1UK3A

Crystal structure of sars coronavirus main proteinase (3clpro) at ph7.6
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
301
structure length
301
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title The crystal structures of severe acute respiratory syndrome virus main protease and its complex with an inhibitor
pubmed doi rcsb
source organism Sars coronavirus
total genus 79
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1uk3A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uk3A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uk3A02
1HAOH 1D6WA 5EW2H 1OXGA 3ATLA 4MPUA 6CHAC 1QFKH 1W2KH 3U1IB 5A09A 1NFXA 2VIWA 5L30H 2CMYA 4BTIB 3ZV9A 2GDDA 1TOMH 1G9IE 1O2NA 1FZZA 1F5RA 2C93B 3BEUA 1A61H 3GICB 1JXPA 1AGJA 4Y7AA 1A5IA 4AFSA 2FX4A 2PW8H 2P94A 1C5QA 4WMEA 5C67A 1QL8A 2BD8A 4HI3A 2ESTE 4YM9A 5C3NA 3HGPA 3B23B 4ISLA 5I25A 4AB8A 5DK1A 1LMWB 2V0BA 1FAXA 1O3GA 2THFB 1TAWA 1NRNH 1O33A 4KELA 4BTUB 3HK6B 1CGIE 3BSQA 2QXIA 1GI4A 1RD3B 3GY8A 3A80A 1VGCB 2WPMS 1DX5M 1EAUA 1FI8A 3SU4A 2NU0E 1C5MD 2PHBA 4XFQA 1P8VC 3PWCA 5FPYA 2D2DA 1C1RA 3JZ2B 2FI4E 2P8OB 2ZCKP 1AVGH 2F9VA 5TCCA 1SGFA 2WUCA 1BOQA 1TPSA 3EQ0H 2A4OA 1C5NH 4GCHG 3M5LA 1HB0B 1Z8GA 3LIWA 1BRAA 1DUEA 4O03A 3S69A 2IOTA 3KQBA 3M3SA 4INKA 2FWWA 3I29A 4GLYA 4ABGA 1O2IA 4K2YA 2ZU4A 4OS1A 5LPFA 3WY8A 1C5OH 1ESBA 2VIDA 3MU1A 3ZVFA 1DLEA 1SGEE 3SV2H 1INCA 1DXWA 1MD8A 4I33A 5FBIA 1TPAE 1EZQA 1QB9A 1RRKA 1TNHA 1GPZA 2Z94A 3M5OA 1NRSH 1QJ6B 2G4UA 1EJMA 3GY7A 1A5GH 4OGYA 4NG9H 3T2NA 1ZGIA 1T8LA 1AMHA 2BDIA 2HNTC 3AAUA 4BAHB 1WUNH 2Y5FA 3OX7U 4H4FA 4INLA 2D8WA 3F1SB 3Q3YA 6ESTA 3UWJH 1T31A 1ZYOA 1EQ9A 1M9UA 1C5ZB 3DHKH 1UTJA 2Z9KA 2SGQE 1NS3A 2TIOA 1A2CH 2J94A 3LGTA 2QXJA 1UTOA 1UMAH 1FQ3A 2UWLA 1IQGA 3SNEA 1TX7A 3TIUA 3SI4H 1IHTH 2YNAA 1MZDA 5ESBA 1QURH 1HBTH 2ODYB 1S85A 2UUYA 4OS5A 2CXVA 3FZZA 2PGQB 1PYTC 2JH0D 7LPRA 2FXRA 4UFFH 1GI6A 1O30A 1MBMA 1ZGVA 1OWDA 2J2UA 1TLDA 4MPWA 3UWIA 5CE1A 2BD5A 3P92A 4B2AA 1VGCC 1NPMA 3A8DA 3BEFB 3UNQA 2C8WB 2ZFTA 1SGQE 1V2QT 3QDZB 1MKWH 1CVWH 1O32A 3RC6A 2ZPQA 1T4UH 2VIPA 4GHTA 4X6NA 4AZ2B 5HYOA 5GCHF 5CMXH 1UTKA 1VITH 2P8OC 1GJ7B 1N1LA 4B2CA 1C2IA 1TQ7B 3GDUA 1QB6A 2ZF0H 1GL0E 1NM6A 3URCA 1C4Y2 1O2TA 1UTNA 3RXUA 1FY5A 4MPXA 3RXOA 4AFQA 1GBEA 1WQSA 2QYIA 1BBRH 2OLGA 2C4FH 1SC8U 4O3UA 1QNJA 1GJ9B 1OWHA 4I31A 1YPLH 1GHXH 2FP7B 1HIAA 3LT3A 1KSNA 2NU2E 3UOUA 3UQVA 3MWIU 1Z6JH 2VGCB 3LH3A 3TGIE 3BG8A 1HRTH 1MAXA 5AF9H 3MI4A 4ABBA 1G3BA 1ABJH 1GBIA 1MKXK 2O8WA 3HATH 2G52A 4NIYA 1ELAA 4OS7A 2C3SA 1LPGB 4X8TH 3RU4D 1F92A 3ZVDA 1BMAA 1QJ7B 1GBKA 2F83A 3VXEH 1O3CA 1NESE 1N6XA 1YPHC 3PO1B 1DY9A 5I46H 1GHYH 1SGFG 1XKAC 1A46H 2OCVB 4D8NA 1C1SA 1HGTH 1ELCA 3URDA 1AVWA 3A84A 1V2NT 1L4ZA 4YZUA 1EXFA 4PROA 2XWBI 5PTPA 3SU1A 1L4DA 2CF9H 3RDZA 3UNRA 2A5AA 2ODPA 2BX4A 1ZJDA 3BTDE 4RSPA 3TU7H 2BLOA 3U8TH 2PFEA 3VB3A 2A4QA 1MTNB 1SFIA 1O2LA 1P10A 2FEQH 2IN2A 1OWIA 1TABE 1LHDH 3P70B 1GBMA 3BTHE 4NGAH 1VITG 2W7UA 1NZQH 3UR9A 1IQKA 3O8CA 3RXHA 5IYTA 1F0UA 1S5SA 1F0TA 5T3HA 1Y3VA 3PWBA 1J14A 3BG4B 3IG6B 3O8RA 1XXFA 1SMFE 2KAIA 1Z8IB 3BF6H 3ZYEA 3SNDA 2FLBH 1DITH 1C2DA 1WAYB 1BB0B 4Y10E 4ABHA 1W12U 2GCTB 1D6RA 1S84A 4OGXA 1FIZA 3TJNA 1C5SA 1BJVA 2R3YA 4ISOA 4DIHH 3RXEA 2VGCC 1IOEA 1WU1A 2FOBA 1QA0A 1O2JA 1TNKA 2BD4A 1O3JA 5C1UA 3TGKE 3ZV8A 4F4OC 1SHYA 4DT7B 1A4WH 3MTYA 5J4QA 2GZ9A 1O2WA 1QBNA 2FIRH 4AX9H 2BY9X 2AGGX 2OC0A 3PTNA 5HM9A 1EB2A 2P16A 1BTPA 1CGHA 2Z3EA 4UONA 1S0QA 4JZDH 4MG3A 2D1JA 3D23A 1H4WA 1MTSA 1BIOA 1SR5C 4AYVB 2OD3B 3P8OA 4HGCA 1ELTA 2BYAX 5F6MA 1O2MA 3MNXA 2I6QA 4X1NU 1ZJKA 5C2ZA 1C1UH 2O9QA 2YOLA 3EA9A 1BTHH 3HPTB 5EU8A 2EEKA 2WYGA 2FM2A 2VJ1A 2TBSA 3DT0H 1FXYA 1MTNC 1QCPA 1P2MA 3SGBE 1KDQA 2VH6A 4XBDA 2BD7A 1HAIH 4O9VA 1B5GH 3M7TA 5E0HA 1UK4A 1D3QB 3RXFA 1WTHD 4FU8A 2AGEX 1GG6B 1XKBC 3KQCA 4XSKU 1EP6A 1NFWA 1H9LB 3ITIA 2CGAA 1IAUA 1C5LH 1GJ8B 5E8EH 1PPHE 1VCPA 1C4V2 3KNXA 3BG4C 1ZMNA 1DDJA 1WSSH 1P57B 4ABAA 3LDXH 3SORA 2VWNA 2BM2A 2A31A 1PPZA 2BQ7B 1D3PB 1Y3UA 1OWEA 1EASA 1JRTA 1V2PT 1W11U 2PGBB 4Z6AH 1EPTA 1WQVH 2AH4X 5EOKA 5T6FA 1O3DA 1LPKB 3TPIZ 2BD3A 3UR6A 2EA3A 1G3EA 2G81E 3OSYA 5ETXA 1P01A 3VEQB 2GCTC 1QBOA 5C5OA 1Z7KA 4AGJA 3A8BA 3SU6A 1P2QA 2K1QA 4TY7A 4K1TA 4RN6A 1Q2WA 4D9QA 2FYRA 1WYKA 4O97A 1NFYA 3RXDA 3NK8A 3GCTF 1O2OA 4A1VA 2QY0B 5HXFA 1O2KA 3SHAH 1O2SA 1OKXA 3ZZ8A 1GDNA 1GJ6A 2VH0A 3U8RH 1K1LA 5GWZA 1S0RA 1V3XA 1FONA 3E1XB 2VB0A 3H5CB 1MTUA 3ATWA 2FTMA 1HAVB 1Z71A 1UK3A 1P12E 3P8FA 2R0KA 2A7CA 3SHCH 4Q80A 1GBLA 1MQ5A 1Y8TA 1V2LT 1NFUA 3SJ8A 2ZHDA 3DD2H 1QRXA 1CSOE 2PV9B 5EQSA 2VINA 3ODFA 1HAYB 3LOXA 2XYAA 3E3TA 1SLXB 3GY3A 4GSOA 4ZROA 2ZQ1A 4UFDH 3QGJA 1BTWA 2NU4E 5DPAA 3RMLH 3S9BA 3MNSA 2XWAA 3SN8A 4K5ZA 2GX4A 1T8MA 1Y5UT 1JMOH 2ZDNA 3A88A 2BDGA 3RXAA 1SLWB 1K1JA 1E35B 3A7WA 1LCYA 5L2YH 5F8XA 1O5FH 4MPVA 3BIVH 2BLVA 2Z9GA 1C4U2 1UHBA 4Y71A 4MNVA 2ZTYA 4ISNA 1TALA 1F2SE 1EATA 2J4IA 1GG6C 2P59A 2BY7X 1EB1H 1C2KA 2ZNKH 2ZI2H 2GGVB 4X6PA 1MZAA 2Q6FA 5ABWA 1MBQA 2BDHA 3VB7A 3T25A 1Z1JA 1DWDH 1O3NA 3E6PH 3UTUH 3V0XA 2F9NA 4Y8YA 1TRNA 