZOMA 5F8TA 5T6FA 2BYAX 1FXYA 1EZXC 1UVPA 3LGIA 5C20A 2FWWA 1FY8E 2BQ7B 4H42U 3SYJA 1BMFD 1YCPH 1ZTLA 3BG4C 3NZIA 3RMOH 1BZXE 3A84A 3RXPA 3T5FH 1HAVA 4YTAA 2BOHB 2ZI2H 3VB7A 3EE0B 3DFJA 1SL3A 1A2CH 4BXWA 3ZZ6A 1JIRA 1P09A 4ABJA 2YMSB 3MH5A 4P02A 1W13U 4AG2A 1FPHH 8GCHF 3QLPH 4X6MA 3SOSA 4NFFA 4XSKU 4ZUHA 1H8DH 4I33A 4RN6A 4MPXA 2NU3E 2A2XH 3Q76A 1RIWB 1SHYA 2VNTA 2P59A 8GCHG 4M7GA 1K22H 1PPFE 4XBDA 1OWEA 1MBMA 1OPHB 1DSTA 3F0PA 1LHCH 2ZECA 2BXTH 1QTFA 2AMDA 3HKJB 2GZ8A 1UTNA 1O3EA 2BD2A 2Q6FA 3LH1A 4U30A 3HGNA 3QO6A 4BAHB 1ELGA 1F2SE 1PQ8A 1LPZB 4IMQA 1IQMA 4XBBA 3UNRA 1EPTC 2GVFA 4MPVA 1AZZA 1TONA 1PPBH 1C1NA 1UCYH 3ZZ9A 4X1NU 1GBFA 2DE9A 2ZDVH 1C5UA 3MU0A 4AOQA 3F2HA 3IWMA 4AORA 2P3FH 1SGNE 3UNQA 1KSNA 4Y0YE 2G81E 4CRCA 1QJ7B 2GCTC 5DG6A 1GJ8B 4DW2U 3JZ1B 2FOGA 5FL7D 4JZIA 1GPZA 1TOCB 2Z3EA 3N7OA 1MTNC 1ESBA 3U8OH 3MNBA 1A5IA 3UREA 4D7GA 2BLVA 5FBIA 1P57B 1WUNH 3AW0A 3BV9B 3M3SA 1IHSH 1T7CA 1NESE 1S81A 2KAIA 1GI0A 3BEUA 2W26A 3RMLH 5A8XA 2G55A 2EQNA 4NIXA 1YY3A 1SFQB 2F9NA 3LC5A 2AS9A 4GUXA 3P95A 3F68H 4THNH 3W1EA 1O5AB 4GAWA 1D6WA 1ABJH 3GICB 1VITH 3E0PB 3PRDA 1J17T 1A7SA 1A4WH 3GYLB 2XBYA 1UCYK 2ZGXH 1P9SA 1P3CA 3ZZ3A 3I78A 1LMWB 3QWCH 2Y6TA 2ZHQH 4MTBA 4WVPE 2RDLA 4LZ1H 2ALVA 2WPJS 1GI7B 3M35A 3SNBA 2DUCA 1E34B 5F8XA 2BDAA 2PHBA 1YPHC 2R0LA 2G5VA 2NU4E 5DP3A 1W0JD 3Q3YA 4FXGH 1O2PA 1A3BH 1OP0A 2WV5A 3RC4A 3OY6U 1FJSA 2PV9B 2WPKS 3GCOA 1L1NA 3ELAH 3S0NA 2FMJA 4IBLH 6CHAB 1AFEH 3QX5H 2F43B 1TPSA 3U8TH 4Y7AA 3ZZAA 1BRCE 1W14U 1OYTH 1V2PT 1Y5AT 4HZHA 2FI4E 5EQRA 3V0XA 1A5HA 1K1OA 1DWDH 1GBAA 2AEIH 2Z9LA 4NSVA 1EZUC 3OU0A 2PTNA 4DURA 3RXMA 3GS9A 2FIRH 1UHBB 3FN8A 2J34A 3P8GA 2W7SA 1V2LT 3H5CB 1T8LA 1WQSA 3SGBE 3HATH 4A1XA 3LDXH 1P3EA 3BTGE 4Y0ZE 1CGHA 1HJ9A 3AK5A 1O3NA 1TNGA 2BY7X 2XC0A 2AMQA 3SZNA 1L2EA 4ABGA 2AIQA 4YLUA 1MUEB 5ETXA 2HALA 5ESBA 3UOPA 3MNSA 1CVWH 1ZSLA 1HPGA 1J9CH 3PMBB 2EA3A 1QB1A 1QL9A 1GHAF 2D1JA 3UR6A 3SU2A 1WV7H 1SBWA 4YOIA 4X6OA 2A7JA 1RD3B 3GCNA 1EZQA 1WAYB 1TBRH 1V2ST 4A92A 4BANB 1ANCA 5C67A 1GHAG 1V6DA 2QCYA 1C5VA 4OS5A 3F9EA 3VB3A 2PSYA 1FY3A 1UTJA 1BMNH 1TLDA 3RM0H 2AFQB 3ZVBA 1UVSH 1LVYA 1CQQA 4AC9A 1O2YA 1KLIH 1O3PB 1P05A 3M3TA 1EFRD 2ANKH 3I29A 3LGTA 1VGCC 2VVCA 1AGJA 1FY1A 1HBTH 2HOBA 1P02A 1O3JA 1SG8B 2QGRA 3SUEA 3M7QA 1GBBA 2FYQA 3H7OA 5EPYA 3A89A 3SJIA 1V2MT 2WPDD 8KME2 5JBBS 3SNCA 3FP8E 1BITA 3RLWH 3OAAD 5FX6A 7GCHF 1GVKB 1G3EA 4D8NA 1GI3A 2CGAA 1BT7A 2HNTC 2XNIA 2EY4C 2O8UA 2Y7XA 5EG4A 1TMTH 3BIUH 1V2NT 1HUTH 3HK3B 2GV6A 3MWIU 3M5LA 3T29A 3B8JA 2M5TA 2ZGHA 1H8IH 1SLXB 3Q3XA 4K1SA 3PLBA 1IQFA 3IG6B 1GG6B 4YOGA 3NXPA 1YWUA 1QA0A 5AFZH 4WWYA 3NRLA 1V2OT 1T4UH 1WSSH 2H9TH 1NN6A 3KEEA 3NWUA 1MTWA 3RP2A 3VFEA 2H9HA 2SFAA 5E8EH 4I7YH 3F9GA 1TRYA 1C5TA 1UVUH 5EXNA 1AFQC 3DD2H 3HKIB 3SJKA 2ZC9H 2J4IA 1P2MA 1WQVH 3GDSA 3KQDA 5KGOA 2AYWA 3RXHA 4ZHMU 1E38B 1ESAA 4ZXYH 5EW2H 2YMSD 1EP5A 2BTCE 1G30B 2JIZD 2ZU2A 1QBNA 1Z1IA 5JBTA 4ESTE 2G00A 1YC0A 1YPHE 2OQ5A 1UK3A 1O0DH 1C4U2 1GJDB 1AUTC 2XBWA 1GBCA 1D6RA 4JZ1A 1GBJA 1AB9C 2A0QB 2XXLA 1ANBA 5DSFA 5C17A 3UAIC 5C1XA 1UTOA 3GCTF 5L2YH 2WUCA 1BHXB 3RXAA 2B5TB 1O2JA 1BRAA 3VXFH 2FP7B 1EOLA 2VINA 1DXWA 1CHGA 4FUCA 5H4IB 3M3VA 1SR5C 5BRRE 1UHBA 2YNBA 2GD4B 2BLOA 3GCTG 1E0FD 4HTCH 4BNRA 1MTSA 1AU8A 2QAAA 2ZA5A 3ZZBA 3A7YA 1DLKB 3P70B 2ZGBH 4TT3D 4ABHA 7KMEH 2H5DA 2Z9IA 2V7QD 1ZPBA 1O5CB 1O2VA 3E91A 8LPRA 1XVMA 3HGPA 1LKAA 3Q00A 5CHAC 1W0ZU 5EQSA 2XC5A 2UWOA 3KYGA 4K5ZA 3RM2H 3RC5A 3S9AA 1A0HB 1EX3A 2XBVA 2BZAA 2OC8A 2QYIA 2R0KA 5TJXA 5HM2A 1JMOH 1AWHB 3A82A 4JK6A 1HB0B 2ZPSA 3BF6H 3BTEE 1HAIH 1BMMH 1GGDC 1L1GA 3BG4B 4FUGA 2TRMA 4ZHLU 2YOLA 3ZVDA 3MH4A 4KGAA 1F5LA 3BG8A 4CH2B 1Z8JB 4B2BA 1FV9A 4KP0A 5C2ZA 1D3QB 4B6FA 2BDBA 2LPRA 3ZIAD 4I8GA 1LHEH 4X8TH 3QTVH 2VIOA 1ELAA 4IW4E 4ABEA 2GT8A 3UPEA 4ACBA 4B74A 4FUFA 4K60A 1SQTA 2FTLE 1O30A 4I32A 1J16A 5F03A 1ZHPA 2PTCE 4OS4A 1TPOA 1COWD 4FU8A 3TITA 1P9UA 1CGJE 1C5RA 4UE7H 2XWAA 3F2GA 1NO9H 4BAOB 1ZPCA 2A4RA 4XFQA 2FM2A 2Z94A 3UWJH 1FY5A 1W10U 4IMZA 1D9IA 3QGJA 4O97A 2XWBI 3A7ZA 1GJ6A 1YLNA 3FANA 1AO5A 4B76A 4D9RA 1FI8A 2R2WU 1EPTB 1ZLRA 2OUAA 3URDA 3BEIB 4YT7H 1O3KA 2PSXA 2VBCA 2Y81A 5SGAE 5EQQA 2HNTE 1ELBA 1QJ6B 3A8CA 2J38A 1MD8A 2GCTB 2XNDD 2R9PA 3F6UH 2BMGB 4Y7BA 4Q7YA 2ILNA 1KDQB 1MTNB 1W0YH 1C1SA 