3E91A

Crystal structure of sars-cov mpro mutant in p21 at ph6.9
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
305
structure length
305
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEFTPFDVVRQCSGVTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the activity-enhanced SARS-CoV Mpro C-terminal mutant
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 80
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3e91A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e91A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3e91A02
3BV9B 5LGOA 2PGBB 4YESB 4NWLA 1T4UH 1XX9A 1KDQA 2FLRH 2A4QA 1Y3YA 5AHGH 3U8RH 1AY6H 1DY8A 1WSSH 4E05H 1BDAA 3QWCH 4XFQA 3T28A 1ANBA 1TFXA 1CGHA 5AF9H 1TPOA 3E90B 4YOGA 2BD8A 2XBWA 3E3TA 1C2LA 1C5OH 1T8MA 2G5VA 1N8OB 1QQ4A 2XBVA 3A7YA 1TMBH 1D9IA 1GDNA 5FAHA 3BIVH 3P6ZB 3NPSA 4O3UA 2ZP0H 4JZEH 3ATLA 2TRMA 2F9NA 2FESH 1P2IA 2VVUA 2CF8H 2Y6TA 1QRWA 2GV6A 2I6SA 1G3BA 4JCNA 2PKSB 3TH3H 4JK5A 1V2QT 4GLYA 3KL6A 3HGPA 4CRCA 1O3LA 3VXEH 2SNWA 1GBEA 3RXQA 3M35A 1FY1A 2A5AA 3ZYEA 3A83A 1SGTA 5A0AE 4I8HA 3M3TA 1TBZH 4LOYH 1LVBA 1CHOF 2ZTYA 1T32A 1O33A 3TGJE 1CHOG 3A85A 3PO1C 5DJ7A 1W11U 5DP5A 1MUEB 3E8LA 1GCDA 4MPXA 2OQ5A 1D4PB 3GDSA 2QXIA 2FOGA 4MVNA 1BTXA 4Y8ZA 1FMGA 1TNIA 1TX6A 2ZO3H 4AG2A 2ZFQH 5EU8A 1QCPA 3SHAH 3GY5A 2PTCE 3I77A 4BTTB 2FX4A 2V35A 2PV9B 1TPPA 1NRPH 2XC0A 3LJJA 4Y7BA 2VJ1A 3MU4A 4NZQA 1O2LA 2ZZUH 2IJOB 3BEFB 2EC9H 1SFIA 1EXFA 4D7GA 2ODPA 3BG8A 6CHAB 1WYKA 3A8CA 1LTOA 2VIVA 4YLUA 4A1XA 2SGQE 1CT2E 4AYYB 1DXWA 1VCPA 4BANB 2O8MA 3F1SB 4FUGA 1RTFB 2A7HA 1HV7A 1KLIH 1EZQA 5DKMA 1ZYOA 2P3FH 3UR6A 1AO5A 3VFEA 4WY3A 4DIHH 1SB1H 2GTBA 1A1RA 3LIWA 1GJ4H 2ZI2H 5JBAS 3PMJA 1YLCA 1GGDB 1W12U 4JYTA 3SNAA 2RDLA 1BRCE 1VGCB 4X2YA 1KY9A 1XVOA 1RIWB 3RXAA 1ETSH 1PJPA 1GI3A 1O2YA 1O3OA 1O0DH 1P12E 4UFFH 1SVPA 4ZHAA 4U30A 1D3DB 2F9VA 1O2VA 1P2QA 5H4IB 1O3EA 1TX8A 1LMWB 5BPEA 1Y59T 4YM9A 2BXTH 3OTJE 4D9RA 1SFQB 2J4IA 2JH5D 5EODA 2Q6GA 1LKAA 2QY0B 3I78A 3UFAA 3OY6U 1F0SA 2QAAA 1FIZA 4WMFA 2Z9JA 1ZPCA 3GCNA 3VB6A 3MH4A 5FBEA 2UWLA 3KN2A 1SI5H 1C1WH 5C5NA 1QB9A 3RXMA 5E2PA 1D6WA 2C90B 5L30H 1LVMA 1TRMA 1O5DH 3HK3B 1D6RA 1SBWA 4KTCA 4Q2KA 3MU1A 1UK2A 1FUJA 2G55A 2PFEA 2FTLE 1H4WA 1PPCE 1GCTC 2B7DH 1C5SA 1O2TA 1GBHA 4BTIB 1G2MA 5TCAA 1EX3A 1W7XH 4QT8C 1C9PA 3MO6A 3BSQA 4AGKA 1P03A 1AI8H 3AAUA 1KYNA 2BY8X 3ZZ9A 5LPEA 3U8OH 1DXPA 4B2CA 1DWDH 1OP0A 3R3GB 2PWXA 5F8TA 4B2AA 3TK9A 3ODFA 1UK4A 1XUIA 2TGTA 2G4TA 3SGBE 1AFEH 1Z8JB 3VB7A 1VZQH 5FCKA 1V2MT 5GCHG 4CR5A 2VIOA 2Y7XA 1GMHG 2VGCB 2QYIA 3MTYA 1BIOA 2ZNKH 1GJ6A 2GMTC 4A1VA 2OCVB 2Z3CA 2BDYA 3BG4C 1FJSA 4UFEH 1MCVA 4SGAE 4CREA 2P16A 2HGTH 3KGPA 5HYOA 1NTPA 1XXDA 4BAQB 3PTBA 1NY22 2ALVA 2QXHA 2Z9IA 4TYDA 1K1MA 1FN8A 4D9QA 1YKTA 1HCGA 1MU6B 4XBBA 1DLKB 1W14U 2ODYB 2AEIH 3RXGA 3GY7A 1B5GH 2F83A 2Z94A 4ISNA 4BXWA 2W5EA 1UTJA 1AVXA 1FIWA 2ZU1A 2JH0D 2R0LA 1OWEA 3ZZ7A 1S6FA 4IMZA 3RLWH 2P93A 4ZKOU 1C4V2 3QZQA 2ZC9H 2ZGBH 2AYWA 4ISLA 4KTUA 2EI8A 3M3SA 1MZDA 3MI4A 3MOCA 2F9PA 1QA0A 9ESTA 1IQMA 1NZQH 1OS8A 3LJOA 1FY8E 1FAXA 1SGEE 2BOKA 3K6ZA 2Q1JA 1LO6A 1CBWC 3RXBA 3B23B 1VJAU 1SOTA 4WF8A 1NT1A 1O2HA 1AN1E 3C27B 1IHTH 3KF2A 5AFZH 1BMAA 2ZFSA 1GBLA 4FUHA 1GBFA 4Z6AH 1SPJA 2ZPRA 1AHTH 1C2FA 3RC5A 2CXVA 3K9XB 2JETB 1ZSKA 1XMNB 2RA3A 1PPEE 1FY5A 5A8YA 1CE5A 1QJ1B 3ZVFA 1P11E 2J38A 1AZZA 3RXRA 1GMCG 3ATKA 1C4Y2 1DY9A 4O3TA 2LPRA 3D49H 1MTWA 2B5TB 4Q7ZA 6CHAC 2FO9A 1E37B 1V2OT 1P06A 3SJ8A 1C1UH 2BDCA 2ZF0H 3HK6B 2NU2E 1V2WT 1IAUA 5JB9S 2AERH 3SBKA 4YTAA 1CQQA 3SI3H 1AE5A 4MNVA 1KLJH 3PLPA 4OS5A 1QIXB 1YCPM 1ACBE 3NZIA 4B1TA 5A2MH 3SQHE 4A92A 2ZDVH 1SGFA 1BB0B 1LKBA 4A6LA 1Y3UA 2BVXH 3D23A 1GDUA 1DSTA 1C2HA 3EGKH 2RG3A 1BJUA 1V2JT 1ZMJA 4I8LA 1P3CA 1GHZA 1DFPA 2H9EH 4KP0A 1S82A 3LT3A 1V2LT 2ZQ2A 3OYPA 2Y81A 1CA0B 1AMHA 1WQVH 1QR3E 1E34B 4U32A 3M37A 4JYVH 2FWWA 1OSSA 2W3IA 1MKWH 1OYTH 2GMTB 1AKSA 1A61H 1O3AA 4FU7A 4E7RG 1FN6A 2Y5FA 5EQSA 3VGCB 1J15A 5DP4A 3ELAH 1DM4B 4X6PA 1EPTA 1GI5A 1K9OE 4DT7B 1BMNH 2A4RA 4FVDA 2BTCE 2VIQA 3M5MA 2BDGA 4ZXYH 3T26A 5DO4H 3NCLA 2FS8A 4MPWA 1MAYA 1QFKH 4ISOA 1W7GH 2XTTB 5HM9A 2CJIA 1W13U 1W3CA 1TA2A 4FU9A 4NSYA 1DANH 3SW2B 4X2VA 1GI2A 1HAYB 3EE0B 3GCTF 4J2YB 1YPJH 5E8EH 1C1QA 2FYQA 1NESE 1S85A 2OUAA 1MTSA 3LKWA 1ZOMA 3PWCA 2PKAA 4ABFA 1Y3VA 4ABIA 2Z9GA 2PHBA 1DLEA 1SGIB 4X2WA 2W7SA 3UIRA 4MLFB 1KXEA 1GJCB 2P8OC 4A1TA 2C93B 2HALA 1T4VH 1Y5UT 1GCTB 1K1JA 4JZDH 1C5LH 3TJOA 1AWHB 2YNBA 1G32B 1SR5C 1LHFH 1TBQH 1TRYA 5C67A 1O5EH 1YM0A 4X1PU 4XDEA 1C5VA 1GG6B 1HRTH 1F5LA 5C1UA 1FI8A 2XC4A 3ESTA 2FIRH 4INKA 5E0JA 1DVAH 3T29A 3FAOA 2GV7A 1DS2E 4K8YA 3UNSA 1HNEE 1P2MA 1KXBA 1CA0C 1NU7B 1YPKH 1P2KA 2A2QH 2FM2A 3SJ9A 3WY8A 4CHAC 2GCTC 2ILNA 1TOCB 3PM3A 5DP3A 2LNCA 1TWXB 5A0CA 2PUQH 1EP5A 2A4OA 2PSXA 1DITH 1JWTA 1GHBF 4RSPA 2VIDA 3SUDA 1BBRH 3RP2A 2GZ9A 1TBRH 2VWLA 7LPRA 2FX6A 1A2CH 2VIPA 3MMGA 4DOQA 1A3BH 1BA8B 1P2NA 4X8UH 2TGAA 1BJVA 1GI0A 1AU8A 3QTOH 3OY5U 3S9CA 1PPHE 1E36B 1C2IA 1Z8IB 1BBRK 4I8GA 4RKOB 1EAIA 1KXCA 3PMBB 2A2XH 4X1RU 2ZDAH 4X6OA 1EAXA 4FUJA 