4I31A

Crystal structure of hcv ns3/ns4a protease complexed with compound 4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular Mechanism by Which a Potent Hepatitis C Virus NS3-NS4A Protease Inhibitor Overcomes Emergence of Resistance.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i31A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4i31A01
1UO6A 1ZHMA 4NIVA 1XKAC 1F5LA 5EW1H 2ZP0H 8LPRA 3GCTF 1P2IA 2G00A 1YP9A 4O3UA 4UE7H 3Q77A 2ZNKH 1Y59T 3MFJA 2P94A 1GMDG 1LHFH 2NWNA 2G55A 1FJSA 4KTCA 1Z6JH 1ANBA 4DT7B 4JZ1A 1IQEA 1O3KA 2Y80A 3L33A 4BNRA 2O8MA 3MMGA 4R0IA 3LDXH 1T4VH 4KKDA 3M5MA 2ZDLA 1SLXB 3ZVGA 1ZGIA 3NKKA 3RC5A 1IQHA 3S7KB 4JZFH 1ZTKA 5EQRA 1WQSA 1ZR0A 5GPIB 1ARBA 3P95A 2GCHF 1QY6A 1MBQA 3ELAH 4JZDH 3SV7A 2VVUA 2Y7ZA 3I77A 4IGDA 4GVUA 3DD2H 3RLWH 1H8DH 3M35A 5LPRA 4Z0KA 2ZWLH 3MO3A 2ZGXH 3BG8A 5FPTA 4MPWA 1YF4A 5A0CA 1K2I1 2V6NA 3TK6A 1O3AA 4K8BA 4QT8C 1Y5BT 2Q6GA 6CHAC 5HGGA 5JBAS 1O2QA 1NO9H 1G3EA 2OQUA 1QURH 4FUDA 2ZECA 1QQUA 1H4WA 5C1YA 1AO5A 2FOBA 5PTPA 2GCTB 1DICA 4WXVA 1HAOH 3P8OA 1O35A 2TGTA 5AFZH 1G3CA 3ZZCA 1O2XA 4CRAA 1PQ5A 4I8KA 3BTTE 4X6OA 5DO4H 2OK5A 2PUXB 3GISB 1K21H 1UTJA 3A7YA 1EAUA 1YPLH 5DP7A 1OYTH 4U32A 1EB1H 2GVFA 1ZYOA 3O8RA 1P02A 4ZROA 1V2RT 3ZVFA 4HFPB 5JB8S 1XVMA 5ETXA 2OC0A 2WPLS 5FXLA 1CA0C 1FY5A 2BLQA 4FUHA 2UUFB 1ABJH 1GVLA 2F9OA 3BTEE 2J94A 1GBCA 1KYNA 2GKVE 2ZGCA 2BD4A 1EPTA 4ZAEA 3MTYA 1MD7A 2ZGBH 3CS7A 1UCYH 1FONA 1C2JA 6GCHF 2VIPA 2B5TB 2P8OB 4DW2U 1A0LA 1UCYE 1XUFA 4WJG2 1YGCH 2ZO3H 2F9NA 3V0XA 3VB3A 1O3BA 2AS9A 2J9NA 4X8VH 5A0BA 2DE9A 4A7IB 2ALVA 2RA3A 2BOHB 2Y5FA 1MBMA 1CA8B 1NRPH 1O2MA 2CGAA 2Y5GA 2HNTF 4HZHA 1QHRB 4DG4A 1Y8TA 2VIVA 2ZPQA 1DLKB 3PLBA 4JK5A 2HNTC 2ZFQH 2ZPRA 5DP9A 3SJ8A 3RM2H 7ESTE 1G2MA 4OS6A 3AAVA 1EJAA 1TA6A 2BQWB 1KXFA 1Q31A 2VVCA 4AORA 4DJZB 1K9OE 2VNTA 3MYWA 1MKWH 2HGTH 1O2GH 2SGQE 1EAXA 1BHXB 2WHXA 4RKOB 2RCEA 2FOGA 3M61U 4GAWA 1SC8U 1GDNA 1QR3E 1Y5UT 5F8TA 2AGIX 5F8XA 2ZU2A 3T2NA 1B5GH 1GI0A 4DIHH 1QFKH 2C8WB 3RXHA 2OUAA 1V2QT 1V2ST 1C2LA 2RA0A 1OXGA 1QJ7B 1TBZH 1UJ1A 1QA0A 1JMOH 2PW8H 3ZZ5A 1THPB 1CU1A 1VR1H 2HRVA 3P6ZB 2Z3CA 3RXCA 1BCUH 3SZNA 2AFQB 4YT7H 3MU8A 5EXMA 1O3JA 3A8DA 1AD8H 1J15A 1CQQA 1A7SA 2A31A 5E2OA 4BAOB 1HAVA 4ABAA 1HFDA 3QZRA 1EZXC 3TU7H 5IDKA 1FY3A 2VJ1A 1L4ZA 4B6EA 4U2WA 1AKSB 3QDZB 1SLUB 1MTVA 1NESE 2UWOA 3U8RH 1JBUH 1HIAB 4FU9A 2PSYA 2P59A 4ABJA 5GXPA 2R3YA 5TCCA 3ZVBA 3OY5U 1VJ9U 2LNCA 5JBCS 3LGUA 1DSTA 1MU8B 1NTPA 4AFQA 1AFQC 1GCTC 3GCOA 3MU1A 1HAYB 5GCHG 7GCHF 1DDJA 5GNDA 1FY8E 2JH0D 1MZDA 2H5CA 1F0UA 3MH4A 4CBNA 1SGDE 5SGAE 1ZRKA 4OGXA 2UWPA 2ANWA 1UCYK 2P3FH 5L2ZH 2XC5A 4IC6A 3FP7E 2QAAA 1GDQA 4Y8ZA 1QCPA 4A92A 2ZU1A 4I8HA 1WUNH 1O2UA 4DOQA 3B23B 1GHBF 4ZHMU 4OS1A 2ZIQH 3UR6A 1OWIA 4FVDA 1C2MA 1CGIE 3RXRA 3A84A 3RP2A 1BDAA 1AWHB 1HB0B 1C5QA 4ISNA 2ZCKP 3A8AA 3LGTA 4ZH8A 3Q3XA 1PJPA 5JBBS 2ZGJA 1O5GH 1GMCF 1P03A 3SV8A 1AVGH 3IG6B 1JRTA 1FPHH 5FCRA 3ZZ8A 4ABFA 3SN8A 3M3SA 4ABEA 1G32B 1LVBA 1TX8A 4YTAA 3ZV9A 3RLYH 1SGFG 4UEHH 4ABBA 1SHYA 3I29A 1OWKA 3A88A 1V2MT 1W13U 1C1RA 4IN2A 2A5KA 1RRKA 1DM4B 2ZC9H 1O0DH 2WPJS 3F9EA 3A86A 1SQOA 4O3TA 3ODDA 2WUBA 1BRBE 2TPIZ 1O2LA 4B74A 1O3HA 1GG6B 2ZHFH 2BY5X 1F0TA 2TGAA 3MO6A 4VGCC 2QYIA 1GJ6A 3OYPA 4Y6DA 1TNHA 1O3PB 1S81A 3UQOA 1BRAA 5FX6A 1O34A 1A0JA 5EXLA 3GY8A 1SQAA 4KP0A 2GV7A 3PO1B 5A8YA 1ARCA 2EA3A 1T8LA 2C8XB 4Z6AH 4YOGA 2C90B 1G3DA 2WV5A 3SYJA 5FBEA 4AB9A 4BAHB 1HJAC 1OWDA 4JYTA 2ANMH 3RXKA 5CE1A 3UOPA 1AE8H 3TH4H 4CRDA 2BVXH 1YLCA 1DLEA 4X8UH 1BQYA 1AY6H 4BTUB 2QC2A 4Q7YA 1NPMA 3QTVH 1Q3XA 2FOAA 3SU5A 2XC4A 4YOJA 1YLDA 3D49H 1C4U2 1NFUA 3MNCA 1BB0B 3CP7A 3AAUA 1K1LA 4MPUA 3M3TA 1ETRH 1YCPH 1E34B 1THSH 2J34A 2HVXA 2ULLA 1IHTH 1SGYE 1HAVB 1GJCB 1ZOMA 3B8JA 2GZ8A 3P8FA 5C2ZA 2ANKH 2H2ZA 1KDQA 3IITA 2I6SA 4ZHLU 1N6YA 6CHAB 1D3DB 1LVOA 2ZDVH 5EGMA 4NA8A 1FI8A 4D8NA 1YCPM 1TFXA 3LGIA 2BY9X 1MTUA 2YNBA 2BX3A 4I32A 2CJIA 3MNXA 5EOKA 1TIOA 1Y3UA 2QGRA 3SUDA 1OYQA 1P04A 1PYTD 1SHHB 3SNBA 1IQFA 3W95A 3SJOA 2FYRA 1EJNA 4XSKU 4I8LA 2HOBA 4ZHAA 1W0ZU 1FUJA 4DY7B 1O2SA 3BTFE 3QTOH 4KTSA 2H9EH 1C2GA 1AVXA 9ESTA 2VBCA 1P11E 4AYVB 1IQJA 1O5FH 3SUEA 1C1VH 2SGAA 2C4FH 1C4Y2 4BTIB 3P8GA 1HLTH 3A80A 4NGAH 3GDUA 1E37B 1SGFA 4I33A 8GCHF 1QL7A 1A5HA 3FP8E 2ZTZA 3LC3A 1GBLA 4GUXA 2H9TH 1GBJA 3A7WA 1L0ZA 2F9BH 4NFFA 1CA0B 2ZZUH 1C1PA 2BLVA 1AFEH 3RXTA 2G8TA 2Z3EA 2A32A 1TE0A 4CHAC 2EC9H 2A4GA 1TRNA 1IAUA 1C4V2 3PYHA 2AMDA 1EB2A 4XE4A 3C1KA 1W7XH 4X1SU 2KAIB 3D23A 1ZZZA 1TMBH 2FM2A 2BZ6H 3QZQA 4O9VA 3QK1A 2BQ7B 4NCYA 1MQ5A 2FX4A 2J2UA 1EXFA 1N8OB 1GJ4H 1C5RA 1SGNE 2SNWA 1ID5H 2XBXA 1HJ8A 2FEQH 1C5YB 2J92A 3QO6A 1NROH 4K1TA 3GY5A 4I8JA 5HYOA 1ZLRA 1UVTH 2BD8A 3NUMA 5T6FA 3T28A 1DOJA 1LQEA 1TGTA 3DA9B 4B2BA 2F3CE 1V2VT 4ISHH 3UR9A 3HGPA 1P9SA 1NC6A 4H4FA 3SQEE 1A5GH 1NT1A 2A4RA 2HWLB 1WBGB 4GPGA 1YCPK 1TPOA 1SBWA 1P09A 4FU8A 2BXTH 4LOYH 3EA7A 1ZHPA 2AGEX 4CREA 2Z9GA 1RS0A 5T6GA 4X2VA 1C5UA 1TA2A 3BN9A 2G5VA 3PLKA 5DP6A 2P93A 4F49A 4X1QU 3MHWU 4IN1A 5J4QA 1O5BB 1AU8A 1PYTC 1RTKA 1UMAH 