4I31A

Crystal structure of hcv ns3/ns4a protease complexed with compound 4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Genome polyprotein
publication title Molecular Mechanism by Which a Potent Hepatitis C Virus NS3-NS4A Protease Inhibitor Overcomes Emergence of Resistance.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i31A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4i31A01
4AG1A 2Q6DA 3BTEE 1C1SA 1FI8A 3FP8E 3VXFH 5C3NA 3RC4A 3BTTE 3UNSA 2W3IA 4TY6A 1BTHH 1LO6A 1W7XH 3DFLA 2DE9A 2GCTC 5JB9S 2J38A 4NZLA 1SI5H 5TJXA 2SNVA 3V13A 3AK5A 1G3BA 4FXGH 1YPHC 3QDZB 3RMLH 3ODFA 3TJVA 1LVYA 4CH8B 1V2LT 1CT0E 1C5UA 1N1LA 1XUIA 1ZLRA 2HVXA 1CU1A 5GIBA 3SNCA 3HK6B 4A7IB 1DSUA 2B7DH 4NA9H 4B1TA 1LHCH 1SHHB 1UJ1A 1S6HA 1EUFA 2BD4A 2GT8A 2HNTF 3KEEA 1O3OA 3H5CB 3M5OA 2FI3E 3P8OA 3VB4A 2ZDAH 2HPPH 4M9FA 4Y76A 2A5KA 4HZHA 1UCYH 5EGMA 1DLEA 1MU8B 1LHDH 2ZPQA 2OK5A 2J9NA 3T25A 3HK3B 3S9BA 4Q80A 2FPZA 4LZ4B 2BZ6H 2VIVA 2QGRA 4FUBA 5EODA 2ZDVH 1TA6A 4RN6A 4KELA 3C1KA 1BRCE 2G5NA 5EPYA 3TJUA 1J16A 1KTTB 4MDSA 5B6LA 1A0LA 3F68H 3M7TA 1K22H 4YZUA 5GCHG 1LMWB 2ZHEH 1PJPA 3A81A 1WOFA 4K2YA 1O2LA 2Z9KA 1P06A 3MI4A 1WTGH 4YESB 3SJ8A 2AMQA 3LH1A 1LQEA 4NA7A 3GY6A 1LHFH 3GDUA 1JRSA 1G32B 1KYNA 4OGXA 1VJ9U 5T1VA 2SGFE 4JZEH 2FZZA 2Z3CA 2QY0B 2A0QB 2A4GA 2FMJA 2PV9B 1DUAA 2YNAA 3Q3KA 1W0ZU 1HRTH 1GVKB 4X1QU 3P8GA 3P92A 1GI0A 3MH6A 1IQEA 2ZTYA 2EA3A 4AB8A 3N7OA 1O5DH 2BQWB 4Y8ZA 3M35A 5T6GA 1OP0A 4I31A 5E2PA 4HGCA 2JETC 4DOQA 8KME2 1H4WA 1C1QA 1O2IA 3QTOH 4Q7XA 1KLIH 1AMHA 3UUZA 1O3EA 4MPVA 2XWAA 1L1JA 3ZZ3A 1AU8A 1TWXB 3LJJA 1ACBE 4ZHMU 4TYDA 1CHOF 3M3VA 3F9GA 1QBVH 1SOZA 1YPJH 2ESTE 2ALPA 2ZQ1A 3KQCA 1HGTH 1EOLA 1P2NA 3P70B 3K2UA 1K1MA 2V3HH 4NIWA 1GJBB 2FM2A 1P9UA 2O8TA 5FAHA 1MKXK 2R9PA 4TY7A 4INHA 1O37A 1OP8A 1OPHB 4PROA 1GJ4H 1GGDB 2QXJA 3SGBE 1SGNE 1S82A 4X8TH 4KP0A 1NFWA 4ZMAH 3MWIU 4K5ZA 1EPTC 1TOCB 1YGCH 3ATKA 1C5LH 1JOUB 5GPIB 1S6FA 2XCFA 2C4FH 3PO1B 3T27A 4I33A 1K1LA 1HNEE 3I77A 2F9BH 3Q76A 3ZZAA 2BMGB 1EAIA 3T26A 3LH3A 2G8TA 4O3UA 4GCHF 1C5PA 2B8OH 4I8GA 3O8BA 2Q1JA 4B2BA 2WPLS 3LGTA 1T8NA 1JXPA 2TGPZ 1LPKB 1UHBA 3B8JA 3CS7A 4BNRA 1QGFA 5DJ7A 2P95A 1Z6EA 2BTCE 3E91A 2H9EH 1YKTA 1O38A 5G4BA 2ZCKP 1ZPBA 1C2MA 1D3TB 3RC6A 3RXAA 1O3HA 2BXUH 2Z9LA 1WTHD 2G00A 1G37A 4FUIA 5FHTA 3IWMA 1BTPA 3QZRA 1EB2A 4KGAA 1KXBA 2ZU3A 5DP9A 2SGDE 1EB1H 4B6EA 1C1WH 1PQAA 1BOQA 3A8CA 1TLDA 1O5FH 4WMDA 1B0EA 1GJ5H 1FN8A 2TGAA 2PUQH 3LC5A 1F5RA 3R0FA 2CV3A 3U8TH 1HIAA 4MVNA 4JYUH 3DUXH 3LGWA 4B2CA 4CHAB 1GHBF 1AQ7A 2HRVA 1HLTH 4YO9A 5JPMH 4ZHAA 1XUJA 1A61H 1FQ3A 1W14U 3BG4B 2OQUA 1V2ST 2VINA 4XBBA 4IMZA 2IJD1 3P6ZB 1QCPA 3SHAH 1T8LA 1V2OT 1TX7A 1GBDA 2HNTE 1ZMJA 2XBVA 2NU4E 1BMNH 1GCTB 1QL7A 4LK4A 4WY3A 2FODA 1AFQB 4X6PA 2Z6BD 1TGNA 1FAKH 2ZKSA 2PTCE 3V7TA 3K9XB 5IDKA 2B0FA 2HOBA 4YLUA 1O3LA 1O2ZA 1SMFE 1DY8A 5JBTA 1PPCE 3ATLA 4MNVA 3FP6E 3ZV9A 1T4VH 5GXPA 1T32A 3GISB 4IC6A 2JKHA 1D4PB 5LH8A 1XVOA 1VGCB 1YBWA 2Y80A 4D9QA 4R0IA 4UE7H 5ETXA 4CRBA 1DY9A 1QB6A 1AVXA 1G36A 8GCHG 3GCNA 3RXMA 2AMDA 1THSH 5JBAS 4Y11E 2SGAA 3SUGA 3LKWA 3AW0A 3UOPA 3OYPA 1FY3A 3EA9A 1O3KA 1TMBH 4JYTA 2FOGA 3SU5A 1MKXH 1S83A 2CMYA 4Z6AH 1C5RA 2NU0E 3F9FA 3TK6A 2VH6A 1ZSJA 1AWFH 1TPSA 3P17H 1DXWA 1MMJN 1C5ZB 1C5WB 3F6UH 3KN2A 1SLUB 2XXLA 2BY6X 3EYDA 3RMOH 4X2YA 4JCNA 3PV2A 3OSYA 3QGJA 1O5EH 1GJ6A 2UWPA 2XC0A 3MOCA 1QR3E 1MCTA 2ZNKH 3LDXH 1UTOA 1GHWH 1TRYA 1A5HA 1P2JA 3SHCH 3BN9A 3QN7A 5CMXH 1TYNA 3RXKA 1G3CA 2J2UA 3TGIE 3GCHB 5I46H 1ZHRA 2VIPA 1OS8A 3MNBA 4BAQB 2BLQA 1DICA 1HAPH 3MO6A 3D65E 1HAXB 1W12U 1IQKA 2BLWA 2GDDA 1LTOA 2C8WB 1YF4A 1O39A 5HYOA 4H6SB 4OS7A 4AFZA 2QN5T 1O3CA 4ABFA 1Z8GA 4YLQH 4JMYA 3MH4A 1NU9A 1J15A 7ESTE 1ZTJA 2G81E 3AAUA 4K1SA 2WV9A 3D62A 2QXIA 1O2YA 3HGPA 2QF3A 4NWLA 4BAOB 3PO1C 4MTBA 1FUJA 4FVBA 2Y82A 2VWLA 4DGJA 5C5OA 1H9LB 3T28A 2ZG0H 2O8UA 3KCGH 4Y8XA 1GCDA 1ZR0A 5DP8A 1D9IA 2VVCA 1V2VT 2IOTA 2FWWA 1HCGA 1BMLA 2BDYA 1VR1H 1IQLA 1ESTA 1PYTD 1AD8H 1A1RA 1YLDA 1TGCA 4ISLA 3RMNH 2ZFFH 5GJ4B 3WY8A 3TITA 4ZAEA 1SFIA 1CGJE 1C1TA 1V2QT 4I8HA 2BVRH 4GPGA 1C1RA 9ESTA 1C2GA 3GYMA 4A6LA 1NRRH 4U32A 2C8ZB 2PSXA 1P03A 3BEIB 1XUKA 2XCNA 2A7CA 2QYIA 3EGKH 4WH8A 1KDQA 3UQOA 5L6NH 2ZIQH 3GDVA 4WH6A 2VVVA 1P57B 3RDZA 4YTAA 1CT2E 2QF0A 1LKBA 2OC1A 1C4Y2 1D3PB 5A8ZA 1CGHA 4CHAC 1K1OA 1TX6A 3SGAE 1M9UA 2WINI 1LQDB 3BTME 1LVBA 3ZZ9A 3ZZ8A 5EU8A 1UCYK 1IHSH 5F8ZA 3BG4C 2FP7B 5DG6A 4CBNA 2OINA 5ESBA 1NRQH 3ODDA 1NC6A 5DGJA 1MD8A 4IGDA 2Z9GA 1GCTC 1GBLA 3MO9A 1AFQC 1KXAA 4NIXA 2TIOA 1NU7B 4CH2B 5JBCS 3SNBA 3C27B 1D3QB 4MLFB 3HGNA 2NU1E 4LXBH 1ELTA 5HM9A 1IQHA 1PQ8A 3R3GB 1O34A 5DP6A 2QXHA 2ZPSA 4UD9H 3BTGE 5C67A 1O33A 1BTZA 1O2KA 4E05H 4ABDA 1NN6A 3PROA 3A7VA 3TPIZ 1MBQA 2Q6FA 1T8OA 2O9QA 3P8NA 1T7CA 2J4IA 3ATMA 5A0BA 1UVUH 1DPOA 1E0FD 3B23B 1T31A 3PWCA 1MBMA 2BD5A 5DO4H 2BOHB 1QBOA 2TGTA 4JZDH 2BD2A 1SGIB 1S5SA 3QLPH 4NZQA 3QTVH 3Q00A 2A1DB 3MTYA 5J4SA 1WUNH 3MU4A 1TBRH 3LGUA 2FOFA 1G9IE 1GHXH 5E0GA 1NFYA 5E0HA 1MAXA 2GVFA 4I8JA 3UNRA 1BBRK 1C5OH 3HKJB 1D6WA 