4I31A

Crystal structure of hcv ns3/ns4a protease complexed with compound 4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Molecular Mechanism by Which a Potent Hepatitis C Virus NS3-NS4A Protease Inhibitor Overcomes Emergence of Resistance.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i31A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4i31A01
2A2XH 2BY8X 3KL6A 2VVUA 1XUIA 2FOBA 2H9EH 1G3DA 3SU3A 3UWIA 2VIVA 1ZPBA 1TBZH 4U2WA 1DUAA 3MFJA 1HDTH 3NWUA 5C1YA 1CO7E 1KXDA 1OKXA 2CHAC 3LIWA 1EOJA 3MH4A 3UUZA 3FZZA 2AIQA 4O9VA 4Y8XA 2ZGHA 2Z9KA 1HLTH 1ZMNA 2W26A 2ZFFH 3E0PB 1C5UA 4FUIA 4FVDA 2Y7XA 1ARCA 1O5AB 4B74A 3S7HB 1YYY1 2F9PA 3MU1A 4X8SH 1EZQA 1EB2A 4K3JA 1E37B 2WUBA 1LHDH 3SNAA 4ZROA 8ESTE 1V2UT 4DJZB 1FMGA 1Y8TA 4D7FA 2ANKH 3QZQA 1BTYA 1OXGA 4FU8A 1FJSA 1TGSZ 1DM4B 1EPTA 1TMBH 3GDSA 1NTPA 3FVFB 3BEUA 1O2QA 1O33A 2V3HH 1GI4A 1CVWH 1ZJDA 1NM6A 5C67A 1RIWB 1AWHB 1VCPA 1EAWA 1ANEA 1NRQH 2TGPZ 4A92A 2FIRH 1WAYB 4K1TA 1TE0A 4IW4E 4Y8YA 3K9XB 1V2ST 1HB0B 1NT1A 2ZFTA 4WH8A 1B5GH 5EPYA 2V0BA 2ZHEH 1GBBA 1O2JA 2GX4A 2GMTC 4UFDH 1YGCH 4ABFA 2A2QH 2CHAB 1A3EH 2R2WU 3SU5A 2V3OH 5E0HA 4ZXYH 3DHKH 3P17H 5DP3A 3NCLA 5GWZA 1QJ7B 1TQ7B 5EQQA 1LKBA 4ISHH 1PQAA 3CENA 1GI5A 1N1LA 4YOIA 1HUTH 1LMWB 1P02A 2OUAA 4I33A 1PFXC 1O5GH 1SGPE 4JZDH 1HAIH 3BTTE 3VGCC 3U1JB 3GY2A 2ZC9H 4B2CA 1C2DA 1ORFA 1G30B 4IC6A 1IAUA 4WWYA 5A8YA 2PTCE 5BPEA 3MNXA 4R8TB 3QDZB 1DS2E 2CXVA 1ZPCA 3ODFA 1GI6A 5DP6A 2G51A 2OXSA 3RXDA 4OGYA 4MTBA 3GCNA 3EGKH 4PROA 5GXPA 4ABEA 1TA6A 3F9GA 1C9TA 2GDDA 3U8TH 1YPHE 1HPGA 4LZ1H 1TQ0B 2GMTB 1GJDB 3T29A 3SW2B 4IMQA 4LXBH 1L4DA 4AB8A 2WYGA 1TRMA 2Y6TA 2BYAX 2GT7A 3OU0A 1SOTA 1YLDA 1EP5A 5E0GA 1BTWA 1ELTA 4WMDA 1Q3XA 1MCVA 1W3CA 2ZU4A 1ETTH 1PQ7A 2GP9B 1DE7H 1TNKA 1MQ6A 4ZHAA 5TCAA 2PWXA 3DFJA 2JH6D 4WY3A 1QQ4A 4FU7A 3VGCB 3ELAH 1NPMA 1YCPM 3TGJE 1ZMJA 1O2SA 1TMUH 5FBEA 4FUDA 4E06H 4B76A 3OSYA 3IWMA 5GNDA 1RTKA 2VIWA 3SZEA 2J2UA 1TGTA 1C5YB 2BVSH 2Z9IA 1OP2A 1W7GH 1WU1A 1EUFA 1QRWA 2A7JA 1Y59T 1DXPA 1QFKH 1S0RA 3GY8A 2QY0B 1FPHH 2FP7B 1CE5A 6LPRA 5A8XA 1FN8A 4YLQH 5EQRA 1OYTH 3EA7A 4J1YA 1TAWA 2J4IA 2O8MA 3TJNA 5LPRA 1L1GA 2XNIA 1IHSH 3TNTA 3U69H 4YESB 1AUJA 1CGIE 4X2VA 1GI3A 2A31A 2TBSA 2FOAA 1SL3A 4Y8ZA 4ESTE 3ZZ9A 3A7VA 1KIGH 2BD9A 1NFWA 3RC4A 1NFXA 1GBDA 1O3IA 1EATA 4ABJA 5JDUB 5CHAB 4A1TA 1SLWB 1OX1A 1GMCG 3RXUA 2C3SA 1D6WA 2P3TB 1G9IE 4XBCA 4NZLA 1ZR0A 2BDCA 2ZU3A 3S69A 4JZIA 4O3UA 2ZU1A 1ZZZA 2THFB 1HAOH 1PPHE 5A2MH 3PTBA 2CGAA 3A7WA 5A09A 3ZVGA 2ZTXA 4X1RU 3KEEA 4GHTA 3RXTA 1AB9C 1ABJH 4YZUA 4SGAE 4BTUB 1C5OH 1EB1H 2WPHS 1H1BA 1P9SA 4Y6DA 1GL1A 4ZH8A 3QUMP 1SSXA 3OY5U 1GJCB 1PQ8A 2R3YA 3M5OA 6GCHF 3QK1A 1P2OA 1V2QT 1SC8U 1XUKA 3ESTA 1HAPH 4MLFB 3Q3YA 2QN5T 5EW2H 2H1UA 3S9CA 4UFGH 1HJ9A 1K1PA 5CE1A 1RD3B 5FPTA 1GBAA 1KLJH 5IDKA 1XKAC 2NWNA 3TK6A 3MH7A 4ZAEA 1TNLA 2CJIA 4HTCH 2FDAA 1EZUC 1LPGB 3MI4A 1FIZA 1O3AA 2SNVA 3ZVBA 1BTPA 2Z9LA 3M61U 1OSSA 3SJ8A 2FOFA 1O2WA 3A8BA 2GVFA 2AMPA 2KAIA 1SLVB 1YPHC 1QHRB 3Q3XA 4IMZA 1A3BH 2ZGXH 4DCDA 5JBAS 3MU0A 2W7SA 2EEKA 3RM2H 3P95A 1K28D 1AZZA 1GVZA 1RGQA 3STIA 3SUFA 2D1JA 1SR5C 5EGMA 1F92A 1O3LA 5L6NH 1GHAG 1LQEA 5LH8A 1JWTA 1HJ8A 4DURA 4X2XA 5GCHF 1DDJA 3ENSB 4XE4A 1O2KA 3N7OA 1QNJA 1IQNA 3RU4D 4CR9A 1O34A 4VGCC 4NIYA 1KXBA 2ZIQH 3RXHA 2OQ5A 2OP9A 2Z6BD 2G00A 2FOHA 1GHXH 1GJ4H 2A4OA 2B9LA 2VH6A 3HATH 3QO6A 5A0CA 1N6XA 2PFEA 2AS9A 1NU9A 1O5DH 4A5TS 3SV8A 3A8DA 2ZFQH 2H6MA 1NFUA 3QWCH 3SI3H 2CN0H 3VB3A 5AFYH 1C5WB 3ZZDA 1ESAA 4OM9A 1FXYA 1V2RT 1E35B 3E16B 3UR6A 1DICA 2BX4A 2I6SA 3P8OA 5C5NA 2EI6A 2BVXH 2H9HA 2WPJS 3A7ZA 1A0HB 4CH8B 1AUTC 1MU8B 1WQSA 1SHHB 1CU1A 1F2SE 3PMAB 1O32A 1O2PA 2F91A 1P01A 2VWNA 4JK5A 4O3TA 3QLPH 1D3PB 1WBGB 3CS0A 1HJAB 1P0SH 4IN1A 3LPRA 1ZRKA 1BZXE 3PM3A 5SGAE 1WYKA 2ZPQA 2SGQE 1F0TA 3ATLA 3HPTB 4E7RG 2XRCA 1KDQA 4I8HA 4VGCB 3I77A 2QIQA 1F0SA 3F9FA 1NN6A 2XWAA 3ATIA 3WY8A 4DOQA 6CHAC 4K2YA 1GBIA 2FMJA 4WMEA 2H2ZA 4Y71A 3VPKA 2IN2A 2VBCA 1O5EH 7KMEH 1J16A 1O3EA 3RM0H 3ZYEA 4NIWA 1QBNA 1GJ8B 1BT7A 2XXLA 1F5KU 4BXWA 1TNHA 3ZVCA 2GT8A 3L33A 1WXRA 4I8GA 1ZSLA 1HRTH 1JRSA 3VB5A 4Y7BA 3BG8A 1C2KA 3LGTA 4AYYB 4GVUA 1UJ1A 5ABWA 2Z9GA 2DE9A 4NIVA 3RXOA 2O8TA 1AGJA 3T62A 3BG4C 3ZVAA 1QB6A 1H8DH 3MO9A 2YNAA 5F8TA 1HFDA 1RXPA 1GBKA 2BDBA 4AFQA 4NZQA 1W8BH 1P03A 7ESTE 3P6ZB 1FPCH 1IQJA 3BTFE 2QXGA 5CMXH 4GHQA 2GDEH 4UE7H 2W3IA 1C1OA 3TU7H 4AZ2B 1ELGA 1G32B 1NS3A 2QF3A 3P8FA 2HRVA 2WZQA 4BXSA 1LHFH 2ZI2H 8GCHF 1SFQB 1HAGE 5I46H 3RXFA 1K21H 3MHWU 1ELDE 6CHAB 4ISLA 2VU8E 2P93A 1W0YH 2AH4X 1CGHA 2Y5FA 1L1NA 3RXVA 3PWCA 1K1IA 1RRKA 3RXIA 2BY6X 1KTSB 2BTCE 4MNYA 1O3OA 1S85A 5J4QA 3E91A 3PO1B 2CF9H 1GBEA 1FAXA 2B5TB 4DVAU 2BDYA 1KYNA 1CHOG 1AFQC 2BXUH 1VCQA 3BTGE 4Y79A 2HGTH 4JCNA 4I8LA 1K1LA 1TNIA 3HK6B 2VH0A 2A45B 3GCHC 2WV9A 1XKBC 2BMGB 3K65B 1IQLA 1WUNH 4MPVA 4Y10E 2V35A 2GCTC 3DT0H 1P2IA 1ZHMA 1QURH 3LONA 2P16A 2G81E 1TGBA 7LPRA 4ZKNU 2J95A 3UREA 3P92A 5JYIA 2A4QA 4CRAA 4J2YB 2C8ZB 2AYWA 4JYTA 4U01A 5LPFA 5FBIA 3FP8E 3GY4A 1TRYA 3SNEA 1ETSH 3PLBA 