3H7TA 2GT7A 3KEEA 1IQLA 1VCWA 4E7RG 1LHDH 2B8OH 1O2HA 2Z9LA 3VB7A 1O5CB 1SGCA 2PGBB 3M36A 2BD7A 2W26A 1GI3A 4K3JA 4MNYA 2GMTC 4ZKNU 4OS7A 3QGNB 3K6ZA 3E90B 4I31A 3LJJA 3ESTA 1XKBC 1P0SH 1A3EH 1JXPA 2OP9A 2IOTA 2ZEBA 1YPJH 1UTQA 4K1SA 1O37A 1RFNA 2JKHA 1WAYB 4RSPA 1UVSH 5A0AE 4I8GA 2IJD1 2ZHEH 1O2JA 1GI9B 1QA7A 1YPKH 2OBQA 2ILNA 3A81A 1C5SA 3L6PA 1ANCA 3A89A 1GI1A 2QA9E 1LPZB 1F2SE 1TRYA 4B71A 1LCYA 2ESTE 3SV6A 1C5XB 5GDSH 1C5WB 1KTSB 2A5IA 1VITG 3MH6A 4JYUH 1Q2WA 1SVPA 3S9CA 1K1MA 1KDQB 5DJ7A 1AFQB 1GCTB 2ZU3A 1X7AC 2F83A 3I78A 4BAMB 1MAXA 2Y7XA 2F9VA 4A5TS 4RI0A 3H5CB 4X0WU 1P8VC 1QBVH 3KQDA 2BB4A 1SGQE 2AGGX 3TK9A 3F68H 2F9UA 1HXEH 5EODA 3TJVA 1OOKB 1BOQA 2Q1JA 4IBLH 3LOXA 3A87A 1Y3WA 3U1JB 1C2FA 1OP0A 2UUKB 3PLPA 4FU7A 3BF6H 4OGYA 4X2WA 3FZDA 1GBMA 3GCTG 3PTBA 2EI7A 2BY8X 5A09A 2A2QH 2W7SA 3DFLA 1VCPA 2BY7X 1EUFA 4D9QA 2BD9A 1EATA 3SNAA 4FUIA 2WYJA 4BXSA 1AKSA 3NXPA 1KLJH 1MAYA 1JIRA 2H5DA 2R0KA 1HPGA 1W10U 1AHTH 2BMGB 1CHOF 5FPSA 3SV9A 1TALA 2FXRA 3T26A 2B9LA 1HIAA 3P8NA 4E05H 3ATWA 1QRWA 4ESTE 2D2DA 1K22H 2PKAB 2GCHG 4KELA 1FZZA 2FLRH 3SJIA 1YC0A 4CR9A 2BX4A 5EPNA 3ZYEA 3RXOA 3OTPA 2FS9A 2DUCA 2ZFSA 1YM0A 1KXDA 3GDVA 3E16B 2FOEA 1O2WA 1A4WH 4NWKA 4Q80A 3UOUA 1YYY1 5C1UA 1B0FA 3UWJH 3O8CA 4YLQH 1H8IH 2OLGA 1WU1A 2WPHS 1GI8B 1SLVB 1P12E 1GDUA 2Q6DA 2QIQA 1DUEA 3ZZDA 2P3UB 3NPSA 1O2ZA 3Q76A 4UFDH 4VGCB 4Y10E 4NWLA 5DP8A 2WPIS 1TGCA 1EOLA 3RXEA 1O2PA 4FUJA 2TIOA 3PWCA 1HAXB 1MU6B 1SMFE 2ZCHP 1QTFA 4K69A 1O2TA 4Y79A 2OXSA 4UONA 3SV2H 4AB8A 3ZZBA 4FUFA 1O2OA 2PKSC 3GDSA 4X8TH 1HJAB 1ZPBA 2FODA 1NY22 2BZAA 5DG6A 2R2MB 3SGAE 3SNEA 1RTFB 1BZXE 3EGKH 1P05A 3HK6B 3TITA 5E0GA 4X2XA 1TOCB 4XOJA 4TPIZ 3RXMA 5CMXH 1F7ZA 1ETSH 1ORFA 3MH7A 1V2KT 1NFWA 3Q00A 1GJAB 2IN2A 1DANH 4A6LA 4OS4A 3K9XB 1ZSKA 4AYYB 4MNWA 1GBBA 2FI5E 1V3XA 3EYDA 1WXRA 1NRRH 1S6HA 3HKJB 4LXBH 3SUFA 1TAWA 6GCHG 3LONA 4B2CA 4UDWH 1TLDA 3MI4A 4SGBE 2K1QA 3S0NA 1O2KA 4O97A 2QN5T 3VPKA 5HM9A 1TBRH 4NZQA 2Z9IA 5E0JA 3UQVA 1Z6EA 1P2QA 1IQKA 3MWIU 4NZLA 1AZZA 1G2LA 1CT4E 1A61H 4Y8YA 5HXFA 1PPGE 1DS2E 1SGTA 5AHGH 1TQ7B 3PMAB 2FPZA 4XDEA 5F6MA 3FP6E 3RM0H 3K65B 2QXGA 4K8YA 3RXAA 2BTCE 3F6UH 1A2CH 1C1TA 1LHGH 1PPCE 1Z8GA 1M9UA 4CRBA 2A7JA 1C1UH 2VB0A 2GX4A 1EKBB 2UWLA 2M5TA 2V3OH 3T62A 2PLXA 2AERH 3EA8A 1NU7B 4LZ4B 3ZYDA 1V2UT 4D7FA 1BBRH 3NZIA 4AFZA 3UWIA 1ZMNA 2JETB 2AYWA 1BBRE 3EE0B 1L1JA 1WYKA 3BTWE 1OSSA 2FX6A 1SGIB 1TOMH 1VCQA 4Y11E 3SHAH 5TJXA 3SW2B 1ELTA 2OINA 5ESBA 1HUTH 1UTNA 1ETTH 1EOJA 3NK8A 4K1EA 1QNJA 3S7HB 1TPSA 2XWAA 3BTGE 3DFJA 4X2YA 1IQIA 1UK4A 3H7OA 1QBOA 3VB6A 3UNSA 3TIUA 4JK6A 5GWZA 1VJAU 2OC1A 1HRTH 1IQMA 4MPVA 1GGDC 1UTKA 1P06A 1QIXB 2Z6BD 2VGCC 4YZUA 1NN6A 1E36B 4NSVA 1AQ7A 1XMNB 1AWFH 2OC7A 3SNDA 1AB9C 4GSOA 4TYDA 2QCYA 4B1TA 1ELCA 1GHWH 1GL0E 1C5LH 3SI3H 3U1IB 4D9RA 1QJ1B 2R3UA 1YPGH 2BM2A 3MNSA 1MD8A 5T3HA 1FDPA 2NU1E 1TPAE 4KTUA 7GCHG 1S6FA 3RU4E 1D3TB 2C3SA 1PPFE 3ZZ7A 4B73A 3H09A 1EASA 1P2NA 4UD9H 5EQQA 4AOQA 1S5SA 1F5KU 3UTUH 3UPEA 3SUGA 1DWEH 2GGVB 2D26C 1WCZA 1F5RA 2W5EA 1ZMLA 4MNXA 1ELDE 3P70B 1A46H 5T6DA 2AIPA 1GI4A 2ZHQH 5FCKA 4YO9A 3V13A 2F4LA 2A4OA 3BG4C 2FWWA 3A82A 2KAIA 2BD2A 3V12A 1O39A 3ATMA 4ISIH 4IMQA 2ODPA 1NM6A 5DP5A 1XUIA 2JH5D 4YM9A 4FUBA 1GHYH 1W8BH 3TNTA 3E91A 2VWOA 1C9TA 1GMCG 1CVWH 2BDIA 1D6WA 1AGJA 1FV9A 1H9HE 1O3OA 2VH0A 1XUJA 1UTMA 2ZFTA 4ZKRU 5ESTE 1WQVH 7KMEH 3E0PB 3MNBA 4UFGH 1DVAH 4LK4A 1GI7B 1LHEH 2G4TA 1HNEE 4X6MA 3UNRA 3PV2A 3UREA 1GI6A 2SGPE 2VINA 1S85A 2P3TB 2P95A 2BLOA 1NFYA 1O30A 3PMHB 2RDLA 5L2YH 4OS2A 3Q3YA 4SGAE 4OM9A 1BBRK 2FI3E 4WWYA 3KGPA 3RXPA 1GMHF 3BTQE 1T31A 2ANYA 1CGJE 1PQ8A 1HV7A 1GPZA 1YPHE 5ABWA 3S9BA 1GJ5H 1PPEE 1KLTA 2FDAA 5HMAA 1EQ9A 2BD5A 1BTHH 1GJDB 2WPKS 3STJA 1SL3A 1KIGH 1UVOA 1DUAA 1KSNA 1EAIA 1GBTA 4GLYA 4WY3A 3VEQB 4ASHA 3GY3A 1FPCH 1OWHA 2THFB 1ABIH 1TNKA 3SU3A 1UK2A 1HBTH 3A85A 5C5OA 3AASA 2AEIH 1J8AA 5C67A 1GJ8B 4ZXXH 1LKAA 2FLBH 3WY8A 1PFXC 3M7UA 2GP9B 1ESBA 3URDA 1QB9A 3BV9B 2XBVA 3SORA 4IW4E 1S84A 3KNXA 3B9FH 1DWDH 4GHTA 1O2YA 2GDDA 1CSOE 1EP5A 4THNH 4AGKA 4GCHF 1C1OA 2SGEE 3K6YA 4AX9H 2Z9JA 2BLWA 3BTDE 4NSYA 2A45B 2FZZA 1GVKB 1C1QA 2G5NA 2OC8A 4FUCA 3KL6A 2HLCA 3V7TA 4ISOA 1IHSH 3A7XA 3LIWA 1PPBH 2GV6A 2V35A 1FY1A 2GZ7A 5E2PA 1DWCH 3AVZA 3KQBA 5A8XA 3F9GA 4MVNA 3OU0A 1Z8JB 1GBEA 3MH5A 1QB1A 2OBOA 4Y0YE 4AGJA 3ZVDA 3SQHE 1RGQA 1FN6A 4Y76A 1UHBB 3UIRA 1NRQH 4WMFA 3PMBB 4FXGH 1GHAF 5L6NH 2CV3A 3E8LA 2PKSB 1Z1JA 5JDUB 3BIVH 2CMYA 4DVAU 4I7YH 1V2JT 3A7VA 3MU4A 1TABE 2GT8A 2ZFFH 1HAGE 2CHAC 2TBSA 5F8ZA 2PKAA 6ESTA 1C5OH 4HGCA 5K0HA 3BSQA 1Y3YA 2VIQA 1CT0E 1O38A 3ATIA 1OS8A 3P17H 3GYMA 8GCHG 4NIWA 4BAQB 1QRZA 1FXYA 2OCVB 2TRMA 1KLIH 1DX5M 2P16A 1D3QB 1V2OT 1EP6A 1F0SA 3SOSA 3U8OH 1RJXB 1Z7KA 4D76A 1ELAA 2ZFRH 1TGSZ 1ELBA 2A2XH 5CHAC 1SG8B 1QGFA 1EJMA 2ZKSA 3E3TA 3TJOA 5FHTA 3M7TA 3PB1E 4X6PA 3FFGA 1AVWA 4TPYA 1VITH 1MTWA 3TH3H 4J2YB 1E38B 2TGPZ 3FVFB 4E7NA 2WUCA 1SLWB 3R0FA 3TLOA 1SOTA 4GHQA 1DE7H 1O36A 1XVOA 5LPFA 1LKBA 2W3KA 1SGPE 1FNIA 2ZCLP 2QXJA 1GCDA 2CN0H 2J95A 