4TPYA 1GDUA 4GHTA 5A0CA 1SGCA 2ZFQH 2D2DA 1HAVA 3GOVB 1SL3A 3A85A 1BHXF 1SQTA 2A31A 2ZHDA 3RXHA 4KTSA 1ZOMA 1FXYA 1EPTA 1DS2E 1GHVH 1SOTA 1EX3A 4AB9A 3JZ2B 4MNYA 2BDGA 1UTJA 3TNTA 1AVGH 1VZQH 1OWKA 3A86A 1BTWA 1TONA 1O2PA 1ESBA 2HPQH 1C2HA 4WXIA 1UCYE 1RD3B 4ISNA 1YCPM 3SU6A 1BRAA 1KSNA 1VCQA 2BYAX 1UTMA 1RTKA 1AKSA 1FAXA 3SNDA 2A4QA 3RXUA 3BEUA 4JK6A 1XUFA 1WBGB 4AZ2B 4XE4A 5GDSH 2VGCB 1UK4A 2BD9A 1KXDA 5K7RA 4FU7A 4ISIH 4DW2U 1XX9A 2JH6D 1MZAA 1DE7H 3SORA 3GCTF 1BTXA 4CRAA 2BQ6B 1EXFA 1XM1A 5C20A 1GHAF 1Y5BT 1OYQA 2P8OB 3MU0A 1OKXA 4X1NU 3TIUA 2PKAB 1DUEA 1NRNH 1EJNA 3SO3A 2NU2E 2XW9A 6GCHF 1AZ8A 1KXFA 5DPAA 1ID5H 1ETSH 1GBCA 4CRCA 1EATA 2P3UB 2G5VA 4O9VA 3M7QA 3SU2A 1O2GH 1OWJA 2GGVB 1SG8B 2GCHF 3L3TA 3S9AA 5SGAE 1THRH 5AVDA 3URDA 4FUCA 2WHXA 3ZYDA 5CE1A 1C2DA 1CBWC 1PFXC 2F3CE 3U8RH 3VPKA 1W11U 1P11E 3TGJE 2AYWA 2A5IA 1WCZA 1A0JA 3PMAB 1SGQE 2Y7XA 1AB9C 1W2KH 2OD3B 3VGCB 1BBRE 3K6ZA 5F8XA 4ZROA 3SQHE 1CE5A 3RM0H 1UVOA 3ATIA 2ZDMA 2ZI2H 2ANYA 1FDPA 2LPRA 1O35A 1FONA 3PLBA 1C1OA 2ZWLH 3BTHE 4Y7AA 4A1TA 1MAYA 1MCVA 3ATWA 1GBJA 4H6TA 1SPJA 1BIOA 4I32A 4ISHH 5BRRE 2BOKA 2ZCLP 3S7HB 3S0NA 2QA9E 3SYJA 4JYVH 1ETTH 1PQ7A 2O8LA 2TPIZ 1GPZA 5FPYA 3SBKA 1PPZA 3TJOA 4CREA 2XBWA 3RXSA 1OYTH 2SGPE 2ZFSA 2ODYB 3BTWE 1GL0E 1YYY1 2G55A 4NWKA 1Y3VA 5F03A 1SGRE 1BBRH 1OOKB 1TGTA 1YPHE 1LPGB 3A7TA 1FLEE 4DCDA 3QWCH 1K28D 2JH5D 1ZMNA 1ZRBA 2V35A 3KQBA 2BLOA 1ELFA 2ASUB 1Y3YA 1JIMA 3A8DA 4MG3A 3V0XA 4E7NA 1TRMA 5JDUB 2VIOA 4NFFA 1OSSA 2VWMA 1C9PA 3NPSA 1ZGIA 1Z8JB 2A7HA 1KLJH 1PPFE 2FOHA 3RXFA 3S9CA 1HB0B 1LPZB 4THNH 4WMFA 3PTNA 2ANKH 2OC8A 3SU0A 1Y5UT 2YOLA 1O30A 1DWDH 2ZF0H 2GD4B 1V2PT 4K1EA 3T62A 3KNXA 1K9OE 1W10U 2I6SA 1GDNA 1G2MA 4AGJA 2W7SA 1CA0B 3LPRA 5C5NA 1P05A 3UWIA 1NTPA 1TFXA 1VCPA 2CJIA 3OTPA 3STIA 4B6FA 2ZC9H 2SNWA 3SI3H 3UR6A 4UFEH 2BX4A 4D7FA 4Y0YE 4Q7YA 2R0LA 4LZ1H 2VIWA 1C4U2 3CS0A 1GWAA 1JIRA 1GL1A 3EDXB 1GBAA 4NIYA 1GMDG 2CF8H 2BQ7B 1A4WH 1SLXB 1WQVH 1O3BA 2ALVA 1MTUA 1ZJDA 2FLRH 3G01A 1PPBH 1F0RA 1EZSC 4ZUHA 4JZFH 2R3YA 3FAOA 2ZFPH 1P2KA 2ZECA 1MTWA 1MTNB 4DVAU 1MQ6A 2P59A 3SN8A 1XVMA 1UK2A 1V2UT 4ZKOU 5EQQA 2FO9A 1YM0A 2H9TH 1UHBB 3NK8A 2VGCC 5FBEA 2BXTH 1ZPCA 2ZTZA 1HAIH 4AOQA 1HAGE 5DP5A 3RXPA 1A0HB 1XUGA 4F49A 2IPHA 1V2TT 7GCHF 1TOMH 2P8OC 3CP7A 2EI8A 2AGGX 1QJ7B 1K2I1 4MQAA 3DHKH 1HXFH 1ELBA 2ILNA 5FXLA 1AWHB 3RM2H 1UO6A 1C2LA 1GI7B 2ANMH 4R8TB 1CSOE 1C5QA 1HXEH 1TALA 1GI8B 2C8XB 3A82A 3RXIA 5LGOA 1V2WT 1GI2A 3ZZCA 2ZPRA 2P16A 3U9AH 3SUEA 2W5EA 5LPRA 1DANH 2NWNA 1NZQH 2A4RA 1HUTH 1SGTA 1HJ9A 1RJXB 1ABIH 1AI8H 2R2WU 1HPGA 3UQVA 4H4FA 1BJVA 5GNDA 1Q31A 3UY9A 1JBUH 2TGDA 1O31A 9LPRA 3BV9B 3VGCC 1N8OB 1C2EA 2ANWA 1IHTH 2WYJA 2FYQA 1SGFG 3UNQA 3AAVA 1W3CA 2GZ9A 1YPGH 1YPKH 2VIDA 5EQSA 1RGQA 3ELAH 1AUTC 4Y71A 4SGBE 1P3EA 1DWEH 2Y81A 2CXVA 3RLYH 1NFXA 1K1JA 4X1RU 4Y6DA 4ZXXH 5EXNA 2VIQA 1GI3A 3EA8A 4I8LA 4E7RG 3TJNA 1FN6A 2Y5FA 3HATH 4GAWA 2M5TA 4NSYA 5EQRA 3SV6A 2F83A 1W8BH 3GCOA 3OY6U 3BIVH 4VGCB 1O3DA 2A7JA 1W0YH 4Q2KA 4YOJA 1BDAA 4CRDA 2GV6A 1P2IA 1FNIA 4K8YA 1N6YA 3PB1E 4NIVA 1ZZZA 4Z0KA 2H1UA 1GI6A 1RIWB 2IJOB 3IG6B 1O3IA 1V3XA 1E38B 1HV7A 1GI1A 4Y8YA 1ZJKA 4OS1A 3U69H 2WPKS 2F4LA 3EAJA 1QBNA 2FX6A 2GP9B 1O2SA 2DUCA 3S69A 1O5GH 1THPB 1SGYE 1QL8A 1H9HE 5F6MA 1P12E 2WYGA 2B9LA 2FIRH 3TH2H 1IQMA 3SUFA 5LPFA 4BTUB 4A5TS 2A45B 2XBXA 3B9FH 2BD8A 3ENSB 5GCHF 1ORFA 1QL9A 2OC7A 1GGDC 1HBTH 4GVUA 3PTBA 3QUMP 3A80A 4FUFA 4KTCA 3ZVBA 4ZKRU 1OP2A 4ABEA 1AN1E 1ZTLA 2BLVA 2Z3DA 2VBCA 2G51A 4K69A 5CHAB 2FOCA 4INKA 1TBQH 4MPXA 1CA0C 2PGQB 2G52A 1DXPA 2WPHS 1KIGH 3TH3H 4A1XA 1H8IH 2O8WA 2UUFB 2V3OH 2A2QH 5EPNA 4ZXYH 1BCUH 2BM2A 1UTNA 1TA2A 3SV8A 1TX8A 3OTJE 1DDJA 4CR9A 3A83A 1J9CH 2OUAA 2FI5E 2ZFRH 1BTYA 2C8YB 3MNCA 1NT1A 4M7GA 2BZAA 3M7UA 1O3FA 2AMPA 4MPUA 3QGNB 1WU1A 3PMHB 4H42U 2OQ5A 4ESTE 2GMTB 1GI4A 1MTNC 1UVPA 3ESTA 1SQOA 1TABE 4IBLH 5JYIA 1O3JA 1VITH 2J92A 1KTSB 1QHRB 2ZDLA 3FZZA 1ETRH 1O5BB 1RTLA 3DT0H 5AFZH 3UIRA 4BXWA 4U30A 1AGJA 2Y7ZA 4OS2A 3D23A 3PM3A 5I25A 1EAXA 1L4ZA 3GY3A 1Z7KA 1HAOH 4AYVB 3MU5A 1GMCF 5T3HA 3IITA 2H5DA 1EZXC 4WVPE 3A88A 2QV1A 1C9TA 3P95A 2J94A 2OCVB 1CHOG 2EEKA 1PPEE 1GDQA 4LOYH 3OU0A 4NGAH 1QTFA 1L2EA 4B71A 4AG2A 4BANB 1ARCA 3RU4E 1OWDA 1BB0B 1DWCH 1E35B 1XXFA 1A5GH 4GHQA 2WV5A 1AZZA 1UTQA 3ZVGA 3RXRA 1P9SA 1ABJH 3GICB 1QJ6B 4ABGA 4AFQA 2ZU2A 3UR9A 4WMEA 1MH0A 2F9NA 3TNSA 1EZQA 1YPLH 2FOBA 1N8OC 2BVXH 3UTUH 1Z1IA 5DP3A 4XDEA 1CHGA 1P0SH 2ZCHP 3LU9B 1ZRKA 2FOMB 1NO9H 1GG6B 2ZQ2A 3A7XA 4NCYA 2KAIB 2PKSB 3TK9A 2HALA 3ZVEA 1GBMA 2ZP0H 1VGCC 3E16B 3LIWA 4X6NA 1AIXH 3URCA 3SGQE 1DT2A 4X6OA 1H8DH 3U1JB 1GI5A 1EOJA 4GCHG 1F2SE 1P04A 5T6FA 1C1MA 3DA9B 1E37B 1LDTT 5AF9H 5C1UA 4BAHB 5EG4A 1NESE 4Y79A 1DWBH 2BDCA 2ZU5A 3KQEA 4KTUA 2HWLB 3A7YA 5L2YH 1RRKA 1O2TA 2XRCA 1O3PB 3HPTB 1XXDA 1IQGA 1QFKH 1MU6B 1INCA 1MZDA 3FFGA 3MYWA 3SJ9A 1G30B 1DLKB 1UMAH 4XOJA 4YT7H 4OS5A 1SHYA 2FS9A 3BTFE 1F0UA 4FUJA 1GVZA 2PTNA 3E1XB 2BDAA 2CF9H 4XSKU 7LPRA 2AFQB 3CENA 2PLXA 4MPWA 2VWNA 1DOJA 2ZGJA 5TCCA 1XMNB 2UWLA 1G3DA 2LNCA 