5JB9S 4AB9A 1S83A 7ESTE 3Q3KA 3M61U 3FVFB 4J1YA 4AFUA 2SGEE 1EKBB 5E0GA 1QRZA 1HXFH 3MOCA 2Z9JA 4WWYA 2STBE 2ALPA 4WVPE 1BZXE 1OWKA 3MH5A 1BMMH 2V3HH 4X1SU 1W10U 2VWMA 1AE5A 1PFXC 1S6FA 4MQAA 5FAHA 1DE7H 2PUXB 4K1SA 2ZG0H 2BZAA 4GVUA 5GCHG 5HM2A 1RJXB 1AUTC 4KTCA 1TWXB 1TPOA 5GJ4B 4CR5A 9LPRA 1ETSH 1ZSLA 2O8UA 5DP5A 2HWLB 3A7VA 1GI1A 1H9IE 4WF8A 1W7GH 1JOUB 1BRCE 3TH4H 2WV4A 1D4PB 2GZ8A 1GBAA 4ABJA 1QBVH 8KME2 1TGSZ 2BY6X 1CT4E 5AFYH 3STIA 4D76A 2AMDA 3TJVA 2ZPSA 1FJSA 3D65E 1UTMA 2ZA5A 1SQOA 3AASA 1KY9A 1AQ7A 3RU4E 5FX6A 1PPGE 4AN7A 1ACBE 4GAWA 1MH0A 4ZKNU 2QN5T 3GY2A 2QF3A 3M3VA 1MTWA 5T6DA 2A5KA 2WPLS 1GI0A 4X6MA 1Y59T 2SFAA 4VGCB 1C1PA 1PQAA 3RXVA 3FAOA 2XTTB 1F7ZA 1EOLA 3SNAA 1GJ4H 2A2QH 1K21H 3LJOA 1K1NA 4FU7A 5C1YA 1XVOA 3E0PB 1SGPE 1TPPA 2EC9H 1WV7H 2HRVA 4NIVA 2PSXA 2OC1A 3RM0H 2EI6A 2GP9B 2ULLA 4ZMAH 1EOJA 2PUQH 1O3IA 2ZCHP 2BDCA 4H6SB 4ABDA 4ZAEA 1YC0A 4IW4E 4A92A 2QF0A 1AWFH 3SW2B 4B75A 3NZIA 1GJBB 1W3CA 2FOEA 1QQUA 4UFGH 4X0WU 4KKDA 4IMZA 5FHTA 3GCHB 1O3BA 3CP7A 5FCRA 3QK1A 1GI7B 3RXRA 2OUAA 4J2YB 2FI3E 1DICA 1AB9B 3LGWA 2A1DB 3P8NA 2V3OH 5DP3A 1NU9A 2RA0A 3ENSB 1O35A 1ARBA 3RXQA 4Q7ZA 2W3IA 1SGRE 4AYYB 1C5VA 1P2NA 1EZXC 1G3CA 3BTTE 1XMNB 4ZH8A 2R0LA 3ZZ4A 6GCHF 2PWXA 1P09A 3RXSA 1CO7E 1BJUA 1YCPM 4BANB 1LQEA 2FOGA 2A7JA 3PMBB 1BMLA 2ZTXA 1ARCA 1MKXH 2FLRH 3ZYDA 1ANBA 1O37A 1JWTA 2BY8X 4U2WA 1HXEH 1PPFE 2LPRA 2HPQH 1YBWA 1TQ0B 1V6DA 1VJAU 2R2WU 1GHZA 4B71A 2G51A 3VB4A 1OYQA 1Q3XA 5LH8A 1A3EH 2TPIZ 3GDSA 1W7XH 4FVBA 3E91A 2ZU1A 4WY3A 3T62A 3NUMA 3ATMA 3UOPA 2BOHB 1E38B 3T29A 3NKKA 3SGQE 4MNYA 1O2UA 3VB5A 4FUHA 2BDBA 5AVDA 2XBYA 3RP2A 2TGDA 1NRRH 1J16A 5FXLA 4E7RG 1C2EA 1RTKA 5GPIB 1E37B 1GBBA 4VGCC 3AAVA 1SLUB 1TBQH 3V7TA 1ZRBA 2BLWA 1TBRH 4Y7BA 2ZIQH 2ZCLP 5DP8A 4I8KA 2BZ6H 1O5DH 4JCNA 5EG4A 3MNCA 1TB6H 2F9BH 3TK9A 1EP5A 1W13U 5C5NA 4Y79A 2JETB 1O5EH 3SU0A 5AHGH 1H9HE 1GDQA 1GHBF 1XX9A 3A7TA 3U69H 4ZHAA 5A0AE 1ELBA 1IQIA 2CN0H 2PKSB 4Q2KA 2PR3A 2VVCA 1C1NA 2OQUA 2OC7A 1TBZH 4R8TB 3GCHC 1Q31A 2ILNA 2R2MB 1FAKH 3LONA 1E0FD 1SPJA 2XCNA 4BAOB 5EPNA 2AIPA 2J9NA 1AB9C 1MCVA 2HVXA 1W0YH 1NRPH 1XVMA 2NWNA 4AFZA 5F8ZA 2ASUB 3KN2A 4X2WA 1V2RT 1CBWB 1W8BH 2LIZA 3A83A 3LGVA 2O8TA 3PMAB 1IQFA 1O3OA 5EXMA 5FBEA 3SJIA 4LK4A 1HAHH 1NY22 3CS0A 1HIAB 1C5UA 4WMDA 3QTVH 1L1GA 3QZRA 3ESTA 2AEIH 1UVUH 2RDLA 5DO4H 1VR1H 2CF8H 1FUJA 3FANA 2JH5D 3L33A 4MTBA 4CH8B 1KLJH 3NXPA 1DWEH 4ISHH 4CRDA 3GCTG 1TGBA 3U1JB 1TYNA 1HAZB 2XBWA 2Z7FE 3QZQA 3ATKA 1ZTJA 1A3BH 2DE8A 3CENA 2ZGBH 1LHEH 1VCQA 4DCDA 2BXTH 5JB8S 1H8IH 4X1RU 2G5NA 1CU1A 2GV7A 3N7OA 2FPZA 1V2MT 1DLKB 1QL7A 2R9PA 4ZKRU 2TGTA 3SU3A 2O8MA 2W26A 2PTNA 2BOKA 1UCYE 4BXSA 1KXEA 3A87A 2JETC 3A81A 1BUIA 2OQ5A 3A8CA 1FY8E 3VGCB 3RXLA 3B9FH 1CE5A 1DVAH 4KP0A 4E05H 1EAXA 1TX6A 3IWMA 1GMCF 5DJ7A 2UUKB 2FYQA 1GBDA 2ZHQH 2PKSC 3ELAH 1BTZA 4JZIA 5SGAE 2ZU2A 3ZZAA 2WYJA 5JYIA 2BDYA 3F9FA 3P6ZB 4JYVH 3QX5H 1THPB 2ZU5A 2DUCA 1MD7A 2HLCA 1GJDB 1P05A 1SLVB 1AZ8A 2FMJA 4I8HA 1OP8A 1ZTLA 4IN2A 1O2VA 4JZFH 1NO9H 4KGAA 1B0FA 1GI2A 2ZDVH 1DFPA 1EAWA 2BD2A 1ABIH 1BITA 1QY6A 4I8JA 2AERH 1K1PA 4DW2U 1K1MA 1CBWC 1IQJA 3A85A 4WXVA 4WXIA 1NRQH 2KAIB 2HNTE 2V6NA 3A86A 4CREA 3ZVCA 1FY3A 1P9UA 3PROA 2XBVA 1PJPA 4MVNA 3P8GA 3IITA 1WTGH 2VWLA 3SJ9A 1DY8A 4H42U 4KTSA 1J8AA 2PTCE 1GGDB 3OY6U 3E8LA 4Y76A 1DSTA 4FUCA 1UK2A 1SOTA 1FNIA 1AD8H 3A7YA 4CRFA 2ZECA 2BDAA 1QR3E 3GCNA 2BVXH 1JIMA 9ESTA 1DT2A 1L2EA 2RCEA 1T32A 3T5FH 2Z3DA 1VCWA 1O3LA 3DFLA 1DWBH 1QHRB 3H7TA 3E16B 1BMNH 1UVTH 4GCHF 2WINI 4UE7H 4CRAA 3QUMP 1SI5H 3F9GA 1K22H 2ZEBA 2OTVA 3BV9B 3TVJB 1FY4A 3FP7E 3GY5A 4Q7XA 1LQDB 2ZDAH 5E2OA 1O34A 4NSYA 3BTQE 3SJKA 4I7YH 5F8TA 1ZSKA 2B0FA 1Y5AT 3SUFA 2WPKS 2Z9LA 3RLWH 1OS8A 1ELGA 1FPCH 4BTTB 2AMPA 4XBBA 3VPKA 4K1EA 3VGCC 3SZNA 2H5DA 1Z1IA 4MLFB 2QCYA 4RKOB 5K0HA 5A2MH 2F9PA 1QQ4A 5BPEA 2A0QB 1KDQB 1K9OE 1V2ST 5J4SA 2XW9A 1ZSJA 1YLCA 2BY5X 1QA7A 4IC5A 4BOHA 1C5XB 3BTFE 4NWLA 2AS9A 5DP6A 1AN1E 1GMHF 2YNBA 3V12A 1C2GA 1YPEH 3K9XB 2Y5HA 3OTJE 2P93A 1EAIA 4KTUA 4DIIH 4O3TA 1ID5H 4NZLA 1YPHE 1AFEH 3SUEA 4NA9H 4X6OA 1BQYA 1O38A 1WBGB 4JZ1A 3BTEE 1EPTB 3RXBA 1AIXH 4HTCH 2F3CE 1GDUA 1C1QA 1ETRH 5LGOA 2RG3A 1ETTH 1ESTA 1C2MA 1OPHB 1O36A 4E7NA 1KXFA 2GCHF 3A82A 1CGJE 3RC5A 4YLUA 2FOCA 1GGDC 4FXGH 1LO6A 1RGQA 1BHXF 1K1IA 2ZU3A 2STAE 4JK6A 4AG1A 4JYTA 3MYWA 5K7RA 3SV8A 1Z8RA 2BMGB 3MHWU 1A1RA 4A1XA 1Y3WA 1DPOA 3RXJA 3LGUA 5GXPA 2GTBA 2A4GA 4U30A 1C2HA 2HNTF 1HUTH 5TCAA 1TRYA 3E0NB 3RXKA 1GVLA 1DUAA 1TMTH 1XUIA 3M5NA 3Q3XA 5JBAS 1SGTA 2ODQA 4YT7H 1GHWH 1KYNA 3SV6A 1DOJA 1DSUA 6GCHG 2C8XB 1F0RA 2ZHEH 1UTLM 4Y0ZE 2ZQ2A 1QIXB 1L1JA 3GY4A 5EW1H 3TJOA 4ZXYH 3EGKH 4R0IA 1P3EA 1AKSA 1CHOF 1P03A 3AVZA 1SGDE 1SL3A 2ANYA 2ZO3H 2RA3A 1O3EA 2FESH 2TGAA 2FX6A 1ZRKA 4TPIZ 1LVBA 5E0JA 5DP4A 2C8YB 3SQHE 1PQ8A 5T6GA 3PV4A 3S9AA 4F49A 1GJAB 1GHAF 4K69A 5EXNA 1Z8JB 1EJNA 2XRCA 1SVPA 1UHBB 2ZDMA 1O3FA 2PLXA 1TNJA 2ZC9H 3QLPH 1K28D 1LHGH 4AGKA 3RU4T 3PLKA 2XC0A 1QL9A 2UWOA 3HK3B 1FLEE 3ZVEA 4DGJA 4ISIH 2BHGA 4YOIA 3V13A 4Y0YE 2Q6DA 3F9EA 2IPHA 1HJ9A 3H7OA 3HGNA 