2PFEA 1NU9A 1O3IA 1ZPCA 2W7UA 1GBIA 4WXIA 4DCDA 5C5NA 3SU1A 2BOKA 3ZZ6A 2BDCA 1NS3A 4Q7ZA 1TPPA 3AW1A 3A7TA 3NCLA 1ELVA 2PSXA 4JYVH 3ZZ3A 1XXDA 2G81E 2HPQH 2QXIA 1DY9A 1C2KA 4Y8XA 3RMOH 2QF0A 5C1XA 2Z7FE 1UTPA 1KY9A 2C93B 4AN7A 1TMUH 4X1RU 4WH6A 4MLFB 1TNLA 1P2OA 2A4QA 1AE5A 1WTHD 1Y5AT 5EQSA 3U8TH 1BRUP 1V6DA 1GWAA 2V3HH 4NA7A 1A1RA 4DURA 1ZJKA 4MDSA 3T29A 2F91A 1W11U 4F4OC 3ZZ9A 2WINI 1P10A 3GCHC 1MTSA 1EPTC 2TGDA 3ENSB 3VFEA 3UY9A 2PR3A 1LHCH 3KF2A 3D65E 1HGTH 4XBDA 2IPHA 1IQNA 1J9CH 3SJ9A 2YOLA 4DGJA 4JZIA 3O8BA 1P2KA 3A8BA 3KHVA 2VGCB 1BA8B 2WV4A 3LGWA 4YT6H 2BDGA 1LVMA 2XBWA 1NRNH 2FP7B 1Y3XA 1O32A 5A8ZA 1AB9B 3MOCA 1BJUA 1SFQB 2O9QA 3EQ0H 4INLA 3LGYA 1C5TA 1PPZA 4TY7A 1HAZB 2ZPSA 2CF9H 2NU2E 3OTJE 1ZHRA 1GMDF 3F1SB 5I25A 5I46H 3N7OA 1OP2A 1QBNA 3TGJE 1O3MA 3RXDA 3BTME 3T5FH 3PO1C 4WMEA 1CBWC 3E6PH 1KXAA 1WOFA 5EU8A 4H42U 5DPAA 3KCGH 4XFQA 1NZQH 1BTPA 2VH6A 1D3PB 1BTZA 1KXEA 1BITA 2ZU5A 1SOZA 2I6QA 3ZVAA 5DP4A 4RN6A 1TNIA 1F92A 3BG4B 1BMLA 3KIDU 4CH2B 5GJ4B 3HGNA 3U98H 3TGKE 2XXLA 1TRMA 1CE5A 2ZQ2A 2ZTXA 1MKXK 1NFXA 1T32A 3FAOA 3TJUA 4ZMAH 2FOMB 1O3NA 4AZ2B 2H9HA 1CHGA 2VIDA 1P01A 1AMHA 3BTKE 4NA9H 1CHOG 3SU2A 1G37A 1WSSH 1C2DA 2ZDMA 1C1WH 4B6FA 1BTYA 4R8TB 1P3CA 2R2WU 1N1LA 3ZVCA 4NIYA 2STAE 4Q7XA 2NU3E 1MTNC 1H1BA 3D62A 3RMMH 2H6MA 4DIIH 1ZMJA 8KME2 2BD3A 2XBYA 3GY4A 3SI4H 1W12U 4TY6A 3QGJA 2SGFE 4J1YA 1C1NA 2UUJB 2V0BA 1MH0A 1EZUC 1GBFA 4O03A 1WTGH 4IS5A 3RXSA 1HJ9A 2D1JA 2STBE 2HNTE 3S9AA 3STIA 4ABDA 1D9IA 1W0YH 1HAPH 1OWEA 4HTCH 5C3NA 2Z94A 3SO3A 2FOFA 1HCGA 1AUJA 4BANB 1QB6A 2WYGA 3AK5A 1L2EA 1O3CA 1S0QA 4NFEA 4ABIA 2A0QB 1DXPA 1C5NH 4A1VA 1AZ8A 3ZVEA 5J4SA 3GOVB 2FTMA 2Q6FA 3CENA 2FOCA 4X1NU 3LH1A 3K2UA 2QF3A 1BT7A 1ELGA 1TNJA 1L1NA 1Z71A 5FAHA 1C5PA 4TWWA 3GCNA 2CF8H 1T8OA 2BDAA 1B7XB 5DGJA 2FOHA 1B0EA 3UUZA 1GJ9B 4CR5A 5H4IB 2F9PA 5EW2H 2BHGA 1H9LB 1TMTH 5FBIA 3F9FA 4Y7BA 4H6TA 1DY8A 2PHBA 2ZDNA 2XWBI 5LH8A 4NIXA 1DWBH 2ZGHA 3TK5A 3GICB 1GJ7B 1INCA 3SU4A 1LQDB 3RMNH 1N8OC 2A7CA 2GTBA 3QUMP 5K7RA 1K1NA 3PM3A 1LDTT 1RIWC 5EG4A 5LGOA 1C1MA 1TGBA 4CH8B 3ATLA 1TGNA 3QLPH 3BEIB 1EX3A 2O8TA 1O33A 2HPPH 4FUEA 1DFPA 1HDTH 1O2IA 3ZZAA 4M9FA 3T27A 1ELEE 1W7GH 2G51A 2XC0A 5EXNA 3VXFH 3VXEH 1JIMA 3DHKH 1W3CA 4Y0ZE 1BMAA 4BXWA 5BPEA 1V2WT 2VIOA 4CBOA 1LPGB 4JMYA 1GBAA 1CO7E 2PTCE 4CRCA 3BEFB 5B6OA 1S82A 1UTOA 2EI6A 1MCVA 2O8UA 2BVRH 2IJOB 1VGCC 1JRSA 1LPKB 2CHAB 3MO9A 1RTLA 3OSYA 1HAIH 1BTUA 2Y5HA 2AMQA 1A3BH 5AVDA 4AFUA 8ESTE 1O5DH 1ESTA 1C2HA 1T8NA 3V3MA 4CHAB 6LPRA 3PTNA 1ZJDA 2J38A 1P9UA 4A1TA 3FZZA 4AFSA 2FTLE 2QXHA 2G4UA 2FESH 1P2JA 1G3BA 3ATKA 3Q3KA 4Y7AA 1DSUA 3RU4D 1TB6H 3RXVA 1E0FD 1HXFH 1AUTC 4MPXA 5CHAB 1TYNA 3TPIZ 4YOIA 1DITH 2UUYA 4H6SB 5LPEA 1ESAA 5G4BA 5GCHF 3MU5A 3SBKA 4HI3A 5IYTA 1J14A 4Y71A 2QV1A 4ABGA 7LPRA 1J16A 4IC5A 3KN2A 3P92A 5AF9H 1UHBA 2FMJA 5F03A 1O3DA 2ZA5A 2OQ5A 1XUHA 1LO6A 4ZXYH 1TQ0B 3LC5A 3ZV8A 1BRCE 4CRFA 1FIWA 1QRXA 2PTNA 3VGCC 1V2TT 3SJKA 2NU4E 1EAWA 1BJVA 2ZDAH 2BYAX 2EEKA 1S0RA 1N6XA 1PQAA 4WVPE 1TNGA 1C5ZB 3RMLH 1XUGA 1GI2A 1GHZA 1BTWA 2Y82A 1HAHH 2SNVA 2GMTB 1GHBG 1SPJA 4INHA 1P2MA 2GDEH 1KXCA 3ODFA 3M5LA 1ZSLA 3LGVA 4B76A 4KGAA 2AMPA 2BXUH 5AFYH 2CXVA 1E35B 1UVUH 5DK1A 5FX5A 1ELFA 5E0HA 1EZQA 1OWJA 3M37A 1O2VA 1K28D 1V2NT 1VZQH 1XM1A 1PQ7A 5DP3A 1U6QA 3SU0A 2VIWA 1ZGVA 3PMJA 3URCA 1DPOA 2JH6D 1C9PA 5EPYA 4B2AA 2D8WA 1MZAA 2R0LA 3A83A 3UNQA 1OX1A 1MKWK 1SR5C 2O8WA 3GCHB 3EAJA 3OX7U 3JZ2B 1EPTB 4ISLA 3RXUA 1SB1H 1L1GA 1RXPA 4ZUHA 2ZTYA 2XRCA 1ZTJA 1O2NA 2B0FA 3KQEA 2ASUB 4IMZA 1PPHE 1QQ4A 2ZG0H 4M7GA 1C2EA 1Y3VA 1O3FA 1YPMH 4NG9H 2C8YB 2ZFPH 2GCTC 3RC4A 3ITIA 1FAKH 4E06H 5BRRE 1K1IA 4PROA 1GMHG 1K1PA 1GHVH 5T1VA 1TX7A 1QL9A 3U9AH 1TX6A 3C27B 4ZKOU 1XUKA 1LVYA 1SSXA 2DE8A 4X8SH 1CBWB 1KTTB 2ODYB 1YPEH 2AH4X 2J4IA 2Y6TA 2VWLA 4JZEH 3PV5A 2A7HA 4A1XA 2VWMA 2WV9A 3R3GB 1ANEA 1C5VA 3HK3B 1O3GA 3QN7A 4WMDA 3VB5A 3LJOA 3EDXB 4AG2A 2BDBA 2GD4B 1MQ6A 3W94A 1FY4A 4MNVA 3M5NA 2W3IA 4MTBA 5FPYA 4K60A 1ZRBA 3QX5H 1WV7H 1FAXA 1ACBE 1ZPZA 2FIRH 2EI8A 1T4UH 2P8OC 5HM2A 2FI4E 3GY6A 2ZDKA 1FN8A 2PGQB 3F9HA 3GYLB 2PV9B 3RXIA 2PUQH 3PWBA 2ZU4A 1MUEB 9LPRA 4U30A 2LPRA 3DUXH 3ZZ4A 5GIBA 5JYIA 1T8MA 3LPRA 3U69H 4MG3A 2BVSH 2ZQ1A 4FUGA 3T25A 3TH2H 4D7GA 2XCFA 3M7QA 5C20A 3A7ZA 5JB9S 4K2YA 2ALPA 1SQTA 4GCHG 1MTNB 1V2PT 4RKJB 1YPHC 2Y81A 1O3EA 5JBTA 1GL1A 1MCTA 3HPTB 1CT2E 1SGRE 1K1OA 2RG3A 5TCAA 4AG1A 1SGEE 1O2RA 1NRSH 4TWYA 2BDHA 1O5EH 2BQ6B 1UTLM 2Z9KA 3DT0H 1TWXB 1IQGA 1BHXF 1EZSC 1BMMH 1GVZA 3CS0A 4U01A 1FIZA 3LH3A 2O8LA 1W14U 1XX9A 1T7CA 1AN1E 1L4DA 1DT2A 4FVBA 2NU0E 3BTHE 3JZ1B 3S69A 5JPMH 2FYQA 1A5IA 3VB4A 2A5AA 2ODQA 1GHAG 4BAKB 1LMWB 4MQAA 1TONA 1W2KH 2H1UA 1GBHA 3M3VA 2R9PA 3RU4T 1QL8A 2OTVA 1F0RA 1QJ6B 1P57B 3SNCA 3O8DA 1GI5A 3OY6U 1OKXA 1TBQH 1UK3A 2VVVA 1LTOA 2JETC 1J17T 3L3TA 4ZKSU 3BEUA 1O5AB 1ZSJA 2OD3B 3RXQA 3TVJB 1K1JA 1IOEA 4CRGA 4XBBA 4INKA 1YBWA 3GY2A 4UFFH 3SU6A 3RXLA 1G9IE 1FMGA 2ZHWH 2XCNA 3SGQE 3SGBE 3PROA 5E8EH 3RXGA 1FQ3A 4WH8A 1GHXH 1H9IE 1BUIA 1KXBA 1GBKA 1O3LA 