5SGAE 2H5CA 1UVSH 4MNWA 2P3UB 4ABJA 4OS1A 2UUYA 4HI3A 2FZZA 1ZTJA 1C9TA 3MU8A 3DHKH 4TPIZ 3P17H 3IITA 2JETC 1O3IA 1ELDE 1C5MD 2OC0A 2BD5A 1HLTH 2Y80A 1Z71A 3LC3A 4B73A 3U1JB 1TGNA 1SGRE 2XC5A 1GHYH 2HNTF 2H9TH 4MQAA 1HIAA 1V2PT 1SQTA 3SV7A 4HGCA 1F2SE 4TWYA 2ANYA 3SJKA 3UUZA 4AB8A 1K1LA 2D2DA 1MMJN 3MH5A 2QF0A 4B75A 1GBKA 1PQ8A 5DGJA 1ARCA 1AUTC 3ZZ6A 1NPMA 1BBRE 1NRSH 1Z7KA 4ZUHA 2XBYA 1QL8A 2Z6BD 4AGJA 2FOEA 1SSXA 2SFAA 1AB9C 3ITIA 1FAKH 4AN7A 1UTPA 2WV5A 1EB1H 3M5OA 2VNTA 2KAIA 2QGRA 2P95A 3GYLB 4MG3A 3CP7A 4NFEA 5HXFA 5F8XA 3BTKE 1EUFA 2DE9A 2FS9A 5EPNA 3TNSA 3KEEA 1SLVB 2IOTA 2XYAA 3SI4H 2V3OH 2UUFB 4Y8XA 3ATMA 1C2EA 2G5NA 5F03A 3ZZAA 1ETRH 1XUFA 4CRGA 5T6DA 1ARBA 3RXHA 3TH2H 3RXDA 2Q6FA 1ELAA 3ZVAA 1O31A 4INLA 2FOBA 4O9VA 1ANCA 5GJ4B 4X6MA 1P2JA 4ZHMU 2A5KA 1T8NA 2QXJA 1K2I1 1PFXC 2PTNA 4GHQA 3BEUA 2G52A 1EAUA 3QUMP 4TY7A 5EQQA 1QNJA 4X8SH 2ZPSA 1HAPH 2RA0A 1ZGVA 2AMQA 1JMOH 2WPHS 3MNBA 2FOCA 3GISB 1YPEH 1GVKB 2M5TA 1EAWA 1GBIA 1O3NA 2BHGA 3LC5A 1J16A 5JDUB 4AZ2B 2VH0A 4H6SB 1ELEE 1MAXA 1OP2A 2R3UA 1C2JA 1C5XB 1O2JA 3QO6A 4AB9A 3U69H 2ZFRH 5EXLA 1G9IE 7ESTE 4BOHA 1F0UA 3ZYDA 1GJ8B 3H5CB 3UQVA 5ESBA 1SG8B 3KQBA 1C5PA 1ELBA 2GVFA 1FLEE 2Z3EA 1QY6A 1C1SA 1LDTT 3PYHA 5HMAA 2CHAB 4TWWA 4DY7B 3C1KA 2WYGA 1CA8B 4NG9H 4Y10E 3AAVA 1YBWA 3MFJA 2G51A 1C1VH 3SUEA 1IQHA 1TX7A 2J94A 3M7TA 1PPZA 5L2ZH 2HVXA 1SGNE 1NFYA 3FP7E 2ZEBA 1S6HA 1KTTB 1L4ZA 4J1YA 4ABGA 2BY6X 4WH8A 1ANEA 8LPRA 1YF4A 1WBGB 2QIQA 1QHRB 1ETTH 1RTLA 1GI8B 2VINA 1SGCA 7GCHG 1L1JA 1PQ7A 3LDXH 2BLQA 2ZFFH 2JKHA 4LXBH 5E2OA 4UD9H 4B2BA 2WV4A 2ZU5A 1C4U2 4NIYA 3EYDA 3MH7A 4FU8A 5FCRA 2CF9H 1C5NH 1E38B 1A4WH 5AFYH 1O5CB 1P3EA 1WU1A 4D76A 1PQ5A 1A0JA 1G37A 3T62A 1GJBB 3VEQB 5I25A 1P10A 1FXYA 1TMUH 1OWIA 5AVDA 3PROA 3VPKA 3W95A 5CHAC 1BITA 1SMFE 2PKAB 1LHEH 1ZHPA 2ZKSA 1XM1A 3TGKE 4IGDA 4CRFA 1AWFH 3UNRA 3SNBA 5JB8S 3U9AH 3MO9A 2PLXA 1F0TA 5K0HA 1WOFA 3TU7H 1GHXH 1ZR0A 1B0FA 3HKIB 1XUHA 5F6MA 5GXPA 3SN8A 2D1JA 1GWAA 1V6DA 3SNDA 3SU5A 2WPLS 2CN0H 1AVWA 4D8NA 1MQ5A 1AZ8A 3EA8A 4U01A 3A80A 3OSYA 1OKXA 1YLDA 1IQFA 4O03A 2XRCA 5JBCS 4MTBA 1O3FA 5DP8A 5L6NH 4RKJB 3TITA 2H1UA 2XBXA 4ISHH 3SOSA 1W8BH 1AD8H 4HTCH 4IN2A 1EZUC 4KTSA 3F9HA 3MYWA 2ZGJA 4BAOB 4Y7AA 1DDJA 1SLWB 2QF3A 3BTME 2F9UA 2BZAA 1Y5AT 4ZMAH 1C5TA 3E91A 1TB6H 1Z8GA 5EW2H 3RDZA 5FX6A 1P02A 5EOKA 1IQNA 3LOXA 5TJXA 3F9FA 4OGYA 2GD4B 1BTWA 3MNSA 1CGIE 3U1IB 3SV6A 3AVZA 1INCA 1L2EA 1MKXH 1Z6JH 3UREA 3DFJA 1HJAB 1TGBA 2ANWA 1TONA 3ENSB 1AVGH 2FOMB 1C2KA 1PYTC 1Z1JA 3RXSA 1QRZA 3L6PA 1O2XA 1TNJA 4IN1A 4HFPB 1W0YH 1SC8U 1YC0A 4X8VH 4BNRA 2VVVA 3FP6E 3HPTB 2TPIZ 3S0NA 2ZCHP 2SNVA 3ZVGA 1TYNA 1IQJA 1C2MA 1ZRKA 1QBVH 3RXJA 3SORA 1OP8A 1THSH 1ABJH 2EA3A 4NZLA 1ELTA 4CRAA 1THRH 3F6UH 4FUEA 1O2OA 5GCHF 4ISIH 1S83A 2ZFPH 2BDAA 1F0RA 1P57B 5LH8A 1FNIA 1Y8TA 1OWKA 1EJNA 1F5KU 1S81A 3SU3A 3QGNB 5PTPA 1MTUA 3FP8E 3A7TA 3UQOA 1ESTA 4CH2B 3KQCA 2VWMA 4SGBE 1OWHA 5LPFA 1VCQA 2UUJB 3T5FH 1NU9A 2BVSH 3SU6A 2BXUH 5DPAA 1AFQC 5FXLA 1BHXB 1C5WB 4GAWA 3SUFA 2TGPZ 1AB9B 4K2YA 4A7IB 5DP9A 2BX4A 1RTKA 2R0KA 3Q3KA 2BB4A 1VGCC 2QN5T 5C20A 3M7QA 2ALPA 3MO3A 2A45B 3RXVA 1FV9A 2NU1E 3S7KB 1YCPK 1ZJDA 4K3JA 3UOUA 2BQ6B 1EOJA 2BD4A 3ZZ4A 1O36A 1HUTH 2BYAX 1G3EA 5EPYA 2FEQH 4LZ1H 4YZUA 1O3PB 1O2KA 1WV7H 1LHCH 3SU0A 3BF6H 1ZPBA 8KME2 1UCYE 2GX4A 3A84A 3IG6B 5C1YA 2B8OH 1GI6A 3PLBA 1HPGA 1RGQA 3KQDA 3GCTG 1OWJA 3EAJA 3HKJB 3ZV9A 5JPMH 3SNEA 4FUFA 1MKWK 2V6NA 4GPGA 1MTVA 1C2GA 1YYY1 3ZZDA 2NU3E 3PV4A 1A0HB 2Z9KA 1CGJE 3M5LA 3QX5H 2BM2A 8ESTE 4MPUA 3K65B 1UJ1A 1Y5BT 8GCHF 4IMQA 3RXTA 1EZSC 3A88A 3RXEA 1DOJA 1QJ7B 4IS5A 1E0FD 1J8AA 2B9LA 3D62A 3RMNH 1O35A 4JZIA 2WPKS 4YLQH 4Y0YE 4M7GA 2ZU2A 1FZZA 2C4FH 1FDPA 1EP6A 2QXGA 1YP9A 1ZRBA 1EATA 3TLOA 2BD9A 3E1XB 3U8TH 2Y82A 8GCHG 4FUBA 3DFLA 4ZROA 1EJAA 4E06H 4JYUH 5HM2A 1C5RA 3PTNA 4TPYA 5E0GA 2ZECA 3W94A 2B0FA 3A86A 1J9CH 1SLXB 1T8LA 2OBOA 1W10U 1UTQA 3G01A 4NWKA 3VB4A 1G30B 3E16B 4Q80A 2G81E 1O5FH 4WMEA 3TNTA 1UHBB 1JOUB 2BD3A 2FTMA 1RD3B 2NU0E 4UE7H 1Y3WA 2XXLA 4O97A 4A5TS 3GY2A 1BOQA 2ZGXH 2BVRH 3CS0A 1TGSZ 4WXIA 1TGCA 1N8OC 1HBTH 1L1NA 3K6YA 3FFGA 4AFQA 1HJAC 1D3QB 1FQ3A 1O34A 1DWEH 1GJAB 2QA9E 4XBCA 3NKKA 1GBAA 3A7ZA 1GHVH 2V3HH 3DUXH 1QJ6B 1P01A 5GPIB 2QC2A 4MDSA 5J4QA 5C3NA 1HXFH 1O2SA 2VH6A 3ODDA 2BQ7B 1PQAA 1SGFG 1KXAA 2BD7A 3RXIA 1UTLM 2OTVA 2ZHEH 1F5RA 1N6YA 2ZCKP 9LPRA 1NC6A 3RXCA 4UDWH 2FMJA 3SV9A 2C8XB 1TABE 3RMMH 3KHVA 5C5OA 3ZZ8A 1S84A 5CHAB 1B0EA 3QTVH 4JZFH 4NIXA 1JRSA 2ZQ1A 2ANKH 1OYQA 5LPRA 2AIPA 1Z8RA 2AH4X 5EXMA 1TGTA 3U98H 1TPSA 2ODQA 3RUOA 1O3GA 2XNIA 3RU4T 4CHAB 1QL7A 3T27A 1HDTH 1KIGH 1O3MA 3HGNA 1C5ZB 3P92A 3QDZB 5DK1A 2D26C 1O3BA 1EB2A 1EJMA 1T31A 1GHAF 2EEKA 4DIIH 2STAE 3QK1A 4ABHA 2O8UA 1LCYA 1MZAA 3RU4E 1WUNH 5GWZA 2J9NA 4YO9A 1GPZA 1HAOH 1O2RA 3V3MA 2CGAA 3DA9B 2OC7A 3SU4A 2OINA 1A7SA 6LPRA 1UCYK 3KNXA 2BLOA 3SUGA 1TQ0B 1TAWA 1N6XA 1GBTA 2UUKB 2J95A 2BY9X 4DURA 3L33A 1HB0B 1TE0A 5FPTA 2SGPE 1H9HE 3Q77A 2G8TA 4ASHA 1RJXB 4GHTA 1GGDC 1ELVA 4R8TB 1PPGE 2ZHQH 1O2ZA 4ABBA 2I6QA 3GOVB 3JZ2B 3UY9A 