4FUJA 4K1EA 4RKOB 1YP9A 4Z1MD 2A5AA 1O3IA 3K6ZA 2ZGCA 3E90B 2OLGA 3MO6A 4JYVH 4GHQA 4AYVB 1SGCA 1C2HA 3AW1A 1GMCF 1DY9A 1EOJA 2FX6A 2GCHF 1GJ7B 3A8AA 3BSQA 1RJXB 2UUFB 1CT4E 1CO7E 1GMHG 3M36A 2C8YB 1BMLA 4O3TA 1C1MA 1GJBB 3VB4A 2OD3B 3F3BA 1DX5M 1TX6A 3FZDA 2Y82A 1QIXB 2A2QH 1GMCG 1GMDF 1Z6EA 2GCHG 2GZ7A 2D2DA 1F0SA 1FQ3A 1N6XA 4XDEA 1EJMA 3RXEA 4GVUA 4Y76A 1LHFH 3AASA 3T2NA 2ASUB 1W3CA 3SQEE 5A0AE 1AE5A 1K9OE 1GMDG 1NU7B 1PQAA 2BD7A 2VJ1A 4K8YA 5EXMA 3G01A 2GX4A 2WHXA 4OS7A 1ZPZA 5EU8A 2BOKA 1DUAA 3KQBA 3L6PA 5A0BA 1GDQA 4A7IB 1WOFA 3ODFA 1HAHH 1GHBF 3KL6A 2RCEA 5A8ZA 4INHA 4I8JA 1C2FA 1SSXA 3FKSD 1GI2A 1TAWA 2BDGA 2AGEX 3SJ9A 1N8OC 4FUBA 5T3HA 1GHBG 4D7FA 3S7KB 1GI9B 1H9IE 3D65E 5I25A 1EATA 2FPZA 4K8BA 2OK5A 1Q3XA 1A5GH 1O34A 1FX0B 5LH8A 3WY8A 2BDCA 3LGUA 3QZQA 5EODA 4YLQH 1KLJH 9LPRA 4JYTA 2C90B 4A1VA 4DIIH 2HLDD 2FS8A 2JETC 1VJ9U 2V3MA 3NPSA 2YNAA 5L2ZH 1S0QA 5J4QA 1THRH
chains in the Genus database with same CATH topology
4NWKA 2K1QA 3SZEA 3P8OA 3M5NA 4U01A 3SUEA 3DSPA 4B73A 3O8BA 4I33A 4TT3D 1W0JD 5EPYA 2IJOB 3OEED 3SU3A 3O8RA 2V7QD 2WPDD 3RC4A 4Z1MD 4M9FA 1NS3A 1DXPA 3UB0A 3E90B 3SU0A 2GGVB 5T1VA 2P59A 2O8MA 4WH8A 2K0QA 2OINA 3OAAD 4JMYA 2WSSD 5EQSA 3N7EA 2WV9A 1DY9A 2F43B 4R8TB 4TSFD 5GNDA 3SV7A 3RC5A 2OBOA 4WF8A 4B6EA 4B71A 1BT7A 1JXPA 2XNIA 3OTPA 3SUFA 2OC8A 2QE7D 3F0PA 5EQRA 3F3BA 3N7DA 3M5LA 4OM9A 4F55A 2QV1A 4FETA 3F2FA 3GS9A 2QF4A 2XOKD 3FN8A 3FO8D 3LONA 4A1TA 3DSOA 2K8IA 3SV9A 5GPIB 3NRLA 2GVFA 2OC0A 3EYDA 2OBQA 2YOLA 5HKKD 1W3CA 2QF5A 4ZCNA 1S6LA 5CDFE 3SUDA 2F9UA 4A1XA 2J5UA 2JJ1D 1E79D 3F2HA 3SU5A 4B6FA 3KN2A 1A1RA 5IDKA 2YMSC 3KEEA 3M5MA 5B6LA 3ZIAD 1RGQA 3AK5A 2WHXA 3PV2A 3OEHD 4WH6A 5C0UA 3SUGA 3SU1A 2KCYA 3PRBA 2KFWA 3P8NA 3PV5A 5FL7D 2KCPA 3SU6A 3O8CA 2KZ4A 3L6PA 5ETXA 2A4GA 3SV6A 1DY8A 5ESBA 3U1IB 2XCNA 2JDID 2A4QA 4B74A 3SU4A 3WWBA 2W6JD 1SKYE 2LELA 4B75A 4NWLA 3O8DA 5FPTA 3VG8A 3FKSD 2XCFA 1E1QD 3SU2A 3KNXA 2OC7A 2KCOA 2W6ID 5FPSA 1NBME 2YMSD 4I32A 2JJ2D 2CK3D 2L6OA 5C0TA 5DN6D 2JIZD 2M2AA 1COWD 3DCLA 3OE7D 4A92A 4DT4A 5F53A 3N99A 2F9VA 1OHHD 5FPYA 4YXWD 1H8HD 2KR7A 4RI0A 5GJ4B 1RTLA 3SV8A 2KCAA 1MABB 1N1LA 3F2GA 4Q4LA 3WW7A 2A4RA 3RC6A 1CU1A 3OFND 2FM2A 4K8BA 3W1EA 2WZQA 2OK5A 5EPNA 1W0KD 5DSFA 1FX0B 2OC1A 5C17A 3LOXA 3SYJA 1H8ED 1BMFD 3PRDA 4I31A 4B76A 1WXRA 3OYPA 3LKWA 4TYDA 4XD7D 1NBMD 3FOAA 1KMHB 3F0OA 2FP7B 2IJD1 3H09A 3U1JB 1EFRD 3WWFA 4A1VA 4ASUD 2HLDD 2VBCA 1DXWA 2AHME 5EQQA 5H4IB 2KM0A 5CHBA 4KTCA 2YMSB 1E1RD 5IK2D 2F4LA 4Q63A 2FOMB 3KF2A 3M5OA 2XNDD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7D A;  2K0Q A;  3DSP A;  3DSO A;  3N7E A;  2LEL A;  2KM0 A; 
#chains in the Genus database with same CATH topology
 1TMB H;  4CHA C;  2VVU A;  5CMX H;  1V2K T;  1ELD E;  4X1S U;  2GJG A;  4WXI A;  2ODP A;  3DT0 H;  2IJO B;  2BDH A;  3ZVC A;  2QXI A;  1QR3 E;  2LP6 A;  1Y8T A;  3ODD A;  3SBK A;  2NU0 E;  1C1Q A;  4X0W U;  1HAX B;  2HPQ H;  3S7H B;  2K0Q A;  1O2U A;  3QZR A;  2QY0 B;  2VWN A;  2ZHF H;  5GND A;  1C5Z B;  1VJA U;  2OQU A;  2P8O C;  4XRN A;  4ABF A;  5FHT A;  3OTJ E;  1F0T A;  4XBC A;  1AIX H;  3N7D A;  2ZTY A;  3SND A;  4FVB A;  1AVW A;  3TLO A;  1AVX A;  2QF4 A;  4CR9 A;  3RUO A;  2WPH S;  2OTV A;  1QJ1 B;  4WJG 2;  2K8I A;  5E2P A;  4Z6A H;  5HGG A;  3VXE H;  3TH2 H;  1SQR A;  1DPO A;  1HAZ B;  2QF0 A;  1VGC B;  3RMN H;  3TGI E;  1ORF A;  1GBE A;  1MH0 A;  1HCG A;  2J9N A;  3F9F A;  5LPE A;  1EPT A;  2ZU1 A;  2ZPQ A;  3Q3K A;  2KZ4 A;  2A5I A;  2ZU4 A;  3OSY A;  3U1I B;  2RFK C;  2VGC C;  4H4F A;  2AGG X;  1ZGI A;  3ZZC A;  1BTW A;  1ETS H;  1O2R A;  3O8D A;  2ZU3 A;  5FPT A;  4MNX A;  4ABI A;  3EDX B;  1V2R T;  2KCO A;  3BTT E;  2ZFT A;  2ZHD A;  2FZZ A;  4JYU H;  1KDQ A;  4KKD A;  1C2M A;  2C3S A;  1SOT A;  4NIY A;  4AFQ A;  4X2Y A;  4UEH H;  2ODQ A;  1GCT C;  4OGX A;  3E1X B;  3ZYD A;  3T62 A;  4OGY A;  2G51 A;  2KCA A;  3SJ8 A;  5F6M A;  4RKJ B;  1QRZ A;  4FU7 A;  3SV2 H;  1O5B B;  2BZ6 H;  1W0K D;  5HYO A;  2OC1 A;  2ZG0 H;  1SC8 U;  2Y5H A;  3H7T A;  1W2K H;  1SMF E;  1D3T B;  2WUB A;  3GCH C;  4UD9 H;  2BB4 A;  3EA9 A;  4X1Q U;  1K1J A;  1SGP E;  2R3U A;  3UTU H;  2BHG A;  1GJA B;  2KM0 A;  1A3E H;  1C5S A;  1LPG B;  1V3X A;  1E1R D;  1DLE A;  2KX4 A;  1C2K