5L30H 3G01A 3SHCH 3NWUA 3GY7A 1MKXH 4YLUA 1CGHA 1RIWB 4BTTB 1Z8RA 1O31A 3SZEA 5A2MH 3LU9B 4Q2KA 1THRH 4LZ1H 1A0HB 1MMJN 2FO9A 5DKMA 3KQCA 1OPHB 1BTXA 2VWNA 4BOHA 2FS8A 1ANDA 1UVPA 1RD3B 1P3EA 4JCNA 4OS5A 3MU0A 1ZTLA 2G52A 3BIUH 3FANA 1C5MD 3M5OA 1BIOA 1D4PB 3UFAA 2HALA 2ZF0H 1SI5H 2XW9A 1FLEE 1SFIA 4XBCA 1C1SA 3HKIB 4ABHA 1HYLA 1D6RA 1VGCB 3RUOA 1OP8A 2A1DB 3RDZA 1YKTA 2B7DH 3RXBA 1G30B 3TJNA 3IWMA 1V2LT 1GBDA 3HATH 2WZQA 1DXWA 1XXFA 2VU8E 1Z8IB 1AI8H 2XTTB 2SFAA 1BMNH 1Z1IA 3E0NB 2QY0B 1JWTA 2AIQA 3QWCH 3LKWA 2C8ZB 2SGDE 3TGIE 1AIXH 3TNSA 3AW0A 2XNIA 1VITF 3RXFA 2XYAA 4B75A 1C2IA 1GGDB 3RC6A 1GJBB 3EA9A 4X6NA 4UFEH 1JOUB 2BDYA 5B6LA 4K5ZA 1S83A 1G36A 3LT3A 3RXJA 2ZI2H 2ZHDA 2WPMS 3PV4A 1GG6C 2Z3DA 4YESB 4X1PU 2BY6X 2PWXA 4WF8A 3E1XB 3A8CA 2GZ9A 3VGCB 2YNAA
chains in the Genus database with same CATH superfamily
1UO6A 1ZHMA 4NIVA 1XKAC 1F5LA 5EW1H 2ZP0H 8LPRA 3GCTF 1P2IA 2G00A 1YP9A 4O3UA 4UE7H 3Q77A 2ZNKH 1Y59T 1QZ8A 3MFJA 2P94A 1GMDG 1LHFH 2NWNA 2G55A 1FJSA 4ACAA 4KTCA 4ZCNA 1Z6JH 1ANBA 2M2AA 4DT7B 4JZ1A 1IQEA 1O3KA 5KEDA 2Y80A 3L33A 5EJLA 4BNRA 2O8MA 3MMGA 4R0IA 3LDXH 1T4VH 4KKDA 3M5MA 2ZDLA 2J98B 1SLXB 3ZVGA 1ZGIA 3NKKA 3RC5A 1IQHA 2QE7D 4JZFH 3S7KB 1ZTKA 5EQRA 1WQSA 1ZR0A 5GPIB 1ARBA 3P95A 2GCHF 1QY6A 1MBQA 3ELAH 4JZDH 3SV7A 2VVUA 2Y7ZA 3I77A 4IGDA 4GVUA 3DD2H 3RLWH 1H8DH 2QF4A 3M35A 5LPRA 4Z0KA 2ZWLH 3MO3A 2ZGXH 3BG8A 5FPTA 4MPWA 1YF4A 5A0CA 1K2I1 2V6NA 3TK6A 1O3AA 4ACBA 4K8BA 4QT8C 1Y5BT 2Q6GA 6CHAC 5HGGA 5JBAS 1O2QA 1NO9H 1G3EA 2OQUA 1QURH 4FUDA 2ZECA 1QQUA 1H4WA 5C1YA 1AO5A 2FOBA 5PTPA 2GCTB 1DICA 4WXVA 1HAOH 3P8OA 1O35A 2TGTA 3PRBA 5AFZH 1G3CA 3ZZCA 1O2XA 1W0JD 4CRAA 2YMSB 1PQ5A 4I8KA 3BTTE 4X6OA 5DO4H 2OK5A 2PUXB 3GISB 1K21H 1UTJA 3A7YA 1EAUA 1YPLH 5DP7A 1OYTH 4U32A 1EB1H 2GVFA 1ZYOA 3O8RA 1P02A 4ZROA 1V2RT 3ZVFA 4HFPB 5JB8S 1XVMA 5ETXA 2OC0A 2WPLS 5FXLA 1CA0C 1FY5A 2BLQA 4FUHA 2UUFB 1ABJH 1GVLA 2F9OA 3BTEE 1BMFD 2J94A 1GBCA 1KYNA 2GKVE 2ZGCA 2BD4A 1EPTA 4ZAEA 3MTYA 1MD7A 2ZGBH 3CS7A 1UCYH 1FONA 1C2JA 6GCHF 2VIPA 2B5TB 2P8OB 4DW2U 1A0LA 1UCYE 1XUFA 4FETA 4WJG2 1YGCH 2ZO3H 2F9NA 3V0XA 3VB3A 1O3BA 2AS9A 2J9NA 4X8VH 5DSFA 5A0BA 2DE9A 4A7IB 2ALVA 2RA3A 2BOHB 2Y5FA 1MBMA 1CA8B 1NRPH 1O2MA 2CGAA 2Y5GA 2HNTF 4HZHA 1QHRB 4DG4A 1Y8TA 2VIVA 2ZPQA 1DLKB 3PLBA 4JK5A 2HNTC 2ZFQH 2ZPRA 5DP9A 3SJ8A 3RM2H 7ESTE 1G2MA 4OS6A 3AAVA 1EJAA 1TA6A 2BQWB 1KXFA 1Q31A 2VVCA 4AORA 4DJZB 5EJ1A 1K9OE 2VNTA 3MYWA 1MKWH 2HGTH 1O2GH 2SGQE 1EAXA 1BHXB 2WHXA 4RKOB 2RCEA 2FOGA 3M61U 4GAWA 1SC8U 1GDNA 4Q4LA 5C0UA 1QR3E 1Y5UT 5F8TA 2AGIX 5F8XA 5HIYA 5EIYA 2ZU2A 3T2NA 1B5GH 1GI0A 4DIHH 1QFKH 2C8WB 3RXHA 2OUAA 1V2QT 1V2ST 1C2LA 2RA0A 1OXGA 1QJ7B 1TBZH 1UJ1A 1QA0A 1JMOH 2PW8H 3ZZ5A 1THPB 1CU1A 1VR1H 2HRVA 3P6ZB 2LELA 2Z3CA 3RXCA 1BCUH 2RDEA 3SZNA 2AFQB 4YT7H 3MU8A 5EXMA 5DN6D 1O3JA 3A8DA 1AD8H 1J15A 1CQQA 1A7SA 2A31A 5E2OA 4HG6A 1HAVA 4BAOB 4ABAA 1HFDA 3QZRA 1EZXC 3TU7H 5IDKA 5EJZA 1FY3A 2VJ1A 1L4ZA 4B6EA 4U2WA 1AKSB 3QDZB 1SLUB 3FOAA 1MTVA 1NESE 2UWOA 3U8RH 1JBUH 1HIAB 4FU9A 2PSYA 2P59A 4ABJA 5GXPA 2R3YA 5TCCA 3ZVBA 3OY5U 1VJ9U 2LNCA 5JBCS 2XNDD 3LGUA 1DSTA 1MU8B 1NTPA 4AFQA 1AFQC 1GCTC 3GCOA 3MU1A 1HAYB 5GCHG 7GCHF 1DDJA 5GNDA 3OE7D 1FY8E 2JH0D 1MZDA 2H5CA 1F0UA 3MH4A 4CBNA 1SGDE 5SGAE 1ZRKA 4OGXA 2UWPA 2ANWA 1UCYK 2P3FH 5L2ZH 2XC5A 4IC6A 3FP7E 2QAAA 1GDQA 4Y8ZA 1QCPA 4A92A 2ZU1A 4I8HA 1WUNH 1O2UA 4DOQA 3B23B 1GHBF 4ZHMU 4OS1A 2ZIQH 3UR6A 1OWIA 4FVDA 1C2MA 1CGIE 3RXRA 3A84A 3RP2A 1BDAA 1AWHB 1HB0B 1C5QA 4ISNA 2ZCKP 3A8AA 3LGTA 4ZH8A 3Q3XA 1PJPA 5JBBS 2ZGJA 1O5GH 1GMCF 1P03A 3SV8A 1AVGH 3IG6B 1JRTA 2WSSD 1FPHH 5FCRA 3ZZ8A 4ABFA 3SN8A 3M3SA 4ABEA 1G32B 1LVBA 1TX8A 4YTAA 3ZV9A 3RLYH 1SGFG 4UEHH 4ABBA 1SHYA 3I29A 1OWKA 3A88A 1V2MT 1W13U 1C1RA 1E1QD 4IN2A 2A5KA 1RRKA 1DM4B 2ZC9H 1O0DH 2WPJS 3F9EA 3A86A 1SQOA 4O3TA 3ODDA 2WUBA 1BRBE 2TPIZ 1O2LA 4B74A 1O3HA 1GG6B 2ZHFH 2BY5X 1F0TA 2TGAA 3MO6A 4VGCC 2QYIA 1GJ6A 3OYPA 4Y6DA 1TNHA 4F48B 1O3PB 1S81A 3UQOA 1BRAA 5FX6A 1O34A 1A0JA 5EXLA 3GY8A 1SQAA 3OEED 4KP0A 2GV7A 3PO1B 5A8YA 1ARCA 2EA3A 1T8LA 2C8XB 4Z6AH 4YOGA 2C90B 1G3DA 2WV5A 3SYJA 5CDFE 5FBEA 4AB9A 4BAHB 1HJAC 1OWDA 4JYTA 2ANMH 3RXKA 5CE1A 3UOPA 1AE8H 3TH4H 4CRDA 2BVXH 1YLCA 1DLEA 4X8UH 1BQYA 1AY6H 4BTUB 4DT4A 2QC2A 4Q7YA 1NPMA 3QTVH 1Q3XA 2FOAA 3SU5A 2XC4A 4YOJA 1YLDA 3D49H 1C4U2 1NFUA 3MNCA 1BB0B 3CP7A 3AAUA 1K1LA 4MPUA 3M3TA 1ETRH 1YCPH 1E34B 1THSH 2J34A 2HVXA 2ULLA 1IHTH 1SGYE 1HAVB 1GJCB 1ZOMA 3B8JA 2GZ8A 3P8FA 5C2ZA 2ANKH 2H2ZA 1KDQA 3IITA 2I6SA 4ZHLU 1N6YA 3OFND 6CHAB 1D3DB 1LVOA 2ZDVH 5EGMA 4NA8A 1FI8A 4D8NA 1YCPM 1TFXA 3LGIA 2BY9X 1MTUA 2YNBA 2BX3A 4I32A 2CJIA 3MNXA 5EOKA 1TIOA 1Y3UA 2QGRA 3SUDA 1OYQA 1P04A 2J5UA 1PYTD 1SHHB 3SNBA 1IQFA 3W95A 3SJOA 2FYRA 1EJNA 4XSKU 4I8LA 2HOBA 4ZHAA 1W0ZU 1FUJA 4DY7B 1O2SA 3BTFE 3QTOH 4KTSA 2H9EH 2J98A 1C2GA 1AVXA 9ESTA 2VBCA 1P11E 4AYVB 1IQJA 1O5FH 3SUEA 1C1VH 2SGAA 2C4FH 1C4Y2 4BTIB 3P8GA 1HLTH 3A80A 3WW7A 4NGAH 3GDUA 1E37B 1SGFA 4I33A 8GCHF 1QL7A 1A5HA 3FP8E 2ZTZA 3LC3A 1GBLA 4GUXA 2H9TH 1GBJA 