3DSOA

Crystal structure of cu(i) bound copper resistance protein copk
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
VDMSNVVKTYDLQDGSKVHVFKDGKMGMENKFGKSMNMPEGKVMETRDGTKIIMKGNEIFRLDEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unprecedented binding cooperativity between Cu(I) and Cu(II) in the copper resistance protein CopK from Cupriavidus metallidurans CH34: implications from structural studies by NMR spectroscopy and X-ray crystallography
pubmed doi rcsb
source organism Ralstonia metallidurans
molecule tags Metal binding protein
molecule keywords Putative uncharacterized protein copK
total genus 13
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11525 CopK Copper resistance protein K
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.300 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3dsoA00
2KM0A 3N7EA 2K0QA 3DSOA 3N7DA 3DSPA 2LELA
chains in the Genus database with same CATH superfamily
1LDTT 1GHZA 4Q80A 2A4RA 2J34A 3NRLA 1ETSH 3PLPA 1LVYA 1NS3A 1SOZA 3BG4C 2GV7A 1NTPA 1ZOMA 2BD4A 1HJAC 2XOKD 3EA7A 2RFKC 5EXLA 1TBQH 2ZQ2A 4A5TS 5F03A 1XM1A 3VPKA 1EZQA 3MTYA 2XBXA 1H8IH 1L1JA 2GX4A 1O2IA 2ZPQA 1H8HD 1WTGH 3EDXB 4OS5A 4OS4A 1XUIA 5FPSA 1OWHA 4JMYA 3VXFH 5FAHA 3S9CA 2BD2A 4K3JA 4B1TA 1FIZA 2AEIH 1TLDA 2BX3A 3FZDA 3FO8D 3TH3H 1D3QB 2ZZUH 1MKXK 4O3TA 1EUFA 2B7DH 4AYYB 3OEHD 1OOKB 1UCYE 3WW7A 1A5IA 1NZQH 5L2ZH 2CF9H 1A3BH 3FP6E 4K8BA 2SGPE 3ZZAA 2KCYA 1SHHB 3VGCB 1O5CB 1DSUA 1S6HA 2ZTXA 3PWCA 5ABWA 5A0AE 1SGNE 4JCNA 2BMGB 3RU4E 2BQWB 2VGCC 3SV9A 3TIUA 2QGRA 1A5HA 2GCTC 2XYAA 3UFAA 1ZZZA 2BZAA 5JBTA 1OHHD 4JYUH 5LGOA 4XBBA 1TX6A 2PHBA 3O8RA 4FXGH 1YPHC 1O5BB 2UWOA 1SFQB 1GI4A 1PPBH 3RC4A 1GJ4H 1TYNA 2BDIA 4B71A 3VB4A 3RXDA 2NU3E 2BD8A 4A6LA 1SFIA 1XUHA 1O2PA 4I8JA 2OC1A 4INLA 1WDIA 3U28C 3MU4A 1A0JA 1K1MA 2BM2A 2EI7A 1FI8A 3PWBA 1H9HE 1O38A 1O2XA 5DN6D 1PQ8A 2UUYA 1C5TA 3P8FA 2Y5FA 4ABEA 1N6YA 1MBQA 1OP8A 2XCFA 3ZVAA 1CGHA 1S85A 2GT8A 4NWLA 2VH6A 3UPEA 3FOAA 4X2VA 5C1YA 3M5OA 3SQEE 4B6FA 1JIMA 2ANWA 3UQOA 4RN6A 2Z9IA 2AERH 1P2OA 1DFPA 1SKYE 3QUMP 4JK6A 3MU8A 2FLBH 3GOVB 1P2MA 3KQCA 1QJ6B 1FY4A 1O36A 1OP2A 1P57B 2I6SA 4ABAA 3B23B 1V2TT 2QCYA 1Y5AT 1SQRA 1C5VA 2P3FH 4GHTA 3NK8A 1AE8H 4RKJB 1CA0C 3T25A 3ZZ5A 3NUMA 1E1RD 4ZXXH 2G51A 1J8AA 1NC6A 1NO9H 1FUJA 2HLCA 1W7XH 1UHBB 3TK5A 3AW1A 1X7AC 3S9AA 1J9CH 1BMLA 1QFKH 2R3YA 3BEUA 7LPRA 4NIXA 1LHFH 1TE0A 4OM9A 1GMCG 3BSQA 1FY1A 4B6EA 3F68H 2Y5HA 1CT0E 5DP5A 1FN6A 5KGOA 1AFEH 5E2PA 5FL7D 1DX5M 4I8HA 2IJOB 5JDUB 1C2LA 4KELA 9LPRA 2O8UA 3RXBA 1A0LA 1Q3XA 4NFEA 1D3PB 2EA3A 2NU2E 1GJAB 3RXSA 1W8BH 3LPRA 1GMCF 4NGAH 3FKSD 1NRPH 4CRDA 1S6FA 1QCPA 3MNCA 3GISB 4GCHF 4CR9A 1K2I1 4TT3D 5E2OA 4IS5A 2C90B 4FVDA 2ZCLP 3VFEA 1NBMD 3UNQA 4BAHB 1LVMA 2ZGXH 1TNIA 1ZSJA 1C5YB 1ANDA 3GY8A 1C2GA 2FX6A 2HALA 2KX4A 3KQEA 3KYFA 3RXCA 4K69A 1NRRH 1UK2A 2PTNA 2FOEA 4U30A 3SUEA 1D6WA 2TGDA 5AFYH 1K1JA 2VIWA 2W6ID 2ZKSA 2ANMH 4H6TA 4OGYA 2EC9H 5EODA 6ESTA 3T26A 1GL1A 1MMJN 1BCUH 2CJIA 1KTTB 5DP8A 1KXAA 2Q6FA 1GBLA 2GT7A 1BBRH 2QF0A 2BX4A 2FOCA 4MLFB 3A7WA 5ETXA 4D8NA 4K60A 1TNLA 1ZPBA 2VWLA 1C9PA 3PROA 1LQEA 2BY6X 2FESH 2XNDD 4X6PA 4XE4A 2JETB 4YLUA 1LVOA 3TNSA 1NFUA 1P9SA 1QB6A 3ENSB 1WQSA 4ISIH 3RXQA 3SV2H 4X2WA 1AB9B 1NBME 2CHAB 2F4LA 5TJXA 3ATWA 5B6LA 1TX7A 3K9XB 3N7OA 1NRSH 1DE7H 3W1EA 3BN9A 1GCDA 4X6MA 2KCAA 2ZA5A 5LPRA 2NWNA 3ZZ4A 1O3CA 2F9BH 4FUDA 1KMHB 1DXWA 4ZUHA 1ZTKA 2TPIZ 1C1UH 1TBZH 1QL7A 1GI3A 3A7VA 5LPEA 1K0HA 1NU9A 1KTSB 2CV3A 2TRMA 1T8OA 1GHBG 1UVPA 4BAOB 2ZDKA 3KF2A 4AYVB 1A3EH 4B74A 3SNCA 1GBHA 3UAIC 8LPRA 2ZQ1A 4INKA 5FPYA 1TA6A 1H9IE 1YCPM 3RMLH 1PPCE 1O2GH 3UQVA 3RXGA 4OGXA 3RC6A 1FIWA 2P3TB 3FFGA 5T3HA 4FVBA 3OY5U 4HI3A 4KP0A 3SJIA 1JWTA 2PUQH 3RLYH 5C94A 5DSFA 5TCCA 1F0RA 4MPUA 5KEDA 2HWLB 3T2NA 4JZFH 1RJXB 1W10U 2JKHA 1E38B 1AE5A 3AW0A 1UTOA 2FOHA 1WQVH 3PMJA 4SGBE 2ZIQH 1QY6A 1O3AA 1C2KA 2ZDAH 2ZTZA 3KQDA 1OWKA 3QN7A 4X8UH 1Z71A 2JDID 3SNBA 2R3UA 1C5ZB 3EGKH 1BRAA 3E8LA 3QK1A 1HB0B 4O97A 4NSVA 3RXJA 2BY5X 4BTTB 4HTCH 1YYY1 4NZQA 3F2HA 4FUCA 5FX5A 1BUIA 3LJJA 3PV5A 1C2FA 1QIXB 1T8NA 1KYNA 3GCOA 4UFEH 1W3CA 1MUEB 1HAOH 1TNHA 2RCEA 1ZSKA 2WUCA 1N8OB 1TMBH 2GMTC 3RXIA 2ZPRA 4D7FA 1Y5BT 5DO4H 3LH3A 4TWWA 3GY4A 1EP5A 3MNBA 1Q2WA 2FTMA 1TQ0B 1GBKA 2C4FH 1DVAH 4J1YA 1K9OE 2ZGHA 3UUZA 4BXSA 2FIRH 3A81A 3PMAB 1JRTA 2J92A 1IQLA 3NWUA 4AFQA 3PV4A 2F91A 1KLJH 4THNH 1LPKB 1P10A 4DW2U 1W2KH 5DP7A 1T8LA 2BD3A 2VU8E 1O35A 1GHAF 3BIVH 1HRTH 3EE0B 2VIVA 3O8DA 3BTME 1AFQB 4IN1A 1QGFA 2PP6A 3SOSA 1SLVB 1J15A 1UTLM 5FBIA 3A80A 1AKSA 3BV9B 5IK2D 2P16A 4GVUA 3LC5A 5JBBS 4LZ4B 1O31A 1HAGE 5FCKA 3ZZCA 4K5ZA 1B7XB 4Y76A 1NT1A 4BANB 3U8OH 3I29A 1HYLA 3SI3H 4K2YA 1TNKA 3BTGE 1KDQA 4JZIA 2FYRA 3DFLA 2PUXB 3W95A 1TALA 4ZKSU 3KYGA 3F9EA 2ZFSA 1W0JD 4D76A 5CE1A 4AGKA 1UTKA 1UCYH 1C4U2 1ZGIA 4X8VH 4I8KA 1AB9C 2R9PA 3I78A 1HAVA 2RDLA 1OYTH 2FI5E 2P93A 2A2QH 3TU7H 1MQ5A 1VGCC 4XBDA 4E7RG 1RXPA 4PROA 1VR1H 4U32A 4P02A 3CS7A 4AOQA 5FBEA 1WU1A 2AMQA 1IQIA 1GMHF 3T5FH 2ZU2A 4BTIB 5T6GA 1PJPA 4K8YA 1C1WH 1B0EA 3P6ZB 3GDSA 4YOJA 1O33A 1O30A 2D8WA 3TH2H 2ZI2H 3R0FA 3WY8A 1YPKH 3QDZB 3SZEA 2D26C 2ZFTA 2P94A 1CA8B 1W7GH 4BAKB 1DM4B 3F2GA 3Q77A 4WMEA 2C93B 3RXKA 7ESTE 1F5RA 1SGYE 4Q7YA 1TMTH 2ZFPH 1VJ9U 1EJAA 3PO1B 3TGJE 2JH5D 3M3TA 3F3BA 4NIYA 1SG8B 2HPQH 1ACBE 2BB4A 2ZO3H 2KR7A 2QIQA 3OYPA 1TGBA 2H1UA 2BVRH 3SJ9A 1YP9A 1GG6C 1ESTA 1O3EA 3SBKA 4K1SA 1QRXA 2CHAC 1V2KT 1UVTH 2QYIA 2VVCA 1C1RA 1MTWA 2GVFA 1BHXF 2BLOA 3UNSA 1C2MA 2GMTB 1GI5A 1F0UA 3A7ZA 1ZHRA 1QBVH 1SHYA 1FY5A 4IC5A 4MQAA 4DVAU 1F2SE 4A7IB 3U1JB 1EXFA 5DP9A 3EYDA 3M5MA 2Y6TA 4UD9H 3RXRA 3SNEA 1BHXB 1SGEE 2ZC9H 1WBGB 3PRBA 4DGJA 1SSXA 3SUFA 4WMDA 3SNDA 1K1OA 2JJ2D 2TGTA 1GVKB 1P06A 1GBAA 2ESTE 6LPRA 2IOTA 1GBIA 4F48B 4ZHAA 4K1EA 2PKAB 4ABJA 4ABIA 5GXPA 3DCLA 1TOMH 