1C2EA 1QTFA 3U98H 3AK5A 1BHXB 1E36B 1L0ZA 2XC5A 1XMNB 2AEIH 1P04A 4BTTB 5FCKA 1A0LA 2JETC 1Y5UT 2UWPA 3ZVFA 3T28A 2BOHB 4BAHB 1HAVA 3UOPA 4AGKA 1GI9B 2Y5GA 5EOKA 1AFQB 1TPAE 1DSTA 1O5FH 4X8TH 2TRMA 1PYTC 3GCHB 2OD3B 1ID5H 2BOKA 4HI3A 1H9HE 1A0JA 3EQ0H 5TCCA 3LT3A 1FZZA 3OYPA 1DLEA 2FXRA 4ABHA 3EAJA 2F9VA 3D23A 1OP8A 3EE0B 1GBLA 3ODDA 4X8VH 3ZZ4A 2OBOA 1P11E 3UNRA 1RFNA 1V2LT 2YOLA 3ZV9A 2R3UA 3SU6A 4K8YA 1DWEH 4NFFA 3M3VA 4JK6A 4K1SA 2XBWA 4OS7A 4ABGA 3LH1A 3UWJH 4RI0A 1QCPA 2PSYA 2A4GA 4ABIA 2ZCLP 1P09A 2J92A 5F6MA 3B9FH 1TYNA 1O37A 1IQEA 1QRZA 1GGDC 1HAXB 3BTHE 1J14A 3BTKE 3HK3B 2W7UA 1ABIH 1V2PT 3DFLA 1KY9A 3VB6A 1Y3WA 1ZSKA 4ABBA 2JETB 1GHZA 1C5LH 5EW1H 3M5LA 2ZEBA 3ZZCA 1DUEA 3O8DA 4X6NA 3TH3H 1HXEH 2I6QA 2ULLA 3SJKA 4IBLH 1J8AA 3PMJA 2GZ8A 1C1RA 1UO6A 1WV7H 2UUJB 4DG4A 1GI2A 3C1KA 1SGIB 2B0FA 1P3EA 4I8KA 2F9OA 4X2YA 4A1VA 4AFUA 3VB4A 1SGFA 1P9UA 1TB6H 1ZTLA 2Y81A 1L2EA 1P2JA 2G4UA 2A4RA 3GY5A 3LC5A 2V6NA 3JZ1B 2JKHA 1EP6A 3BEIB 1ANDA 1BOQA 4X1SU 1QL8A 2WV4A 2STAE 4BAOB 3EYDA 5FPSA 1AVXA 2UUKB 1O2HA 3DA9B 4XOJA 1QA7A 4AGJA 6ESTA 1OOKB 1E34B 2AFQB 4CRDA 3QZRA 1YKTA 1UCYE 2A5AA 4KELA 2FI5E 3SQEE 1NC6A 4X0WU 1ZRBA 1C5ZB 2FOCA 1GGDB 3V12A 1GI8B 2J38A 1P2KA 2JH5D 2ZDVH 9ESTA 1YLCA 2A7HA 1EZXC 4GCHF 2ZWLH 1IQHA 1A5GH 1SQAA 4DGJA 5E8EH 1ZLRA 3A7YA 3KHVA 1DXWA 3SU0A 5DKMA 2SGAA 2QGRA 1YPEH 2ZHWH 2BLQA 1GJ9B 1FV9A 2P94A 4Y11E 3A7TA 3SGQE 5JB8S 3QTVH 1YPMH 4NGAH 5H4IB 1TA2A 1VGCC 2WPKS 4X2WA 3RMNH 4OS5A 4BAKB 1K1NA 4MPXA 2HPQH 4CBOA 1P10A 1S84A 1NFYA 1BTUA 1AQ7A 1MTNC 1GVLA 1MTUA 4A1XA 5A0AE 4UEHH 1DVAH 1ARBA 3A89A 1LHCH 1QA0A 3LOXA 3MOCA 4XDEA 1SB1H 2XBXA 3MMGA 4K60A 2XBVA 1KXAA 1TGCA 1SGTA 4E05H 3GDVA 3GY7A 3PYHA 2HNTE 2W3KA 2C8YB 3KQDA 3P70B 3ATMA 5AFZH 3F6UH 2FTMA 3UNSA 2EC9H 1S0QA 1CT2E 2ZDMA 1AHTH 3KIDU 4NA7A 2HOBA 1WOFA 2HLCA 2GD4B 2XCFA 5EG4A 2ZHQH 4MNVA 2DUCA 2ZQ2A 1NY22 3MWIU 5C3NA 1VZQH 1YCPK 4KKDA 4AB9A 4F4OC 1DANH 3M36A 2QXIA 1AMHA 1VGCB 1PQ5A 2BDIA 3MU5A 2D26C 4DY7B 2ZU5A 1BRUP 3K6ZA 1C1WH 4NA8A 1GL0E 4O03A 1MTNB 3SI4H 1SI5H 1SVPA 2A7CA 2VNTA 2UWLA 5AHGH 1D9IA 2XCNA 2FWWA 3TJOA 1WTGH 5T1VA 5CHAC 4IN2A 3S9BA 1NRSH 2VIDA 3RMOH 1EPTC 2ZQ1A 1O2OA 4WMFA 5K7RA 5E2OA 4INLA 1ELCA 4OS2A 1Y3XA 1TRNA 1LKAA 1D3TB 1X7AC 4WF8A 3TK5A 2PW8H 1HAYB 1AO5A 1SGYE 2ZHFH 1J17T 2Z94A 2G5NA 3BTDE 5IYTA 4D7GA 6GCHG 1GJBB 4DT7B 1MU6B 2PUQH 1IQIA 1AU8A 4TY6A 3A85A 3DUXH 1GMHF 2PGQB 2F83A 3FP6E 1C5QA 4X6OA 1ZTJA 3M3TA 1J15A 3U9AH 3LU9B 3ZV8A 2AIPA 1QJ1B 2J94A 4AFSA 3KQBA 1CSOE 2FX4A 4WXVA 3MO6A 3ATKA 1TBRH 5FX5A 4MVNA 4XBBA 3PTNA 2FZZA 1GI1A 1BBRH 1SMFE 2ZGJA 4GPGA 1UTJA 1FN6A 2QV1A 8LPRA 1EPTB 1EQ9A 2ZP0H 3SUDA 1AFEH 1HNEE 3I78A 1P2QA 3URCA 4I7YH 4X6MA 3QGJA 1C2MA 3TGIE 2RG3A 5LPEA 1XVOA 1O30A 2PKSC 2XYAA 1MMJN 3EDXB 4IC5A 1GBCA 5GCHG 2WPIS 3SOSA 1KLIH 1BMLA 1VITF 1WTHD 3U8OH 4FUCA 4NA9H 5HYOA 2C90B 2CF8H 4K5ZA 1C4U2 2NU0E 1OWDA 1NZQH 1ZHRA 1GCTB 1RJXB 5T6GA 1C5PA 2BZAA 2Q6FA 4TY7A 1K1JA 1V3XA 5K0HA 1G3CA 1P57B 1NROH 4DIHH 4B6FA 1E0FD 5C1XA 4FUGA 1DWCH 2M5TA 2ZDAH 1ELFA 4OS4A 1JIRA 5GJ4B 1BQYA 1Z8GA 1MTSA 3PV4A 1ELVA 1MKWK 1C2IA 1MH0A 4F49A 3Q3KA 3SQHE 3H09A 1CT4E 1AN1E 1JBUH 5DP4A 3D62A 2NU1E 5C20A 2ZKSA 1QRXA 2HNTC 1YPJH 2ALVA 2BX3A 3M35A 4YOGA 2PKSB 3TJVA 1MAXA 1B0FA 3IG6B 1GHVH 2BDHA 1DWBH 1C2FA 5A8ZA 4NIXA 1C5MD 1C1VH 1GJ6A 3B23B 2IJOB 1HJAC 4NCYA 3STJA 1O36A 1MBQA 1V2KT 2A5IA 1DFPA 3AASA 3PWBA 1EASA 2OBQA 3R0FA 1THSH 2F9NA 5C2ZA 3TH4H 1S81A 3KNXA 4JZFH 4MNXA 4D76A 1PJPA 3HGPA 4A7IB 1Z8JB 3TLOA 1AKSA 1K22H 1MD8A 2ZA5A 3A81A 3QN7A 3W95A 2ALPA 4NG9H 3V13A 1UHBA 3FANA 2SFAA 3ITIA 2BLWA 1O3MA 2SNWA 4LK4A 4H6TA 3K6YA 3RMLH 3RLYH 1V2NT 3ZZBA 2ILNA 2K1QA 2FI3E 1O3CA 1O2XA 3FZDA 2FEQH 4XBDA 3SHCH 1S82A 5EPNA 4IS5A 2A32A 1EAIA 2DE8A 3RU4T 1C2JA 1UK3A 1E38B 1HYLA 4AN7A 2BD8A 5JBBS 5LGOA 1T31A 2WPMS 1O3JA 3EA9A 3KQEA 4Q7YA 1QJ6B 8GCHG 2Q1JA 1O2VA 1TABE 2ESTE 3GISB 3RU4E 1H9IE 1XUHA 3GCOA 3GICB 1A1RA 2BDGA 3RXBA 1SGNE 1BJVA 1PPEE 3SORA 2G5VA 2GZ9A 1YBWA 1Y5AT 1QL7A 2XC0A 4ASHA 1HIAA 1Y5BT 4HZHA 4ZHMU 1YCPH 3SUEA 2F4LA 3SYJA 2ZGBH 3AVZA 1ELEE 2TIOA 3ZZ7A 1BRAA 3SV7A 2PKAA 2PSXA 1OWHA 4AFZA 2EI8A 3PO1C 1UVTH 4RKJB 1C5XB 4BOHA 2ZZUH 1CT0E 1TOMH 5B6LA 2G8TA 1GDUA 3PV2A 5E0JA 2VWOA 5HXFA 1SPJA 1MBMA 2AMDA 2O8WA 3MNCA 1GWAA 1QB9A 1TALA 2QXHA 3QX5H 2PHBA 3TNSA 3TGKE 1THPB 1OP0A 1GG6C 4TPIZ 1YM0A 1ESBA 1FY4A 2R2MB 2BY7X 2XBYA 1DT2A 1PPFE 1ZGVA 4CR5A 4BAQB 3D65E 1CA0B 1GBMA 2D8WA 1O2IA 4HGCA 3SGBE 3DD2H 1XXFA 1F0UA 3P8NA 3RXPA 4YT7H 1C2LA 2ZPSA 1O3GA 4ZKSU 1O2ZA 1T4UH 5F03A 2BD3A 4AG1A 3M7UA 1EXFA 3UPEA 3Q00A 1VITH 1GHBF 3ZZ3A 3A82A 3NZIA 1SGRE 3GCTF 1UVUH 3ZZ6A 3ZZ5A 1EOLA 1C1QA 1EJMA 3RMMH 1Q2WA 1Z1JA 1V2VT 5DP9A 1W0ZU 4B1TA 4Y76A 1LCYA 1C2GA 2R0KA 3LGVA 1QB1A 4ZUHA 1TMTH 1BHXF 1ACBE 1H8IH 3A8AA 2KAIB 4QT8C 2J9NA 4CREA 1YPLH 1FLEE 1F5LA 4YLUA 1GDNA 1O38A 4YTAA 3TIUA 5JB9S 1FDPA 1GG6B 4Y0ZE 1VJAU 1TGNA 1OS8A 5JPMH 1Z7KA 4WH6A 2FOGA 5FCRA 1BIOA 2ZECA 3MNSA 1VJ9U 4YO9A 4UFFH 2FTLE 2XC4A 1W2KH 2FOEA 3Q77A 4D8NA 4K1EA 3VEQB 1GMDF 3F68H 3RXKA 