3A7WA 1L0ZA 2F9BH 4NFFA 1CA0B 3MQKC 2ZZUH 1C1PA 2BLVA 1AFEH 3RXTA 2G8TA 2Z3EA 2A32A 1TE0A 4CHAC 2EC9H 2A4GA 1TRNA 1IAUA 1C4V2 3PYHA 2AMDA 1EB2A 4XE4A 3C1KA 1W7XH 4X1SU 2KAIB 3D23A 1ZZZA 1TMBH 2FM2A 2BZ6H 3QZQA 4O9VA 3QK1A 2BQ7B 4NCYA 1MQ5A 2FX4A 2J2UA 1EXFA 1N8OB 1GJ4H 1C5RA 1SGNE 2SNWA 1ID5H 2XBXA 1HJ8A 2FEQH 1C5YB 2J92A 3QO6A 1NROH 4K1TA 3GY5A 4I8JA 5HYOA 1ZLRA 1UVTH 2BD8A 3NUMA 5T6FA 3T28A 1DOJA 2XOKD 1LQEA 1TGTA 3DA9B 4B2BA 2F3CE 1V2VT 4ISHH 3UR9A 3HGPA 1P9SA 1NC6A 4H4FA 3SQEE 1A5GH 1NT1A 2A4RA 2HWLB 1WBGB 4GPGA 1YCPK 1TPOA 1SBWA 1P09A 4FU8A 2BXTH 4LOYH 3EA7A 1ZHPA 2AGEX 4CREA 2Z9GA 1RS0A 5T6GA 4X2VA 1C5UA 1TA2A 3BN9A 2G5VA 3PLKA 5DP6A 2P93A 4F49A 4X1QU 3MHWU 4IN1A 5J4QA 1O5BB 1AU8A 1PYTC 1RTKA 1UMAH 3H7TA 2GT7A 3KEEA 1IQLA 1VCWA 4E7RG 1LHDH 2B8OH 1O2HA 2Z9LA 3VB7A 1O5CB 1SGCA 2PGBB 3M36A 2BD7A 1NBMD 2W26A 1GI3A 4K3JA 4MNYA 2GMTC 4ZKNU 4OS7A 3QGNB 3K6ZA 3E90B 4I31A 3LJJA 3ESTA 1XKBC 3F2HA 1P0SH 1A3EH 1E1RD 1JXPA 2OP9A 2IOTA 2ZEBA 1YPJH 1UTQA 4K1SA 1O37A 1RFNA 2JKHA 1WAYB 4RSPA 2K0QA 1UVSH 5A0AE 4I8GA 2IJD1 2ZHEH 1O2JA 1GI9B 1QA7A 1YPKH 2OBQA 2ILNA 3A81A 1C5SA 2GJGA 3L6PA 1ANCA 3A89A 1GI1A 2QA9E 1LPZB 1F2SE 1TRYA 4B71A 1LCYA 2ESTE 3SV6A 1C5XB 5GDSH 1C5WB 1KTSB 2A5IA 1VITG 3MH6A 4JYUH 1Q2WA 1SVPA 3S9CA 1K1MA 1KDQB 5DJ7A 1AFQB 1UW7A 1GCTB 2ZU3A 1X7AC 2F43B 2F83A 3I78A 4BAMB 1MAXA 2Y7XA 2F9VA 4RI0A 4A5TS 3H5CB 4X0WU 3W1EA 1P8VC 1QBVH 3KQDA 2BB4A 1SGQE 2AGGX 3TK9A 3F68H 2F9UA 1HXEH 5EODA 3TJVA 1OOKB 1BOQA 2KX4A 2Q1JA 4IBLH 3LOXA 3A87A 1Y3WA 3U1JB 1C2FA 1OP0A 2UUKB 3PLPA 4FU7A 3BF6H 3ZIAD 4OGYA 4X2WA 3FZDA 1GBMA 3GCTG 3PTBA 2EI7A 2BY8X 5A09A 2A2QH 2W7SA 1S6LA 3DFLA 1VCPA 2BY7X 1EUFA 4D9QA 4AC9A 2BD9A 1EATA 3SNAA 4FUIA 2WYJA 4BXSA 1AKSA 3NXPA 1KLJH 1MAYA 1JIRA 2H5DA 2R0KA 1HPGA 1W10U 1AHTH 2BMGB 1CHOF 5FPSA 3SV9A 1TALA 2FXRA 3T26A 2B9LA 1HIAA 3P8NA 4E05H 3ATWA 1QRWA 4ESTE 2D2DA 1K22H 2PKAB 2GCHG 4KELA 1FZZA 2FLRH 3SJIA 1WDIA 1YC0A 4CR9A 2BX4A 5EPNA 3OTPA 3RXOA 3ZYEA 2FS9A 2DUCA 2ZFSA 1YM0A 1KXDA 3GDVA 3E16B 2FOEA 1O2WA 1A4WH 4NWKA 4Q80A 3UOUA 1YYY1 5C1UA 1B0FA 3UWJH 3O8CA 4YLQH 1H8IH 2OLGA 1WU1A 2WPHS 3U28C 1GI8B 1SLVB 1P12E 1GDUA 1FX0B 2Q6DA 2QIQA 1DUEA 3ZZDA 2P3UB 3NPSA 1O2ZA 3N7DA 3Q76A 4UFDH 4VGCB 4Y10E 4NWLA 5DP8A 2WPIS 1TGCA 1EOLA 4Z1MD 3RXEA 1O2PA 4FUJA 4P02A 2TIOA 3PWCA 1HAXB 1MU6B 1SMFE 2ZCHP 1QTFA 4K69A 1O2TA 4Y79A 2OXSA 4UONA 3SV2H 4AB8A 3ZZBA 4FUFA 1O2OA 2PKSC 3GDSA 4X8TH 1HJAB 1ZPBA 2FODA 1NY22 2BZAA 5DG6A 2R2MB 3SGAE 3SNEA 1RTFB 1BZXE 3EGKH 1P05A 3HK6B 3TITA 5E0GA 4X2XA 1TOCB 4XOJA 4TPIZ 3RXMA 5CMXH 1F7ZA 1ETSH 1ORFA 3MH7A 1V2KT 1NFWA 1H8ED 3Q00A 1GJAB 2IN2A 1DANH 4A6LA 4OS4A 3K9XB 1ZSKA 4AYYB 4MNWA 1GBBA 2FI5E 1V3XA 3EYDA 1WXRA 1NRRH 1S6HA 3HKJB 2JJ1D 4LXBH 3SUFA 1TAWA 6GCHG 3LONA 4B2CA 4UDWH 1TLDA 3MI4A 4SGBE 2K1QA 3S0NA 3DSGA 1O2KA 4O97A 2QN5T 3VPKA 5HM9A 1TBRH 4NZQA 2Z9IA 1E79D 5E0JA 3UQVA 1Z6EA 1P2QA 1IQKA 3MWIU 4NZLA 1AZZA 1G2LA 1CT4E 1A61H 4Y8YA 5HXFA 1PPGE 1DS2E 1SGTA 5AHGH 1TQ7B 3PMAB 2FPZA 5IK2D 4XDEA 5F6MA 3FP6E 3RM0H 3K65B 2QXGA 4K8YA 3RXAA 2BTCE 3F6UH 1A2CH 1C1TA 1LHGH 1PPCE 1Z8GA 1M9UA 4CRBA 2A7JA 1C1UH 2VB0A 2GX4A 1EKBB 2UWLA 2M5TA 2V3OH 3T62A 2PLXA 2AERH 3OAAD 3EA8A 1NU7B 4LZ4B 3ZYDA 1V2UT 1YWUA 4D7FA 1BBRH 3NZIA 4AFZA 3UWIA 1ZMNA 2JETB 2AYWA 1BBRE 3EE0B 1L1JA 1WYKA 3BTWE 1OSSA 2FX6A 1SGIB 1TOMH 1VCQA 4Y11E 3SHAH 5TJXA 3SW2B 1ELTA 2OINA 5ESBA 1HUTH 1UTNA 1ETTH 1EOJA 3NK8A 4K1EA 1QNJA 3S7HB 1TPSA 2XWAA 3BTGE 3DFJA 4X2YA 1IQIA 1UK4A 3H7OA 1QBOA 3VB6A 3UNSA 3TIUA 4JK6A 2IPQX 1VJAU 2OC1A 5GWZA 3F2GA 1HRTH 1IQMA 4MPVA 1GGDC 2PP6A 1UTKA 1P06A 1QIXB 1YY3A 2Z6BD 2VGCC 4YZUA 1NN6A 1E36B 4NSVA 1AQ7A 1XMNB 1AWFH 2OC7A 3SNDA 1AB9C 4GSOA 4TYDA 2QCYA 4B1TA 1ELCA 1GHWH 1GL0E 1C5LH 3SI3H 3U1IB 4D9RA 1QJ1B 2R3UA 1YPGH 2BM2A 2LP6A 1MD8A 3MNSA 5T3HA 1FDPA 2NU1E 1TPAE 4KTUA 7GCHG 1S6FA 2JJ2D 3RU4E 1D3TB 2C3SA 1PPFE 3H09A 3ZZ7A 4B73A 1EASA 1P2NA 4UD9H 5EQQA 4AOQA 1S5SA 1F5KU 3UTUH 4RT1A 3UPEA 2V3MA 3SUGA 1DWEH 2GGVB 2D26C 1WCZA 1F5RA 2W5EA 1ZMLA 4MNXA 1ELDE 3P70B 1A46H 5T6DA 2AIPA 1GI4A 2ZHQH 5FCKA 4YO9A 3V13A 2F4LA 2A4OA 3BG4C 3UB0A 2FWWA 3A82A 2KAIA 2BD2A 3V12A 1O39A 3ATMA 4ISIH 4IMQA 3PRDA 2ODPA 1NM6A 5DP5A 1XUIA 2JH5D 4YM9A 4FUBA 1GHYH 1W8BH 3DSPA 1SKYE 3TNTA 3E91A 2VWOA 1C9TA 1GMCG 1CVWH 2BDIA 1D6WA 1AGJA 1FV9A 1H9HE 1O3OA 2VH0A 1XUJA 1UTMA 2ZFTA 4ZKRU 5ESTE 1WQVH 7KMEH 3E0PB 3MNBA 4UFGH 1DVAH 4LK4A 1GI7B 1LHEH 2G4TA 1HNEE 3PV2A 4X6MA 3UNRA 3UREA 1GI6A 2SGPE 2VINA 1S85A 2P3TB 2P95A 2BLOA 1NFYA 1O30A 3PMHB 2RDLA 5L2YH 4OS2A 3Q3YA 4OM9A 4SGAE 1BBRK 2FI3E 4WWYA 3KGPA 5F53A 3RXPA 1GMHF 3BTQE 1T31A 2ANYA 1CGJE 1PQ8A 1HV7A 1GPZA 1YPHE 5ABWA 3S9BA 1GJ5H 1PPEE 1KLTA 2FDAA 5HMAA 1EQ9A 2BD5A 1BTHH 1GJDB 2WPKS 3STJA 1SL3A 1KIGH 1UVOA 1DUAA 1KSNA 1EAIA 1GBTA 4GLYA 4WY3A 3VEQB 4ASHA 3GY3A 1FPCH 1OWHA 2THFB 1ABIH 1TNKA 3SU3A 1UK2A 1HBTH 3A85A 5C5OA 3AASA 3F3BA 2AEIH 1J8AA 5C67A 1GJ8B 4ZXXH 1LKAA 2FLBH 3WY8A 1PFXC 2KCAA 3M7UA 1H8HD 2GP9B 1ESBA 3URDA 1QB9A 1OHHD 3BV9B 2KCOA 2XBVA 3SORA 4IW4E 1S84A 3KNXA 3B9FH 1DWDH 