A;  3MYW A;  1HIA B;  2K1Q A;  3A7T A;  3SZE A;  3M37 A;  1ZHR A;  4U01 A;  2ZU5 A;  3PLK A;  3O8B A;  2Z7F E;  3O8R A;  1AFQ B;  6EST A;  1GBI A;  2B8O H;  1MQ5 A;  1K28 D;  2A45 B;  1O3H A;  3RU4 T;  1ZTJ A;  1GDN A;  1TRN A;  3N7E A;  1AE8 H;  2VID A;  4NSY A;  4Y10 E;  2FOF A;  4B71 A;  4RT1 A;  3RXQ A;  1JXP A;  2FEQ H;  4ZKN U;  1G32 B;  1SPJ A;  1MKW H;  1DT2 A;  1O2T A;  4HFP B;  4OM9 A;  1E37 B;  1AZ8 A;  1AB9 B;  1UJ1 A;  5AHG H;  2FOE A;  1Z8I B;  1Z8R A;  3U28 C;  1XUG A;  2H2Z A;  4E7R G;  5DO4 H;  1LQE A;  4UON A;  3AVZ A;  1EUF A;  2SNW A;  3SGQ E;  3QK1 A;  1DVA H;  2FS9 A;  3QDZ B;  1LVO A;  3V3M A;  2STA E;  3ZYE A;  1C1R A;  1JWT A;  3D49 H;  1GI5 A;  1HFD A;  1GBH A;  2ZCK P;  4FUD A;  4U32 A;  3P8N A;  1YBW A;  2Q6D A;  1B0F A;  3O8C A;  1PPH E;  2A4G A;  1VIT F;  2GDD A;  4B2C A;  4GPG A;  1GJ9 B;  1BTH H;  2A7H A;  4ABA A;  3SI4 H;  3PYH A;  2F3C E;  2LEL A;  3GY3 A;  1TOM H;  1TWX B;  2VIQ A;  2OC7 A;  5G4B A;  1P2N A;  5GWZ A;  3MTY A;  5CHA B;  3VEQ B;  4ZKS U;  1VIT G;  1C2E A;  1OWI A;  2ZQ1 A;  3DSG A;  1NRR H;  1MCV A;  1T8O A;  3EQ0 H;  5FAH A;  1IQK A;  5GCH F;  1GHY H;  4RI0 A;  1GBT A;  1MKW K;  4CR5 A;  3A83 A;  1ARB A;  5ABW A;  1ANE A;  2J92 A;  2O8L A;  4TPI Z;  1S82 A;  1GGD B;  2BY5 X;  1WXR A;  5GCH G;  3V12 A;  1BTU A;  2NWN A;  4WMF A;  1B0E A;  2EI8 A;  1FAK H;  1G2M A;  4UFD H;  3ZZ5 A;  5GXP A;  2Y80 A;  5DJ7 A;  1PPZ A;  4E05 H;  1BQY A;  2PUX B;  3MI4 A;  1ZRB A;  1OP2 A;  2F4L A;  1TNI A;  1QL7 A;  2FES H;  2ZDN A;  1V2Q T;  2QA9 E;  1EAU A;  2ZKS A;  1SGE E;  2FDA A;  3A7X A;  5LPF A;  1O3A A;  1Y3X A;  1NRN H;  1TAL A;  4JZD H;  2BM2 A;  1BRU P;  1WYK A;  4K3J A;  1KXA A;  3RXT A;  2F9O A;  1S85 A;  2OIN A;  2SGP E;  1T32 A;  3GDV A;  4AFZ A;  1Q2W A;  2OBO A;  1TBZ H;  1EJA A;  1GJC B;  3CP7 A;  1Y3V A;  4JK5 A;  2VWO A;  1P8V C;  1MZA A;  2EST E;  1TMU H;  3ENS B;  1O2G H;  1G3C A;  1G2L A;  1AND A;  1VCW A;  1NFU A;  4UFF H;  2W3I A;  2PKS C;  1O2S A;  1O3F A;  4OS6 A;  1GL0 E;  4A1T A;  4IC6 A;  2G8T A;  3LIW A;  4UFE H;  2OC0 A;  2G5N A;  3EYD A;  1E36 B;  1SHH B;  3ZV8 A;  1O3C A;  3GY6 A;  1C5X B;  1QNJ A;  2BDY A;  5CDF E;  1SLV B;  4CRF A;  2G4U A;  2JJ1 D;  5EJ1 A;  1VCQ A;  2WV4 A;  3VB6 A;  3D23 A;  3TNS A;  3U8R H;  1RGQ A;  4HGC A;  3SI3 H;  2UWL A;  5C5N A;  1H4W A;  3GIS B;  3PV5 A;  1BB0 B;  1TA2 A;  1FZZ A;  1XMN B;  2AH4 X;  1DY8 A;  2H9E H;  1YPJ H;  2A4Q A;  7GCH G;  4GLY A;  3SU4 A;  1FAX A;  3A87 A;  3K6Y A;  3WWB A;  4ZH8 A;  4MVN A;  3ZZ7 A;  2XBX A;  2ZO3 H;  1HIA A;  4K2Y A;  5C0T A;  2BY6 X;  3F1S B;  1Q31 A;  2W7U A;  4ISO A;  4LK4 A;  3ZZD A;  1D3D B;  4BAM B;  2HLC A;  4BAK B;  3UQV A;  1HXE H;  4JZE H;  4Q80 A;  4X6P A;  2BVX H;  1GDU A;  1SQA A;  4UFG H;  5HXF A;  1CA8 B;  1EAI A;  4HG6 A;  4HI3 A;  2HWL B;  4B2A A;  1G36 A;  2RA3 A;  3KGP A;  2BLW A;  1ZHM A;  2A4O A;  2FOC A;  2TGT A;  1GL1 A;  4NA8 A;  4Y8Y A;  4MPU A;  4GHT A;  2P3T B;  3TJO A;  3M5O A;  1ELT A;  3SHA H;  2O9Q A;  1S5S A;  4VGC C;  1O2W A;  1O38 A;  3MOC A;  2FLR H;  1HJA C;  1J15 A;  1T8N A;  2ZF0 H;  5EJL A;  1O36 A;  1XXF A;  3SO3 A;  1N6Y A;  2RA0 A;  4M9F A;  1U6Q A;  2WPM S;  2GGV B;  2FXR A;  4BTT B;  3LU9 B;  1TBQ H;  1P01 A;  2WSS D;  3LPR A;  4I8H A;  4UDW H;  1YF4 A;  2PUQ H;  1QGF A;  2FOH A;  2CJI A;  2P93 A;  4Y79 A;  5C3N A;  1N8O B;  3URC A;  1L4D A;  1Z1J A;  1EB1 H;  4NA9 H;  1AVG H;  2V35 A;  1H9L B;  1WCZ A;  1J14 A;  1SFI A;  4R0I A;  2BD3 A;  2PR3 A;  1O2M A;  3PWC A;  1SOZ A;  1C1O A;  1SGY E;  3LON A;  1TYN A;  3PLP A;  1C1V H;  3SV9 A;  1NFW A;  4Y8Z A;  4JZF H;  5L30 H;  1TAB E;  2QF5 A;  2EI7 A;  1DIC A;  1EKB B;  1PYT C;  4QT8 C;  4F48 B;  1UK2 A;  1UW7 A;  2J97 A;  2JET B;  2VH0 A;  2ODY B;  1L1J A;  3RU4 E;  1O39 A;  1HNE E;  2C93 B;  2B9L A;  2R2M B;  5C5O A;  4CHA B;  3ATK A;  2B7D H;  4INL A;  1FN6 A;  1CT2 E;  4AB8 A;  5AF9 H;  3GY4 A;  1A46 H;  1KLT A;  1QZ8 A;  2RDE A;  1XUK A;  2W6J D;  2H1U A;  1MAX A;  3VB5 A;  1E1Q D;  1WTG H;  2TGP Z;  3LT3 A;  1EXF A;  4MDS A;  2W6I D;  5FPS A;  5DN6 D;  2XYA A;  2V3H H;  2ZNK H;  5EGM A;  3K9X B;  1MTV A;  3ZVA A;  3BTH E;  1O2Z A;  4X6N A;  5GDS H;  3E3T A;  1K1L A;  4O3U A;  4P00 