4I31A

Crystal structure of hcv ns3/ns4a protease complexed with compound 4
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
APITAYSQQTRGLLGCIITSLTGRDKNQVDGEVQVLSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWPAPPGARSMTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFIPVESMETTMRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism by Which a Potent Hepatitis C Virus NS3-NS4A Protease Inhibitor Overcomes Emergence of Resistance.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Genome polyprotein
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4i31A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4i31A01
2ZF0H 1GHYH 1HAPH 4FUJA 1FPHH 3MH6A 5EODA 3FANA 4XE4A 5C5NA 3S9AA 1MTNB 3S7KB 1QA7A 2TGTA 4B75A 1XVOA 2B0FA 1CO7E 3QN7A 1CA0B 1PPEE 3N7OA 4ZKSU 1HAZB 1YPMH 5JPMH 2Y5FA 1DFPA 1YPKH 3S7HB 1RTLA 3BTEE 2Z3DA 1PPBH 3LGTA 4GAWA 1QJ1B 1C5QA 1C2LA 2HNTE 4X8SH 3HATH 4WJG2 6ESTA 1SGIB 2XC4A 3EDXB 1ELVA 2A7JA 9LPRA 4DOQA 1TRYA 1NFWA 1TQ7B 3AVZA 3LGUA 1C1UH 5DP9A 1HB0B 1XKBC 4CREA 4JCNA 4K69A 4YO9A 1V2TT 4GSOA 1P0SH 1WBGB 5IYTA 1G3EA 1WV7H 3KF2A 1F92A 1HAOH 3M5MA 5T3HA 3GISB 1IQKA 1GI2A 2WUBA 3UNQA 2FOFA 2JKHA 4E05H 2H1UA 1QHRB 1HIAB 3F9GA 3PO1C 4LZ1H 2SGQE 2W3IA 4SGAE 1O31A 1AD8H 2A45B 3WY8A 1QJ6B 3SU2A 1NC6A 4X2WA 1LVBA 1PQAA 1EJNA 1GPZA 1A5GH 1T8MA 1W0YH 3BTQE 3JZ1B 3I78A 1ZMNA 1FAXA 1EXFA 3KGPA 1MTWA 5B6OA 1ZMJA 1W0ZU 3UTUH 4WMFA 3VB3A 3NWUA 3UOPA 1N1LA 2WZQA 3LT3A 7ESTE 4Z6AH 3PB1E 1DY9A 1GBMA 5E2OA 3K6YA 5K7RA 1YLDA 2OUAA 1O3AA 5A0CA 1ZSLA 1THSH 3U8TH 4H6SB 1C5MD 1J17T 4Q80A 1BUIA 1SGRE 2ZIQH 1TX6A 3E3TA 1ZHRA 2IPHA 1O2YA 1QQUA 2R2MB 2HNTC 1QL7A 3O8CA 1YPJH 4IW4E 1YC0A 1OYQA 1O3NA 2F91A 3GCHB 1J16A 3GY3A 2PSXA 4DGJA 4E7NA 2GZ9A 2VGCB 4ZXXH 1TPSA 4FUDA 1HJ8A 2CHAC 4JZ1A 1GJBB 1BTZA 4O03A 1LHEH 1UTLM 1GVLA 4TWWA 5LPEA 1Y8TA 1AY6H 1QB6A 2FYRA 1IQLA 4WH8A 1LMWB 3I29A 1HAVB 1G37A 4MNYA 4Q7YA 1VCQA 3LJJA 1P3CA 1P8VC 1MKXK 2EI6A 2PGBB 1C5UA 5F8TA 5J4SA 2AMDA 4Y0ZE 2AERH 1GBTA 3RMMH 1O35A 3KQCA 4X8TH 4AFQA 1C1VH 2VVCA 3SUEA 5LPRA 4CR5A 1AUJA 1Y3YA 1OOKB 5L6NH 2HVXA 3UNRA 3QTVH 3GICB 3U98H 4ISOA 3GCNA 1LHDH 2TIOA 1LQEA 4TY7A 1TMBH 1E38B 1OP0A 2F9BH 2XBXA 5JDUB 1GBEA 1TFXA 1PYTC 1SOZA 3GY5A 4JK6A 4K8YA 1JIMA 1LHGH 1GCTC 3U8RH 1A7SA 1MAYA 1C1WH 3T62A 4BTUB 1KXAA 4UFFH 2WV9A 2PR3A 4X6PA 3AW0A 1SB1H 3TJNA 3HK3B 1NRNH 2FXRA 3TGIE 3STIA 5GIBA 1MQ6A 1V2MT 1O3FA 3SUGA 1ABJH 1VGCC 3TH3H 3DFLA 1DM4B 1KLIH 2VWLA 4CRBA 4TY6A 4UDWH 4OS2A 1V2LT 4ZHLU 3TJVA 1GGDC 2G4TA 3ZVGA 1C9PA 1CT2E 3C27B 5DP8A 1UTJA 1YPLH 4J1YA 1EQ9A 4DURA 4Y6DA 1XUFA 1EAUA 2P3TB 1PPHE 1VCPA 1TNIA 1D6WA 1T8OA 2PUQH 1BCUH 5ESTE 3K65B 1BTWA 3VB7A 6LPRA 4ZH8A 3M3TA 3Q3YA 5HGGA 2FOEA 2CHAB 5EQQA 4ZHAA 3GYLB 5T1VA 5GJ4B 1C1NA 3PROA 3ATWA 4BAHB 2R0LA 1GJ9B 1QURH 4KP0A 3V0XA 1NY22 1O2PA 1SGPE 3MU4A 8GCHF 1YM0A 3SJ8A 2O8MA 1HV7A 1TYNA 4NZLA 1C5VA 1DWDH 1GG6B 4NSVA 4M9FA 3SU5A 1TPAE 4INHA 1C2HA 4BAOB 4RI0A 1GJ7B 1RXPA 3QDZB 3GDVA 2AGEX 3LJOA 4AG2A 1RRKA 3BTTE 4XDEA 1NRPH 3O8DA 1TX8A 3P95A 2GTBA 1KTTB 5AVDA 1N8OC 1GMDG 1XXDA 1T32A 5AHGH 1C1MA 4ABIA 1P2QA 1HBTH 1QY6A 4VGCC 3RLWH 5FXLA 3RXFA 2B5TB 1O32A 4AYYB 3DT0H 2ASUB 1G3BA 4LXBH 2B9LA 1U6QA 2F9NA 3F1SB 4D76A 2CMYA 3BTDE 1NRQH 1V2JT 3LPRA 1SOTA 4Y8YA 5CMXH 1AB9C 2AIPA 1O34A 3SU4A 4CRDA 3RXDA 1O38A 3TJUA 4A1VA 2ZGCA 1Q31A 5HXFA 1KTSB 1SHHB 4IBLH 4FU7A 1YPHE 1AZZA 1UVTH 4HTCH 1SLVB 1D9IA 1BBRK 4AGKA 4A7IB 1O5BB 1Z1IA 4A1XA 3EA8A 4ZUHA 4B71A 5DG6A 2C8YB 5EW2H 1ZPZA 1GJ6A 1THRH 3SV2H 3SGQE 3RXSA 1ZOMA 1V2PT 3D23A 1HAGE 3P8FA 1QIXB 1O2HA 1NPMA 1PYTD 2QF0A 1TMUH 3MFJA 4R8TB 1D3QB 5A0AE 1QNJA 1WYKA 3ZVBA 4B74A 3SUFA 2HRVA 4CHAC 3FFGA 1EUFA 1OS8A 3M7QA 1SQTA 3BTKE 1EB1H 1UCYE 2FOHA 1W12U 1FIWA 1ZRBA 1O36A 1N6XA 3S9CA 3SHCH 3ODFA 5FX6A 1TWXB 3RXGA 4ISNA 2HGTH 1EJMA 4NCYA 4WH6A 2JH0D 4ZXYH 1TNGA 1DWEH 3GDSA 4UD9H 1J15A 1IQMA 1ZPBA 1V2RT 1FDPA 4JZIA 1O2UA 2ALVA 4H4FA 1OWHA 1Q3XA 2PKAA 4HI3A 1SHYA 1GCDA 1SFQB 1CHGA 3E91A 2PGQB 3ZZ7A 2QC2A 2BVXH 3ESTA 1O3GA 2PKSB 5CE1A 3BTME 3R3GB 1CQQA 1P2JA 3MU5A 1IQHA 1Y3VA 4WMDA 4Y8XA 1ETRH 3MU8A 3F68H 4DG4A 2LPRA 1OYTH 3RXIA 1MU6B 1P2KA 2OC1A 1ELCA 4THNH 2FI3E 1WOFA 1O3EA 2ZA5A 1O3OA 2BLWA 2Z3EA 2FMJA 2H9EH 1HLTH 5A8YA 1MD7A 1NM6A 1AKSB 3UIRA 1SGFA 1W13U 3NUMA 1KSNA 2UWOA 2AMQA 3LGIA 2NU3E 2VB0A 4DIHH 5EW1H 1HPGA 1CSOE 4FU9A 4WF8A 4X2XA 3U8OH 6GCHG 1CT4E 4IGDA 1F5RA 1QFKH 4BAMB 1BB0B 5BPEA 2P16A 2SNWA 2FTMA 1C2FA 1ELDE 2FODA 1V2OT 2GP9B 3GY8A 4KGAA 4HFPB 2ZDMA 1C1OA 3MNSA 2ZP0H 3OX7U 2BVSH 1TNHA 3QTOH 1MTVA 1TNKA 3EQ0H 3SYJA 5SGAE 2BDIA 2KAIB 3UY9A 4MNVA 4XBBA 1EX3A 2ZO3H 1K1IA 3SV7A 3L3TA 2F9PA 3TK6A 1FY1A 3UPEA 4AOQA 1DSUA 1H8IH 3UFAA 4E7RG 1DICA 2QXJA 2ZTYA 2A4RA 2LNCA 3LOXA 1Z8RA 2HPQH 1TOCB 4BXSA 1V3XA 1F0TA 1GDQA 1DUEA 1VJAU 1NROH 1EPTB 2FS9A 2PLXA 4FUBA 3RXJA 2R3YA 1FONA 4D8NA 1K1OA 3ELAH 3AW1A 2ZFQH 1PQ7A 3A7ZA 1ZSJA 1GHAF 1EKBB 4A1TA 1KXBA 3AASA 1C5WB 4U30A 1OWDA 5E8EH 3ZZ5A 3A89A 2H9HA 2ZCLP 2FI4E 5FCKA 5EQSA 2V3OH 3TU7H 1K1PA 6GCHF 1ETTH 1QBVH 1Y5BT 2VWOA 5ABWA 1ARBA 1MKWH 5BRRE 2ZFRH 1EPTA 