4GHTA 1O2YA 2GDDA 1CSOE 1EP5A 4THNH 4AGKA 4GCHF 1C1OA 2SGEE 3K6YA 4AX9H 2Z9JA 2BLWA 3BTDE 4NSYA 2A45B 2FZZA 5FL7D 1GVKB 1C1QA 2G5NA 2OC8A 4FUCA 3KL6A 2HLCA 3V7TA 4ISOA 1IHSH 3A7XA 3LIWA 1PPBH 2GV6A 2V35A 1FY1A 2GZ7A 5E2PA 1DWCH 3AVZA 3KQBA 5A8XA 3F9GA 4MVNA 3OU0A 1Z8JB 1GBEA 3MH5A 1QB1A 2OBOA 4Y0YE 4AGJA 3ZVDA 3SQHE 1RGQA 1FN6A 4Y76A 1UHBB 3UIRA 1NRQH 4WMFA 3PMBB 4FXGH 1GHAF 5L6NH 3DCLA 2CV3A 3E8LA 2PKSB 1Z1JA 5JDUB 3BIVH 2CMYA 4DVAU 4I7YH 1V2JT 3A7VA 3MU4A 1TABE 2GT8A 2ZFFH 1HAGE 2CHAC 2TBSA 5F8ZA 2PKAA 6ESTA 1C5OH 4HGCA 5K0HA 3BSQA 1Y3YA 2VIQA 1CT0E 1O38A 3ATIA 1OS8A 3P17H 3GYMA 8GCHG 4NIWA 4BAQB 1QRZA 1FXYA 2OCVB 3WWFA 2TRMA 1KLIH 1DX5M 2P16A 1D3QB 1V2OT 1EP6A 1F0SA 3SOSA 3U8OH 1RJXB 1Z7KA 4D76A 1ELAA 2ZFRH 1TGSZ 1ELBA 2A2XH 5CHAC 1SG8B 1QGFA 1EJMA 2ZKSA 3E3TA 3TJOA 3DSOA 5FHTA 3M7TA 3PB1E 4RT0A 4X6PA 3FFGA 1AVWA 2W6JD 4TPYA 1VITH 1MTWA 3TH3H 4J2YB 1E38B 2TGPZ 3FVFB 4E7NA 2WUCA 1SLWB 3R0FA 3TLOA 1SOTA 4GHQA 1DE7H 1O36A 1XVOA 5LPFA 1LKBA 2W3KA 1SGPE 1FNIA 2KZ4A 2ZCLP 2QXJA 1GCDA 2CN0H 2J95A 2PFEA 1NU9A 1O3IA 1ZPCA 2W7UA 1GBIA 4WXIA 4DCDA 5C5NA 3SU1A 2BOKA 3ZZ6A 2BDCA 1NS3A 4Q7ZA 1TPPA 3AW1A 3A7TA 3NCLA 1ELVA 2PSXA 4JYVH 3ZZ3A 1XXDA 2G81E 2HPQH 2QXIA 1DY9A 1C2KA 4Y8XA 3RMOH 2QF0A 5C1XA 2Z7FE 1UTPA 1KY9A 2C93B 4AN7A 1TMUH 4X1RU 4WH6A 4MLFB 1TNLA 1P2OA 3KYGA 2A4QA 1AE5A 1WTHD 1Y5AT 2JDID 5EQSA 3U8TH 1BRUP 1V6DA 1GWAA 2V3HH 4NA7A 1A1RA 4DURA 1ZJKA 4MDSA 3T29A 2F91A 1W11U 4F4OC 3ZZ9A 2WINI 1P10A 3GCHC 1MTSA 1EPTC 2TGDA 3ENSB 3VFEA 3UY9A 2PR3A 1LHCH 3KF2A 1EFRD 3D65E 1HGTH 4XBDA 2IPHA 1IQNA 1J9CH 3SJ9A 2YOLA 4DGJA 4JZIA 3O8BA 1P2KA 3A8BA 3KHVA 2VGCB 2KM0A 1BA8B 2WV4A 3LGWA 4YT6H 5HIZA 2BDGA 1LVMA 2XBWA 1NRNH 2FP7B 1Y3XA 1O32A 5A8ZA 1AB9B 3MOCA 1BJUA 1SFQB 2O9QA 3EQ0H 4INLA 3LGYA 1C5TA 1PPZA 4TY7A 1HAZB 2ZPSA 2CF9H 2NU2E 3OTJE 1ZHRA 1GMDF 3F1SB 5I25A 5I46H 3N7OA 1OP2A 1QBNA 3TGJE 1O3MA 3RXDA 3BTME 3T5FH 3NRLA 3PO1C 4WMEA 1CBWC 3E6PH 1KXAA 1WOFA 5EU8A 4Q63A 4H42U 5DPAA 3KCGH 4XFQA 1NZQH 1BTPA 2VH6A 1D3PB 1BTZA 1KXEA 1BITA 2ZU5A 1SOZA 2I6QA 3ZVAA 5DP4A 4RN6A 1TNIA 1F92A 3BG4B 1BMLA 3KIDU 4CH2B 5GJ4B 3HGNA 2KFWA 3U98H 3TGKE 2XXLA 1TRMA 1CE5A 2ZQ2A 2ZTXA 1MKXK 1NFXA 1T32A 3FAOA 3TJUA 2CK3D 4ZMAH 2FOMB 1O3NA 4AZ2B 2H9HA 1CHGA 2VIDA 1P01A 1AMHA 3BTKE 4NA9H 1CHOG 3SU2A 1G37A 1WSSH 1C2DA 2ZDMA 3FN8A 1C1WH 4B6FA 1BTYA 4R8TB 1P3CA 2R2WU 1N1LA 3ZVCA 4NIYA 2STAE 4Q7XA 2NU3E 1MTNC 1H1BA 3D62A 3RMMH 2H6MA 4DIIH 1ZMJA 8KME2 3UAIC 2BD3A 2XBYA 3GY4A 3SI4H 1W12U 4TY6A 3QGJA 2SGFE 4J1YA 1C1NA 2UUJB 2V0BA 1MH0A 1EZUC 1GBFA 4O03A 1WTGH 4IS5A 3RXSA 1HJ9A 2D1JA 2STBE 2HNTE 3S9AA 3STIA 3F2FA 4ABDA 1D9IA 1W0YH 1HAPH 1OWEA 4HTCH 5C3NA 2Z94A 3SO3A 2FOFA 1HCGA 1AUJA 4BANB 1QB6A 2WYGA 3AK5A 1L2EA 1O3CA 1S0QA 4NFEA 4ABIA 2A0QB 2QF5A 1DXPA 1C5NH 4A1VA 1AZ8A 3ZVEA 5J4SA 3GOVB 2FTMA 2Q6FA 3CENA 2FOCA 4X1NU 3LH1A 3K2UA 2QF3A 1BT7A 1ELGA 1TNJA 1L1NA 1Z71A 5FAHA 1C5PA 4TWWA 3GCNA 2CF8H 1T8OA 2BDAA 3KQ5A 1B7XB 5DGJA 2FOHA 1B0EA 3UUZA 1GJ9B 4CR5A 5H4IB 2F9PA 5EW2H 2BHGA 1H9LB 1TMTH 5FBIA 3F9FA 4Y7BA 4H6TA 5CHBA 1DY8A 2PHBA 2ZDNA 2XWBI 5LH8A 4NIXA 1DWBH 2ZGHA 3TK5A 3GICB 1GJ7B 2EQNA 1INCA 3SU4A 1LQDB 3RMNH 1N8OC 2A7CA 2GTBA 3QUMP 5K7RA 1COWD 1K1NA 3PM3A 1LDTT 1RIWC 5EG4A 5LGOA 1C1MA 1TGBA 4CH8B 3ATLA 1TGNA 3QLPH 3BEIB 1EX3A 2O8TA 1O33A 2HPPH 4FUEA 1DFPA 1HDTH 1O2IA 3ZZAA 4M9FA 5HKKD 3T27A 1ELEE 1W7GH 2G51A 2XC0A 5EXNA 3VXFH 3EE7A 3VXEH 1JIMA 3DHKH 1W3CA 4Y0ZE 1BMAA 4BXWA 5BPEA 1V2WT 2VIOA 4CBOA 1LPGB 4JMYA 1GBAA 1CO7E 2PTCE 4CRCA 3BEFB 2RFKC 5B6OA 1S82A 1UTOA 2EI6A 1MCVA 2O8UA 2BVRH 2IJOB 1VGCC 1JRSA 1LPKB 2CHAB 3MO9A 1RTLA 3OSYA 1HAIH 1BTUA 2Y5HA 3FKSD 2AMQA 1A3BH 5AVDA 4AFUA 8ESTE 1O5DH 1ESTA 1C2HA 1T8NA 3V3MA 4CHAB 6LPRA 3PTNA 1ZJDA 2J38A 1P9UA 4A1TA 3FZZA 4AFSA 2FTLE 2QXHA 1MABB 2G4UA 2FESH 1P2JA 1G3BA 3ATKA 3Q3KA 4Y7AA 1DSUA 3RU4D 1TB6H 3RXVA 1E0FD 1HXFH 1AUTC 4MPXA 5CHAB 1TYNA 3TPIZ 4YOIA 1DITH 2UUYA 4H6SB 5LPEA 1ESAA 5G4BA 5GCHF 3F0OA 3MU5A 3SBKA 4HI3A 5IYTA 1J14A 2YMSD 4Y71A 2QV1A 4ABGA 7LPRA 1J16A 3CNRA 4IC5A 4XD7D 3KN2A 3P92A 5AF9H 1UHBA 2FMJA 5F03A 1O3DA 2ZA5A 2OQ5A 1XUHA 1LO6A 4ZXYH 1TQ0B 3LC5A 3ZV8A 3WWBA 1BRCE 4CRFA 3VG8A 1FIWA 1QRXA 2PTNA 3VGCC 1V2TT 3SJKA 2NU4E 1EAWA 1BJVA 2ZDAH 2BYAX 2EEKA 1S0RA 1N6XA 1PQAA 4WVPE 1SQRA 1TNGA 1C5ZB 3RMLH 1XUGA 1GI2A 1GHZA 1BTWA 2JIZD 2Y82A 1HAHH 2SNVA 2GMTB 1GHBG 1SPJA 4INHA 1P2MA 2GDEH 1KXCA 3ODFA 3M5LA 1ZSLA 3LGVA 4B76A 4KGAA 2AMPA 2BXUH 5AFYH 2CXVA 1E35B 1UVUH 5DK1A 5FX5A 1ELFA 5E0HA 1EZQA 1OWJA 3M37A 1O2VA 1K28D 1V2NT 1VZQH 1XM1A 1PQ7A 5DP3A 1U6QA 4ASUD 3SU0A 2VIWA 1ZGVA 3PMJA 3F0PA 3URCA 1DPOA 1YLNA 2JH6D 1C9PA 5EPYA 4B2AA 2D8WA 1MZAA 2R0LA 4YXWD 3A83A 3UNQA 1OX1A 1MKWK 1SR5C 2O8WA 3GCHB 3EAJA 3OX7U 3JZ2B 1EPTB 4ISLA 3RXUA 2KCPA 1SB1H 4FOUC 1L1GA 1RXPA 4ZUHA 2ZTYA 2XRCA 1ZTJA 1O2NA 2B0FA 3KQEA 2ASUB 4IMZA 1PPHE 1QQ4A 2ZG0H 4M7GA 3FO8D 1C2EA 1Y3VA 1O3FA 1YPMH 4NG9H 2C8YB 2ZFPH 2GCTC 3RC4A 2L6OA 3ITIA 5KECA 1FAKH 4E06H 5BRRE 4TSFD 1K1IA 4PROA 1GMHG 1K1PA 2YMSC 1GHVH 5T1VA 1TX7A 1QL9A 3U9AH 1TX6A 