3O8BA 4CRBA 3EDXB 1EPTC 1TA6A 1HAGE 2VIVA 1GHBG 1HFDA 4BNRA 2SGPE 1SGNE 3T27A 1LTOA 2A45B 2FDAA 1K1OA 1T8OA 2I6SA 3EYDA 2OC8A 1IQNA 4IGDA 1P9SA 3LH1A 1TNIA 2G4TA 3FP6E 3KCGH 3Q77A 4ASHA 1XUFA 3PB1E 3S7KB 4CHAB 4FUEA 5FPSA 3SNBA 4B73A 1HCGA 2A32A 1YPGH 4MDSA 4OS4A 4THNH 3KQEA 2AGIX 1V2TT 2ZZUH 3M5MA 4M7GA 5FPTA 3M35A 5DG6A 3K65B 3KGPA 1BTXA 1A0LA 1GI8B 4D9RA 1GJ5H 2P3FH 2A2XH 2VVUA 3F68H 1DXPA 3W94A 2QGRA 1HJ8A 1DS2E 1GMDF 1GBHA 1MUEB 2BQWB 1LKBA 2NU1E 3VXFH 1X7AC 1TE0A 2HGTH 2J92A 4YTAA 1TRMA 4CBNA 1XUHA 8LPRA 2W3KA 1ZR0A 1T7CA 2BLQA 2M5TA 3UIRA 1FN8A 1LVYA 3GISB 3KF2A 6LPRA 3RLYH 4IN1A 1HPGA 4K60A 1AU8A 1Z6EA 4NA8A 1T8NA 1OP2A 2Y81A 4TYDA 3MFJA 2PKAA 3U9AH 3PTBA 1NTPA 1C1OA 1YM0A 3RMMH 1MTVA 2ZTZA 1NN6A 3BTKE 2ZFSA 5DGJA 2ZFRH 2QC2A 1HLTH 1CT2E 1WCZA 4LZ4B 1V2VT 1KXBA 2FOAA 3TLOA 1C5YB 1LHCH 1FV9A 2ZGHA 1AVXA 1FN6A 3EA7A 4FUBA 4SGBE 4XDEA 1TGNA 4YOJA 1P11E 3ZZ6A 1LVOA 1ZHRA 5LPEA 3U98H 1AY6H 3QTOH 1ZHPA 2HOBA 1GMCG 2FO9A 1RTLA 1IQMA 2FS8A 4Z0KA 1TNGA 4MNWA 1NROH 1OX1A 1YYY1 2XC5A 1UVOA 4SGAE 1AUJA 4FUIA 1G36A 2ZFPH 1DANH 4ZHLU 5EQRA 1GVKB 2C90B 3OY5U 2UWPA 4A7IB 1H8DH 4CHAC 1ZPCA 4E06H 4CBOA 1N6YA 1D3TB 1YP9A 2H9HA 4DOQA 1TGCA 1KIGH 4FUDA 4B74A 1F0SA 3GCOA 3GYMA 1UCYH 2F91A 2QXHA 3ZVGA 1TNLA 4X8UH 4UD9H 2FZZA 5F03A 3UUZA 2GMTB 4RKJB 1ZMJA 4JYUH 1H1BA 4JK5A 1GBJA 1P3CA 1HAXB 2Y7ZA 3BIUH 5EODA 1O2PA 4FUGA 3SQEE 3E90B 1KLIH 1BTYA 1S6HA 4Y8ZA 1P2JA 2AMQA 1AI8H 2IJOB 7KMEH 3JZ1B 1AFQC 3Q00A 2W5EA 3I77A 1O31A 4U32A 3K6YA 2XCFA 1TA2A 2VU8E 5AFZH 3MU8A 2SGFE 4X2VA 4D7GA 3AW1A 1AO5A 2BQ6B 2XXLA 3P17H 5HGGA 2Y82A 1C1TA 1V2UT 2P3TB 2QA9E 1P04A 4BAKB 3HKIB 2PSYA 1G30B 1OOKB 2H9TH 4U01A 4DG4A 4NIXA 1GJCB 1JIRA 1DWCH 1GBCA 2ANWA 4NSVA 2TGPZ 2VVVA 1G2LA 2G00A 4FUFA 4Q7YA 2B5TB 3NCLA 2GKVE 3BTGE 2ALVA 4NFEA 4NIWA 5JDUB 1THSH 1CA0C 1V2WT 3BEIB 3TJUA 3F6UH 1QB1A 2ANMH 1UVSH 2UUFB 5CHAB 3UNSA 1XUGA 3PLPA 1O2RA 4XE4A 3P95A 1DM4B 1FY1A 4XOJA 3RXCA 3M7UA 3A7ZA 3TNTA 2Q1JA 2EI8A 2WPHS 1P2IA 2WUBA 2F9OA 3RXIA 2H9EH 2SNVA 1LDTT 1IHSH 2FOFA 4CRGA 1MU6B 3KQDA 3FZDA 3S7HB 1GMHG 1IQLA 1ANDA 1G3DA 4DVAU 2ZDLA 1P2OA 4NA7A 3ZVAA 2JKHA 1GI9B 3CS7A 3LC3A 3NWUA 2XBXA 3PLBA 4K8YA 4I8LA 2J34A 3TH3H 2BXUH 3Q76A 2GMTC 1ZTKA 1CT0E 1SB1H 2Y6TA 1SHHB 4OS2A 4BAQB 1T4VH 1GBTA 4A5TS 4D7FA 2GCHG 1G32B 1TFXA 1PQ5A 1UVPA 3TGJE 2UUJB 1KXCA 1PPCE 1RFNA 4GPGA 4A6LA 7GCHF 1UCYK 1L1NA 1YPJH 3QWCH 4GUXA 1RXPA 1ZZZA 3RXGA 3UQOA 1HV7A 2H1UA 1P2KA 1C5RA 3BTME 1ANEA 1V2OT 1C1MA 2JH6D 1C9PA 4YT6H 1MMJN 3BTWE 2OBOA 3TK6A 3R3GB 3VB6A 2GVFA 1QRWA 1J15A 4Y6DA 1C2FA 3RXPA 3UFAA 2CHAB 4BXWA 1O5BB 1J17T 3MO6A 1CHOG 4UDWH 8GCHF 5E2PA 4B2BA 1YGCH 1ZPZA 1B0EA 4UFEH 2V35A 1EX3A 3TH2H 5JBTA 4ABFA 2C8ZB 1HYLA 1IQEA 5CHAC 2G55A 2Z9IA 1EUFA 1ZPBA 1SQAA 1TGTA 2Y7XA 2Q6GA 4FU9A 3TNSA 1SGCA 2VIOA 5EQQA 4YO9A 3EE0B 1C9TA 1GHAG 3W95A 1VZQH 2EI7A 5C1XA 1O0DH 5JBBS 4B1TA 1O3HA 3D62A 1RTFB 1ZOMA 2OXSA 1A7SA 3K6ZA 3S9CA 2J95A 2HPPH 4FUJA 2DE9A 3ZZ7A 3MO3A 1YPMH 1O5GH 3V3MA 3M3TA 1Y3YA 1G37A 2R3UA 3MU4A 1XM1A 3SJOA 1AHTH 1JRSA 2OBQA 2GD4B 3FP8E 2AIQA 5A8XA 4TWWA 3GY6A 3SI3H 2ZDKA 1SG8B 4OS6A 1QJ1B 1MAYA 1G2MA 2B8OH 4YOGA 1GL1A 2ZFQH 1RS0A 3R0FA 1FMGA 4ABEA 1ELEE 3LPRA 3SBKA 4WMFA 4Y11E 2CV3A 1ZMLA 1E36B 1IQHA 1LPZB 1KXDA 2SNWA 3PMJA 3PYHA 3L3TA 3BN9A 4X8SH 2BVRH 3RM2H 4X1QU 3G01A 4IBLH 2BTCE 1D9IA 1VJ9U 1SGYE 1S81A 2HALA 1OSSA 5L6NH 3D49H 4K8BA 1YKTA 1O3KA 4ZKSU 2VWOA 3UREA 2B7DH 3MMGA 1HJAB 3PMHB 5FX5A 3MH4A 1HAPH 3I78A 2ZWLH 3AW0A 1MKWK 2CHAC 1O39A 1GMDG 3VFEA 2CJIA 3M37A 5EPYA 1NC6A 1GVZA 3KL6A 1EZSC 3S0NA 1FDPA 1P02A 1Y5BT 2ZGCA 1MU8B 1PPBH 1RIWB 1BBRK 1GI3A 2BVSH 1O3MA 2QV1A 4DURA 3LJJA 5DKMA 4IMQA 1OWJA 1HDTH 1YCPH 3PO1C 1SSXA 3TITA 1GCDA 1BT7A 2A7HA 1PPEE 1YF4A 3LU9B 5BRRE 1UO6A 4JMYA 1LKAA 4TWYA 5G4BA 2OINA 2FI5E 5DP7A 2ZHWH 3UY9A 5L2ZH 4CH2B 3KIDU 5GIBA 1BCUH 2SGDE 1ORFA 1XXDA 1O2XA 1GCTB 1MQ6A 4ZKOU 4LOYH 3U8OH 4INHA 3PM3A 3MH7A 1MCTA 3DFJA 3QGNB 2O8LA 3ATIA 3DUXH 3MNBA 1FPHH 4ABIA 1BBRE 1NT1A 4WH6A 1O2QA 1OYTH 1PQ7A 3F9HA 1ELDE 4I32A 1AE8H 3SV9A 3A8AA 3ODDA 3UPEA 1NU7B 4WJG2 2ZGJA 2NU3E 1C5WB 2FTLE 3SU5A 1WOFA 2G5VA 2AFQB 4YESB 1L0ZA 2P95A 4AORA 4CRCA 3SO3A 1C5PA 1K2I1 4ZHMU 4XBCA 2XC4A 1GI5A 1F5LA 1CHGA 3NPSA 2FS9A 1BRBE 1ANCA 8ESTE 1HJAC 5EXLA 2XNIA 3ZZCA 3RMNH 1J9CH 1A0HB 3QO6A 2A5IA 1AKSB 5A0CA 2K7XA 5HMAA 1KXAA 3SNCA 2P3UB 1C2JA 1U6QA 1ZHMA 2FOMB 4MNXA 4NCYA 1GHVH 3LKWA 2VIQA 2QAAA 5JPMH 3ZZ3A 1ESAA 3M36A 4HFPB 1O5CB 1TMBH 2ZKSA 3MU0A 1O5AB 1SGIB 1C1WH 2GT7A 1P0SH 3T28A 3L6PA 1RIWC 1TIOA 4X2XA 5FCKA 2GDEH 3STJA 1D3DB 4LZ1H 4A1TA 2WV5A 3EA8A 1N8OB 1ZLRA 4NFFA 3QN7A 4DJZB 2BD9A 1XUKA 1C2LA 3A7XA 1F5KU 1O2GH 1CA8B 2AYWA 1HAVA 1EZUC 1THRH 1KTTB 1HNEE 3GDVA 1KLTA 1UJ1A 2Z3CA 1O2HA 4JZEH 1O2YA 4TPYA 3EAJA 5JBCS 5DP9A 1AZZA 1V2JT 2D26C 1GCTC 1SQTA 2FODA 3TK5A 1TX8A 1YCPK 3FFGA 3ZZ5A 3LGYA 4WH8A 1YPKH 5TJXA 2GV6A 1AWHB 2BX3A 2BB4A 4Y8XA 1O2ZA 4B76A 2VNTA 2A4RA 3RC4A 3SGAE 1ELVA 2ZHFH 3K2UA 6CHAB 2TRMA 2ANKH 2SGAA 3A89A 1W14U 1YLDA 2ZPRA 3O8DA 1P06A 2GT8A 1VITF 1A5HA 4NWKA 1C5TA 1UTQA 2H6MA 3KEEA 1O3PB 2B9LA 