3MH4A 4Y8YA 1BRUP 2BY7X 3M7TA 2STBE 3BTFE 4X1SU 1C5LH 2GP9B 1ELDE 1VCQA 1YC0A 3AASA 2Y7XA 4AX9H 1G30B 2CF8H 2FPZA 4JZEH 1GI9B 4FUBA 1C1NA 4I8GA 1IHSH 3ODDA 2FOAA 2KCPA 3OFND 1W14U 1O3MA 2FMJA 4MNXA 1K21H 1BMFD 4WH6A 4ABHA 6GCHG 2VIPA 3AAUA 2ZU3A 1GWAA 2J98A 4BNRA 2P59A 2V3OH 3FP7E 3BIUH 3Q3KA 2BTCE 1HFDA 3K6ZA 3ZYDA 2WHXA 1BOQA 4J2YB 1ZMNA 3SGAE 3KQBA 2BOHB 2A5KA 1QB1A 2KAIB 4I31A 4FUFA 1DT2A 2B8OH 3TH4H 1A7SA 5HKKD 2Z6BD 4FUHA 1YLNA 1C1TA 1QL9A 1O3JA 1C9TA 4BTUB 3PB1E 1P3CA 2VBCA 5HM2A 3RXFA 4B75A 2XBVA 1F7ZA 2WV4A 1O2ZA 1SLWB 2BOKA 4Y79A 1E34B 1SQTA 5EPYA 1QQUA 3PYHA 2NU0E 1DWCH 5FXLA 3VB7A 2UWLA 3K6YA 1CE5A 1DPOA 3G01A 1FPHH 1GBBA 3W94A 5C0UA 1KXFA 4KTSA 2BLVA 2SGDE 4X2YA 4AG1A 1Y3XA 2FP7B 2VWNA 1EAUA 1W0KD 5ESBA 1C5RA 3PV2A 3TVJB 1GJCB 2DUCA 3UTUH 2ZFQH 1CQQA 1SQOA 3GCHC 5AFZH 5T6FA 1O2OA 4GHQA 1JXPA 2LP6A 3U98H 3GDUA 3RMMH 3IITA 1NRNH 2R2WU 1AU8A 1NY22 1HPGA 1NRQH 5A09A 4LZ1H 1Z6JH 1ESAA 3UOPA 1O2NA 1HJ8A 1QTFA 1TIOA 4MNWA 1ABJH 1EPTB 2OBOA 3S9BA 4NWKA 1TABE 1P05A 3H09A 5H4IB 1U6QA 1VGCB 1O3OA 3A88A 1HLTH 3A8DA 1L2EA 2TIOA 1V2NT 5E0GA 1KLTA 1O5EH 3HK3B 2PSXA 1ANCA 3OE7D 2G5VA 1H9LB 2GZ9A 5C1XA 1W0YH 1TFXA 4ASUD 1BTHH 1ZPCA 2A4GA 5HYOA 1XXDA 3C27B 1W13U 1HJAB 3U8TH 2SGAA 3E90B 1BT7A 1BA8B 2UWPA 1CT2E 3TJOA 1AQ7A 4CRGA 1S82A 3E16B 3LGUA 1P12E 4F49A 3NCLA 1EZUC 1QURH 1LHDH 3B9FH 1IQKA 1ELAA 6GCHF 1GHYH 5DP4A 5GNDA 3BTHE 4X6NA 1EQ9A 1BMAA 3ZVGA 1V2ST 1QQ4A 4IBLH 1XXFA 4BXWA 2ZCKP 2ZHFH 1TRNA 1RFNA 1W12U 2VH0A 4WXVA 4DIIH 2Q6DA 3RXTA 2ODPA 1Z8RA 4AN7A 4ZXYH 3RLWH 3F6UH 3V0XA 3ESTA 3UREA 2ZU4A 3PO1C 5K7RA 3RXEA 1Y3YA 1HJ9A 1C1SA 3T62A 1MZDA 4NIVA 4B73A 1AZZA 3A8AA 3RU4T 5GIBA 1O2QA 3E0NB 3MNSA 3RMNH 3KCGH 3A82A 2CK3D 2VJ1A 4HGCA 3MU1A 1DUAA 1WTHD 3I77A 3BTTE 1MBMA 4WJG2 1KIGH 3D62A 3KIDU 4MNVA 4RT0A 3RXVA 6CHAB 1C4V2 2G00A 2IPHA 1QJ1B 5DPAA 5A0CA 4KKDA 1PPFE 4CRFA 1OP0A 2ZPSA 5T1VA 4INHA 2A2XH 2XC4A 5GCHG 1O3IA 1ZTJA 2BD7A 3SJ8A 5EU8A 3SGBE 5JPMH 2PTCE 1BMMH 4IMZA 5I46H 1MAXA 3SO3A 1Z8IB 2OD3B 1B0FA 4BAQB 3GY6A 1CHGA 3KHVA 3DSOA 1RIWB 2THFB 1S0RA 2WPIS 4XSKU 1BTYA 8ESTE 2V0BA 2LELA 3EA9A 2F9VA 3PTNA 5LPFA 3TK6A 1ETRH 1JBUH 3ZV8A 3EE7A 1FX0B 1KXEA 1V2PT 3ATIA 2GCHF 5CHAC 2Y80A 2J2UA 3BG4B 3NZIA 4YM9A 4LK4A 1EB1H 5C17A 5C1UA 3SU1A 4CH2B 1V6DA 2OUAA 1ANEA 1QNJA 1T7CA 1C4Y2 3DFJA 2XXLA 4TY7A 2J98B 1Z1JA 2P95A 4ABBA 3LOXA 2A4OA 2A7JA 4WWYA 5A8XA 1O2MA 2TGAA 5EIYA 4MPVA 1ZHMA 2V6NA 1HAIH 4X0WU 2QF5A 1ZRKA 1O2TA 3OX7U 1A61H 5C0TA 2SGQE 1CT4E 1VITF 1A2CH 1GCTB 2K0QA 5FPTA 4AGJA 1INCA 3Q3XA 4U2WA 1UTNA 2ZFFH 3SN8A 2BVXH 3ZZ8A 1P09A 1DITH 4X1QU 2FZZA 1IQEA 3ELAH 4FUIA 3HKIB 2Z9JA 3A86A 3U9AH 2STAE 1QJ7B 1ZGVA 4XOJA 1FY3A 3ZZ9A 1IQGA 1THSH 2ZDNA 4IN2A 3SQHE 4DT7B 2FDAA 1E37B 3NKKA 1DY9A 4NCYA 3KEEA 1FONA 3FP8E 2GZ8A 3GYLB 2G4UA 4NFFA 1G32B 2OC7A 2QV1A 1WSSH 4IC6A 4KTCA 1GI1A 1ZPZA 2XW9A 1FJSA 1MABB 5SGAE 1TGTA 1YCPK 2GZ7A 2J95A 3GCNA 3K65B 1BRBE 1P3EA 2FOFA 1TPPA 1UJ1A 1DWDH 3ZV9A 4X1NU 1VITH 3S7HB 4E7NA 1BJVA 1CHOG 4FUJA 1UVUH 3KGPA 4DG4A 1GJ5H 3MYWA 1RD3B 1E1QD 1EOLA 2CMYA 2KCOA 4TY6A 2AIQA 1GGDB 1WUNH 1ELBA 3GDVA 1YM0A 3BTEE 1QA7A 1IHTH 1EAWA 4DURA 3ZYEA 1O2WA 2GKVE 3UR6A 1LMWB 1VJAU 5EQRA 3VG8A 2RDEA 1DXPA 1Z6EA 2ALPA 1V2LT 1QHRB 3RDZA 1LCYA 1NPMA 3SGQE 1O3LA 1MCVA 1HXEH 3CS0A 1W0ZU 2FXRA 1C5UA 1SPJA 1NFYA 1AI8H 1NROH 3RC5A 2QXJA 3OTJE 1FAKH 1YPLH 3FANA 1YPJH 4ZROA 5FX6A 2BY8X 4FUGA 3MNXA 1O39A 2GV6A 1GI2A 4A1TA 3T29A 2Q1JA 1NESE 4D7GA 2G5NA 1G2MA 1P2QA 2OQUA 3ZVEA 2ZWLH 3GS9A 5HIYA 3QO6A 1N1LA 4DCDA 1BMNH 2WPDD 1FMGA 1KDQB 2GTBA 4ZHMU 1FDPA 1O2RA 3M7UA 4XBCA 1OWIA 3F1SB 2Z3CA 3BEIB 1FLEE 3SU6A 1GI7B 1HUTH 1AD8H 1GCTC 3S7KB 3HKJB 5EW1H 2GCTB 1P2IA 4TYDA 2ZNKH 1KXBA 4YZUA 1GBTA 1PQ5A 4LXBH 2W3KA 5EPNA 5EG4A 3SUGA 1O5AB 3HGPA 1P8VC 2VIOA 3EAJA 3URCA 4YT6H 1WAYB 2BDYA 1Y3VA 2XNIA 1HAZB 1LO6A 3LT3A 4ASHA 1BB0B 1FQ3A 2C8YB 1QZ8A 3A84A 3D65E 3GY7A 1V2JT 4CRCA 1UK3A 1TBRH 2KZ4A 1AWFH 4X8SH 1UHBA 1TNGA 2QXGA 1QBNA 3SZNA 6CHAC 4ISLA 3A83A 8GCHF 1D3TB 1DSTA 2HNTC 5ESTE 1GG6B 2WUBA 1DY8A 1K22H 5FHTA 1AZ8A 2BYAX 1SLUB 3TJNA 2Q6GA 2VVVA 1DWEH 2A5IA 2CN0H 2AGEX 2J38A 1OWJA 1SI5H 2EI6A 3KQ5A 2G52A 1O5DH 2XWBI 1NU7B 1ETTH 3M5LA 1TGSZ 2F3CE 3UR9A 1Y3UA 1IQNA 3FZZA 1S84A 1QRWA 1ZSLA 2P8OB 2FI4E 2PR3A 2ASUB 1HIAB 1GHVH 3GY5A 1O2SA 7GCHG 4X1PU 2J5UA 1OPHB 4CHAC 1WYKA 1L1GA 2Y7ZA 5HGGA 2BVSH 1DLKB 2R0KA 2G8TA 1T32A 2QF3A 1SL3A 1V2VT 5EXNA 2OBQA 2BZ6H 1AFQC 1C5XB 5C5NA 4ZMAH 2L6OA 5E0JA 2Z3DA 4DOQA 1EP6A 1GL0E 1HV7A 4FOUC 1L4DA 1PYTC 2FWWA 1CO7E 5A8YA 4RI0A 2PKSC 3SU2A 4RSPA 1UVSH 3DT0H 2H9HA 1GHAG 2BDHA 1YPMH 2F9NA 2ZGBH 2O8WA 3FN8A 3M3SA 3BG8A 1ORFA 3HPTB 4UONA 1YGCH 1H8ED 1O2LA 4TPIZ 1O34A 2HVYB 4ABDA 1F0TA 1M9UA 1SLXB 1AVWA 2FYQA 4ZKNU 1XMNB 1ARCA 1C1PA 3BTDE 1XUFA 3LGTA 3RXUA 1V2OT 1SMFE 2ZCHP 2BY9X 1EZSC 3MQKC 1H1BA 2WSSD 1IOEA 4GCHG 2HOBA 2K8IA 3TPIZ 1XUKA 2W3IA 3E91A 4K1TA 4YOGA 3WWFA 2CXVA 3RXLA 3RP2A 2AMDA 2C8ZB 1UCYK 5K0HA 1EPTC 1UTMA 3F9HA 3RXOA 1AVXA 1ZYOA 3GYMA 2OINA 3TGKE 5BPEA 4NA7A 3LGVA 1TONA 4Y7AA 3Q3YA 1MD7A 2J97A 2FX4A 2FI3E 3HK6B 1MKWH 1SGDE 2PGQB 4Y8ZA 1O2JA 1JRSA 2JH6D 3V12A 2A4QA 1THRH 1FNIA 1FPCH 2JH0D 1SQAA 2W5EA 3TJVA 2J4IA 3KL6A 4FUEA 1C5QA 4Y6DA 1C5NH 3TK9A 1C5PA 1RRKA 5EGMA 5C3NA 2SFAA 2H6MA 1HAVB 1PFXC 1TPAE 1BZXE 2VVUA 4WY3A 2VNTA 4IMQA 4UFDH 5F8TA 4O3UA 2TGPZ 4Y0YE 2A1DB 3ZVBA 4MVNA 4DIHH 4FU9A 1Y59T 2OCVB 4Q7ZA 1THPB 3SV8A 2HLDD 1GDQA 1V2RT 1HBTH 4NG9H 3A85A 3M3VA 4GUXA 5A2MH 3QX5H 3O8BA 2F9UA 2Y81A 3JZ2B 2QF4A 3SORA 8GCHG 2OC0A 2PKSB 3TJUA 1PYTD 2ZDLA 5AF9H 1GHBF 4JZDH 3U8RH 2JIZD 1EX3A 4I86A 2FLRH 4B2CA 2J94A 2B9LA 1O3DA 4BOHA 4D9RA 1J16A 2GD4B 1IQHA 3ZZ7A 1C1OA 1N8OC 1SGQE 1TX8A 2WV5A 1IQMA 1HNEE 2F43B 5HIZA 4DJZB 1GJBB 1QA0A 5AVDA 2ODQA 1TGCA 1L0ZA 2XWAA 1C5OH 3IWMA 3MU0A 1C5MD 2PLXA 2AS9A 2SNVA 1C2JA 4GSOA 1JMOH 1NM6A 2IPQX 5DGJA 1V2QT 