3A8BA 3ATMA 1ZMLA 1ANCA 1JWTA 4Y71A 1BTXA 1JBUH 3MNXA 1CT0E 1S6HA 3MOCA 3QZRA 1JRSA 2BDHA 2Y7XA 3CS0A 4JK5A 1HNEE 5AFYH 3W94A 2Z9JA 4FUEA 2AYWA 2QXHA 2QN5T 4ABEA 1SGCA 4BOHA 1L1JA 2XBVA 3SW2B 1TOMH 5GWZA 2EEKA 1C5ZB 2UUFB 1BHXF 1UO6A 1F5KU 4NIXA 2GDEH 1XX9A 3ODDA 1ANDA 1G9IE 3EE0B 3NK8A 3ZZ4A 4GLYA 2ZU1A 1VITF 5F6MA 3PMAB 3ZZ9A 2WHXA 2ZGBH 1O2RA 1PQ8A 1O2WA 1DVAH 2CF9H 1O2TA 2A4QA 1KXCA 5FPYA 4LK4A 3ATLA 4U2WA 3MI4A 2ZTXA 2G55A 2C4FH 3A88A 1C5LH 1GBKA 3CP7A 1TLDA 3A8CA 4Q7XA 2QIQA 4B76A 1NFXA 2OQUA 1TONA 3AAVA 1BRBE 1L4DA 3VB6A 3VXFH 3QK1A 3E8LA 4SGBE 3M36A 1LVMA 3D62A 5HMAA 3T5FH 4AB9A 2VH0A 3BG4C 3VB4A 1P09A 3SQHE 3LGWA 2A7CA 3OTJE 1OWKA 3A8AA 1CHOG 1FPCH 3AAUA 4AORA 1GDUA 5DGJA 2Y82A 7GCHG 5DPAA 1UVSH 1IQNA 3L6PA 4XOJA 1UJ1A 1H9IE 3RMNH 1ANEA 2NWNA 4X8UH 4NIVA 2J9NA 1UTOA 2ESTE 1YKTA 2BD4A 2FESH 1TGCA 1S0RA 4MPUA 3A87A 3Q3KA 1XKAC 1O5FH 2XYAA 3STJA 1SMFE 5E0GA 4I7YH 5JBCS 2OK5A 2Z94A 2PV9B 5JYIA 3QUMP 2D1JA 3TLOA 1EB2A 1DX5M 3F9HA 4CRGA 2R2WU 4ZKRU 2ZFSA 4ZKNU 3EGKH 1RJXB 5DP3A 3A84A 2CN0H 2B7DH 4K3JA 3D65E 1TB6H 4KTSA 2WV4A 1GHBF 1YPGH 3GCTG 3UREA 4KTUA 3A7YA 1TPOA 3TITA 4I8JA 1V2QT 3MH7A 3M3VA 2O8TA 2SFAA 5TJXA 2Y5GA 3LC3A 1JOUB 4X1QU 1CVWH 2J4IA 1A3EH 3T28A 2ZCKP 4FUGA 1VJ9U 5T6FA 1Q2WA 2PFEA 2F9UA 1O3JA 2VU8E 2FIRH 1C4V2 2ZGXH 3TH4H 3A82A 2F3CE 1BHXB 1TGSZ 1BRCE 1D4PB 1A5IA 2BDCA 3SU3A 2NU0E 2RCEA 4LOYH 4B2CA 3KNXA 2R9PA 1GI6A 2ZKSA 3U69H 1XVMA 2ZHWH 3MH5A 3FAOA 4B2AA 3LU9B 1BMLA 2ZZUH 5F8ZA 4AX9H 1GBIA 1XM1A 2RA0A 2W3KA 1XUHA 1WCZA 4FUIA 1AB9B 2V0BA 1A0JA 1EAXA 3RDZA 4YM9A 1S82A 3PLPA 3A80A 1WSSH 1FZZA 2AEIH 4NWLA 5PTPA 1AQ7A 1DPOA 3BN9A 4YZUA 7GCHF 1QB1A 4NIWA 2UUYA 1D3DB 1GJ8B 1K1MA 1GWAA 2M5TA 4K5ZA 5C1YA 1ZHMA 1C5RA 1NU7B 1O3BA 1MCVA 1HXEH 4B2BA 1DUAA 3SHAH 3FVFB 3KHVA 4YT6H 4I33A 1EPTC 1ZZZA 3KQBA 4YESB 1LPKB 1TRNA 1A46H 1A61H 1C5XB 1P3EA 4JZDH 4FVBA 2Q1JA 5JBBS 4AFZA 5K0HA 1DLEA 1F5LA 3UOUA 4DIIH 1W2KH 2ZNKH 1EOLA 1TBQH 1YF4A 3TGJE 2BXTH 1O2XA 2FWWA 1SFIA 1EAIA 3GOVB 1QBOA 1TIOA 2GZ7A 2STAE 2ZGJA 3A7XA 4PROA 3O8BA 4TPIZ 2EC9H 5E2PA 2QCYA 2ALPA 3SNEA 1O3KA 3PLBA 1XMNB 1TQ0B 3NPSA 2VVUA 4CH2B 1NO9H 5A09A 1FY3A 2GVFA 1O5DH 1NT1A 2BY9X 1XUJA 1HRTH 2J95A 2Z7FE 2QA9E 5EQRA 8ESTE 3E1XB 1G30B 1YPHC 1H8DH 3A7WA 4U01A 1C2MA 1QL8A 3V12A 1YLCA 4X2VA 1LPGB 1NESE 3EA9A 3SJIA 2BLVA 1NFYA 1KDQB 1V6DA 3RXUA 3A83A 1UCYH 1AN1E 1F0UA 1S84A 2GT7A 3UR6A 3ZZCA 4K1EA 5C1UA 4JZEH 2CJIA 2BQ6B 2BQ7B 2ZC9H 2BD7A 3K2UA 1HAVA 3IWMA 1TE0A 2P93A 2TBSA 2WINI 4AZ2B 1OSSA 2P59A 4Q7ZA 1J8AA 1GI8B 2YNAA 1C2KA 5LH8A 2BLQA 2BDBA 1P10A 1WAYB 4ABGA 4JZFH 3URCA 2NU2E 3HGNA 3GYMA 5HM9A 1O2QA 1FAKH 2Y5HA 2FZZA 3RXLA 2Y81A 2CGAA 1ZHPA 1O2GH 2C8XB 3R0FA 4IMZA 1YCPH 3BEUA 3NXPA 1QJ7B 1SI5H 1HXFH 1GCTB 3RUOA 2W5EA 3S0NA 4NFFA 3TNTA 1MMJN 4B73A 1J9CH 1QRZA 1DWCH 4MG3A 1ZSKA 2ILNA 1T31A 5G4BA 1P03A 3F6UH 1UCYK 1D6RA 1WU1A 1GI5A 1MUEB 1SVPA 2IOTA 3Q00A 3ZVCA 5C2ZA 1C2GA 4GUXA 1ZYOA 1AVXA 2HWLB 4CR9A 2BQWB 1TALA 1FIZA 3A7VA 4F4OC 2GKVE 3S69A 1QR3E 2WV5A 2H5CA 2XRCA 2FOCA 1TGBA 2Y6TA 3Q77A 2K1QA 2ZPQA 4TYDA 1K1JA 3PWCA 1P06A 4D7FA 2SGPE 1FV9A 4H6TA 2GT8A 3VFEA 2BVRH 3P8GA 1N8OB 3B23B 2F9VA 3ZZDA 4MPXA 1BDAA 2ZFTA 1NRRH 2CXVA 2PSYA 4NWKA 1PJPA 1BA8B 1YCPK 1HJAC 1ANBA 1K28D 4HZHA 1WTGH 3F9FA 3SV8A 4DJZB 3M7TA 8KME2 1XXFA 3QWCH 1K2I1 3RXCA 5DP4A 1BBRE 2GMTB 2V35A 2BDYA 2ULLA 2FX6A 3CS7A 4FUFA 2A31A 3V13A 3RM0H 1BTPA 3ZZ3A 2RA3A 1MCTA 2BM2A 3BG4B 4XSKU 4Y11E 4OS5A 3RXPA 5DKMA 2HOBA 3SI3H 2BXUH 1TBRH 4X0WU 4YLUA 2J34A 2AMPA 2H2ZA 1AVWA 2R0KA 4A92A 3PMJA 1AHTH 3U9AH 1K21H 1QCPA 1NFUA 1SPJA 1P02A 1AUTC 4WXVA 2P8OB 3ZVEA 5C20A 3GDUA 4KELA 1P2OA 4NFEA 4D9RA 1C2JA 2IN2A 5A0BA 5HYOA 3TGKE 4YTAA 1AE8H 2WPLS 4O3UA 2A4GA 4OS4A 4ABDA 1GG6C 4AG1A 5E0JA 1MU8B 3Q3XA 2C90B 1A1RA 3URDA 1QB9A 1HIAA 2RDLA 1D3PB 2OP9A 3TIUA 1GBLA 4ZHMU 1BMAA 4ESTE 1O2IA 1O3DA 2GZ8A 3JZ2B 1NN6A 2FOAA 1CGIE 2ZG0H 1E0FD 2BY6X 2FPZA 3UWIA 1GBFA 3VPKA 1QQ4A 1KLJH 1KXEA 4BNRA 3L33A 1GI9B 1O3MA 3G01A 2BOKA 2Y80A 9ESTA 1S83A 1O0DH 1AGJA 1HYLA 1HCGA 1SQOA 1CA8B 3A85A 2JH6D 1P2IA 1FNIA 4I8KA 1O5CB 5T6DA 1O2LA 2FEQH 2BD2A 3FP7E 5AF9H 4IMQA 2VIQA 2OXSA 1B5GH 1MKWK 1FN8A 2ZFFH 5IDKA 1GMHF 3SZEA 1DOJA 1C5PA 3RU4E 4MPVA 1W7XH 1HGTH 2A1DB 4BTIB 2GDDA 1MZAA 1MAXA 1UVPA 1UTPA 1BTHH 4MPWA 1O2VA 2ANMH 3ZVDA 5EPYA 2A5IA 3O8RA 1GI3A 2P3FH 4A6LA 2GGVB 4I8GA 2RG3A 1GBDA 4X2YA 1UK2A 3UWJH 4Z0KA 3RC5A 1L1GA 4JYTA 4NG9H 3RXOA 4DW2U 1TPPA 4B6FA 1P57B 1DE7H 3ZZ6A 1EOJA 5EXLA 1FJSA 2GD4B 3KEEA 1MBMA 2XBYA 2ZQ2A 3MMGA 1S5SA 1Y3XA 4WVPE 1CGHA 1ESBA 1TA2A 2IJOB 3M61U 4RN6A 3TJOA 4IN2A 2PTCE 2ZHQH 4ISLA 5ETXA 2P94A 2ODPA 4ZROA 1EZXC 3E16B 4AFUA 4YOIA 2ZQ1A 5L2ZH 2OLGA 3RMLH 1GVZA 3ZZAA 3SU0A 1AFQB 2C8ZB 1ELBA 1V2VT 2ZU5A 1ZGVA 3PV4A 2XWAA 4MDSA 3ZZ8A 4FUCA 3BIUH 1F0RA 1CHOF 1KY9A 1GL1A 4AN7A 3SGBE 2SGEE 5FCRA 4HGCA 1O5EH 4ABBA 1BQYA 1IQFA 1GHWH 2W26A 4GCHF 3BTGE 1V2WT 2ZU3A 2C3SA 1X7AC 2ZHFH 1L4ZA 1SL3A 2QV1A 5TCCA 1C5NH 4KKDA 1O3CA 3T26A 2FM2A 2O8WA 1INCA 2G00A 1G3CA 3QZQA 4MTBA 1NTPA 3RXBA 1GBHA 5FHTA 1FLEE 1EAWA 2JETB 1TNJA 2BHGA 3DHKH 1Y59T 2VJ1A 1F0SA 