2HNTC

Crystallographic structure of human gamma-thrombin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic structure of human gamma-thrombin.
pubmed rcsb
source organism Homo sapiens
molecule tags Serine protease
molecule keywords GAMMA-THROMBIN
total genus 5
structure length 67
sequence length 67
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hntC00
2ZFTA 1TA6A 3C1KA 1SLXB 1XM1A 2OQUA 4B1TA 2Y5FA 3E0PB 4B73A 3KIDU 4FUDA 2R2MB 4X6OA 1GBDA 1TPAE 4IBLH 3DT0H 2ASUB 3R0FA 1G9IE 4RN6A 3VXEH 2ZEBA 1GI4A 1GVLA 3MYWA 1GBBA 2BD5A 1SBWA 3ENSB 1D3QB 3L6PA 4JZIA 1AU8A 2WPJS 3EYDA 3LU9B 3AW0A 3UIRA 3SUGA 5LPFA 1EZUC 3BTME 1GJDB 4K8YA 3FVFB 3PM3A 1GMHG 1OWKA 4JCNA 1IQJA 3RLYH 1C5XB 1F5KU 1OS8A 3HK3B 4DVAU 1GJCB 2AS9A 6ESTA 3VFEA 4ABBA 3ZVBA 3RC4A 1BMLA 3MWIU 1O2VA 3RXFA 4K3JA 3LGWA 2F91A 1TX7A 3GY8A 3MH5A 5G4BA 3KN2A 5EQRA 5EGMA 3QGJA 1F0TA 4JZEH 4Y6DA 3A88A 2GMTC 4ISOA 3VB4A 2BD9A 1PPCE 3ITIA 1SLVB 4ABAA 1A5HA 2VGCB 1C1SA 3HGPA 3B23B 4FUBA 1OWIA 5ESBA 2Z6BD 1TX6A 1CGIE 6CHAC 1BB0B 1HAXB 1YPLH 1AWFH 1GBIA 2FOMB 2VIPA 1D6WA 3GCHC 2RA3A 2JETC 4IMQA 1BZXE 3U98H 1IQKA 1TIOA 4B2CA 1FNIA 3D49H 1G36A 2JH5D 3LC3A 1D3DB 3ODFA 2KAIB 2BX4A 2RCEA 2BDHA 1TOMH 2NU0E 1O32A 2GZ8A 1WOFA 1LVOA 3UNQA 4OS5A 3A7WA 1V2WT 1QY6A 1S85A 1HXFH 1FN6A 1C5SA 8LPRA 1QFKH 3S7KB 1TGBA 2Z94A 1GI9B 1DDJA 1AHTH 3E6PH 2ZWLH 1PYTD 1G3EA 1LPKB 3TNSA 2G5VA 1TNLA 1WCZA 2V6NA 5HYOA 4YTAA 1VITH 4K5ZA 1P04A 3P8GA 4I8KA 4B76A 3M35A 1UTPA 4ASHA 1GHAF 2F9PA 5EQSA 1THSH 1C5NH 2ZQ2A 2A1DB 2H6MA 1GHBG 2QAAA 3A80A 2ZGBH 3GDVA 2WPKS 2XTTB 4UFDH 1LKBA 4IC5A 2J38A 1EASA 1SFIA 1GWAA 2TIOA 2ZQ1A 1LO6A 1Y5BT 3AASA 1JBUH 1IQFA 2AIPA 1EOLA 3EE0B 1GVKB 3VB5A 4NSYA 7LPRA 5EODA 1C1QA 4WMFA 2QXHA 1W7XH 1OP8A 4DOQA 3Q00A 4K2YA 1UVPA 1GGDC 1IOEA 2VWMA 3UNSA 3AVZA 