3C1KA 3H7TA 2QN5T 1TGNA 2OP9A 3AAVA 1EJMA 3SNAA 3SJOA 3P8NA 1ZRBA 1LKAA 1P03A 1ELCA 1O2YA 4CREA 3RM0H 4GAWA 4I8LA 5E0HA 4YT7H 2ZHQH 2M5TA 3ZVCA 3LU9B 3OTPA 3EA8A 4RKOB 3ZZDA 2FTLE 4Q2KA 3MFJA 3F2FA 4Y7BA 4JK5A 2KM0A 2ANKH 3VB6A 1CGIE 4R0IA 1FAXA 4DT4A 1CVWH 1Z1IA 1BRCE 4AORA 1O2KA 1YBWA 2V3HH 4O9VA 5JB8S 1OS8A 1C5SA 4WVPE 3LDXH 1CGJE 1MCTA 1ZMJA 3GCTF 8KME2 1RTKA 2HNTF 3TITA 1OSSA 2FOBA 3ITIA 1UTPA 3MO6A 1GVLA 1BJUA 2WPKS 3RM2H 1JIRA 3KNXA 4GLYA 2Z9LA 4AFZA 1EOJA 2EQNA 2R0LA 1EPTA 1UO6A 1BTUA 4OS6A 5L30H 1WXRA 3BEFB 3K2UA 2WV9A 4ABGA 1UTQA 3DUXH 3LIWA 4ISNA 4AB9A 1GHXH 4XDEA 1DWBH 2V35A 4JZ1A 1K1NA 5IDKA 5JYIA 1D3DB 3GICB 3P95A 2ODYB 1DOJA 4JYVH 2ALVA 2TBSA 3MU5A 4ESTE 1TMUH 3M35A 1SGRE 4YOIA 3DHKH 3OAAD 1A4WH 1CBWC 1MTNB 4Z6AH 4ISOA 1A1RA 1Q31A 1RIWC 2H9TH 4O03A 1O3HA 3TNTA 3MOCA 3N7DA 2VWMA 1MKWK 5C2ZA 3Q76A 1CU1A 1ZHPA 1Y5UT 2H2ZA 1FN8A 1GJ7B 1L1NA 1EB2A 5G4BA 3OEED 4Q63A 1FXYA 2RA0A 3SHCH 3RXHA 3MHWU 2Y82A 1O5FH 2OTVA 3PLBA 3RXPA 3H5CB 1BTZA 1GJ8B 1K1PA 1H4WA 1O3GA 1SR5C 5F53A 1SVPA 2W7SA 4Y0ZE 2CGAA 2IJD1 1QB9A 1HAPH 1ZLRA 1D4PB 3E6PH 1OWEA 2AFQB 4TWYA 2FOGA 1PPGE 1CA0B 1XX9A 1GBDA 5EJ1A 4ACBA 5CDFE 4I32A 3U1IB 1C2HA 2JJ1D 2Z94A 2XBYA 3R3GB 3VB5A 4YXWD 1TAWA 3NXPA 3ZZ6A 1O5GH 1VITG 3B8JA 3MH5A 1VZQH 3UOUA 1E36B 2ZEBA 3OY6U 2HVXA 1E0FD 2XBWA 2WYJA 1BTWA 1BTPA 1OYQA 2BQ6B 4NSYA 1P02A 4AG2A 3SHAH 5BRRE 1P2JA 3QZQA 2AGIX 4XRNA 1ZTLA 1LPGB 5PTPA 3VEQB 1IAUA 3V3MA 2P3UB 2HGTH 1COWD 1QR3E 5EOKA 2GDDA 1BIOA 2WINI 3URDA 2O8MA 2ZP0H 1TNJA 4CBOA 2GCHG 4YO9A 2BDCA 3A7TA 1EJNA 2C8XB 4GPGA 2Z3EA 3SUDA 1YPHE 5EXMA 1O0DH 4XD7D 1YPEH 2WPLS 1E35B 1QRZA 1GI8B 1C1QA 1TB6H 2AGGX 4CBNA 2DE8A 2YNBA 2ZG0H 4YLQH 2ZGCA 3Q00A 1CHOF 5DK1A 3FAOA 2UUFB 1AHTH 4ZCNA 4ZHLU 4VGCC 5L6NH 1P9UA 3OU0A 1OX1A 1UVOA 2G81E 2Z9GA 3E0PB 1WV7H 5CHBA 1SOTA 1FY8E 4I7YH 1DLEA 4A1XA 4TPYA 4X6OA 1KLIH 2H9EH 2BXUH 1YCPH 1ARBA 2OK5A 3D49H 4MDSA 1RTFB 2FS8A 2VIQA 4Y11E 4OS1A 2AMPA 5J4SA 2A45B 4HFPB 1BTXA 2UUKB 1UTJA 1NN6A 3BTKE 2ZU5A 3V7TA 2GDEH 2DE9A 5F8XA 1LVBA 1ELVA 1T8MA 2O8TA 5J4QA 3E3TA 1HAXB 1ZJDA 1A0HB 1P11E 4JYTA 2OC8A 5TCAA 1NFXA 4MG3A 3D23A 3FVFB 3LKWA 1AKSB 1G37A 2PSYA 3U69H 1BBRK 4UFGH 2G4TA 1O3NA 2AIPA 1P0SH 3SV6A 2G55A 2Z7FE 1TWXB 7KMEH 2H5CA 1AMHA 4MPWA 3QGJA 5GJ4B 1F0SA 4IW4E 2SGFE 2F9PA 2O9QA 3PMHB 4M7GA 3P8GA 5I25A 1PQ7A 3BTWE 2XC5A 5L2YH 2LPRA 2RA3A 1V2UT 2PW8H 4WF8A 1A5GH 1G9IE 2WPHS 5EQSA 3P17H 4HZHA 4H6SB 3TGIE 1O3PB 5JBCS 3A7YA 3P8OA 3SYJA 4WMFA 1G36A 1GBEA 2ZDMA 1GHWH 1ZR0A 2YMSC 4YTAA 4E06H 1P2KA 1TA2A 4ISHH 1LHCH 3PM3A 1DUEA 5F6MA 3RXAA 3QLPH 4Z1MD 1RS0A 4Z0KA 3DA9B 1DICA 2GGVB 3N99A 1CBWB 1LKBA 2ZHEH 4FU7A 5GCHF 3VXEH 5EJZA 4CRBA 2YNAA 2M2AA 2OLGA 2A32A 3MI4A 1EATA 2A31A 3BTQE 1FV9A 1UK4A 2PKAA 3PTBA 2ZTYA 3UWJH 1GI0A 1V2MT 1EZXC 3LGWA 2K1QA 1SGFA 3MH7A 2BDGA 2D1JA 3ZZBA 1KXCA 1MTNC 1ABIH 4ABFA 1MTUA 3HATH 1AWHB 2W6JD 1ID5H 4R8TB 3E1XB 1V3XA 1BQYA 2EY4C 1TRMA 1OXGA 2YMSB 2F9OA 1SGFG 3LGIA 3UY9A 3P70B 4TSFD 3QWCH 2PFEA 5GWZA 1Y8TA 1G3EA 1VCWA 3N7EA 4NZLA 3DSGA 4CRAA 1Y3WA 1MU6B 1S5SA 1T4UH 1GJDB 1ZJKA 5DP3A 3DD2H 1O3BA 1MD8A 2KAIA 4X8TH 3LGYA 2ANYA 2BQ7B 2FEQH 3ZZ3A 2I6QA 1XVMA 4E05H 5F8ZA 1XKBC 1AN1E 4NA9H 1VCPA 3V13A 3F9FA 4NIWA 1T31A 1EAXA 3F0OA 3GY3A 4SGAE 4Y71A 1EAIA 3LC3A 4MNYA 1O2VA 3S0NA 1BITA 3M36A 3A8BA 1F5LA 2XTTB 3UB0A 1SC8U 3F0PA 4DY7B 4F55A 5A8ZA 1TOCB 4ZKRU 2XCNA 1L4ZA 1HIAA 3T27A 1RTLA 3GCTG 3M5NA 3MMGA 1GBFA 1KXDA 4KTUA 1IQFA 2PGBB 3KN2A 4AB8A 1A46H 2ZDVH 2A5AA 2ILNA 1HAYB 2ZHDA 1AIXH 3UWIA 1WCZA 4I33A 4WH8A 1EASA 4P00A 1OKXA 5AHGH 1C2EA 1K28D 1C5WB 2YMSD 3M7QA 1LTOA 1ELTA 1YWUA 5GDSH 3O8CA 3NPSA 1C2DA 1GGDC 5EJLA 1QL8A 2HNTE 3L3TA 1SGIB 3AK5A 3ODFA 3GCHB 3M61U 4LOYH 2BDAA 2ZFRH 4H42U 1ELGA 1P2NA 2AHME 4UEHH 2AH4X 3QTVH 4AZ2B 4ZKOU 1GMHG 1DS2E 2A7CA 1YLCA 3RXMA 3S69A 1PQAA 2V7QD 1F5KU 1S81A 1W11U 5HM9A 2YOLA 3CNRA 2BD9A 3STIA 4ACAA 1N6XA 4OS2A 1PPZA 3QTOH 1YF4A 4MPXA 4QT8C 3MH6A 1ANBA 2IN2A 5A0BA 4BAMB 1YLDA 2LNCA 1EFRD 1BDAA 3WWBA 2VWOA 1H8DH 1RGQA 2AYWA 3CP7A 2FODA 2C8WB 1XUGA 4D9QA 2Y5GA 1GBMA 1TQ7B 1MTSA 1SGCA 2C3SA 4HG6A 1YPGH 5JB9S 4Y10E 2HPPH 3A89A 1OWDA 1NFWA 2J9NA 4CHAB 4Y8XA 3STJA 4M9FA 3SJKA 3HGNA 5FCRA 2QY0B 4CH8B 1D6RA 1C1MA 1P01A 5IYTA 2FO9A 1B5GH 1GDNA 1G3BA 2UUJB 2H5DA 2XC0A 3OSYA 3RUOA 1SB1H 5DG6A 1Z7KA 1AUJA 4XFQA 5HXFA 4YESB 2R2MB 3LJOA 3CENA 4A92A 1TPSA 2BLQA 1LQDB 1UW7A 4KGAA 1VKYA 4B2BA 2QA9E 1FZZA 3LH1A 3RMOH 3SW2B 3QGNB 2VB0A 1E79D 3A8CA 4Q7XA 4UDWH 1AGJA 5C67A 4B76A 2QE7D 1AVGH 3QZRA 1GJ6A 4X1RU 5DP6A 1P04A 1AUTC 1S83A 1KY9A 5EQQA 1LHEH 3VGCC 1GBCA 3MO3A 2SGEE 1MU8B 2OQ5A 5KECA 1IQJA 3BF6H 5EW2H 3GY2A 5B6OA 1XKAC 1TPOA 1YY3A 3MWIU 1AY6H 1SGTA 2KFWA 1EKBB 1GBJA 3JZ1B 4VGCB 1O3KA 1S6LA 1ELFA 2QXIA 2PV9B 9ESTA 2Z9KA 3T28A 3SU5A 2WPJS 2P8OC 4ZH8A 2A7HA 2ZGJA 4B2AA 1MTVA 1G3DA 2VGCB 3SV7A 2B5TB 2A0QB 1Z8GA 2GJGA 4ZAEA 1XVOA 2ZECA 3ZVFA 5GPIB 1PPEE 1O2HA 5HMAA 5JBAS 3SU3A 1GDUA 4UFFH 1AO5A 1G3CA 5LH8A 3UIRA 3L33A 4AC9A 2QAAA 2BXTH 2ULLA 7GCHF 1C1VH 3SU4A 2BLWA 5CHAB 2BHGA 2RG3A 1CSOE 2ZHWH 4WXIA 1MQ6A 2QXHA 1ELEE 4FETA 1JOUB 2EEKA 1J14A 1GJ9B 2L74A 4Q4LA 5DJ7A 3P92A 4U01A 1GMDF 1ZMLA 1GVZA 1T4VH 3VB3A 1F92A 2VIDA 2O8LA 3ZVDA 4X2XA 4F4OC 1MAYA 2BDBA 2JETC 3LONA 3AVZA 1UMAH 1O3FA 1GI6A 2W26A 1ESBA 4MTBA 1XUJA 3PLKA 1HAHH 2FS9A 2ZU1A 1WOFA 4OS7A 3SU0A 2QC2A 2NU1E 2ZF0H 2WPMS 2SNWA 1K1LA 1K1IA 3ZIAD 1MZAA 1SGPE 4UE7H 3EQ0H 1O2UA 1TRYA 2D2DA 1C2IA 1DDJA 4NA8A 2BD5A 2HRVA 1PPHE 1O32A 5CMXH 1KSNA 1S0QA 1G2LA 3A7XA 3SI4H 1HXFH 1HDTH 2F83A 3ATLA 2PWXA 5C20A 3MO9A 3A87A 2VINA 3DSPA 5E8EH 3H7OA 3RU4D 2V3MA 2B0FA 4FU8A 1MH0A 3PRDA 4IGDA 1D9IA 4CR5A 2EI8A 3ATKA 2OXSA 1O37A 5T6DA 1SBWA 1MKXH 3F9GA 5DKMA 3TLOA 3UNRA 1J17T 3IG6B 2FOMB 3M37A 1LPZB 2WYGA 3L6PA 2FM2A 2WZQA 4RT1A 1GPZA 1LHGH 1BBRE 2W7UA 4H4FA 4AFSA 1QBOA 2NU4E 1V2WT 1DANH 1Z8JB 1GMDG 1YKTA 4A1VA 4AFUA 3ATMA 3PMBB 1HCGA 2XRCA 5C5OA 1HGTH