4ABAA 5LGOA 1TABE 1OPHB 1BRUP 3QGNB 3PMBB 3MHWU 1Z8IB 1HJAB 1K1NA 5DK1A 3SJ9A 3M35A 3LIWA 1IAUA 2XCNA 1UVUH 2V3HH 1YP9A 2OTVA 3SNBA 4IN1A 3LONA 1FN6A 2ODYB 3BV9B 3RXAA 4X1RU 2OBQA 3BG8A 4F49A 4INLA 2GCHF 5FX5A 2ZTZA 3GY2A 1RIWB 1GHBG 1DXWA 1DS2E 2SNVA 4CH8B 4NSYA 3LC5A 1L1NA 1C2EA 4CHAB 1BJVA 4Y7BA 1TRMA 1NRSH 2Z9KA 1QGFA 1AWHB 1FXYA 1G3DA 1B0EA 1Z8GA 5AFZH 1LQDB 2FOBA 1Z6JH 1ACBE 2C8WB 2YNBA 1PPCE 2O8LA 1RS0A 1MH0A 4UFEH 4X8VH 5C5OA 1HAYB 1O33A 2PHBA 3I77A 3U1JB 4X6NA 4BAKB 4A5TS 3T25A 1S6FA 4MQAA 4QT8C 1IHTH 3MU1A 3RC6A 1GHZA 1ZJKA 2XCFA 1MTUA 2G81E 2GV6A 3SU6A 5CHAC 2Z3CA 2AIQA 5EGMA 4X1NU 2BD9A 1O2MA 2AGIX 1C2IA 2A5AA 1P01A 2ZCHP 2NU1E 4WY3A 3B9FH 2I6SA 1BOQA 1PPFE 1AMHA 3BTWE 2A32A 1EATA 1Z7KA 3P70B 2VIOA 1ELFA 2D8WA 4IS5A 2FS8A 2BD8A 3U1IB 1MBQA 1GL0E 2XWBI 1ORFA 1AVGH 2CF8H 3RP2A 2A2QH 1AFEH 3VGCB 1IQEA 3DD2H 4ZMAH 1C1QA 1K9OE 1LPZB 2Q6FA 4JYUH 2VIVA 1A5HA 5C67A 1Y5UT 2P95A 2ZFPH 5DP7A 1L0ZA 2BLOA 2A4OA 1MTNC 1N6YA 3M5LA 2JETC 1E35B 3E0NB 3SNDA 3Q76A 3OTPA 1GVKB 1W11U 1UTKA 1MD8A 1SSXA 1GBCA 2FOMB 3QX5H 1WTHD 3DFJA 3F9EA 1WQSA 3EYDA 3NKKA 4IC5A 1RFNA 3ZVFA 4CRAA 2AS9A 1FI8A 4I32A 4DCDA 5JB9S 2GCTB 2FLRH 1Y5AT 2OC8A 4ISHH 1UTQA 1QRXA 1ZPCA 1EJAA 2SGAA 1B0FA 2SGDE 2ZHEH 3EA7A 1GJ5H 4UEHH 2ZDNA 3VGCC 1RD3B 3GY4A 3HK6B 3SN8A 3KL6A 3A8DA 3RU4D 1THPB 2GX4A 4AFSA 3BTHE 3KCGH 3RXVA 4ZKOU 5DO4H 1SLWB 3UUZA 3E6PH 1C4U2 3RXQA 3P92A 4XFQA 1KYNA 3C1KA 3IG6B 1S81A 1NZQH 4OS7A 2Z9LA 4GCHG 1GJ4H 3SZNA 2TGPZ 2EA3A 3QGJA 1ZJDA 3TK5A 3GY6A 1Z1JA 1P12E 2THFB 4CRFA 2PKSC 3MO9A 1V2KT 2XC5A 2A0QB 1GHVH 3RXTA 1SGTA 2FI5E 1JMOH 1O3PB 3MYWA 2VGCC 5A2MH 1QRWA 2PWXA 3GCHC 1FQ3A 2PW8H 2AFQB 4JMYA 4M7GA 2XXLA 3LGVA 3RC4A 2WPIS 4CRCA 2VIPA 1GMCF 1PPGE 2ANYA 4K1TA 5LPFA 1M9UA 2GCHG 4LZ4B 5FBEA 2ODQA 1HAXB 2QXIA 1LVYA 1P11E 2HNTF 3SU1A 1K22H 2DE9A 1S0QA 1SG8B 4Y8ZA 1H4WA 3E90B 1YGCH 1BIOA 2ZI2H 4UFDH 1J14A 1VR1H 3P8OA 3TH2H 3ZZBA 2ZHDA 2BOHB 1O3HA 2OCVB 4TWYA 4NA7A 4DT7B 3NCLA 2G5NA 8LPRA 2Z9IA 4OM9A 4FXGH 4UONA 2OC7A 2BD3A 4JYVH 1ESAA 2QY0B 1CGJE 1A2CH 1G2MA 1UK3A 3BSQA 3SV9A 4INKA 1DDJA 3ZYEA 3LDXH 4Y7AA 3SGAE 4ZAEA 1Z71A 3PV2A 1K1LA 3DA9B 4H42U 1RTFB 1OP2A 6CHAC 1ETSH 3ZV9A 2KAIA 3BEIB 3H7OA 4GHTA 3DUXH 3TK9A 3HKJB 3NZIA 1YBWA 3KIDU 1OWIA 5A8XA 1C5YB 1NS3A 2FO9A 1ZTLA 2VINA 2VIWA 3ZV8A 1DWBH 1XUIA 1S85A 2XBWA 2VWMA 3A81A 3PTNA 5FPTA 3RXHA 1BTUA 1ABIH 2W7UA 5E0HA 5GCHG 1BT7A 1TA6A 3BEFB 1P2MA 5EOKA 3QLPH 1GMDF 2BDGA 3MTYA 1Z6EA 4OS1A 3MH4A 1C2DA 1C5OH 2FP7B 1ELTA 2BMGB 1KIGH 1AIXH 1A3BH 1C5SA 1LDTT 3GY7A 4I8HA 3BF6H 2OQ5A 1ARCA 4MVNA 2OINA 3H09A 3ITIA 2EI8A 5C3NA 1HAIH 1O2SA 1QBNA 2AH4X 3TPIZ 3BTFE 2P8OC 1DSTA 4U32A 2ZDAH 1FY5A 7KMEH 3SJKA 2WYJA 4NGAH 4R0IA 1O2NA 1GBJA 4FVDA 1TAWA 1P9UA 1GI4A 2SGFE 4I31A 1TBZH 3VXEH 1IOEA 1VZQH 1H1BA 1Y3WA 2QXGA 1ZLRA 4MLFB 4D9QA 1WUNH 2XNIA 3A7TA 2XTTB 2H9TH 5I25A 1IQJA 1GJDB 1UHBA 1DLKB 1RTKA 2DE8A 1EZQA 4YLQH 2FYQA 2FOGA 3PTBA 2GCTC 1GBBA 1GDNA 2Q6GA 1C9TA 2CV3A 3RMOH 4B6EA 4K1SA 4DVAU 3SOSA 3UR9A 2QGRA 4ABFA 2QYIA 3OY5U 1ID5H 1VITG 2BY8X 1GJAB 4CBOA 2TGAA 3OSYA 1HFDA 2HLCA 4RKOB 3IITA 1UHBB 1LHCH 1QTFA 1HAHH 1SC8U 2AGGX 4OS6A 1EP6A 1YPEH 1OWJA 3RU4T 2ZWLH 2WPKS 5JB8S 1G32B 2BDAA 3KN2A 4ABHA 3P8NA 7LPRA 1LO6A 1AU8A 1D3TB 2BD5A 3CENA 3MNCA 3T2NA 3FP6E 1GI1A 5T6GA 1FMGA 4X1SU 3MWIU 2BZ6H 3PYHA 2HALA 1SLUB 2ANWA 1GGDB 1AZ8A 3E0PB 1O5GH 2G5VA 4RSPA 1OX1A 2C93B 1F2SE 4UE7H 1ZTJA 1P04A 4O97A 2TRMA 4NA8A 5JBAS 1HUTH 1MQ5A 2ANKH 2BZAA 3M7UA 1BJUA 3PLKA 2ZDVH 2UWLA 5FAHA 3PMHB 3LH3A 3SJOA 1O2OA 1MKXH 3V3MA 4BANB 1GHAG 1G2LA 1W7GH 5F8XA 1O3LA 1T8NA 1ZRKA 5L2YH 3UNSA 5F03A 4X6OA 2PTNA 2WPHS 3RXEA 1GI7B 4E06H 3VB5A 1IQGA 4YT7H 4O3TA 2HPPH 1LVOA 2IJD1 1SLXB 1KXDA 2WPJS 3M3SA 3PM3A 1P05A 2F4LA 2QF3A 4WMEA 3LKWA 3ZYDA 4XBCA 5GDSH 3AK5A 1YYY1 1UVOA 3M37A 1OP8A 2ZPSA 3T29A 1A0LA 3SO3A 2GV7A 4K60A 5L30H 2BB4A 2DUCA 5I46H 1EZUC 1KXFA 1VCWA 1O3IA 3HKIB 3MNBA 4GVUA 1TNLA 1Y3UA 2OBOA 4VGCB 1AWFH 3RM2H 4AGJA 3SNAA 4Y10E 3P17H 3K9XB 1TGTA 1A0HB 6CHAB 2PKAB 1V2UT 1EP5A 5CHAB 4D7GA 4BAQB 1RGQA 1W10U 1GBAA 1B7XB 2F83A 1A4WH 5FBIA 4ISIH 4YOGA 5GPIB 1ESTA 1TX7A 1YCPM 1GHXH 1XUKA 1F7ZA 3HGPA 1GMHG 4X1PU 1BMNH 3FZZA 1VGCB 3SBKA 1FY8E 1MZDA 2UWPA 2XC0A 1ELAA 3OYPA 2EI7A 4GHQA 2TPIZ 4NZQA 5EU8A 5HM2A 3UQVA 1EZSC 1C1SA 2OD3B 4Q2KA 1PFXC 1LHFH 4I8LA 2Z9GA 4ABJA 1OXGA 1TMTH 2UUJB 2YOLA 1OKXA 3B8JA 5EG4A 1AKSA 2D2DA 1CE5A 2J38A 3RXKA 1SGDE 1C5TA 3K6ZA 3RLYH 3SQEE 2VIDA 2J94A 2R3UA 2G8TA 1AI8H 2VNTA 1W3CA 1G36A 1CU1A 1SGEE 1CBWC 1LKAA 1C1RA 1ZR0A 5EXNA 3A86A 1UTMA 5GXPA 3PO1B 1C1PA 1SQAA 1V2ST 1GMCG 2B8OH 5A8ZA 1AFQC 4MNWA 2P3UB 1P9SA 2G52A 2I6QA 3RXMA 2VVVA 3BIVH 2QAAA 1DT2A 4WWYA 1JIRA 1AO5A 1AE5A 1EASA 3TVJB 4DY7B 4XBDA 1HDTH 8GCHG 1DITH 2ZDLA 1SBWA 1Z8JB 2FTLE 2BY5X 1LKBA 1C1TA 1DXPA 3LGYA 4YOJA 1GJCB 2D26C 1WQVH 4BXWA 2W7SA 4KTCA 4WXIA 1DANH 2ZECA 5H4IB 2WUCA 1DY8A 1T8LA 4Y79A 2TGDA 2J2UA 2XW9A 1NU9A 1BBRH 3D49H 2J92A 1SR5C 3MO3A 1O5AB 4IC6A 3TNSA 4K8BA 2PUXB 2VWNA 4O9VA 1FUJA 3MU0A 3MO6A 1RIWC 1WXRA 3GCOA 5J4QA 3ZVAA 5EPNA 1BMMH 3RXRA 1VITH 1GI0A 3LH1A 3SUDA 