3M37A 2P94A 1DWDH 1KXBA 1INCA 2QF3A 3RXTA 1O3IA 3U8OH 1A4WH 1CBWC 1ZSJA 3PMAB 2WPHS 1WYKA 2OBQA 1VGCC 2PTNA 3TK5A 1K1LA 1WUNH 1UO6A 1HUTH 3ZVEA 1QRZA 2BVSH 4K8BA 3PMBB 1FPHH 5F6MA 3PMJA 2QXJA 2A7CA 2F3CE 1CGJE 2Y7XA 2Z9GA 1XMNB 1BCUH 1AI8H 1XXDA 1XUHA 1C4V2 4JZDH 4SGAE 2WPLS 3A8CA 3RC6A 4YOIA 4GSOA 1GJBB 2AMQA 5HGGA 1YM0A 2P3TB 3SQEE 1Y8TA 4NA9H 1O2WA 2PKSB 1TNKA 5DP9A 2D26C 1EAUA 3A89A 3MHWU 1S6HA 5T6DA 2BD8A 4WVPE 2G4UA 2BY6X 1P12E 1T32A 2F9OA 3BV9B 1QR3E 2ZTZA 1KTSB 3BTEE 2Z3DA 3RXUA 1J17T 3LH1A 1DS2E 1TPSA 3P8FA 1BRAA 1CA0C 1MKWH 1MCTA 2AMDA 4GLYA 3SJ9A 1Q31A 1AY6H 4MNYA 1KXCA 4BAHB 2H5CA 5GWZA 4WY3A 2BMGB 2H5DA 2Y5GA 2ESTE 2WV5A 4AB9A 2CXVA 3M3SA 1Q3XA 1ANEA 1HAVA 4MVNA 1FY5A 1L1NA 1YYY1 4E05H 3TK6A 4YLQH 3I77A 2GVFA 3UQVA 1O5DH 1IQNA 1GBCA 1GBJA 3PO1C 3KF2A 1TABE 3F9EA 1OPHB 1NRNH 2XBVA 3L33A 4IW4E 3U1JB 3RXRA 1AVGH 2A5AA 2LNCA 3ZZ5A 2ZHWH 3GY5A 2XCNA 4INKA 4NZQA 1D4PB 1CT2E 1TBRH 2PKAA 4O03A 1NS3A 1F2SE 3RXLA 1CE5A 1A3EH 1CO7E 2JKHA 1O2QA 1C1NA 3RXAA 1O3HA 3WY8A 2CF9H 5EW1H 3TGJE 3F68H 4MQAA 1HAZB 2FZZA 2OC7A 3DD2H 5C20A 1TGNA 1O38A 4H6SB 4NSVA 1SGRE 1YCPK 2J9NA 1QURH 1O0DH 4NIYA 1ZGIA 3LGUA 4U2WA 5PTPA 1O3AA 2BLQA 2WYGA 4CRAA 3DFJA 3LGIA 1PFXC 4I8GA 2ALVA 4K69A 4WMDA 3EDXB 1C1VH 1IHSH 2HGTH 3LKWA 3QUMP 2ZU5A 1ZTLA 1RJXB 3M7TA 3D65E 1QNJA 1C2FA 1MTNC 1CA8B 1ZPBA 2HALA 3S9BA 5DO4H 1O2SA 2R3YA 3OTJE 2ZFFH 4DW2U 3QWCH 3T26A 4K60A 4YZUA 3SW2B 1EP5A 3I78A 3ZZ7A 3ZYDA 2G51A 2BTCE 2GX4A 1C5LH 1P01A 3DHKH 1IAUA 1O5CB 5A8YA 1P10A 4UFFH 1UCYH 2Z9KA 4NIXA 4Y8YA 4NWLA 2BDBA 3F6UH 1DOJA 3UOUA 1O2UA 3ATMA 1ETRH 4F4OC 4Y7BA 1C2DA 2EI7A 1GGDB 4AG2A 3QX5H 1O2ZA 2VNTA 5K0HA 2SGDE 1V2ST 1NT1A 1AB9C 2R9PA 3QK1A 5JBTA 1QRWA 3SHAH 1H8IH 1YPHC 5AHGH 5F8TA 1BBRH 8GCHF 3PTBA 4LOYH 3EA9A 1TYNA 5HXFA 2W7SA 1BT7A 