1F92A 3ZVFA 4I8KA 2EC9H 3F9HA 1O3AA 1DFPA 1KY9A 2J95A 2WPMS 3QK1A 1GHBG 5BPEA 5EW2H 4MNXA 1ANBA 2FEQH 1O2XA 1EAWA 1Z8RA 5DKMA 3GCHC 1Y3WA 3PMJA 1JWTA 1P09A 1SR5C 3ZZ4A 1TMTH 1EPTB 3M5NA 1DM4B 5B6OA 2UUJB 1UTLM 1O3GA 5AHGH 4B76A 2ZHFH 2RA0A 2FXRA 4B73A 3SQEE 1Y8TA 3KHVA 5FBIA 1WXRA 2H9HA 1C2IA 1O3MA 5CHAC 3NWUA 4YM9A 1SC8U 1UVTH 2WUBA 1DX5M 4INLA 4DURA 3ZZ5A 1GJ8B 1C1VH 1K1PA 1BJUA 1F5KU 1PYTC 1T4UH 3H09A 1C2FA 3RXBA 3VB3A 4U2WA 4IN2A 2ZTXA 1C1UH 3DFJA 1L1NA 4NFEA 2CGAA 5A09A 2DE8A 1BMMH 2STBE 1QIXB 2HGTH 1MKWK 3FP7E 1NRPH 2PKAA 1C1PA 4Y0ZE 3W95A 1AFEH 3FZDA 3A84A 1L1GA 1O2QA 4RKJB 4AORA 2OTVA 2YNBA 3NXPA 2D26C 3RXCA 2ZDKA 4RSPA 1W7GH 4FUGA 1QB1A 2GMTC 2WV4A 3UOUA 2V0BA 2QAAA 3QO6A 4WF8A 1ARBA 2QXGA 3A8AA 1EJAA 1SGPE 5C1YA 1S85A 1Z71A 1P3CA 2SGQE 8ESTE 2D1JA 3TU7H 4O03A 3K6YA 2Y5GA 1HAHH 3BEFB 1RTFB 1S0RA 1S84A 2A32A 2J34A 1QJ1B 1E34B 3HKIB 5EXMA 4X8SH 2GZ7A 1A2CH 2PFEA 2GV7A 1B0FA 1MTSA 1AHTH 2BDBA 2WUCA 3QX5H 2FOAA 3KF2A 2PUXB 4BXSA 2PW8H 1D6RA 1DSTA 2RCEA 4QT8C 3T5FH 1A3EH 2FTLE 1AO5A 3NUMA 3A7WA 1HAZB 4OS4A 3RXJA 2IN2A 1O32A 2BY8X 2RA3A 3M37A 1ANDA 2BY7X 3M36A 1KXEA 4KKDA 5A2MH 2FS8A 1ELDE 4ABJA 1VCWA 4TWYA 2VJ1A 1S81A 3PWBA 5HGGA 1ELVA 3SZNA 3ZZDA 1WQSA 1FJSA 5A0AE 1FMGA 1TGSZ 4MNWA 4IMQA 1GBKA 1UVSH 3M5MA 1S0QA 4CR5A 8LPRA 1ELGA 1TNIA 2A4OA 3NKKA 1GG6C 1QB9A 1G2LA 3MFJA 3Q3YA 1T8MA 2PKSC 2F9OA 3JZ1B 2Z9JA 5JBBS 1F0TA 4X1PU 4I7YH 1QQ4A 1HDTH 3T2NA 1JMOH 1UTKA 2XNIA 6CHAB 2C90B 1IAUA 3LOXA 1GBBA 4GSOA 1TPOA 1CGIE 2P3FH 4ZHLU 1VITF 4BOHA 3U8OH 4B2AA 2BDHA 1QY6A 4SGAE 1NY22 1BQYA 3E90B 4ISOA 4WXVA 4FUHA 1CVWH 2O8MA 1C5NH 2NU3E 3H7OA 4OS6A 4UDWH 3UREA 5A8YA 2G4UA 3SV9A 1IQIA 3MNSA 1O2OA 3NZIA 2F91A 1NRSH 1GMHF 2RDLA 3H7TA 4D76A 1GMCG 5DP4A 1BRBE 1GBIA 3RMMH 1C2KA 2EI6A 1O2JA 2QC2A 5E2OA 4FUEA 4OM9A 5AFYH 1GJAB 2AGEX 2C3SA 2HNTC 1SLVB 1NM6A 3FVFB 3SU1A 2CHAB 2PGBB 2Z3EA 3GY7A 3E0NB 3Q3XA 1O2MA 2ZGBH 1VJAU 1TGBA 2JH0D 2Y5HA 4Y7BA 6ESTA 4NSVA 4B75A 2AGIX 1K21H 3RU4D 1WYKA 1MKWH 1TE0A 1TNHA 2QCYA 1D3DB 2D8WA 2OLGA 4BTIB 2Y6TA 2B5TB 2AIPA 3RLWH 1LCYA 1LVOA 3GDSA 3GYLB 4X0WU 1AUJA 5H4IB 1J17T 4CRGA 3V3MA 3F9EA 1O3NA 4ABHA 1YC0A 2P93A 4ABIA 4YT6H 2BHGA 2BD7A 1C5XB 1LHGH 3OX7U 4FVDA 4FUDA 2FI4E 3KQDA 1FY1A 1QA0A 1ZPZA 3SI4H 1ZSLA 3DD2H 5LPEA 2FX4A 2VU8E 4HTCH 1HYLA 1C5MD 1L4DA 1QA7A 4X8UH 1YP9A 4DIHH 1TQ7B 1BRUP 2ODQA 4WWYA 4Y10E 1IQNA 1EKBB 2K1QA 2AS9A 1XKBC 1KLTA 5ABWA 2ZZUH 1OX1A 2OC0A 2FLBH 1JRTA 3VFEA 3BTDE 3ZZ6A 3SV2H 3TGKE 1ZSKA 2ZFTA 4DG4A 5FCKA 1YPMH 1ELCA 1EZUC 1AE8H 1HIAB 1U6QA 2PWXA 1IQJA 1K1IA 4U01A 1X7AC 4BAMB 1TNLA 1ZYOA 1SBWA 2ZO3H 1O2WA 4CRFA 5A8XA 1O2HA 1L0ZA 4ZKNU 1FY8E 2OXSA 3A8BA 1E36B 4A92A 2I6QA 1NS3A 5E0JA 4ZKSU 3RXLA 1ESAA 3VB6A 5DK1A 1BTUA 1PQ5A 1OWHA 1GJ7B 5HM2A 3EA7A 3SJOA 1WV7H 1P01A 1TNGA 4D8NA 4RI0A 4TWWA 1O2UA 1SB1H 5HXFA 3AASA 1MQ5A 1RFNA 3TK5A 2R2MB 3MMGA 3SV7A 2BY5X 4HFPB 1AY6H 1P02A 3SNEA 4UFGH 2SFAA 4UEHH 2AIQA 2W26A 1HFDA 1J8AA 4K8BA 4WJG2 1A3BH 3E8LA 3TVJB 1YCPK 3SUDA 2XC4A 2EI7A 1GBHA 4X2VA 3BG8A 1C5VA 2A5AA 3BSQA 1GJDB 1HAYB 3PLPA 2W3KA 5L30H 4TPIZ 3K65B 3RU4T 1C5TA 1ANCA 3M5LA 1Y3UA 3LGYA 1C4V2 3GCTG 1Y5AT 3ITIA 2VB0A 3A87A 1GHAG 3V12A 1GHYH 3SJKA 1FIZA 2AEIH 4BTTB 2H2ZA 4UONA 2ZA5A 2TRMA 2XWBI 2BVSH 6CHAC 2A2XH 3O8CA 1TB6H 1MD7A 6GCHG 1WSSH 3MH5A 3NCLA 2GTBA 4NA8A 1IOEA 1Z6JH 3SOSA 1SGEE 5FX6A 3ZV8A 3MH7A 4D7GA 2F9UA 1Y59T 1FIWA 1O5AB 3F1SB 4XFQA 1HJAB 2GCHG 5EW1H 3MU8A 4A1VA 4ABBA 3AW1A 1CA8B 1LVMA 4D9RA 1GJCB 1GBEA 3D49H 5ESTE 2V6NA 3E3TA 3VB7A 1V2KT 1GVLA 2ZEBA 4DT7B 3QZQA 4DY7B 3RXVA 5GWZA 3SNAA 4DIIH 1QNJA 2G4TA 1ZTKA 3PYHA 3RP2A 3MO3A 1XUHA 3GY4A 1FPCH 1O2RA 2UUKB 3M3TA 2CHAC 2C93B 1TNJA 2ULLA 1A46H 4E06H 3LGVA 1EASA 1HJ8A 2XBYA 1LKAA 5DP7A 2ODPA 4K1TA 3S7KB 3TH4H 1TQ0B 1H9IE 1QRWA 2GKVE 1QURH 3LC3A 2OBOA 4Q7ZA 3RC5A 3RUOA 3ZZBA 3VB5A 1F5LA 2GX4A 1C2JA 1AVWA 1TIOA 2GCTB 1EP5A 1P10A 2ZHWH 3BTQE 1FPHH 3U1IB 4ABAA 2VNTA 2H5CA 5J4QA 2TBSA 1ANEA 1YLCA 3L33A 4NG9H 3O8RA 4IC5A 3RXGA 2QIQA 3LT3A 1AE5A 1P2QA 2OP9A 2CN0H 4AFUA 2PR3A 1BMAA 2BY9X 5E8EH 1RXPA 1OWIA 6LPRA 4CBOA 3RXEA 1EJMA 4X6MA 1N6XA 4K60A 4IN1A 1O2NA 3BTKE 5EOKA 3UPEA 2STAE 4AFSA 3SZEA 1A7SA 2WPJS 4ASHA 3GY8A 1W13U 5T6DA 1Z1JA 4YOGA 1QQUA 1CBWB 2GDEH 1KDQB 3RXOA 2PSYA 3O8DA 1O0DH 3VXEH 2BB4A 1KXCA 1SSXA 1BA8B 5HMAA 1GHZA 4B74A 2ZU1A 1VITG 4XBDA 1UTPA 4IW4E 1AB9B 2ZU4A 2SGEE 3VEQB 1QRXA 4UFFH 3PV5A 3SU4A 3ZVDA 1OXGA 2BD3A 1LHEH 3OY5U 3LJOA 1SVPA 2ZDNA 1SGDE 1TPPA 4JZ1A 2Q6GA 1ELEE 1H1BA 3GY5A 3BIUH 1GJ9B 2HLCA 2XYAA 5FPSA 5TCAA 1EAUA 1BHXB 1NPMA 5IYTA 1YCPH 1ZHMA 2FOEA 1GMHG 1GMDF 1OWEA 4K3JA 2ZHQH 1SFQB 2UWOA 3L6PA 1SGFA 3KGPA 4HI3A 2Z7FE 2AERH 1TMUH 3RXQA 1TPAE 4X1SU 4X2WA 2ZGCA 1DITH 5EXLA 2R0KA 1O5CB 1EP6A 4JZIA 4O3TA 2VWOA 3MHWU 1G3EA 7KMEH 1CO7E 2BX3A 3I78A 3UFAA 1Y3XA 3RXDA 2KAIA 4ZH8A 3LONA 1Q2WA 2XTTB 2F9PA 3I29A 2JETB 4YOIA 3M61U 5K0HA 1BUIA 2Z9IA 5F8TA 1V6DA 4X8VH 2UUYA 4AX9H 4UFDH 3SU3A 1P2MA 1PPHE 5FCRA 3SJIA 1CT4E 3MNXA 3M3SA 1ZMLA 2FDAA 4VGCC 1UK3A 2OBQA 2XC5A 1V2JT 2F9VA 2BDIA 2FESH 1YPEH 3UWJH 3A7ZA 