3C27B 4ZKOU 1XUKA 1LVYA 1SSXA 2DE8A 4X8SH 1CBWB 1KTTB 2ODYB 1YPEH 2AH4X 2J4IA 2Y6TA 2VWLA 4JZEH 3PV5A 2A7HA 4A1XA 2V7QD 2VWMA 2WV9A 3R3GB 1ANEA 1C5VA 3HK3B 1O3GA 3QN7A 4WMDA 3VB5A 3LJOA 3EDXB 4AG2A 2BDBA 5KGOA 2GD4B 1MQ6A 3W94A 1FY4A 4MNVA 3M5NA 2W3IA 4MTBA 5FPYA 4K60A 1ZRBA 3QX5H 3N7EA 1WV7H 1FAXA 1ACBE 1ZPZA 2FIRH 2EI8A 1T4UH 2P8OC 5HM2A 2FI4E 3GY6A 2ZDKA 4TT3D 1FN8A 2PGQB 3F9HA 3GYLB 2PV9B 3RXIA 2PUQH 3PWBA 2ZU4A 1MUEB 2KCYA 2AHME 9LPRA 4U30A 2LPRA 3DUXH 3ZZ4A 5GIBA 5JYIA 1T8MA 3LPRA 3U69H 4MG3A 2BVSH 2ZQ1A 4FUGA 3T25A 3TH2H 4D7GA 2XCFA 3M7QA 5C20A 3A7ZA 5JB9S 4K2YA 2ALPA 1SQTA 4GCHG 1MTNB 2J97A 1V2PT 4RKJB 1YPHC 2Y81A 1O3EA 5JBTA 1GL1A 1MCTA 3HPTB 1CT2E 2KR7A 1SGRE 1K1OA 2RG3A 5TCAA 4AG1A 1SGEE 1O2RA 1NRSH 4TWYA 2BDHA 1O5EH 2BQ6B 1UTLM 2Z9KA 3DT0H 1TWXB 1IQGA 1BHXF 1EZSC 1BMMH 1GVZA 3CS0A 4U01A 1FIZA 3LH3A 2O8LA 1W14U 1XX9A 1T7CA 1AN1E 1L4DA 1DT2A 4F55A 4FVBA 2NU0E 3BTHE 3JZ1B 3S69A 1K0HA 5JPMH 2FYQA 1A5IA 5C0TA 3VB4A 2A5AA 2ODQA 1GHAG 4BAKB 1LMWB 4MQAA 1TONA 1KMHB 2HVYB 1W2KH 2H1UA 2K8IA 1GBHA 3M3VA 2R9PA 3RU4T 1QL8A 2OTVA 1F0RA 1QJ6B 1P57B 3SNCA 3O8DA 1GI5A 5C94A 3OY6U 1OKXA 1TBQH 1UK3A 2VVVA 1LTOA 2JETC 1J17T 3L3TA 4ZKSU 3OEHD 3BEUA 1O5AB 1ZSJA 2OD3B 3RXQA 3TVJB 1K1JA 1IOEA 4CRGA 4XBBA 4INKA 1YBWA 3GY2A 4UFFH 3SU6A 2HLDD 3RXLA 1G9IE 3KYFA 1FMGA 2ZHWH 2XCNA 3SGQE 3SGBE 3PROA 5E8EH 3RXGA 1FQ3A 4WH8A 1GHXH 1H9IE 1BUIA 1KXBA 1GBKA 1O3LA 5L30H 3G01A 3SHCH 3NWUA 3GY7A 1MKXH 4YLUA 1CGHA 1RIWB 2L74A 4BTTB 1Z8RA 1O31A 2WPDD 3SZEA 2EY4C 5A2MH 3LU9B 4I86A 4Q2KA 1THRH 4LZ1H 1A0HB 1MMJN 2FO9A 5DKMA 3KQCA 1OPHB 1BTXA 2VWNA 4BOHA 2FS8A 1ANDA 1UVPA 1RD3B 1P3EA 4JCNA 4OS5A 3MU0A 1ZTLA 2G52A 3BIUH 3FANA 1C5MD 3M5OA 1BIOA 1D4PB 3UFAA 2HALA 2ZF0H 1SI5H 2XW9A 1FLEE 1SFIA 4XBCA 1C1SA 3HKIB 4ABHA 3GS9A 1HYLA 1D6RA 1W0KD 1VGCB 3RUOA 1OP8A 2A1DB 3RDZA 1YKTA 2B7DH 4P00A 3RXBA 1G30B 3TJNA 3IWMA 1V2LT 1GBDA 3HATH 2WZQA 1DXWA 1XXFA 2VU8E 1Z8IB 1AI8H 2XTTB 4XRNA 2SFAA 1BMNH 1Z1IA 3E0NB 2QY0B 1JWTA 2AIQA 3QWCH 3LKWA 2W6ID 2C8ZB 5C17A 2SGDE 3TGIE 1AIXH 3TNSA 3AW0A 2XNIA 1VITF 3RXFA 2XYAA 4B75A 1C2IA 1GGDB 3RC6A 1GJBB 3EA9A 4X6NA 1NBME 4UFEH 1JOUB 2BDYA 5B6LA 4K5ZA 1S83A 1G36A 3LT3A 3RXJA 2ZI2H 2ZHDA 2WPMS 3PV4A 1GG6C 2Z3DA 4YESB 4X1PU 2BY6X 2PWXA 4WF8A 3N99A 3E1XB 1VKYA 3A8CA 2GZ9A 3VGCB 2YNAA
chains in the Genus database with same CATH topology
1UO6A 1ZHMA 4NIVA 1XKAC 1F5LA 5EW1H 2ZP0H 8LPRA 3GCTF 1P2IA 2G00A 1YP9A 4O3UA 4UE7H 3Q77A 2ZNKH 1Y59T 3MFJA 2P94A 1GMDG 1LHFH 2NWNA 2G55A 1FJSA 4KTCA 4ZCNA 1Z6JH 1ANBA 2M2AA 4DT7B 4JZ1A 1IQEA 1O3KA 2Y80A 3L33A 4BNRA 2O8MA 3MMGA 4R0IA 3LDXH 1T4VH 4KKDA 3M5MA 2ZDLA 1SLXB 3ZVGA 1ZGIA 3NKKA 3RC5A 1IQHA 3S7KB 4JZFH 2QE7D 1ZTKA 5EQRA 1WQSA 1ZR0A 5GPIB 1ARBA 3P95A 2GCHF 1QY6A 1MBQA 3ELAH 4JZDH 3SV7A 2VVUA 2Y7ZA 3I77A 4IGDA 4GVUA 3DD2H 3RLWH 1H8DH 2QF4A 3M35A 5LPRA 4Z0KA 2ZWLH 3MO3A 2ZGXH 3BG8A 5FPTA 4MPWA 1YF4A 5A0CA 1K2I1 2V6NA 3TK6A 1O3AA 4K8BA 4QT8C 1Y5BT 2Q6GA 6CHAC 5HGGA 5JBAS 1O2QA 1NO9H 1G3EA 2OQUA 1QURH 4FUDA 2ZECA 1QQUA 1H4WA 5C1YA 1AO5A 2FOBA 5PTPA 2GCTB 1DICA 4WXVA 1HAOH 3P8OA 1O35A 2TGTA 3PRBA 5AFZH 1G3CA 3ZZCA 1O2XA 1W0JD 4CRAA 2YMSB 1PQ5A 4I8KA 3BTTE 4X6OA 5DO4H 2OK5A 2PUXB 3GISB 1K21H 1UTJA 3A7YA 1EAUA 1YPLH 5DP7A 1OYTH 4U32A 1EB1H 2GVFA 1ZYOA 3O8RA 1P02A 4ZROA 1V2RT 3ZVFA 4HFPB 5JB8S 1XVMA 5ETXA 2OC0A 2WPLS 5FXLA 1CA0C 1FY5A 2BLQA 4FUHA 2UUFB 1ABJH 1GVLA 2F9OA 3BTEE 1BMFD 2J94A 1GBCA 1KYNA 2GKVE 2ZGCA 2BD4A 1EPTA 4ZAEA 3MTYA 1MD7A 2ZGBH 3CS7A 1UCYH 1FONA 1C2JA 6GCHF 2VIPA 2B5TB 2P8OB 4DW2U 1A0LA 1UCYE 1XUFA 4FETA 4WJG2 1YGCH 2ZO3H 2F9NA 3V0XA 3VB3A 1O3BA 2AS9A 2J9NA 4X8VH 5A0BA 5DSFA 2DE9A 4A7IB 2ALVA 2RA3A 2BOHB 2Y5FA 1MBMA 1CA8B 1NRPH 1O2MA 2CGAA 2Y5GA 2HNTF 4HZHA 1QHRB 4DG4A 1Y8TA 2VIVA 2ZPQA 1DLKB 3PLBA 4JK5A 2HNTC 2ZFQH 2ZPRA 5DP9A 3SJ8A 3RM2H 7ESTE 1G2MA 4OS6A 3AAVA 1EJAA 1TA6A 2BQWB 1KXFA 1Q31A 2VVCA 4AORA 4DJZB 1K9OE 2VNTA 3MYWA 1MKWH 2HGTH 1O2GH 2SGQE 1EAXA 1BHXB 2WHXA 4RKOB 2RCEA 2FOGA 3M61U 4GAWA 1SC8U 1GDNA 4Q4LA 5C0UA 1QR3E 1Y5UT 5F8TA 2AGIX 5F8XA 2ZU2A 3T2NA 1B5GH 1GI0A 4DIHH 1QFKH 2C8WB 3RXHA 2OUAA 1V2QT 1V2ST 1C2LA 2RA0A 1OXGA 1QJ7B 1TBZH 1UJ1A 1QA0A 1JMOH 2PW8H 3ZZ5A 1THPB 1CU1A 1VR1H 2HRVA 3P6ZB 2Z3CA 3RXCA 2LELA 1BCUH 3SZNA 2AFQB 4YT7H 3MU8A 5EXMA 5DN6D 1O3JA 3A8DA 1AD8H 1J15A 1CQQA 1A7SA 2A31A 5E2OA 4BAOB 1HAVA 4ABAA 1HFDA 3QZRA 1EZXC 3TU7H 5IDKA 1FY3A 2VJ1A 1L4ZA 4B6EA 4U2WA 1AKSB 3QDZB 1SLUB 3FOAA 1MTVA 1NESE 2UWOA 3U8RH 1JBUH 1HIAB 4FU9A 2PSYA 2P59A 4ABJA 5GXPA 2R3YA 5TCCA 3ZVBA 3OY5U 1VJ9U 2LNCA 5JBCS 2XNDD 3LGUA 1DSTA 1MU8B 1NTPA 4AFQA 1AFQC 1GCTC 3GCOA 3MU1A 1HAYB 5GCHG 7GCHF 1DDJA 5GNDA 3OE7D 1FY8E 2JH0D 1MZDA 2H5CA 1F0UA 3MH4A 4CBNA 1SGDE 5SGAE 1ZRKA 4OGXA 2UWPA 2ANWA 1UCYK 2P3FH 5L2ZH 2XC5A 4IC6A 3FP7E 2QAAA 1GDQA 4Y8ZA 1QCPA 4A92A 2ZU1A 4I8HA 1WUNH 1O2UA 4DOQA 3B23B 1GHBF 4ZHMU 4OS1A 2ZIQH 3UR6A 1OWIA 4FVDA 1C2MA 1CGIE 3RXRA 3A84A 3RP2A 1BDAA 1AWHB 1HB0B 1C5QA 4ISNA 2ZCKP 3A8AA 3LGTA 4ZH8A 3Q3XA 1PJPA 5JBBS 2ZGJA 1O5GH 1GMCF 1P03A 3SV8A 1AVGH 3IG6B 