1BTZA 4OS4A 3S9BA 1QRXA 2ASUB 1OX1A 3SJIA 1HJ9A 3MH6A 4UFGH 2XCNA 2IPHA 4X1QU 5A0BA 1XXFA 2ZG0H 7GCHF 3P8NA 1V2RT 1ZSJA 2ZDKA 5FHTA 3P70B 1BHXF 4OS7A 1O2GH 3QLPH 1VITH 3RXKA 1ORFA 5EXNA 4B71A 1O2UA 1LVYA 3SGQE 3DT0H 2AGIX 2FDAA 3HATH 3GCHB 3OU0A 1ZLRA 2ZDLA 3EDXB 3ZZ3A 1HGTH 1F7ZA 2PW8H 3A81A 3SHCH 1P0SH 2CMYA 3O8DA 3FANA 1MD8A 1GJ9B 4CBOA 2F9BH 2FOFA 2O9QA 2PSYA 4OS6A 2AMDA 3TK6A 1D3TB 1CT4E 1NS3A 1C1MA 1ZHMA 5IDKA 1THPB 2PUXB 2W7UA 1HXEH 3MU0A 4RN6A 1GMDG 5I46H 4Y0ZE 4NIWA 3EQ0H 1WCZA 1V2UT 1W0ZU 4AFUA 1O39A 3GDUA 1ZSLA 3E6PH 4MNXA 1K22H 3UTUH 4ABAA 1K1OA 1CHGA 2Y5GA 4X2XA 2ZTXA 3P8OA 1K1NA 4K8BA 2BOHB 4JZ1A 1QQUA 4FXGH 1LQDB 1IOEA 3I29A 1OOKB 2WUBA 1LQEA 1EPTC 4CBNA 1BRAA 3SNCA 2PKSC 1CSOE 4NA7A 4NIVA 2GCTB 1UTOA 1AFQB 1ID5H 3CENA 1BT7A 2IN2A 3SGAE 4Z0KA 4YOIA 1FPCH 3V0XA 1V3XA 1TRNA 2O8WA 4ZAEA 5ETXA 2ZU4A 1LHDH 1UCYH 3RXLA 4AYVB 1BTUA 3SU2A 4ZHLU 3PLKA 3A87A 1GHAG 1QURH 1GJ5H 3RM2H 4BTUB 4Q7YA 1E35B 1ZZZA 3M36A 4K1SA 1TOMH 3PB1E 2DE8A 3VB3A 1BMLA 1NROH 2KAIB 2P94A 3LGTA 3RC6A 1QA7A 1X7AC 3NWUA 1MBMA 2HNTE 1KXDA 1RRKA 4ABDA 2H2ZA 1O2QA 4Q7XA 1EOLA 3O8CA 3H7OA 4X6NA 1EPTB 2A0QB 1IHSH 2C3SA 3EBNA 3M3VA 3NK8A 3A82A 1GMDF 1JXPA 2FP7B 4INHA 4VGCC 5FBIA 3URCA 4CH8B 4IW4E 4K5ZA 1SGYE 4FUDA 4JK6A 2K1QA 2BZ6H 3GCHC 5B6OA 1KXFA 5FPYA 3V7TA 1O2MA 1TIOA 4H42U 5GIBA 1MH0A 1EZXC 1HIAB 1YGCH 2J34A 2WYJA 3QN7A 1NRQH 2VWNA 5ABWA 1DICA 5DP7A 3SO3A 2WPIS 2AS9A 2Z9LA 3GYMA 1O5AB 1J14A 1DX5M 2FI3E 2C8ZB 3LGWA 4X1NU 5CE1A 2ESTE 2HPPH 2STBE 3A7WA 1WTGH 2OXSA 1XKBC 2WUCA 3A8DA 3TPIZ 1GI9B 3SJOA 1KLTA 1G2LA 1ZMNA 3SV8A 2CHAC 1Y3XA 1O38A 4X8TH 3DD2H 1TA6A 1GHWH 4I33A 4XOJA 3LGYA 3GY8A 2OC1A 2ZCLP 2R2WU 1ESBA 5C1XA 1QTFA 4NA9H 5A09A 1GVZA 1C2DA 3BTHE 1O32A 1O2PA 1CU1A 3SQEE 3T2NA 1A5GH 2ZFTA 1HAGE 6GCHG 1O30A 4FUIA 2A31A 3PO1B 3UR9A 2G4UA 2SGAA 1W2KH 3RXOA 1JIMA 4K69A 1HAVA 3BG4B 1QL9A 2YOLA 4YOJA 1UVPA 2BLWA 5JBTA 1O2WA 1GHBG 5T6GA 5HGGA 2Z3DA 5EW1H 2SGEE 1S5SA 1UTNA 2NU4E 1VJ9U 3RXUA 2GT8A 1XVMA 2HRVA 3TIUA 4DVAU 2HNTC 4Y79A 1IQEA 3BTDE 2XW9A 3LGVA 1V2VT 1O37A 3FZDA 1GI1A 5GDSH 1YPHC 4OS2A 1G3CA 1AIXH 3BTFE 1C5QA 1ABIH 1SOZA 3LH1A 1GDQA 1SGQE 1EASA 1HAVB 4ZKSU 1F92A 4ZKNU 2SGDE 1GBCA 1KDQB 2D8WA 1V2KT 1TQ7B 2FI4E 3RU4D 4DG4A 7KMEH 2OP9A 1ZGIA 2A1DB 3E0PB 1BTPA 4LK4A 3VGCC 2K7XA 2BMGB 2Y7ZA 1OPHB 2ZDMA 2F3CE 2GCHF 2BD2A 1MQ6A 4IC6A 4ZXXH 3UNQA 1GL1A 3MNCA 1BUIA 3JZ1B 1RIWC 1T7CA 1TMTH 2WINI 3BTTE 3MWIU 2P8OB 1DWCH 1HFDA 3F9EA 1H1BA 2HPQH 2HOBA 2QCYA 3F9GA 2ULLA 2GDDA 5FPSA 4ZH8A 2F9OA 3STIA 2YNAA 1MKXK 4Y71A 3GY3A 1DUEA 1P05A 1YPLH 1L1GA 2G00A 1DSUA 1H8DH 3BTGE 3BTWE 2AMPA 1ZHRA 1NN6A 4UONA 3Q3XA 1P9SA 1VITF 2OD3B 2W3KA 3P95A 3LU9B 2GZ7A 2R3YA 3BTQE 1SL3A 2GP9B 4XSKU 1DE7H 2J2UA 4AOQA 5TCCA 1Q3XA 1S0RA 2A7JA 2GT7A 2EI6A 4FVBA 5EQRA 2RCEA 1FONA 3M5NA 3ZVEA 1A5HA 2TIOA 3PMAB 2GKVE 1C1OA 3GY6A 3A8BA 2OQUA 2F91A 2GCHG 4NGAH 4VGCB 5J4SA 1P2OA 1FY4A 4D7FA 6ESTA 1JBUH 2BY7X 3STJA 3ATIA 1NRRH 4I8JA 1UO6A 1NO9H 2H9HA 4GVUA 2W26A 2ZA5A 3UWJH 1YPHE 1UMAH 1AUJA 1IQKA 4U2WA 1GBBA 1TNLA 1XUKA 5JBBS 3R0FA 4MPVA 3V12A 1NFWA 1A0LA 3O8RA 2AIQA 5BRRE 2ZHFH 3QZRA 3LONA 3QGJA 1GMCF 2VB0A 3O8BA 4KKDA 1ZJKA 5A8XA 1GL0E 1GJ7B 3SV2H 1K21H 2R9PA 2VGCC 5E0HA 1C1TA 1BZXE 2XWBI 1UTMA 1SLUB 2LIZA 1BTHH 1PYTD 1SGDE 1QBNA 1EQ9A 3KIDU 2ZHWH 4H6TA 1C1RA 1H8IH 3KCGH 4GSOA 4GCHG 1K1PA 2AGEX 4Y76A 1A3EH 2HWLB 1ESAA 1VITG 3TGIE 5IYTA 4LZ4B 5A8ZA 4AX9H 2C8YB 4YT7H 4K1EA 1LHGH 4WVPE 1SGPE 4I32A 2FODA 1U6QA 2XWAA 4K1TA 3V13A 1ZPZA 2A5IA 1SHYA 3BTEE 3D65E 1TPAE 2UWOA 3K2UA 3A89A 4NA8A 3Q76A 1GJDB 1FPHH 1SQOA 2FPZA 3SU1A 1UK3A 1MCTA 1M9UA 4MNYA 1P8VC 2BDHA 3M61U 1A5IA 1FY3A 4WWYA 3ZVBA 2P59A 3RXFA 2NWNA 4NFFA 5F8ZA 1ZMLA 2WPMS 3BN9A 4Y11E 1LVOA 2OBQA 1MTNB 3GCOA 2Z7FE 1XUGA 3RM0H 1IQIA 3CS7A 4FUCA 4TY6A 2VIWA 2ANMH 3A7VA 3EA9A 3LGUA 1A46H 3A7XA 4Y8YA 2GDEH 1TLDA 1GMHF 1NRNH 1LPKB 1C5YB 1WQSA 1O5BB 3S9AA 1IQLA 3UPEA 3ZVDA 3T25A 2J92A 4R0IA 1UVTH 2FYRA 4UFDH 2OC8A 3L3TA 1Q31A 1ZTLA 1QGFA 4DW2U 2FOAA 1O2NA 3P8FA 2A4GA 1BRUP 3RMOH 2UWPA 3ZZ5A 1BMMH 2GZ8A 1BQYA 4WJG2 3AW0A 5JYIA 1K28D 2JH6D 1XKAC 4DGJA 2HLCA 3B9FH 4GCHF 4F49A 2Y5HA 3URDA 1CT0E 3BIUH 1G3DA 1L0ZA 1PPFE 3F68H 3LH3A 4AFZA 1T8OA 1O3DA 2VU8E 1K1IA 1YPGH 3LPRA 1JRTA 4Y6DA 1H9IE 2TGDA 1UHBA 2R2MB 5G4BA 3S7HB 3B8JA 3RXPA 5L2YH 4IC5A 1UVOA 4BXSA 5ESTE 2FXRA 1O2IA 2AFQB 4OGXA 3ZVCA 5K7RA 1ELGA 3VXFH 4X1SU 3VB5A 3ZV8A 5C2ZA 1MD7A 1HAZB 1GG6C 4XBDA 4NSVA 1NFUA 1ZTKA 1BTYA 1TNKA 1QB6A 2ZIQH 1C5UA 1DWBH 2OLGA 5EGMA 2BDBA 1P09A 3NUMA 1MTNC 2GGVB 5T3HA 4F4OC 1ELCA 1B7XB 1TALA 1O3HA 1UTKA 1V2NT 4IBLH 4WXVA 2BLVA 1DT2A 2A32A 3M7UA 4BAMB 2BY5X 3AASA 1S0QA 1HAHH 1DUAA 5FX5A 3AW1A 3RC4A 2FOHA 4H4FA 1ELFA 5DG6A 2BDIA 4NCYA 4WMDA 3ZZCA 4K60A 3S69A 4BAKB 5T6FA 2ZDNA 2Q6DA 3RMLH 2A7CA 1H9LB 1OWDA 1QB1A 4DJZB 1HAXB 2O8TA 4DCDA 1Z6EA 1HYLA 1YPMH 3MU5A 1LPZB 4JMYA 1CBWB 1JIRA 1MU8B 3KQEA 3Q3YA 4YT6H 1G36A 1WTHD 3GICB 1GI7B 4WH6A 4AFSA 1GBJA 4KELA 1L4DA 4I31A 1RXPA 3NXPA 2ZTZA 3FVFB 3OX7U 2ZGHA 1HJ8A 4CRDA 1GBMA 1C1PA 1AQ7A 1TNHA 2O8LA 4AORA 2PR3A 2VVCA 4ABEA 3P8GA 