1UMAH 1C1TA 1L4ZA 1T32A 2SGDE 1D6RA 2Y80A 4CHAC 3BN9A 3SV9A 4JYVH 2GV6A 4NWLA 3H7TA 1JOUB 3RXQA 4R0IA 3M5NA 4FUFA 4GLYA 3SJ9A 2ANMH 7GCHF 1GI7B 1XM1A 3M7TA 4TWWA 2FPZA 3T5FH 1MKWH 2FLRH 1TNJA 1G2LA 5EXNA 5JBCS 4LOYH 5J4SA 1VCWA 3BEFB 3VXFH 1ZSJA 1KSNA 1ELAA 4ISIH 1SG8B 1K9OE 4U32A 3VB7A 1XVMA 1ESTA 1BBRK 3BF6H 3RUOA 3KF2A 3RXCA 1Z6JH 1DLKB 2RA3A 2BHGA 1GDQA 2BQ7B 1A4WH 2C4FH 4KTCA 2YNBA 2Q6GA 1H9LB 3D49H 2VIOA 4IGDA 1KDQB 1ZYOA 4Z6AH 1CQQA 2ZGCA 4FU9A 5DP8A 2P59A 1F7ZA 1P05A 1P3CA 4JYUH 2OC0A 4GCHG 1QQUA 3BTQE 4CHAB 1GHWH 3L3TA 2QCYA 2FO9A 1P12E 3AAVA 1BMMH 2VGCB 5DG6A 2P3UB 3E0NB 3I29A 2GCHF 2QAAA 1DWDH 1QBVH 3AW1A 3GDUA 3UTUH 3QGNB 2ODQA 1PPGE 1O3KA 2ZDLA 3R3GB 1V2JT 3OTJE 1FNIA 2ZNKH 2HPPH 1TX7A 2EA3A 1C2HA 2BLOA 1FIWA 1K1MA 3A87A 1AE5A 3TK9A 1IQMA 3S7KB 3T2NA 4DIIH 2XTTB 1THRH 2ZFRH 5AF9H 1GBJA 1BB0B 3LGIA 4CRGA 4ZHLU 3LJOA 9LPRA 3SV6A 1CA8B 1AVWA 4K69A 1MUEB 1YPGH 3ZVDA 4OS1A 2F9UA 2O8UA 3SU1A 2GGVB 1HAZB 3F9EA 4NWKA 1AD8H 1LPZB 1QY6A 2RCEA 1G3EA 4UFEH 2FESH 3CS7A 5ETXA 3OY6U 3NPSA 4BTIB 1TFXA 2B8OH 1FAKH 4UONA 3B8JA 4E7NA 3A83A 4WXIA 4LZ4B 1JIMA 5FAHA 2WHXA 2W5EA 1XUGA 3MO3A 1ELBA 3SU4A 4FUHA 5F8XA 1ZHPA 1SGFG 1MCTA 2BD2A 2P3FH 2R9PA 2RDLA 2QA9E 3ATWA 3GOVB 3A7XA 4B2BA 3SUGA 5DK1A 2ZFSA 1YP9A 2GKVE 1TPOA 1O3FA 4KTUA 2C93B 1OWEA 2CMYA 1O2GH 3KN2A 1SGCA 1Q31A 1MZAA 1W7XH 3ZYDA 5T6FA 1BJUA 1Y3UA 4ISNA 1UK4A 4M7GA 4BNRA 3LKWA 4Q2KA 5T6DA 1SQTA 4DW2U 2P8OB 3V3MA 4XSKU 1GJ7B 3HGNA 4OGXA 2O8LA 4Y7AA 1C4V2 2Z9JA 3H5CB 1QIXB 2FS8A 2C8XB 2AMQA 1BMNH 1JXPA 4H4FA 2AGEX 4Z0KA 2TGAA 2VWLA 2Q6DA 4WJG2 3AW0A 1GJ5H 1BTHH 1SLUB 2FOMB 2C8WB 4U30A 5B6OA 4XFQA 2FYRA 2G52A 1TX6A 1EZSC 2H5CA 1BCUH 1GMHG 2HVXA 4JZEH 4MQAA 3M5MA 3SJIA 4OS6A 2OQUA 4AOQA 1DITH 2XWBI 2BD7A 1UTMA 3TPIZ 4GAWA 3K2UA 3OX7U 1ZMLA 3MNBA 2Y7ZA 1O2LA 2A1DB 3LGUA 4A6LA 1HAVB 1ZOMA 1T8OA 5GPIB 4KP0A 3A88A 1O3HA 1UTOA 1ZGIA 1BITA 2SGEE 2PUXB 1GJAB 3RDZA 2EI7A 2Z7FE 3BIUH 1A5HA 1TPSA 1SFIA 1P2MA 4CRFA 1O35A 5A0BA 1TONA 1ZTKA 1QBOA 2IJD1 1PPCE 4Y0YE 3GY3A 1LTOA 1HBTH 3A86A 5DO4H 1MD7A 2IPHA 2ZCHP 1VITG 2ZFPH 1LHGH 3M7QA 3SHAH 3UY9A 1Z8RA 3S9AA 1BRBE 4K8BA 3ZVEA 1IQKA 4H6SB 3SN8A 1BTXA 2WPLS 3MU4A 2ODYB 2FI4E 1A2CH 2OK5A 3UR9A 3RXAA 3PB1E 3GY6A 2STBE 4RKOB 1L1JA 4JMYA 4ABDA 2FLBH 2LPRA 1UCYK 1CGJE 2SGPE 1G3BA 1GCTC 1PPBH 1O31A 1HCGA 1P2NA 1BTZA 1HGTH 1TWXB 3O8BA 1MKXK 4YM9A 1DY8A 1S5SA 3GYMA 3A8CA 4NFEA 2R0LA 3F9HA 3GYLB 1UTKA 4FUEA 3ZZ8A 3HKIB 1KXFA 1Y3VA 1FQ3A 5AVDA 1MQ5A 5L2ZH 2XW9A 1YPKH 3M37A 1LHEH 1S6FA 1W14U 1AVGH 2BD5A 5DJ7A 1LVMA 1AWFH 3SNBA 4X1QU 2OC8A 3CP7A 2PGBB 1O2MA 2H9TH 2WV5A 1SGDE 1C1UH 2BB4A 4INKA 5EU8A 4BANB 4X6PA 3LJJA 1D3DB 4SGBE 1EJAA 1A7SA 3UNQA 1A61H 1D4PB 1G2MA 5EQSA 4ISOA 3IITA 2ANYA 4RSPA 1SBWA 2FS9A 2ANWA 5EXLA 2PR3A 1O3DA 2ODPA 1XX9A 5T3HA 1IQGA 2B7DH 3A84A 1VR1H 1NO9H 1ETRH 4Q7ZA 3VXEH 3JZ2B 1EAUA 1XXDA 5BRRE 1T4VH 3U8RH 1KXEA 4INHA 2Z3DA 1BUIA 3BTWE 2QF0A 5EXMA 1UVPA 2OINA 1N6YA 3T26A 4ABAA 3LC3A 1A46H 1FY3A 1T7CA 1HXFH 2PV9B 1KTTB 1NRNH 1C1PA 4YOJA 1C1MA 1EX3A 1AY6H 4HFPB 2VIQA 4B6EA 8KME2 4FUJA 1EJNA 3RP2A 1F5RA 1F0RA 1JRTA 1UTLM 3E3TA 2BM2A 2BZ6H 4AORA 1GBFA 3QTOH 1LVOA 1TIOA 4H42U 2VJ1A 1EKBB 3PLPA 1MTWA 3SV2H 2HNTF 2J34A 2A0QB 2ZCKP 4O97A 4TWYA 3U1IB 4NSYA 2LNCA 1QL9A 5L2YH 3LGYA 1D3QB 3NUMA 3UOUA 2ZPRA 5ESBA 3MH6A 2OC1A 1W11U 1FY5A 1EAXA 3RXLA 1T8NA 4ZMAH 2WYJA 3E1XB 1Z6EA 1GMCF 3RXMA 1GVKB 3Q76A 2OTVA 1Y3YA 2HALA 3S0NA 5GIBA 4Q80A 2AERH 1AZ8A 1AB9B 1P8VC 5GDSH 5ESTE 1DPOA 2VINA 4GUXA 3NXPA 1V2TT 2ZDNA 2H5DA 4MPWA 3MH5A 1W12U 2WUCA 4B71A 2TPIZ 1PYTD 4FUBA 5C5OA 4B2AA 4I31A 1NU7B 1DX5M 1LVBA 4MNWA 1IOEA 5HM2A 3RC6A 1GHYH 4TPYA 1UTNA 1KLTA 1OPHB 1O2TA 5E2PA 3SBKA 1W13U 2QXJA 4ZKOU 3PROA 5DP5A 1C1NA 1TLDA 2Y5HA 4UDWH 5EODA 1TX8A 1TNGA 2BD4A 1MAYA 3URDA 3UQVA 1BDAA 3UQOA 2P95A 2JH0D 1SGQE 4YT6H 1SHYA 1CA0C 5FXLA 1AIXH 1C9PA 1GHBG 3SZNA 3T27A 1C5TA 1NRPH 1O3NA 2UUFB 2ZO3H 3GCTG 3V0XA 4ZKRU 3E6PH 3P8GA 1Z71A 2BY9X 1H4WA 1ZPZA 4AYVB 1UK2A 3V7TA 4Q7XA 3FAOA 2ZTYA 3SGAE 1LQDB 3BSQA 2NU3E 1V2OT 2SGFE 3FFGA 3LGWA 4TYDA 4AG2A 3L6PA 4ZXXH 5JBTA 1V2MT 3MU8A 1GHAF 1FI8A 1UTQA 1B7XB 2BY5X 2VB0A 3BIVH 1OWJA 3LH3A 2GV7A 1S6HA 1SLXB 2ZG0H 1C5NH 1T8LA 1RTFB 2RA0A 4X1PU 1DSUA 1O39A 1SQOA 1LPKB 1GMDG 1O5CB 2UUYA 3H7OA 2VVVA 1U6QA 1CBWC 1YC0A 3NKKA 2OCVB 3LDXH 1M9UA 1V6DA 1NESE 5C1UA 1G36A 1P06A 2AGGX 1BBRE 1N8OC 1WSSH 2QYIA 1O3PB 2Z3EA 4I32A 3RXGA 3T25A 1RTLA 2VWMA 1O2RA 2GZ7A 3MTYA 3SO3A 2ZTZA 1UCYH 2ZDKA 3O8CA 1DY9A 1LVYA 5DPAA 5HMAA 3ZZAA 7GCHG 4FVBA 1MKXH 2QC2A 1HV7A 5DP7A 4CH2B 1GBHA 4X8UH 4AX9H 5HGGA 4D9RA 1GBTA 4RN6A 4GSOA 1C4Y2 4X1NU 3TITA 2A5KA 4KTSA 2BXTH 3F1SB 2OC7A 5DGJA 1O3BA 1HAHH 5HM9A 3TH2H 1LDTT 3UIRA 4CRBA 3RXJA 5TJXA 2F9BH 2G4TA 3VFEA 1JMOH 2VVCA 1NRRH 2VIPA 2F3CE 2BQ6B 1A5IA 1OWKA 1CBWB 1FY8E 5FHTA 3KQCA 3W94A 1V2WT 2TGTA 3M3SA 3G01A 2HWLB 1GCDA 2FM2A 3KCGH 1N8OB 3MYWA 4B75A 1K2I1 1LO6A 3OTPA 1RS0A 2CV3A 1SGEE 2Z3CA 3SNCA 1O2YA 1INCA 5I25A 1TBQH 3BTEE 3NK8A 4NSVA 3E8LA 5F8ZA 2GCHG 1OWIA 3HKJB 1AKSB 1C5SA 4MDSA 1O5BB 2NU2E 3PMHB 