1GHAG 1AIXH 3TJOA 3SU6A 3M5LA 3T25A 2Y7ZA 1P8VC 2FI4E 1J14A 3RMNH 1MZDA 1SHYA 4WMEA 2OP9A 1C5QA 2A31A 4AGKA 5HM9A 1Y3UA 1AZZA 2VIOA 3RMLH 1GI0A 1DANH 3BTKE 1BJUA 1O3DA 2FM2A 4TY7A 2GCTC 5DPAA 4YESB 4ZHLU 3SNCA 1WTHD 3LT3A 1ELTA 1F0RA 3V0XA 3TJNA 2VWLA 1W13U 1F5LA 4U32A 2A5IA 2XW9A 2ILNA 1WQSA 1HCGA 2A45B 1P2IA 2GZ9A 3RU4E 1PQ8A 1BBRE 4D7FA 1TA2A 3QLPH 5FX6A 1O2IA 2TGDA 1DUAA 1P2JA 1E38B 4CRFA 3MNSA 1K22H 2CN0H 2ZDLA 4AORA 2PSXA 2ZPSA 3E90B 1UTMA 1S84A 4DCDA 3HK6B 1MUEB 1K28D 3PLPA 1NRPH 4AB8A 3PO1B 3SJ8A 1GI2A 1ZMLA 1BTXA 3E91A 3F9HA 1O34A 1O3FA 2WINI 1TNGA 2AH4X 4XBDA 3CP7A 3SQHE 5C2ZA 3MNXA 1FAKH 1QQ4A 3M5MA 2ZNKH 1LVBA 2Z3EA 1Y3YA 1NFWA 2NU1E 1ELAA 4K1SA 4AFUA 2BM2A 2FPZA 1HIAA 2G00A 2NU2E 1YKTA 1NU7B 2B5TB 2FOBA 4CRCA 1LPZB 3SV9A 2FTMA 3KHVA 2OXSA 2ZDKA 5E2OA 1C2IA 3A7XA 2BDAA 5F8XA 3BIVH 3SI3H 1UVOA 2RA0A 1K2I1 3T28A 1H4WA 3ATKA 4Y79A 3TNTA 2SGAA 2FP7B 1ZSLA 1C2LA 1O2NA 2ANWA 1G2LA 2ZG0H 4X8TH 3L3TA 2FYQA 2VH6A 3SJIA 4OGYA 3UWJH 4D7GA 2B9LA 1V2RT 3STJA 1GMDF 3A8DA 1O39A 4D76A 1EPTA 1TQ7B 3V12A 4YT7H 1DITH 1GPZA 3E3TA 4O3UA 2BZAA 3SGAE 3RXSA 3PYHA 2ZU3A 1EZSC 2LPRA 2G4TA 2QA9E 2WUBA 2IJOB 3T62A 3LOXA 1P06A 2D8WA 1C5PA 1ZSKA 2J4IA 2KAIA 1DXPA 5L2YH 4NIVA 1BDAA 2WV4A 1VCWA 4CBNA 1NC6A 1ZGVA 1IQGA 1GCTB 1HJ8A 5ABWA 5IDKA 2PKSC 3PMHB 1FONA 1QBVH 5DJ7A 2Y6TA 1TGCA 2Q1JA 3IG6B 4B75A 2O8UA 3T2NA 1AE5A 2WPIS 5JB9S 1LQDB 4UD9H 4DURA 4ABEA 1T7CA 5GPIB 2O8LA 2BLWA 4HTCH 4DG4A 1AQ7A 3SJOA 1O33A 4BTIB 3P8OA 4BAMB 2G55A 2PV9B 2G8TA 3A81A 4ZKRU 3SGBE 4X8VH 3ZZ8A 1VR1H 2AYWA 2EEKA 1MAYA 4GHQA 4FUGA 4HZHA 1TPPA 1V2MT 1HB0B 4X1PU 3KGPA 2OC8A 1MKXH 3FP7E 1T4VH 3PV4A 1C1PA 5GDSH 1Y3WA 2BOHB 2JH0D 2ZGHA 1QTFA 3FZZA 2ZDAH 2ODPA 3TH2H 1O2JA 2FOHA 4H42U 4VGCB 3AAVA 1UTQA 1AD8H 1BTYA 1GHZA 1GMHF 2A32A 2BZ6H 2FEQH 5BRRE 