3SUGA 3RXMA 2WPJS 5B6OA 4DY7B 2GZ7A 1A0JA 1E34B 3OU0A 3OYPA 3EBNA 1JBUH 1OP0A 2F9UA 1S82A 5LPRA 5H4IB 4AOQA 4IC6A 5A8YA 1TONA 5IDKA 3GOVB 1TOCB 2WPIS 5A0BA 2ZGXH 3SOSA 1Y3XA 3C27B 1XUJA 4X2YA 3RXTA 4I8GA 5ESTE 4GHQA 4X8VH 1LVMA 2G8TA 4IS5A 4UEHH 3B8JA 2ZFFH 4FVDA 7GCHG 1SFQB 3GYLB 3MU5A 3C1KA 4BAMB 5C20A 4LXBH 2Z6BD 1SBWA 2W7SA 4CR9A 2FOHA 2Y5GA 3SV7A 4AG2A 3SUDA 2PKAB 3ZVBA 1QGFA 1GWAA 1AFQB 3ZZBA 2QXGA 1EJAA 3RUOA 1BRUP 1CQQA 2H2ZA 1N8OC 1PYTD 2ZP0H 5EGMA 1BTUA 1LHFH 2LNCA 1BA8B 1FIWA 3HKJB 2OP9A 1B7XB 4ZXXH 2H5CA 3KHVA 4ZUHA 4QT8C 4X1PU 1QTFA 1UTPA 3SU2A 1KTSB 1W0ZU 1ELFA 3LGIA 3T26A 8GCHG 2QIQA 4YLQH 3M7QA 4TY6A 1V2KT 2Y80A 3LC5A 1GBFA 5A8ZA 3ZZ9A 4K3JA 4H6TA 3RMOH 4HZHA 1BHXB 1CA0B 1SOZA 3MH6A 4NZQA 3ZZDA 3MO9A 4ESTE 1BDAA 1TMUH 2J38A 1C1VH 1O3AA 3DA9B 5GDSH
chains in the Genus database with same CATH superfamily
1HAOH 1D6WA 5EW2H 1OXGA 3ATLA 4MPUA 6CHAC 1QFKH 1W2KH 3U1IB 5A09A 1NFXA 2VIWA 3FO8D 5L30H 2CMYA 4BTIB 3ZV9A 2GDDA 1TOMH 1G9IE 1O2NA 2CK3D 1FZZA 1F5RA 2C93B 3BEUA 1A61H 3GICB 1JXPA 1AGJA 4Y7AA 1A5IA 4AFSA 2FX4A 2PW8H 2P94A 1C5QA 4WMEA 5C67A 1QL8A 2BD8A 2WV9A 4HI3A 2ESTE 4YM9A 5C3NA 3HGPA 3B23B 4ISLA 4Z1MD 5I25A 4AB8A 5DK1A 1LMWB 2V0BA 1FAXA 1O3GA 2THFB 1TAWA 1NRNH 1O33A 4KELA 4BTUB 3HK6B 1CGIE 3BSQA 2QXIA 1GI4A 1RD3B 3GY8A 3A80A 1VGCB 2WPMS 1DX5M 1EAUA 1FI8A 2F4LA 2KCPA 4HG6A 3SU4A 2NU0E 1C5MD 2PHBA 4XFQA 1P8VC 3PWCA 5FPYA 2D2DA 1C1RA 3JZ2B 2FI4E 2P8OB 2ZCKP 3N7DA 1AVGH 2F9VA 1YY3A 5TCCA 1SGFA 5HIZA 2WUCA 1BOQA 1TPSA 3EQ0H 2A4OA 1C5NH 4GCHG 3M5LA 1HB0B 1Z8GA 3LIWA 1BRAA 1DUEA 4O03A 3S69A 2IOTA 3KQBA 3M3SA 4INKA 2FWWA 3I29A 4GLYA 4ABGA 1O2IA 4K2YA 2ZU4A 4OS1A 5LPFA 3WY8A 5GNDA 1C5OH 1ESBA 2VIDA 3MU1A 3ZVFA 1DLEA 1SGEE 3SV2H 1INCA 1DXWA 2EQNA 3OTPA 1MD8A 4I33A 5FBIA 1TPAE 1EZQA 1QB9A 2PP6A 1RRKA 1TNHA 5HKKD 5EJZA 1GPZA 2Z94A 1SQRA 3M5OA 1NRSH 1QJ6B 2G4UA 1EJMA 3GY7A 1A5GH 4OGYA 4NG9H 3T2NA 1ZGIA 1T8LA 2J5UA 1AMHA 2BDIA 2HNTC 3AAUA 4BAHB 1WUNH 2Y5FA 3OX7U 4H4FA 4INLA 2D8WA 3F1SB 3Q3YA 6ESTA 3UWJH 1T31A 1ZYOA 1EQ9A 1M9UA 1C5ZB 3DHKH 1UTJA 2Z9KA 2SGQE 1NS3A 2TIOA 3U28C 1A2CH 2J94A 3LGTA 2QXJA 1UTOA 1UMAH 1FQ3A 2UWLA 1IQGA 3SNEA 2JJ1D 1TX7A 3TIUA 3SI4H 1IHTH 2YNAA 1MZDA 5ESBA 1QURH 1HBTH 2ODYB 1S85A 2UUYA 4OS5A 2CXVA 3FZZA 2PGQB 1PYTC 2JH0D 7LPRA 2FXRA 4UFFH 1GI6A 1O30A 1MBMA 1ZGVA 1OWDA 2J2UA 1TLDA 4MPWA 3UWIA 5CE1A 2BD5A 3P92A 4B2AA 1VGCC 1NPMA 3A8DA 3BEFB 3UNQA 2C8WB 2ZFTA 1SGQE 1V2QT 2VBCA 3QDZB 1MKWH 1CVWH 1O32A 3RC6A 2ZPQA 1T4UH 2VIPA 4GHTA 5GDSH 4X6NA 4AZ2B 5HYOA 2HLDD 3PV2A 5GCHF 5CMXH 1UTKA 1VITH 2P8OC 1GJ7B 1N1LA 4B2CA 1C2IA 1TQ7B 3GDUA 1QB6A 2ZF0H 1GL0E 1NM6A 3URCA 1C4Y2 1O2TA 1UTNA 3RXUA 2KFWA 1FY5A 4MPXA 3RXOA 4AFQA 1GBEA 1WQSA 2QYIA 1BBRH 2OLGA 2C4FH 1SC8U 4O3UA 1QNJA 1GJ9B 1OWHA 4I31A 1YPLH 1GHXH 2FP7B 1HIAA 3LT3A 1KSNA 2NU2E 1H8ED 3UOUA 3UQVA 3MWIU 1Z6JH 2VGCB 3LH3A 3TGIE 3BG8A 1HRTH 1MAXA 5AF9H 3MI4A 4ABBA 1G3BA 1ABJH 1GBIA 1MKXK 2O8WA 3HATH 2G52A 4NIYA 1ELAA 4OS7A 2C3SA 1LPGB 4X8TH 3RU4D 1F92A 3ZVDA 1BMAA 1QJ7B 1GBKA 2F83A 3VXEH 1O3CA 1NESE 1N6XA 1YPHC 3PO1B 5F53A 1DY9A 5I46H 1GHYH 1SGFG 5FL7D 1XKAC 1A46H 2OCVB 4D8NA 1C1SA 1HGTH 1ELCA 3URDA 1AVWA 3A84A 1V2NT 1L4ZA 4YZUA 1EXFA 4PROA 2XWBI 5PTPA 3SU1A 1L4DA 2CF9H 3RDZA 3UNRA 2A5AA 2ODPA 2BX4A 1ZJDA 3BTDE 4RSPA 2QF5A 2J97A 4TSFD 2BLOA 3TU7H 2PFEA 3U8TH 3VB3A 3WWFA 2A4QA 1MTNB 1SFIA 1O2LA 1P10A 2FEQH 2IN2A 1OWIA 1TABE 1LHDH 3P70B 1GBMA 3BTHE 4NGAH 2GJGA 1VITG 2W7UA 3PRDA 1NZQH 3UR9A 1IQKA 3O8CA 3RXHA 5IYTA 1F0UA 1S5SA 1F0TA 5T3HA 1Y3VA 3PWBA 1J14A 1QZ8A 3BG4B 3IG6B 3O8RA 1XXFA 1SMFE 4XD7D 5C94A 2KAIA 1Z8IB 3BF6H 3ZYEA 3SNDA 2FLBH 1DITH 1C2DA 1WAYB 1BB0B 4Y10E 4ABHA 1W12U 2GCTB 1D6RA 1S84A 4OGXA 1FIZA 3TJNA 1C5SA 1BJVA 2R3YA 4ISOA 4DIHH 3RXEA 2VGCC 1IOEA 1WU1A 2FOBA 1QA0A 1O2JA 1TNKA 2BD4A 1O3JA 5C1UA 3TGKE 3ZV8A 4F4OC 1SHYA 4DT7B 1A4WH 3MTYA 5J4QA 2GZ9A 1O2WA 1QBNA 2FIRH 4AX9H 2BY9X 2AGGX 2OC0A 3PTNA 5HM9A 1EB2A 2P16A 1BTPA 1CGHA 2Z3EA 4UONA 1S0QA 4JZDH 4Q63A 4MG3A 2D1JA 3D23A 5DSFA 1H4WA 1MTSA 1NBME 1BIOA 1SR5C 4AYVB 2OD3B 3P8OA 4HGCA 1ELTA 2BYAX 5F6MA 1O2MA 3MNXA 2I6QA 4X1NU 1ZJKA 5C2ZA 1C1UH 2O9QA 2YOLA 5C0TA 3EA9A 1BTHH 3HPTB 5EU8A 2EEKA 2WYGA 2FM2A 2VJ1A 4RT1A 2TBSA 3DT0H 1FXYA 1MTNC 1QCPA 1P2MA 3SGBE 1KDQA 2VH6A 4XBDA 2BD7A 1HAIH 4O9VA 5T1VA 1B5GH 3M7TA 5E0HA 1UK4A 1D3QB 3RXFA 5DN6D 1WTHD 4FU8A 2AGEX 1GG6B 1XKBC 3KQCA 4XSKU 1EP6A 1NFWA 1H9LB 3ITIA 2CGAA 1IAUA 1C5LH 1GJ8B 5E8EH 1PPHE 1VCPA 1C4V2 3KNXA 3BG4C 1ZMNA 1DDJA 1WSSH 1P57B 4ABAA 3LDXH 3SORA 2VWNA 2BM2A 2A31A 1PPZA 2BQ7B 1D3PB 1Y3UA 1OWEA 1EASA 1JRTA 1OHHD 1V2PT 1W11U 2PGBB 4Z6AH 1EPTA 1WQVH 3EE7A 2AH4X 2KR7A 5EOKA 5T6FA 1O3DA 2M2AA 1LPKB 3TPIZ 2BD3A 3UR6A 2EA3A 1G3EA 2G81E 3OSYA 5ETXA 1P01A 3VEQB 2GCTC 4ACBA 1QBOA 5C5OA 1Z7KA 4AGJA 3A8BA 3SU6A 1P2QA 2K1QA 4TY7A 4K1TA 4RN6A 1Q2WA 4D9QA 2FYRA 1WYKA 4O97A 4F55A 1NFYA 3RXDA 3NK8A 2J98B 3GCTF 1O2OA 4A1VA 2QY0B 5HXFA 1O2KA 3SHAH 1O2SA 1OKXA 3ZZ8A 1GDNA 1GJ6A 2VH0A 3U8RH 1K1LA 5GWZA 1S0RA 1V3XA 1FONA 3OEED 1SKYE 3E1XB 2VB0A 2KCYA 1MTUA 3H5CB 3H09A 3ATWA 