3A89A 1V2RT 1IQFA 3Q77A 2WZQA 1DVAH 1K1NA 1SQAA 3EE0B 1BZXE 5L2ZH 1BT7A 3P8FA 4IS5A 5FX5A 3GY2A 5C2ZA 3ZVAA 1V2MT 1RIWC 4AGKA 1FY4A 2RG3A 4JK5A 4O97A 2THFB 4FU8A 1FV9A 3ZYEA 1ELAA 7GCHG 2W7UA 1B7XB 1RS0A 3KL6A 2R3UA 4RKOB 1ZGVA 2ZGHA 1NROH 4DJZB 1NFUA 4FU9A 2PHBA 4GLYA 5PTPA 1TNKA 3E6PH 4X2XA 1FZZA 1A5IA 3E0PB 3U98H 3FANA 2ZGXH 1WAYB 1B5GH 1HAVB 1TAWA 3ZVCA 1EQ9A 2Z94A 1TRNA 4J1YA 2H6MA 4AYYB 2AH4X 1ZHPA 3AVZA 1C5SA 1Z8IB 1QRZA 3RXTA 1Q3XA 1XKAC 3STJA 1HJAC 1O2VA 2GZ8A 1MTVA 1C5YB 4GUXA 4F4OC 3ZZ7A 4XBCA 1BITA 1TBZH 3PMBB 3SW2B 3W94A 5C1XA 5FPTA 1FY5A 1F0SA 1C1NA 4AN7A 1GBTA 4J2YB 8GCHF 2VH0A 1J14A 2GT7A 2FTMA 2P3TB 3PV4A 4BAKB 1GBFA 1MUEB 3T29A 2FYRA 3KIDU 1O36A 3TLOA 2P94A 1F7ZA 3BF6H 5JB8S 1V2NT 1P2OA 1AKSB 3LGIA 1SLWB 1CQQA 1GI9B 3PLKA 1PPGE 2VVUA 2WPIS 3MU1A 4OGYA 1P8VC 3EQ0H
chains in the Genus database with same CATH superfamily
4AG1A 2Q6DA 3BTEE 1C1SA 1FI8A 3FP8E 3VXFH 5C3NA 3RC4A 3BTTE 3UNSA 2W3IA 4TY6A 1BTHH 1LO6A 1W7XH 3DFLA 2DE9A 2GCTC 5JB9S 2J38A 4NZLA 1SI5H 5TJXA 2SNVA 3V13A 3AK5A 1G3BA 4FXGH 1YPHC 3QDZB 3RMLH 3ODFA 3TJVA 1LVYA 4CH8B 1V2LT 1CT0E 1C5UA 2JIZD 1N1LA 1XUIA 2J98B 1ZLRA 2HVXA 1CU1A 5GIBA 3SNCA 3HK6B 4A7IB 1DSUA 2B7DH 4NA9H 4B1TA 1LHCH 1SHHB 1UJ1A 1S6HA 1EUFA 2BD4A 2GT8A 2HNTF 3KEEA 1O3OA 3H5CB 3M5OA 2FI3E 3P8OA 3VB4A 2ZDAH 2HPPH 4M9FA 4Y76A 2A5KA 4HZHA 1UCYH 5EGMA 1DLEA 1MU8B 1LHDH 2ZPQA 2OK5A 2J9NA 3T25A 3HK3B 3S9BA 4Q80A 2FPZA 2WPDD 4LZ4B 2PP6A 2BZ6H 2VIVA 2QGRA 4FUBA 5EODA 2ZDVH 1TA6A 4RN6A 4KELA 3C1KA 1BRCE 2G5NA 5EPYA 3TJUA 1J16A 1KTTB 4MDSA 5B6LA 1A0LA 3F68H 3M7TA 1K22H 4YZUA 5GCHG 1LMWB 2ZHEH 1PJPA 3A81A 1WOFA 4K2YA 1O2LA 2Z9KA 3WWBA 1P06A 3MI4A 1WTGH 4YESB 3SJ8A 2AMQA 3LH1A 1LQEA 4NA7A 4Q4LA 3GY6A 1LHFH 3GDUA 1JRSA 1G32B 1KYNA 4OGXA 1VJ9U 5T1VA 2SGFE 4JZEH 2FZZA 2Z3CA 2QY0B 2WSSD 2A0QB 2HVYB 2A4GA 2FMJA 2PV9B 1DUAA 2YNAA 3Q3KA 1W0ZU 1HRTH 1GVKB 4X1QU 3P8GA 3P92A 1GI0A 3MH6A 1IQEA 2ZTYA 2EA3A 4AB8A 3N7OA 1O5DH 2BQWB 4Y8ZA 3M35A 5T6GA 1OP0A 4I31A 5E2PA 4HGCA 2JETC 4DOQA 8KME2 1H4WA 1C1QA 1O2IA 3QTOH 4Q7XA 1KLIH 1AMHA 3UUZA 1O3EA 4MPVA 2XWAA 1L1JA 3ZZ3A 1AU8A 1TWXB 3LJJA 1ACBE 4ZHMU 4TYDA 1CHOF 3M3VA 3F9GA 1QBVH 1YY3A 1SOZA 1YPJH 2ESTE 2ALPA 2ZQ1A 3KQCA 1HGTH 1EOLA 1P2NA 3P70B 3K2UA 1K1MA 2V3HH 4NIWA 1GJBB 2FM2A 1P9UA 2O8TA 5FAHA 1MKXK 2R9PA 4TY7A 4INHA 1O37A 1OP8A 1OPHB 4PROA 1E1RD 1GJ4H 1GGDB 2QXJA 3SGBE 2KCAA 1SGNE 1S82A 4X8TH 4KP0A 1NFWA 4ZMAH 3MWIU 4K5ZA 1EPTC 1TOCB 1YGCH 2V3MA 3ATKA 1C5LH 1JOUB 5FL7D 1S6FA 5GPIB 2XCFA 2C4FH 3PO1B 3T27A 4I33A 4RT1A 1K1LA 1HNEE 3I77A 2F9BH 3Q76A 3ZZAA 2BMGB 1EAIA 3T26A 3LH3A 2G8TA 4O3UA 1K0HA 4GCHF 1C5PA 2B8OH 4I8GA 3O8BA 1QZ8A 2Q1JA 4B2BA 2WPLS 3LGTA 1T8NA 1JXPA 2TGPZ 1LPKB 1UHBA 3FO8D 3B8JA 4ZCNA 4FETA 3CS7A 4BNRA 1QGFA 5DJ7A 2P95A 1Z6EA 2BTCE 3E91A 2H9EH 1YKTA 1O38A 5G4BA 2ZCKP 1ZPBA 1C2MA 1D3TB 3RC6A 3RXAA 1O3HA 2BXUH 2Z9LA 3DCLA 1WTHD 2G00A 1G37A 4FUIA 5FHTA 3IWMA 1BTPA 3QZRA 1EB2A 4KGAA 1KXBA 2ZU3A 5DP9A 2SGDE 1EB1H 4B6EA 1C1WH 1PQAA 1BOQA 3A8CA 1TLDA 1O5FH 4WMDA 1B0EA 1GJ5H 1FN8A 2TGAA 2PUQH 3LC5A 1F5RA 3R0FA 2CV3A 3U8TH 1HIAA 4MVNA 4JYUH 3DUXH 3LGWA 4B2CA 4CHAB 1GHBF 1AQ7A 2HRVA 1HLTH 4YO9A 5JPMH 5EJ1A 4ZHAA 1UW7A 1XUJA 1A61H 1FQ3A 1W14U 3BG4B 2OQUA 1V2ST 2VINA 4XBBA 4IMZA 2IJD1 3P6ZB 1QCPA 3SHAH 1T8LA 1V2OT 1TX7A 1GBDA 2HNTE 1ZMJA 2XBVA 2NU4E 1BMNH 1GCTB 1QL7A 4LK4A 4WY3A 2FODA 1AFQB 4X6PA 2Z6BD 1TGNA 1FAKH 2ZKSA 2PTCE 3V7TA 3K9XB 5IDKA 1S6LA 2B0FA 2HOBA 4YLUA 1O3LA 1O2ZA 1SMFE 1DY8A 5JBTA 1PPCE 3ATLA 4MNVA 3FP6E 3ZV9A 1T4VH 5GXPA 1T32A 3GISB 4IC6A 2JKHA 1D4PB 2W6JD 5LH8A 1XVOA 1VGCB 1YBWA 2Y80A 2W6ID 4D9QA 4R0IA 4UE7H 5ETXA 4CRBA 1DY9A 1QB6A 1AVXA 1G36A 8GCHG 3GCNA 3RXMA 2AMDA 1THSH 5JBAS 4Y11E 2SGAA 3SUGA 3LKWA 3AW0A 3UOPA 3OYPA 1FY3A 3EA9A 1O3KA 1TMBH 4JYTA 2FOGA 3SU5A 1MKXH 2GJGA 1S83A 2CMYA 4Z6AH 1C5RA 2NU0E 3F9FA 2AHME 3TK6A 2VH6A 1ZSJA 1AWFH 1TPSA 3P17H 1DXWA 1MMJN 1C5ZB 1C5WB 3F6UH 3KN2A 1SLUB 2XXLA 2BY6X 3EYDA 3RMOH 4X2YA 4JCNA 3PV2A 3OSYA 3QGJA 1O5EH 1GJ6A 2UWPA 2XC0A 3MOCA 1QR3E 1MCTA 2ZNKH 3LDXH 1UTOA 1GHWH 1TRYA 1A5HA 1P2JA 3SHCH 1YWUA 3BN9A 3QN7A 5CMXH 1TYNA 5IK2D 3RXKA 1G3CA 2J2UA 2RFKC 3TGIE 3GCHB 5I46H 1ZHRA 2VIPA 1OS8A 3MNBA 4BAQB 2BLQA 1BMFD 1DICA 4F48B 1HAPH 3MO6A 3D65E 1HAXB 1W12U 1IQKA 2BLWA 2GDDA 1LTOA 2C8WB 1YF4A 1O39A 5HYOA 4H6SB 4OS7A 4AFZA 2QN5T 1O3CA 4ABFA 1Z8GA 4YLQH 4JMYA 2K8IA 3MH4A 1NU9A 1J15A 7ESTE 1W0KD 4P02A 1ZTJA 2G81E 2WV9A 3AAUA 4K1SA 3D62A 2QXIA 1O2YA 3HGPA 2QF3A 4NWLA 4BAOB 3PO1C 4MTBA 1FUJA 4FVBA 2Y82A 2VWLA 4DGJA 5C5OA 1H9LB 3T28A 4Z1MD 2ZG0H 2O8UA 3KCGH 4Y8XA 1GCDA 1ZR0A 5DP8A 1D9IA 2VVCA 1V2VT 2IOTA 2FWWA 1HCGA 1BMLA 2BDYA 1VR1H 1IQLA 1ESTA 1PYTD 1AD8H 1A1RA 1YLDA 1TGCA 4ISLA 3RMNH 2ZFFH 5GJ4B 3WY8A 3TITA 4ZAEA 1SFIA 1CGJE 1C1TA 1V2QT 4I8HA 2BVRH 4GPGA 1C1RA 9ESTA 1C2GA 3GYMA 4A6LA 1NRRH 4U32A 2C8ZB 2PSXA 1P03A 3BEIB 1XUKA 2XCNA 2A7CA 2QYIA 3EGKH 4WH8A 1KDQA 3UQOA 5L6NH 2ZIQH 3GDVA 4WH6A 2VVVA 1P57B 3RDZA 4YTAA 1CT2E 2QF0A 1LKBA 2OC1A 4RT0A 1C4Y2 1D3PB 5A8ZA 1CGHA 5HIYA 5C17A 4CHAC 1K1OA 1TX6A 