2VWOA 2AGGX 2H6MA 3TJVA 2TBSA 1J17T 1O3CA 5EG4A 3UWIA 1CVWH 4KGAA 1RS0A 2BX3A 1NM6A 1C1NA 1KTSB 1O3JA 1NFXA 3PWBA 2FI5E 3H7TA 2ZPQA 1V2ST 1O3KA 3BEIB 4I8KA 1UVUH 1SHHB 4ZKRU 3MNXA 3TVJB 2DUCA 1VCWA 1GI4A 1BCUH 1VR1H 3ATWA 1O5GH 3LGIA 4UEHH 3GY4A 1GVLA 1AKSB 2ZU3A 2XCFA 3PMHB 1Q2WA 1BRBE 2PGQB 1DPOA 2THFB 4AG1A 1PPBH 1AE8H 1IQGA 3TH4H 3RLYH 3IWMA 3TJNA 4B74A 4E7NA 4HZHA 1RFNA 4B76A 1Z1IA 1AGJA 1QBOA 3E0NB 4BAHB 1XUJA 4GUXA 2C8WB 3Q00A 1GBDA 1YCPH 2ZHDA 2ZWLH 4CR9A 2V0BA 1P9UA 2WPJS 2EI7A 4THNH 1V2TT 1MBQA 5DP6A 3UOPA 3ZZBA 4XE4A 1D3PB 1LPGB 4CRBA 1OXGA 3FZZA 2FLBH 1ANDA 1TNGA 2CV3A 1CO7E 2ZGCA 4I7YH 1WAYB 3A8AA 1SQAA 3MHWU 1P04A 4PROA 1HAIH 2BQWB 3GDVA 3SZNA 3TK5A 2H5DA 1EKBB 5CMXH 3TJUA 2P3TB 3N7OA 4ESTE 1N1LA 4X0WU 6GCHF 2QV1A 3EA7A 1KSNA 2SGFE
chains in the Genus database with same CATH superfamily
3BV9B 5LGOA 2PGBB 3N7DA 4YESB 4NWLA 1T4UH 1XX9A 1KDQA 1YY3A 2FLRH 2A4QA 1Y3YA 5AHGH 3U8RH 1AY6H 1DY8A 1WSSH 4E05H 1BDAA 3QWCH 4XFQA 3T28A 1ANBA 1TFXA 1CGHA 5AF9H 1TPOA 3E90B 4YOGA 2BD8A 2XBWA 3E3TA 1C2LA 1C5OH 1T8MA 2G5VA 1N8OB 1QQ4A 2XBVA 3A7YA 1TMBH 1D9IA 1GDNA 5FAHA 3BIVH 3P6ZB 3NPSA 4O3UA 2ZP0H 4JZEH 3ATLA 2TRMA 2F9NA 2FESH 1P2IA 2VVUA 2CF8H 2Y6TA 1QRWA 2GV6A 2I6SA 1G3BA 4JCNA 2PKSB 3TH3H 4JK5A 1V2QT 4GLYA 3KL6A 3HGPA 4CRCA 1O3LA 3VXEH 2SNWA 1GBEA 3RXQA 3M35A 1FY1A 2A5AA 3ZYEA 3A83A 1SGTA 5GNDA 5A0AE 4I8HA 3M3TA 1TBZH 4LOYH 1LVBA 1CHOF 2ZTYA 1T32A 1O33A 3TGJE 2KM0A 1CHOG 3A85A 3PO1C 5DJ7A 1W11U 5DP5A 1MUEB 3E8LA 1GCDA 4MPXA 2OQ5A 1D4PB 3GDSA 2QXIA 2FOGA 4MVNA 1BTXA 4Y8ZA 1FMGA 1TNIA 1TX6A 2ZO3H 4AG2A 2ZFQH 5EU8A 1QCPA 3SHAH 3GY5A 2PTCE 3I77A 4BTTB 2FX4A 2V35A 2PV9B 1TPPA 1NRPH 2KFWA 2XC0A 3LJJA 4Y7BA 2VJ1A 3MU4A 4NZQA 1O2LA 2ZZUH 2IJOB 3BEFB 2EC9H 1SFIA 1EXFA 2J98B 4D7GA 2ODPA 3BG8A 6CHAB 1WYKA 3A8CA 1LTOA 2VIVA 4YLUA 3N99A 2EQNA 4A1XA 2SGQE 1CT2E 4AYYB 1DXWA 1VCPA 4BANB 2O8MA 3F1SB 4FUGA 1RTFB 2A7HA 1HV7A 1KLIH 1EZQA 5DKMA 1ZYOA 2P3FH 3UR6A 1AO5A 3VFEA 4WY3A 4DIHH 1SB1H 2GTBA 1A1RA 3LIWA 1GJ4H 2ZI2H 5JBAS 3PMJA 1YLCA 1GGDB 1W12U 4JYTA 3SNAA 2RDLA 1BRCE 1VGCB 4X2YA 1KY9A 1XVOA 1RIWB 3RXAA 1ETSH 1PJPA 1GI3A 1O2YA 1O3OA 1O0DH 1P12E 4UFFH 1SVPA 4ZHAA 4U30A 4B6FA 1D3DB 2F9VA 1O2VA 1P2QA 5H4IB 1O3EA 1TX8A 1LMWB 5BPEA 1Y59T 4YM9A 2BXTH 3OTJE 4D9RA 1SFQB 2J4IA 2JH5D 5EODA 5T1VA 2Q6GA 1LKAA 2QY0B 3I78A 3UFAA 3OY6U 1F0SA 2QAAA 1FIZA 4WMFA 2Z9JA 1ZPCA 3GCNA 3VB6A 3MH4A 5FBEA 2UWLA 3KN2A 1SI5H 1C1WH 5C5NA 1QB9A 3RXMA 5E2PA 1D6WA 2C90B 5L30H 1LVMA 1TRMA 1O5DH 3HK3B 1D6RA 1SBWA 4KTCA 4Q2KA 4XRNA 3MU1A 1UK2A 1FUJA 2G55A 4XD7D 2PFEA 2FTLE 2KCAA 1H4WA 2WHXA 1PPCE 1GCTC 2B7DH 4RT1A 1C5SA 3UB0A 1O2TA 1GBHA 4BTIB 1G2MA 5TCAA 1EX3A 1W7XH 4QT8C 1C9PA 3MO6A 1BMFD 3BSQA 4AGKA 2WZQA 1P03A 1AI8H 3AAUA 1KYNA 2BY8X 3ZZ9A 5LPEA 3U8OH 1DXPA 4B2CA 5EJ1A 1DWDH 1OP0A 3R3GB 2PWXA 5F8TA 4B2AA 3TK9A 3ODFA 1UK4A 1XUIA 2TGTA 2G4TA 3SGBE 1AFEH 1Z8JB 3VB7A 1VZQH 5FCKA 1V2MT 5GCHG 4CR5A 2VIOA 2Y7XA 1GMHG 2VGCB 2QYIA 3MTYA 1BIOA 2ZNKH 3KYFA 1GJ6A 2GMTC 4A1VA 2OCVB 2Z3CA 2BDYA 3BG4C 1FJSA 4UFEH 1MCVA 4SGAE 4CREA 2P16A 2HGTH 3KGPA 5HYOA 1NTPA 1XXDA 4BAQB 3PTBA 1NY22 2ALVA 2QXHA 2Z9IA 4TYDA 1K1MA 1FN8A 4D9QA 2EY4C 3EE7A 1YKTA 3OE7D 1HCGA 1MU6B 4XBBA 1DLKB 1W14U 2ODYB 2AEIH 3RXGA 4B6EA 3GY7A 1B5GH 2F83A 2Z94A 4ISNA 4BXWA 2W5EA 1UTJA 1AVXA 1FIWA 2ZU1A 2JH0D 2R0LA 1OWEA 3ZZ7A 1S6FA 4IMZA 5FL7D 1SKYE 1H8ED 2P93A 3RLWH 4ZKOU 1C4V2 3QZQA 2J97A 2ZC9H 2ZGBH 2AYWA 4ISLA 4KTUA 2EI8A 3M3SA 1MZDA 3MI4A 3MOCA 2F9PA 1QA0A 9ESTA 1IQMA 1NZQH 1OS8A 3LJOA 1FY8E 1FAXA 1SGEE 2BOKA 3K6ZA 2Q1JA 1LO6A 1CBWC 2KR7A 3RXBA 3B23B 1VJAU 2GJGA 1SOTA 4WF8A 1NT1A 1O2HA 1AN1E 3C27B 1IHTH 3KF2A 5AFZH 1BMAA 2ZFSA 3NRLA 1GBLA 4FUHA 1GBFA 4Z6AH 1SPJA 2ZPRA 1E1RD 1AHTH 1C2FA 3RC5A 2CXVA 3K9XB 4Z1MD 2JETB 1ZSKA 1XMNB 2RA3A 1PPEE 1FY5A 5A8YA 1CE5A 1QJ1B 3ZVFA 1P11E 2J38A 1AZZA 3RXRA 1GMCG 3ATKA 1C4Y2 1DY9A 4O3TA 2QE7D 2LPRA 3D49H 1MTWA 2B5TB 4Q7ZA 6CHAC 2FO9A 1E37B 1V2OT 1P06A 3SJ8A 1C1UH 2BDCA 2ZF0H 3HK6B 2NU2E 1V2WT 1IAUA 5JB9S 2AERH 3SBKA 4YTAA 1CQQA 3SI3H 1AE5A 4MNVA 1KLJH 3PLPA 4OS5A 1QIXB 1YCPM 1ACBE 3NZIA 4B1TA 5A2MH 3SQHE 4A92A 2ZDVH 1SGFA 1BB0B 1LKBA 4A6LA 1Y3UA 2BVXH 3D23A 1GDUA 1DSTA 1C2HA 3EGKH 2RG3A 1BJUA 1V2JT 1ZMJA 4I8LA 1P3CA 1GHZA 1DFPA 2H9EH 4KP0A 1S82A 3LT3A 1V2LT 2ZQ2A 3OYPA 2Y81A 1CA0B 1AMHA 1WQVH 1QR3E 1E34B 4U32A 3M37A 4JYVH 2FWWA 1OSSA 2W3IA 1MKWH 1OYTH 2GMTB 1AKSA 1A61H 1O3AA 4FU7A 4M9FA 4E7RG 1FN6A 2Y5FA 3KQ5A 5EQSA 3VGCB 1J15A 5DP4A 3ELAH 1DM4B 4X6PA 1EPTA 1GI5A 1K9OE 4DT7B 1BMNH 2A4RA 4FVDA 2BTCE 2VIQA 3DSGA 3M5MA 2BDGA 4ZXYH 3T26A 5DO4H 3NCLA 2FS8A 4MPWA 1MAYA 1QFKH 4ISOA 1W7GH 2XTTB 5HM9A 2CJIA 1W13U 1W3CA 1TA2A 4FU9A 4NSYA 1DANH 3SW2B 4X2VA 1GI2A 1HAYB 3EE0B 3GCTF 4J2YB 1YPJH 5E8EH 1C1QA 2FYQA 1NESE 1S85A 2OUAA 1MTSA 3LKWA 1ZOMA 2WPDD 2PKAA 3PWCA 4ABFA 1Y3VA 4ABIA 2Z9GA 2PHBA 1DLEA 1SGIB 4X2WA 2W7SA 3UIRA 4MLFB 1KXEA 1GJCB 2P8OC 4A1TA 2C93B 2HALA 1T4VH 1Y5UT 1GCTB 1K1JA 4JZDH 1C5LH 3TJOA 3DCLA 1AWHB 2YNBA 1G32B 1SR5C 1LHFH 1TBQH 1TRYA 5C67A 1O5EH 1YM0A 4X1PU 4XDEA 3F0PA 1C5VA 1GG6B 