1BRAA 1W8BH 1O2KA 3HPTB 1T4UH 5DP5A 1W14U 3ATKA 3SNCA 1P2NA 1SGNE 5ESBA 2BTCE 3M5OA 1QL9A 4FU8A 4NA9H 1BTYA 2FDAA 3M5NA 1T7CA 2ZEBA 1CBWB 1O37A 2WPMS 2F9OA 4OGXA 1LTOA 2Z6BD 5GNDA 5JBTA 1SGFG 1KDQA 3S9BA 2O9QA 3W95A 2BX4A 2G51A 3KQDA 1T4VH 2A2XH 4AYVB 2A5KA 4MNXA 3ATIA 1UMAH 2G4UA 1FY4A 1HJ9A 2V6NA 2O8UA 3P6ZB 1H9HE 1JRTA 1L2EA 1KLTA 4AB8A 4Y0YE 1O30A 4FUHA 2ZDKA 1E34B 2H5DA 2FLBH 1JXPA 1LCYA 1O2JA 1OWEA 3ENSB 2BY7X 4RKJB 3KQEA 5DJ7A 4NIYA 1V2NT 1E37B 3T27A 2BX3A 3UQOA 5FPSA 1PPZA 1O2ZA 2ZU4A 3V7TA 2FX4A 4Y76A 5EXMA 1ELGA 3FP8E 4BTTB 1SGYE 3H5CB 3SI4H 2VH6A 4UFGH 4TPYA 1ZTKA 2BYAX 5GCHF 4OGYA 3SV6A 1BZXE 2VBCA 1UTNA 1UK4A 2ZU2A 3VEQB 1IQIA 1BITA 3PV5A 4J2YB 2JH5D 1H9LB 3EAJA 4ASHA 3QO6A 3GCTF 4K2YA 3OY6U 5DP6A 3OU0A 2GMTC 3H7TA 1O39A 2A7HA 1ELEE 2WYGA 5B6LA 2UUKB 3FZDA 2Q6DA 1TGNA 2STBE 4B1TA 1PQ5A 2Y7ZA 4GPGA 2ZPRA 5TCAA 3SORA 1IHSH 1QA0A 5C1XA 1XUGA 1SGQE 2ZGHA 4CBNA 1CA0C 1C4Y2 2OC0A 4X6MA 3PWBA 1ZGIA 1MTSA 1E36B 2H6MA 2NU4E
chains in the Genus database with same CATH superfamily
2ZF0H 1GHYH 1HAPH 4FUJA 1FPHH 3MH6A 5EODA 3FANA 4XE4A 5C5NA 3S9AA 1MTNB 3S7KB 1QA7A 2TGTA 4B75A 1XVOA 3F3BA 2B0FA 1CO7E 3QN7A 1CA0B 2LP6A 1PPEE 3N7OA 4ZKSU 1HAZB 1YPMH 5JPMH 2Y5FA 1DFPA 1YPKH 3S7HB 1RTLA 3BTEE 2Z3DA 1PPBH 2EQNA 3LGTA 4GAWA 1QJ1B 1C5QA 1C2LA 2HNTE 4X8SH 3HATH 4WJG2 6ESTA 1SGIB 2XC4A 3EDXB 1ELVA 2A7JA 9LPRA 4DOQA 1TRYA 1NFWA 5KGOA 1TQ7B 3AVZA 3LGUA 1C1UH 4I86A 5DP9A 1HB0B 1XKBC 4CREA 4JCNA 4K69A 3FO8D 4YO9A 1V2TT 4GSOA 1H8HD 1P0SH 1WBGB 5IYTA 1G3EA 1WV7H 3KF2A 1F92A 1HAOH 3M5MA 5T3HA 3GISB 1IQKA 1GI2A 2WUBA 3UNQA 2FOFA 2JKHA 4E05H 2H1UA 1QHRB 1HIAB 3F9GA 3PO1C 4LZ1H 2SGQE 2W3IA 4SGAE 1O31A 1AD8H 2A45B 3WY8A 1QJ6B 3SU2A 1NC6A 4X2WA 1LVBA 1PQAA 1EJNA 1GPZA 1A5GH 1T8MA 1W0YH 3BTQE 2V7QD 3JZ1B 3I78A 4AC9A 1ZMNA 1FAXA 1EXFA 3KGPA 1MTWA 5B6OA 1ZMJA 1W0ZU 3UTUH 4WMFA 3VB3A 3NWUA 3UOPA 1N1LA 2WZQA 4P02A 3LT3A 7ESTE 4Z6AH 3PB1E 1DY9A 1GBMA 5E2OA 3K6YA 5K7RA 1YLDA 2OUAA 1O3AA 5A0CA 1ZSLA 1THSH 3U8TH 4H6SB 1C5MD 1J17T 4Q80A 1BUIA 1SGRE 2ZIQH 1TX6A 3E3TA 1ZHRA 2IPHA 1O2YA 1QQUA 2R2MB 2HNTC 1QL7A 3O8CA 3DCLA 2YMSD 1YPJH 4IW4E 1YC0A 1OYQA 1O3NA 2F91A 3GCHB 1J16A 3GY3A 2PSXA 4DGJA 4E7NA 2GZ9A 2VGCB 5DN6D 4ZXXH 3DSGA 1TPSA 4FUDA 1HJ8A 2CHAC 4JZ1A 1GJBB 1BTZA 4O03A 1LHEH 1UTLM 4ACBA 1GVLA 4TWWA 5LPEA 1Y8TA 1AY6H 1QB6A 2FYRA 1IQLA 4WH8A 1LMWB 3I29A 1HAVB 1G37A 4MNYA 4Q7YA 1VCQA 3LJJA 1P3CA 1P8VC 1MKXK 2EI6A 2PGBB 1C5UA 5F8TA 5J4SA 2AMDA 4Y0ZE 2AERH 1GBTA 3RMMH 1O35A 3KQCA 4X8TH 4AFQA 1C1VH 2VVCA 3SUEA 5LPRA 2IPQX 4CR5A 1AUJA 1Y3YA 5DSFA 1OOKB 5L6NH 2HVXA 3UNRA 3QTVH 3GICB 3U98H 4ISOA 2JJ2D 3GCNA 1LHDH 2TIOA 1LQEA 4TY7A 1TMBH 1E38B 1OP0A 2F9BH 2XBXA 5JDUB 1GBEA 1TFXA 1PYTC 1SOZA 3GY5A 4JK6A 4K8YA 1JIMA 1YY3A 1LHGH 5EIYA 1GCTC 3U8RH 1A7SA 1NBMD 1MAYA 1C1WH 3T62A 4BTUB 1KXAA 4UFFH 2WV9A 2PR3A 4X6PA 3AW0A 1SB1H 3TJNA 3HK3B 1NRNH 2FXRA 3TGIE 3STIA 5GIBA 1MQ6A 1V2MT 1O3FA 3SUGA 1ABJH 1VGCC 3TH3H 3DFLA 1DM4B 1KLIH 2VWLA 4CRBA 4TY6A 4UDWH 4OS2A 1V2LT 4ZHLU 3TJVA 1GGDC 2G4TA 3ZVGA 1C9PA 1CT2E 3C27B 5DP8A 1UTJA 1YPLH 4J1YA 1EQ9A 4DURA 4Y6DA 1XUFA 1EAUA 2P3TB 1PPHE 3KQ5A 1VCPA 1TNIA 1D6WA 1T8OA 2PUQH 1BCUH 5ESTE 3K65B 1BTWA 3VB7A 6LPRA 4ZH8A 3M3TA 3Q3YA 5HGGA 2FOEA 2CHAB 5EQQA 4ZHAA 3GYLB 5T1VA 5GJ4B 1C1NA 3PROA 2M2AA 3WWBA 3ATWA 4BAHB 2R0LA 1GJ9B 1QURH 4KP0A 3V0XA 1NY22 1O2PA 1SGPE 3MU4A 8GCHF 1YM0A 3SJ8A 2O8MA 1HV7A 1TYNA 4NZLA 1C5VA 1DWDH 1GG6B 4NSVA 4M9FA 3SU5A 2K8IA 1TPAE 4INHA 1C2HA 4RI0A 4BAOB 1GJ7B 1RXPA 3QDZB 3GDVA 2AGEX 3LJOA 4AG2A 1RRKA 3BTTE 4XDEA 1NRPH 3O8DA 1TX8A 3P95A 2GTBA 1KTTB 5AVDA 1N8OC 1GMDG 1XXDA 1T32A 5AHGH 1C1MA 4ABIA 1P2QA 1HBTH 1QY6A 4VGCC 3RLWH 5FXLA 3RXFA 2B5TB 1O32A 4AYYB 3DT0H 2ASUB 1G3BA 4LXBH 2B9LA 1U6QA 2F9NA 3F1SB 4D76A 2CMYA 3BTDE 1NRQH 1V2JT 3LPRA 1SOTA 4Y8YA 5CMXH 1AB9C 2AIPA 1O34A 3SU4A 4CRDA 3RXDA 1O38A 3TJUA 4A1VA 2ZGCA 1Q31A 5HXFA 1KTSB 1SHHB 4IBLH 4FU7A 1YPHE 1AZZA 1UVTH 4HTCH 1SLVB 1D9IA 1BBRK 4AGKA 4A7IB 1O5BB 1Z1IA 4A1XA 3EA8A 4ZUHA 4B71A 5DG6A 2C8YB 5EW2H 1ZPZA 1GJ6A 1THRH 3SV2H 3SGQE 3RXSA 1ZOMA 1V2PT 3D23A 1HAGE 3P8FA 1QIXB 1O2HA 1NPMA 1PYTD 2QF0A 3WW7A 1TMUH 3MFJA 4R8TB 1D3QB 5A0AE 1QNJA 1WYKA 3ZVBA 4B74A 3SUFA 2HRVA 3PRDA 4CHAC 3FFGA 1EUFA 1OS8A 4HG6A 3M7QA 1SQTA 3BTKE 1EB1H 1UCYE 2FOHA 2J5UA 1W12U 1FIWA 1ZRBA 1O36A 1N6XA 3S9CA 3SHCH 3ODFA 5FX6A 1TWXB 1W0KD 3RXGA 4ISNA 2HGTH 1EJMA 4NCYA 4WH6A 2JH0D 4ZXYH 1TNGA 1DWEH 3GDSA 4UD9H 1J15A 1IQMA 1ZPBA 1V2RT 3EE7A 1FDPA 4JZIA 1O2UA 5C17A 2ALVA 4H4FA 1OWHA 1Q3XA 2PKAA 4HI3A 1SHYA 2YMSC 1GCDA 1SFQB 1CHGA 3E91A 2PGQB 3ZZ7A 2QC2A 2BVXH 3ESTA 1O3GA 2PKSB 5CE1A 3BTME 3R3GB 1CQQA 1P2JA 3MU5A 1IQHA 1Y3VA 4WMDA 4Y8XA 1ETRH 3MU8A 3F68H 4DG4A 2LPRA 1OYTH 3RXIA 1MU6B 1P2KA 2OC1A 1ELCA 4THNH 4ASUD 2FI3E 1WOFA 1O3EA 2ZA5A 1O3OA 2BLWA 2Z3EA 2FMJA 2H9EH 1HLTH 5A8YA 1MD7A 1NM6A 1AKSB 3UIRA 1SGFA 2KCAA 1W13U 3NUMA 1KSNA 2UWOA 2AMQA 3LGIA 2NU3E 2VB0A 4DIHH 5EW1H 1HPGA 1CSOE 4FU9A 4WF8A 4X2XA 3U8OH 6GCHG 1CT4E 4IGDA 1F5RA 1QFKH 4BAMB 1K0HA 1BB0B 5BPEA 2P16A 2SNWA 2FTMA 1C2FA 1ELDE 2FODA 1V2OT 2GP9B 3GY8A 