2FTMA 1HAVB 1Z71A 1UK3A 1P12E 3P8FA 2R0KA 2A7CA 3SHCH 4Q80A 1GBLA 1MQ5A 1Y8TA 1V2LT 1NFUA 3SJ8A 2ZHDA 3DD2H 1QRXA 1CSOE 2PV9B 5EQSA 2VINA 3ODFA 1HAYB 3LOXA 2XYAA 3E3TA 1SLXB 3GY3A 4GSOA 4ZROA 2ZQ1A 4UFDH 3QGJA 1BTWA 2NU4E 5DPAA 3RMLH 3S9BA 3MNSA 2XWAA 3SN8A 4K5ZA 2GX4A 1T8MA 1Y5UT 1JMOH 2ZDNA 3A88A 2BDGA 3DSPA 3RXAA 1SLWB 1K1JA 1E35B 3A7WA 1LCYA 5L2YH 5F8XA 1O5FH 4MPVA 3BIVH 2BLVA 2Z9GA 1C4U2 5KEDA 1UHBA 4Y71A 4MNVA 2ZTYA 4ISNA 1TALA 1F2SE 3ZIAD 1EATA 2J4IA 1GG6C 2P59A 2BY7X 1EB1H 1C2KA 2ZNKH 2ZI2H 2GGVB 4X6PA 1MZAA 2Q6FA 5ABWA 1MBQA 2BDHA 3VB7A 3T25A 1Z1JA 1DWDH 1O3NA 3E6PH 3UTUH 3V0XA 2F9NA 4Y8YA 2QE7D 1TRNA 5JB9S 4AB9A 1S83A 7ESTE 3Q3KA 3M61U 3FVFB 4J1YA 4AFUA 2SGEE 1EKBB 5E0GA 1QRZA 1HXFH 3MOCA 2Z9JA 4WWYA 2STBE 2ALPA 4WVPE 1BZXE 1OWKA 3MH5A 1BMMH 2V3HH 4X1SU 1W10U 2VWMA 1AE5A 1PFXC 1S6FA 4MQAA 5FAHA 1DE7H 2PUXB 4K1SA 3MQKC 2ZG0H 2BZAA 4GVUA 5GCHG 5HM2A 1RJXB 1AUTC 4KTCA 1TWXB 1TPOA 5GJ4B 4CR5A 9LPRA 1ETSH 1ZSLA 2O8UA 5DP5A 2HWLB 3A7VA 1GI1A 1H9IE 4WF8A 1W7GH 4B6FA 2QF4A 1JOUB 1BRCE 3TH4H 2WV4A 1D4PB 2GZ8A 1GBAA 4ABJA 1QBVH 8KME2 1TGSZ 2BY6X 1CT4E 5EJLA 5AFYH 3STIA 4D76A 2AMDA 3TJVA 3OFND 2ZPSA 1FJSA 3D65E 1UTMA 2ZA5A 1SQOA 3AASA 1KY9A 1AQ7A 3RU4E 5FX6A 1PPGE 5C0UA 4AN7A 1ACBE 2EY4C 4GAWA 3NRLA 1MH0A 4ZKNU 3KYGA 2QN5T 1K0HA 3GY2A 2QF3A 2L6OA 3M3VA 1MTWA 5T6DA 2A5KA 2WPLS 1GI0A 4X6MA 1Y59T 2SFAA 4VGCB 1C1PA 1PQAA 3RXVA 3FAOA 4ZCNA 2XTTB 1F7ZA 1EOLA 3SNAA 1GJ4H 2A2QH 1K21H 3LJOA 1K1NA 4FU7A 5C1YA 1XVOA 3E0PB 1SGPE 1TPPA 2EC9H 1WV7H 2HRVA 4NIVA 2KCOA 2PSXA 2OC1A 3RM0H 2KCAA 2EI6A 2GP9B 2ULLA 4ZMAH 1EOJA 2PUQH 1O3IA 2ZCHP 2BDCA 3OEHD 4H6SB 4ABDA 1WDIA 4ZAEA 1YC0A 4IW4E 4A92A 2QF0A 1AWFH 3SW2B 4B75A 3NZIA 1GJBB 1W3CA 2FOEA 1QQUA 4UFGH 4X0WU 4KKDA 4IMZA 5FHTA 3GCHB 1O3BA 3CP7A 5FCRA 3QK1A 1GI7B 3RXRA 2OUAA 4J2YB 2FI3E 1DICA 1AB9B 3LGWA 2A1DB 3P8NA 2V3OH 5DP3A 1NU9A 2RA0A 3ENSB 1O35A 1ARBA 3RXQA 4Q7ZA 2W3IA 1SGRE 4AYYB 1C5VA 1P2NA 1EZXC 1G3CA 3BTTE 1XMNB 4ZH8A 2R0LA 3ZZ4A 6GCHF 2PWXA 1P09A 3RXSA 1CO7E 1BJUA 1YCPM 4BANB 1LQEA 2FOGA 2A7JA 3PMBB 1BMLA 3VG8A 2ZTXA 1ARCA 1MKXH 2FLRH 3ZYDA 1ANBA 1O37A 1JWTA 2BY8X 4U2WA 1HXEH 1PPFE 2LPRA 2HPQH 1YBWA 1TQ0B 1V6DA 1VJAU 2R2WU 1GHZA 4B71A 2G51A 3VB4A 1OYQA 1Q3XA 5LH8A 1A3EH 2TPIZ 3GDSA 1W7XH 4FVBA 3E91A 2ZU1A 4WY3A 3T62A 3NUMA 3ATMA 3UOPA 2BOHB 1E38B 2YMSD 3T29A 3NKKA 3SGQE 4MNYA 1O2UA 3VB5A 4FUHA 2BDBA 5AVDA 2LELA 2XBYA 3RP2A 2TGDA 1NRRH 1J16A 2K0QA 5FXLA 4E7RG 1C2EA 1RTKA 5GPIB 1E37B 1GBBA 4VGCC 3AAVA 1SLUB 1TBQH 3V7TA 1ZRBA 2BLWA 1TBRH 4Y7BA 2ZIQH 2ZCLP 5DP8A 4I8KA 2BZ6H 1O5DH 4JCNA 1UW7A 5EG4A 3MNCA 1TB6H 2F9BH 3TK9A 1EP5A 1W13U 5C5NA 4Y79A 2JETB 1O5EH 3SU0A 5AHGH 3FN8A 1H9HE 1GDQA 1GHBF 1XX9A 3A7TA 3U69H 4ZHAA 5A0AE 1ELBA 1IQIA 2CN0H 2PKSB 4Q2KA 2PR3A 2VVCA 1C1NA 2OQUA 2OC7A 1TBZH 4R8TB 3GCHC 1Q31A 2ILNA 2R2MB 1FAKH 3LONA 2V7QD 1E0FD 1SPJA 2XCNA 4BAOB 5EPNA 2AIPA 2J9NA 1AB9C 1MCVA 2HVXA 1W0YH 1NRPH 1XVMA 2NWNA 4AFZA 5F8ZA 2ASUB 3KN2A 2WHXA 4X2WA 1V2RT 1CBWB 1W8BH 2LIZA 3A83A 3LGVA 2O8TA 3PMAB 1IQFA 1O3OA 5EXMA 5FBEA 3SJIA 4LK4A 1HAHH 2YMSB 1NY22 3CS0A 1HIAB 1C5UA 4WMDA 3QTVH 4B6EA 1L1GA 3QZRA 3ESTA 2AEIH 1UVUH 2RDLA 5DO4H 1VR1H 2CF8H 1FUJA 3FANA 2JH5D 3L33A 4MTBA 4CH8B 1KLJH 3F2GA 3NXPA 1DWEH 4ISHH 4CRDA 3GCTG 5B6LA 1TGBA 3U1JB 1TYNA 1HAZB 2XBWA 2Z7FE 3QZQA 3ATKA 1ZTJA 1A3BH 2DE8A 3CENA 2ZGBH 1LHEH 1VCQA 4DCDA 2BXTH 5JB8S 1H8IH 4X1RU 2G5NA 1CU1A 2GV7A 3N7OA 2FPZA 1V2MT 1DLKB 1QL7A 2R9PA 4ZKRU 2TGTA 3SU3A 2O8MA 2W26A 4ASUD 2PTNA 2BOKA 1UCYE 4BXSA 1KXEA 3A87A 2JETC 3A81A 1YLNA 1BUIA 2OQ5A 3A8CA 1FY8E 3VGCB 3RXLA 3B9FH 1COWD 1CE5A 1DVAH 4KP0A 4E05H 1EAXA 1TX6A 3IWMA 1GMCF 5DJ7A 2UUKB 2FYQA 1GBDA 2ZHQH 2PKSC 3ELAH 1BTZA 4JZIA 5SGAE 2ZU2A 3ZZAA 2WYJA 5JYIA 2BDYA 3F9FA 3P6ZB 4JYVH 3QX5H 1THPB 4AC9A 2ZU5A 2DUCA 1MD7A 2HLCA 1GJDB 1P05A 1SLVB 1AZ8A 2FMJA 4I8HA 1OP8A 1ZTLA 4IN2A 1O2VA 4JZFH 1NO9H 4KGAA 1B0FA 1GI2A 2ZDVH 1DFPA 1EAWA 2BD2A 1ABIH 1BITA 1QY6A 4I8JA 2AERH 5EJ1A 1K1PA 4DW2U 1K1MA 1CBWC 1IQJA 3A85A 4WXVA 4WXIA 1NRQH 2KAIB 2HNTE 2V6NA 2W6JD 3A86A 4CREA 3ZVCA 1FY3A 5CDFE 1P9UA 3PROA 2XBVA 1PJPA 4MVNA 3P8GA 2YMSC 3IITA 1WTGH 2VWLA 3SJ9A 1DY8A 4H42U 4KTSA 1J8AA 2PTCE 1GGDB 3OY6U 3E8LA 4Y76A 1DSTA 4FUCA 1UK2A 1SOTA 1FNIA 1AD8H 3A7YA 4CRFA 2ZECA 2BDAA 3WWBA 1QR3E 3GCNA 2BVXH 1JIMA 9ESTA 1DT2A 1L2EA 2RCEA 1T32A 3T5FH 2Z3DA 1VCWA 3FKSD 1O3LA 3DFLA 1DWBH 1QHRB 3H7TA 3E16B 1BMNH 1UVTH 4GCHF 2WINI 4UE7H 4CRAA 3QUMP 1SI5H 3F9GA 1K22H 2ZEBA 2OTVA 3BV9B 3TVJB 1FY4A 3FP7E 3GY5A 4Q7XA 1LQDB 2ZDAH 5E2OA 1O34A 4NSYA 3BTQE 3SJKA 4I7YH 5F8TA 1ZSKA 2B0FA 1Y5AT 3SUFA 2WPKS 2Z9LA 5KGOA 3RLWH 1OS8A 1ELGA 1FPCH 1W0KD 2AMPA 4BTTB 4XBBA 3VPKA 4K1EA 3VGCC 3SZNA 2H5DA 1Z1IA 4MLFB 2QCYA 4RKOB 5K0HA 5A2MH 2F9PA 1QQ4A 5BPEA 2W6ID 2A0QB 1KDQB 1K9OE 1V2ST 5J4SA 2XW9A 1ZSJA 1YLCA 2BY5X 1QA7A 4IC5A 4BOHA 1E1RD 1C5XB 3BTFE 2RFKC 4NWLA 2AS9A 5DP6A 1AN1E 1GMHF 2YNBA 3V12A 1C2GA 1YPEH 3K9XB 2Y5HA 3OTJE 2P93A 1EAIA 4KTUA 4DIIH 4O3TA 1ID5H 3KQ5A 4NZLA 1YPHE 1AFEH 3SUEA 4NA9H 4X6OA 1BQYA 1O38A 1WBGB 4JZ1A 3BTEE 1EPTB 3RXBA 1AIXH 4HTCH 