chains in the Genus database with same CATH topology
3N7EA 2K0QA 5FPTA 1H8ED 2XCFA 4I31A 3F2GA 5F53A 2A4RA 3NRLA 3SU4A 4NWLA 1NS3A 5HKKD 2IJD1 3FOAA 2OC8A 5ETXA 3SU6A 2XOKD 4M9FA 3M5OA 4B6FA 3LKWA 4FETA 2VBCA 4B75A 2XNDD 2WSSD 3F3BA 4Q4LA 1SKYE 1DY9A 2K8IA 4TYDA 3KEEA 3SV6A 3P8NA 4U01A 3WWFA 4I32A 3U1IB 5CDFE 2KR7A 2JJ1D 5EPNA 2OC7A 2QV1A 3F0OA 4KTCA 3OYPA 1H8HD 3SUGA 5EPYA 4B73A 4YXWD 1NBME 2F4LA 1MABB 5FPSA 5GJ4B 3LONA 3OTPA 3UB0A 4JMYA 5B6LA 2OINA 3F0PA 2XNIA 4F55A 5C0UA 3W1EA 2XCNA 1E1RD 2KCAA 2CK3D 1RTLA 2GVFA 2KM0A 3F2FA 2FP7B 3M5NA 4A92A 4DT4A 3FO8D 1W0KD 1KMHB 3KN2A 5ESBA 1DXWA 3SU0A 4WF8A 2A4QA 2KZ4A 3PV2A 5EQSA 1E79D 4I33A 4B76A 4WH8A 3ZIAD 3P8OA 3SYJA 3U1JB 2QE7D 1E1QD 3EYDA 3OEHD 3M5MA 3O8DA 1JXPA 1COWD 5T1VA 3WW7A 2KCOA 4OM9A 1DY8A 3KNXA 2O8MA 4B6EA 2YMSD 3PRBA 4K8BA 2YMSC 3KF2A 3SUFA 5EQQA 4B74A 3O8CA 5FL7D 5IK2D 1WXRA 5FPYA 2JJ2D 2IJOB 2KCYA 2WV9A 3SUDA 4Z1MD 4XD7D 2OBOA 3DSOA 3VG8A 5EQRA 4NWKA 3RC6A 3AK5A 1DXPA 3H09A 3DSPA 2GGVB 5H4IB 2LELA 3M5LA 3N99A 2F9VA 3SV9A 2KFWA 3SV8A 5DSFA 3FKSD 5IDKA 2HLDD 2M2AA 3DCLA 1S6LA 2AHME 1W0JD 1FX0B 3PRDA 1OHHD 3OE7D 3SU5A 4TT3D 2J5UA 3RC5A 3O8BA 5C17A 3O8RA 2F9UA 3OAAD 3SU1A 4ASUD 1NBMD 3SV7A 4ZCNA 2V7QD 2K1QA 2QF4A 2A4GA 2JDID 2OBQA 2YOLA 1A1RA 3RC4A 2OC0A 3LOXA 2L6OA 2KCPA 3OFND 2FOMB 4B71A 5CHBA 2W6JD 3N7DA 5GPIB 3L6PA 2FM2A 2WZQA 4R8TB 4A1TA 3E90B 4A1XA 1BMFD 1CU1A 1BT7A 4WH6A 4RI0A 2JIZD 3SU3A 3SU2A 2OK5A 3SUEA 2OC1A 2QF5A 2YMSB 3F2HA 3GS9A 2W6ID 3OEED 4Q63A 4TSFD 1EFRD 1N1LA 2P59A 3WWBA 4A1VA 2WPDD 5C0TA 3PV5A 5DN6D 1RGQA 3FN8A 2F43B 2WHXA 3SZEA 1W3CA 5GNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KM0 A;  3N7E A;  2K0Q A;  3DSO A;  3N7D A;  3DSP A;  2LEL A; 
#chains in the Genus database with same CATH topology
 1LDT T;  1GHZ A;  4Q80 A;  2A4R A;  2J34 A;  3NRL A;  1ETS H;  3PLP A;  1LVY A;  1NS3 A;  1SOZ A;  3BG4 C;  2GV7 A;  1NTP A;  1ZOM A;  2BD4 A;  1HJA C;  2XOK D;  3EA7 A;  2RFK C;  5EXL A;  1TBQ H;  2ZQ2 A;  4A5T S;  5F03 A;  1XM1 A;  3VPK A;  1EZQ A;  3MTY A;  2XBX A;  1H8I H;  1L1J A;  2GX4 A;  1O2I A;  2ZPQ A;  1H8H D;  1WTG H;  3EDX B;  4OS5 A;  4OS4 A;  1XUI A;  5FPS A;  1OWH A;  4JMY A;  3VXF H;  5FAH A;  3S9C A;  2BD2 A;  4K3J A;  4B1T A;  1FIZ A;  2AEI H;  1TLD A;  2BX3 A;  3FZD A;  3FO8 D;  3TH3 H;  1D3Q B;  2ZZU H;  1MKX K;  4O3T A;  1EUF A;  2B7D H;  4AYY B;  3OEH D;  1OOK B;  1UCY E;  3WW7 A;  1A5I A;  1NZQ H;  5L2Z H;  2CF9 H;  1A3B H;  3FP6 E;  4K8B A;  2SGP E;  3ZZA A;  2KCY A;  1SHH B;  3VGC B;  1O5C B;  1DSU A;  1S6H A;  2ZTX A;  3PWC A;  5ABW A;  5A0A E;  1SGN E;  4JCN A;  2BMG B;  3RU4 E;  2BQW B;  2VGC C;  3SV9 A;  3TIU A;  2QGR A;  1A5H A;  2GCT C;  2XYA A;  3UFA A;  1ZZZ A;  2BZA A;  5JBT A;  1OHH D;  4JYU H;  5LGO A;  4XBB A;  1TX6 A;  2PHB A;  3O8R A;  4FXG H;  1YPH C;  1O5B B;  2UWO A;  1SFQ B;  1GI4 A;  1PPB H;  3RC4 A;  1GJ4 H;  1TYN A;  2BDI A;  4B71 A;  3VB4 A;  3RXD A;  2NU3 E;  2BD8 A;  4A6L A;  1SFI A;  1XUH A;  1O2P A;  4I8J A;  2OC1 A;  4INL A;  1WDI A;  3U28 C;  3MU4 A;  1A0J A;  1K1M A;  2BM2 A;  2EI7 A;  1FI8 A;  3PWB A;  1H9H E;  1O38 A;  1O2X A;  5DN6 D;  1PQ8 A;  2UUY A;  1C5T A;  3P8F A;  2Y5F A;  4ABE A;  1N6Y A;  1MBQ A;  1OP8 A;  2XCF A;  3ZVA A;  1CGH A;  1S85 A;  2GT8 A;  4NWL A;  2VH6 A;  3UPE A;  3FOA A;  4X2V A;  5C1Y A;  3M5O A;  3SQE E;  4B6F A;  1JIM A;  2ANW A;  3UQO A;  4RN6 A;  2Z9I A;  2AER H;  1P2O A;  1DFP A;  1SKY E;  3QUM P;  4JK6 A;  3MU8 A;  2FLB H;  3GOV B;  1P2M A;  3KQC A;  1QJ6 B;  1FY4 A;  1O36 A;  1OP2 A;  1P57 B;  2I6S A;  4ABA A;  3B23 B;  1V2T T;  2QCY A;  1Y5A T;  1SQR A;  1C5V A;  2P3F H;  4GHT A;  3NK8 A;  1AE8 H;  4RKJ B;  1CA0 C;  3T25 A;  3ZZ5 A;  3NUM A;  1E1R D;  4ZXX H;  2G51 A;  1J8A A;  1NC6 A;  1NO9 H;  1FUJ A;  2HLC A;  1W7X H;  1UHB B;  3TK5 A;  3AW1 A;  1X7A C;  3S9A A;  1J9C H;  1BML A;  1QFK H;  2R3Y A;  3BEU A;  7LPR A;  4NIX A;  1LHF H;  1TE0 A;  4OM9 A;  1GMC G;  3BSQ A;  1FY1 A;  4B6E A;  3F68 H;  2Y5H A;  1CT0 E;  5DP5 A;  1FN6 A;  5KGO A;  1AFE H;  5E2P A;  5FL7 D;  1DX5 M;  4I8H A;  2IJO B;  5JDU B;  1C2L A;  4KEL A;  9LPR A;  2O8U A;  3RXB A;  1A0L A;  1Q3X A;  4NFE A;  1D3P B;  2EA3 A;  2NU2 E;  1GJA B;  3RXS A;  1W8B H;  3LPR A;  1GMC F;  4NGA H;  3FKS D;  1NRP H;  4CRD A;  1S6F A;  1QCP A;  3MNC A;  3GIS B;  4GCH F;  4CR9 A;  1K2I 1;  4TT3 D;  5E2O A;  4IS5 A;  2C90 B;  4FVD A;  2ZCL P;  3VFE A;  1NBM D;  3UNQ A;  4BAH B;  1LVM A;  2ZGX H;  1TNI A;  1ZSJ A;  1C5Y B;  1AND A;  3GY8 A;  1C2G A;  2FX6 A;  2HAL A;  2KX4 A;  3KQE A;  3KYF A;  3RXC A;  4K69 A;  1NRR H;  1UK2 A;  2PTN A;  2FOE A;  4U30 A;  3SUE A;  1D6W A;  2TGD A;  5AFY H;  1K1J A;  2VIW A;  2W6I D;  2ZKS A;  2ANM H;  4H6T A;  4OGY A;  2EC9 H;  5EOD A;  6EST A;  3T26 A;  1GL1 A;  1MMJ N;  1BCU H;  2CJI A;  1KTT B;  5DP8 A;  1KXA A;  2Q6F A;  1GBL A;  2GT7 A;  1BBR H;  2QF0 A;  2BX4 A;  2FOC A;  4MLF B;  3A7W A;  5ETX A;  4D8N A;  4K60 A;  1TNL A;  1ZPB A;  2VWL A;  1C9P A;  3PRO A;  1LQE A;  2BY6 X;  2FES H;  2XND D;  4X6P A;  4XE4 A;  2JET B;  4YLU A;  1LVO A;  3TNS A;  1NFU A;  1P9S A;  1QB6 A;  3ENS B;  1WQS A;  4ISI H;  3RXQ A;  3SV2 H;  4X2W A;  1AB9 B;  1NBM E;  2CHA B;  2F4L A;  5TJX A;  3ATW A;  5B6L A;  1TX7 A;  3K9X B;  3N7O A;  1NRS H;  1DE7 H;  3W1E A;  3BN9 A;  1GCD A;  4X6M A;  2KCA A;  2ZA5 A;  5LPR A;  2NWN A;  3ZZ4 A;  1O3C A;  2F9B H;  4FUD A;  1KMH B;  1DXW A;  4ZUH A;  1ZTK A;  2TPI Z;  1C1U H;  1TBZ H;  1QL7 A;  1GI3 A;  3A7V A;  5LPE A;  1K0H A;  1NU9 A;  1KTS B;  2CV3 A;  2TRM A;  1T8O A;  1GHB G;  1UVP A;  4BAO B;  2ZDK A;  3KF2 A;  4AYV B;  1A3E H;  4B74 A;  3SNC A;  1GBH A;  3UAI C;  8LPR A;  2ZQ1 A;  4INK A;  5FPY A;  1TA6 A;  1H9I E;  1YCP