1HRTH 1F5LA 5C1UA 1FI8A 2XC4A 3ESTA 2FIRH 4INKA 5E0JA 1DVAH 3T29A 3FAOA 5KECA 2GV7A 1DS2E 4K8YA 3UNSA 1HNEE 1P2MA 1KXBA 1CA0C 1NU7B 1YPKH 1P2KA 2A2QH 2FM2A 3SJ9A 3WY8A 4CHAC 2GCTC 2ILNA 1TOCB 3PM3A 5DP3A 2LNCA 1TWXB 5A0CA 2PUQH 1EP5A 2A4OA 2PSXA 1DITH 1JWTA 1GHBF 4RSPA 2KZ4A 2VIDA 3SUDA 1BBRH 3RP2A 2GZ9A 2JIZD 1TBRH 2VWLA 7LPRA 2FX6A 3PRDA 1A2CH 2VIPA 3MMGA 1MABB 4DOQA 1A3BH 1BA8B 1P2NA 4X8UH 2TGAA 1BJVA 1GI0A 1AU8A 3QTOH 3OY5U 3S9CA 1PPHE 1E36B 1C2IA 1Z8IB 1BBRK 4I8GA 4RKOB 1EAIA 1KXCA 3PMBB 2A2XH 2VBCA 4X1RU 2ZDAH 4X6OA 1EAXA 4FUJA 5SGAE 2H5CA 1UVSH 4MNWA 2P3UB 4ABJA 4OS1A 2UUYA 4HI3A 2FZZA 1ZTJA 1C9TA 3MU8A 3DHKH 4TPIZ 3P17H 3IITA 2JETC 1O3IA 1ELDE 1C5MD 2OC0A 2BD5A 1HLTH 2Y80A 1Z71A 3LC3A 4B73A 3U1JB 1TGNA 1SGRE 2XC5A 1GHYH 2HNTF 2H9TH 4MQAA 1HIAA 1V2PT 1SQTA 3SV7A 4HGCA 1F2SE 4TWYA 2ANYA 3SJKA 3UUZA 4AB8A 1K1LA 2D2DA 1MMJN 3MH5A 2QF0A 4B75A 2AHME 1GBKA 1PQ8A 5DGJA 1ARCA 1AUTC 3ZZ6A 1NPMA 1BBRE 1NRSH 1Z7KA 4ZUHA 2XBYA 1QL8A 2Z6BD 4AGJA 2FOEA 1SSXA 2SFAA 1AB9C 3ITIA 1FAKH 4AN7A 1UTPA 2WV5A 1EB1H 3M5OA 2VNTA 2KAIA 2P95A 2QGRA 3GYLB 4MG3A 3CP7A 4NFEA 5HXFA 2LP6A 5F8XA 3BTKE 1EUFA 2DE9A 2FS9A 5EPNA 3TNSA 3KEEA 1SLVB 2IOTA 2XYAA 3SI4H 2V3OH 2UUFB 4Y8XA 3ATMA 1C2EA 2G5NA 5F03A 3ZZAA 1ETRH 1XUFA 4CRGA 5T6DA 1ARBA 3RXHA 3TH2H 3RXDA 2Q6FA 1ELAA 3ZVAA 1O31A 4INLA 3VG8A 2FOBA 4O9VA 1ANCA 5GJ4B 4X6MA 1P2JA 4ZHMU 2A5KA 1T8NA 2QXJA 1K2I1 1PFXC 3DSOA 2PTNA 4GHQA 3BEUA 2G52A 1EAUA 3QUMP 4TY7A 5EQQA 1QNJA 4X8SH 3WWFA 2ZPSA 1HAPH 2RA0A 3OFND 1ZGVA 2AMQA 1JMOH 2WPHS 3MNBA 2FOCA 3GISB 1YPEH 1GVKB 2M5TA 1EAWA 1GBIA 1O3NA 5KEDA 2QF5A 2BHGA 3LC5A 1J16A 5JDUB 4AZ2B 2VH0A 4H6SB 1ELEE 1MAXA 1OP2A 2R3UA 1C2JA 1C5XB 1O2JA 3QO6A 4AB9A 3U69H 2ZFRH 5EXLA 1G9IE 7ESTE 4BOHA 1F0UA 3ZYDA 1GJ8B 3H5CB 3UQVA 5ESBA 1SG8B 3KQBA 1C5PA 1ELBA 2GVFA 3PV5A 1FLEE 2Z3EA 1QY6A 1C1SA 1LDTT 3PYHA 5HMAA 2CHAB 4TWWA 4DY7B 3C1KA 2WYGA 1CA8B 4NG9H 4Y10E 3AAVA 1YBWA 3MFJA 3ZIAD 2G51A 1C1VH 3SUEA 1IQHA 1TX7A 2J94A 2W6JD 3M7TA 1PPZA 5L2ZH 2HVXA 1SGNE 1NFYA 3FP7E 2ZEBA 1S6HA 1KTTB 1L4ZA 4J1YA 4ABGA 2BY6X 4TT3D 4WH8A 1ANEA 8LPRA 2J5UA 1YF4A 1WBGB 2QIQA 1QHRB 1ETTH 1RTLA 4YXWD 1GI8B 2VINA 1SGCA 7GCHG 1L1JA 1PQ7A 3LDXH 2BLQA 2ZFFH 2JKHA 4LXBH 5E2OA 4UD9H 1H8HD 4B2BA 2WV4A 1VKYA 2ZU5A 1C4U2 4NIYA 3EYDA 3MH7A 4FU8A 5FCRA 2CF9H 1C5NH 1E38B 1A4WH 5AFYH 1O5CB 1P3EA 1WU1A 4D76A 1PQ5A 1A0JA 1G37A 3T62A 1GJBB 1YLNA 3VEQB 1P10A 5I25A 1FXYA 1TMUH 1OWIA 5AVDA 3PROA 3VPKA 3W95A 5CHAC 1BITA 1SMFE 2PKAB 1LHEH 1ZHPA 2ZKSA 1XM1A 3TGKE 4IGDA 4CRFA 1AWFH 1FX0B 3UNRA 3SNBA 5JB8S 3U9AH 3MO9A 2PLXA 1F0TA 3U28C 5K0HA 1WOFA 3PV2A 1GHXH 1ZR0A 1S6LA 3TU7H 1B0FA 3HKIB 1XUHA 5CHBA 5F6MA 5GXPA 3SN8A 2D1JA 1GWAA 1V6DA 3SNDA 3SU5A 2WPLS 2CN0H 1AVWA 4D8NA 1MQ5A 1AZ8A 3EA8A 4U01A 3A80A 3OSYA 1OKXA 1YLDA 1IQFA 4O03A 2XRCA 5JBCS 4MTBA 1O3FA 5DP8A 5L6NH 3FOAA 4RKJB 3TITA 2H1UA 2XBXA 4ISHH 3SOSA 1W8BH 1AD8H 4HTCH 4IN2A 3FKSD 1EZUC 4KTSA 3F9HA 3MYWA 2ZGJA 4BAOB 4Y7AA 1DDJA 2XNDD 1SLWB 2QF3A 3BTME 2F9UA 2BZAA 1Y5AT 4ZMAH 1C5TA 3E91A 1TB6H 1Z8GA 5EW2H 3RDZA 5FX6A 1P02A 1WDIA 5EOKA 1NBME 2KCPA 1IQNA 3LOXA 5TJXA 3F9FA 4OGYA 2GD4B 1BTWA 3MNSA 1CGIE 3U1IB 3SV6A 3AVZA 1INCA 1L2EA 1MKXH 1Z6JH 3UREA 3DFJA 5C17A 1HJAB 1TGBA 2ANWA 1TONA 3ENSB 1AVGH 2FOMB 1C2KA 1PYTC 1Z1JA 3RXSA 1E1QD 1QRZA 3L6PA 5KGOA 1O2XA 1TNJA 4IN1A 4HFPB 1W0YH 1SC8U 1YC0A 4X8VH 4BNRA 2VVVA 3FP6E 3HPTB 2TPIZ 3S0NA 2ZCHP 2SNVA 3ZVGA 1TYNA 1IQJA 1C2MA 1ZRKA 1QBVH 3RXJA 3SORA 1OP8A 1THSH 1ABJH 2EA3A 4NZLA 1ELTA 4CRAA 1THRH 3F6UH 4FUEA 1O2OA 5GCHF 4ISIH 1S83A 2ZFPH 2BDAA 1F0RA 1P57B 5LH8A 1FNIA 1Y8TA 1OWKA 1EJNA 1F5KU 1S81A 3SU3A 3QGNB 2HLDD 5PTPA 1MTUA 3FP8E 3A7TA 3UQOA 1ESTA 5EJLA 3KQCA 4CH2B 2VWMA 2YMSC 4SGBE 3N7EA 1OWHA 5LPFA 1VCQA 2UUJB 3T5FH 1NU9A 2BVSH 3SU6A 2BXUH 2KCYA 5DPAA 1AFQC 5FXLA 3WWBA 1BHXB 1C5WB 4GAWA 3SUFA 2TGPZ 1AB9B 4K2YA 4A7IB 5DP9A 2BX4A 1RTKA 2R0KA 3Q3KA 2BB4A 1VGCC 2QN5T 5C20A 3M7QA 2ALPA 3MO3A 2WSSD 2A45B 3RXVA 1FV9A 2NU1E 3S7KB 1YCPK 1ZJDA 4K3JA 3UOUA 2BQ6B 1EOJA 2BD4A 3ZZ4A 1O36A 1HUTH 2BYAX 1G3EA 5EPYA 2FEQH 4LZ1H 4YZUA 1O3PB 1O2KA 1WV7H 1LHCH 3SU0A 3BF6H 1ZPBA 8KME2 1UCYE 2GX4A 3A84A 3IG6B 5C1YA 2B8OH 1GI6A 3PLBA 1HPGA 1RGQA 3KQDA 3GCTG 1OWJA 3EAJA 3HKJB 3ZV9A 5JPMH 3SNEA 4FUFA 1NBMD 1MKWK 2V6NA 4GPGA 5DN6D 1MTVA 1C2GA 1YYY1 3ZZDA 2NU3E 3PV4A 1A0HB 2Z9KA 1CGJE 3M5LA 1W0JD 3QX5H 2BM2A 8ESTE 4MPUA 3K65B 1UJ1A 1Y5BT 8GCHF 4IMQA 3RXTA 1EZSC 3A88A 3RXEA 1DOJA 1QJ7B 4IS5A 1E0FD 1J8AA 2B9LA 3D62A 3RMNH 1O35A 4JZIA 2WPKS 4YLQH 4Y0YE 4M7GA 2ZU2A 1FZZA 2C4FH 1FDPA 1EP6A 2QXGA 1YP9A 1ZRBA 1EATA 3TLOA 2BD9A 3E1XB 3U8TH 2Y82A 3FO8D 8GCHG 4FUBA 3DFLA 4ZROA 1EJAA 4E06H 4JYUH 5HM2A 1C5RA 3PTNA 4TPYA 5E0GA 2ZECA 2F43B 3W94A 2B0FA 3A86A 1J9CH 1SLXB 1T8LA 2OBOA 1W10U 1UTQA 3G01A 4NWKA 3VB4A 1G30B 3E16B 4Q80A 2G81E 1O5FH 4WMEA 3TNTA 1UHBB 1JOUB 2BD3A 2FTMA 1RD3B 2NU0E 4UE7H 1Y3WA 2XXLA 4O97A 5HIZA 4A5TS 1K0HA 3GY2A 1BOQA 2ZGXH 2BVRH 3CS0A 1TGSZ 4WXIA 1TGCA 1N8OC 1HBTH 1L1NA 3K6YA 4RT0A 4P00A 3FFGA 4AFQA 1HJAC 1D3QB 1FQ3A 1O34A 1DWEH 1GJAB 2QA9E 4XBCA 3NKKA 1GBAA 