A;  2ZP0 H;  3N99 A;  1YGC H;  2F9V A;  2P8O B;  1SI5 H;  1H8H D;  2VWM A;  4J2Y B;  1KIG H;  1VCP A;  1HAP H;  1UTP A;  1VKY A;  2PFE A;  3C1K A;  4X2V A;  2FO9 A;  1YM0 A;  4IGD A;  2SNV A;  3LC3 A;  4CH8 B;  2Z3D A;  1OWH A;  2HRV A;  4AFS A;  2ZFP H;  3KQ5 A;  3OYP A;  1DM4 B;  5DP9 A;  1DSU A;  1GHZ A;  4BTI B;  5J4S A;  1GJ5 H;  4XD7 D;  1K1M A;  4AX9 H;  3RXG A;  1THS H;  3L3T A;  1IQG A;  3H09 A;  2NU2 E;  2SGE E;  1O3O A;  2ULL A;  1EAW A;  2BDI A;  3MMG A;  1H1B A;  3SGA E;  4CBN A;  5IK2 D;  1XKA C;  1O31 A;  2CHA C;  5EXL A;  1RFN A;  1S6H A;  4KTS A;  1TGT A;  1ELF A;  2ZEB A;  2FLB H;  2B0F A;  3JZ2 B;  1ETR H;  1SGD E;  5DP8 A;  4BTU B;  1TIO A;  2VGC B;  3RXV A;  4Y6D A;  3T26 A;  4KEL A;  2G52 A;  3MU8 A;  2TBS A;  4DVA U;  1P2Q A;  3QTO H;  1OSS A;  4YT6 H;  4DY7 B;  4R8T B;  4TSF D;  2HPP H;  5E0H A;  4TY6 A;  1GCT B;  3GOV B;  1O2Q A;  1Y3U A;  1K2I 1;  1TX7 A;  1T31 A;  2IOT A;  3MU5 A;  4I8K A;  4F55 A;  3BTK E;  3F2F A;  1KYN A;  2GZ9 A;  1MBQ A;  3GY5 A;  1OOK B;  1O3M A;  1YLD A;  5DPA A;  3GCH B;  4IN2 A;  5HKK D;  1Z7K A;  2TPI Z;  2Y5G A;  8EST E;  4SGB E;  1KTS B;  4NZQ A;  1VR1 H;  1VZQ H;  4DG4 A;  2VB0 A;  1BJU A;  1A0J A;  1TFX A;  1O37 A;  1QRW A;  2ZDA H;  1IQI A;  3L33 A;  4WH6 A;  3TVJ B;  5C0U A;  3SU1 A;  1V2T T;  4RSP A;  1O5F H;  1W7G H;  2C8X B;  1P12 E;  2WPI S;  1UVT H;  1L0Z A;  1WU1 A;  1ZSK A;  1Y3Y A;  1UVO A;  3D62 A;  1K1I A;  1NU9 A;  2BVR H;  1G37 A;  5KEC A;  3NUM A;  3STJ A;  3MQK C;  3PM3 A;  1CBW C;  2L6O A;  2XC4 A;  1YLC A;  1CA0 C;  3BEF B;  1GHW H;  3DCL A;  3PMA B;  3T27 A;  3P8F A;  4E7N A;  5GJ4 B;  3SV8 A;  1K21 H;  4OS2 A;  2CV3 A;  3QN7 A;  3A7V A;  3U9A H;  2FOA A;  1SLW B;  2XW9 A;  4MNY A;  1DAN H;  3RXO A;  3TJN A;  1H8E D;  4I31 A;  3MNC A;  2D26 C;  1FIZ A;  2QF3 A;  1XUI A;  4ISN A;  1PPE E;  1BRB E;  4ASU D;  2J95 A;  2PKA B;  4YM9 A;  3NKK A;  2OXS A;  4E06 H;  3KHV A;  3U98 H;  2H6M A;  2O8T A;  3E6P H;  4NWK A;  3STI A;  1GVZ A;  5FX5 A;  3M5N A;  3DSP A;  1ZGV A;  1C1U H;  5FXL A;  5JBA S;  1T4V H;  5DK1 A;  1GI6 A;  1KXC A;  3TH4 H;  2ZTX A;  1V2U T;  3CEN A;  3FAO A;  3UB0 A;  1NRP H;  5DP5 A;  4F4O C;  4WH8 A;  2J98 B;  2A32 A;  2PWX A;  3A81 A;  2W5E A;  1GBL A;  3E0N B;  2TGD A;  1TRM A;  3MH6 A;  2PGB B;  4D76 A;  1TQ0 B;  1GI8 B;  2QXG A;  3OTP A;  1KXE A;  3VPK A;  1C5Y B;  1BCU H;  1ABI H;  1S0R A;  1WBG B;  1A0L A;  2QE7 D;  4K69 A;  1D3P B;  1CHO F;  1TNL A;  1LQD B;  5C1U A;  1OYQ A;  3VGC C;  2GMT C;  1X7A C;  1GBD A;  1IAU A;  1CGI E;  1ID5 H;  1UTL M;  5GPI B;  6LPR A;  1FDP A;  2CF9 H;  3UQO A;  1XVO A;  1RS0 A;  1CHO G;  5A2M H;  1LO6 A;  1FMG A;  1YPK H;  4ABB A;  2UUY A;  4ZCN A;  4YZU A;  2F9U A;  5DP7 A;  1A1R A;  1SLU B;  3LJO A;  2A1D B;  1W8B H;  3CS0 A;  3FP7 E;  2QC2 A;  1SGF G;  3K2U A;  4TWY A;  1FNI A;  5GIB A;  3ATM A;  2KCP A;  5E0G A;  3PTN A;  4MPW A;  3K65 B;  3RXF A;  1BBR E;  1ETT H;  5F8Z A;  3BTM E;  1Y3W A;  2J94 A;  4B1T A;  3MO3 A;  2C8Z B;  2ZDM A;  3IIT A;  3FZZ A;  1DE7 H;  1SKY E;  4B75 A;  3PO1 B;  2XCF A;  3KQE A;  4FU9 A;  3A85 A;  1NTP A;  1P2K A;  1QCP A;  2V6N A;  5DP4 A;  2L74 A;  1ZRK A;  4I8L A;  5FPY A;  3LGY A;  3SHC H;  1T8M A;  1RTK A;  1MAB B;  1THP B;  1LHG H;  3WW7 A;  3RC6 A;  3RMM H;  1JIM A;  1ACB E;  1WDI A;  7EST E;  1C2G A;  2WZQ A;  2PKS B;  2ANW A;  1LVB A;  4FVD A;  1ELV A;  1MKX H;  4XOJ A;  1FY4 A;  4ZHA A;  3T25 A;  1MD7 A;  1TNK A;  3SQH E;  3FFG A;  1TGB A;  5JDU B;  2P3U B;  3R0F A;  4AB9 A;  1HXF H;  1EB2 A;  4X8S H;  5KED A;  1BOQ A;  2FOM B;  1XUH A;  1F0U A;  1G3B A;  2ZIQ H;  3ATW A;  2ZFF H;  1GHX H;  2BD4 A;  3P8O A;  3S9B A;  2FOD A;  1ZJK A;  1YPL H;  1SGT A;  5HIY A;  1MMJ N;  3M61 U;  1YCP K;  3OEE D;  3M7T A;  4NA7 A;  1C1W H;  4X1P U;  5AVD A;  3TGJ E;  3UFA A;  2P95 A;  2O8M A;  2PGQ B;  1O2H A;  1FIW A;  1E35 B;  3MHW U;  1INC A;  4JMY A;  3DA9 B;  1K1N A;  1NM6 A;  1HDT H;  2FI5 E;  4OS1 A;  5TCA A;  4MNW A;  3SV7 A;  2G4T A;  3UNS A;  2PW8 H;  3EE7 A;  1IQH A;  1XXD A;  4B6E A;  4X8V H;  5B6O A;  1HYL A;  1EJN A;  7LPR A;  5JPM H;  2XRC A;  4U2W A;  4YO9 A;  1HLT H;  2P16 A;  4CRB A;  2QV1 A;  2O8W A;  4NFE A;  1SGR E;  1BHX F;  4Q7Z A;  