3SGAE 1M9UA 2WINI 1LQDB 3BTME 1LVBA 3ZZ9A 3ZZ8A 5EU8A 3U28C 1UCYK 1IHSH 5F8ZA 3BG4C 2FP7B 5DG6A 4CBNA 2OINA 5ESBA 1NRQH 3ODDA 1NC6A 1YLNA 1MD8A 5DGJA 4IGDA 2Z9GA 1GCTC 1GBLA 3MO9A 1AFQC 1KXAA 4NIXA 2TIOA 1NU7B 4CH2B 5JBCS 3SNBA 3C27B 2J97A 1D3QB 4MLFB 3HGNA 2NU1E 4LXBH 1ELTA 3OFND 5HM9A 1IQHA 1PQ8A 3R3GB 1O34A 4FOUC 5DP6A 2QXHA 2ZPSA 4UD9H 3BTGE 5C67A 1O33A 1BTZA 1O2KA 2HLDD 4E05H 4ABDA 1NN6A 3PROA 3A7VA 3TPIZ 1MBQA 2Q6FA 1T8OA 2O9QA 3P8NA 1T7CA 2J4IA 3ATMA 5A0BA 1UVUH 1DPOA 1E0FD 3B23B 4I86A 1T31A 3PWCA 1MBMA 2BD5A 5DO4H 2BOHB 1QBOA 2TGTA 4JZDH 2BD2A 1SGIB 1S5SA 3QLPH 4NZQA 3QTVH 3Q00A 4ASUD 2A1DB 3MTYA 5J4SA 1WUNH 3MU4A 1TBRH 3LGUA 2FOFA 1G9IE 1GHXH 5E0GA 1NFYA 5E0HA 1MAXA 2GVFA 4I8JA 3UNRA 1BBRK 1C5OH 1E1QD 3HKJB 1D6WA 4TPYA 1GDUA 4GHTA 5A0CA 1SGCA 2ZFQH 2D2DA 1HAVA 3GOVB 1SL3A 3A85A 1BHXF 1SQTA 2A31A 2ZHDA 3RXHA 4KTSA 1ZOMA 1FXYA 1EPTA 1DS2E 1GHVH 1SOTA 1EX3A 4AB9A 3JZ2B 4MNYA 2BDGA 1UTJA 3TNTA 1AVGH 1VZQH 1OWKA 3A86A 1BTWA 1TONA 1O2PA 1ESBA 2HPQH 1C2HA 4WXIA 1UCYE 1RD3B 4ISNA 1YCPM 3SU6A 1BRAA 1KSNA 1VCQA 2BYAX 1UTMA 1RTKA 1AKSA 1FAXA 3SNDA 2A4QA 3RXUA 3BEUA 4JK6A 1XUFA 1WBGB 4AZ2B 4XE4A 5GDSH 2VGCB 1UK4A 2BD9A 1KXDA 5K7RA 4FU7A 4ISIH 4DW2U 1XX9A 2JH6D 1MZAA 1DE7H 3SORA 3GCTF 1BTXA 4CRAA 2BQ6B 1EXFA 1XM1A 5C20A 1GHAF 1Y5BT 1OYQA 2P8OB 3MU0A 1OKXA 4X1NU 3TIUA 2PKAB 1DUEA 1NRNH 2J98A 1EJNA 3SO3A 2NU2E 2XW9A 6GCHF 1AZ8A 1KXFA 5DPAA 1ID5H 1ETSH 1GBCA 4CRCA 1EATA 2P3UB 2G5VA 4O9VA 3M7QA 3SU2A 1O2GH 1OWJA 3KYFA 2GGVB 1SG8B 2GCHF 3L3TA 3S9AA 5SGAE 1THRH 5AVDA 3GS9A 3URDA 4FUCA 2WHXA 3ZYDA 5CE1A 1C2DA 1CBWC 1PFXC 2F3CE 3U8RH 3VPKA 1W11U 1P11E 3TGJE 2AYWA 2A5IA 1WCZA 1A0JA 3PMAB 1SGQE 2J5UA 2Y7XA 1AB9C 1VKYA 1W2KH 2OD3B 3VGCB 1BBRE 3K6ZA 5F8XA 4ZROA 3SQHE 1CE5A 3RM0H 1UVOA 3ATIA 2ZDMA 2ZI2H 2ANYA 1FDPA 2LPRA 1O35A 1FONA 3PLBA 1C1OA 2ZWLH 3BTHE 4Y7AA 4A1TA 1MAYA 1MCVA 3ATWA 1GBJA 4H6TA 1SPJA 1EFRD 1BIOA 4I32A 4ISHH 5BRRE 2BOKA 2ZCLP 3S7HB 3S0NA 5EIYA 2QA9E 3SYJA 4JYVH 1ETTH 4ACBA 1PQ7A 2O8LA 2TPIZ 1GPZA 5FPYA 3SBKA 1PPZA 3TJOA 4CREA 2XBWA 5CDFE 3RXSA 1OYTH 2SGPE 2ZFSA 2ODYB 3BTWE 1GL0E 1YYY1 2G55A 4NWKA 1Y3VA 5F03A 1SGRE 1BBRH 1COWD 1OOKB 1TGTA 1YPHE 1LPGB 3A7TA 1FLEE 4DCDA 3OAAD 3QWCH 1K28D 2JH5D 1ZMNA 5DSFA 1ZRBA 2V35A 3KQBA 2BLOA 1ELFA 3FKSD 2ASUB 1Y3YA 1JIMA 3A8DA 4MG3A 3V0XA 4E7NA 1TRMA 5JDUB 2VIOA 4NFFA 1OSSA 2VWMA 1C9PA 3NPSA 1ZGIA 1Z8JB 2A7HA 1WDIA 1KLJH 1PPFE 2FOHA 3RXFA 3S9CA 2KR7A 1HB0B 1LPZB 4THNH 4WMFA 3PTNA 2ANKH 2OC8A 3SU0A 1Y5UT 2YOLA 1O30A 1DWDH 2ZF0H 2GD4B 2JJ2D 1V2PT 4K1EA 3T62A 3KNXA 1K9OE 1W10U 2I6SA 1GDNA 1G2MA 4AGJA 2W7SA 1CA0B 3LPRA 5C5NA 1P05A 3UWIA 1H8HD 1NTPA 1TFXA 1VCPA 2CJIA 3OTPA 3STIA 4B6FA 2ZC9H 2SNWA 3SI3H 3UR6A 4UFEH 2BX4A 4D7FA 4Y0YE 4Q7YA 2R0LA 4LZ1H 2VIWA 1C4U2 3CS0A 1GWAA 1JIRA 1GL1A 3EDXB 1GBAA 4NIYA 1GMDG 2CF8H 2BQ7B 1A4WH 1SLXB 1WQVH 1O3BA 2ALVA 1MTUA 1ZJDA 2FLRH 3G01A 1PPBH 1F0RA 3PRBA 1EZSC 4ZUHA 4JZFH 2R3YA 3FAOA 2ZFPH 1P2KA 2ZECA 1MTWA 1MTNB 4DVAU 1MQ6A 2P59A 3SN8A 1XVMA 1UK2A 1V2UT 4ZKOU 5EQQA 2FO9A 1YM0A 2H9TH 3EE7A 1UHBB 3NK8A 2VGCC 5FBEA 2BXTH 1ZPCA 2ZTZA 1HAIH 4AOQA 1HAGE 5DP5A 3RXPA 1A0HB 1XUGA 4F49A 2IPHA 1V2TT 7GCHF 1TOMH 2P8OC 2KX4A 3CP7A 2EI8A 2AGGX 1QJ7B 1K2I1 2EQNA 4MQAA 3DHKH 1HXFH 3F2HA 1E79D 1ELBA 2ILNA 5FXLA 1AWHB 3RM2H 1UO6A 1C2LA 1GI7B 2ANMH 4R8TB 1CSOE 1C5QA 1HXEH 1TALA 1GI8B 2C8XB 3A82A 3RXIA 5LGOA 1V2WT 1GI2A 3ZZCA 2ZPRA 2P16A 3U9AH 3SUEA 2W5EA 5LPRA 1DANH 2NWNA 1NZQH 2A4RA 1HUTH 1SGTA 1HJ9A 1RJXB 1ABIH 2EY4C 1AI8H 2R2WU 1HPGA 3UQVA 4H4FA 1BJVA 3N7DA 5GNDA 1Q31A 2K0QA 1JBUH 3UY9A 2TGDA 1O31A 9LPRA 3BV9B 3VGCC 1N8OB 1C2EA 5C94A 2ANWA 1IHTH 2WYJA 2FYQA 1SGFG 3UNQA 3AAVA 1W3CA 2GZ9A 1YPGH 1YPKH 2VIDA 5EQSA 1RGQA 3ELAH 1AUTC 4Y71A 4SGBE 1P3EA 1DWEH 2Y81A 2CXVA 3RLYH 1NFXA 1K1JA 4X1RU 4Y6DA 4ZXXH 5EXNA 2VIQA 1GI3A 1SKYE 3EA8A 4I8LA 4E7RG 3TJNA 1FN6A 2Y5FA 3HATH 4GAWA 2M5TA 4NSYA 5EQRA 5F53A 3SV6A 2F83A 1W8BH 3GCOA 3OY6U 3BIVH 4VGCB 1O3DA 2A7JA 1W0YH 4Q2KA 4YOJA 3F0PA 1BDAA 4CRDA 2GV6A 1P2IA 1FNIA 5HKKD 4K8YA 1N6YA 3PB1E 4NIVA 1ZZZA 4Z0KA 2H1UA 1GI6A 1RIWB 2IJOB 3IG6B 1O3IA 1V3XA 1E38B 1HV7A 1GI1A 2XOKD 4Y8YA 1ZJKA 4OS1A 3U69H 2WPKS 2F4LA 3EAJA 1QBNA 2FX6A 5CHBA 2GP9B 1O2SA 2DUCA 3S69A 1O5GH 1THPB 1SGYE 1QL8A 1H9HE 5F6MA 1P12E 2WYGA 2B9LA 2FIRH 3TH2H 1IQMA 3SUFA 5LPFA 4BTUB 4A5TS 2A45B 2XBXA 3B9FH 2BD8A 3ENSB 5GCHF 1ORFA 1QL9A 2OC7A 1GGDC 1HBTH 4GVUA 3PTBA 3QUMP 3A80A 4FUFA 4KTCA 3ZVBA 4ZKRU 1FX0B 1OP2A 5EJLA 4ABEA 1AN1E 1ZTLA 2BLVA 2VBCA 2Z3DA 2G51A 4K69A 5CHAB 2FOCA 4INKA 1TBQH 4MPXA 1CA0C 2PGQB 2G52A 1DXPA 1KMHB 2WPHS 1KIGH 3TH3H 4A1XA 1H8IH 2O8WA 2UUFB 2V3OH 2A2QH 2KCYA 5EPNA 4ZXYH 5EJZA 1BCUH 2BM2A 1UTNA 1TA2A 3SV8A 1TX8A 3OTJE 1DDJA 4CR9A 3A83A 1J9CH 2OUAA 2FI5E 2ZFRH 1BTYA 2C8YB 3MNCA 1NT1A 4M7GA 2BZAA 3M7UA 1O3FA 2AMPA 4MPUA 3QGNB 1WU1A 3PMHB 4H42U 2OQ5A 4ESTE 2GMTB 1GI4A 1MTNC 1UVPA 3ESTA 1SQOA 1TABE 4IBLH 5JYIA 1O3JA 1VITH 2J92A 1KTSB 1QHRB 2ZDLA 3FZZA 1ETRH 1O5BB 1RTLA 3DT0H 5AFZH 3UIRA 4BXWA 4U30A 1AGJA 2Y7ZA 4OS2A 3D23A 3PM3A 5I25A 1EAXA 1L4ZA 