3A7ZA 2V7QD 1GHVH 2V3HH 3DUXH 1QJ6B 1P01A 5GPIB 2QC2A 4MDSA 5J4QA 5C3NA 1HXFH 1O2SA 2VH6A 3ODDA 2BQ7B 1PQAA 1SGFG 1KXAA 2BD7A 3RXIA 1UTLM 2OTVA 2ZHEH 1F5RA 1N6YA 2ZCKP 9LPRA 1NC6A 3RXCA 4UDWH 2FMJA 3SV9A 2C8XB 1TABE 3RMMH 3KHVA 5C5OA 3ZZ8A 1S84A 5CHAB 1B0EA 3QTVH 4JZFH 4NIXA 1JRSA 3UAIC 2ZQ1A 3CNRA 2ANKH 1OYQA 5LPRA 2AIPA 1Z8RA 2AH4X 5EXMA 1TGTA 3U98H 1TPSA 2ODQA 3RUOA 1O3GA 2K8IA 2XNIA 3RU4T 4CHAB 1QL7A 3T27A 1HDTH 1KIGH 1O3MA 3HGNA 1C5ZB 3P92A 3QDZB 5DK1A 2D26C 3WW7A 1O3BA 1EB2A 1EJMA 1T31A 1GHAF 2EEKA 4DIIH 2STAE 3QK1A 4ABHA 2O8UA 1LCYA 1MZAA 3RU4E 1WUNH 5GWZA 2J9NA 4YO9A 1GPZA 1HAOH 1O2RA 3V3MA 2CGAA 3DA9B 2OC7A 4AC9A 3SU4A 2OINA 1A7SA 6LPRA 1UCYK 3KNXA 2BLOA 3SUGA 1TQ0B 1TAWA 1N6XA 1GBTA 2UUKB 2J95A 2BY9X 4Q4LA 4DURA 3L33A 1HB0B 1TE0A 5FPTA 2SGPE 1H9HE 3Q77A 2G8TA 4ASHA 1RJXB 4GHTA 4P02A 1WXRA 1GGDC 1ELVA 4R8TB 1PPGE 2ZHQH 1O2ZA 4ABBA 2I6QA 3GOVB 3JZ2B 3UY9A 1BTZA 4OS4A 3S9BA 1QRXA 2ASUB 2WV9A 1OX1A 3SJIA 1HJ9A 3MH6A 3OEHD 2XCNA 4UFGH 2IPHA 4X1QU 5A0BA 1XXFA 2ZG0H 2IJD1 7GCHF 3P8NA 1V2RT 1ZSJA 2ZDKA 5FHTA 3P70B 1BHXF 4OS7A 1O2GH 3QLPH 1VITH 3RXKA 3F3BA 1ORFA 5EXNA 4B71A 2L6OA 1O2UA 1LVYA 3SGQE 3DT0H 2AGIX 2FDAA 3HATH 3GCHB 3OU0A 1ZLRA 2ZDLA 3EDXB 3ZZ3A 1HGTH 3OAAD 1F7ZA 2PW8H 3A81A 3SHCH 1P0SH 2CMYA 3O8DA 3FANA 1MD8A 1GJ9B 4CBOA 2F9BH 2FOFA 2O9QA 2PSYA 4OS6A 2AMDA 3TK6A 1D3TB 1CT4E 1NS3A 1C1MA 1ZHMA 5IDKA 1THPB 2PUXB 2W7UA 1HXEH 3MU0A 4RN6A 1GMDG 5I46H 1QZ8A 4Y0ZE 4NIWA 3EQ0H 1WCZA 1V2UT 1W0ZU 4AFUA 1O39A 3GDUA 1ZSLA 3E6PH 4MNXA 5HIYA 3W1EA 1K22H 3UTUH 4ABAA 1K1OA 1CHGA 2XOKD 2Y5GA 4X2XA 2ZTXA 3P8OA 1K1NA 4K8BA 3SYJA 2BOHB 4JZ1A 1QQUA 4FXGH 1LQDB 1IOEA 3I29A 1OOKB 2WUBA 1LQEA 1EPTC 4CBNA 1BRAA 3SNCA 2PKSC 2QF4A 1CSOE 4NA7A 4NIVA 2GCTB 1UTOA 1AFQB 1ID5H 3CENA 1BT7A 2IN2A 3SGAE 4Z0KA 4YOIA 1FPCH 3V0XA 1V3XA 1TRNA 2O8WA 4ZAEA 5ETXA 2ZU4A 1LHDH 1UCYH 3RXLA 4AYVB 1BTUA 3SU2A 4ZHLU 3PLKA 3A87A 1GHAG 1QURH 1GJ5H 3RM2H 4BTUB 2JJ2D 4Q7YA 1E35B 1ZZZA 3F0OA 3M36A 4K1SA 1TOMH 3PB1E 2DE8A 3VB3A 1BMLA 1NROH 2KAIB 2P94A 2PP6A 3LGTA 3RC6A 1QA7A 1X7AC 3NWUA 1MBMA 2HNTE 1KXDA 1RRKA 4ABDA 2H2ZA 1O2QA 4Q7XA 1EOLA 3O8CA 3H7OA 4Q63A 4X6NA 1EPTB 2A0QB 2IPQX 1IHSH 3OEED 2C3SA 3EBNA 3M3VA 3NK8A 3A82A 1GMDF 1JXPA 2FP7B 4INHA 4VGCC 5FBIA 3URCA 4CH8B 4IW4E 4K5ZA 1SGYE 4FUDA 4JK6A 2K1QA 5B6LA 2BZ6H 3GCHC 5B6OA 1KXFA 5FPYA 3V7TA 1O2MA 1TIOA 4H42U 5GIBA 1MH0A 1EZXC 1HIAB 1YGCH 2J34A 2WYJA 3QN7A 1NRQH 2VWNA 4F48B 5ABWA 1DICA 5DP7A 3SO3A 2WPIS 2AS9A 2Z9LA 3GYMA 2FI3E 1O5AB 1J14A 1DX5M 2C8ZB 3LGWA 4X1NU 5CE1A 2ESTE 2HPPH 2STBE 3A7WA 1WTGH 2OXSA 1XKBC 2WUCA 3A8DA 3TPIZ 1GI9B 3SJOA 1KLTA 1G2LA 1ZMNA 3SV8A 2CHAC 1Y3XA 1O38A 4X8TH 3DD2H 1TA6A 1GHWH 4I33A 4XOJA 3LGYA 3GY8A 2OC1A 2ZCLP 2R2WU 1ESBA 5C1XA 1QTFA 4NA9H 5A09A 1GVZA 1C2DA 5C0TA 3F2FA 3BTHE 1O32A 1O2PA 1CU1A 3SQEE 1E79D 3T2NA 1A5GH 2ZFTA 1HAGE 6GCHG 1O30A 4FUIA 2A31A 2RDEA 3PO1B 3UR9A 2G4UA 2SGAA 1W2KH 3RXOA 1JIMA 4K69A 1HAVA 3BG4B 1QL9A 2YOLA 4YOJA 1UVPA 2BLWA 5JBTA 1O2WA 1GHBG 5T6GA 5HGGA 2Z3DA 5EW1H 2SGEE 1S5SA 1UTNA 2NU4E 1VJ9U 3RXUA 2GT8A 1XVMA 2HRVA 3TIUA 4DVAU 2HNTC 4Y79A 1IQEA 3BTDE 2XW9A 3LGVA 1V2VT 1O37A 3FZDA 1GI1A 5GDSH 1YPHC 4OS2A 1G3CA 1AIXH 3BTFE 3FN8A 3AK5A 1C5QA 1ABIH 1SOZA 3LH1A 1GDQA 1SGQE 5DSFA 1EASA 1HAVB 4ZKSU 1F92A 3F2GA 4ZKNU 2SGDE 1GBCA 1KDQB 2D8WA 1V2KT 1TQ7B 2FI4E 4ASUD 3RU4D 4DG4A 7KMEH 2OP9A 1ZGIA 2A1DB 3E0PB 1BTPA 4LK4A 3VGCC 2K7XA 2BMGB 2Y7ZA 1YWUA 1OPHB 2ZDMA 2F3CE 2GCHF 2BD2A 1MQ6A 4IC6A 4ZXXH 3UNQA 1GL1A 2YMSB 3MNCA 1BUIA 3JZ1B 1RIWC 2L74A 1T7CA 1TMTH 2WINI 3BTTE 3MWIU 2CK3D 2P8OB 1DWCH 1HFDA 3F9EA 1H1BA 2HPQH 4FOUC 2HOBA 2QCYA 1EFRD 3KYGA 1OHHD 3F9GA 2ULLA 2GDDA 5FPSA 4ZH8A 5CDFE 5EIYA 2F9OA 3STIA 2YNAA 1MKXK 3H09A 4Y71A 3GY3A 1DUEA 1P05A 1YPLH 1L1GA 2G00A 1DSUA 1H8DH 3BTGE 3BTWE 2AMPA 1ZHRA 1NN6A 4UONA 3Q3XA 1P9SA 1VITF 2OD3B 2W3KA 3P95A 3LU9B 2GZ7A 2R3YA 3BTQE 1SL3A 2GP9B 4XSKU 1DE7H 2J2UA 4AOQA 5TCCA 4FETA 1Q3XA 1S0RA 2A7JA 2GT7A 2EI6A 4FVBA 3MQKC 5EQRA 4ACAA 2RCEA 1FONA 3M5NA 3ZVEA 1A5HA 2TIOA 3PMAB 2GKVE 1C1OA 3GY6A 3A8BA 2OQUA 2F91A 2GCHG 4NGAH 2J98A 4VGCB 5J4SA 1P2OA 1FY4A 4D7FA 6ESTA 1JBUH 2BY7X 3STJA 3ATIA 1NRRH 4I8JA 1UO6A 1NO9H 2H9HA 4GVUA 5C0UA 2W26A 2ZA5A 3UWJH 1YPHE 1UMAH 1AUJA 1IQKA 4U2WA 1GBBA 1TNLA 1XUKA 5JBBS 3R0FA 4MPVA 3V12A 1NFWA 1A0LA 3O8RA 2AIQA 2KCOA 5BRRE 2ZHFH 3QZRA 3LONA 3QGJA 1GMCF 2VB0A 3O8BA 4KKDA 1ZJKA 5A8XA 1GL0E 1GJ7B 3SV2H 1K21H 2R9PA 4TSFD 2VGCC 5E0HA 1C1TA 1BZXE 2XWBI 1UTMA 1SLUB 2LIZA 1BTHH 1PYTD 1SGDE 1QBNA 1EQ9A 3KIDU 2ZHWH 4H6TA 1C1RA 1H8IH 3KCGH 2OK5A 2W6ID 4GSOA 4GCHG 1K1PA 2AGEX 4Y76A 1A3EH 2HWLB 1ESAA 1VITG 3TGIE 5IYTA 4LZ4B 5A8ZA 4AX9H 2C8YB 4YT7H 4K1EA 1LHGH 4WVPE 1SGPE 4I32A 2FODA 1U6QA 2XWAA 4K1TA 3V13A 1ZPZA 2A5IA 1SHYA 3BTEE 1COWD 4DT4A 3D65E 1TPAE 2UWOA 3K2UA 3A89A 4NA8A 3Q76A 1GJDB 1FPHH 1SQOA 2FPZA 3SU1A 1UK3A 1MCTA 1M9UA 4MNYA 1P8VC 2BDHA 3M61U 1A5IA 1FY3A 4WWYA 3ZVBA 2P59A 3RXFA 2NWNA 4NFFA 5F8ZA 1ZMLA 2WPMS 3GS9A 3BN9A 4Y11E 1LVOA 2OBQA 1MTNB 3GCOA 2Z7FE 1XUGA 3RM0H 1IQIA 3CS7A 4FUCA 4TY6A 2VIWA 2ANMH 3A7VA 3EA9A 3LGUA 