2F3CE 1GDUA 3SYJA 1C1QA 1ETRH 5LGOA 2RG3A 1ETTH 2WPDD 1ESTA 1C2MA 1OPHB 1O36A 4E7NA 1KXFA 2GCHF 3A82A 1CGJE 3RC5A 4YLUA 2FOCA 1GGDC 4FXGH 1LO6A 1RGQA 1BHXF 1K1IA 2ZU3A 2STAE 4JK6A 4AG1A 4JYTA 3MYWA 5K7RA 3SV8A 1Z8RA 2BMGB 3MHWU 1A1RA 4A1XA 1Y3WA 1DPOA 3RXJA 3LGUA 4P00A 5GXPA 2GTBA 2A4GA 4U30A 1C2HA 2HNTF 1HUTH 3PV5A 1TRYA 5TCAA 3E0NB 3RXKA 1GVLA 1DUAA 1TMTH 1XUIA 3M5NA 3Q3XA 1EFRD 5JBAS 1SGTA 2ODQA 4YT7H 1GHWH 1KYNA 3SV6A 3F2FA 1DOJA 1DSUA 6GCHG 2C8XB 1F0RA 2KZ4A 2ZHEH 1UTLM 4Y0ZE 2ZQ2A 1QIXB 1L1JA 3GY4A 5EW1H 3TJOA 4ZXYH 3EGKH 4R0IA 1P3EA 1AKSA 1CHOF 1P03A 3AVZA 1SGDE 1SL3A 2ANYA 2ZO3H 2RA3A 1O3EA 2FESH 2TGAA 2FX6A 1ZRKA 4TPIZ 1LVBA 5E0JA 5DP4A 2C8YB 1E1QD 3SQHE 1PQ8A 5T6GA 3PV4A 3S9AA 4F49A 2JJ2D 2K8IA 1GJAB 1GHAF 4K69A 5EXNA 1Z8JB 2V3MA 1EJNA 2XRCA 1SVPA 1UHBB 2ZDMA 1O3FA 2PLXA 1TNJA 2ZC9H 3QLPH 1K28D 3F0PA 1LHGH 4AGKA 3RU4T 3PLKA 2XC0A 1QL9A 2UWOA 3HK3B 1FLEE 3ZVEA 4DGJA 4ISIH 2BHGA 4YOIA 3V13A 4Y0YE 2Q6DA 3F9EA 2IPHA 1HJ9A 3H7OA 3HGNA 3O8BA 4CRBA 3EDXB 1EPTC 1TA6A 1HAGE 2VIVA 1GHBG 3F3BA 1HFDA 4BNRA 2SGPE 1SGNE 2XNDD 3T27A 1LTOA 2A45B 2FDAA 1K1OA 1T8OA 2I6SA 3EYDA 2OC8A 1IQNA 4IGDA 1P9SA 5KECA 3LH1A 1TNIA 2G4TA 3FP6E 3KCGH 3Q77A 4ASHA 3KYFA 1XUFA 3PB1E 3W1EA 3S7KB 4CHAB 4FUEA 5FPSA 3SNBA 4B73A 1HCGA 2A32A 1YPGH 4MDSA 4OS4A 4THNH 3KQEA 2AGIX 1V2TT 2ZZUH 3M5MA 4M7GA 4P02A 5FPTA 3M35A 5DG6A 3K65B 3KGPA 1BTXA 1A0LA 1GI8B 4D9RA 1GJ5H 3N99A 2P3FH 2A2XH 2VVUA 3F68H 1DXPA 5HIYA 3W94A 2QGRA 1HJ8A 1DS2E 1GMDF 1GBHA 3OE7D 1MUEB 2BQWB 1LKBA 2NU1E 3VXFH 1X7AC 1TE0A 2HGTH 2J92A 4YTAA 4Q4LA 1TRMA 4CBNA 1XUHA 8LPRA 2W3KA 1ZR0A 1T7CA 2BLQA 2M5TA 3UIRA 1FN8A 1LVYA 3GISB 3KF2A 6LPRA 3RLYH 4IN1A 1HPGA 4K60A 1AU8A 1Z6EA 4NA8A 1T8NA 1OP2A 2Y81A 4TYDA 3MFJA 2PKAA 3U9AH 3PTBA 1NTPA 1C1OA 1YM0A 3RMMH 1MTVA 2ZTZA 1NN6A 3BTKE 2ZFSA 5DGJA 2ZFRH 2QC2A 1HLTH 1CT2E 1WCZA 4LZ4B 1V2VT 1KXBA 2FOAA 3TLOA 1C5YB 1LHCH 1FV9A 2ZGHA 1AVXA 1FN6A 3EA7A 4FUBA 4SGBE 4XDEA 1TGNA 4YOJA 1P11E 3ZZ6A 1LVOA 1ZHRA 5LPEA 3U98H 2JIZD 1AY6H 3QTOH 1ZHPA 1WXRA 2HOBA 1GMCG 2FO9A 1RTLA 1IQMA 2FS8A 4Z0KA 3AK5A 1TNGA 4MNWA 1NROH 1OX1A 1YYY1 2XC5A 1UVOA 4SGAE 1AUJA 4FUIA 1G36A 2ZFPH 1DANH 4ZHLU 5EQRA 1GVKB 2C90B 3OY5U 2UWPA 4A7IB 1H8DH 4CHAC 1ZPCA 4E06H 4CBOA 1N6YA 1D3TB 1YP9A 2H9HA 4DOQA 1TGCA 1KIGH 4FUDA 4B74A 1F0SA 3GCOA 3GYMA 1UCYH 2F91A 2QXHA 3ZVGA 1TNLA 4X8UH 4UD9H 2FZZA 5F03A 3UUZA 2GMTB 4RKJB 1ZMJA 4JYUH 1H1BA 4JK5A 1GBJA 1P3CA 1HAXB 2Y7ZA 3BIUH 5EODA 1O2PA 4FUGA 3SQEE 3E90B 2KX4A 1KLIH 1BTYA 1S6HA 4Y8ZA 1P2JA 2AMQA 1AI8H 2IJOB 7KMEH 3JZ1B 1AFQC 3FOAA 3Q00A 2W5EA 3I77A 4RI0A 3WW7A 1O31A 4U32A 3K6YA 2XCFA 3F0OA 1TA2A 2VU8E 5AFZH 3MU8A 2SGFE 4X2VA 4D7GA 3AW1A 1AO5A 2BQ6B 2XXLA 3P17H 5HGGA 2Y82A 1C1TA 1V2UT 2P3TB 2QA9E 1P04A 4BAKB 3HKIB 2PSYA 1G30B 1OOKB 2H9TH 4U01A 4DG4A 4NIXA 1GJCB 1JIRA 1DWCH 1GBCA 1H8HD 2ANWA 4NSVA 2TGPZ 2VVVA 1G2LA 2G00A 4FUFA 4Q7YA 2B5TB 3NCLA 2GKVE 3BTGE 2ALVA 4NFEA 4NIWA 5JDUB 1THSH 1CA0C 1V2WT 3BEIB 3TJUA 3F6UH 1QB1A 2ANMH 1UVSH 2UUFB 5CHAB 3UNSA 1XUGA 3PLPA 1O2RA 4XE4A 3P95A 1DM4B 1FY1A 4XOJA 3RXCA 3M7UA 4DT4A 3A7ZA 3TNTA 2Q1JA 2EI8A 2WPHS 1P2IA 2WUBA 2F9OA 3RXIA 2H9EH 2SNVA 1LDTT 1IHSH 4TT3D 2FOFA 4CRGA 1KMHB 1MU6B 3KQDA 3FZDA 3S7HB 1GMHG 1IQLA 1ANDA 1G3DA 4DVAU 2ZDLA 1P2OA 4NA7A 3ZVAA 2JKHA 1GI9B 3CS7A 3LC3A 3NWUA 2XBXA 3PLBA 4K8YA 4I8LA 2J34A 3TH3H 2BXUH 3Q76A 2LP6A 2GMTC 1ZTKA 1CT0E 1SB1H 2Y6TA 1SHHB 4OS2A 4BAQB 1T4VH 1GBTA 4A5TS 4D7FA 2GCHG 1G32B 1TFXA 1PQ5A 1UVPA 3TGJE 2UUJB 2JDID 2WZQA 1KXCA 1PPCE 1RFNA 4GPGA 4A6LA 7GCHF 1UCYK 1L1NA 1YPJH 3QWCH 4GUXA 1RXPA 1ZZZA 3RXGA 3UQOA 1HV7A 2H1UA 1P2KA 1C5RA 3BTME 1ANEA 1BMFD 1V2OT 1C1MA 2JH6D 1C9PA 4YT6H 1MMJN 3BTWE 2OBOA 3TK6A 3R3GB 3VB6A 2GVFA 2RDEA 1QRWA 3DCLA 1J15A 4Y6DA 1C2FA 3RXPA 3UFAA 2CHAB 4BXWA 1O5BB 3CNRA 4FOUC 1J17T 3MO6A 1CHOG 4UDWH 8GCHF 5E2PA 4B2BA 1YGCH 1ZPZA 1B0EA 4UFEH 2V35A 1EX3A 3TH2H 5JBTA 4ABFA 2C8ZB 1HYLA 1IQEA 2HVYB 2KM0A 5CHAC 2G55A 2Z9IA 1EUFA 1ZPBA 1SQAA 1TGTA 2Y7XA 2Q6GA 3UB0A 4FU9A 3TNSA 1SGCA 2VIOA 5EQQA 4YO9A 3EE0B 1C9TA 5EIYA 1GHAG 3W95A 1VZQH 2EI7A 5C1XA 1O0DH 5JBBS 4B1TA 1O3HA 3D62A 1RTFB 1ZOMA 2OXSA 1A7SA 3K6ZA 3S9CA 2J95A 2HPPH 4FUJA 2DE9A 3ZZ7A 3MO3A 1YPMH 1O5GH 3V3MA 3M3TA 1Y3YA 1G37A 2R3UA 3MU4A 1XM1A 3SJOA 1AHTH 1JRSA 2OBQA 2GD4B 3FP8E 2AIQA 5A8XA 4TWWA 3GY6A 3SI3H 2ZDKA 1SG8B 4OS6A 1QJ1B 1MAYA 1G2MA 2B8OH 4YOGA 1GL1A 2ZFQH 1RS0A 3R0FA 1FMGA 4ABEA 1ELEE 3LPRA 3SBKA 4WMFA 4Y11E 2CV3A 1ZMLA 1E36B 1IQHA 1LPZB 1KXDA 2SNWA 3PMJA 3PYHA 3L3TA 5IK2D 3BN9A 4I86A 4X8SH 2BVRH 3RM2H 4X1QU 3G01A 4IBLH 2BTCE 1D9IA 1FX0B 1VJ9U 1SGYE 1S81A 2HALA 1OSSA 5L6NH 3D49H 4K8BA 1YKTA 1O3KA 4ZKSU 2VWOA 3UREA 2B7DH 3MMGA 1HJAB 3PMHB 5FX5A 3MH4A 1HAPH 3I78A 2ZWLH 3AW0A 1MKWK 2CHAC 1O39A 1GMDG 3VFEA 2CJIA 3M37A 5EPYA 1NC6A 1GVZA 3KL6A 1EZSC 3S0NA 1FDPA 1P02A 1Y5BT 2ZGCA 1MU8B 1PPBH 1RIWB 1BBRK 1GI3A 2BVSH 1O3MA 2QV1A 4DURA 3LJJA 5DKMA 4IMQA 1OWJA 4XRNA 1HDTH 1YCPH 3PO1C 1SSXA 3TITA 1GCDA 1BT7A 2A7HA 1PPEE 1YF4A 3LU9B 5BRRE 1UO6A 4JMYA 3F2HA 4RT0A 1LKAA 4TWYA 5C17A 5G4BA 2OINA 1S6LA 2FI5E 5DP7A 2ZHWH 