4KGAA 4HFPB 2HVYB 2ZDMA 1C1OA 3MNSA 2ZP0H 3OX7U 2BVSH 1TNHA 3QTOH 1MTVA 1TNKA 3EQ0H 3SYJA 5SGAE 2BDIA 2KAIB 3UY9A 4MNVA 4XBBA 1EX3A 2ZO3H 1K1IA 1W0JD 3SV7A 3L3TA 2F9PA 3TK6A 1FY1A 3UPEA 4AOQA 1DSUA 2KZ4A 1H8IH 3UFAA 4E7RG 1DICA 2QXJA 2ZTYA 2A4RA 2LNCA 3LOXA 1Z8RA 2HPQH 1TOCB 2AHME 4BXSA 1V3XA 1F0TA 1GDQA 1DUEA 1VJAU 1NROH 1EPTB 2FS9A 2PLXA 4FUBA 3RXJA 2R3YA 1FONA 4D8NA 1K1OA 2J98B 1KMHB 3ELAH 3AW1A 2ZFQH 1PQ7A 3A7ZA 1ZSJA 1GHAF 1EKBB 4A1TA 1KXBA 3AASA 1C5WB 4U30A 1OWDA 5E8EH 3ZZ5A 3A89A 2H9HA 2ZCLP 2FI4E 5FCKA 5EQSA 2V3OH 3TU7H 1K1PA 6GCHF 1ETTH 1QBVH 1Y5BT 2VWOA 2WPDD 1ARBA 1MKWH 2YMSB 5ABWA 5BRRE 2ZFRH 1EPTA 3A8BA 3ATMA 1ZMLA 1ANCA 1JWTA 4Y71A 1BTXA 1JBUH 3MNXA 1CT0E 1S6HA 3MOCA 3QZRA 1JRSA 2BDHA 2Y7XA 3CS0A 4JK5A 1HNEE 5AFYH 3W94A 2Z9JA 4FUEA 2AYWA 2QXHA 2QN5T 4ABEA 1SGCA 4BOHA 1L1JA 2XBVA 3SW2B 1TOMH 5GWZA 2EEKA 1C5ZB 2UUFB 1BHXF 1UO6A 1F5KU 4NIXA 2GDEH 1XX9A 3ODDA 1ANDA 1G9IE 2XOKD 3EE0B 3NK8A 3ZZ4A 4GLYA 2ZU1A 5EJ1A 1VITF 2F43B 5F6MA 3PMAB 2WHXA 3ZZ9A 2ZGBH 1O2RA 1PQ8A 1O2WA 1DVAH 2CF9H 1O2TA 2A4QA 1KXCA 5FPYA 4LK4A 3ATLA 5EJLA 4U2WA 3UAIC 2K0QA 3N99A 3MI4A 1COWD 2ZTXA 2G55A 2C4FH 3A88A 1C5LH 1GBKA 3CP7A 1TLDA 3A8CA 4Q7XA 2QIQA 4B76A 3FKSD 1NFXA 2OQUA 1TONA 3AAVA 1BRBE 1L4DA 3VB6A 3VXFH 3QK1A 3E8LA 4SGBE 3M36A 1LVMA 3D62A 5HMAA 3T5FH 4AB9A 2VH0A 3BG4C 3VB4A 1P09A 3SQHE 3LGWA 2A7CA 3OTJE 1OWKA 3A8AA 1CHOG 2QF5A 1FPCH 3AAUA 4AORA 5C0UA 1GDUA 5DGJA 2Y82A 7GCHG 5DPAA 1UVSH 1IQNA 3L6PA 4XOJA 1UJ1A 3OE7D 1H9IE 3RMNH 1ANEA 2NWNA 4X8UH 4NIVA 2J9NA 1UTOA 2ESTE 1YKTA 2BD4A 2FESH 1TGCA 1S0RA 4MPUA 3A87A 3Q3KA 1XKAC 1O5FH 2XYAA 3STJA 1SMFE 5E0GA 2OK5A 5JBCS 4I7YH 2Z94A 2PV9B 4TSFD 3QUMP 2D1JA 3TLOA 5JYIA 1EB2A 1DX5M 3F9HA 4CRGA 2R2WU 3W1EA 4ZKRU 2ZFSA 4ZKNU 3EGKH 1RJXB 5DP3A 3A84A 2CN0H 2B7DH 4K3JA 3D65E 1TB6H 4KTSA 2WV4A 1GHBF 1YPGH 3GCTG 3UREA 4KTUA 3A7YA 1FX0B 1TPOA 3TITA 4I8JA 1V2QT 3MH7A 3M3VA 2O8TA 2SFAA 5TJXA 2Y5GA 3LC3A 1JOUB 4X1QU 1CVWH 2J4IA 1A3EH 3T28A 2ZCKP 4FUGA 1VJ9U 5T6FA 1Q2WA 2PFEA 2F9UA 1O3JA 2VU8E 2FIRH 1C4V2 2ZGXH 3TH4H 3A82A 2F3CE 1BHXB 1TGSZ 1BRCE 1D4PB 3VG8A 1A5IA 2BDCA 3SU3A 2NU0E 2RCEA 4LOYH 4B2CA 3KNXA 2R9PA 1GI6A 2ZKSA 3U69H 1XVMA 2ZHWH 3MH5A 3FAOA 4B2AA 3LU9B 1BMLA 2ZZUH 5F8ZA 4AX9H 1GBIA 1XM1A 2RA0A 2W3KA 1XUHA 1WCZA 4FUIA 1AB9B 2V0BA 1A0JA 1EAXA 3OAAD 3RDZA 4YM9A 1S82A 3PLPA 3A80A 1WSSH 1FZZA 1BMFD 1QZ8A 2AEIH 4NWLA 5PTPA 1AQ7A 1DPOA 3BN9A 2J97A 4YZUA 7GCHF 1QB1A 4NIWA 2UUYA 1D3DB 1GJ8B 1K1MA 1GWAA 2M5TA 4K5ZA 5C1YA 1ZHMA 1C5RA 1NU7B 1O3BA 1MCVA 1HXEH 4B2BA 1DUAA 3SHAH 3FVFB 3KHVA 4YT6H 4I33A 1EPTC 1ZZZA 3KQBA 4YESB 1LPKB 1TRNA 1A46H 1A61H 1C5XB 1P3EA 4JZDH 4FVBA 2Q1JA 5JBBS 2EY4C 4AFZA 5K0HA 1DLEA 1F5LA 3UOUA 4DIIH 1W2KH 2ZNKH 1EOLA 1TBQH 1YF4A 3TGJE 2BXTH 1O2XA 2FWWA 1SFIA 1EAIA 3GOVB 1QBOA 1TIOA 2GZ7A 2STAE 2ZGJA 3A7XA 3F0OA 4PROA 3O8BA 4TPIZ 2EC9H 5E2PA 2QCYA 2ALPA 3SNEA 1WDIA 1O3KA 3PLBA 1XMNB 1TQ0B 3NPSA 2VVUA 4CH2B 1NO9H 5A09A 1FY3A 2GVFA 1O5DH 1NT1A 2BY9X 1XUJA 1HRTH 2J95A 2Z7FE 2QA9E 5EQRA 8ESTE 1SKYE 3E1XB 1G30B 1YPHC 1H8DH 3A7WA 4U01A 1C2MA 1QL8A 3V12A 1YLCA 4X2VA 1LPGB 1NESE 3EA9A 3SJIA 2BLVA 1NFYA 1KDQB 1V6DA 3RXUA 3A83A 1UCYH 1AN1E 1F0UA 1NBME 1S84A 2GT7A 3UR6A 3ZZCA 4K1EA 5C1UA 4JZEH 2CJIA 2BQ6B 2BQ7B 2ZC9H 2BD7A 3K2UA 1HAVA 3IWMA 1TE0A 2P93A 2TBSA 3FOAA 2WINI 4AZ2B 1OSSA 2P59A 4Q7ZA 1J8AA 1GI8B 2YNAA 1C2KA 5LH8A 2BLQA 2BDBA 1P10A 1WAYB 4ABGA 4JZFH 3URCA 2NU2E 3HGNA 3GYMA 5HM9A 1O2QA 1FAKH 2Y5HA 2FZZA 3RXLA 2Y81A 2CGAA 1ZHPA 1O2GH 2C8XB 3R0FA 4IMZA 5F53A 1YCPH 3BEUA 3NXPA 1QJ7B 1SI5H 1HXFH 1GCTB 3RUOA 2W5EA 3S0NA 4NFFA 3TNTA 1MMJN 4B73A 1J9CH 1QRZA 1DWCH 4MG3A 1ZSKA 2ILNA 1T31A 5G4BA 1P03A 3F6UH 1UCYK 2W6JD 1D6RA 1WU1A 1GI5A 1MUEB 1SVPA 2IOTA 3Q00A 3ZVCA 5C2ZA 1C2GA 4GUXA 1ZYOA 1AVXA 2HWLB 4CR9A 2BQWB 1TALA 1FIZA 3A7VA 4F4OC 2GKVE 3S69A 1QR3E 2WV5A 2H5CA 2XRCA 2FOCA 1TGBA 2Y6TA 3Q77A 2K1QA 2ZPQA 4TYDA 2KCPA 1K1JA 3PWCA 1P06A 4D7FA 2SGPE 1FV9A 4H6TA 2GT8A 3VFEA 3F2FA 2BVRH 3P8GA 2PP6A 1N8OB 3B23B 2F9VA 3ZZDA 4MPXA 1BDAA 2ZFTA 1NRRH 2CXVA 2PSYA 4NWKA 1PJPA 1BA8B 1YCPK 3DSOA 1HJAC 1ANBA 1K28D 1MABB 3GS9A 4HZHA 1WTGH 3F9FA 3SV8A 4DJZB 3M7TA 8KME2 1XXFA 3QWCH 1K2I1 3RXCA 5DP4A 1BBRE 2GMTB 2V35A 2BDYA 2ULLA 2FX6A 3CS7A 4FUFA 3PRBA 2A31A 3V13A 3RM0H 1BTPA 3ZZ3A 2RA3A 1MCTA 2BM2A 3BG4B 4XSKU 4Y11E 4OS5A 3RXPA 5DKMA 2HOBA 3SI3H 2BXUH 1TBRH 4X0WU 4YLUA 2J34A 2AMPA 2H2ZA 1AVWA 3FN8A 2HLDD 2R0KA 4A92A 3PMJA 1AHTH 3U9AH 1K21H 1QCPA 1NFUA 1SPJA 1P02A 3KYFA 1AUTC 4WXVA 2P8OB 3ZVEA 5C20A 3GDUA 4KELA 1P2OA 4NFEA 4D9RA 1C2JA 2IN2A 5A0BA 5HYOA 3TGKE 1E1RD 4YTAA 1AE8H 2WPLS 4O3UA 2A4GA 4OS4A 4ABDA 1GG6C 4Z1MD 4AG1A 5E0JA 1MU8B 3Q3XA 2C90B 1A1RA 3URDA 4YXWD 1QB9A 1HIAA 2RDLA 1D3PB 2OP9A 3TIUA 1GBLA 4ZHMU 1BMAA 4ESTE 1O2IA 1O3DA 2QE7D 2GZ8A 3JZ2B 1NN6A 2FOAA 1CGIE 2ZG0H 1E0FD 2BY6X 2FPZA 3UWIA 1GBFA 3VPKA 1QQ4A 1KLJH 1KXEA 4BNRA 3L33A 1GI9B 2XNDD 1O3MA 3G01A 2BOKA 2Y80A 9ESTA 1S83A 1O0DH 5EJZA 1AGJA 1HYLA 1HCGA 1SQOA 1CA8B 3A85A 2JH6D 1P2IA 1FNIA 4I8KA 1O5CB 5T6DA 1O2LA 2FEQH 2BD2A 3FP7E 5AF9H 4IMQA 2KX4A 2VIQA 2OXSA 1B5GH 1MKWK 