1A46H 3A7XA 4Y8YA 2GDEH 1TLDA 1GMHF 1NRNH 1LPKB 1C5YB 1WQSA 1O5BB 3S9AA 4ACBA 5C94A 1IQLA 3UPEA 3ZVDA 3T25A 2J92A 4R0IA 1UVTH 2FYRA 4UFDH 2OC8A 3L3TA 1Q31A 1ZTLA 1QGFA 4DW2U 2FOAA 1O2NA 3P8FA 2A4GA 1BRUP 3RMOH 2UWPA 3ZZ5A 1BMMH 2GZ8A 1BQYA 4WJG2 3AW0A 5JYIA 1K28D 2JH6D 1XKAC 4DGJA 2HLCA 3B9FH 4GCHF 4F49A 2F4LA 2Y5HA 3URDA 1CT0E 3BIUH 1G3DA 1L0ZA 1PPFE 3F68H 3LH3A 4HG6A 4AFZA 1T8OA 1O3DA 2VU8E 1K1IA 1YPGH 3LPRA 1JRTA 4Y6DA 1H9IE 2TGDA 3DSPA 1UHBA 2R2MB 5G4BA 3S7HB 5HKKD 2JJ1D 3B8JA 3RXPA 5L2YH 4IC5A 1UVOA 4BXSA 5ESTE 2FXRA 1O2IA 2AFQB 4OGXA 3ZVCA 5K7RA 1ELGA 3VXFH 4X1SU 3VB5A 3ZV8A 5C2ZA 1MD7A 1HAZB 1GG6C 4XBDA 4NSVA 2K0QA 1NFUA 1ZTKA 1BTYA 1TNKA 4OM9A 1QB6A 2ZIQH 1C5UA 1DWBH 2OLGA 5EGMA 2BDBA 1P09A 3NUMA 1MTNC 2GGVB 5T3HA 4F4OC 1ELCA 1B7XB 1TALA 1O3HA 1UTKA 1V2NT 4IBLH 3SZEA 4WXVA 2BLVA 1DT2A 2A32A 3M7UA 4BAMB 2BY5X 3AASA 1S0QA 1HAHH 1DUAA 5FX5A 3AW1A 3RC4A 2FOHA 2LELA 4H4FA 1ELFA 5DG6A 2BDIA 4NCYA 2V3MA 4WMDA 3ZZCA 4K60A 3S69A 4BAKB 5T6FA 2ZDNA 2Q6DA 3RMLH 2A7CA 1H9LB 1OWDA 1QB1A 4DJZB 1HAXB 2O8TA 4DCDA 1Z6EA 1HYLA 1YPMH 3MU5A 1LPZB 4JMYA 2RFKC 1CBWB 1JIRA 1MU8B 3KQEA 3Q3YA 4YT6H 5F53A 1G36A 1WTHD 3GICB 1GI7B 4WH6A 4AFSA 1GBJA 4KELA 1L4DA 4I31A 1RXPA 3NXPA 5IK2D 2ZTZA 3FVFB 3OX7U 2ZGHA 1HJ8A 3PRBA 4CRDA 1GBMA 1C1PA 1AQ7A 1TNHA 2O8LA 4AORA 2PR3A 2VVCA 3OTPA 4ABEA 3P8GA 2VWOA 2AGGX 2H6MA 3TJVA 2KX4A 2TBSA 1J17T 1O3CA 5EG4A 4F55A 3UWIA 1SQRA 1CVWH 4KGAA 1RS0A 2BX3A 1NM6A 2JDID 1C1NA 1KTSB 1UW7A 1O3JA 1NFXA 2YMSD 3PWBA 2FI5E 3H7TA 2ZPQA 1V2ST 1O3KA 3BEIB 4I8KA 1UVUH 1SHHB 4ZKRU 4I86A 3MNXA 3TVJB 1VCWA 2DUCA 1GI4A 1BCUH 1VR1H 3ATWA 1O5GH 3F2HA 3LGIA 4UEHH 3GY4A 1GVLA 1AKSB 2ZU3A 2XCFA 3PMHB 1Q2WA 4ZCNA 1BRBE 2PGQB 1DPOA 2THFB 4AG1A 1PPBH 1AE8H 1IQGA 3TH4H 4RI0A 3RLYH 3IWMA 3TJNA 5EJZA 4B74A 4E7NA 4HZHA 1RFNA 4B76A 1Z1IA 1AGJA 1QBOA 3E0NB 4BAHB 1XUJA 4GUXA 2C8WB 3Q00A 1KMHB 1GBDA 1YCPH 2ZHDA 2ZWLH 4CR9A 2V0BA 1P9UA 2WPJS 2EI7A 4THNH 1V2TT 1MBQA 5DP6A 3UOPA 3ZZBA 4XE4A 1D3PB 2M2AA 1W0KD 1LPGB 4CRBA 1OXGA 3FZZA 2FLBH 1ANDA 1TNGA 2CV3A 1CO7E 2ZGCA 4I7YH 1WAYB 3A8AA 1SQAA 3MHWU 2HVYB 1P04A 4PROA 1HAIH 2BQWB 3GDVA 3SZNA 3TK5A 2H5DA 1EKBB 5CMXH 3TJUA 2P3TB 3N7OA 4ESTE 1N1LA 4X0WU 6GCHF 2QV1A 3EA7A 1KSNA 2SGFE
chains in the Genus database with same CATH topology
3BV9B 5LGOA 2PGBB 4YESB 4NWLA 1T4UH 1XX9A 1KDQA 2FLRH 2A4QA 1Y3YA 5AHGH 3U8RH 1AY6H 1DY8A 1WSSH 4E05H 1BDAA 3QWCH 4XFQA 3T28A 1ANBA 1TFXA 1CGHA 5AF9H 1TPOA 3E90B 4YOGA 2BD8A 2XBWA 3E3TA 1C2LA 1C5OH 1T8MA 2G5VA 1N8OB 1QQ4A 2XBVA 3A7YA 1TMBH 1D9IA 1GDNA 5FAHA 3BIVH 3P6ZB 3NPSA 4O3UA 2ZP0H 4JZEH 3ATLA 2TRMA 2F9NA 2FESH 1P2IA 2VVUA 2CF8H 2Y6TA 1QRWA 2GV6A 2I6SA 1G3BA 4JCNA 2PKSB 3TH3H 4JK5A 1V2QT 4GLYA 3KL6A 3HGPA 4CRCA 1O3LA 3VXEH 2SNWA 1GBEA 3RXQA 3M35A 1FY1A 2A5AA 3ZYEA 3A83A 1SGTA 5A0AE 4I8HA 3M3TA 1TBZH 4LOYH 1LVBA 1CHOF 2ZTYA 1T32A 1O33A 3TGJE 1CHOG 3A85A 3PO1C 5DJ7A 1W11U 5DP5A 1MUEB 3E8LA 1GCDA 4MPXA 2OQ5A 1D4PB 3GDSA 2QXIA 2FOGA 4MVNA 1BTXA 4Y8ZA 1FMGA 1TNIA 1TX6A 2ZO3H 4AG2A 2ZFQH 5EU8A 1QCPA 3SHAH 3GY5A 2PTCE 3I77A 4BTTB 2FX4A 2V35A 2PV9B 1TPPA 1NRPH 2XC0A 3LJJA 4Y7BA 2VJ1A 3MU4A 4NZQA 1O2LA 2ZZUH 2IJOB 3BEFB 2EC9H 1SFIA 1EXFA 4D7GA 2ODPA 3BG8A 6CHAB 1WYKA 3A8CA 1LTOA 2VIVA 4YLUA 4A1XA 2SGQE 1CT2E 4AYYB 1DXWA 1VCPA 4BANB 2O8MA 3F1SB 4FUGA 1RTFB 2A7HA 1HV7A 1KLIH 1EZQA 5DKMA 1ZYOA 2P3FH 3UR6A 1AO5A 3VFEA 4WY3A 4DIHH 1SB1H 2GTBA 1A1RA 3LIWA 1GJ4H 2ZI2H 5JBAS 3PMJA 1YLCA 1GGDB 1W12U 4JYTA 3SNAA 2RDLA 1BRCE 1VGCB 4X2YA 1KY9A 1XVOA 1RIWB 3RXAA 1ETSH 1PJPA 1GI3A 1O2YA 1O3OA 1O0DH 1P12E 4UFFH 1SVPA 4ZHAA 4U30A 1D3DB 2F9VA 1O2VA 1P2QA 5H4IB 1O3EA 1TX8A 1LMWB 5BPEA 1Y59T 4YM9A 2BXTH 3OTJE 4D9RA 1SFQB 2J4IA 2JH5D 5EODA 2Q6GA 1LKAA 2QY0B 3I78A 3UFAA 3OY6U 1F0SA 2QAAA 1FIZA 4WMFA 2Z9JA 1ZPCA 3GCNA 3VB6A 3MH4A 5FBEA 2UWLA 3KN2A 1SI5H 1C1WH 5C5NA 1QB9A 3RXMA 5E2PA 1D6WA 2C90B 5L30H 1LVMA 1TRMA 1O5DH 3HK3B 1D6RA 1SBWA 4KTCA 4Q2KA 3MU1A 1UK2A 1FUJA 2G55A 2PFEA 2FTLE 1H4WA 1PPCE 1GCTC 2B7DH 1C5SA 1O2TA 1GBHA 4BTIB 1G2MA 5TCAA 1EX3A 1W7XH 4QT8C 1C9PA 3MO6A 3BSQA 4AGKA 1P03A 1AI8H 3AAUA 1KYNA 2BY8X 3ZZ9A 5LPEA 3U8OH 1DXPA 4B2CA 1DWDH 1OP0A 3R3GB 2PWXA 5F8TA 4B2AA 3TK9A 3ODFA 1UK4A 1XUIA 2TGTA 2G4TA 3SGBE 1AFEH 1Z8JB 3VB7A 1VZQH 5FCKA 1V2MT 5GCHG 4CR5A 2VIOA 2Y7XA 1GMHG 2VGCB 2QYIA 3MTYA 1BIOA 2ZNKH 1GJ6A 2GMTC 4A1VA 2OCVB 2Z3CA 2BDYA 3BG4C 1FJSA 4UFEH 1MCVA 4SGAE 4CREA 2P16A 2HGTH 3KGPA 5HYOA 1NTPA 1XXDA 4BAQB 3PTBA 1NY22 2ALVA 2QXHA 2Z9IA 4TYDA 1K1MA 1FN8A 4D9QA 1YKTA 1HCGA 1MU6B 4XBBA 1DLKB 1W14U 2ODYB 2AEIH 3RXGA 3GY7A 1B5GH 2F83A 2Z94A 4ISNA 4BXWA 2W5EA 1UTJA 1AVXA 1FIWA 2ZU1A 2JH0D 2R0LA 1OWEA 3ZZ7A 1S6FA 4IMZA 3RLWH 2P93A 4ZKOU 1C4V2 3QZQA 2ZC9H 2ZGBH 2AYWA 4ISLA 4KTUA 2EI8A 3M3SA 1MZDA 3MI4A 3MOCA 2F9PA 1QA0A 9ESTA 1IQMA 1NZQH 1OS8A 3LJOA 1FY8E 1FAXA 1SGEE 2BOKA 3K6ZA 2Q1JA 1LO6A 1CBWC 3RXBA 3B23B 1VJAU 1SOTA 4WF8A 1NT1A 1O2HA 1AN1E 3C27B 1IHTH 3KF2A 5AFZH 1BMAA 2ZFSA 1GBLA 4FUHA 1GBFA 4Z6AH 1SPJA 2ZPRA 1AHTH 1C2FA 3RC5A 2CXVA 3K9XB 2JETB 1ZSKA 1XMNB 2RA3A 1PPEE 1FY5A 5A8YA 1CE5A 1QJ1B 3ZVFA 