3GY3A 1Z7KA 1HAOH 4AYVB 3MU5A 1GMCF 5T3HA 3IITA 2H5DA 1EZXC 4WVPE 3A88A 2QV1A 1C9TA 3P95A 2J94A 2OCVB 1CHOG 2EEKA 1PPEE 1GDQA 4LOYH 3OU0A 4NGAH 1QTFA 1L2EA 4B71A 4AG2A 4BANB 1ARCA 3RU4E 1OWDA 1BB0B 1DWCH 1E35B 1XXFA 1A5GH 4GHQA 2WV5A 1AZZA 1UTQA 3ZVGA 3RXRA 1P9SA 1ABJH 3GICB 1QJ6B 4ABGA 4AFQA 2ZU2A 3UR9A 4WMEA 1MH0A 2F9NA 3TNSA 1EZQA 1YPLH 2FOBA 1N8OC 2BVXH 3UTUH 1Z1IA 5DP3A 4XDEA 1CHGA 1P0SH 2KCOA 2ZCHP 3LU9B 1ZRKA 2FOMB 1NO9H 1GG6B 2ZQ2A 3A7XA 4NCYA 2KAIB 2PKSB 3TK9A 2HALA 3ZVEA 1GBMA 2ZP0H 1VGCC 3E16B 2V7QD 3LIWA 1AIXH 4X6NA 3URCA 3SGQE 1DT2A 4X6OA 2YMSB 1H8DH 3U1JB 1GI5A 1EOJA 4GCHG 1F2SE 1P04A 5T6FA 1C1MA 3DA9B 1E37B 1LDTT 5AF9H 5C1UA 4BAHB 5EG4A 2L6OA 1NESE 3F2GA 4P00A 4Y79A 1DWBH 2BDCA 2ZU5A 3KQEA 4KTUA 2HWLB 3A7YA 5L2YH 1RRKA 1O2TA 2XRCA 1O3PB 3HPTB 1XXDA 2XNDD 1IQGA 1QFKH 1MU6B 1INCA 1MZDA 3FFGA 3MYWA 3SJ9A 1G30B 2YMSD 1DLKB 1UMAH 4XOJA 4YT7H 4OS5A 1SHYA 2FS9A 3BTFE 1F0UA 4FUJA 1GVZA 2PTNA 3E1XB 2BDAA 2CF9H 4XSKU 7LPRA 2AFQB 3CENA 2PLXA 4MPWA 2VWNA 1DOJA 2ZGJA 5TCCA 1XMNB 2UWLA 4TSFD 1G3DA 2LNCA 1F92A 3ZVFA 4I8KA 2EC9H 3F9HA 1O3AA 1DFPA 1KY9A 2J95A 2WPMS 3QK1A 1GHBG 5BPEA 5EW2H 4MNXA 1ANBA 2FEQH 3UB0A 1O2XA 1EAWA 3NRLA 1Z8RA 5DKMA 3GCHC 1Y3WA 3PMJA 1JWTA 1P09A 1SR5C 3ZZ4A 3DSPA 1TMTH 1EPTB 3M5NA 1DM4B 5B6OA 2UUJB 1UTLM 1O3GA 5AHGH 4B76A 2IPQX 2RA0A 2FXRA 2ZHFH 4B73A 3SQEE 1Y8TA 3KHVA 5FBIA 1WXRA 2H9HA 1C2IA 1MABB 1O3MA 5CHAC 3NWUA 4YM9A 1SC8U 1UVTH 2WUBA 1DX5M 4INLA 4DURA 3ZZ5A 1GJ8B 1C1VH 1K1PA 1BJUA 1F5KU 1PYTC 1T4UH 3FN8A 5KECA 3H09A 1C2FA 3RXBA 3VB3A 4U2WA 4IN2A 2ZTXA 1C1UH 3DFJA 1L1NA 4NFEA 3WWFA 2CGAA 5A09A 2DE8A 1BMMH 3OE7D 2STBE 1QIXB 2HGTH 1MKWK 3FP7E 2LP6A 1NRPH 2PKAA 1C1PA 2KFWA 4Y0ZE 1AFEH 3W95A 2RDEA 3A84A 3FZDA 1L1GA 1O2QA 4RKJB 4AORA 2OTVA 2YNBA 3NXPA 2D26C 3RXCA 2ZDKA 4RSPA 1W7GH 4FUGA 1QB1A 2GMTC 2WV4A 3UOUA 2V0BA 2QAAA 3QO6A 4WF8A 1ARBA 2QXGA 3A8AA 1EJAA 1SGPE 5C1YA 1S85A 1Z71A 1P3CA 2SGQE 8ESTE 2D1JA 3TU7H 4O03A 3K6YA 3OEHD 2Y5GA 1HAHH 3BEFB 1RTFB 1S0RA 1S84A 2A32A 2J34A 1QJ1B 1E34B 4TT3D 3HKIB 5EXMA 4X8SH 2GZ7A 1A2CH 2GV7A 2PFEA 1B0FA 1MTSA 1AHTH 2BDBA 2WUCA 3VG8A 3QX5H 2FOAA 3KF2A 2PUXB 4BXSA 2PW8H 1D6RA 1DSTA 2RCEA 4QT8C 3T5FH 1A3EH 2FTLE 1AO5A 3NUMA 3A7WA 1HAZB 4OS4A 3RXJA 2IN2A 1O32A 2BY8X 2RA3A 3M37A 1ANDA 2BY7X 3M36A 1KXEA 4KKDA 5A2MH 2FS8A 1ELDE 4ABJA 1VCWA 4TWYA 2VJ1A 1S81A 3PWBA 5HGGA 1ELVA 3MQKC 3SZNA 3ZZDA 1WQSA 1FJSA 5A0AE 1FMGA 1TGSZ 3KQ5A 4MNWA 4IMQA 1GBKA 3DSOA 1UVSH 3M5MA 1S0QA 4CR5A 8LPRA 1ELGA 1TNIA 2A4OA 3NKKA 1GG6C 1QB9A 1G2LA 3MFJA 3Q3YA 1T8MA 2PKSC 2F9OA 3JZ1B 2Z9JA 5JBBS 1F0TA 4X1PU 3ZIAD 4I7YH 1QQ4A 1HDTH 2YMSC 3T2NA 1JMOH 1UTKA 2XNIA 6CHAB 2C90B 1IAUA 3LOXA 1GBBA 4GSOA 1TPOA 1CGIE 2P3FH 4ZHLU 1VITF 4BOHA 3U8OH 4B2AA 2BDHA 1QY6A 4SGAE 1NY22 1BQYA 3E90B 4ISOA 4WXVA 4FUHA 1CVWH 4DT4A 5DN6D 2O8MA 1C5NH 2NU3E 5KEDA 3H7OA 2CK3D 4OS6A 4UDWH 3UREA 5A8YA 2G4UA 3SV9A 1IQIA 3F0OA 3MNSA 1O2OA 3NZIA 2F91A 1NRSH 1GMHF 2RDLA 3H7TA 4D76A 1GMCG 5DP4A 1BRBE 1GBIA 3RMMH 1C2KA 2EI6A 1O2JA 2QC2A 5E2OA 4FUEA 4OM9A 5AFYH 1GJAB 2AGEX 2C3SA 2HNTC 1SLVB 1NM6A 3FVFB 3SU1A 2CHAB 2PGBB 2Z3EA 3GY7A 3E0NB 3Q3XA 5HIZA 1O2MA 2ZGBH 1VJAU 1TGBA 2JH0D 2Y5HA 4Y7BA 6ESTA 4NSVA 4B75A 2AGIX 1K21H 3RU4D 1WYKA 1MKWH 1TE0A 1TNHA 2QCYA 3UAIC 1D3DB 2D8WA 2OLGA 4BTIB 2Y6TA 1H8ED 2B5TB 2AIPA 3RLWH 1LCYA 1LVOA 3GDSA 3GYLB 4X0WU 1AUJA 5H4IB 1J17T 4CRGA 3V3MA 3F9EA 1O3NA 4ABHA 1YC0A 3N7EA 2P93A 4ABIA 4YT6H 2BHGA 2BD7A 3N99A 1C5XB 1LHGH 3OX7U 4FVDA 4FUDA 2FI4E 3F3BA 3KQDA 1FY1A 1QA0A 1ZPZA 3SI4H 1ZSLA 3DD2H 5LPEA 2FX4A 2VU8E 4HTCH 1HYLA 1C5MD 1L4DA 1QA7A 4X8UH 1YP9A 4DIHH 2KCPA 1TQ7B 1BRUP 2ODQA 4WWYA 4Y10E 1IQNA 1EKBB 2K1QA 2AS9A 1XKBC 1KLTA 5ABWA 2ZZUH 1OX1A 2OC0A 1NBME 2FLBH 1JRTA 3VFEA 3BTDE 3ZZ6A 3SV2H 3TGKE 1ZSKA 3KYGA 2ZFTA 4DG4A 5FCKA 1YPMH 1ELCA 1EZUC 1AE8H 1HIAB 1U6QA 2PWXA 1IQJA 1K1IA 4U01A 1X7AC 4BAMB 1TNLA 1ZYOA 1SBWA 2ZO3H 1O2WA 2M2AA 4CRFA 5A8XA 1O2HA 1L0ZA 4ZKNU 1FY8E 2OXSA 3A8BA 1E36B 4A92A 2I6QA 1NS3A 5E0JA 4ZKSU 3RXLA 1ESAA 3VB6A 5DK1A 1BTUA 1PQ5A 1OWHA 1GJ7B 5HM2A 3EA7A 3FOAA 3SJOA 1WV7H 1P01A 1TNGA 4RI0A 4D8NA 4TWWA 1O2UA 1SB1H 5HXFA 3AASA 1MQ5A 1RFNA 3TK5A 2R2MB 3MMGA 3SV7A 2BY5X 4HFPB 1AY6H 1P02A 3SNEA 4UFGH 2SFAA 4UEHH 2AIQA 2W26A 1HFDA 1J8AA 4K8BA 4WJG2 1A3BH 3E8LA 3TVJB 1YCPK 3SUDA 2XC4A 2EI7A 1GBHA 4X2VA 3BG8A 1C5VA 2A5AA 3BSQA 1GJDB 1HAYB 3PLPA 2W3KA 5L30H 4TPIZ 3K65B 3RU4T 1C5TA 1ANCA 3M5LA 1Y3UA 3LGYA 1C4V2 3GCTG 1Y5AT 3ITIA 2VB0A 3A87A 1GHAG 3V12A 1GHYH 3SJKA 1FIZA 2AEIH 4BTTB 2H2ZA 4UONA 2ZA5A 2TRMA 2XWBI 3CNRA 2BVSH 3W1EA 2A2XH 6CHAC 1TB6H 1MD7A 2QF4A 3O8CA 6GCHG 1WSSH 3MH5A 3NCLA 2GTBA 4NA8A 1IOEA 1Z6JH 3SOSA 1SGEE 5FX6A 3ZV8A 3MH7A 4D7GA 2F9UA 1Y59T 1FIWA 1O5AB 3F1SB 4XFQA 1HJAB 2GCHG 5EW1H 3MU8A 4A1VA 4ABBA 3AW1A 1CA8B 1LVMA 4D9RA 1GJCB 1GBEA 3D49H 5ESTE 2V6NA 3E3TA 3WW7A 3VB7A 1V2KT 1GVLA 2ZEBA 4DT7B 3QZQA 4DY7B 3RXVA 5GWZA 3SNAA 2KM0A 4DIIH 1QNJA 2G4TA 1ZTKA 3PYHA 3RP2A 3MO3A 1XUHA 3GY4A 4XD7D 1FPCH 1O2RA 2UUKB 3M3TA 2CHAC 2C93B 1TNJA 2ULLA 1A46H 4E06H 3LGVA 1EASA 1HJ8A 