1MZD A;  1C1T A;  1P04 A;  1MKX K;  3EGK H;  3DSO A;  2V3O H;  2GP9 B;  2OBQ A;  3TPI Z;  1AWF H;  1HAO H;  4DJZ B;  1DWB H;  2VWL A;  3RXR A;  1QB9 A;  3MU4 A;  1IHT H;  4INK A;  1ZYO A;  1B5G H;  5FCR A;  1UTQ A;  1AI8 H;  1UO6 A;  3B9F H;  2WIN I;  2FOB A;  4MLF B;  2QIQ A;  4Q2K A;  1MU6 B;  1GBM A;  4VGC B;  1YPG H;  2I6Q A;  1NRQ H;  1O33 A;  5FBE A;  4ABD A;  3A7W A;  1HJA B;  3TK5 A;  1P11 E;  1BTX A;  2A5K A;  1O3B A;  1KXB A;  1V2W T;  2GV7 A;  1ELC A;  2PKA A;  3A86 A;  3PMH B;  4ZKR U;  1UMA H;  1XM1 A;  1AHT H;  3ITI A;  2BQ6 B;  3KQC A;  2GDE H;  4H6T A;  1QBV H;  1YYY 1;  2BXU H;  1O32 A;  1LDT T;  1OS8 A;  1PQ5 A;  2CN0 H;  2D8W A;  3SOR A;  2SGD E;  5F53 A;  1P2J A;  1ZML A;  3ZVG A;  3RXB A;  2BVS H;  1CT0 E;  1GJ4 H;  1N1L A;  1LHD H;  2IPH A;  2J98 A;  2BY9 X;  1A61 H;  5EPN A;  3NCL A;  3LOX A;  4ZKO U;  1XKB C;  3LKW A;  4WY3 A;  1NC6 A;  5LPR A;  3RXI A;  4TYD A;  2BQW B;  3RXC A;  3F0O A;  4AYY B;  1QUR H;  1ZTK A;  2BD8 A;  4ASH A;  1QY6 A;  1BMA A;  1UCY E;  4Y71 A;  3S9C A;  1QQ4 A;  4DGJ A;  1O35 A;  3A8D A;  1C4Y 2;  1ZZZ A;  1Z6J H;  1MU8 B;  1B7X B;  2A7C A;  4AG1 A;  6GCH F;  4BXS A;  1EZS C;  1TGN A;  1QBO A;  4H6S B;  1DDJ A;  1FON A;  1NS3 A;  1QRX A;  2VIP A;  3SU0 A;  1HAG E;  1C5M D;  3DFL A;  4AZ2 B;  4DT7 B;  5HIZ A;  1W11 U;  4CRA A;  2FX4 A;  2WV9 A;  4Z0K A;  1DWC H;  1NT1 A;  1QL8 A;  1JRS A;  6GCH G;  1NFX A;  2BX4 A;  1OWD A;  2ZDL A;  3PV4 A;  2UUK B;  2Y7Z A;  3ATI A;  4WXV A;  4AGK A;  1TPA E;  1C5W B;  1QA7 A;  3GY8 A;  1JRT A;  1IQJ A;  3LH3 A;  1LCY A;  3P17 H;  4GCH F;  1JOU B;  2ZHW H;  2BD9 A;  5K0H A;  2XOK D;  4X2X A;  3TJV A;  3FO8 D;  4ACA A;  4XE4 A;  1GWA A;  3TIU A;  2IPQ X;  4ZAE A;  3PO1 C;  3RXL A;  5JYI A;  1TPP A;  3FP6 E;  1S6L A;  4GCH G;  3KYF A;  3SUD A;  3TNT A;  5TCC A;  1OX1 A;  1WTH D;  3KN2 A;  2YMS C;  4Q7X A;  1KY9 A;  2Z9K A;  1PQ7 A;  2CHA B;  3KCG H;  1RTF B;  4DCD A;  3GDU A;  2EC9 H;  2JH0 D;  5A09 A;  2AGI X;  4IS5 A;  4DIH H;  5AFY H;  4MG3 A;  4FUE A;  1PJP A;  1RIW C;  5HM9 A;  3TK9 A;  1TA6 A;  1BJV A;  4PRO A;  4NWL A;  3UY9 A;  1FLE E;  5T6D A;  3VG8 A;  2ZHE H;  1O5E H;  1LTO A;  1AY6 H;  4NZL A;  3DHK H;  3P92 A;  4A6L A;  1C5L H;  2ZPR A;  1TGS Z;  1IQN A;  1KTT B;  1OKX A;  2F83 A;  2ZTZ A;  4O03 A;  3MFJ A;  2HVX A;  1F92 A;  4BOH A;  4YXW D;  2BLQ A;  2BX3 A;  1GI1 A;  1CE5 A;  2OCV B;  3OFN D;  1P10 A;  1P03 A;  3PMJ A;  2PP6 A;  4J1Y A;  3SNE A;  2AIP A;  1MCT A;  1HAY B;  3B23 B;  1EAS A;  2BY8 X;  2IJD 1;  3SW2 B;  1Y59 T;  3BTD E;  4YOJ A;  1EQ9 A;  2FTM A;  2Z6B D;  5JB9 S;  5K7R A;  2Z9G A;  1AKS B;  4GSO A;  1ZSJ A;  2JH6 D;  5CHB A;  3RU4 D;  4ISH H;  3AAV A;  4A5T S;  4Y8X A;  2F9B H;  1G9I E;  2JKH A;  3P6Z B;  3SU3 A;  3HPT B;  5A8Y A;  3UIR A;  2Y5F A;  4FUI A;  3TK6 A;  1OP8 A;  3RDZ A;  2OP9 A;  2ANY A;  1F5K U;  1V2V T;  1Y5U T;  1G3D A;  1CBW B;  1CA0 B;  1YPE H;  5C1Y A;  3I77 A;  4WF8 A;  4YES B;  3MH7 A;  1C9P A;  3AAU A;  3RLY H;  1NFY A;  1O3D A;  4MQA A;  3U69 H;  4SGA E;  4WME A;  1O3G A;  3GY7 A;  4NCY A;  1AUJ A;  1HJ8 A;  1O2I A;  4AFU A;  3BIV H;  1NRO H;  3EA8 A;  1S6F A;  1YPM H;  4CRD A;  5JBC S;  5T6G A;  2HGT H;  2TIO A;  2ZQ2 A;  4LZ4 B;  1FN8 A;  3SU5 A;  2FYR A;  5BPE A;  1TQ7 B;  3PV2 A;  4Y11 E;  1C5P A;  3GY2 A;  3PRB A;  1C1P A;  4CBO A;  2KFW A;  1LPK B;  2SGF E;  2C4F H;  5PTP A;  2WYJ A;  2GTB A;  1TGC A;  3QUM P;  1SVP A;  2ZCL P;  3RXS A;  1D4P B;  1CSO E;  1RRK A;  2BD5 A;  4RT0 A;  3OX7 U;  2UUJ B;  2ZWL H;  6CHA C;  2JJ2 D;  4JCN A;  1SQO A;  4TY7 A;  2HVY B;  1QB6 A;  1TE0 A;  5HMA A;  1OWK A;  2UWP A;  1EST A;  3OE7 D;  1UTK A;  3C27 B;  4X1R U;  1W7X H;  4AGJ A;  1HV7 A;  1H9H E;  1O3L A;  3A88 A;  3EST A;  4ZMA H;  2VH6 A;  3UOU A;  1ZMJ A;  1MAY A;  1TNJ A;  1MQ6 A;  1M9U A;  2P94 A;  3VGC B;  1SGQ E;  5I46 H;  1P0S H;  2GMT B;  1XX9 A;  2GKV E;  4X8U H;  5EST E;  1KMH B;  1W12 U;  1NPM A;  2FI3 E;  3WWF A;  1O2X A;  3U1J B;  2THF B;  4KTC A;  2ZFS A;  1XUF A;  4K1T A;  4I86 A;  4TWW A;  2ANM H;  4ISI H;  1TNH A;  1HGT H;  2VIW A;  1F5R A;  3S69 A;  2QN5 T;  1C5N H;  1PPC E;  4B73 A;  5A0C A;  4FUH A;  3RXD A;  3BN9 A;  1DIT H;  2I6S A;  5EJZ A;  5LGO A;  4AN7 A;  