2KM0A 1FN8A 2ZFFH 5IDKA 1GMHF 3SZEA 1DOJA 1C5PA 3RU4E 4MPVA 1SQRA 1W7XH 1HGTH 2A1DB 4BTIB 2GDDA 1MZAA 1MAXA 1UVPA 1UTPA 1BTHH 4MPWA 1O2VA 2ANMH 3ZVDA 5EPYA 2A5IA 3O8RA 1GI3A 2P3FH 4A6LA 2GGVB 4I8GA 2RG3A 5FL7D 1GBDA 4X2YA 1UK2A 3UWJH 4XRNA 4Z0KA 3RC5A 1L1GA 4JYTA 4NG9H 3RXOA 2JJ1D 4DW2U 1TPPA 4DT4A 4B6FA 1P57B 1DE7H 3ZZ6A 3OEHD 1EOJA 5EXLA 1FJSA 4F48B 2GD4B 2JDID 3KEEA 1MBMA 2XBYA 2ZQ2A 3MMGA 1S5SA 1Y3XA 4WVPE 1CGHA 1ESBA 1TA2A 2IJOB 3M61U 4RN6A 3TJOA 4IN2A 2PTCE 2ZHQH 4ISLA 5ETXA 2P94A 2ODPA 4ZROA 1EZXC 3E16B 4AFUA 4YOIA 2ZQ1A 5L2ZH 2OLGA 3RMLH 1GVZA 3ZZAA 3SU0A 1AFQB 2C8ZB 1ELBA 1V2VT 2ZU5A 1ZGVA 3PV4A 2XWAA 4MDSA 3ZZ8A 4FUCA 3BIUH 1F0RA 1CHOF 1KY9A 1GL1A 4AN7A 3SGBE 2SGEE 5FCRA 4HGCA 1O5EH 4ABBA 1BQYA 1IQFA 1GHWH 2W26A 4GCHF 3BTGE 1V2WT 2ZU3A 2C3SA 1X7AC 2ZHFH 1S6LA 1L4ZA 1SL3A 2QV1A 5TCCA 1C5NH 4KKDA 1O3CA 3T26A 2FM2A 2O8WA 1INCA 2G00A 1G3CA 3QZQA 4MTBA 1NTPA 5HIYA 1GBHA 3RXBA 5FHTA 1FLEE 1EAWA 2JETB 1TNJA 2BHGA 3DHKH 1Y59T 2VJ1A 1F0SA 4ABAA 5LGOA 1TABE 1OPHB 1BRUP 3QGNB 3PMBB 3MHWU 1Z8IB 1HJAB 1K1NA 5DK1A 3SJ9A 2W6ID 3M35A 3LIWA 1IAUA 1UVUH 2V3HH 2XCNA 1YP9A 2OTVA 3SNBA 4IN1A 3LONA 4F55A 4Q4LA 1FN6A 2ODYB 3BV9B 3RXAA 4X1RU 2OBQA 3BG8A 4F49A 4INLA 2GCHF 5FX5A 2ZTZA 3GY2A 1RIWB 1GHBG 1DXWA 1DS2E 2SNVA 4CH8B 4NSYA 3LC5A 1L1NA 2L6OA 1C2EA 4CHAB 1BJVA 4Y7BA 1TRMA 1NRSH 2Z9KA 1QGFA 1AWHB 1FXYA 1G3DA 1B0EA 1Z8GA 5AFZH 1LQDB 2FOBA 1Z6JH 1ACBE 2C8WB 2YNBA 1PPCE 2O8LA 3F2HA 1RS0A 1MH0A 4UFEH 4X8VH 5C5OA 1HAYB 1O33A 2PHBA 3I77A 3U1JB 4X6NA 4BAKB 4A5TS 3T25A 5KEDA 1S6FA 4MQAA 4QT8C 1IHTH 3MU1A 3RC6A 1GHZA 1ZJKA 2XCFA 1MTUA 2G81E 2GV6A 3SU6A 5CHAC 2Z3CA 2AIQA 5EGMA 4X1NU 3CNRA 2BD9A 1O2MA 2AGIX 1C2IA 2A5AA 1P01A 2ZCHP 2NU1E 4WY3A 3B9FH 2I6SA 1BOQA 1PPFE 1AMHA 3BTWE 2A32A 1EATA 1Z7KA 3P70B 2VIOA 1ELFA 2D8WA 4IS5A 2FS8A 2BD8A 3U1IB 1MBQA 1GL0E 2XWBI 1ORFA 1AVGH 2CF8H 3RP2A 2A2QH 1AFEH 3VGCB 1IQEA 3DD2H 4ZMAH 1C1QA 1K9OE 1LPZB 2Q6FA 4JYUH 2VIVA 1A5HA 5C67A 1Y5UT 2P95A 2ZFPH 5DP7A 1L0ZA 2BLOA 2A4OA 1MTNC 1N6YA 3M5LA 2JETC 1E35B 3E0NB 3SNDA 3Q76A 3OTPA 1GVKB 1W11U 1UTKA 1MD8A 1SSXA 1GBCA 3KYGA 2FOMB 3MQKC 3QX5H 1WTHD 3DFJA 3F9EA 1WQSA 3U28C 3EYDA 3NKKA 4IC5A 1RFNA 3ZVFA 4CRAA 2AS9A 1FI8A 4I32A 4DCDA 5JB9S 2GCTB 2FLRH 1Y5AT 2OC8A 4ISHH 1UTQA 1QRXA 1ZPCA 1EJAA 2SGAA 1B0FA 2SGDE 2ZHEH 2RFKC 3EA7A 1GJ5H 4UEHH 2ZDNA 3VGCC 1RD3B 3GY4A 3HK6B 3SN8A 3KL6A 3A8DA 3RU4D 1THPB 2GX4A 4AFSA 3BTHE 3KCGH 3RXVA 4ZKOU 5DO4H 1SLWB 3UUZA 3E6PH 1C4U2 3RXQA 3P92A 4XFQA 5KECA 1KYNA 3C1KA 3IG6B 1S81A 1NZQH 4OS7A 2Z9LA 4GCHG 1GJ4H 3SZNA 2TGPZ 2EA3A 3QGJA 1ZJDA 3TK5A 3GY6A 1Z1JA 1P12E 2GJGA 2THFB 4CRFA 2PKSC 3MO9A 1V2KT 2XC5A 2A0QB 1GHVH 3RXTA 1SGTA 2FI5E 1JMOH 1O3PB 3MYWA 2VGCC 5A2MH 4Q63A 1QRWA 2PWXA 3GCHC 1FQ3A 2PW8H 2AFQB 1YWUA 4JMYA 4M7GA 2XXLA 3LGVA 3RC4A 2WPIS 4CRCA 4TT3D 2VIPA 1GMCF 1PPGE 2ANYA 4K1TA 5LPFA 1M9UA 2GCHG 4LZ4B 5FBEA 2ODQA 1HAXB 2WSSD 2QXIA 1LVYA 1P11E 2HNTF 3SU1A 1K22H 2DE9A 1S0QA 1SG8B 4Y8ZA 1H4WA 3E90B 1YGCH 1BIOA 2ZI2H 4UFDH 1J14A 1VR1H 3P8OA 3TH2H 3ZZBA 2ZHDA 2BOHB 1O3HA 2OCVB 4TWYA 4NA7A 4DT7B 3NCLA 2G5NA 4OM9A 2Z9IA 8LPRA 4FXGH 4UONA 2OC7A 2BD3A 4JYVH 1ESAA 2QY0B 1CGJE 1A2CH 1G2MA 1UK3A 3BSQA 3SV9A 4INKA 1DDJA 3ZYEA 3LDXH 4Y7AA 3SGAE 1VKYA 4ZAEA 1Z71A 3PV2A 1K1LA 3DA9B 4H42U 1RTFB 1OP2A 6CHAC 1UW7A 1ETSH 3ZV9A 2KAIA 3BEIB 3H7OA 4GHTA 3DUXH 3TK9A 2KCOA 3HKJB 3NZIA 1YBWA 3KIDU 1OWIA 5A8XA 1C5YB 1NS3A 2FO9A 1ZTLA 2VINA 2VIWA 3ZV8A 1DWBH 1XUIA 1S85A 2XBWA 2VWMA 3A81A 3PTNA 5FPTA 3RXHA 1BTUA 3UB0A 1ABIH 2W7UA 5E0HA 5GCHG 1BT7A 1TA6A 3BEFB 1P2MA 5EOKA 3QLPH 1GMDF 2BDGA 3MTYA 1Z6EA 4OS1A 3MH4A 1C2DA 1C5OH 2FP7B 1ELTA 2BMGB 1KIGH 1AIXH 1A3BH 1C5SA 1LDTT 4XD7D 3GY7A 4I8HA 3BF6H 2OQ5A 1ARCA 4MVNA 2OINA 3H09A 3ITIA 2EI8A 5C3NA 1HAIH 1O2SA 1QBNA 2AH4X 3TPIZ 3BTFE 2P8OC 1DSTA 4U32A 2ZDAH 1FY5A 7KMEH 3SJKA 2WYJA 4NGAH 4R0IA 1O2NA 1GBJA 4FVDA 1TAWA 1P9UA 3DSPA 1GI4A 2SGFE 4I31A 1TBZH 3VXEH 1IOEA 1VZQH 1H1BA 1Y3WA 2QXGA 1ZLRA 2V3MA 4MLFB 4D9QA 1WUNH 2XNIA 3A7TA 2XTTB 2H9TH 5I25A 1IQJA 1GJDB 1UHBA 1DLKB 1RTKA 2DE8A 1EZQA 4YLQH 5HKKD 2FYQA 2FOGA 3PTBA 2LELA 2GCTC 1GBBA 1GDNA 2Q6GA 1C9TA 1YLNA 2CV3A 3RMOH 4B6EA 4K1SA 4DVAU 3SOSA 3UR9A 2QGRA 4ABFA 2KFWA 2QYIA 3OY5U 1ID5H 1VITG 2BY8X 1GJAB 4CBOA 2TGAA 3OSYA 1HFDA 2HLCA 4RKOB 3IITA 1UHBB 1LHCH 1QTFA 1HAHH 1SC8U 2AGGX 4OS6A 1EP6A 1YPEH 1OWJA 3RU4T 2ZWLH 2WPKS 5JB8S 1G32B 2BDAA 3KN2A 4ABHA 3P8NA 7LPRA 1LO6A 1AU8A 1D3TB 2BD5A 3CENA 3MNCA 3T2NA 3FP6E 1GI1A 5T6GA 1FMGA 4X1SU 3MWIU 2BZ6H 4FETA 3PYHA 2HALA 1SLUB 2ANWA 1GGDB 1AZ8A 3E0PB 1O5GH 2G5VA 4RSPA 1OX1A 2C93B 1F2SE 4UE7H 1ZTJA 1P04A 4O97A 2TRMA 4NA8A 1E79D 5JBAS 1HUTH 1MQ5A 2ANKH 2BZAA 3M7UA 1BJUA 3PLKA 2ZDVH 2UWLA 5FAHA 2KCYA 3LH3A 3PMHB 3SJOA 1O2OA 1MKXH 3V3MA 4BANB 1GHAG 1G2LA 1W7GH 5F8XA 1O3LA 1T8NA 1ZRKA 5L2YH 3UNSA 5F03A 4X6OA 2PTNA 2WPHS 3RXEA 1GI7B 4E06H 3VB5A 1IQGA 3N7EA 4YT7H 4O3TA 5C0TA 2HPPH 1LVOA 2IJD1 1SLXB 1KXDA 2WPJS 3M3SA 3PM3A 3WWFA 1P05A 2F4LA 2QF3A 4WMEA 3LKWA 3ZYDA 4XBCA 5GDSH 3AK5A 3F2GA 1YYY1 1UVOA 3M37A 1OP8A 2ZPSA 3T29A 1A0LA 3SO3A 2GV7A 4K60A 5L30H 