4XRNA 2XBYA 1LKAA 5DP7A 2ODPA 4K1TA 3S7KB 3TH4H 1TQ0B 1H9IE 1QRWA 2GKVE 1QURH 3LC3A 2OBOA 4Q7ZA 3RC5A 3RUOA 2KZ4A 3ZZBA 3VB5A 1F5LA 2GX4A 1C2JA 1AVWA 1TIOA 2GCTB 1OHHD 1EP5A 1P10A 2ZHWH 3BTQE 1FPHH 3F2FA 3U1IB 3OEED 4ABAA 2VNTA 2H5CA 5J4QA 2TBSA 1W0JD 1ANEA 1YLCA 3L33A 4NG9H 3O8RA 4IC5A 3RXGA 2QIQA 3LT3A 1AE5A 1P2QA 2OP9A 2CN0H 4AFUA 2PR3A 1BMAA 2BY9X 5E8EH 1RXPA 1OWIA 4HG6A 6LPRA 4CBOA 3RXEA 1EJMA 4X6MA 1N6XA 2QE7D 4K60A 4IN1A 1O2NA 3BTKE 5EOKA 3UPEA 2STAE 4AFSA 3SZEA 1A7SA 2WPJS 4ASHA 3GY8A 1W13U 5T6DA 1Z1JA 4YOGA 1QQUA 1CBWB 2GDEH 1KDQB 3RXOA 2PSYA 3O8DA 1O0DH 3VXEH 2BB4A 1KXCA 1SSXA 1BA8B 5HMAA 1GHZA 4B74A 2ZU1A 1VITG 4XBDA 1UTPA 4IW4E 1AB9B 2ZU4A 2SGEE 3VEQB 1QRXA 2JJ1D 4UFFH 3PV5A 3SU4A 3ZVDA 1OXGA 2BD3A 1LHEH 3OY5U 3LJOA 1SVPA 2ZDNA 3DSGA 1SGDE 1TPPA 4JZ1A 2Q6GA 1ELEE 1H1BA 3GY5A 5KGOA 3BIUH 1GJ9B 2HLCA 2XYAA 5FPSA 5TCAA 1EAUA 1BHXB 1NPMA 5IYTA 1YCPH 1ZHMA 2FOEA 1GMHG 1GMDF 1OWEA 4K3JA 2ZHQH 1SFQB 2UWOA 3L6PA 1SGFA 3KGPA 4HI3A 2Z7FE 2AERH 1TMUH 3RXQA 1TPAE 4X1SU 4X2WA 2ZGCA 1DITH 5EXLA 2R0KA 1O5CB 1EP6A 4JZIA 4O3TA 2VWOA 3MHWU 1G3EA 7KMEH 1CO7E 2BX3A 3I78A 3UFAA 1Y3XA 3RXDA 2KAIA 4ZH8A 4YXWD 3LONA 1Q2WA 2XTTB 2F9PA 3I29A 2LELA 2JETB 4YOIA 3M61U 5K0HA 1BUIA 2Z9IA 5F8TA 1V6DA 4X8VH 2UUYA 4AX9H 4UFDH 3SU3A 1P2MA 1PPHE 5FCRA 3SJIA 1CT4E 3MNXA 3M3SA 4AC9A 1ZMLA 2FDAA 4VGCC 1UK3A 2OBQA 2XC5A 1V2JT 2F9VA 2BDIA 2FESH 1YPEH 3UWJH 3A7ZA 3A89A 1V2RT 1IQFA 2WZQA 3Q77A 1DVAH 1K1NA 1SQAA 3EE0B 1BZXE 5L2ZH 1BT7A 3P8FA 4IS5A 2F43B 3GY2A 5FX5A 5C2ZA 3ZVAA 2JDID 1V2MT 1RIWC 4AGKA 1FY4A 2QF5A 2RG3A 4JK5A 4O97A 2THFB 5C0UA 4FU8A 1FV9A 4F55A 3ZYEA 1ELAA 7GCHG 2W7UA 1B7XB 1RS0A 3KL6A 2R3UA 4RKOB 1ZGVA 2ZGHA 1NROH 4DJZB 1NFUA 4FU9A 2PHBA 4GLYA 4Q63A 5PTPA 1TNKA 1NBMD 3E6PH 4X2XA 1FZZA 1A5IA 3E0PB 3U98H 3FANA 2ZGXH 1WAYB 1B5GH 1HAVB 1TAWA 3ZVCA 1EQ9A 2Z94A 1TRNA 4J1YA 2H6MA 4AYYB 2AH4X 1ZHPA 3AVZA 1C5SA 1Z8IB 1QRZA 3RXTA 1Q3XA 1XKAC 3STJA 1HJAC 1O2VA 2GZ8A 1MTVA 1C5YB 4GUXA 4F4OC 3ZZ7A 4XBCA 1BITA 1TBZH 3PMBB 3PRDA 3SW2B 3W94A 5C1XA 5C0TA 5FPTA 1SQRA 1FY5A 1F0SA 1C1NA 4AN7A 1GBTA 4J2YB 8GCHF 2VH0A 1J14A 2GT7A 2FTMA 2P3TB 3PV4A 4BAKB 4ACAA 1GBFA 1MUEB 3T29A 2FYRA 3KIDU 1O36A 3TLOA 2P94A 1F7ZA 3BF6H 5JB8S 1V2NT 2L74A 1P2OA 1AKSB 3LGIA 1SLWB 1CQQA 1GI9B 3PLKA 1PPGE 2VVUA 2WPIS 3MU1A 4OGYA 1P8VC 3EQ0H
chains in the Genus database with same CATH topology
4AG1A 2Q6DA 3BTEE 1C1SA 1FI8A 3FP8E 3VXFH 5C3NA 3RC4A 3BTTE 3UNSA 2W3IA 4TY6A 1BTHH 1LO6A 1W7XH 3DFLA 2DE9A 2GCTC 5JB9S 2J38A 4NZLA 1SI5H 5TJXA 2SNVA 3V13A 3AK5A 1G3BA 4FXGH 1YPHC 3QDZB 3RMLH 3ODFA 3TJVA 1LVYA 4CH8B 1V2LT 1CT0E 1C5UA 1N1LA 1XUIA 2JIZD 1ZLRA 2HVXA 1CU1A 5GIBA 3SNCA 3HK6B 4A7IB 1DSUA 2B7DH 4NA9H 4B1TA 1LHCH 1SHHB 1UJ1A 1S6HA 1EUFA 2BD4A 2GT8A 2HNTF 3KEEA 1O3OA 3H5CB 3M5OA 2FI3E 3P8OA 3VB4A 2ZDAH 2HPPH 4M9FA 4Y76A 2A5KA 4HZHA 1UCYH 5EGMA 1DLEA 1MU8B 1LHDH 2ZPQA 2OK5A 2J9NA 3T25A 3HK3B 3S9BA 4Q80A 2FPZA 2WPDD 4LZ4B 2BZ6H 2VIVA 2QGRA 4FUBA 5EODA 2ZDVH 1TA6A 4RN6A 4KELA 3C1KA 1BRCE 2G5NA 5EPYA 3TJUA 1J16A 1KTTB 4MDSA 5B6LA 1A0LA 3F68H 3M7TA 1K22H 4YZUA 5GCHG 1LMWB 2ZHEH 1PJPA 3A81A 1WOFA 4K2YA 1O2LA 2Z9KA 3WWBA 1P06A 3MI4A 1WTGH 4YESB 3SJ8A 2AMQA 3LH1A 1LQEA 4NA7A 4Q4LA 3GY6A 1LHFH 3GDUA 1JRSA 1G32B 1KYNA 4OGXA 1VJ9U 5T1VA 2SGFE 4JZEH 2FZZA 2Z3CA 2QY0B 2WSSD 2A0QB 2A4GA 2FMJA 2PV9B 1DUAA 2YNAA 3Q3KA 1W0ZU 1HRTH 1GVKB 4X1QU 3P8GA 3P92A 1GI0A 3MH6A 1IQEA 2ZTYA 2EA3A 4AB8A 3N7OA 1O5DH 2BQWB 4Y8ZA 3M35A 5T6GA 1OP0A 4I31A 5E2PA 4HGCA 2JETC 4DOQA 8KME2 1H4WA 1C1QA 1O2IA 3QTOH 4Q7XA 1KLIH 1AMHA 3UUZA 1O3EA 4MPVA 2XWAA 1L1JA 3ZZ3A 1AU8A 1TWXB 3LJJA 1ACBE 4ZHMU 4TYDA 1CHOF 3M3VA 3F9GA 1QBVH 1SOZA 1YPJH 2ESTE 2ALPA 2ZQ1A 3KQCA 1HGTH 1EOLA 1P2NA 3P70B 3K2UA 1K1MA 2V3HH 4NIWA 1GJBB 2FM2A 1P9UA 2O8TA 5FAHA 1MKXK 2R9PA 4TY7A 4INHA 1O37A 1OP8A 1OPHB 4PROA 1E1RD 1GJ4H 1GGDB 2QXJA 3SGBE 2KCAA 1SGNE 1S82A 4X8TH 4KP0A 1NFWA 4ZMAH 3MWIU 4K5ZA 1EPTC 1TOCB 1YGCH 3ATKA 1C5LH 1JOUB 5GPIB 1S6FA 5FL7D 2XCFA 2C4FH 3PO1B 3T27A 4I33A 1K1LA 1HNEE 3I77A 2F9BH 3Q76A 3ZZAA 2BMGB 1EAIA 3T26A 3LH3A 2G8TA 4O3UA 4GCHF 1C5PA 2B8OH 4I8GA 3O8BA 2Q1JA 4B2BA 2WPLS 3LGTA 1T8NA 1JXPA 2TGPZ 1LPKB 1UHBA 3FO8D 3B8JA 4ZCNA 4FETA 3CS7A 4BNRA 1QGFA 5DJ7A 2P95A 1Z6EA 2BTCE 3E91A 2H9EH 1YKTA 1O38A 5G4BA 2ZCKP 1ZPBA 1C2MA 1D3TB 3RC6A 3RXAA 1O3HA 2BXUH 2Z9LA 3DCLA 1WTHD 2G00A 1G37A 4FUIA 5FHTA 3IWMA 1BTPA 3QZRA 1EB2A 4KGAA 1KXBA 2ZU3A 5DP9A 2SGDE 1EB1H 4B6EA 1C1WH 1PQAA 1BOQA 3A8CA 1TLDA 1O5FH 4WMDA 1B0EA 1GJ5H 1FN8A 2TGAA 2PUQH 3LC5A 1F5RA 3R0FA 2CV3A 3U8TH 1HIAA 4MVNA 4JYUH 3DUXH 3LGWA 4B2CA 4CHAB 1GHBF 1AQ7A 2HRVA 1HLTH 4YO9A 5JPMH 4ZHAA 1XUJA 1A61H 1FQ3A 1W14U 3BG4B 2OQUA 1V2ST 2VINA 4XBBA 4IMZA 2IJD1 3P6ZB 1QCPA 3SHAH 1T8LA 1V2OT 1TX7A 1GBDA 2HNTE 1ZMJA 2XBVA 2NU4E 1BMNH 1GCTB 1QL7A 4LK4A 4WY3A 2FODA 1AFQB 4X6PA 2Z6BD 1TGNA 1FAKH 2ZKSA 2PTCE 3V7TA 3K9XB 5IDKA 2B0FA 1S6LA 2HOBA 4YLUA 1O3LA 1O2ZA 1SMFE 1DY8A 5JBTA 1PPCE 3ATLA 4MNVA 3FP6E 3ZV9A 1T4VH 5GXPA 1T32A 3GISB 4IC6A 2JKHA 1D4PB 2W6JD 5LH8A 1XVOA 1VGCB 1YBWA 2Y80A 2W6ID 