M;  3RML H;  1PPC E;  1O2G H;  3UQV A;  3RXG A;  4OGX A;  3RC6 A;  1FIW A;  2P3T B;  3FFG A;  5T3H A;  4FVB A;  3OY5 U;  4HI3 A;  4KP0 A;  3SJI A;  1JWT A;  2PUQ H;  3RLY H;  5C94 A;  5DSF A;  5TCC A;  1F0R A;  4MPU A;  5KED A;  2HWL B;  3T2N A;  4JZF H;  1RJX B;  1W10 U;  2JKH A;  1E38 B;  1AE5 A;  3AW0 A;  1UTO A;  2FOH A;  1WQV H;  3PMJ A;  4SGB E;  2ZIQ H;  1QY6 A;  1O3A A;  1C2K A;  2ZDA H;  2ZTZ A;  3KQD A;  1OWK A;  3QN7 A;  4X8U H;  1Z71 A;  2JDI D;  3SNB A;  2R3U A;  1C5Z B;  3EGK H;  1BRA A;  3E8L A;  3QK1 A;  1HB0 B;  4O97 A;  4NSV A;  3RXJ A;  2BY5 X;  4BTT B;  4HTC H;  1YYY 1;  4NZQ A;  3F2H A;  4FUC A;  5FX5 A;  1BUI A;  3LJJ A;  3PV5 A;  1C2F A;  1QIX B;  1T8N A;  1KYN A;  3GCO A;  4UFE H;  1W3C A;  1MUE B;  1HAO H;  1TNH A;  2RCE A;  1ZSK A;  2WUC A;  1N8O B;  1TMB H;  2GMT C;  3RXI A;  2ZPR A;  4D7F A;  1Y5B T;  5DO4 H;  3LH3 A;  4TWW A;  3GY4 A;  1EP5 A;  3MNB A;  1Q2W A;  2FTM A;  1TQ0 B;  1GBK A;  2C4F H;  1DVA H;  4J1Y A;  1K9O E;  2ZGH A;  3UUZ A;  4BXS A;  2FIR H;  3A81 A;  3PMA B;  1JRT A;  2J92 A;  1IQL A;  3NWU A;  4AFQ A;  3PV4 A;  2F91 A;  1KLJ H;  4THN H;  1LPK B;  1P10 A;  4DW2 U;  1W2K H;  5DP7 A;  1T8L A;  2BD3 A;  2VU8 E;  1O35 A;  1GHA F;  3BIV H;  1HRT H;  3EE0 B;  2VIV A;  3O8D A;  3BTM E;  1AFQ B;  4IN1 A;  1QGF A;  2PP6 A;  3SOS A;  1SLV B;  1J15 A;  1UTL M;  5FBI A;  3A80 A;  1AKS A;  3BV9 B;  5IK2 D;  2P16 A;  4GVU A;  3LC5 A;  5JBB S;  4LZ4 B;  1O31 A;  1HAG E;  5FCK A;  3ZZC A;  4K5Z A;  1B7X B;  4Y76 A;  1NT1 A;  4BAN B;  3U8O H;  3I29 A;  1HYL A;  3SI3 H;  4K2Y A;  1TNK A;  3BTG E;  1KDQ A;  4JZI A;  2FYR A;  3DFL A;  2PUX B;  3W95 A;  1TAL A;  4ZKS U;  3KYG A;  3F9E A;  2ZFS A;  1W0J D;  4D76 A;  5CE1 A;  4AGK A;  1UTK A;  1UCY H;  1C4U 2;  1ZGI A;  4X8V H;  4I8K A;  1AB9 C;  2R9P A;  3I78 A;  1HAV A;  2RDL A;  1OYT H;  2FI5 E;  2P93 A;  2A2Q H;  3TU7 H;  1MQ5 A;  1VGC C;  4XBD A;  4E7R G;  1RXP A;  4PRO A;  1VR1 H;  4U32 A;  4P02 A;  3CS7 A;  4AOQ A;  5FBE A;  1WU1 A;  2AMQ A;  1IQI A;  1GMH F;  3T5F H;  2ZU2 A;  4BTI B;  5T6G A;  1PJP A;  4K8Y A;  1C1W H;  1B0E A;  3P6Z B;  3GDS A;  4YOJ A;  1O33 A;  1O30 A;  2D8W A;  3TH2 H;  2ZI2 H;  3R0F A;  3WY8 A;  1YPK H;  3QDZ B;  3SZE A;  2D26 C;  2ZFT A;  2P94 A;  1CA8 B;  1W7G H;  4BAK B;  1DM4 B;  3F2G A;  3Q77 A;  4WME A;  2C93 B;  3RXK A;  7EST E;  1F5R A;  1SGY E;  4Q7Y A;  1TMT H;  2ZFP H;  1VJ9 U;  1EJA A;  3PO1 B;  3TGJ E;  2JH5 D;  3M3T A;  3F3B A;  4NIY A;  1SG8 B;  2HPQ H;  1ACB E;  2BB4 A;  2ZO3 H;  2KR7 A;  2QIQ A;  3OYP A;  1TGB A;  2H1U A;  2BVR H;  3SJ9 A;  1YP9 A;  1GG6 C;  1EST A;  1O3E A;  3SBK A;  4K1S A;  1QRX A;  2CHA C;  1V2K T;  1UVT H;  2QYI A;  2VVC A;  1C1R A;  1MTW A;  2GVF A;  1BHX F;  2BLO A;  3UNS A;  1C2M A;  2GMT B;  1GI5 A;  1F0U A;  3A7Z A;  1ZHR A;  1QBV H;  1SHY A;  1FY5 A;  4IC5 A;  4MQA A;  4DVA U;  1F2S E;  4A7I B;  3U1J B;  1EXF A;  5DP9 A;  3EYD A;  3M5M A;  2Y6T A;  4UD9 H;  3RXR A;  3SNE A;  1BHX B;  1SGE E;  2ZC9 H;  1WBG B;  3PRB A;  4DGJ A;  1SSX A;  3SUF A;  4WMD A;  3SND A;  1K1O A;  2JJ2 D;  2TGT A;  1GVK B;  1P06 A;  1GBA A;  2EST E;  6LPR A;  2IOT A;  1GBI A;  4F48 B;  4ZHA A;  4K1E A;  2PKA B;  4ABJ A;  4ABI A;  5GXP A;  3DCL A;  1TOM H;  3MH4 A;  4Y8Y A;  1BRU P;  2BY7 X;  3M7T A;  2STB E;  3BTF E;  4X1S U;  1C5L H;  2GP9 B;  1ELD E;  1VCQ A;  1YC0 A;  3AAS A;  2Y7X A;  4AX9 H;  1G30 B;  2CF8 H;  2FPZ A;  4JZE H;  1GI9 B;  4FUB A;  1C1N A;  4I8G A;  1IHS H;  3ODD A;  2FOA A;  2KCP A;  3OFN D;  1W14 U;  1O3M A;  2FMJ A;  4MNX A;  1K21 H;  1BMF D;  4WH6 A;  4ABH A;  6GCH G;  2VIP A;  3AAU A;  2ZU3 A;  1GWA A;  2J98 A;  4BNR A;  2P59 A;  2V3O H;  3FP7 E;  3BIU H;  3Q3K A;  2BTC E;  1HFD A;  3K6Z A;  3ZYD A;  2WHX A;  1BOQ A;  4J2Y B;  1ZMN A;  3SGA E;  3KQB A;  2BOH B;  2A5K A;  1QB1 A;  2KAI B;  4I31 A;  4FUF A;  1DT2 A;  2B8O H;  3TH4 H;  1A7S A;  5HKK D;  2Z6B D;  4FUH A;  1YLN A;  1C1T A;  1QL9 A;  1O3J A;  1C9T A;  4BTU B;  3PB1 E;  1P3C A;  2VBC A;  5HM2 A;  3RXF A;  4B75 A;  2XBV A;  1F7Z A;  2WV4 A;  1O2Z A;  1SLW B;  2BOK A;  4Y79 A;  1E34 B;  1SQT A;  5EPY A;  1QQU A;  3PYH A;  2NU0 E;  1DWC H;  5FXL A;  3VB7 A;  2UWL A;  3K6Y A;  1CE5 A;  1DPO A;  3G01 A;  1FPH H;  1GBB A;  3W94 A;  5C0U A;  1KXF A;  4KTS A;  2BLV A;  2SGD E;  4X2Y A;  4AG1 A;  1Y3X A;  2FP7 B;  2VWN A;  1EAU A;  1W0K D;  5ESB A;  1C5R A;  3PV2 A;  3TVJ B;  1GJC B;  2DUC A;  3UTU H;  2ZFQ H;  1CQQ A;  1SQO A;  3GCH C;  5AFZ H;  5T6F A;  1O2O A;  4GHQ A;  1JXP A;  2LP6 A;  3U98 H;  3GDU A;  3RMM H;  3IIT A;  1NRN H;  2R2W U;  1AU8 A;  1NY2 2;  1HPG A;  1NRQ H;  5A09 A;  4LZ1 H;  1Z6J H;  1ESA A;  3UOP A;  1O2N A;  1HJ8 A;  1QTF A;  1TIO A;  4MNW A;  1ABJ H;  1EPT B;  2OBO A;  3S9B A;  4NWK A;  1TAB E;  1P05 A;  3H09 A;  5H4I B;  1U6Q A;  1VGC B;  1O3O A;  3A88 A;  1HLT H;  3A8D A;  1L2E A;  2TIO A;  1V2N T;  5E0G A;  1KLT A;  1O5E H;  3HK3 B;  2PSX A;  1ANC A;  3OE7 D;  2G5V A;  1H9L B;  2GZ9 A;  5C1X A;  1W0Y H;  1TFX A;  4ASU D;  1BTH H;  1ZPC A;  2A4G A;  5HYO A;  1XXD A;  3C27 B;  1W13 U;  1HJA B;  3U8T H;  2SGA A;  3E90 B;  1BT7 A;  1BA8 B;  2UWP A;  1CT2 E;  3TJO A;  1AQ7 A;  4CRG A;  1S82 A;  3E16 B;  3LGU A;  1P12 E;  4F49 A;  3NCL A;  1EZU C;  1QUR H;  1LHD H;  3B9F H;  1IQK A;  1ELA A;  6GCH F;  1GHY H;  5DP4 A;  5GND A;  3BTH E;  4X6N A;  1EQ9 A;  1BMA A;  3ZVG A;  1V2S T;  1QQ4 A;  4IBL H;  1XXF A;  4BXW A;  2ZCK P;  2ZHF H;  1TRN A;  1RFN A;  1W12 U;  2VH0 A;  4WXV A;  4DII H;  2Q6D A;  3RXT A;  2ODP A;  1Z8R A;  4AN7 A;  4ZXY H;  3RLW H;  3F6U H;  3V0X A;  3EST A;  3URE A;  2ZU4 A;  3PO1 C;  5K7R A;  3RXE A;  1Y3Y A;  1HJ9 A;  1C1S A;  3T62 A;  1MZD A;  4NIV A;  4B73 A;  1AZZ A;  3A8A A;  3RU4 T;  5GIB A;  1O2Q A;  