3UY9A 5L2ZH 4CH2B 3KIDU 5GIBA 1BCUH 2SGDE 1ORFA 1XXDA 1O2XA 1GCTB 1MQ6A 4ZKOU 4LOYH 3U8OH 1VKYA 4INHA 3PM3A 3MH7A 1MCTA 3DFJA 3QGNB 2O8LA 3ATIA 3DUXH 1MABB 1FPHH 3MNBA 4ABIA 4M9FA 1BBRE 1NT1A 4WH6A 1O2QA 1OYTH 1PQ7A 3F9HA 1ELDE 4I32A 1AE8H 3SV9A 3A8AA 3ODDA 3UAIC 3UPEA 1NU7B 4WJG2 2ZGJA 2NU3E 1C5WB 2FTLE 3SU5A 1WOFA 2G5VA 2AFQB 4YESB 1L0ZA 2P95A 4AORA 4CRCA 3SO3A 1C5PA 1K2I1 4ZHMU 4XBCA 2XC4A 1GI5A 1F5LA 1CHGA 3NPSA 2FS9A 1BRBE 1ANCA 8ESTE 1HJAC 2WSSD 3N7EA 5EXLA 2XNIA 3ZZCA 4YXWD 3RMNH 1J9CH 1A0HB 3QO6A 2A5IA 1AKSB 5A0CA 2K7XA 5HMAA 1KXAA 3SNCA 2P3UB 1C2JA 1U6QA 1ZHMA 2FOMB 4MNXA 4NCYA 1GHVH 3LKWA 2VIQA 2QAAA 5JPMH 3ZZ3A 1ESAA 3M36A 4HFPB 1O5CB 1TMBH 2ZKSA 3MU0A 1O5AB 1SGIB 1C1WH 2GT7A 1P0SH 3T28A 3L6PA 1RIWC 1TIOA 4X2XA 5FCKA 2GDEH 2J98A 3STJA 1D3DB 4LZ1H 4A1TA 2WV5A 3EA8A 1N8OB 1ZLRA 4NFFA 3QN7A 4DJZB 2BD9A 1XUKA 1C2LA 3A7XA 1F5KU 1O2GH 1CA8B 4FETA 2AYWA 1HAVA 1EZUC 1THRH 3OAAD 1KTTB 5CHBA 1HNEE 4ACAA 3GDVA 1KLTA 1UJ1A 2Z3CA 1O2HA 4JZEH 1O2YA 4TPYA 3EAJA 5JBCS 5DP9A 2F43B 1AZZA 1V2JT 2D26C 1GCTC 1SQTA 2FODA 3TK5A 1TX8A 1YCPK 3FFGA 3ZZ5A 3LGYA 4WH8A 1YPKH 5TJXA 2GV6A 1AWHB 2BX3A 2BB4A 4Y8XA 1O2ZA 4B76A 2L74A 2VNTA 2A4RA 3RC4A 3SGAE 1ELVA 2ZHFH 4OM9A 3K2UA 6CHAB 2TRMA 2ANKH 2SGAA 3A89A 1W14U 1YLDA 2ZPRA 3DSGA 3O8DA 1P06A 2GT8A 1VITF 1A5HA 4NWKA 1C5TA 1UTQA 2H6MA 2XOKD 3KEEA 1O3PB 2IPQX 1W0JD 2B9LA 3SUGA 3RXMA 2WPJS 5B6OA 4DY7B 2GZ7A 1A0JA 1E34B 3OU0A 3OYPA 3EBNA 1JBUH 1OP0A 2F9UA 3SZEA 1S82A 5LPRA 5H4IB 4AOQA 4IC6A 5A8YA 1TONA 5IDKA 3GOVB 1TOCB 2WPIS 5A0BA 2ZGXH 3SOSA 1Y3XA 3C27B 1XUJA 4X2YA 3RXTA 1E79D 4I8GA 5ESTE 4GHQA 4X8VH 1LVMA 2G8TA 4IS5A 4F48B 4UEHH 3B8JA 2ZFFH 4FVDA 7GCHG 2OK5A 1SFQB 3GYLB 3MU5A 3C1KA 4BAMB 5C20A 4LXBH 2Z6BD 1SBWA 3DSOA 2W7SA 4CR9A 2FOHA 2Y5GA 3SV7A 4AG2A 3SUDA 2PKAB 3ZVBA 1QGFA 1GWAA 1AFQB 3PRBA 3ZZBA 2QXGA 1EJAA 3RUOA 1BRUP 1CQQA 2H2ZA 1N8OC 1PYTD 2ZP0H 5EGMA 1BTUA 1LHFH 2LNCA 1BA8B 1FIWA 3HKJB 2OP9A 1B7XB 4ZXXH 2IJD1 2H5CA 3KHVA 4ZUHA 4QT8C 4X1PU 1QTFA 1UTPA 3SU2A 2AHME 1KTSB 1W0ZU 1ELFA 3LGIA 3T26A 8GCHG 2QIQA 4YLQH 3M7QA 4TY6A 1V2KT 2Y80A 3LC5A 1GBFA 5A8ZA 1NBMD 3ZZ9A 4K3JA 4H6TA 3RMOH 4HZHA 1BHXB 1CA0B 1SOZA 1YWUA 3MH6A 4NZQA 3ZZDA 3MO9A 4ESTE 1BDAA 1TMUH 2J38A 1C1VH 1O3AA 3DA9B 3GS9A
chains in the Genus database with same CATH topology
1HAOH 1D6WA 5EW2H 1OXGA 3ATLA 4MPUA 6CHAC 1QFKH 1W2KH 3U1IB 5A09A 1NFXA 2VIWA 5L30H 2CMYA 4BTIB 3ZV9A 2GDDA 1TOMH 1G9IE 1O2NA 1FZZA 1F5RA 2C93B 3BEUA 1A61H 3GICB 1JXPA 1AGJA 4Y7AA 1A5IA 4AFSA 2FX4A 2PW8H 2P94A 1C5QA 4WMEA 5C67A 1QL8A 2BD8A 4HI3A 2ESTE 4YM9A 5C3NA 3HGPA 3B23B 4ISLA 5I25A 4AB8A 5DK1A 1LMWB 2V0BA 1FAXA 1O3GA 2THFB 1TAWA 1NRNH 1O33A 4KELA 4BTUB 3HK6B 1CGIE 3BSQA 2QXIA 1GI4A 1RD3B 3GY8A 3A80A 1VGCB 2WPMS 1DX5M 1EAUA 1FI8A 3SU4A 2NU0E 1C5MD 2PHBA 4XFQA 1P8VC 3PWCA 5FPYA 2D2DA 1C1RA 3JZ2B 2FI4E 2P8OB 2ZCKP 1AVGH 2F9VA 5TCCA 1SGFA 2WUCA 1BOQA 1TPSA 3EQ0H 2A4OA 1C5NH 4GCHG 3M5LA 1HB0B 1Z8GA 3LIWA 1BRAA 1DUEA 4O03A 3S69A 2IOTA 3KQBA 3M3SA 4INKA 2FWWA 3I29A 4GLYA 4ABGA 1O2IA 4K2YA 2ZU4A 4OS1A 5LPFA 3WY8A 1C5OH 1ESBA 2VIDA 3MU1A 3ZVFA 1DLEA 1SGEE 3SV2H 1INCA 1DXWA 1MD8A 4I33A 5FBIA 1TPAE 1EZQA 1QB9A 1RRKA 1TNHA 1GPZA 2Z94A 3M5OA 1NRSH 1QJ6B 2G4UA 1EJMA 3GY7A 1A5GH 4OGYA 4NG9H 3T2NA 1ZGIA 1T8LA 1AMHA 2BDIA 2HNTC 3AAUA 4BAHB 1WUNH 2Y5FA 3OX7U 4H4FA 4INLA 2D8WA 3F1SB 3Q3YA 6ESTA 3UWJH 1T31A 1ZYOA 1EQ9A 1M9UA 1C5ZB 3DHKH 1UTJA 2Z9KA 2SGQE 1NS3A 2TIOA 1A2CH 2J94A 3LGTA 2QXJA 1UTOA 1UMAH 1FQ3A 2UWLA 1IQGA 3SNEA 1TX7A 3TIUA 3SI4H 1IHTH 2YNAA 1MZDA 5ESBA 1QURH 1HBTH 2ODYB 1S85A 2UUYA 4OS5A 2CXVA 3FZZA 2PGQB 1PYTC 2JH0D 7LPRA 2FXRA 4UFFH 1GI6A 1O30A 1MBMA 1ZGVA 1OWDA 2J2UA 1TLDA 4MPWA 3UWIA 5CE1A 2BD5A 3P92A 4B2AA 1VGCC 1NPMA 3A8DA 3BEFB 3UNQA 2C8WB 2ZFTA 1SGQE 1V2QT 3QDZB 1MKWH 1CVWH 1O32A 3RC6A 2ZPQA 1T4UH 2VIPA 4GHTA 4X6NA 4AZ2B 5HYOA 5GCHF 5CMXH 1UTKA 1VITH 2P8OC 1GJ7B 1N1LA 4B2CA 1C2IA 1TQ7B 3GDUA 1QB6A 2ZF0H 1GL0E 1NM6A 3URCA 1C4Y2 1O2TA 1UTNA 3RXUA 1FY5A 4MPXA 3RXOA 4AFQA 1GBEA 1WQSA 2QYIA 1BBRH 2OLGA 2C4FH 1SC8U 4O3UA 1QNJA 1GJ9B 1OWHA 4I31A 1YPLH 1GHXH 2FP7B 1HIAA 3LT3A 1KSNA 2NU2E 3UOUA 3UQVA 3MWIU 1Z6JH 2VGCB 3LH3A 3TGIE 3BG8A 1HRTH 1MAXA 5AF9H 3MI4A 4ABBA 1G3BA 1ABJH 1GBIA 1MKXK 2O8WA 3HATH 2G52A 4NIYA 1ELAA 4OS7A 2C3SA 1LPGB 4X8TH 3RU4D 1F92A 3ZVDA 1BMAA 1QJ7B 1GBKA 2F83A 3VXEH 1O3CA 1NESE 1N6XA 1YPHC 3PO1B 1DY9A 5I46H 1GHYH 1SGFG 1XKAC 1A46H 2OCVB 4D8NA 1C1SA 1HGTH 1ELCA 3URDA 1AVWA 3A84A 1V2NT 1L4ZA 4YZUA 1EXFA 4PROA 2XWBI 5PTPA 3SU1A 1L4DA 2CF9H 3RDZA 3UNRA 2A5AA 2ODPA 2BX4A 1ZJDA 3BTDE 4RSPA 3TU7H 2BLOA 3U8TH 2PFEA 3VB3A 2A4QA 1MTNB 1SFIA 1O2LA 1P10A 2FEQH 2IN2A 1OWIA 1TABE 1LHDH 3P70B 1GBMA 3BTHE 4NGAH 1VITG 2W7UA 1NZQH 3UR9A 1IQKA 3O8CA 3RXHA 5IYTA 1F0UA 1S5SA 1F0TA 5T3HA 1Y3VA 3PWBA 1J14A 3BG4B 3IG6B 3O8RA 1XXFA 1SMFE 2KAIA 1Z8IB 3BF6H 3ZYEA 3SNDA 2FLBH 1DITH 1C2DA 1WAYB 1BB0B 4Y10E 4ABHA 1W12U 2GCTB 1D6RA 1S84A 4OGXA 1FIZA 3TJNA 1C5SA 1BJVA 2R3YA 4ISOA 4DIHH 3RXEA 2VGCC 1IOEA 1WU1A 2FOBA 1QA0A 1O2JA 1TNKA 2BD4A 1O3JA 5C1UA 3TGKE 3ZV8A 4F4OC 1SHYA 4DT7B 