1P11E 2J38A 1AZZA 3RXRA 1GMCG 3ATKA 1C4Y2 1DY9A 4O3TA 2LPRA 3D49H 1MTWA 2B5TB 4Q7ZA 6CHAC 2FO9A 1E37B 1V2OT 1P06A 3SJ8A 1C1UH 2BDCA 2ZF0H 3HK6B 2NU2E 1V2WT 1IAUA 5JB9S 2AERH 3SBKA 4YTAA 1CQQA 3SI3H 1AE5A 4MNVA 1KLJH 3PLPA 4OS5A 1QIXB 1YCPM 1ACBE 3NZIA 4B1TA 5A2MH 3SQHE 4A92A 2ZDVH 1SGFA 1BB0B 1LKBA 4A6LA 1Y3UA 2BVXH 3D23A 1GDUA 1DSTA 1C2HA 3EGKH 2RG3A 1BJUA 1V2JT 1ZMJA 4I8LA 1P3CA 1GHZA 1DFPA 2H9EH 4KP0A 1S82A 3LT3A 1V2LT 2ZQ2A 3OYPA 2Y81A 1CA0B 1AMHA 1WQVH 1QR3E 1E34B 4U32A 3M37A 4JYVH 2FWWA 1OSSA 2W3IA 1MKWH 1OYTH 2GMTB 1AKSA 1A61H 1O3AA 4FU7A 4E7RG 1FN6A 2Y5FA 5EQSA 3VGCB 1J15A 5DP4A 3ELAH 1DM4B 4X6PA 1EPTA 1GI5A 1K9OE 4DT7B 1BMNH 2A4RA 4FVDA 2BTCE 2VIQA 3M5MA 2BDGA 4ZXYH 3T26A 5DO4H 3NCLA 2FS8A 4MPWA 1MAYA 1QFKH 4ISOA 1W7GH 2XTTB 5HM9A 2CJIA 1W13U 1W3CA 1TA2A 4FU9A 4NSYA 1DANH 3SW2B 4X2VA 1GI2A 1HAYB 3EE0B 3GCTF 4J2YB 1YPJH 5E8EH 1C1QA 2FYQA 1NESE 1S85A 2OUAA 1MTSA 3LKWA 1ZOMA 3PWCA 2PKAA 4ABFA 1Y3VA 4ABIA 2Z9GA 2PHBA 1DLEA 1SGIB 4X2WA 2W7SA 3UIRA 4MLFB 1KXEA 1GJCB 2P8OC 4A1TA 2C93B 2HALA 1T4VH 1Y5UT 1GCTB 1K1JA 4JZDH 1C5LH 3TJOA 1AWHB 2YNBA 1G32B 1SR5C 1LHFH 1TBQH 1TRYA 5C67A 1O5EH 1YM0A 4X1PU 4XDEA 1C5VA 1GG6B 1HRTH 1F5LA 5C1UA 1FI8A 2XC4A 3ESTA 2FIRH 4INKA 5E0JA 1DVAH 3T29A 3FAOA 2GV7A 1DS2E 4K8YA 3UNSA 1HNEE 1P2MA 1KXBA 1CA0C 1NU7B 1YPKH 1P2KA 2A2QH 2FM2A 3SJ9A 3WY8A 4CHAC 2GCTC 2ILNA 1TOCB 3PM3A 5DP3A 2LNCA 1TWXB 5A0CA 2PUQH 1EP5A 2A4OA 2PSXA 1DITH 1JWTA 1GHBF 4RSPA 2VIDA 3SUDA 1BBRH 3RP2A 2GZ9A 1TBRH 2VWLA 7LPRA 2FX6A 1A2CH 2VIPA 3MMGA 4DOQA 1A3BH 1BA8B 1P2NA 4X8UH 2TGAA 1BJVA 1GI0A 1AU8A 3QTOH 3OY5U 3S9CA 1PPHE 1E36B 1C2IA 1Z8IB 1BBRK 4I8GA 4RKOB 1EAIA 1KXCA 3PMBB 2A2XH 4X1RU 2ZDAH 4X6OA 1EAXA 4FUJA 5SGAE 2H5CA 1UVSH 4MNWA 2P3UB 4ABJA 4OS1A 2UUYA 4HI3A 2FZZA 1ZTJA 1C9TA 3MU8A 3DHKH 4TPIZ 3P17H 3IITA 2JETC 1O3IA 1ELDE 1C5MD 2OC0A 2BD5A 1HLTH 2Y80A 1Z71A 3LC3A 4B73A 3U1JB 1TGNA 1SGRE 2XC5A 1GHYH 2HNTF 2H9TH 4MQAA 1HIAA 1V2PT 1SQTA 3SV7A 4HGCA 1F2SE 4TWYA 2ANYA 3SJKA 3UUZA 4AB8A 1K1LA 2D2DA 1MMJN 3MH5A 2QF0A 4B75A 1GBKA 1PQ8A 5DGJA 1ARCA 1AUTC 3ZZ6A 1NPMA 1BBRE 1NRSH 1Z7KA 4ZUHA 2XBYA 1QL8A 2Z6BD 4AGJA 2FOEA 1SSXA 2SFAA 1AB9C 3ITIA 1FAKH 4AN7A 1UTPA 2WV5A 1EB1H 3M5OA 2VNTA 2KAIA 2QGRA 2P95A 3GYLB 4MG3A 3CP7A 4NFEA 5HXFA 5F8XA 3BTKE 1EUFA 2DE9A 2FS9A 5EPNA 3TNSA 3KEEA 1SLVB 2IOTA 2XYAA 3SI4H 2V3OH 2UUFB 4Y8XA 3ATMA 1C2EA 2G5NA 5F03A 3ZZAA 1ETRH 1XUFA 4CRGA 5T6DA 1ARBA 3RXHA 3TH2H 3RXDA 2Q6FA 1ELAA 3ZVAA 1O31A 4INLA 2FOBA 4O9VA 1ANCA 5GJ4B 4X6MA 1P2JA 4ZHMU 2A5KA 1T8NA 2QXJA 1K2I1 1PFXC 2PTNA 4GHQA 3BEUA 2G52A 1EAUA 3QUMP 4TY7A 5EQQA 1QNJA 4X8SH 2ZPSA 1HAPH 2RA0A 1ZGVA 2AMQA 1JMOH 2WPHS 3MNBA 2FOCA 3GISB 1YPEH 1GVKB 2M5TA 1EAWA 1GBIA 1O3NA 2BHGA 3LC5A 1J16A 5JDUB 4AZ2B 2VH0A 4H6SB 1ELEE 1MAXA 1OP2A 2R3UA 1C2JA 1C5XB 1O2JA 3QO6A 4AB9A 3U69H 2ZFRH 5EXLA 1G9IE 7ESTE 4BOHA 1F0UA 3ZYDA 1GJ8B 3H5CB 3UQVA 5ESBA 1SG8B 3KQBA 1C5PA 1ELBA 2GVFA 1FLEE 2Z3EA 1QY6A 1C1SA 1LDTT 3PYHA 5HMAA 2CHAB 4TWWA 4DY7B 3C1KA 2WYGA 1CA8B 4NG9H 4Y10E 3AAVA 1YBWA 3MFJA 2G51A 1C1VH 3SUEA 1IQHA 1TX7A 2J94A 3M7TA 1PPZA 5L2ZH 2HVXA 1SGNE 1NFYA 3FP7E 2ZEBA 1S6HA 1KTTB 1L4ZA 4J1YA 4ABGA 2BY6X 4WH8A 1ANEA 8LPRA 1YF4A 1WBGB 2QIQA 1QHRB 1ETTH 1RTLA 1GI8B 2VINA 1SGCA 7GCHG 1L1JA 1PQ7A 3LDXH 2BLQA 2ZFFH 2JKHA 4LXBH 5E2OA 4UD9H 4B2BA 2WV4A 2ZU5A 1C4U2 4NIYA 3EYDA 3MH7A 4FU8A 5FCRA 2CF9H 1C5NH 1E38B 1A4WH 5AFYH 1O5CB 1P3EA 1WU1A 4D76A 1PQ5A 1A0JA 1G37A 3T62A 1GJBB 3VEQB 5I25A 1P10A 1FXYA 1TMUH 1OWIA 5AVDA 3PROA 3VPKA 3W95A 5CHAC 1BITA 1SMFE 2PKAB 1LHEH 1ZHPA 2ZKSA 1XM1A 3TGKE 4IGDA 4CRFA 1AWFH 3UNRA 3SNBA 5JB8S 3U9AH 3MO9A 2PLXA 1F0TA 5K0HA 1WOFA 3TU7H 1GHXH 1ZR0A 1B0FA 3HKIB 1XUHA 5F6MA 5GXPA 3SN8A 2D1JA 1GWAA 1V6DA 3SNDA 3SU5A 2WPLS 2CN0H 1AVWA 4D8NA 1MQ5A 1AZ8A 3EA8A 4U01A 3A80A 3OSYA 1OKXA 1YLDA 1IQFA 4O03A 2XRCA 5JBCS 4MTBA 1O3FA 5DP8A 5L6NH 4RKJB 3TITA 2H1UA 2XBXA 4ISHH 3SOSA 1W8BH 1AD8H 4HTCH 4IN2A 1EZUC 4KTSA 3F9HA 3MYWA 2ZGJA 4BAOB 4Y7AA 1DDJA 1SLWB 2QF3A 3BTME 2F9UA 2BZAA 1Y5AT 4ZMAH 1C5TA 3E91A 1TB6H 1Z8GA 5EW2H 3RDZA 5FX6A 1P02A 5EOKA 1IQNA 3LOXA 5TJXA 3F9FA 4OGYA 2GD4B 1BTWA 3MNSA 1CGIE 3U1IB 3SV6A 3AVZA 1INCA 1L2EA 1MKXH 1Z6JH 3UREA 3DFJA 1HJAB 1TGBA 2ANWA 1TONA 3ENSB 1AVGH 2FOMB 1C2KA 1PYTC 1Z1JA 3RXSA 1QRZA 3L6PA 1O2XA 1TNJA 4IN1A 4HFPB 1W0YH 1SC8U 1YC0A 4X8VH 4BNRA 2VVVA 3FP6E 3HPTB 2TPIZ 3S0NA 2ZCHP 2SNVA 3ZVGA 1TYNA 1IQJA 1C2MA 1ZRKA 1QBVH 3RXJA 3SORA 1OP8A 1THSH 1ABJH 2EA3A 4NZLA 1ELTA 4CRAA 1THRH 3F6UH 4FUEA 1O2OA 5GCHF 4ISIH 1S83A 2ZFPH 2BDAA 1F0RA 1P57B 5LH8A 1FNIA 1Y8TA 1OWKA 1EJNA 1F5KU 1S81A 3SU3A 3QGNB 5PTPA 1MTUA 3FP8E 3A7TA 3UQOA 1ESTA 4CH2B 3KQCA 2VWMA 4SGBE 1OWHA 5LPFA 1VCQA 2UUJB 3T5FH 1NU9A 2BVSH 3SU6A 2BXUH 5DPAA 1AFQC 5FXLA 1BHXB 1C5WB 4GAWA 3SUFA 2TGPZ 1AB9B 4K2YA 4A7IB 5DP9A 2BX4A 1RTKA 2R0KA 3Q3KA 2BB4A 1VGCC 2QN5T 5C20A 3M7QA 2ALPA 3MO3A 2A45B 3RXVA 1FV9A 2NU1E 3S7KB 1YCPK 1ZJDA 4K3JA 3UOUA 2BQ6B 1EOJA 2BD4A 3ZZ4A 1O36A 1HUTH 2BYAX 1G3EA 5EPYA 2FEQH 4LZ1H 4YZUA 1O3PB 1O2KA 1WV7H 1LHCH 3SU0A 3BF6H 1ZPBA 8KME2 1UCYE 2GX4A 3A84A 3IG6B