3E0N B;  3MNS A;  3RMN H;  3KCG H;  3A82 A;  2CK3 D;  2VJ1 A;  4HGC A;  3MU1 A;  1DUA A;  1WTH D;  3I77 A;  3BTT E;  1MBM A;  4WJG 2;  1KIG H;  3D62 A;  3KID U;  4MNV A;  4RT0 A;  3RXV A;  6CHA B;  1C4V 2;  2G00 A;  2IPH A;  1QJ1 B;  5DPA A;  5A0C A;  4KKD A;  1PPF E;  4CRF A;  1OP0 A;  2ZPS A;  5T1V A;  4INH A;  2A2X H;  2XC4 A;  5GCH G;  1O3I A;  1ZTJ A;  2BD7 A;  3SJ8 A;  5EU8 A;  3SGB E;  5JPM H;  2PTC E;  1BMM H;  4IMZ A;  5I46 H;  1MAX A;  3SO3 A;  1Z8I B;  2OD3 B;  1B0F A;  4BAQ B;  3GY6 A;  1CHG A;  3KHV A;  3DSO A;  1RIW B;  2THF B;  1S0R A;  2WPI S;  4XSK U;  1BTY A;  8EST E;  2V0B A;  2LEL A;  3EA9 A;  2F9V A;  3PTN A;  5LPF A;  3TK6 A;  1ETR H;  1JBU H;  3ZV8 A;  3EE7 A;  1FX0 B;  1KXE A;  1V2P T;  3ATI A;  2GCH F;  5CHA C;  2Y80 A;  2J2U A;  3BG4 B;  3NZI A;  4YM9 A;  4LK4 A;  1EB1 H;  5C17 A;  5C1U A;  3SU1 A;  4CH2 B;  1V6D A;  2OUA A;  1ANE A;  1QNJ A;  1T7C A;  1C4Y 2;  3DFJ A;  2XXL A;  4TY7 A;  2J98 B;  1Z1J A;  2P95 A;  4ABB A;  3LOX A;  2A4O A;  2A7J A;  4WWY A;  5A8X A;  1O2M A;  2TGA A;  5EIY A;  4MPV A;  1ZHM A;  2V6N A;  1HAI H;  4X0W U;  2QF5 A;  1ZRK A;  1O2T A;  3OX7 U;  1A61 H;  5C0T A;  2SGQ E;  1CT4 E;  1VIT F;  1A2C H;  1GCT B;  2K0Q A;  5FPT A;  4AGJ A;  1INC A;  3Q3X A;  4U2W A;  1UTN A;  2ZFF H;  3SN8 A;  2BVX H;  3ZZ8 A;  1P09 A;  1DIT H;  4X1Q U;  2FZZ A;  1IQE A;  3ELA H;  4FUI A;  3HKI B;  2Z9J A;  3A86 A;  3U9A H;  2STA E;  1QJ7 B;  1ZGV A;  4XOJ A;  1FY3 A;  3ZZ9 A;  1IQG A;  1THS H;  2ZDN A;  4IN2 A;  3SQH E;  4DT7 B;  2FDA A;  1E37 B;  3NKK A;  1DY9 A;  4NCY A;  3KEE A;  1FON A;  3FP8 E;  2GZ8 A;  3GYL B;  2G4U A;  4NFF A;  1G32 B;  2OC7 A;  2QV1 A;  1WSS H;  4IC6 A;  4KTC A;  1GI1 A;  1ZPZ A;  2XW9 A;  1FJS A;  1MAB B;  5SGA E;  1TGT A;  1YCP K;  2GZ7 A;  2J95 A;  3GCN A;  3K65 B;  1BRB E;  1P3E A;  2FOF A;  1TPP A;  1UJ1 A;  1DWD H;  3ZV9 A;  4X1N U;  1VIT H;  3S7H B;  4E7N A;  1BJV A;  1CHO G;  4FUJ A;  1UVU H;  3KGP A;  4DG4 A;  1GJ5 H;  3MYW A;  1RD3 B;  1E1Q D;  1EOL A;  2CMY A;  2KCO A;  4TY6 A;  2AIQ A;  1GGD B;  1WUN H;  1ELB A;  3GDV A;  1YM0 A;  3BTE E;  1QA7 A;  1IHT H;  1EAW A;  4DUR A;  3ZYE A;  1O2W A;  2GKV E;  3UR6 A;  1LMW B;  1VJA U;  5EQR A;  3VG8 A;  2RDE A;  1DXP A;  1Z6E A;  2ALP A;  1V2L T;  1QHR B;  3RDZ A;  1LCY A;  1NPM A;  3SGQ E;  1O3L A;  1MCV A;  1HXE H;  3CS0 A;  1W0Z U;  2FXR A;  1C5U A;  1SPJ A;  1NFY A;  1AI8 H;  1NRO H;  3RC5 A;  2QXJ A;  3OTJ E;  1FAK H;  1YPL H;  3FAN A;  1YPJ H;  4ZRO A;  5FX6 A;  2BY8 X;  4FUG A;  3MNX A;  1O39 A;  2GV6 A;  1GI2 A;  4A1T A;  3T29 A;  2Q1J A;  1NES E;  4D7G A;  2G5N A;  1G2M A;  1P2Q A;  2OQU A;  3ZVE A;  2ZWL H;  3GS9 A;  5HIY A;  3QO6 A;  1N1L A;  4DCD A;  1BMN H;  2WPD D;  1FMG A;  1KDQ B;  2GTB A;  4ZHM U;  1FDP A;  1O2R A;  3M7U A;  4XBC A;  1OWI A;  3F1S B;  2Z3C A;  3BEI B;  1FLE E;  3SU6 A;  1GI7 B;  1HUT H;  1AD8 H;  1GCT C;  3S7K B;  3HKJ B;  5EW1 H;  2GCT B;  1P2I A;  4TYD A;  2ZNK H;  1KXB A;  4YZU A;  1GBT A;  1PQ5 A;  4LXB H;  2W3K A;  5EPN A;  5EG4 A;  3SUG A;  1O5A B;  3HGP A;  1P8V C;  2VIO A;  3EAJ A;  3URC A;  4YT6 H;  1WAY B;  2BDY A;  1Y3V A;  2XNI A;  1HAZ B;  1LO6 A;  3LT3 A;  4ASH A;  1BB0 B;  1FQ3 A;  2C8Y B;  1QZ8 A;  3A84 A;  3D65 E;  3GY7 A;  1V2J T;  4CRC A;  1UK3 A;  1TBR H;  2KZ4 A;  1AWF H;  4X8S H;  1UHB A;  1TNG A;  2QXG A;  1QBN A;  3SZN A;  6CHA C;  4ISL A;  3A83 A;  8GCH F;  1D3T B;  1DST A;  2HNT C;  5EST E;  1GG6 B;  2WUB A;  1DY8 A;  1K22 H;  5FHT A;  1AZ8 A;  2BYA X;  1SLU B;  3TJN A;  2Q6G A;  2VVV A;  1DWE H;  2A5I A;  2CN0 H;  2AGE X;  2J38 A;  1OWJ A;  1SI5 H;  2EI6 A;  3KQ5 A;  2G52 A;  1O5D H;  2XWB I;  1NU7 B;  1ETT H;  3M5L A;  1TGS Z;  2F3C E;  3UR9 A;  1Y3U A;  1IQN A;  3FZZ A;  1S84 A;  1QRW A;  1ZSL A;  2P8O B;  2FI4 E;  2PR3 A;  2ASU B;  1HIA B;  1GHV H;  3GY5 A;  1O2S A;  7GCH G;  4X1P U;  2J5U A;  1OPH B;  4CHA C;  1WYK A;  1L1G A;  2Y7Z A;  5HGG A;  2BVS H;  1DLK B;  2R0K A;  2G8T A;  1T32 A;  2QF3 A;  1SL3 A;  1V2V T;  5EXN A;  2OBQ A;  2BZ6 H;  1AFQ C;  1C5X B;  5C5N A;  4ZMA H;  2L6O A;  5E0J A;  2Z3D A;  4DOQ A;  1EP6 A;  1GL0 E;  1HV7 A;  4FOU C;  1L4D A;  1PYT C;  2FWW A;  1CO7 E;  5A8Y A;  4RI0 A;  2PKS C;  3SU2 A;  4RSP A;  1UVS H;  3DT0 H;  2H9H A;  1GHA G;  2BDH A;  1YPM H;  2F9N A;  2ZGB H;  2O8W A;  3FN8 A;  3M3S A;  3BG8 A;  1ORF A;  3HPT B;  4UON A;  1YGC H;  1H8E D;  1O2L A;  4TPI Z;  1O34 A;  2HVY B;  4ABD A;  1F0T A;  1M9U A;  1SLX B;  1AVW A;  2FYQ A;  4ZKN U;  1XMN B;  1ARC A;  1C1P A;  3BTD E;  1XUF A;  3LGT A;  3RXU A;  1V2O T;  1SMF E;  2ZCH P;  2BY9 X;  1EZS C;  3MQK C;  1H1B A;  2WSS D;  1IOE A;  4GCH G;  2HOB A;  2K8I A;  3TPI Z;  1XUK A;  2W3I A;  3E91 A;  4K1T A;  4YOG A;  3WWF A;  2CXV A;  3RXL A;  3RP2 A;  2AMD A;  2C8Z B;  1UCY K;  5K0H A;  1EPT C;  1UTM A;  3F9H A;  3RXO A;  1AVX A;  1ZYO A;  3GYM A;  2OIN A;  3TGK E;  5BPE A;  4NA7 A;  3LGV A;  1TON A;  4Y7A A;  3Q3Y A;  1MD7 A;  2J97 A;  2FX4 A;  2FI3 E;  3HK6 B;  1MKW H;  1SGD E;  2PGQ B;  4Y8Z A;  1O2J A;  1JRS A;  2JH6 D;  3V12 A;  2A4Q A;  1THR H;  1FNI A;  1FPC H;  2JH0 D;  1SQA A;  2W5E A;  3TJV A;  2J4I A;  3KL6 A;  4FUE A;  1C5Q A;  4Y6D A;  1C5N H;  3TK9 A;  1C5P A;  1RRK A;  5EGM A;  5C3N A;  2SFA A;  2H6M A;  1HAV B;  1PFX C;  1TPA E;  1BZX E;  2VVU A;  4WY3 A;  2VNT A;  4IMQ A;  4UFD H;  5F8T A;  4O3U A;  2TGP Z;  4Y0Y E;  2A1D B;  3ZVB A;  4MVN A;  4DIH H;  4FU9 A;  1Y59 T;  2OCV B;  4Q7Z A;  1THP B;  3SV8 A;  2HLD D;  1GDQ A;  1V2R T;  1HBT H;  4NG9 H;  3A85 A;  3M3V A;  4GUX A;  5A2M H;  3QX5 H;  3O8B A;  2F9U A;  2Y81 A;  3JZ2 B;  2QF4 A;  3SOR A;  8GCH G;  2OC0 A;  2PKS B;  3TJU A;  1PYT D;  2ZDL A;  5AF9 H;  1GHB F;  4JZD H;  3U8R H;  2JIZ D;  1EX3 A;  4I86 A;  2FLR H;  4B2C A;  