1T8MA 3BG4B 3BV9B 4I8JA 1G37A 3RXRA 2BLVA 1GI0A 2TGDA 2ZF0H 4FXGH 1UHBB 2VGCC 3SU2A 1C5VA 4BAMB 1FUJA 1GPZA 4M9FA 2BDAA 1PPZA 1BA8B 1BRCE 3PV5A 1QR3E 1BMAA 1UVSH 1AE8H 1KXCA 1Z8IB 1K1OA 1IQFA 1S83A 4D9QA 5PTPA 1SOZA 1ZJKA 2OLGA 4B73A 4KGAA 3RC5A 1XUJA 3RLWH 1W10U 1OYQA 3C27B 2ZHDA 2FX6A 1IHTH 5FPYA 3RXSA 1ANCA 1O0DH 2AGIX 4UD9H 1Z1IA 4THNH 4WVPE 4MG3A 3KGPA 4JZ1A 1MZDA 1WQVH 2IOTA 1XUFA 1QGFA 1TOCB 2FYQA 2ZU2A 3UFAA 1CHGA 4MPUA 2NU4E 2D2DA 1HIAB 3EA8A 2BQWB 2FODA 4CBNA 2GCTB 1CHOF 1O2NA 3FP7E 1ANBA 1UVOA 2PKAB 5G4BA 4CRCA 2UWOA 2GTBA 3TVJB 1YF4A 5L30H 2PTNA 3BTME 2Y82A 2WINI 1C5RA 3E90B 3SNDA 2ASUB 3PMBB 1FY1A 1DOJA 1AI8H 3PLKA 3RXEA 2G55A 3A80A 3AAUA 2PLXA 1B0EA 1MTVA 1WCZA 1C1SA 1FONA 3O8RA 2BVRH 3SJOA 5FX6A 1TPPA 2O9QA 2P8OC 3TJUA 1UTPA 1J9CH 1RIWC 1O2UA
chains in the Genus database with same CATH superfamily
2A2XH 2BY8X 3KL6A 2VVUA 1XUIA 2FOBA 2H9EH 1G3DA 3SU3A 3UWIA 2VIVA 1ZPBA 1TBZH 4U2WA 1DUAA 3MFJA 1HDTH 3NWUA 5C1YA 1CO7E 1KXDA 1OKXA 2KR7A 2CHAC 3LIWA 1EOJA 3MH4A 3UUZA 3FZZA 2AIQA 4O9VA 4Y8XA 2ZGHA 2Z9KA 1HLTH 1ZMNA 2W26A 2ZFFH 3E0PB 1C5UA 4FUIA 4FVDA 2Y7XA 3FKSD 1ARCA 1O5AB 4B74A 3S7HB 1YYY1 2F9PA 3MU1A 4X8SH 1EZQA 1EB2A 2GJGA 4K3JA 1E37B 2WUBA 1LHDH 3SNAA 4ZROA 8ESTE 1V2UT 4DJZB 1FMGA 1Y8TA 4D7FA 2ANKH 3FOAA 3QZQA 1BTYA 1OXGA 4FU8A 1FJSA 1TGSZ 1DM4B 1EPTA 1TMBH 3GDSA 1NTPA 3FVFB 5EJZA 3BEUA 1O2QA 1O33A 2V3HH 1GI4A 1CVWH 1ZJDA 1NM6A 5C67A 1RIWB 1AWHB 1VCPA 1EAWA 1H8HD 1ANEA 1NRQH 2TGPZ 4A92A 2FIRH 1WAYB 4K1TA 1TE0A 4IW4E 4Y8YA 3K9XB 1V2ST 1HB0B 1NT1A 2ZFTA 4WH8A 1B5GH 5EPYA 2V0BA 2ZHEH 1GBBA 1O2JA 2GX4A 2GMTC 4UFDH 1YGCH 4ABFA 2A2QH 2CHAB 1A3EH 2R2WU 3SU5A 2V3OH 5E0HA 4ZXYH 3DHKH 3P17H 3DSGA 5DP3A 3NCLA 5GWZA 1QJ7B 1TQ7B 5KECA 5EQQA 1LKBA 4ISHH 1PQAA 3CENA 1GI5A 1N1LA 4YOIA 1HUTH 1LMWB 1P02A 2OUAA 4I33A 1PFXC 1O5GH 1SGPE 4JZDH 1HAIH 3BTTE 3VGCC 3U1JB 3GY2A 2ZC9H 4B2CA 1C2DA 1ORFA 1G30B 4IC6A 1IAUA 4WWYA 5A8YA 2PTCE 5BPEA 3MNXA 4R8TB 3QDZB 1DS2E 2CXVA 1ZPCA 3ODFA 1GI6A 5DP6A 2G51A 2OXSA 3RXDA 4OGYA 4MTBA 2JDID 3GCNA 3EGKH 4PROA 5GXPA 4ABEA 1TA6A 3F9GA 1C9TA 2GDDA 3U8TH 1YPHE 1HPGA 4LZ1H 1TQ0B 2GMTB 1GJDB 3T29A 3SW2B 4IMQA 3F2GA 4LXBH 1L4DA 4AB8A 2WYGA 1TRMA 2Y6TA 2BYAX 2GT7A 3OU0A 1SOTA 1YLDA 1EP5A 5E0GA 1BTWA 1ELTA 3UAIC 4WMDA 4P00A 1Q3XA 1MCVA 1W3CA 2ZU4A 2HVYB 1ETTH 1PQ7A 2GP9B 5EJLA 1DE7H 1TNKA 1MQ6A 4ZHAA 5TCAA 2PWXA 3DFJA 2JH6D 4WY3A 1E1RD 1QQ4A 4FU7A 3VGCB 3ELAH 1NPMA 1YCPM 3TGJE 1ZMJA 1O2SA 1TMUH 5FBEA 4FUDA 4E06H 4B76A 3OSYA 3IWMA 5GNDA 1RTKA 2VIWA 3SZEA 2J2UA 1TGTA 1C5YB 2BVSH 2Z9IA 1OP2A 1E79D 1W7GH 1WU1A 1EUFA 1QRWA 2A7JA 1Y59T 1DXPA 1QFKH 1S0RA 3GY8A 2QY0B 1FPHH 2FP7B 1CE5A 6LPRA 5A8XA 1FN8A 4YLQH 5EQRA 1OYTH 3EA7A 4J1YA 1TAWA 2J4IA 2O8MA 3TJNA 5LPRA 1L1GA 2XNIA 1IHSH 3TNTA 3U69H 2QF5A 4YESB 1AUJA 1CGIE 4X2VA 4ZCNA 1GI3A 2A31A 2TBSA 2FOAA 1SL3A 3MQKC 4Y8ZA 4ESTE 3ZZ9A 2QF4A 1KIGH 3A7VA 2BD9A 1NFWA 3RC4A 1NFXA 1GBDA 1O3IA 1EATA 4ABJA 5JDUB 5CHAB 4A1TA 1SLWB 1OX1A 1GMCG 3RXUA 2C3SA 1D6WA 2P3TB 1G9IE 4XBCA 4NZLA 1ZR0A 2BDCA 2ZU3A 3S69A 4JZIA 4O3UA 2ZU1A 1ZZZA 2THFB 1HAOH 1PPHE 5A2MH 3PTBA 2CGAA 3A7WA 5A09A 3ZVGA 2ZTXA 4X1RU 3KEEA 4GHTA 3RXTA 1AB9C 1ABJH 4YZUA 4SGAE 4BTUB 1C5OH 1EB1H 2WPHS 1NBME 1H1BA 1P9SA 4Y6DA 3F2HA 1GL1A 4ZH8A 3QUMP 1SSXA 3OY5U 1GJCB 1PQ8A 2R3YA 3M5OA 6GCHF 3QK1A 1P2OA 1V2QT 1SC8U 1XUKA 1MABB 3ESTA 1HAPH 2J5UA 4MLFB 3Q3YA 2QN5T 5EW2H 2H1UA 3S9CA 4UFGH 1HJ9A 1K1PA 5CE1A 1RD3B 5FPTA 1GBAA 1KLJH 5IDKA 1XKAC 2NWNA 3TK6A 3MH7A 4ZAEA 1TNLA 2CJIA 4HTCH 2FDAA 1EZUC 1LPGB 3MI4A 2KFWA 1FIZA 1O3AA 2SNVA 3ZVBA 1BTPA 2Z9LA 3M61U 1OSSA 3SJ8A 2FOFA 1O2WA 3A8BA 2GVFA 2AMPA 2KAIA 1SLVB 1YPHC 1QHRB 3Q3XA 4IMZA 1A3BH 2ZGXH 4DCDA 5JBAS 3MU0A 2W7SA 2EEKA 3RM2H 3P95A 4RT1A 1K28D 1AZZA 1GVZA 1RGQA 3STIA 3SUFA 2D1JA 1SR5C 5EGMA 1F92A 1O3LA 5L6NH 1GHAG 1LQEA 5LH8A 1JWTA 1HJ8A 4DURA 4X2XA 5GCHF 1DDJA 3ENSB 4XE4A 1O2KA 3N7OA 3U28C 1QNJA 1IQNA 3RU4D 4CR9A 1O34A 4VGCC 4NIYA 1KXBA 2ZIQH 3RXHA 2OQ5A 2OP9A 2Z6BD 2G00A 2FOHA 1GHXH 1GJ4H 2A4OA 2B9LA 2VH6A 3HATH 3QO6A 5A0CA 1N6XA 2PFEA 2AS9A 1NU9A 1O5DH 4A5TS 3SV8A 3A8DA 5F53A 2ZFQH 2H6MA 1NFUA 3QWCH 3SI3H 2CN0H 3VB3A 5AFYH 1C5WB 3ZZDA 1ESAA 1YY3A 4OM9A 1FXYA 1V2RT 1E35B 3E16B 3UR6A 1DICA 5KGOA 2BX4A 2I6SA 3P8OA 5C5NA 2EI6A 2BVXH 2H9HA 2WPJS 3A7ZA 1A0HB 4CH8B 1AUTC 1MU8B 1WQSA 1SHHB 1CU1A 1F2SE 3PMAB 1O32A 1O2PA 2F91A 1P01A 2VWNA 4JK5A 4O3TA 3QLPH 1D3PB 3DSPA 1WBGB 3CS0A 1HJAB 4P02A 1P0SH 2K0QA 4IN1A 5HIZA 3LPRA 1ZRKA 1BZXE 3PM3A 5SGAE 1WYKA 2ZPQA 2SGQE 1F0TA 3ATLA 3HPTB 4E7RG 2XRCA 1KDQA 4I8HA 4VGCB 3I77A 2QIQA 1F0SA 3F9FA 1NN6A 2XWAA 3ATIA 3WY8A 4DOQA 6CHAC 4K2YA 1GBIA 2FMJA 4WMEA 2H2ZA 4Y71A 3VPKA 2IN2A 2YMSC 2VBCA 1O5EH 7KMEH 1J16A 1O3EA 3RM0H 3ZYEA 4NIWA 1QBNA 1GJ8B 1BT7A 2XXLA 1F5KU 4BXWA 1TNHA 3ZVCA 2GT8A 3L33A 1WXRA 4I8GA 1ZSLA 1HRTH 1JRSA 3VB5A 4Y7BA 3BG8A 1C2KA 3LGTA 4AYYB 4GVUA 1UJ1A 5ABWA 2Z9GA 2DE9A 4NIVA 3RXOA 2O8TA 1AGJA 3T62A 3BG4C 3ZVAA 1QB6A 1H8DH 3MO9A 2YNAA 5F8TA 1HFDA 1RXPA 1GBKA 2BDBA 5FL7D 4AFQA 4NZQA 1W8BH 1P03A 7ESTE 3P6ZB 1FPCH 