4H4FA 1SQAA 1V2QT 2NU3E 3MFJA 2Y81A 1UTOA 2W3IA 2ZKSA 1W0ZU 1IQEA 2B8OH 2IPHA 1K1MA 2CHAC 3LGVA 2VWOA 4ZKSU 1C4Y2 1HAGE 1BRCE 1OOKB 1FIWA 1KLJH 3F9GA 2ZGCA 1L2EA 2IOTA 5DP5A 4X2YA 1SOTA 4ABIA 1O36A 3N7OA 1DLKB 5B6OA 1KSNA 4XBCA 2Z9JA 4ZXXH 3HPTB 1G3DA 4KGAA 1FPCH 5EU8A 1HIAB 3HGNA 4NIWA 1A46H 1BHXB 1RTFB 1TRYA 5CHAC 4ABFA 1CVWH 2PKAB 2XWAA 3CS0A 4MPVA 5A8XA 1AVWA 1KXFA 2ZO3H 3BTDE 1TB6H 3EA8A 4FVDA 5FHTA 1H8DH 3SNBA 2ANYA 2VVCA 2ZTXA 5TCCA 1HGTH 1EJAA 3JZ1B 4KELA 2P8OB 1A1RA 2ZP0H 3BEFB 1S0RA 1C5OH 1C5RA 1X7AC 2C8ZB 4ISIH 1GI3A 2ZECA 2ZHFH 3QO6A 1FY1A 2F9NA 1AO5A 5GCHF 1TNHA 1HAVB 3TLOA 3ATLA 2STBE 4MNWA 2O8MA 1P11E 1KXEA 4ABJA 3B9FH 1ZHRA 2P16A 1GHYH 4FVBA 4FU9A 1AVXA 1HLTH 2P8OC 3FAOA 2BY9X 5ESTE 3LH3A 1T4UH 2VGCC 2STAE 2G52A 4Y76A 4CHAC 5CMXH 2H2ZA 3TGKE 4INLA 1QJ1B 2OCVB 2GV7A 2FLRH 2FI5E 2CJIA 1V2OT 1YPEH 2XCFA 1GJ7B 1SB1H 1PQAA 3U1IB 4GUXA 5DP7A 1DLEA 1GG6B 2OLGA 3E16B 1V3XA 3GISB 3MNBA 4ZMAH 4TYDA 4MNVA 5IYTA 3ELAH 2R0KA 3M3VA 5E2PA 1Z8GA 2WUCA 2PTCE 4ZHAA 4HI3A 3ZYEA 5C5NA 1UCYK 4AZ2B 5EPNA 2A4GA 1BBRK 1QB9A 3GCOA 3ZZ4A 5L2ZH 2GCTB 4IN2A 2VH0A 9LPRA 1AZ8A 1C2EA 1DM4B 2W5EA 1AUTC 5EW2H 3UPEA 3MI4A 1BA8B 3AW1A 3SU1A 3URDA 1P2QA 4ZKOU 4RSPA 4I32A 3DUXH 3MO3A 4BTTB 2VB0A 2QC2A 1OWDA 4UEHH 1VJAU 1E35B 4ZAEA 2PR3A 1CHGA 2OC0A 1FAXA 5AF9H 1P0SH 1MAXA 1B7XB 1GJAB 2R3UA 2ZCKP 1G30B 2FO9A 3TJUA 1K21H 4X1SU 5EPYA 1TBZH 1HAYB 2H9TH 1ANCA 2BYAX 1T8NA 2YNAA 4DJZB 2HWLB 3Q3KA 3MTYA 1GG6C 1W8BH 2R0LA 1CU1A 2TGTA 2J92A 3BTQE 3IITA 2FS9A 1BTWA 1TRMA 1V2PT 4UONA 1FZZA 1RGQA 4NGAH 1IQIA 2FOEA 1F7ZA 2AMPA 1Z7KA 3PWCA 1WAYB 1ZOMA 2W7UA 2DE8A 1C5YB 1XXFA 3RXMA 1Z6JH 1MTUA 1FXYA 3GDUA 2QGRA 4MPWA 4WF8A 1LHGH 1ELCA 2FXRA 2GTBA 2ZIQH 4A92A 4DGJA 1NPMA 1L4DA 2TPIZ 4XSKU 1MBMA 4WJG2 4UE7H 4FU8A 3LIWA 4FUCA 1O2KA 5C5OA 