2J94 A;  2B9L A;  1O3D A;  4BOH A;  4D9R A;  1J16 A;  2GD4 B;  1IQH A;  3ZZ7 A;  1C1O A;  1N8O C;  1SGQ E;  1TX8 A;  2WV5 A;  1IQM A;  1HNE E;  2F43 B;  5HIZ A;  4DJZ B;  1GJB B;  1QA0 A;  5AVD A;  2ODQ A;  1TGC A;  1L0Z A;  2XWA A;  1C5O H;  3IWM A;  3MU0 A;  1C5M D;  2PLX A;  2AS9 A;  2SNV A;  1C2J A;  4GSO A;  1JMO H;  1NM6 A;  2IPQ X;  5DGJ A;  1V2Q T;  3C1K A;  3H7T A;  2QN5 T;  1TGN A;  2OP9 A;  3AAV A;  1EJM A;  3SNA A;  3SJO A;  3P8N A;  1ZRB A;  1LKA A;  1P03 A;  1ELC A;  1O2Y A;  4CRE A;  3RM0 H;  4GAW A;  4I8L A;  5E0H A;  4YT7 H;  2ZHQ H;  2M5T A;  3ZVC A;  3LU9 B;  3OTP A;  3EA8 A;  4RKO B;  3ZZD A;  2FTL E;  4Q2K A;  3MFJ A;  3F2F A;  4Y7B A;  4JK5 A;  2KM0 A;  2ANK H;  3VB6 A;  1CGI E;  4R0I A;  1FAX A;  4DT4 A;  1CVW H;  1Z1I A;  1BRC E;  4AOR A;  1O2K A;  1YBW A;  2V3H H;  4O9V A;  5JB8 S;  1OS8 A;  1C5S A;  4WVP E;  3LDX H;  1CGJ E;  1MCT A;  1ZMJ A;  3GCT F;  8KME 2;  1RTK A;  2HNT F;  3TIT A;  1OSS A;  2FOB A;  3ITI A;  1UTP A;  3MO6 A;  1GVL A;  1BJU A;  2WPK S;  3RM2 H;  1JIR A;  3KNX A;  4GLY A;  2Z9L A;  4AFZ A;  1EOJ A;  2EQN A;  2R0L A;  1EPT A;  1UO6 A;  1BTU A;  4OS6 A;  5L30 H;  1WXR A;  3BEF B;  3K2U A;  2WV9 A;  4ABG A;  1UTQ A;  3DUX H;  3LIW A;  4ISN A;  4AB9 A;  1GHX H;  4XDE A;  1DWB H;  2V35 A;  4JZ1 A;  1K1N A;  5IDK A;  5JYI A;  1D3D B;  3GIC B;  3P95 A;  2ODY B;  1DOJ A;  4JYV H;  2ALV A;  2TBS A;  3MU5 A;  4EST E;  1TMU H;  3M35 A;  1SGR E;  4YOI A;  3DHK H;  3OAA D;  1A4W H;  1CBW C;  1MTN B;  4Z6A H;  4ISO A;  1A1R A;  1Q31 A;  1RIW C;  2H9T H;  4O03 A;  1O3H A;  3TNT A;  3MOC A;  3N7D A;  2VWM A;  1MKW K;  5C2Z A;  3Q76 A;  1CU1 A;  1ZHP A;  1Y5U T;  2H2Z A;  1FN8 A;  1GJ7 B;  1L1N A;  1EB2 A;  5G4B A;  3OEE D;  4Q63 A;  1FXY A;  2RA0 A;  3SHC H;  3RXH A;  3MHW U;  2Y82 A;  1O5F H;  2OTV A;  3PLB A;  3RXP A;  3H5C B;  1BTZ A;  1GJ8 B;  1K1P A;  1H4W A;  1O3G A;  1SR5 C;  5F53 A;  1SVP A;  2W7S A;  4Y0Z E;  2CGA A;  2IJD 1;  1QB9 A;  1HAP H;  1ZLR A;  1D4P B;  3E6P H;  1OWE A;  2AFQ B;  4TWY A;  2FOG A;  1PPG E;  1CA0 B;  1XX9 A;  1GBD A;  5EJ1 A;  4ACB A;  5CDF E;  4I32 A;  3U1I B;  1C2H A;  2JJ1 D;  2Z94 A;  2XBY A;  3R3G B;  3VB5 A;  4YXW D;  1TAW A;  3NXP A;  3ZZ6 A;  1O5G H;  1VIT G;  3B8J A;  3MH5 A;  1VZQ H;  3UOU A;  1E36 B;  2ZEB A;  3OY6 U;  2HVX A;  1E0F D;  2XBW A;  2WYJ A;  1BTW A;  1BTP A;  1OYQ A;  2BQ6 B;  4NSY A;  1P02 A;  4AG2 A;  3SHA H;  5BRR E;  1P2J A;  3QZQ A;  2AGI X;  4XRN A;  1ZTL A;  1LPG B;  5PTP A;  3VEQ B;  1IAU A;  3V3M A;  2P3U B;  2HGT H;  1COW D;  1QR3 E;  5EOK A;  2GDD A;  1BIO A;  2WIN I;  3URD A;  2O8M A;  2ZP0 H;  1TNJ A;  4CBO A;  2GCH G;  4YO9 A;  2BDC A;  3A7T A;  1EJN A;  2C8X B;  4GPG A;  2Z3E A;  3SUD A;  1YPH E;  5EXM A;  1O0D H;  4XD7 D;  1YPE H;  2WPL S;  1E35 B;  1QRZ A;  1GI8 B;  1C1Q A;  1TB6 H;  2AGG X;  4CBN A;  2DE8 A;  2YNB A;  2ZG0 H;  4YLQ H;  2ZGC A;  3Q00 A;  1CHO F;  5DK1 A;  3FAO A;  2UUF B;  1AHT H;  4ZCN A;  4ZHL U;  4VGC C;  5L6N H;  1P9U A;  3OU0 A;  1OX1 A;  1UVO A;  2G81 E;  2Z9G A;  3E0P B;  1WV7 H;  5CHB A;  1SOT A;  1FY8 E;  4I7Y H;  1DLE A;  4A1X A;  4TPY A;  4X6O A;  1KLI H;  2H9E H;  2BXU H;  1YCP H;  1ARB A;  2OK5 A;  3D49 H;  4MDS A;  1RTF B;  2FS8 A;  2VIQ A;  4Y11 E;  4OS1 A;  2AMP A;  5J4S A;  2A45 B;  4HFP B;  1BTX A;  2UUK B;  1UTJ A;  1NN6 A;  3BTK E;  2ZU5 A;  3V7T A;  2GDE H;  2DE9 A;  5F8X A;  1LVB A;  1ELV A;  1T8M A;  2O8T A;  5J4Q A;  3E3T A;  1HAX B;  1ZJD A;  1A0H B;  1P11 E;  4JYT A;  2OC8 A;  5TCA A;  1NFX A;  4MG3 A;  3D23 A;  3FVF B;  3LKW A;  1AKS B;  1G37 A;  2PSY A;  3U69 H;  1BBR K;  4UFG H;  2G4T A;  1O3N A;  2AIP A;  1P0S H;  3SV6 A;  2G55 A;  2Z7F E;  1TWX B;  7KME H;  2H5C A;  1AMH A;  4MPW A;  3QGJ A;  5GJ4 B;  1F0S A;  4IW4 E;  2SGF E;  2F9P A;  2O9Q A;  3PMH B;  4M7G A;  3P8G A;  5I25 A;  1PQ7 A;  3BTW E;  2XC5 A;  5L2Y H;  2LPR A;  2RA3 A;  1V2U T;  2PW8 H;  4WF8 A;  1A5G H;  1G9I E;  2WPH S;  5EQS A;  3P17 H;  4HZH A;  4H6S B;  3TGI E;  1O3P B;  5JBC S;  3A7Y A;  3P8O A;  3SYJ A;  4WMF A;  1G36 A;  1GBE A;  2ZDM A;  1GHW H;  1ZR0 A;  2YMS C;  4YTA A;  4E06 H;  1P2K A;  1TA2 A;  4ISH H;  1LHC H;  3PM3 A;  1DUE A;  5F6M A;  3RXA A;  3QLP H;  4Z1M D;  1RS0 A;  4Z0K A;  3DA9 B;  1DIC A;  2GGV B;  3N99 A;  1CBW B;  1LKB A;  2ZHE H;  4FU7 A;  5GCH F;  3VXE H;  5EJZ A;  4CRB A;  2YNA A;  2M2A A;  2OLG A;  2A32 A;  3MI4 A;  1EAT A;  2A31 A;  3BTQ E;  1FV9 A;  1UK4 A;  2PKA A;  3PTB A;  2ZTY A;  3UWJ H;  1GI0 A;  1V2M T;  1EZX C;  3LGW A;  2K1Q A;  1SGF A;  3MH7 A;  2BDG A;  2D1J A;  3ZZB A;  1KXC A;  1MTN C;  1ABI H;  4ABF A;  1MTU A;  3HAT H;  1AWH B;  2W6J D;  1ID5 H;  4R8T B;  3E1X B;  1V3X A;  1BQY A;  2EY4 C;  1TRM A;  1OXG A;  2YMS B;  2F9O A;  1SGF G;  3LGI A;  3UY9 A;  3P70 B;  4TSF D;  3QWC H;  2PFE A;  5GWZ A;  1Y8T A;  1G3E A;  1VCW A;  3N7E A;  4NZL A;  3DSG A;  4CRA A;  1Y3W A;  1MU6 B;  1S5S A;  1T4U H;  1GJD B;  1ZJK A;  5DP3 A;  3DD2 H;  1O3B A;  1MD8 A;  2KAI A;  4X8T H;  3LGY A;  2ANY A;  2BQ7 B;  2FEQ H;  3ZZ3 A;  2I6Q A;  1XVM A;  4E05 H;  5F8Z A;  1XKB C;  1AN1 E;  4NA9 H;  1VCP A;  3V13 A;  3F9F A;  4NIW A;  1T31 A;  1EAX A;  3F0O A;  3GY3 A;  4SGA E;  4Y71 A;  1EAI A;  3LC3 A;  4MNY A;  1O2V A;  3S0N A;  1BIT A;  3M36 A;  3A8B A;  1F5L A;  2XTT B;  3UB0 A;  1SC8 U;  3F0P A;  4DY7 B;  4F55 A;  5A8Z A;  1TOC B;  4ZKR U;  2XCN A;  1L4Z A;  1HIA A;  3T27 A;  1RTL A;  3GCT G;  3M5N A;  3MMG A;  1GBF A;  1KXD A;  4KTU A;  1IQF A;  2PGB B;  3KN2 A;  4AB8 A;  1A46 H;  2ZDV H;  2A5A A;  2ILN A;  1HAY B;  2ZHD A;  1AIX H;  3UWI A;  1WCZ A;  4I33 A;  4WH8 A;  1EAS A;  4P00 A;  1OKX A;  5AHG H;  1C2E A;  1K28 D;  1C5W B;  2YMS D;  3M7Q A;  1LTO A;  1ELT A;  1YWU A;  5GDS H;  3O8C A;  3NPS A;  1C2D A;  