2BB4A 2DUCA 5I46H 1EZUC 1KXFA 1VCWA 1O3IA 3HKIB 3MNBA 4GVUA 1TNLA 1Y3UA 2OBOA 4VGCB 1AWFH 3RM2H 4AGJA 3SNAA 4Y10E 3P17H 3K9XB 1TGTA 1A0HB 6CHAB 2PKAB 1V2UT 1EP5A 5CHAB 4D7GA 4BAQB 1RGQA 1W10U 1GBAA 1B7XB 2F83A 1A4WH 5FBIA 2CK3D 4ISIH 4YOGA 5GPIB 1ESTA 1TX7A 1YCPM 4RT1A 5HIZA 1GHXH 1XUKA 1F7ZA 3HGPA 1GMHG 3N7DA 4X1PU 1BMNH 3FZZA 1VGCB 3SBKA 1FY8E 1MZDA 2UWPA 2XC0A 1ELAA 3NRLA 2EI7A 3OYPA 4GHQA 2TPIZ 4NZQA 5EU8A 5HM2A 3UQVA 1EZSC 1H8ED 1C1SA 2OD3B 4Q2KA 1PFXC 1LHFH 4I8LA 2Z9GA 4ABJA 1OXGA 1TMTH 2UUJB 2YOLA 1OKXA 3B8JA 5EG4A 1AKSA 2D2DA 3F0PA 1CE5A 2J38A 3RXKA 1SGDE 1C5TA 3K6ZA 3RLYH 3SQEE 2VIDA 2J94A 2R3UA 2G8TA 1EFRD 1AI8H 2VNTA 1W3CA 1G36A 1CU1A 1SGEE 5CDFE 1CBWC 1LKAA 1C1RA 1ZR0A 1OHHD 5EXNA 3A86A 1UTMA 5GXPA 3PO1B 1C1PA 1SQAA 1V2ST 1GMCG 2B8OH 5A8ZA 1AFQC 4MNWA 2P3UB 1P9SA 2G52A 2I6QA 3RXMA 2VVVA 3BIVH 2QAAA 1DT2A 3ZIAD 4WWYA 1JIRA 1AO5A 1AE5A 1EASA 3TVJB 4DY7B 4XBDA 1HDTH 8GCHG 1DITH 2ZDLA 1SBWA 1Z8JB 2FTLE 2BY5X 1LKBA 1C1TA 1DXPA 3LGYA 4YOJA 1GJCB 5C94A 2D26C 1E1QD 1WQVH 4BXWA 2W7SA 4KTCA 4WXIA 1DANH 2ZECA 5H4IB 5IK2D 2WUCA 1DY8A 1T8LA 2QF4A 4Y79A 2TGDA 2J98A 2J2UA 2XW9A 1NU9A 1BBRH 3D49H 2J92A 1SR5C 3MO3A 1O5AB 4IC6A 3TNSA 4K8BA 2PUXB 2VWNA 4O9VA 1FUJA 3MU0A 3MO6A 1RIWC 1WXRA 3GCOA 5J4QA 3ZVAA 4P00A 1BMMH 5EPNA 1VITH 1GI0A 3LH1A 3RXRA 3SUDA 1BRAA 1W8BH 1O2KA 3HPTB 1T4UH 5DP5A 1W14U 3ATKA 3SNCA 1P2NA 1SGNE 5ESBA 2BTCE 3M5OA 1QL9A 4FU8A 4NA9H 1BTYA 2FDAA 3M5NA 1T7CA 2ZEBA 1CBWB 1O37A 2WPMS 2F9OA 5CHBA 4FOUC 4OGXA 4RT0A 1LTOA 2Z6BD 5GNDA 5JBTA 1SGFG 1KDQA 3S9BA 2O9QA 3W95A 2BX4A 2G51A 3KQDA 1T4VH 2A2XH 4AYVB 2A5KA 4MNXA 3ATIA 1UMAH 2G4UA 2KR7A 1FY4A 1HJ9A 2V6NA 2O8UA 3P6ZB 1H9HE 1JRTA 1L2EA 3OEED 1KLTA 4AB8A 4Y0YE 1O30A 4FUHA 2ZDKA 1E34B 2H5DA 4ZCNA 2FLBH 1JXPA 1LCYA 1O2JA 1OWEA 3ENSB 2BY7X 4RKJB 3KQEA 5DJ7A 4NIYA 2JIZD 2RDEA 1V2NT 1E37B 3T27A 2BX3A 3UQOA 5FPSA 1PPZA 1O2ZA 2ZU4A 3V7TA 2FX4A 4Y76A 5EXMA 1ELGA 3FP8E 4BTTB 1SGYE 3H5CB 3SI4H 2VH6A 4UFGH 4TPYA 1ZTKA 2BYAX 5GCHF 4OGYA 2L74A 3SV6A 1BZXE 2VBCA 1UTNA 1UK4A 2ZU2A 3VEQB 1IQIA 1BITA 3PV5A 4J2YB 2JH5D 1H9LB 3EAJA 4ASHA 3QO6A 3GCTF 4K2YA 3OY6U 5DP6A 3OU0A 2GMTC 3H7TA 1O39A 2A7HA 4ACAA 3OFND 1ELEE 2WYGA 5B6LA 2UUKB 3FZDA 2Q6DA 1TGNA 2STBE 4B1TA 1PQ5A 2Y7ZA 4GPGA 2ZPRA 5TCAA 3SORA 1IHSH 1QA0A 5C1XA 1XUGA 1SGQE 2ZGHA 4CBNA 1CA0C 1C4Y2 2OC0A 4X6MA 3PWBA 1ZGIA 1MTSA 1E36B 2H6MA 2NU4E
chains in the Genus database with same CATH topology
2ZF0H 1GHYH 1HAPH 4FUJA 1FPHH 3MH6A 5EODA 3FANA 4XE4A 5C5NA 3S9AA 1MTNB 3S7KB 1QA7A 2TGTA 4B75A 1XVOA 3F3BA 2B0FA 1CO7E 3QN7A 1CA0B 1PPEE 3N7OA 4ZKSU 1HAZB 1YPMH 5JPMH 2Y5FA 1DFPA 1YPKH 3S7HB 1RTLA 3BTEE 2Z3DA 1PPBH 3LGTA 4GAWA 1QJ1B 1C5QA 1C2LA 2HNTE 4X8SH 3HATH 4WJG2 6ESTA 1SGIB 2XC4A 3EDXB 1ELVA 2A7JA 9LPRA 4DOQA 1TRYA 1NFWA 1TQ7B 3AVZA 3LGUA 1C1UH 5DP9A 1HB0B 1XKBC 4CREA 4JCNA 4K69A 3FO8D 4YO9A 1V2TT 4GSOA 1H8HD 1P0SH 1WBGB 5IYTA 1G3EA 1WV7H 3KF2A 1F92A 1HAOH 3M5MA 5T3HA 3GISB 1IQKA 1GI2A 2WUBA 3UNQA 2FOFA 2JKHA 4E05H 2H1UA 1QHRB 1HIAB 3F9GA 3PO1C 4LZ1H 2SGQE 2W3IA 4SGAE 1O31A 1AD8H 2A45B 3WY8A 1QJ6B 3SU2A 1NC6A 4X2WA 1LVBA 1PQAA 1EJNA 1GPZA 1A5GH 1T8MA 1W0YH 3BTQE 2V7QD 3JZ1B 3I78A 1ZMNA 1FAXA 1EXFA 3KGPA 1MTWA 5B6OA 1ZMJA 1W0ZU 3UTUH 4WMFA 3VB3A 3NWUA 3UOPA 1N1LA 2WZQA 3LT3A 7ESTE 4Z6AH 3PB1E 1DY9A 1GBMA 5E2OA 3K6YA 5K7RA 1YLDA 2OUAA 1O3AA 5A0CA 1ZSLA 1THSH 3U8TH 4H6SB 1C5MD 1J17T 4Q80A 1BUIA 1SGRE 2ZIQH 1TX6A 3E3TA 1ZHRA 2IPHA 1O2YA 1QQUA 2R2MB 2HNTC 1QL7A 3O8CA 3DCLA 2YMSD 1YPJH 4IW4E 1YC0A 1OYQA 1O3NA 2F91A 3GCHB 1J16A 3GY3A 2PSXA 4DGJA 4E7NA 2GZ9A 2VGCB 5DN6D 4ZXXH 1TPSA 4FUDA 1HJ8A 2CHAC 4JZ1A 1GJBB 1BTZA 4O03A 1LHEH 1UTLM 1GVLA 4TWWA 5LPEA 1Y8TA 1AY6H 1QB6A 2FYRA 1IQLA 4WH8A 1LMWB 3I29A 1HAVB 1G37A 4MNYA 4Q7YA 1VCQA 3LJJA 1P3CA 1P8VC 1MKXK 2EI6A 2PGBB 1C5UA 5F8TA 5J4SA 2AMDA 4Y0ZE 2AERH 1GBTA 3RMMH 1O35A 3KQCA 4X8TH 4AFQA 1C1VH 2VVCA 3SUEA 5LPRA 4CR5A 1AUJA 1Y3YA 5DSFA 1OOKB 5L6NH 2HVXA 3UNRA 3QTVH 3GICB 3U98H 4ISOA 2JJ2D 3GCNA 1LHDH 2TIOA 1LQEA 4TY7A 1TMBH 1E38B 1OP0A 2F9BH 2XBXA 5JDUB 1GBEA 1TFXA 1PYTC 1SOZA 3GY5A 4JK6A 4K8YA 1JIMA 1LHGH 1GCTC 3U8RH 1A7SA 1NBMD 1MAYA 1C1WH 3T62A 4BTUB 1KXAA 4UFFH 2WV9A 2PR3A 4X6PA 3AW0A 1SB1H 3TJNA 3HK3B 1NRNH 2FXRA 3TGIE 3STIA 5GIBA 1MQ6A 1V2MT 1O3FA 3SUGA 1ABJH 1VGCC 3TH3H 3DFLA 1DM4B 1KLIH 2VWLA 4CRBA 4TY6A 4UDWH 4OS2A 1V2LT 4ZHLU 3TJVA 1GGDC 2G4TA 3ZVGA 1C9PA 1CT2E 3C27B 5DP8A 1UTJA 1YPLH 4J1YA 1EQ9A 4DURA 4Y6DA 1XUFA 1EAUA 2P3TB 1PPHE 1VCPA 1TNIA 1D6WA 1T8OA 2PUQH 1BCUH 5ESTE 3K65B 1BTWA 3VB7A 6LPRA 4ZH8A 3M3TA 3Q3YA 5HGGA 2FOEA 2CHAB 5EQQA 4ZHAA 3GYLB 5T1VA 5GJ4B 1C1NA 3PROA 2M2AA 3WWBA 3ATWA 4BAHB 2R0LA 1GJ9B 1QURH 4KP0A 3V0XA 1NY22 1O2PA 1SGPE 3MU4A 8GCHF 1YM0A 3SJ8A 2O8MA 1HV7A 1TYNA 4NZLA 1C5VA 1DWDH 1GG6B 4NSVA 4M9FA 3SU5A 2K8IA 1TPAE 4INHA 1C2HA 4BAOB 4RI0A 1GJ7B 1RXPA 3QDZB 3GDVA 2AGEX 3LJOA 4AG2A 1RRKA 3BTTE 4XDEA 1NRPH 3O8DA 1TX8A 3P95A 2GTBA 1KTTB 5AVDA 1N8OC 1GMDG 1XXDA 1T32A 5AHGH 1C1MA 4ABIA 1P2QA 1HBTH 1QY6A 4VGCC 3RLWH 5FXLA 3RXFA 2B5TB 1O32A 4AYYB 3DT0H 2ASUB 1G3BA 4LXBH 2B9LA 1U6QA 2F9NA 3F1SB 