4D9QA 4R0IA 4UE7H 5ETXA 4CRBA 1DY9A 1QB6A 1AVXA 1G36A 8GCHG 3GCNA 3RXMA 2AMDA 1THSH 5JBAS 4Y11E 2SGAA 3SUGA 3LKWA 3AW0A 3UOPA 3OYPA 1FY3A 3EA9A 1O3KA 1TMBH 4JYTA 2FOGA 3SU5A 1MKXH 1S83A 2CMYA 4Z6AH 1C5RA 2NU0E 3F9FA 2AHME 3TK6A 2VH6A 1ZSJA 1AWFH 1TPSA 3P17H 1DXWA 1MMJN 1C5ZB 1C5WB 3F6UH 3KN2A 1SLUB 2XXLA 2BY6X 3EYDA 3RMOH 4X2YA 4JCNA 3PV2A 3OSYA 3QGJA 1O5EH 1GJ6A 2UWPA 2XC0A 3MOCA 1QR3E 1MCTA 2ZNKH 3LDXH 1UTOA 1GHWH 1TRYA 1A5HA 1P2JA 3SHCH 3BN9A 3QN7A 5CMXH 1TYNA 5IK2D 3RXKA 1G3CA 2J2UA 3TGIE 3GCHB 5I46H 1ZHRA 2VIPA 1OS8A 3MNBA 4BAQB 2BLQA 1BMFD 1DICA 1HAPH 3MO6A 3D65E 1HAXB 1W12U 1IQKA 2BLWA 2GDDA 1LTOA 2C8WB 1YF4A 1O39A 5HYOA 4H6SB 4OS7A 4AFZA 2QN5T 1O3CA 4ABFA 1Z8GA 4YLQH 4JMYA 2K8IA 3MH4A 1NU9A 1J15A 7ESTE 1W0KD 1ZTJA 2G81E 3AAUA 4K1SA 2WV9A 3D62A 2QXIA 1O2YA 3HGPA 2QF3A 4NWLA 4BAOB 3PO1C 4MTBA 1FUJA 4FVBA 2Y82A 2VWLA 4DGJA 5C5OA 1H9LB 3T28A 4Z1MD 2ZG0H 2O8UA 3KCGH 4Y8XA 1GCDA 1ZR0A 5DP8A 1D9IA 2VVCA 1V2VT 2IOTA 2FWWA 1HCGA 1BMLA 2BDYA 1VR1H 1IQLA 1ESTA 1PYTD 1AD8H 1A1RA 1YLDA 1TGCA 4ISLA 3RMNH 2ZFFH 5GJ4B 3WY8A 3TITA 4ZAEA 1SFIA 1CGJE 1C1TA 1V2QT 4I8HA 2BVRH 4GPGA 1C1RA 9ESTA 1C2GA 3GYMA 4A6LA 1NRRH 4U32A 2C8ZB 2PSXA 1P03A 3BEIB 1XUKA 2XCNA 2A7CA 2QYIA 3EGKH 4WH8A 1KDQA 3UQOA 5L6NH 2ZIQH 3GDVA 4WH6A 2VVVA 1P57B 3RDZA 4YTAA 1CT2E 2QF0A 1LKBA 2OC1A 1C4Y2 1D3PB 5A8ZA 1CGHA 5C17A 4CHAC 1K1OA 1TX6A 3SGAE 1M9UA 2WINI 1LQDB 3BTME 1LVBA 3ZZ9A 3ZZ8A 5EU8A 1UCYK 1IHSH 5F8ZA 3BG4C 2FP7B 5DG6A 4CBNA 2OINA 5ESBA 1NRQH 3ODDA 1NC6A 5DGJA 1MD8A 4IGDA 2Z9GA 1GCTC 1GBLA 3MO9A 1AFQC 1KXAA 4NIXA 2TIOA 1NU7B 4CH2B 5JBCS 3SNBA 3C27B 1D3QB 4MLFB 3HGNA 2NU1E 4LXBH 1ELTA 3OFND 5HM9A 1IQHA 1PQ8A 3R3GB 1O34A 5DP6A 2QXHA 2ZPSA 4UD9H 3BTGE 5C67A 1O33A 1BTZA 1O2KA 2HLDD 4E05H 4ABDA 1NN6A 3PROA 3A7VA 3TPIZ 1MBQA 2Q6FA 1T8OA 2O9QA 3P8NA 1T7CA 2J4IA 3ATMA 5A0BA 1UVUH 1DPOA 1E0FD 3B23B 1T31A 3PWCA 1MBMA 2BD5A 5DO4H 2BOHB 1QBOA 2TGTA 4JZDH 2BD2A 1SGIB 1S5SA 3QLPH 4NZQA 3QTVH 3Q00A 4ASUD 2A1DB 3MTYA 5J4SA 1WUNH 3MU4A 1TBRH 3LGUA 2FOFA 1G9IE 1GHXH 5E0GA 1NFYA 5E0HA 1MAXA 2GVFA 4I8JA 3UNRA 1BBRK 1C5OH 1E1QD 3HKJB 1D6WA 4TPYA 1GDUA 4GHTA 5A0CA 1SGCA 2ZFQH 2D2DA 1HAVA 3GOVB 1SL3A 3A85A 1BHXF 1SQTA 2A31A 2ZHDA 3RXHA 4KTSA 1ZOMA 1FXYA 1EPTA 1DS2E 1GHVH 1SOTA 1EX3A 4AB9A 3JZ2B 4MNYA 2BDGA 1UTJA 3TNTA 1AVGH 1VZQH 1OWKA 3A86A 1BTWA 1TONA 1O2PA 1ESBA 2HPQH 1C2HA 4WXIA 1UCYE 1RD3B 4ISNA 1YCPM 3SU6A 1BRAA 1KSNA 1VCQA 2BYAX 1UTMA 1RTKA 1AKSA 1FAXA 3SNDA 2A4QA 3RXUA 3BEUA 4JK6A 1XUFA 1WBGB 4AZ2B 4XE4A 5GDSH 2VGCB 1UK4A 2BD9A 1KXDA 5K7RA 4FU7A 4ISIH 4DW2U 1XX9A 2JH6D 1MZAA 1DE7H 3SORA 3GCTF 1BTXA 4CRAA 2BQ6B 1EXFA 1XM1A 5C20A 1GHAF 1Y5BT 1OYQA 2P8OB 3MU0A 1OKXA 4X1NU 3TIUA 2PKAB 1DUEA 1NRNH 1EJNA 3SO3A 2NU2E 2XW9A 6GCHF 1AZ8A 1KXFA 5DPAA 1ID5H 1ETSH 1GBCA 4CRCA 1EATA 2P3UB 2G5VA 4O9VA 3M7QA 3SU2A 1O2GH 1OWJA 2GGVB 1SG8B 2GCHF 3L3TA 3S9AA 5SGAE 1THRH 5AVDA 3GS9A 3URDA 4FUCA 2WHXA 3ZYDA 5CE1A 1C2DA 1CBWC 1PFXC 2F3CE 3U8RH 3VPKA 1W11U 1P11E 3TGJE 2AYWA 2A5IA 1WCZA 1A0JA 3PMAB 1SGQE 2J5UA 2Y7XA 1AB9C 1W2KH 2OD3B 3VGCB 1BBRE 3K6ZA 5F8XA 4ZROA 3SQHE 1CE5A 3RM0H 1UVOA 3ATIA 2ZDMA 2ZI2H 2ANYA 1FDPA 2LPRA 1O35A 1FONA 3PLBA 1C1OA 2ZWLH 3BTHE 4Y7AA 4A1TA 1MAYA 1MCVA 3ATWA 1GBJA 4H6TA 1SPJA 1EFRD 1BIOA 4I32A 4ISHH 5BRRE 2BOKA 2ZCLP 3S7HB 3S0NA 2QA9E 3SYJA 4JYVH 1ETTH 1PQ7A 2O8LA 2TPIZ 1GPZA 5FPYA 3SBKA 1PPZA 3TJOA 4CREA 2XBWA 5CDFE 3RXSA 1OYTH 2SGPE 2ZFSA 2ODYB 3BTWE 1GL0E 1YYY1 2G55A 4NWKA 1Y3VA 5F03A 1SGRE 1BBRH 1COWD 1OOKB 1TGTA 1YPHE 1LPGB 3A7TA 1FLEE 4DCDA 3OAAD 3QWCH 1K28D 2JH5D 1ZMNA 5DSFA 1ZRBA 2V35A 3KQBA 2BLOA 1ELFA 3FKSD 2ASUB 1Y3YA 1JIMA 3A8DA 4MG3A 3V0XA 4E7NA 1TRMA 5JDUB 2VIOA 4NFFA 1OSSA 2VWMA 1C9PA 3NPSA 1ZGIA 1Z8JB 2A7HA 1KLJH 1PPFE 2FOHA 3RXFA 3S9CA 2KR7A 1HB0B 1LPZB 4THNH 4WMFA 3PTNA 2ANKH 2OC8A 3SU0A 1Y5UT 2YOLA 1O30A 1DWDH 2ZF0H 2GD4B 2JJ2D 1V2PT 4K1EA 3T62A 3KNXA 1K9OE 1W10U 2I6SA 1GDNA 1G2MA 4AGJA 2W7SA 1CA0B 3LPRA 5C5NA 1P05A 3UWIA 1H8HD 1NTPA 1TFXA 1VCPA 2CJIA 3OTPA 3STIA 4B6FA 2ZC9H 2SNWA 3SI3H 3UR6A 4UFEH 2BX4A 4D7FA 4Y0YE 4Q7YA 2R0LA 4LZ1H 2VIWA 1C4U2 3CS0A 1GWAA 1JIRA 1GL1A 3EDXB 1GBAA 4NIYA 1GMDG 2CF8H 2BQ7B 1A4WH 1SLXB 1WQVH 1O3BA 2ALVA 1MTUA 1ZJDA 2FLRH 3G01A 1PPBH 1F0RA 3PRBA 1EZSC 4ZUHA 4JZFH 2R3YA 3FAOA 2ZFPH 1P2KA 2ZECA 1MTWA 1MTNB 4DVAU 1MQ6A 2P59A 3SN8A 1XVMA 1UK2A 1V2UT 4ZKOU 5EQQA 2FO9A 1YM0A 2H9TH 1UHBB 3NK8A 2VGCC 5FBEA 2BXTH 1ZPCA 2ZTZA 1HAIH 4AOQA 1HAGE 5DP5A 3RXPA 1A0HB 1XUGA 4F49A 2IPHA 1V2TT 7GCHF 1TOMH 2P8OC 3CP7A 2EI8A 2AGGX 1QJ7B 1K2I1 4MQAA 3DHKH 1HXFH 3F2HA 1E79D 1ELBA 2ILNA 5FXLA 1AWHB 3RM2H 1UO6A 1C2LA 1GI7B 2ANMH 4R8TB 1CSOE 1C5QA 1HXEH 1TALA 1GI8B 2C8XB 3A82A 3RXIA 5LGOA 1V2WT 1GI2A 3ZZCA 2ZPRA 2P16A 3U9AH 3SUEA 2W5EA 5LPRA 1DANH 2NWNA 1NZQH 2A4RA 1HUTH 1SGTA 1HJ9A 1RJXB 1ABIH 1AI8H 2R2WU 1HPGA 3UQVA 4H4FA 1BJVA 3N7DA 5GNDA 1Q31A 3UY9A 1JBUH 2K0QA 2TGDA 1O31A 9LPRA 3BV9B 3VGCC 1N8OB 1C2EA 2ANWA 1IHTH 2WYJA 2FYQA 1SGFG 3UNQA 3AAVA 1W3CA 2GZ9A 1YPGH 1YPKH 2VIDA 5EQSA 1RGQA 3ELAH 1AUTC 4Y71A 4SGBE 1P3EA 1DWEH 2Y81A