1JRTA 2WSSD 1FPHH 5FCRA 3ZZ8A 4ABFA 3SN8A 3M3SA 4ABEA 1G32B 1LVBA 1TX8A 4YTAA 3ZV9A 3RLYH 1SGFG 4UEHH 4ABBA 1SHYA 3I29A 1OWKA 3A88A 1V2MT 1W13U 1C1RA 1E1QD 4IN2A 2A5KA 1RRKA 1DM4B 2ZC9H 1O0DH 2WPJS 3F9EA 3A86A 1SQOA 4O3TA 3ODDA 2WUBA 1BRBE 2TPIZ 1O2LA 4B74A 1O3HA 1GG6B 2ZHFH 2BY5X 1F0TA 2TGAA 3MO6A 4VGCC 2QYIA 1GJ6A 3OYPA 4Y6DA 1TNHA 1O3PB 1S81A 3UQOA 1BRAA 5FX6A 1O34A 1A0JA 5EXLA 3GY8A 1SQAA 3OEED 4KP0A 2GV7A 3PO1B 5A8YA 1ARCA 2EA3A 1T8LA 2C8XB 4Z6AH 4YOGA 2C90B 1G3DA 2WV5A 3SYJA 5CDFE 5FBEA 4AB9A 4BAHB 1HJAC 1OWDA 4JYTA 2ANMH 3RXKA 5CE1A 3UOPA 1AE8H 3TH4H 4CRDA 2BVXH 1YLCA 1DLEA 4X8UH 1BQYA 1AY6H 4BTUB 4DT4A 2QC2A 4Q7YA 1NPMA 3QTVH 1Q3XA 2FOAA 3SU5A 2XC4A 4YOJA 1YLDA 3D49H 1C4U2 1NFUA 3MNCA 1BB0B 3CP7A 3AAUA 1K1LA 4MPUA 3M3TA 1ETRH 1YCPH 1E34B 1THSH 2J34A 2HVXA 2ULLA 1IHTH 1SGYE 1HAVB 1GJCB 1ZOMA 3B8JA 2GZ8A 3P8FA 5C2ZA 2ANKH 2H2ZA 1KDQA 3IITA 2I6SA 4ZHLU 1N6YA 3OFND 6CHAB 1D3DB 1LVOA 2ZDVH 5EGMA 4NA8A 1FI8A 4D8NA 1YCPM 1TFXA 3LGIA 2BY9X 1MTUA 2YNBA 2BX3A 4I32A 2CJIA 3MNXA 5EOKA 1TIOA 1Y3UA 2QGRA 3SUDA 1OYQA 1P04A 2J5UA 1PYTD 1SHHB 3SNBA 1IQFA 3W95A 3SJOA 2FYRA 1EJNA 4XSKU 4I8LA 2HOBA 4ZHAA 1W0ZU 1FUJA 4DY7B 1O2SA 3BTFE 3QTOH 4KTSA 2H9EH 1C2GA 1AVXA 9ESTA 2VBCA 1P11E 4AYVB 1IQJA 1O5FH 3SUEA 1C1VH 2SGAA 2C4FH 1C4Y2 4BTIB 3P8GA 1HLTH 3A80A 3WW7A 4NGAH 3GDUA 1E37B 1SGFA 4I33A 8GCHF 1QL7A 1A5HA 3FP8E 2ZTZA 3LC3A 1GBLA 4GUXA 2H9TH 1GBJA 3A7WA 1L0ZA 2F9BH 4NFFA 1CA0B 2ZZUH 1C1PA 2BLVA 1AFEH 3RXTA 2G8TA 2Z3EA 2A32A 1TE0A 4CHAC 2EC9H 2A4GA 1TRNA 1IAUA 1C4V2 3PYHA 2AMDA 1EB2A 4XE4A 3C1KA 1W7XH 4X1SU 2KAIB 3D23A 1ZZZA 1TMBH 2FM2A 2BZ6H 3QZQA 4O9VA 3QK1A 2BQ7B 4NCYA 1MQ5A 2FX4A 2J2UA 1EXFA 1N8OB 1GJ4H 1C5RA 1SGNE 2SNWA 1ID5H 2XBXA 1HJ8A 2FEQH 1C5YB 2J92A 3QO6A 1NROH 4K1TA 3GY5A 4I8JA 5HYOA 1ZLRA 1UVTH 2BD8A 3NUMA 5T6FA 3T28A 1DOJA 2XOKD 1LQEA 1TGTA 3DA9B 4B2BA 2F3CE 1V2VT 4ISHH 3UR9A 3HGPA 1P9SA 1NC6A 4H4FA 3SQEE 1A5GH 1NT1A 2A4RA 2HWLB 1WBGB 4GPGA 1YCPK 1TPOA 1SBWA 1P09A 4FU8A 2BXTH 4LOYH 3EA7A 1ZHPA 2AGEX 4CREA 2Z9GA 1RS0A 5T6GA 4X2VA 1C5UA 1TA2A 3BN9A 2G5VA 3PLKA 5DP6A 2P93A 4F49A 4X1QU 3MHWU 4IN1A 5J4QA 1O5BB 1AU8A 1PYTC 1RTKA 1UMAH 3H7TA 2GT7A 3KEEA 1IQLA 1VCWA 4E7RG 1LHDH 2B8OH 1O2HA 2Z9LA 3VB7A 1O5CB 1SGCA 2PGBB 3M36A 2BD7A 2W26A 1NBMD 1GI3A 4K3JA 4MNYA 2GMTC 4ZKNU 4OS7A 3QGNB 3K6ZA 3E90B 4I31A 3LJJA 3ESTA 1XKBC 3F2HA 1P0SH 1A3EH 1E1RD 1JXPA 2OP9A 2IOTA 2ZEBA 1YPJH 1UTQA 4K1SA 1O37A 1RFNA 2JKHA 1WAYB 4RSPA 2K0QA 1UVSH 5A0AE 4I8GA 2IJD1 2ZHEH 1O2JA 1GI9B 1QA7A 1YPKH 2OBQA 2ILNA 3A81A 1C5SA 3L6PA 1ANCA 3A89A 1GI1A 2QA9E 1LPZB 1F2SE 1TRYA 4B71A 1LCYA 2ESTE 3SV6A 1C5XB 5GDSH 1C5WB 1KTSB 2A5IA 1VITG 3MH6A 4JYUH 1Q2WA 1SVPA 3S9CA 1K1MA 1KDQB 5DJ7A 1AFQB 1GCTB 2ZU3A 1X7AC 2F43B 2F83A 3I78A 4BAMB 1MAXA 2Y7XA 2F9VA 4A5TS 4RI0A 3H5CB 4X0WU 3W1EA 1P8VC 1QBVH 3KQDA 2BB4A 1SGQE 2AGGX 3TK9A 3F68H 2F9UA 1HXEH 5EODA 3TJVA 1OOKB 1BOQA 2Q1JA 4IBLH 3LOXA 3A87A 1Y3WA 3U1JB 1C2FA 1OP0A 2UUKB 3PLPA 4FU7A 3BF6H 3ZIAD 4OGYA 4X2WA 3FZDA 1GBMA 3GCTG 3PTBA 2EI7A 2BY8X 5A09A 2A2QH 2W7SA 3DFLA 1S6LA 1VCPA 2BY7X 1EUFA 4D9QA 2BD9A 1EATA 3SNAA 4FUIA 2WYJA 4BXSA 1AKSA 3NXPA 1KLJH 1MAYA 1JIRA 2H5DA 2R0KA 1HPGA 1W10U 1AHTH 2BMGB 1CHOF 5FPSA 3SV9A 1TALA 2FXRA 3T26A 2B9LA 1HIAA 3P8NA 4E05H 3ATWA 1QRWA 4ESTE 2D2DA 1K22H 2PKAB 2GCHG 4KELA 1FZZA 2FLRH 3SJIA 1YC0A 4CR9A 2BX4A 5EPNA 3ZYEA 3RXOA 3OTPA 2FS9A 2DUCA 2ZFSA 1YM0A 1KXDA 3GDVA 3E16B 2FOEA 1O2WA 1A4WH 4NWKA 4Q80A 3UOUA 1YYY1 5C1UA 1B0FA 3UWJH 3O8CA 4YLQH 1H8IH 2OLGA 1WU1A 2WPHS 1GI8B 1SLVB 1P12E 1GDUA 2Q6DA 1FX0B 2QIQA 1DUEA 3ZZDA 2P3UB 3NPSA 1O2ZA 3Q76A 3N7DA 4UFDH 4VGCB 4Y10E 4NWLA 5DP8A 2WPIS 1TGCA 1EOLA 4Z1MD 3RXEA 1O2PA 4FUJA 2TIOA 3PWCA 1HAXB 1MU6B 1SMFE 2ZCHP 1QTFA 4K69A 1O2TA 4Y79A 2OXSA 4UONA 3SV2H 4AB8A 3ZZBA 4FUFA 1O2OA 2PKSC 3GDSA 4X8TH 1HJAB 1ZPBA 2FODA 1NY22 2BZAA 5DG6A 2R2MB 3SGAE 3SNEA 1RTFB 1BZXE 3EGKH 1P05A 3HK6B 3TITA 5E0GA 4X2XA 1TOCB 4XOJA 4TPIZ 3RXMA 5CMXH 1F7ZA 1ETSH 1ORFA 3MH7A 1V2KT 1NFWA 1H8ED 3Q00A 1GJAB 2IN2A 1DANH 4A6LA 4OS4A 3K9XB 1ZSKA 4AYYB 4MNWA 1GBBA 2FI5E 1V3XA 3EYDA 1WXRA 1NRRH 1S6HA 3HKJB 2JJ1D 4LXBH 3SUFA 1TAWA 6GCHG 3LONA 4B2CA 4UDWH 1TLDA 3MI4A 4SGBE 2K1QA 3S0NA 1O2KA 4O97A 2QN5T 3VPKA 5HM9A 1TBRH 4NZQA 2Z9IA 1E79D 5E0JA 3UQVA 1Z6EA 1P2QA 1IQKA 3MWIU 4NZLA 1AZZA 1G2LA 1CT4E 1A61H 4Y8YA 5HXFA 1PPGE 1DS2E 1SGTA 5AHGH 1TQ7B 3PMAB 2FPZA 5IK2D 4XDEA 5F6MA 3FP6E 3RM0H 3K65B 2QXGA 4K8YA 3RXAA 2BTCE 3F6UH 1A2CH 1C1TA 1LHGH 1PPCE 1Z8GA 1M9UA 4CRBA 2A7JA 1C1UH 2VB0A 2GX4A 1EKBB 2UWLA 2M5TA 2V3OH 3T62A 2PLXA 2AERH 3OAAD 3EA8A 1NU7B 4LZ4B 3ZYDA 1V2UT 4D7FA 1BBRH 3NZIA 4AFZA 3UWIA 1ZMNA 2JETB 2AYWA 1BBRE 3EE0B 1L1JA 1WYKA 3BTWE 1OSSA 2FX6A 1SGIB 1TOMH 1VCQA 4Y11E 3SHAH 5TJXA 3SW2B 1ELTA 2OINA 5ESBA 1HUTH 1UTNA 1ETTH 1EOJA 3NK8A 4K1EA 1QNJA 3S7HB 1TPSA 2XWAA 3BTGE 3DFJA 4X2YA 1IQIA 1UK4A 3H7OA 1QBOA 3VB6A 3UNSA 3TIUA 4JK6A 5GWZA 1VJAU 2OC1A 3F2GA 1HRTH 1IQMA 4MPVA 1GGDC 1UTKA 1P06A 1QIXB 2Z6BD 2VGCC 4YZUA 1NN6A 1E36B 4NSVA 1AQ7A 1XMNB 1AWFH 2OC7A 3SNDA 1AB9C 4GSOA 4TYDA