1IQJA 3BTFE 2QXGA 5CMXH 4GHQA 2GDEH 4UE7H 2HLDD 2W3IA 1C1OA 3TU7H 4AZ2B 1ELGA 1G32B 1NS3A 2QF3A 3P8FA 2HRVA 2WZQA 4BXSA 1LHFH 2ZI2H 8GCHF 1SFQB 1HAGE 5I46H 3RXFA 1K21H 3MHWU 2JJ2D 1ELDE 6CHAB 4ISLA 2VU8E 2P93A 1W0YH 2AH4X 1CGHA 2Y5FA 1L1NA 3RXVA 3PWCA 1K1IA 1RRKA 4HG6A 3RXIA 2BY6X 1KTSB 2BTCE 4MNYA 1O3OA 1S85A 2KCPA 5J4QA 3E91A 3PO1B 2CF9H 1GBEA 1FAXA 2AHME 2B5TB 4DVAU 2BDYA 1KYNA 1CHOG 1AFQC 2BXUH 1VCQA 3BTGE 4Y79A 2HGTH 4JCNA 4I8LA 1K1LA 1TNIA 3HK6B 2VH0A 2A45B 2WV9A 3GCHC 1XKBC 2BMGB 1SQRA 3K65B 1IQLA 1SKYE 1WUNH 4MPVA 4Y10E 2V35A 2GCTC 3DT0H 1P2IA 1ZHMA 1QURH 3LONA 2P16A 2G81E 1TGBA 7LPRA 4ZKNU 2J95A 3UREA 3P92A 5JYIA 2A4QA 4CRAA 4J2YB 2C8ZB 2AYWA 4JYTA 4U01A 5LPFA 5FBIA 3FP8E 3GY4A 1TRYA 3SNEA 1ETSH 3PLBA 1C2EA 1QTFA 3U98H 4I86A 1BHXB 3AK5A 1E36B 1L0ZA 2XC5A 1XMNB 2AEIH 1P04A 4BTTB 5FCKA 1A0LA 2JETC 1Y5UT 2UWPA 3ZVFA 3T28A 2BOHB 4BAHB 1HAVA 3UOPA 4AGKA 1GI9B 2Y5GA 5EOKA 1AFQB 1TPAE 1DSTA 1O5FH 4X8TH 2TRMA 3N99A 1PYTC 3GCHB 2OD3B 1ID5H 2BOKA 4HI3A 1H9HE 1A0JA 3EQ0H 5TCCA 3F0PA 3DSOA 3LT3A 1FZZA 3OYPA 1DLEA 2FXRA 4ABHA 3EAJA 2F9VA 3F0OA 2JJ1D 3D23A 1OP8A 3EE0B 1GBLA 3ODDA 4X8VH 3ZZ4A 2OBOA 1P11E 3UNRA 1RFNA 1V2LT 2YOLA 3ZV9A 2R3UA 3SU6A 4K8YA 1DWEH 4NFFA 3M3VA 4JK6A 4K1SA 2XBWA 4OS7A 4ABGA 3LH1A 4RI0A 3UWJH 1QCPA 2PSYA 2A4GA 4ABIA 2ZCLP 1P09A 2J92A 5C0TA 5F6MA 3B9FH 1TYNA 1O37A 1IQEA 1QRZA 1GGDC 1HAXB 3BTHE 1J14A 3BTKE 3HK3B 2W7UA 1ABIH 1V2PT 3DFLA 1KY9A 3VB6A 1Y3WA 1ZSKA 4ABBA 2JETB 1GHZA 1C5LH 2IPQX 5EW1H 3M5LA 1OHHD 2ZEBA 3ZZCA 1DUEA 3O8DA 4X6NA 3TH3H 1HXEH 2I6QA 2ULLA 3SJKA 4IBLH 1J8AA 3PMJA 2J98A 2GZ8A 1C1RA 1UO6A 1WV7H 2UUJB 4DG4A 1GI2A 3C1KA 1SGIB 5KEDA 2B0FA 1P3EA 3OEHD 4I8KA 2F9OA 4X2YA 4A1VA 4AFUA 3VB4A 1SGFA 1P9UA 1TB6H 1ZTLA 2Y81A 1L2EA 1P2JA 2G4UA 2A4RA 3GY5A 3LC5A 2V6NA 3JZ1B 2JKHA 1EP6A 3BEIB 1ANDA 1BOQA 4X1SU 1QL8A 2WV4A 2STAE 4BAOB 3EYDA 3UB0A 5FPSA 1AVXA 2UUKB 1O2HA 3DA9B 4XOJA 1QA7A 4AGJA 6ESTA 1OOKB 1E34B 2AFQB 4CRDA 3QZRA 1YKTA 1UCYE 2A5AA 4KELA 2FI5E 3SQEE 1NC6A 4X0WU 1ZRBA 1C5ZB 2FOCA 1GGDB 3V12A 1GI8B 2J38A 1P2KA 2JH5D 2ZDVH 9ESTA 1YLCA 2A7HA 1EZXC 4GCHF 1EFRD 2ZWLH 1IQHA 1A5GH 1SQAA 1H8ED 4DGJA 5E8EH 1ZLRA 3A7YA 3KHVA 1DXWA 3SU0A 5DKMA 2SGAA 2QGRA 1YPEH 2ZHWH 2BLQA 1GJ9B 1FV9A 2P94A 4Y11E 3A7TA 3SGQE 5JB8S 3QTVH 1YPMH 4NGAH 5H4IB 1TA2A 1VGCC 2WPKS 4X2WA 2WSSD 3RMNH 4OS5A 4BAKB 1K1NA 4MPXA 2HPQH 4CBOA 1P10A 1S84A 1NFYA 1BTUA 1AQ7A 1MTNC 1GVLA 1MTUA 4A1XA 5A0AE 4UEHH 1DVAH 1ARBA 3A89A 1LHCH 1QA0A 3LOXA 3MOCA 4FETA 4XDEA 2W6ID 1SB1H 2K8IA 2XBXA 3MMGA 4K60A 2XBVA 1KXAA 1TGCA 1SGTA 4E05H 3GDVA 3GY7A 3PYHA 2HNTE 2W3KA 2C8YB 3W1EA 3KQDA 3P70B 3ATMA 5AFZH 3F6UH 2FTMA 3UNSA 2EC9H 1S0QA 1CT2E 2ZDMA 1AHTH 3KIDU 4NA7A 2HOBA 1WOFA 2HLCA 2GD4B 2XCFA 5EG4A 4DT4A 2ZHQH 4MNVA 2DUCA 2ZQ2A 1NY22 3MWIU 5C3NA 1VZQH 1YCPK 4KKDA 4AB9A 4F4OC 1DANH 1KMHB 3M36A 1FX0B 2QXIA 1AMHA 1VGCB 1PQ5A 2BDIA 3MU5A 2D26C 4DY7B 2ZU5A 1BRUP 3K6ZA 1C1WH 4NA8A 1GL0E 4O03A 1MTNB 3SI4H 1SI5H 1SVPA 2A7CA 2VNTA 2UWLA 5AHGH 1D9IA 2XCNA 2FWWA 3TJOA 1WTGH 5T1VA 5CHAC 4IN2A 3S9BA 1NRSH 2VIDA 3RMOH 1EPTC 2ZQ1A 1O2OA 4WMFA 5K7RA 5E2OA 4INLA 1ELCA 4OS2A 1Y3XA 1TRNA 1LKAA 1D3TB 1X7AC 4WF8A 3TK5A 2PW8H 1HAYB 1AO5A 1SGYE 2ZHFH 1J17T 2Z94A 2G5NA 3BTDE 5IYTA 4D7GA 6GCHG 1GJBB 4DT7B 1MU6B 2PUQH 1IQIA 1AU8A 4TY6A 3A85A 3DUXH 1GMHF 2PGQB 2F83A 3FP6E 1C5QA 4X6OA 1ZTJA 3M3TA 1J15A 3U9AH 3LU9B 3ZV8A 2AIPA 3KQ5A 1QJ1B 2J94A 4AFSA 3KQBA 1CSOE 2FX4A 4WXVA 3MO6A 3ATKA 1TBRH 2F43B 5FX5A 4MVNA 4XBBA 3PTNA 2FZZA 1GI1A 1BBRH 1SMFE 3WWBA 2ZGJA 4GPGA 1UTJA 1FN6A 2QV1A 8LPRA 1COWD 1EPTB 1EQ9A 2ZP0H 3SUDA 1AFEH 1HNEE 3I78A 1P2QA 3URCA 4I7YH 4X6MA 3QGJA 1C2MA 3TGIE 2RG3A 2J97A 5LPEA 1XVOA 1O30A 2PKSC 2JIZD 2XYAA 1MMJN 3EDXB 4IC5A 1GBCA 5GCHG 2WPIS 3SOSA 3WWFA 1KLIH 1BMLA 1VITF 1WTHD 3U8OH 4FUCA 4NA9H 5HYOA 2C90B 2CF8H 4K5ZA 1C4U2 1OWDA 2NU0E 1NZQH 1ZHRA 1GCTB 1RJXB 5T6GA 1C5PA 2BZAA 2Q6FA 4TY7A 1K1JA 1V3XA 5K0HA 1G3CA 1P57B 1NROH 4DIHH 4B6FA 1E0FD 5C1XA 4FUGA 1DWCH 2M5TA 2ZDAH 1ELFA 4OS4A 1JIRA 2W6JD 5GJ4B 3OEED 1BQYA 1Z8GA 1MTSA 3PV4A 1ELVA 1MKWK 1C2IA 1MH0A 4F49A 3H09A 3Q3KA 3SQHE 1CT4E 1AN1E 1JBUH 5DP4A 3D62A 2NU1E 5C20A 2ZKSA 3NRLA 1QRXA 2HNTC 1YPJH 2ALVA 2BX3A 3M35A 4YOGA 2EQNA 2PKSB 5DN6D 3TJVA 1MAXA 1B0FA 3IG6B 1GHVH 2BDHA 1DWBH 5C0UA 1C2FA 5A8ZA 4NIXA 1C5MD 1C1VH 1GJ6A 3B23B 2IJOB 1HJAC 4NCYA 3STJA 1O36A 1MBQA 1V2KT 2A5IA 1DFPA 3AASA 3PWBA 1EASA 2OBQA 3R0FA 2M2AA 1THSH 2F9NA 5C2ZA 3TH4H 1S81A 3KNXA 4JZFH 4MNXA 4D76A 1PJPA 3HGPA 4A7IB 1Z8JB 3TLOA 1AKSA 1K22H 1MD8A 5EJ1A 2ZA5A 3A81A 3QN7A 3W95A 2ALPA 4NG9H 3V13A 1UHBA 3FANA 2SFAA 3ITIA 2BLWA 1O3MA 2SNWA 4LK4A 4H6TA 3K6YA 3RMLH 3RLYH 1V2NT 3ZZBA 5HKKD 2ILNA 2K1QA 2FI3E 1O3CA 1O2XA 3FZDA 2FEQH 4XBDA 3SHCH 1S82A 5EPNA 4IS5A 2A32A 1VKYA 1EAIA 2DE8A 3RU4T 1C2JA 1UK3A 1E38B 2EY4C 1HYLA 4AN7A 2BD8A 5JBBS 5LGOA 1T31A 2WPMS 1O3JA 1K0HA 3EA9A 3KQEA 4Q7YA 1QJ6B 8GCHG 2Q1JA 1O2VA 1TABE 2ESTE 3GISB 3RU4E 1H9IE 1XUHA 3GCOA 3GICB 3PRDA 2KCOA 1A1RA 2BDGA 3RXBA 1SGNE 4XRNA 1BJVA 1PPEE 3CNRA 3SORA 2G5VA 1YWUA 2GZ9A 