1QBOA 5A2MH 4X8UH 3P92A 1NZQH 4FUIA 5A0AE 1V2NT 3SUFA 2Q6DA 2UWLA 1EB2A 4AX9H 1MU8B 2PWXA 4BTUB 1MH0A 1QBNA 1QCPA 2ZFPH 1GBTA 3RXGA 5SGAE 2PW8H 1NFUA 2BD4A 1F0SA 2XYAA 4JMYA 3DA9B 4D9RA 1SGCA 1FQ3A 3O8BA 3BSQA 3STIA 1O3CA 1RTKA 5DGJA 2SGPE 1O31A 2CGAA 3KL6A 3GY3A 2SGEE 6GCHG 1PPFE 2D2DA 5LPRA 2ODQA 4Y8XA 1XKBC 4ABDA 2V3OH 1BTUA 3GICB 3A84A 1ESBA 2BDCA 1A5IA 2FIRH 1H9HE 5CHAB 4Q7ZA 1HRTH 1AKSB 1O2LA 4FUHA 4GVUA 4HFPB 1AKSA 4YM9A 1EUFA 5A0BA 1H1BA 4CH8B 1JMOH 4X8SH 4AG1A 3VB3A 1SR5C 3S9CA 4GCHF 2F9UA 1CHOF 3MO6A 1F0UA 3TJVA 1N6YA 3C27B 4ISLA 4E06H 3MMGA 1DUEA 1MQ6A 1Y5UT 4O97A 1A0LA 2AFQB 1ID5H 3SHCH 5GIBA 1ARCA 2FYRA 2EA3A 3M61U 1ZZZA 2IN2A 3R3GB 3UTUH 1SSXA 3MU1A 2FI3E 5FBEA 1AWHB 1EJMA 2C8YB 3FANA 3NKKA 4Y71A 1U6QA 3BEIB 1PJPA 4OGXA 3PLBA 1O3LA 3SU2A 2ZDNA 2Z9LA 1J15A 1G3BA 1YPMH 2O8TA 4J2YB 3SJKA 1TMUH 3SV7A 3ATIA 3BTHE 2FTLE 1FY8E 3HKJB 1P2NA 3FZDA 1RIWC 3LONA 1QQUA 1DX5M 1BTPA 1CA0B 1WBGB 1NY22 1HJ9A 3T5FH 1CBWB 5L6NH 2VIQA 3RC5A 1O37A 1S0QA 1ZTKA 1OP2A 2FX6A 1O3PB 3SNDA 1P3EA 1C9TA 1EAWA 1LVMA 3OX7U 1C4U2 2ZI2H 4YT6H 1GDNA 2Z3CA 1QL9A 1W3CA 4MLFB 2BQWB 4D9QA 2GT7A 5FCRA 1QHRB 1UJ1A 2XBYA 1YCPH 3P6ZB 3RU4D 1T31A 1C9PA 4HGCA 3ZV9A 1EQ9A 1EZQA 1ELDE 5JBAS 1D3TB 4I7YH 2BVRH 1NRQH 3BG4C 1GBEA 1EAIA 4MPXA 1C1TA 4XE4A 1N8OC 1K1IA 3TGIE 1UVTH 1YP9A 1C1UH 2BDGA 1FIZA 4CHAB 1SMFE 4AYVB 2ZA5A 2GKVE 4Y0ZE 4DT7B 1SGEE 1NFXA 3RP2A 1JWTA 3A85A 3EGKH 4WH8A 1O2TA 1PPEE 3RXPA 2QV1A 2SGQE 3SN8A 3TK9A 1DWCH 1UTLM 3SZNA 1OWJA 1VZQH 2ZFSA 3VEQB 1SHHB 3Q77A 4CRBA 1O2MA 2ZHEH 2FLBH 3GCTF 2C93B 1TPOA 1NTPA 2F9VA 1MU6B 1MTSA 1VCQA 3ZZ9A 3VGCC 1T8LA 1N6XA 1SGDE 3I29A 2VVVA 1M9UA 4KTCA 2BD7A 1VGCB 4NFFA 1LTOA 3F1SB 2ZFQH 2BXTH 1E37B 1XUIA 4CBOA 5DP6A 4TY6A 4BXSA 1OWHA 3ZV8A 3QTOH 1BOQA 1HPGA 1JIRA 1ARBA 3ODDA 1PQ7A 