4D76A 2CMYA 3BTDE 1NRQH 1V2JT 3LPRA 1SOTA 4Y8YA 5CMXH 1AB9C 2AIPA 1O34A 3SU4A 4CRDA 3RXDA 1O38A 3TJUA 4A1VA 2ZGCA 1Q31A 5HXFA 1KTSB 1SHHB 4IBLH 4FU7A 1YPHE 1AZZA 1UVTH 4HTCH 1SLVB 1D9IA 1BBRK 4AGKA 4A7IB 1O5BB 1Z1IA 4A1XA 3EA8A 4ZUHA 4B71A 5DG6A 2C8YB 5EW2H 1ZPZA 1GJ6A 1THRH 3SV2H 3SGQE 3RXSA 1ZOMA 1V2PT 3D23A 1HAGE 3P8FA 1QIXB 1O2HA 1NPMA 1PYTD 2QF0A 3WW7A 1TMUH 3MFJA 4R8TB 1D3QB 5A0AE 1QNJA 1WYKA 3ZVBA 4B74A 3SUFA 2HRVA 3PRDA 4CHAC 3FFGA 1EUFA 1OS8A 3M7QA 1SQTA 3BTKE 1EB1H 1UCYE 2FOHA 2J5UA 1W12U 1FIWA 1ZRBA 1O36A 1N6XA 3S9CA 3SHCH 3ODFA 5FX6A 1TWXB 1W0KD 3RXGA 4ISNA 2HGTH 1EJMA 4NCYA 4WH6A 2JH0D 4ZXYH 1TNGA 1DWEH 3GDSA 4UD9H 1J15A 1IQMA 1ZPBA 1V2RT 1FDPA 4JZIA 1O2UA 5C17A 2ALVA 4H4FA 1OWHA 1Q3XA 2PKAA 4HI3A 1SHYA 2YMSC 1GCDA 1SFQB 1CHGA 3E91A 2PGQB 3ZZ7A 2QC2A 2BVXH 3ESTA 1O3GA 2PKSB 5CE1A 3BTME 3R3GB 1CQQA 1P2JA 3MU5A 1IQHA 1Y3VA 4WMDA 4Y8XA 1ETRH 3MU8A 3F68H 4DG4A 2LPRA 1OYTH 3RXIA 1MU6B 1P2KA 2OC1A 1ELCA 4THNH 4ASUD 2FI3E 1WOFA 1O3EA 2ZA5A 1O3OA 2BLWA 2Z3EA 2FMJA 2H9EH 1HLTH 5A8YA 1MD7A 1NM6A 1AKSB 3UIRA 1SGFA 2KCAA 1W13U 3NUMA 1KSNA 2UWOA 2AMQA 3LGIA 2NU3E 2VB0A 4DIHH 5EW1H 1HPGA 1CSOE 4FU9A 4WF8A 4X2XA 3U8OH 6GCHG 1CT4E 4IGDA 1F5RA 1QFKH 4BAMB 1BB0B 5BPEA 2P16A 2SNWA 2FTMA 1C2FA 1ELDE 2FODA 1V2OT 2GP9B 3GY8A 4KGAA 4HFPB 2ZDMA 1C1OA 3MNSA 2ZP0H 3OX7U 2BVSH 1TNHA 3QTOH 1MTVA 1TNKA 3EQ0H 3SYJA 5SGAE 2BDIA 2KAIB 3UY9A 4MNVA 4XBBA 1EX3A 2ZO3H 1K1IA 3SV7A 1W0JD 3L3TA 2F9PA 3TK6A 1FY1A 3UPEA 4AOQA 1DSUA 2KZ4A 1H8IH 3UFAA 4E7RG 1DICA 2QXJA 2ZTYA 2A4RA 2LNCA 3LOXA 1Z8RA 2HPQH 1TOCB 2AHME 4BXSA 1V3XA 1F0TA 1GDQA 1DUEA 1VJAU 1NROH 1EPTB 2FS9A 2PLXA 4FUBA 3RXJA 2R3YA 1FONA 4D8NA 1K1OA 1KMHB 3ELAH 3AW1A 2ZFQH 1PQ7A 3A7ZA 1ZSJA 1GHAF 1EKBB 4A1TA 1KXBA 3AASA 1C5WB 4U30A 1OWDA 5E8EH 3ZZ5A 3A89A 2H9HA 2ZCLP 2FI4E 5FCKA 5EQSA 2V3OH 3TU7H 1K1PA 6GCHF 1ETTH 1QBVH 1Y5BT 2VWOA 5ABWA 1ARBA 1MKWH 2WPDD 2YMSB 5BRRE 2ZFRH 1EPTA 3A8BA 3ATMA 1ZMLA 1ANCA 1JWTA 4Y71A 1BTXA 1JBUH 3MNXA 1CT0E 1S6HA 3MOCA 3QZRA 1JRSA 2BDHA 2Y7XA 3CS0A 4JK5A 1HNEE 5AFYH 3W94A 2Z9JA 4FUEA 2AYWA 2QXHA 2QN5T 4ABEA 1SGCA 4BOHA 1L1JA 2XBVA 3SW2B 1TOMH 5GWZA 2EEKA 1C5ZB 2UUFB 1BHXF 1UO6A 1F5KU 4NIXA 2GDEH 1XX9A 3ODDA 1ANDA 1G9IE 2XOKD 3EE0B 3NK8A 3ZZ4A 4GLYA 2ZU1A 1VITF 2F43B 5F6MA 3PMAB 3ZZ9A 2WHXA 2ZGBH 1O2RA 1PQ8A 1O2WA 1DVAH 2CF9H 1O2TA 2A4QA 1KXCA 5FPYA 4LK4A 3ATLA 4U2WA 2K0QA 3N99A 3MI4A 1COWD 2ZTXA 2G55A 2C4FH 3A88A 1C5LH 1GBKA 3CP7A 1TLDA 3A8CA 4Q7XA 2QIQA 4B76A 3FKSD 1NFXA 2OQUA 1TONA 3AAVA 1BRBE 1L4DA 3VB6A 3VXFH 3QK1A 3E8LA 4SGBE 3M36A 1LVMA 3D62A 5HMAA 3T5FH 4AB9A 2VH0A 3BG4C 3VB4A 1P09A 3SQHE 3LGWA 2A7CA 3OTJE 1OWKA 3A8AA 1CHOG 2QF5A 1FPCH 3AAUA 4AORA 5C0UA 1GDUA 5DGJA 2Y82A 7GCHG 5DPAA 1UVSH 1IQNA 3L6PA 4XOJA 1UJ1A 3OE7D 1H9IE 3RMNH 1ANEA 2NWNA 4X8UH 4NIVA 2J9NA 1UTOA 2ESTE 1YKTA 2BD4A 2FESH 1TGCA 1S0RA 4MPUA 3A87A 3Q3KA 1XKAC 1O5FH 2XYAA 3STJA 1SMFE 5E0GA 4I7YH 5JBCS 2OK5A 2Z94A 2PV9B 5JYIA 3QUMP 2D1JA 3TLOA 4TSFD 1EB2A 1DX5M 3F9HA 4CRGA 2R2WU 3W1EA 4ZKRU 2ZFSA 4ZKNU 3EGKH 1RJXB 5DP3A 3A84A 2CN0H 2B7DH 4K3JA 3D65E 1TB6H 4KTSA 2WV4A 1GHBF 1YPGH 3GCTG 3UREA 4KTUA 3A7YA 1FX0B 1TPOA 3TITA 4I8JA 1V2QT 3MH7A 3M3VA 2O8TA 2SFAA 5TJXA 2Y5GA 3LC3A 1JOUB 4X1QU 1CVWH 2J4IA 1A3EH 3T28A 2ZCKP 4FUGA 1VJ9U 5T6FA 1Q2WA 2PFEA 2F9UA 1O3JA 2VU8E 2FIRH 1C4V2 2ZGXH 3TH4H 3A82A 2F3CE 1BHXB 1TGSZ 1BRCE 1D4PB 3VG8A 1A5IA 2BDCA 3SU3A 2NU0E 2RCEA 4LOYH 4B2CA 3KNXA 2R9PA 1GI6A 2ZKSA 3U69H 1XVMA 2ZHWH 3MH5A 3FAOA 4B2AA 3LU9B 1BMLA 2ZZUH 5F8ZA 4AX9H 1GBIA 1XM1A 2RA0A 2W3KA 1XUHA 1WCZA 4FUIA 1AB9B 2V0BA 1A0JA 1EAXA 3RDZA 4YM9A 3OAAD 1S82A 3PLPA 3A80A 1WSSH 1FZZA 1BMFD 2AEIH 4NWLA 5PTPA 1AQ7A 1DPOA 3BN9A 4YZUA 7GCHF 1QB1A 4NIWA 2UUYA 1D3DB 1GJ8B 1K1MA 1GWAA 2M5TA 4K5ZA 5C1YA 1ZHMA 1C5RA 1NU7B 1O3BA 1MCVA 1HXEH 4B2BA 1DUAA 3SHAH 3FVFB 3KHVA 4YT6H 4I33A 1EPTC 1ZZZA 3KQBA 4YESB 1LPKB 1TRNA 1A46H 1A61H 1C5XB 1P3EA 4JZDH 4FVBA 2Q1JA 5JBBS 4AFZA 5K0HA 1DLEA 1F5LA 3UOUA 4DIIH 1W2KH 2ZNKH 1EOLA 1TBQH 1YF4A 3TGJE 2BXTH 1O2XA 2FWWA 1SFIA 1EAIA 3GOVB 1QBOA 1TIOA 2GZ7A 2STAE 2ZGJA 3A7XA 3F0OA 4PROA 3O8BA 4TPIZ 2EC9H 5E2PA 2QCYA 2ALPA 3SNEA 1O3KA 3PLBA 1XMNB 1TQ0B 3NPSA 2VVUA 4CH2B 1NO9H 5A09A 1FY3A 2GVFA 1O5DH 1NT1A 2BY9X 1XUJA 1HRTH 2J95A 2Z7FE 2QA9E 5EQRA 8ESTE 3E1XB 1SKYE 1G30B 1YPHC 1H8DH 3A7WA 4U01A 1C2MA 1QL8A 3V12A 1YLCA 4X2VA 1LPGB 1NESE 3EA9A 3SJIA 2BLVA 1NFYA 1KDQB 1V6DA 3RXUA 3A83A 1UCYH 1AN1E 1F0UA 1NBME 1S84A 2GT7A 3UR6A 3ZZCA 4K1EA 5C1UA 4JZEH 2CJIA 2BQ6B 2BQ7B 2ZC9H 2BD7A 3K2UA 1HAVA 3IWMA 1TE0A 2P93A 2TBSA 3FOAA 2WINI 4AZ2B 1OSSA 2P59A 4Q7ZA 1J8AA 1GI8B 2YNAA 1C2KA 5LH8A 2BLQA 2BDBA 1P10A 1WAYB 4ABGA 4JZFH 3URCA 2NU2E 3HGNA 3GYMA 5HM9A 1O2QA 1FAKH 2Y5HA 2FZZA 3RXLA 2Y81A 2CGAA 1ZHPA 1O2GH 2C8XB 3R0FA 4IMZA 5F53A 1YCPH 3BEUA 3NXPA 1QJ7B 1SI5H 1HXFH 1GCTB 3RUOA 2W5EA 3S0NA 4NFFA 3TNTA 1MMJN 4B73A 1J9CH 1QRZA 1DWCH 4MG3A 1ZSKA 2ILNA 1T31A 5G4BA 1P03A 3F6UH 1UCYK 2W6JD 1D6RA 1WU1A 1GI5A 1MUEB 1SVPA 2IOTA 3Q00A 3ZVCA 5C2ZA 1C2GA 4GUXA 1ZYOA 1AVXA 2HWLB 4CR9A 2BQWB 1TALA 1FIZA 3A7VA 4F4OC 2GKVE 3S69A 1QR3E<