1YBWA 1Y5AT 1QL7A 2XC0A 4ASHA 1HIAA 1Y5BT 4HZHA 4ZHMU 1YCPH 2F4LA 3SUEA 3SYJA 2ZGBH 3AVZA 1ELEE 2TIOA 3ZZ7A 1BRAA 3SV7A 2PKAA 2PSXA 1OWHA 4AFZA 2EI8A 3PO1C 1UVTH 4RKJB 1C5XB 4BOHA 4ACBA 2ZZUH 1CT0E 1TOMH 5B6LA 2G8TA 1GDUA 3PV2A 5E0JA 2VWOA 5HXFA 1SPJA 1MBMA 2AMDA 2O8WA 3MNCA 1GWAA 1QB9A 1TALA 2QXHA 3QX5H 2PHBA 3TNSA 3TGKE 3EE7A 1THPB 1OP0A 1GG6C 4TPIZ 1YM0A 1ESBA 1FY4A 2R2MB 2BY7X 2XBYA 1DT2A 1PPFE 1ZGVA 4CR5A 4BAQB 3D65E 1CA0B 1GBMA 2D8WA 1O2IA 4HGCA 3SGBE 3DD2H 1XXFA 1F0UA 3F2FA 3P8NA 3RXPA 4YT7H 1C2LA 2ZPSA 1O3GA 4ZKSU 1O2ZA 1T4UH 5F03A 2BD3A 4AG1A 3M7UA 1EXFA 3UPEA 3Q00A 1VITH 1GHBF 3ZZ3A 3A82A 3NZIA 1SGRE 3GCTF 1UVUH 3OE7D 3ZZ6A 3ZZ5A 1EOLA 1C1QA 1EJMA 3RMMH 1Q2WA 1Z1JA 1V2VT 5DP9A 1W0ZU 4B1TA 4Y76A 1LCYA 1C2GA 2R0KA 3LGVA 1QB1A 4ZUHA 1TMTH 1BHXF 1ACBE 1H8IH 3A8AA 2KAIB 4QT8C 2J9NA 4CREA 1YPLH 1FLEE 1F5LA 4YLUA 1GDNA 1O38A 4YTAA 3TIUA 5JB9S 1FDPA 1GG6B 4Y0ZE 1VJAU 1TGNA 1OS8A 5JPMH 1Z7KA 4WH6A 2FOGA 5FCRA 1BIOA 2ZECA 3MNSA 1VJ9U 4YO9A 4UFFH 2FTLE 2XC4A 1W2KH 2FOEA 3Q77A 4D8NA 4K1EA 3VEQB 1GMDF 3F68H 3RXKA 1UMAH 1C1TA 1L4ZA 1T32A 2SGDE 1D6RA 2Y80A 4CHAC 3BN9A 3SV9A 4JYVH 2GV6A 4NWLA 3FO8D 3H7TA 1JOUB 4TSFD 3RXQA 4R0IA 3M5NA 3KYGA 4FUFA 4GLYA 3SJ9A 2ANMH 7GCHF 1GI7B 1XM1A 3M7TA 4TWWA 2FPZA 3T5FH 1MKWH 2FLRH 5EIYA 1TNJA 1G2LA 3F3BA 5EXNA 5JBCS 2PP6A 4LOYH 5J4SA 1VCWA 3BEFB 3VXFH 1ZSJA 1KSNA 1ELAA 4ISIH 1SG8B 1K9OE 4U32A 3VB7A 1XVMA 1ESTA 1BBRK 3VG8A 3BF6H 3RUOA 3KF2A 3RXCA 1Z6JH 1DLKB 2RA3A 2BHGA 1GDQA 3FN8A 2BQ7B 1W0KD 1A4WH 2C4FH 4KTCA 2YNBA 2Q6GA 1H9LB 3D49H 2VIOA 4IGDA 1KDQB 1ZYOA 4Z6AH 1CQQA 2ZGCA 4FU9A 5DP8A 1F7ZA 1P05A 1P3CA 2P59A 4JYUH 2OC0A 4Q4LA 4GCHG 1QQUA 3BTQE 4CHAB 1GHWH 3L3TA 2QCYA 2FO9A 1P12E 3AAVA 1BMMH 2VGCB 5DG6A 2P3UB 3E0NB 3I29A 2GCHF 2QAAA 1DWDH 1QBVH 3AW1A 3GDUA 3UTUH 3QGNB 2ODQA 1PPGE 1O3KA 2ZDLA 3R3GB 1V2JT 3OTJE 1FNIA 2ZNKH 2HPPH 5CHBA 1TX7A 2EA3A 1C2HA 2BLOA 1FIWA 1K1MA 3A87A 1AE5A 3TK9A 4F48B 1IQMA 3S7KB 3T2NA 4DIIH 2XTTB 1THRH 2ZFRH 5AF9H 1GBJA 1BB0B 3LGIA 4CRGA 4ZHLU 3LJOA 9LPRA 3SV6A 1CA8B 1AVWA 4K69A 1MUEB 1YPGH 3ZVDA 4OS1A 1YLNA 3OAAD 2F9UA 2O8UA 3SU1A 2GGVB 1HAZB 3F9EA 2RFKC 4NWKA 1AD8H 1LPZB 1QY6A 1W0JD 2RCEA 1G3EA 4UFEH 2FESH 3CS7A 5ETXA 3OY6U 3NPSA 4BTIB 1TFXA 2B8OH 1FAKH 4UONA 3B8JA 4E7NA 3A83A 4WXIA 4LZ4B 1JIMA 2WHXA 5FAHA 2W5EA 1XUGA 3MO3A 1ELBA 3SU4A 4FUHA 5F8XA 1ZHPA 1SGFG 1MCTA 2BD2A 2P3FH 2R9PA 2RDLA 2QA9E 3ATWA 3GOVB 3A7XA 4B2BA 3SUGA 5DK1A 2ZFSA 1YP9A 2GKVE 1TPOA 1O3FA 4KTUA 2C93B 1OWEA 2CMYA 1O2GH 3KN2A 1SGCA 1Q31A 1MZAA 1W7XH 3ZYDA 5T6FA 1BJUA 1Y3UA 4ISNA 1UK4A 4M7GA 4BNRA 3LKWA 4Q2KA 5T6DA 1SQTA 4DW2U 2P8OB 3V3MA 4XSKU 1GJ7B 4F55A 3HGNA 4OGXA 2O8LA 4Y7AA 1C4V2 2Z9JA 3H5CB 1QIXB 2FS8A 2C8XB 2AMQA 1BMNH 1JXPA 4H4FA 2AGEX 4Z0KA 2TGAA 2VWLA 2Q6DA 4WJG2 3AW0A 1GJ5H 1BTHH 1SLUB 2FOMB 2C8WB 4U30A 5B6OA 4XFQA 2FYRA 2G52A 1TX6A 1EZSC 2H5CA 1BCUH 1GMHG 2HVXA 4JZEH 4MQAA 3M5MA 3SJIA 2RDEA 4OS6A 2OQUA 4AOQA 1DITH 2XWBI 2BD7A 1UTMA 3TPIZ 3N7EA 3K2UA 4GAWA 3OX7U 1ZMLA 3MNBA 2Y7ZA 1O2LA 5CDFE 2A1DB 3LGUA 4A6LA 1HAVB 1ZOMA 1T8OA 5GPIB 4KP0A 2L6OA 3A88A 1O3HA 1UTOA 1ZGIA 1BITA 2SGEE 2PUXB 1GJAB 3RDZA 2EI7A 2Z7FE 3BIUH 1A5HA 1TPSA 1SFIA 2L74A 1P2MA 4CRFA 1O35A 5A0BA 1TONA 1ZTKA 1QBOA 2IJD1 1PPCE 4Y0YE 3GY3A 1LTOA 1HBTH 3A86A 4ASUD 5DO4H 1MD7A 2IPHA 2ZCHP 4RT0A 1VITG 2ZFPH 1LHGH 3M7QA 3SHAH 3UY9A 1Z8RA 4FOUC 3S9AA 1BRBE 4K8BA 3ZVEA 1IQKA 4H6SB 3SN8A 1BTXA 2WPLS 3MU4A 2ODYB 2FI4E 5C94A 1A2CH 2OK5A 3UR9A 3RXAA 3PB1E 3GY6A 2STBE 4RKOB 1L1JA 4JMYA 4ABDA 2FLBH 2LPRA 5HIYA 1UCYK 1CGJE 2SGPE 1G3BA 1GCTC 1PPBH 1O31A 1HCGA 1P2NA 1BTZA 1HGTH 1TWXB 2J98B 3O8BA 3OFND 1MKXK 4YM9A 1DY8A 1S5SA 3GYMA 3A8CA 4NFEA 2R0LA 3F9HA 3GYLB 1UTKA 4FUEA 3ZZ8A 2CK3D 1KXFA 2YMSD 3HKIB 1Y3VA 1FQ3A 5AVDA 1MQ5A 4YXWD 5L2ZH 2XW9A 1YPKH 3M37A 1LHEH 1S6FA 1W14U 1AVGH 2BD5A 5DJ7A 1LVMA 3ZIAD 1AWFH 3SNBA 4X1QU 2OC8A 1S6LA 3CP7A 2PGBB 1NBMD 1O2MA 2H9TH 2WV5A 1SGDE 1C1UH 2BB4A 4INKA 5EU8A 3GS9A 4BANB 2KM0A 4X6PA 3LJJA 1D3DB 4SGBE 1EJAA 1A7SA 3UNQA 1A61H 4Z1MD 1D4PB 1G2MA 5EQSA 4ISOA 3IITA 2ANYA 4RSPA 1SBWA 2QE7D 2FS9A 2ANWA 5EXLA 2PR3A 1O3DA 2ODPA 1XX9A 5T3HA 1IQGA 2B7DH 3A84A 1VR1H 1NO9H 1ETRH 4Q7ZA 3VXEH 3JZ2B 1EAUA 1XXDA 5BRRE 1T4VH 3U8RH 1KXEA 4INHA 2Z3DA 1BUIA 3BTWE 2QF0A 5EXMA 1UVPA 2OINA 1N6YA 3T26A 4ABAA 3LC3A 1A46H 1FY3A 1T7CA 1HXFH 2PV9B 1KTTB 1NRNH 1C1PA 2LP6A 4YOJA 1C1MA 1EX3A 1AY6H 4HFPB 2VIQA 4B6EA 8KME2 4FUJA 1EJNA 3RP2A 1F5RA 1E1QD 1F0RA 1JRTA 1UTLM 3E3TA 2BM2A 2BZ6H 1WDIA 4AORA 1GBFA 3QTOH 1LVOA 1TIOA 4H42U 2VJ1A 1EKBB 3PLPA 1MTWA 3SV2H 2HNTF 2J34A 2A0QB 2ZCKP 4O97A 4TWYA 3KYFA 3U1IB 4NSYA 2LNCA 1QL9A 2KZ4A 5L2YH 3LGYA 1D3QB 1BMFD 3NUMA 3UOUA 2ZPRA 5ESBA 3MH6A 2OC1A 1W11U 1FY5A 1EAXA 3RXLA 1T8NA 4ZMAH 2WYJA 3E1XB 1Z6EA 1GMCF 3RXMA 1GVKB 3Q76A 2OTVA 1Y3YA 2HALA 4Q63A 3S0NA 5GIBA 4Q80A 2AERH 1AZ8A 1AB9B 1P8VC 5GDSH 5ESTE 1DPOA 2VINA 4GUXA 3NXPA 1V2TT 2ZDNA 2H5DA 4MPWA 3MH5A 1W12U 2WUCA 4B71A 2TPIZ 1PYTD 4FUBA 5C5OA 4B2AA 4I31A 1NU7B 1DX5M 1LVBA 2V3MA 4MNWA 1IOEA 5HM2A 3RC6A 1GHYH 4TPYA 1UTNA 1KLTA 1OPHB 