1A4WH 3MTYA 5J4QA 2GZ9A 1O2WA 1QBNA 2FIRH 4AX9H 2BY9X 2AGGX 2OC0A 3PTNA 5HM9A 1EB2A 2P16A 1BTPA 1CGHA 2Z3EA 4UONA 1S0QA 4JZDH 4MG3A 2D1JA 3D23A 1H4WA 1MTSA 1BIOA 1SR5C 4AYVB 2OD3B 3P8OA 4HGCA 1ELTA 2BYAX 5F6MA 1O2MA 3MNXA 2I6QA 4X1NU 1ZJKA 5C2ZA 1C1UH 2O9QA 2YOLA 3EA9A 1BTHH 3HPTB 5EU8A 2EEKA 2WYGA 2FM2A 2VJ1A 2TBSA 3DT0H 1FXYA 1MTNC 1QCPA 1P2MA 3SGBE 1KDQA 2VH6A 4XBDA 2BD7A 1HAIH 4O9VA 1B5GH 3M7TA 5E0HA 1UK4A 1D3QB 3RXFA 1WTHD 4FU8A 2AGEX 1GG6B 1XKBC 3KQCA 4XSKU 1EP6A 1NFWA 1H9LB 3ITIA 2CGAA 1IAUA 1C5LH 1GJ8B 5E8EH 1PPHE 1VCPA 1C4V2 3KNXA 3BG4C 1ZMNA 1DDJA 1WSSH 1P57B 4ABAA 3LDXH 3SORA 2VWNA 2BM2A 2A31A 1PPZA 2BQ7B 1D3PB 1Y3UA 1OWEA 1EASA 1JRTA 1V2PT 1W11U 2PGBB 4Z6AH 1EPTA 1WQVH 2AH4X 5EOKA 5T6FA 1O3DA 1LPKB 3TPIZ 2BD3A 3UR6A 2EA3A 1G3EA 2G81E 3OSYA 5ETXA 1P01A 3VEQB 2GCTC 1QBOA 5C5OA 1Z7KA 4AGJA 3A8BA 3SU6A 1P2QA 2K1QA 4TY7A 4K1TA 4RN6A 1Q2WA 4D9QA 2FYRA 1WYKA 4O97A 1NFYA 3RXDA 3NK8A 3GCTF 1O2OA 4A1VA 2QY0B 5HXFA 1O2KA 3SHAH 1O2SA 1OKXA 3ZZ8A 1GDNA 1GJ6A 2VH0A 3U8RH 1K1LA 5GWZA 1S0RA 1V3XA 1FONA 3E1XB 2VB0A 3H5CB 1MTUA 3ATWA 2FTMA 1HAVB 1Z71A 1UK3A 1P12E 3P8FA 2R0KA 2A7CA 3SHCH 4Q80A 1GBLA 1MQ5A 1Y8TA 1V2LT 1NFUA 3SJ8A 2ZHDA 3DD2H 1QRXA 1CSOE 2PV9B 5EQSA 2VINA 3ODFA 1HAYB 3LOXA 2XYAA 3E3TA 1SLXB 3GY3A 4GSOA 4ZROA 2ZQ1A 4UFDH 3QGJA 1BTWA 2NU4E 5DPAA 3RMLH 3S9BA 3MNSA 2XWAA 3SN8A 4K5ZA 2GX4A 1T8MA 1Y5UT 1JMOH 2ZDNA 3A88A 2BDGA 3RXAA 1SLWB 1K1JA 1E35B 3A7WA 1LCYA 5L2YH 5F8XA 1O5FH 4MPVA 3BIVH 2BLVA 2Z9GA 1C4U2 1UHBA 4Y71A 4MNVA 2ZTYA 4ISNA 1TALA 1F2SE 1EATA 2J4IA 1GG6C 2P59A 2BY7X 1EB1H 1C2KA 2ZNKH 2ZI2H 2GGVB 4X6PA 1MZAA 2Q6FA 5ABWA 1MBQA 2BDHA 3VB7A 3T25A 1Z1JA 1DWDH 1O3NA 3E6PH 3UTUH 3V0XA 2F9NA 4Y8YA 1TRNA 5JB9S 4AB9A 1S83A 7ESTE 3Q3KA 3M61U 3FVFB 4J1YA 4AFUA 2SGEE 1EKBB 5E0GA 1QRZA 1HXFH 3MOCA 2Z9JA 4WWYA 2STBE 2ALPA 4WVPE 1BZXE 1OWKA 3MH5A 1BMMH 2V3HH 4X1SU 1W10U 2VWMA 1AE5A 1PFXC 1S6FA 4MQAA 5FAHA 1DE7H 2PUXB 4K1SA 2ZG0H 2BZAA 4GVUA 5GCHG 5HM2A 1RJXB 1AUTC 4KTCA 1TWXB 1TPOA 5GJ4B 4CR5A 9LPRA 1ETSH 1ZSLA 2O8UA 5DP5A 2HWLB 3A7VA 1GI1A 1H9IE 4WF8A 1W7GH 1JOUB 1BRCE 3TH4H 2WV4A 1D4PB 2GZ8A 1GBAA 4ABJA 1QBVH 8KME2 1TGSZ 2BY6X 1CT4E 5AFYH 3STIA 4D76A 2AMDA 3TJVA 2ZPSA 1FJSA 3D65E 1UTMA 2ZA5A 1SQOA 3AASA 1KY9A 1AQ7A 3RU4E 5FX6A 1PPGE 4AN7A 1ACBE 4GAWA 1MH0A 4ZKNU 2QN5T 3GY2A 2QF3A 3M3VA 1MTWA 5T6DA 2A5KA 2WPLS 1GI0A 4X6MA 1Y59T 2SFAA 4VGCB 1C1PA 1PQAA 3RXVA 3FAOA 2XTTB 1F7ZA 1EOLA 3SNAA 1GJ4H 2A2QH 1K21H 3LJOA 1K1NA 4FU7A 5C1YA 1XVOA 3E0PB 1SGPE 1TPPA 2EC9H 1WV7H 2HRVA 4NIVA 2PSXA 2OC1A 3RM0H 2EI6A 2GP9B 2ULLA 4ZMAH 1EOJA 2PUQH 1O3IA 2ZCHP 2BDCA 4H6SB 4ABDA 4ZAEA 1YC0A 4IW4E 4A92A 2QF0A 1AWFH 3SW2B 4B75A 3NZIA 1GJBB 1W3CA 2FOEA 1QQUA 4UFGH 4X0WU 4KKDA 4IMZA 5FHTA 3GCHB 1O3BA 3CP7A 5FCRA 3QK1A 1GI7B 3RXRA 2OUAA 4J2YB 2FI3E 1DICA 1AB9B 3LGWA 2A1DB 3P8NA 2V3OH 5DP3A 1NU9A 2RA0A 3ENSB 1O35A 1ARBA 3RXQA 4Q7ZA 2W3IA 1SGRE 4AYYB 1C5VA 1P2NA 1EZXC 1G3CA 3BTTE 1XMNB 4ZH8A 2R0LA 3ZZ4A 6GCHF 2PWXA 1P09A 3RXSA 1CO7E 1BJUA 1YCPM 4BANB 1LQEA 2FOGA 2A7JA 3PMBB 1BMLA 2ZTXA 1ARCA 1MKXH 2FLRH 3ZYDA 1ANBA 1O37A 1JWTA 2BY8X 4U2WA 1HXEH 1PPFE 2LPRA 2HPQH 1YBWA 1TQ0B 1V6DA 1VJAU 2R2WU 1GHZA 4B71A 2G51A 3VB4A 1OYQA 1Q3XA 5LH8A 1A3EH 2TPIZ 3GDSA 1W7XH 4FVBA 3E91A 2ZU1A 4WY3A 3T62A 3NUMA 3ATMA 3UOPA 2BOHB 1E38B 3T29A 3NKKA 3SGQE 4MNYA 1O2UA 3VB5A 4FUHA 2BDBA 5AVDA 2XBYA 3RP2A 2TGDA 1NRRH 1J16A 5FXLA 4E7RG 1C2EA 1RTKA 5GPIB 1E37B 1GBBA 4VGCC 3AAVA 1SLUB 1TBQH 3V7TA 1ZRBA 2BLWA 1TBRH 4Y7BA 2ZIQH 2ZCLP 5DP8A 4I8KA 2BZ6H 1O5DH 4JCNA 5EG4A 3MNCA 1TB6H 2F9BH 3TK9A 1EP5A 1W13U 5C5NA 4Y79A 2JETB 1O5EH 3SU0A 5AHGH 1H9HE 1GDQA 1GHBF 1XX9A 3A7TA 3U69H 4ZHAA 5A0AE 1ELBA 1IQIA 2CN0H 2PKSB 4Q2KA 2PR3A 2VVCA 1C1NA 2OQUA 2OC7A 1TBZH 4R8TB 3GCHC 1Q31A 2ILNA 2R2MB 1FAKH 3LONA 1E0FD 1SPJA 2XCNA 4BAOB 5EPNA 2AIPA 2J9NA 1AB9C 1MCVA 2HVXA 1W0YH 1NRPH 1XVMA 2NWNA 4AFZA 5F8ZA 2ASUB 3KN2A 4X2WA 1V2RT 1CBWB 1W8BH 2LIZA 3A83A 3LGVA 2O8TA 3PMAB 1IQFA 1O3OA 5EXMA 5FBEA 3SJIA 4LK4A 1HAHH 1NY22 3CS0A 1HIAB 1C5UA 4WMDA 3QTVH 1L1GA 3QZRA 3ESTA 2AEIH 1UVUH 2RDLA 5DO4H 1VR1H 2CF8H 1FUJA 3FANA 2JH5D 3L33A 4MTBA 4CH8B 1KLJH 3NXPA 1DWEH 4ISHH 4CRDA 3GCTG 1TGBA 3U1JB 1TYNA 1HAZB 2XBWA 2Z7FE 3QZQA 3ATKA 1ZTJA 1A3BH 2DE8A 3CENA 2ZGBH 1LHEH 1VCQA 4DCDA 2BXTH 5JB8S 1H8IH 4X1RU 2G5NA 1CU1A 2GV7A 3N7OA 2FPZA 1V2MT 1DLKB 1QL7A 2R9PA 4ZKRU 2TGTA 3SU3A 2O8MA 2W26A 2PTNA 2BOKA 1UCYE 4BXSA 1KXEA 3A87A 2JETC 3A81A 1BUIA 2OQ5A 3A8CA 1FY8E 3VGCB 3RXLA 3B9FH 1CE5A 1DVAH 4KP0A 4E05H 1EAXA 1TX6A 3IWMA 1GMCF 5DJ7A 2UUKB 2FYQA 1GBDA 2ZHQH 2PKSC 3ELAH 1BTZA 4JZIA 5SGAE 2ZU2A 3ZZAA 2WYJA 5JYIA 2BDYA 3F9FA 3P6ZB 4JYVH 3QX5H 1THPB 2ZU5A 2DUCA 1MD7A 2HLCA 1GJDB 1P05A 1SLVB 1AZ8A 2FMJA 4I8HA 1OP8A 1ZTLA 4IN2A 1O2VA 4JZFH 1NO9H 4KGAA 1B0FA 1GI2A 2ZDVH 1DFPA 1EAWA 2BD2A 1ABIH 1BITA 1QY6A 4I8JA 2AERH 1K1PA 4DW2U 1K1MA 1CBWC 1IQJA 3A85A 4WXVA 4WXIA 1NRQH 2KAIB 2HNTE 2V6NA 3A86A 4CREA 3ZVCA 1FY3A 1P9UA 3PROA 2XBVA 1PJPA 4MVNA 3P8GA 3IITA 1WTGH 2VWLA 3SJ9A 1DY8A 4H42U 4KTSA 1J8AA 2PTCE 1GGDB 3OY6U 3E8LA 4Y76A 1DSTA 4FUCA 1UK2A