1DS2 E;  3LGW A;  2LNC A;  4TPY A;  3T28 A;  1AD8 H;  5T1V A;  3ZZ8 A;  1KXD A;  2WPL S;  3BTQ E;  1OXG A;  2HNT F;  2ZDK A;  2VVV A;  2WYG A;  3KID U;  5DKM A;  1C9T A;  4NIV A;  5DGJ A;  1HAV B;  1MTU A;  2ZCH P;  3SUF A;  2ALP A;  1O2O A;  1FPC H;  1SB1 H;  3FVF B;  1DOJ A;  3ATL A;  3PTB A;  2R3Y A;  4FET A;  1BIO A;  1C2I A;  1P06 A;  1SGF A;  3BTW E;  3OY5 U;  2EEK A;  5C94 A;  2SGQ E;  4KTU A;  1SGI B;  1BA8 B;  1YCP M;  1F7Z A;  1J8A A;  2STB E;  1AQ7 A;  3CNR A;  1BTP A;  1P2I A;  2A31 A;  3ZZ4 A;  1UK4 A;  4NG9 H;  4CRE A;  5IYT A;  2ZFQ H;  3M5M A;  1F0R A;  2RG3 A;  3OEH D;  3ZVF A;  3ZV9 A;  3SUG A;  1GVL A;  1TB6 H;  3M7U A;  3RXJ A;  3SV6 A;  1QQU A;  1C5Q A;  3DUX H;  1QHR B;  1AKS A;  2NU1 E;  3UUZ A;  4MNV A;  4LOY H;  1DWE H;  1LVM A;  1PYT D;  1P2O A;  1AN1 E;  1RXP A;  4O9V A;  2W3K A;  1K0H A;  1PPG E;  3EAJ A;  1NZQ H;  3LGV A;  1C2J A;  1O5G H;  1TX8 A;  2M2A A;  3PWB A;  4F49 A;  1BTZ A;  3A80 A;  5FCK A;  1DFP A;  3SNA A;  1BTY A;  2KR7 A;  1HRT H;  4LXB H;  5EW1 H;  1RTL A;  2QXH A;  3PB1 E;  2JH5 D;  1NRS H;  1S83 A;  1ELE E;  2VU8 E;  2VIV A;  4IN1 A;  1GG6 C;  1GMH F;  1PFX C;  2IN2 A;  1O5D H;  1Y5B T;  2AER H;  1NBM D;  3FOA A;  1DUE A;  2CXV A;  4X2W A;  1C2L A;  1GBK A;  1KXF A;  4WMD A;  3TU7 H;  3SN8 A;  1C5O H;  3W94 A;  5L6N H;  3A8B A;  1AMH A;  2AHM E;  4FOU C;  1JBU H;  2PLX A;  3CS7 A;  1ZR0 A;  3BTF E;  4Q63 A;  4D9Q A;  3KF2 A;  5JB8 S;  1V2J T;  2KAI B;  3NK8 A;  1L4Z A;  2TGA A;  2Z3C A;  2CMY A;  2DE8 A;  1BBR H;  4DOQ A;  1FUJ A;  1LKB A;  4IC5 A;  1OWJ A;  2F9P A;  2Q1J A;  2H5C A;  1GI4 A;  1DXP A;  3HK6 B;  1O2L A;  4ZRO A;  2ZFR H;  1O2N A;  2F91 A;  1IOE A;  3TH3 H;  1XUJ A;  2GT7 A;  1EAX A;  2EI6 A;  3TGK E;  1Z8G A;  3TJU A;  1IQL A;  3UWI A;  3W95 A;  3E8L A;  1NY2 2;  3EA7 A;  4CRG A;  2AMP A;  3MO9 A;  4ZXX H;  4BAQ B;  5E2O A;  1YKT A;  3LJJ A;  3R3G B;  3RXK A;  1BUI A;  3UR9 A;  3QGN B;  2SGA A;  5DP6 A;  1ARC A;  1GCD A;  1UTM A;  1O2K A;  2J5U A;  9EST A;  1E79 D;  5IDK A;  2CF8 H;  3RXU A;  2V0B A;  3MU1 A;  1ZJD A;  2Z9J A;  3ZVE A;  5B6L A;  2ZGJ A;  5EIY A;  2KCY A;  2ZZU H;  3Q77 A;  3SU6 A;  1BBR K;  2C8W B;  2XTT B;  3V7T A;  2XCN A;  2JDI D;  3MNX A;  2J2U A;  1ZMN A;  2QXJ A;  3V13 A;  5CE1 A;  1Z71 A;  3SJO A;  1QFK H;  5E0J A;  1GHV H;  1IQE A;  3KNX A;  4NIW A;  1NBM E;  2CK3 D;  1C2D A;  1EP6 A;  3E16 B;  4NGA H;  1S84 A;  4ISL A;  4DT4 A;  2Q6G A;  3PRO A;  1OHH D;  1C4V 2;  3F9H A;  4Q4L A;  1K1P A;  5EOK A;  1BDA A;  3GYM A;  1CU1 A;  1ZOM A;  5F8T A;  5T6F A;  2BYA X;  1FXY A;  1EZX C;  1UVP A;  3LGI A;  5C20 A;  2FWW A;  1FY8 E;  2BQ7 B;  4H42 U;  3SYJ A;  1BMF D;  1YCP H;  1ZTL A;  3BG4 C;  3NZI A;  3RMO H;  1BZX E;  3A84 A;  3RXP A;  3T5F H;  1HAV A;  4YTA A;  2BOH B;  2ZI2 H;  3VB7 A;  3EE0 B;  3DFJ A;  1SL3 A;  1A2C H;  4BXW A;  3ZZ6 A;  1JIR A;  1P09 A;  4ABJ A;  2YMS B;  3MH5 A;  4P02 A;  1W13 U;  4AG2 A;  1FPH H;  8GCH F;  3QLP H;  4X6M A;  3SOS A;  4NFF A;  4XSK U;  4ZUH A;  1H8D H;  4I33 A;  4RN6 A;  4MPX A;  2NU3 E;  2A2X H;  3Q76 A;  1RIW B;  1SHY A;  2VNT A;  2P59 A;  8GCH G;  4M7G A;  1K22 H;  1PPF E;  4XBD A;  1OWE A;  1MBM A;  1OPH B;  1DST A;  3F0P A;  1LHC H;  2ZEC A;  2BXT H;  1QTF A;  2AMD A;  3HKJ B;  2GZ8 A;  1UTN A;  1O3E A;  2BD2 A;  2Q6F A;  3LH1 A;  4U30 A;  3HGN A;  3QO6 A;  4BAH B;  1ELG A;  1F2S E;  1PQ8 A;  1LPZ B;  4IMQ A;  1IQM A;  4XBB A;  3UNR A;  1EPT C;  2GVF A;  4MPV A;  1AZZ A;  1TON A;  1PPB H;  1C1N A;  1UCY H;  3ZZ9 A;  4X1N U;  1GBF A;  2DE9 A;  2ZDV H;  1C5U A;  3MU0 A;  4AOQ A;  3F2H A;  3IWM A;  4AOR A;  2P3F H;  1SGN E;  3UNQ A;  1KSN A;  4Y0Y E;  2G81 E;  4CRC A;  1QJ7 B;  2GCT C;  5DG6 A;  1GJ8 B;  4DW2 U;  3JZ1 B;  2FOG A;  5FL7 D;  4JZI A;  1GPZ A;  1TOC B;  2Z3E A;  3N7O A;  1MTN C;  1ESB A;  3U8O H;  3MNB A;  1A5I A;  3URE A;  4D7G A;  2BLV A;  5FBI A;  1P57 B;  1WUN H;  3AW0 A;  3BV9 B;  3M3S A;  1IHS H;  1T7C A;  1NES E;  1S81 A;  2KAI A;  1GI0 A;  3BEU A;  2W26 A;  3RML H;  5A8X A;  2G55 A;  2EQN A;  4NIX A;  1YY3 A;  1SFQ B;  2F9N A;  3LC5 A;  2AS9 A;  4GUX A;  3P95 A;  3F68 H;  4THN H;  3W1E A;  1O5A B;  4GAW A;  1D6W A;  1ABJ H;  3GIC B;  1VIT H;  3E0P B;  3PRD A;  1J17 T;  