1O2TA 5E2PA 3SBKA 1W13U 2QXJA 4ZKOU 3PROA 5DP5A 1C1NA 1TLDA 2Y5HA 4UDWH 5EODA 1TX8A 1TNGA 2BD4A 1MAYA 3URDA 3UQVA 1BDAA 3UQOA 2P95A 2JH0D 1SGQE 4YT6H 1SHYA 1CA0C 5FXLA 1AIXH 1C9PA 1GHBG 3SZNA 3T27A 1C5TA 1NRPH 1O3NA 2UUFB 2ZO3H 3GCTG 3V0XA 4ZKRU 3E6PH 4XD7D 3P8GA 1Z71A 2BY9X 1H4WA 1ZPZA 4AYVB 1UK2A 3V7TA 4Q7XA 3FAOA 2ZTYA 3SGAE 4ACAA 1LQDB 3BSQA 4AC9A 2KCAA 2NU3E 1V2OT 2SGFE 3FFGA 3LGWA 4TYDA 4AG2A 3L6PA 4ZXXH 3N7DA 5JBTA 1V2MT 3MU8A 1GHAF 1FI8A 1UTQA 1B7XB 2BY5X 2VB0A 3BIVH 1OWJA 3LH3A 2GV7A 1S6HA 1SLXB 2ZG0H 1C5NH 1T8LA 1RTFB 2RA0A 2XNDD 4X1PU 1DSUA 1O39A 1SQOA 1LPKB 1GMDG 1O5CB 2UUYA 3H7OA 2VVVA 1U6QA 1CBWC 1YC0A 3NKKA 2OCVB 3LDXH 1M9UA 1V6DA 1NESE 5C1UA 1G36A 1P06A 2AGGX 1BBRE 1N8OC 1WSSH 2QYIA 1O3PB 2Z3EA 4I32A 3RXGA 3T25A 1RTLA 2VWMA 1O2RA 2GZ7A 3DCLA 3MTYA 3SO3A 2ZTZA 1UCYH 2ZDKA 3O8CA 1DY9A 1LVYA 5DPAA 5HMAA 3ZZAA 7GCHG 4FVBA 1MKXH 2QC2A 1HV7A 5DP7A 4CH2B 1GBHA 5C17A 4X8UH 4AX9H 5HGGA 4D9RA 1GBTA 4RN6A 4GSOA 1C4Y2 4X1NU 2LELA 3TITA 2A5KA 4KTSA 2BXTH 3F1SB 2OC7A 5DGJA 1O3BA 1HAHH 5HM9A 3TH2H 1LDTT 3UIRA 4CRBA 3RXJA 5TJXA 2F9BH 2G4TA 3VFEA 1JMOH 2VVCA 1NRRH 2V7QD 2VIPA 2XOKD 2F3CE 2YMSB 2BQ6B 1A5IA 1OWKA 4TT3D 1CBWB 1FY8E 2WPDD 3KQCA 5FHTA 3W94A 1V2WT 2TGTA 3M3SA 3G01A 2HWLB 1GCDA 2FM2A 3KCGH 1N8OB 3MYWA 4B75A 1K2I1 1LO6A 3OTPA 1RS0A 2CV3A 1SGEE 2Z3CA 3PRBA 3SNCA 1O2YA 1INCA 5I25A 1TBQH 3BTEE 3NK8A 4NSVA 1UW7A 3E8LA 2KCYA 5F8ZA 2GCHG 1OWIA 3HKJB 1AKSB 1C5SA 4MDSA 5IK2D 1O5BB 2NU2E 3PMHB 1T8MA 3BG4B 3BV9B 4I8JA 1G37A 3RXRA 2BLVA 1GI0A 2TGDA 2ZF0H 4FXGH 1UHBB 2VGCC 3SU2A 1C5VA 4BAMB 1FUJA 1GPZA 4M9FA 2BDAA 1PPZA 1BA8B 1BRCE 3PV5A 1QR3E 1BMAA 1UVSH 1AE8H 1KXCA 1Z8IB 1K1OA 1IQFA 1S83A 4D9QA 5PTPA 1SOZA 1ZJKA 2OLGA 4B73A 4KGAA 3RC5A 1XUJA 3RLWH 1W10U 2KX4A 1OYQA 3C27B 2ZHDA 2FX6A 1IHTH 5FPYA 3RXSA 1ANCA 1O0DH 2AGIX 4UD9H 1Z1IA 4THNH 4WVPE 4MG3A 3KGPA 4JZ1A 1MZDA 1WQVH 2IOTA 1XUFA 1QGFA 3WW7A 1TOCB 2FYQA 2ZU2A 3UFAA 1CHGA 5DSFA 4MPUA 2NU4E 2D2DA 1HIAB 3EA8A 2BQWB 1QZ8A 2FODA 4CBNA 2GCTB 1CHOF 1O2NA 3FP7E 1ANBA 1UVOA 2PKAB 5G4BA 4CRCA 2UWOA 2GTBA 3TVJB 1YF4A 5L30H 2PTNA 3BTME 2Y82A 2WINI 1C5RA 3E90B 3SNDA 2ASUB 3PMBB 1FY1A 1DOJA 1AI8H 3PLKA 3RXEA 2G55A 3A80A 3AAUA 2PLXA 1B0EA 1MTVA 1WCZA 1C1SA 1FONA 3O8RA 2BVRH 3SJOA 5FX6A 1TPPA 2O9QA 2P8OC 3TJUA 1UTPA 1J9CH 1RIWC 1O2UA
chains in the Genus database with same CATH topology
2A2XH 2BY8X 3KL6A 2VVUA 1XUIA 2FOBA 2H9EH 1G3DA 3SU3A 3UWIA 2VIVA 1ZPBA 1TBZH 4U2WA 1DUAA 3MFJA 1HDTH 3NWUA 5C1YA 1CO7E 1KXDA 1OKXA 2KR7A 2CHAC 3LIWA 1EOJA 3MH4A 3UUZA 3FZZA 2AIQA 4O9VA 4Y8XA 2ZGHA 2Z9KA 1HLTH 1ZMNA 2W26A 2ZFFH 3E0PB 1C5UA 4FUIA 4FVDA 2Y7XA 3FKSD 1ARCA 1O5AB 4B74A 3S7HB 1YYY1 2F9PA 3MU1A 4X8SH 1EZQA 1EB2A 4K3JA 1E37B 2WUBA 1LHDH 3SNAA 4ZROA 8ESTE 1V2UT 4DJZB 1FMGA 1Y8TA 4D7FA 2ANKH 3FOAA 3QZQA 1BTYA 1OXGA 4FU8A 1FJSA 1TGSZ 1DM4B 1EPTA 1TMBH 3GDSA 1NTPA 3FVFB 3BEUA 1O2QA 1O33A 2V3HH 1GI4A 1CVWH 1ZJDA 1NM6A 5C67A 1RIWB 1AWHB 1VCPA 1EAWA 1H8HD 1ANEA 1NRQH 2TGPZ 4A92A 2FIRH 1WAYB 4K1TA 1TE0A 4IW4E 4Y8YA 3K9XB 1V2ST 1HB0B 1NT1A 2ZFTA 4WH8A 1B5GH 5EPYA 2V0BA 2ZHEH 1GBBA 1O2JA 2GX4A 2GMTC 4UFDH 1YGCH 4ABFA 2A2QH 2CHAB 1A3EH 2R2WU 3SU5A 2V3OH 5E0HA 4ZXYH 3DHKH 3P17H 5DP3A 3NCLA 5GWZA 1QJ7B 1TQ7B 5EQQA 1LKBA 4ISHH 1PQAA 3CENA 1GI5A 1N1LA 4YOIA 1HUTH 1LMWB 1P02A 2OUAA 4I33A 1PFXC 1O5GH 1SGPE 4JZDH 1HAIH 3BTTE 3VGCC 3U1JB 3GY2A 2ZC9H 4B2CA 1C2DA 1ORFA 1G30B 4IC6A 1IAUA 4WWYA 5A8YA 2PTCE 5BPEA 3MNXA 4R8TB 3QDZB 1DS2E 2CXVA 1ZPCA 3ODFA 1GI6A 5DP6A 2G51A 2OXSA 3RXDA 4OGYA 4MTBA 2JDID 3GCNA 3EGKH 4PROA 5GXPA 4ABEA 1TA6A 3F9GA 1C9TA 2GDDA 3U8TH 1YPHE 1HPGA 4LZ1H 1TQ0B 2GMTB 1GJDB 3T29A 3SW2B 4IMQA 3F2GA 4LXBH 1L4DA 4AB8A 2WYGA 1TRMA 2Y6TA 2BYAX 2GT7A 3OU0A 1SOTA 1YLDA 1EP5A 5E0GA 1BTWA 1ELTA 4WMDA 1Q3XA 1MCVA 1W3CA 2ZU4A 1ETTH 1PQ7A 2GP9B 1DE7H 1TNKA 1MQ6A 4ZHAA 5TCAA 2PWXA 3DFJA 2JH6D 4WY3A 1QQ4A 4FU7A 1E1RD 3VGCB 3ELAH 1NPMA 1YCPM 3TGJE 1ZMJA 1O2SA 1TMUH 5FBEA 4FUDA 4E06H 4B76A 3OSYA 3IWMA 5GNDA 1RTKA 2VIWA 3SZEA 2J2UA 1TGTA 1C5YB 2BVSH 2Z9IA 1OP2A 1E79D 1W7GH 1WU1A 1EUFA 1QRWA 2A7JA 1Y59T 1DXPA 1QFKH 1S0RA 3GY8A 2QY0B 1FPHH 2FP7B 1CE5A 6LPRA 5A8XA 1FN8A 4YLQH 5EQRA 1OYTH 3EA7A 4J1YA 1TAWA 2J4IA 2O8MA 3TJNA 5LPRA 1L1GA 2XNIA 1IHSH 3TNTA 3U69H 4YESB 2QF5A 1AUJA 1CGIE 4X2VA 4ZCNA 1GI3A 2A31A 2TBSA 2FOAA 1SL3A 4Y8ZA 4ESTE 3ZZ9A 3A7VA 1KIGH 2QF4A 2BD9A 1NFWA 3RC4A 1NFXA 1GBDA 1O3IA 1EATA 4ABJA 5JDUB 5CHAB 4A1TA 1SLWB 1OX1A 1GMCG 3RXUA 2C3SA 1D6WA 2P3TB 1G9IE 4XBCA 4NZLA 1ZR0A 2BDCA 2ZU3A 3S69A 4JZIA 4O3UA 2ZU1A 1ZZZA 2THFB 1HAOH 1PPHE 5A2MH 3PTBA 2CGAA 3A7WA 5A09A 3ZVGA 2ZTXA 4X1RU 3KEEA 4GHTA 3RXTA 1AB9C 1ABJH 4YZUA 4SGAE 4BTUB 1C5OH 1EB1H 2WPHS 1NBME 1H1BA 1P9SA 4Y6DA 3F2HA 1GL1A 4ZH8A 3QUMP 1SSXA 3OY5U 1GJCB 1PQ8A 2R3YA 3M5OA 6GCHF 3QK1A 1P2OA 1V2QT 1SC8U 1XUKA 3ESTA 1HAPH 1MABB 4MLFB 2J5UA 3Q3YA 2QN5T 5EW2H 2H1UA 3S9CA 4UFGH 1HJ9A 1K1PA 5CE1A 1RD3B 5FPTA 1GBAA 1KLJH 5IDKA 1XKAC 2NWNA 3TK6A 3MH7A 4ZAEA 1TNLA 2CJIA 4HTCH 2FDAA 1EZUC 1LPGB 3MI4A 2KFWA 1FIZA 1O3AA 2SNVA 3ZVBA 1BTPA 2Z9LA 