1GGD C;  5EJL A;  1QL8 A;  2HNT E;  3L3T A;  1SGI B;  3AK5 A;  3ODF A;  3GCH B;  3M61 U;  4LOY H;  2BDA A;  2ZFR H;  4H42 U;  1ELG A;  1P2N A;  2AHM E;  4UEH H;  2AH4 X;  3QTV H;  4AZ2 B;  4ZKO U;  1GMH G;  1DS2 E;  2A7C A;  1YLC A;  3RXM A;  3S69 A;  1PQA A;  2V7Q D;  1F5K U;  1S81 A;  1W11 U;  5HM9 A;  2YOL A;  3CNR A;  2BD9 A;  3STI A;  4ACA A;  1N6X A;  4OS2 A;  1PPZ A;  3QTO H;  1YF4 A;  4MPX A;  4QT8 C;  3MH6 A;  1ANB A;  2IN2 A;  5A0B A;  4BAM B;  1YLD A;  2LNC A;  1EFR D;  1BDA A;  3WWB A;  2VWO A;  1H8D H;  1RGQ A;  2AYW A;  3CP7 A;  2FOD A;  2C8W B;  1XUG A;  4D9Q A;  2Y5G A;  1GBM A;  1TQ7 B;  1MTS A;  1SGC A;  2C3S A;  4HG6 A;  1YPG H;  5JB9 S;  4Y10 E;  2HPP H;  3A89 A;  1OWD A;  1NFW A;  2J9N A;  4CHA B;  4Y8X A;  3STJ A;  4M9F A;  3SJK A;  3HGN A;  5FCR A;  2QY0 B;  4CH8 B;  1D6R A;  1C1M A;  1P01 A;  5IYT A;  2FO9 A;  1B5G H;  1GDN A;  1G3B A;  2UUJ B;  2H5D A;  2XC0 A;  3OSY A;  3RUO A;  1SB1 H;  5DG6 A;  1Z7K A;  1AUJ A;  4XFQ A;  5HXF A;  4YES B;  2R2M B;  3LJO A;  3CEN A;  4A92 A;  1TPS A;  2BLQ A;  1LQD B;  1UW7 A;  4KGA A;  1VKY A;  4B2B A;  2QA9 E;  1FZZ A;  3LH1 A;  3RMO H;  3SW2 B;  3QGN B;  2VB0 A;  1E79 D;  3A8C A;  4Q7X A;  4UDW H;  1AGJ A;  5C67 A;  4B76 A;  2QE7 D;  1AVG H;  3QZR A;  1GJ6 A;  4X1R U;  5DP6 A;  1P04 A;  1AUT C;  1S83 A;  1KY9 A;  5EQQ A;  1LHE H;  3VGC C;  1GBC A;  3MO3 A;  2SGE E;  1MU8 B;  2OQ5 A;  5KEC A;  1IQJ A;  3BF6 H;  5EW2 H;  3GY2 A;  5B6O A;  1XKA C;  1TPO A;  1YY3 A;  3MWI U;  1AY6 H;  1SGT A;  2KFW A;  1EKB B;  1GBJ A;  3JZ1 B;  4VGC B;  1O3K A;  1S6L A;  1ELF A;  2QXI A;  2PV9 B;  9EST A;  2Z9K A;  3T28 A;  3SU5 A;  2WPJ S;  2P8O C;  4ZH8 A;  2A7H A;  2ZGJ A;  4B2A A;  1MTV A;  1G3D A;  2VGC B;  3SV7 A;  2B5T B;  2A0Q B;  1Z8G A;  2GJG A;  4ZAE A;  1XVO A;  2ZEC A;  3ZVF A;  5GPI B;  1PPE E;  1O2H A;  5HMA A;  5JBA S;  3SU3 A;  1GDU A;  4UFF H;  1AO5 A;  1G3C A;  5LH8 A;  3UIR A;  3L33 A;  4AC9 A;  2QAA A;  2BXT H;  2ULL A;  7GCH F;  1C1V H;  3SU4 A;  2BLW A;  5CHA B;  2BHG A;  2RG3 A;  1CSO E;  2ZHW H;  4WXI A;  1MQ6 A;  2QXH A;  1ELE E;  4FET A;  1JOU B;  2EEK A;  1J14 A;  1GJ9 B;  2L74 A;  4Q4L A;  5DJ7 A;  3P92 A;  4U01 A;  1GMD F;  1ZML A;  1GVZ A;  1T4V H;  3VB3 A;  1F92 A;  2VID A;  2O8L A;  3ZVD A;  4X2X A;  4F4O C;  1MAY A;  2BDB A;  2JET C;  3LON A;  3AVZ A;  1UMA H;  1O3F A;  1GI6 A;  2W26 A;  1ESB A;  4MTB A;  1XUJ A;  3PLK A;  1HAH H;  2FS9 A;  2ZU1 A;  1WOF A;  4OS7 A;  3SU0 A;  2QC2 A;  2NU1 E;  2ZF0 H;  2WPM S;  2SNW A;  1K1L A;  1K1I A;  3ZIA D;  1MZA A;  1SGP E;  4UE7 H;  3EQ0 H;  1O2U A;  1TRY A;  2D2D A;  1C2I A;  1DDJ A;  4NA8 A;  2BD5 A;  2HRV A;  1PPH E;  1O32 A;  5CMX H;  1KSN A;  1S0Q A;  1G2L A;  3A7X A;  3SI4 H;  1HXF H;  1HDT H;  2F83 A;  3ATL A;  2PWX A;  5C20 A;  3MO9 A;  3A87 A;  2VIN A;  3DSP A;  5E8E H;  3H7O A;  3RU4 D;  2V3M A;  2B0F A;  4FU8 A;  1MH0 A;  3PRD A;  4IGD A;  1D9I A;  4CR5 A;  2EI8 A;  3ATK A;  2OXS A;  1O37 A;  5T6D A;  1SBW A;  1MKX H;  3F9G A;  5DKM A;  3TLO A;  3UNR A;  1J17 T;  3IG6 B;  2FOM B;  3M37 A;  1LPZ B;  2WYG A;  3L6P A;  2FM2 A;  2WZQ A;  4RT1 A;  1GPZ A;  1LHG H;  1BBR E;  2W7U A;  4H4F A;  4AFS A;  1QBO A;  2NU4 E;  1V2W T;  1DAN H;  1Z8J B;  1GMD G;  1YKT A;  4A1V A;  4AFU A;  3ATM A;  3PMB B;  1HCG A;  2XRC A;  5C5O A;  1HGT H; 
#chains in the Genus database with same CATH homology
 3N7E A;  2K0Q A;  5FPT A;  1H8E D;  2XCF A;  4I31 A;  3F2G A;  5F53 A;  2A4R A;  3NRL A;  3SU4 A;  4NWL A;  1NS3 A;  5HKK D;  2IJD 1;  3FOA A;  2OC8 A;  5ETX A;  3SU6 A;  2XOK D;  4M9F A;  3M5O A;  4B6F A;  3LKW A;  4FET A;  2VBC A;  4B75 A;  2XND D;  2WSS D;  3F3B A;  4Q4L A;  1SKY E;  1DY9 A;  2K8I A;  4TYD A;  3KEE A;  3SV6 A;  3P8N A;  4U01 A;  3WWF A;  4I32 A;  3U1I B;  5CDF E;  2KR7 A;  2JJ1 D;  5EPN A;  2OC7 A;  2QV1 A;  3F0O A;  4KTC A;  3OYP A;  1H8H D;  3SUG A;  5EPY A;  4B73 A;  4YXW D;  1NBM E;  2F4L A;  1MAB B;  5FPS A;  5GJ4 B;  3LON A;  3OTP A;  3UB0 A;  4JMY A;  5B6L A;  2OIN A;  3F0P A;  2XNI A;  4F55 A;  5C0U A;  3W1E A;  2XCN A;  1E1R D;  2KCA A;  2CK3 D;  1RTL A;  2GVF A;  2KM0 A;  3F2F A;  2FP7 B;  3M5N A;  4A92 A;  4DT4 A;  3FO8 D;  1W0K D;  1KMH B;  3KN2 A;  5ESB A;  1DXW A;  3SU0 A;  4WF8 A;  2A4Q A;  2KZ4 A;  3PV2 A;  5EQS A;  1E79 D;  4I33 A;  4B76 A;  4WH8 A;  3ZIA D;  3P8O A;  3SYJ A;  3U1J B;  2QE7 D;  1E1Q D;  3EYD A;  3OEH D;  3M5M A;  3O8D A;  1JXP A;  1COW D;  5T1V A;  3WW7 A;  2KCO A;  4OM9 A;  1DY8 A;  3KNX A;  2O8M A;  4B6E A;  2YMS D;  3PRB A;  4K8B A;  2YMS C;  3KF2 A;  3SUF A;  5EQQ A;  4B74 A;  3O8C A;  5FL7 D;  5IK2 D;  1WXR A;  5FPY A;  2JJ2 D;  2IJO B;  2KCY A;  2WV9 A;  3SUD A;  4Z1M D;  4XD7 D;  2OBO A;  3DSO A;  3VG8 A;  5EQR A;  4NWK A;  3RC6 A;  3AK5 A;  1DXP A;  3H09 A;  3DSP A;  2GGV B;  5H4I B;  2LEL A;  3M5L A;  3N99 A;  2F9V A;  3SV9 A;  2KFW A;  3SV8 A;  5DSF A;  3FKS D;  5IDK A;  2HLD D;  2M2A A;  3DCL A;  1S6L A;  2AHM E;  1W0J D;  1FX0 B;  3PRD A;  1OHH D;  3OE7 D;  3SU5 A;  4TT3 D;  2J5U A;  3RC5 A;  3O8B A;  5C17 A;  3O8R A;  2F9U A;  3OAA D;  3SU1 A;  4ASU D;  1NBM D;  3SV7 A;  4ZCN A;  2V7Q D;  2K1Q A;  2QF4 A;  2A4G A;  2JDI D;  2OBQ A;  2YOL A;  1A1R A;  3RC4 A;  2OC0 A;  3LOX A;  2L6O A;  2KCP A;  3OFN D;  2FOM B;  4B71 A;  5CHB A;  2W6J D;  3N7D A;  5GPI B;  3L6P A;  2FM2 A;  2WZQ A;  4R8T B;  4A1T A;  3E90 B;  4A1X A;  1BMF D;  1CU1 A;  1BT7 A;  4WH6 A;  4RI0 A;  2JIZ D;  3SU3 A;  3SU2 A;  2OK5 A;  3SUE A;  2OC1 A;  2QF5 A;  2YMS B;  3F2H A;  3GS9 A;  2W6I D;  3OEE D;  4Q63 A;  4TSF D;  1EFR D;  1N1L A;  2P59 A;  3WWB A;  4A1V A;  2WPD D;  5C0T A;  3PV5 A;  5DN6 D;  1RGQ A;  3FN8 A;  2F43 B;  2WHX A;  3SZE A;  1W3C A;  5GND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...