1A7S A;  1A4W H;  3GYL B;  2XBY A;  1UCY K;  2ZGX H;  1P9S A;  1P3C A;  3ZZ3 A;  3I78 A;  1LMW B;  3QWC H;  2Y6T A;  2ZHQ H;  4MTB A;  4WVP E;  2RDL A;  4LZ1 H;  2ALV A;  2WPJ S;  1GI7 B;  3M35 A;  3SNB A;  2DUC A;  1E34 B;  5F8X A;  2BDA A;  2PHB A;  1YPH C;  2R0L A;  2G5V A;  2NU4 E;  5DP3 A;  1W0J D;  3Q3Y A;  4FXG H;  1O2P A;  1A3B H;  1OP0 A;  2WV5 A;  3RC4 A;  3OY6 U;  1FJS A;  2PV9 B;  2WPK S;  3GCO A;  1L1N A;  3ELA H;  3S0N A;  2FMJ A;  4IBL H;  6CHA B;  1AFE H;  3QX5 H;  2F43 B;  1TPS A;  3U8T H;  4Y7A A;  3ZZA A;  1BRC E;  1W14 U;  1OYT H;  1V2P T;  1Y5A T;  4HZH A;  2FI4 E;  5EQR A;  3V0X A;  1A5H A;  1K1O A;  1DWD H;  1GBA A;  2AEI H;  2Z9L A;  4NSV A;  1EZU C;  3OU0 A;  2PTN A;  4DUR A;  3RXM A;  3GS9 A;  2FIR H;  1UHB B;  3FN8 A;  2J34 A;  3P8G A;  2W7S A;  1V2L T;  3H5C B;  1T8L A;  1WQS A;  3SGB E;  3HAT H;  4A1X A;  3LDX H;  1P3E A;  3BTG E;  4Y0Z E;  1CGH A;  1HJ9 A;  3AK5 A;  1O3N A;  1TNG A;  2BY7 X;  2XC0 A;  2AMQ A;  3SZN A;  1L2E A;  4ABG A;  2AIQ A;  4YLU A;  1MUE B;  5ETX A;  2HAL A;  5ESB A;  3UOP A;  3MNS A;  1CVW H;  1ZSL A;  1HPG A;  1J9C H;  3PMB B;  2EA3 A;  1QB1 A;  1QL9 A;  1GHA F;  2D1J A;  3UR6 A;  3SU2 A;  1WV7 H;  1SBW A;  4YOI A;  4X6O A;  2A7J A;  1RD3 B;  3GCN A;  1EZQ A;  1WAY B;  1TBR H;  1V2S T;  4A92 A;  4BAN B;  1ANC A;  5C67 A;  1GHA G;  1V6D A;  2QCY A;  1C5V A;  4OS5 A;  3F9E A;  3VB3 A;  2PSY A;  1FY3 A;  1UTJ A;  1BMN H;  1TLD A;  3RM0 H;  2AFQ B;  3ZVB A;  1UVS H;  1LVY A;  1CQQ A;  4AC9 A;  1O2Y A;  1KLI H;  1O3P B;  1P05 A;  3M3T A;  1EFR D;  2ANK H;  3I29 A;  3LGT A;  1VGC C;  2VVC A;  1AGJ A;  1FY1 A;  1HBT H;  2HOB A;  1P02 A;  1O3J A;  1SG8 B;  2QGR A;  3SUE A;  3M7Q A;  1GBB A;  2FYQ A;  3H7O A;  5EPY A;  3A89 A;  3SJI A;  1V2M T;  2WPD D;  8KME 2;  5JBB S;  3SNC A;  3FP8 E;  1BIT A;  3RLW H;  3OAA D;  5FX6 A;  7GCH F;  1GVK B;  1G3E A;  4D8N A;  1GI3 A;  2CGA A;  1BT7 A;  2HNT C;  2XNI A;  2EY4 C;  2O8U A;  2Y7X A;  5EG4 A;  1TMT H;  3BIU H;  1V2N T;  1HUT H;  3HK3 B;  2GV6 A;  3MWI U;  3M5L A;  3T29 A;  3B8J A;  2M5T A;  2ZGH A;  1H8I H;  1SLX B;  3Q3X A;  4K1S A;  3PLB A;  1IQF A;  3IG6 B;  1GG6 B;  4YOG A;  3NXP A;  1YWU A;  1QA0 A;  5AFZ H;  4WWY A;  3NRL A;  1V2O T;  1T4U H;  1WSS H;  2H9T H;  1NN6 A;  3KEE A;  3NWU A;  1MTW A;  3RP2 A;  3VFE A;  2H9H A;  2SFA A;  5E8E H;  4I7Y H;  3F9G A;  1TRY A;  1C5T A;  1UVU H;  5EXN A;  1AFQ C;  3DD2 H;  3HKI B;  3SJK A;  2ZC9 H;  2J4I A;  1P2M A;  1WQV H;  3GDS A;  3KQD A;  5KGO A;  2AYW A;  3RXH A;  4ZHM U;  1E38 B;  1ESA A;  4ZXY H;  5EW2 H;  2YMS D;  1EP5 A;  2BTC E;  1G30 B;  2JIZ D;  2ZU2 A;  1QBN A;  1Z1I A;  5JBT A;  4EST E;  2G00 A;  1YC0 A;  1YPH E;  2OQ5 A;  1UK3 A;  1O0D H;  1C4U 2;  1GJD B;  1AUT C;  2XBW A;  1GBC A;  1D6R A;  4JZ1 A;  1GBJ A;  1AB9 C;  2A0Q B;  2XXL A;  1ANB A;  5DSF A;  5C17 A;  3UAI C;  5C1X A;  1UTO A;  3GCT F;  5L2Y H;  2WUC A;  1BHX B;  3RXA A;  2B5T B;  1O2J A;  1BRA A;  3VXF H;  2FP7 B;  1EOL A;  2VIN A;  1DXW A;  1CHG A;  4FUC A;  5H4I B;  3M3V A;  1SR5 C;  5BRR E;  1UHB A;  2YNB A;  2GD4 B;  2BLO A;  3GCT G;  1E0F D;  4HTC H;  4BNR A;  1MTS A;  1AU8 A;  2QAA A;  2ZA5 A;  3ZZB A;  3A7Y A;  1DLK B;  3P70 B;  2ZGB H;  4TT3 D;  4ABH A;  7KME H;  2H5D A;  2Z9I A;  2V7Q D;  1ZPB A;  1O5C B;  1O2V A;  3E91 A;  8LPR A;  1XVM A;  3HGP A;  1LKA A;  3Q00 A;  5CHA C;  1W0Z U;  5EQS A;  2XC5 A;  2UWO A;  3KYG A;  4K5Z A;  3RM2 H;  3RC5 A;  3S9A A;  1A0H B;  1EX3 A;  2XBV A;  2BZA A;  2OC8 A;  2QYI A;  2R0K A;  5TJX A;  5HM2 A;  1JMO H;  1AWH B;  3A82 A;  4JK6 A;  1HB0 B;  2ZPS A;  3BF6 H;  3BTE E;  1HAI H;  1BMM H;  1GGD C;  1L1G A;  3BG4 B;  4FUG A;  2TRM A;  4ZHL U;  2YOL A;  3ZVD A;  3MH4 A;  4KGA A;  1F5L A;  3BG8 A;  4CH2 B;  1Z8J B;  4B2B A;  1FV9 A;  4KP0 A;  5C2Z A;  1D3Q B;  4B6F A;  2BDB A;  2LPR A;  3ZIA D;  4I8G A;  1LHE H;  4X8T H;  3QTV H;  2VIO A;  1ELA A;  4IW4 E;  4ABE A;  2GT8 A;  3UPE A;  4ACB A;  4B74 A;  4FUF A;  4K60 A;  1SQT A;  2FTL E;  1O30 A;  4I32 A;  1J16 A;  5F03 A;  1ZHP A;  2PTC E;  4OS4 A;  1TPO A;  1COW D;  4FU8 A;  3TIT A;  1P9U A;  1CGJ E;  1C5R A;  4UE7 H;  2XWA A;  3F2G A;  1NO9 H;  4BAO B;  1ZPC A;  2A4R A;  4XFQ A;  2FM2 A;  2Z94 A;  3UWJ H;  