3M61U 1OSSA 3SJ8A 2FOFA 1O2WA 3A8BA 2GVFA 2AMPA 2KAIA 1SLVB 1YPHC 1QHRB 3Q3XA 4IMZA 1A3BH 2ZGXH 4DCDA 5JBAS 3MU0A 2W7SA 2EEKA 3RM2H 3P95A 1K28D 1AZZA 1GVZA 1RGQA 3STIA 3SUFA 2D1JA 1SR5C 5EGMA 1F92A 1O3LA 5L6NH 1GHAG 1LQEA 5LH8A 1JWTA 1HJ8A 4DURA 4X2XA 5GCHF 1DDJA 3ENSB 4XE4A 1O2KA 3N7OA 1QNJA 1IQNA 3RU4D 4CR9A 1O34A 4VGCC 4NIYA 1KXBA 2ZIQH 3RXHA 2OQ5A 2OP9A 2Z6BD 2G00A 2FOHA 1GHXH 1GJ4H 2A4OA 2B9LA 2VH6A 3HATH 3QO6A 5A0CA 1N6XA 2PFEA 2AS9A 1NU9A 1O5DH 4A5TS 3SV8A 3A8DA 5F53A 2ZFQH 2H6MA 1NFUA 3QWCH 3SI3H 2CN0H 3VB3A 5AFYH 1C5WB 3ZZDA 1ESAA 4OM9A 1FXYA 1V2RT 1E35B 3E16B 3UR6A 1DICA 2BX4A 2I6SA 3P8OA 5C5NA 2EI6A 2BVXH 2H9HA 2WPJS 3A7ZA 1A0HB 4CH8B 1AUTC 1MU8B 1WQSA 1SHHB 1CU1A 1F2SE 3PMAB 1O32A 1O2PA 2F91A 1P01A 2VWNA 4JK5A 4O3TA 3QLPH 1D3PB 3DSPA 1WBGB 3CS0A 1HJAB 1P0SH 4IN1A 2K0QA 3LPRA 1ZRKA 1BZXE 3PM3A 5SGAE 1WYKA 2ZPQA 2SGQE 1F0TA 3ATLA 3HPTB 4E7RG 2XRCA 1KDQA 4I8HA 4VGCB 3I77A 2QIQA 1F0SA 3F9FA 1NN6A 2XWAA 3ATIA 3WY8A 4DOQA 6CHAC 4K2YA 1GBIA 2FMJA 4WMEA 2H2ZA 4Y71A 3VPKA 2IN2A 2YMSC 2VBCA 1O5EH 7KMEH 1J16A 1O3EA 3RM0H 3ZYEA 4NIWA 1QBNA 1GJ8B 1BT7A 2XXLA 1F5KU 4BXWA 1TNHA 3ZVCA 2GT8A 3L33A 1WXRA 4I8GA 1ZSLA 1HRTH 1JRSA 3VB5A 4Y7BA 3BG8A 1C2KA 3LGTA 4AYYB 4GVUA 1UJ1A 5ABWA 2Z9GA 2DE9A 4NIVA 3RXOA 2O8TA 1AGJA 3T62A 3BG4C 3ZVAA 1QB6A 1H8DH 3MO9A 2YNAA 5F8TA 1HFDA 1RXPA 1GBKA 2BDBA 5FL7D 4AFQA 4NZQA 1W8BH 1P03A 7ESTE 3P6ZB 1FPCH 1IQJA 3BTFE 2QXGA 5CMXH 4GHQA 2GDEH 4UE7H 2HLDD 2W3IA 1C1OA 3TU7H 4AZ2B 1ELGA 1G32B 1NS3A 2QF3A 3P8FA 2HRVA 2WZQA 4BXSA 1LHFH 2ZI2H 8GCHF 1SFQB 1HAGE 5I46H 3RXFA 1K21H 3MHWU 2JJ2D 1ELDE 6CHAB 4ISLA 2VU8E 2P93A 1W0YH 2AH4X 1CGHA 2Y5FA 1L1NA 3RXVA 3PWCA 1K1IA 1RRKA 3RXIA 2BY6X 1KTSB 2BTCE 4MNYA 1O3OA 1S85A 5J4QA 2KCPA 3E91A 3PO1B 2CF9H 1GBEA 1FAXA 2B5TB 2AHME 4DVAU 2BDYA 1KYNA 1CHOG 1AFQC 2BXUH 1VCQA 3BTGE 4Y79A 2HGTH 4JCNA 4I8LA 1K1LA 1TNIA 3HK6B 2VH0A 2A45B 3GCHC 2WV9A 1XKBC 2BMGB 3K65B 1IQLA 1WUNH 4MPVA 4Y10E 1SKYE 2V35A 2GCTC 3DT0H 1P2IA 1ZHMA 1QURH 3LONA 2P16A 2G81E 1TGBA 7LPRA 4ZKNU 2J95A 3UREA 3P92A 5JYIA 2A4QA 4CRAA 4J2YB 2C8ZB 2AYWA 4JYTA 4U01A 5LPFA 5FBIA 3FP8E 3GY4A 1TRYA 3SNEA 1ETSH 3PLBA 1C2EA 1QTFA 3U98H 3AK5A 1BHXB 1E36B 1L0ZA 2XC5A 1XMNB 2AEIH 1P04A 4BTTB 5FCKA 1A0LA 2JETC 1Y5UT 2UWPA 3ZVFA 3T28A 2BOHB 4BAHB 1HAVA 3UOPA 4AGKA 1GI9B 2Y5GA 5EOKA 1AFQB 1TPAE 1DSTA 1O5FH 4X8TH 2TRMA 3N99A 1PYTC 3GCHB 2OD3B 1ID5H 2BOKA 4HI3A 1H9HE 1A0JA 3EQ0H 5TCCA 3F0PA 3DSOA 3LT3A 1FZZA 3OYPA 1DLEA 2FXRA 4ABHA 3EAJA 2F9VA 3F0OA 3D23A 2JJ1D 1OP8A 3EE0B 1GBLA 3ODDA 4X8VH 3ZZ4A 2OBOA 1P11E 3UNRA 1RFNA 1V2LT 2YOLA 3ZV9A 2R3UA 3SU6A 4K8YA 1DWEH 4NFFA 3M3VA 4JK6A 4K1SA 2XBWA 4OS7A 4ABGA 3LH1A 3UWJH 4RI0A 1QCPA 2PSYA 2A4GA 4ABIA 2ZCLP 1P09A 2J92A 5F6MA 5C0TA 3B9FH 1TYNA 1O37A 1IQEA 1QRZA 1GGDC 1HAXB 3BTHE 1J14A 3BTKE 3HK3B 2W7UA 1ABIH 1V2PT 3DFLA 1KY9A 3VB6A 1Y3WA 1ZSKA 4ABBA 2JETB 1GHZA 1C5LH 5EW1H 3M5LA 1OHHD 2ZEBA 3ZZCA 1DUEA 3O8DA 4X6NA 3TH3H 1HXEH 2I6QA 2ULLA 3SJKA 4IBLH 1J8AA 3PMJA 2GZ8A 1C1RA 1UO6A 1WV7H 2UUJB 4DG4A 1GI2A 3C1KA 1SGIB 2B0FA 1P3EA 3OEHD 4I8KA 2F9OA 4X2YA 4A1VA 4AFUA 3VB4A 1SGFA 1P9UA 1TB6H 1ZTLA 2Y81A 1L2EA 1P2JA 2G4UA 2A4RA 3GY5A 3LC5A 2V6NA 3JZ1B 2JKHA 1EP6A 3BEIB 1ANDA 1BOQA 4X1SU 1QL8A 2WV4A 2STAE 4BAOB 3EYDA 3UB0A 5FPSA 1AVXA 2UUKB 1O2HA 3DA9B 4XOJA 1QA7A 4AGJA 6ESTA 1OOKB 1E34B 2AFQB 4CRDA 3QZRA 1YKTA 1UCYE 2A5AA 4KELA 2FI5E 3SQEE 1NC6A 4X0WU 1ZRBA 1C5ZB 2FOCA 1GGDB 3V12A 1GI8B 2J38A 1P2KA 2JH5D 2ZDVH 9ESTA 1YLCA 2A7HA 1EZXC 4GCHF 1EFRD 2ZWLH 1IQHA 1A5GH 1SQAA 1H8ED 4DGJA 5E8EH 1ZLRA 3A7YA 3KHVA 1DXWA 3SU0A 5DKMA 2SGAA 2QGRA 1YPEH 2ZHWH 2BLQA 1GJ9B 1FV9A 2P94A 4Y11E 3A7TA 3SGQE 5JB8S 3QTVH 1YPMH 4NGAH 5H4IB 1TA2A 1VGCC 2WPKS 4X2WA 3RMNH 2WSSD 4OS5A 4BAKB 1K1NA 4MPXA 2HPQH 4CBOA 1P10A 1S84A 1NFYA 1BTUA 1AQ7A 1MTNC 1GVLA 1MTUA 4A1XA 5A0AE 4UEHH 1DVAH 1ARBA 3A89A 1LHCH 1QA0A 3LOXA 3MOCA 4XDEA 4FETA 2W6ID 1SB1H 2K8IA 2XBXA 3MMGA 4K60A 2XBVA 1KXAA 1TGCA 1SGTA 4E05H 3GDVA 3GY7A 3PYHA 2HNTE 2W3KA 2C8YB 3W1EA 3KQDA 3P70B 3ATMA 5AFZH 3F6UH 2FTMA 3UNSA 2EC9H 1S0QA 1CT2E 2ZDMA 1AHTH 3KIDU 4NA7A 2HOBA 1WOFA 2HLCA 2GD4B 2XCFA 5EG4A 4DT4A 2ZHQH 4MNVA 2DUCA 2ZQ2A 1NY22 3MWIU 5C3NA 1VZQH 1YCPK 4KKDA 4AB9A 4F4OC 1DANH 3M36A 1KMHB 1FX0B 2QXIA 1AMHA 1VGCB 1PQ5A 2BDIA 3MU5A 2D26C 4DY7B 2ZU5A 1BRUP 3K6ZA 1C1WH 4NA8A 1GL0E 4O03A 1MTNB 3SI4H 1SI5H 1SVPA 2A7CA 2VNTA 2UWLA 5AHGH 1D9IA 2XCNA 2FWWA 3TJOA 1WTGH 5T1VA 5CHAC 4IN2A 3S9BA 1NRSH 2VIDA 3RMOH 1EPTC 2ZQ1A 1O2OA 4WMFA 5K7RA 5E2OA 4INLA 1ELCA 4OS2A 1Y3XA 1TRNA 1LKAA 1D3TB 1X7AC 4WF8A 3TK5A 2PW8H 1HAYB 1AO5A 1SGYE 2ZHFH 1J17T 2Z94A 2G5NA 3BTDE 5IYTA 4D7GA 6GCHG 1GJBB 4DT7B 1MU6B 2PUQH 1IQIA 1AU8A 4TY6A 3A85A 3DUXH 1GMHF 2PGQB 2F83A 3FP6E 1C5QA 4X6OA 1ZTJA 3M3TA 1J15A 3U9AH 3LU9B 3ZV8A 2AIPA 1QJ1B 2J94A 4AFSA 3KQBA 1CSOE 2FX4A 4WXVA 3MO6A 3ATKA 1TBRH 2F43B 5FX5A 4MVNA 4XBBA 3PTNA 2FZZA 1GI1A 1BBRH 1SMFE 3WWBA 2ZGJA 4GPGA 1UTJA 1FN6A 2QV1A 8LPRA 1COWD 1EPTB 1EQ9A 2ZP0H 3SUDA 1AFEH 1HNEE 3I78A 1P2QA 3URCA 4I7YH 4X6MA 3QGJA 1C2MA 3TGIE 2RG3A 5LPEA