1FY5 A;  1W10 U;  4IMZ A;  1D9I A;  3QGJ A;  4O97 A;  2XWB I;  3A7Z A;  1GJ6 A;  1YLN A;  3FAN A;  1AO5 A;  4B76 A;  4D9R A;  1FI8 A;  2R2W U;  1EPT B;  1ZLR A;  2OUA A;  3URD A;  3BEI B;  4YT7 H;  1O3K A;  2PSX A;  2VBC A;  2Y81 A;  5SGA E;  5EQQ A;  2HNT E;  1ELB A;  1QJ6 B;  3A8C A;  2J38 A;  1MD8 A;  2GCT B;  2XND D;  2R9P A;  3F6U H;  2BMG B;  4Y7B A;  4Q7Y A;  2ILN A;  1KDQ B;  1MTN B;  1W0Y H;  1C1S A;  4FUJ A;  4K1E A;  4RKO B;  1YP9 A;  4Z1M D;  2A5A A;  1O3I A;  3K6Z A;  2ZGC A;  3E90 B;  2OLG A;  3MO6 A;  4JYV H;  4GHQ A;  4AYV B;  1SGC A;  1C2H A;  3AW1 A;  1GMC F;  1DY9 A;  1EOJ A;  2FX6 A;  2GCH F;  1GJ7 B;  3A8A A;  3BSQ A;  1RJX B;  2UUF B;  1CT4 E;  1CO7 E;  1GMH G;  3M36 A;  2C8Y B;  1BML A;  4O3T A;  1C1M A;  1GJB B;  3VB4 A;  2OD3 B;  3F3B A;  1DX5 M;  1TX6 A;  3FZD A;  2Y82 A;  1QIX B;  2A2Q H;  1GMC G;  1GMD F;  1Z6E A;  2GCH G;  2GZ7 A;  2D2D A;  1F0S A;  1FQ3 A;  1N6X A;  4XDE A;  1EJM A;  3RXE A;  4GVU A;  4Y76 A;  1LHF H;  3AAS A;  3T2N A;  2ASU B;  1W3C A;  3SQE E;  5A0A E;  1AE5 A;  1K9O E;  1GMD G;  1NU7 B;  1PQA A;  2BD7 A;  2VJ1 A;  4K8Y A;  5EXM A;  3G01 A;  2GX4 A;  2WHX A;  4OS7 A;  1ZPZ A;  5EU8 A;  2BOK A;  1DUA A;  3KQB A;  3L6P A;  5A0B A;  1GDQ A;  4A7I B;  1WOF A;  3ODF A;  1HAH H;  1GHB F;  3KL6 A;  2RCE A;  5A8Z A;  4INH A;  4I8J A;  1C2F A;  1SSX A;  3FKS D;  1GI2 A;  1TAW A;  2BDG A;  2AGE X;  3SJ9 A;  1N8O C;  4FUB A;  5T3H A;  1GHB G;  4D7F A;  3S7K B;  1GI9 B;  1H9I E;  3D65 E;  5I25 A;  1EAT A;  2FPZ A;  4K8B A;  2OK5 A;  1Q3X A;  1A5G H;  1O34 A;  1FX0 B;  5LH8 A;  3WY8 A;  2BDC A;  3LGU A;  3QZQ A;  5EOD A;  4YLQ H;  1KLJ H;  9LPR A;  4JYT A;  2C90 B;  4A1V A;  4DII H;  2HLD D;  2FS8 A;  2JET C;  1VJ9 U;  2V3M A;  3NPS A;  2YNA A;  5L2Z H;  1S0Q A;  5J4Q A;  1THR H; 
#chains in the Genus database with same CATH homology
 4NWK A;  2K1Q A;  3SZE A;  3P8O A;  3M5N A;  4U01 A;  3SUE A;  3DSP A;  4B73 A;  3O8B A;  4I33 A;  4TT3 D;  1W0J D;  5EPY A;  2IJO B;  3OEE D;  3SU3 A;  3O8R A;  2V7Q D;  2WPD D;  3RC4 A;  4Z1M D;  4M9F A;  1NS3 A;  1DXP A;  3UB0 A;  3E90 B;  3SU0 A;  2GGV B;  5T1V A;  2P59 A;  2O8M A;  4WH8 A;  2K0Q A;  2OIN A;  3OAA D;  4JMY A;  2WSS D;  5EQS A;  3N7E A;  2WV9 A;  1DY9 A;  2F43 B;  4R8T B;  4TSF D;  5GND A;  3SV7 A;  3RC5 A;  2OBO A;  4WF8 A;  4B6E A;  4B71 A;  1BT7 A;  1JXP A;  2XNI A;  3OTP A;  3SUF A;  2OC8 A;  2QE7 D;  3F0P A;  5EQR A;  3F3B A;  3N7D A;  3M5L A;  4OM9 A;  4F55 A;  2QV1 A;  4FET A;  3F2F A;  3GS9 A;  2QF4 A;  2XOK D;  3FN8 A;  3FO8 D;  3LON A;  4A1T A;  3DSO A;  2K8I A;  3SV9 A;  5GPI B;  3NRL A;  2GVF A;  2OC0 A;  3EYD A;  2OBQ A;  2YOL A;  5HKK D;  1W3C A;  2QF5 A;  4ZCN A;  1S6L A;  5CDF E;  3SUD A;  2F9U A;  4A1X A;  2J5U A;  2JJ1 D;  1E79 D;  3F2H A;  3SU5 A;  4B6F A;  3KN2 A;  1A1R A;  5IDK A;  2YMS C;  3KEE A;  3M5M A;  5B6L A;  3ZIA D;  1RGQ A;  3AK5 A;  2WHX A;  3PV2 A;  3OEH D;  4WH6 A;  5C0U A;  3SUG A;  3SU1 A;  2KCY A;  3PRB A;  2KFW A;  3P8N A;  3PV5 A;  5FL7 D;  2KCP A;  3SU6 A;  3O8C A;  2KZ4 A;  3L6P A;  5ETX A;  2A4G A;  3SV6 A;  1DY8 A;  5ESB A;  3U1I B;  2XCN A;  2JDI D;  2A4Q A;  4B74 A;  3SU4 A;  3WWB A;  2W6J D;  1SKY E;  2LEL A;  4B75 A;  4NWL A;  3O8D A;  5FPT A;  3VG8 A;  3FKS D;  2XCF A;  1E1Q D;  3SU2 A;  3KNX A;  2OC7 A;  2KCO A;  2W6I D;  5FPS A;  1NBM E;  2YMS D;  4I32 A;  2JJ2 D;  2CK3 D;  2L6O A;  5C0T A;  5DN6 D;  2JIZ D;  2M2A A;  1COW D;  3DCL A;  3OE7 D;  4A92 A;  4DT4 A;  5F53 A;  3N99 A;  2F9V A;  1OHH D;  5FPY A;  4YXW D;  1H8H D;  2KR7 A;  4RI0 A;  5GJ4 B;  1RTL A;  3SV8 A;  2KCA A;  1MAB B;  1N1L A;  3F2G A;  4Q4L A;  3WW7 A;  2A4R A;  3RC6 A;  1CU1 A;  3OFN D;  2FM2 A;  4K8B A;  3W1E A;  2WZQ A;  2OK5 A;  5EPN A;  1W0K D;  5DSF A;  1FX0 B;  2OC1 A;  5C17 A;  3LOX A;  3SYJ A;  1H8E D;  1BMF D;  3PRD A;  4I31 A;  4B76 A;  1WXR A;  3OYP A;  3LKW A;  4TYD A;  4XD7 D;  1NBM D;  3FOA A;  1KMH B;  3F0O A;  2FP7 B;  2IJD 1;  3H09 A;  3U1J B;  1EFR D;  3WWF A;  4A1V A;  4ASU D;  2HLD D;  2VBC A;  1DXW A;  2AHM E;  5EQQ A;  5H4I B;  2KM0 A;  5CHB A;  4KTC A;  2YMS B;  1E1R D;  5IK2 D;  2F4L A;  4Q63 A;  2FOM B;  3KF2 A;  3M5O A;  2XND D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...