5A0CA 3PWBA 3DFLA 1RD3B 3SI4H 4Q80A 2JH6D 1TNJA 1B0EA 4Y0YE 3SV6A 3ZZAA 5I46H 4Z0KA 3O8DA 1ELEE 4JK6A 5H4IB 1LVYA 3ZVGA 3ZZBA 1KTTB 3ZVFA 4Z6AH 3F9FA 1HV7A 2FOCA 2VIWA 2QY0B 5E0JA 5C1XA 1GI6A 1MBQA 1W11U 7GCHG 4AFQA 2BOKA 5J4QA 1A7SA 1Z71A 2OD3B 1ELFA 3MO9A 2BY5X 2PGQB 2ZU1A 1TQ0B 4AYYB 5I25A 3NCLA 1TLDA 2R2WU 4VGCC 2XRCA 1JOUB 2QCYA 1P3CA 2BQ6B 5T3HA 4A7IB 1K1JA 1ZRKA 5FPSA 5DKMA 5TJXA 3LDXH 4JZFH 2BLOA 3BTWE 4ZHMU 1YC0A 1A2CH 1FDPA 2THFB 2UWOA 3BN9A 3NXPA 1Q2WA 3QN7A 4A1TA 1GL0E 4CH2B 4E7NA 3NPSA 3ATWA 1YLDA 1UTKA 1O3JA 6GCHF 1TNIA 1N1LA 2VIVA 3S7HB 4FU7A 4UDWH 1FI8A 1A61H 1Z8IB 2HNTC 2EC9H 1LCYA 1OP0A 2BQ7B 3KCGH 5FBIA 5F8ZA 1TOCB 1EAXA 1GI1A 4LK4A 3BG4B 1A0JA 2QF0A 1ZMNA 1C5UA 2ANKH 2XC0A 2C8WB 5JBCS 4MG3A 1NRRH 1HYLA 4ABGA 2GGVB 1GCTC 1TAWA 1FLEE 1Z8RA 3FFGA 3HKIB 1TGTA 5LGOA 1FV9A 1EOJA 1ZMJA 4DY7B 2AGIX 3T29A 1A3BH 5FPTA 1TWXB 4UFGH 1C2GA 2SNWA 1SGPE 3V13A 1GBLA 3KQCA 1BIOA 1BTZA 2AGEX 3Q3XA 4Q2KA 3A8AA 1TRNA 1DICA 1O5AB 1GBKA 3SGQE 2ULLA 3M7QA 8ESTE 1KLTA 1NESE 5C1UA 1GJ5H 3H5CB 5E8EH 2F83A 1C5VA 1SLUB 1IQMA 2Y80A 4BXWA 2OUAA 2BD2A 2UWPA 1LMWB 3A8BA 5DP8A 1V2TT 1GI7B 1WU1A 2UUYA 1C5TA 4RKOB 2FOAA 3KQEA 3TH4H 2BB4A 4Y10E 1H9IE 2GDEH 3M3TA 3MH7A 1ZHMA 2O9QA 4TPIZ 5T6GA 4D8NA 1EXFA 3ESTA 1BMNH 1OKXA 2JETB 1ETTH 4IN1A 4R8TB 3VXFH 4ZROA 1HFDA 4RKJB 4WXIA 1HDTH 3SU3A 1QL8A 2YOLA 3VGCB 1T8OA 2ZPQA 2FOFA 4AFZA 2ALPA 2H9EH 4E7RG 1LDTT 1TMTH 4JYTA 1KDQA 2GV6A 4XOJA 1DWBH 1LHCH 4X6PA 3BTFE 2XC5A 1GBFA 1C1OA 3K6ZA 1A0HB 2H1UA 1GJ4H 2J2UA 1WV7H 4X0WU 3PLKA 3UQOA 1XUFA 2ANMH 1DWEH 1ZYOA 4Q7XA 2OINA 5CE1A 2TBSA 3MH6A 2HOBA 3RMMH 2ODYB 3T27A 1O2PA 1LHEH 4X1NU 3A7VA 1DFPA 1V2LT 6LPRA 4ZXYH 6CHAB 1O3BA 3ZVDA 1CGHA 3U8TH 4FUJA 1EP6A 3GCNA 2PUQH 4UFEH 2A5KA 3RXVA 4LZ1H 1SGNE 4B74A 4MPUA 5C67A 4B2AA 5HM2A 2ZZUH 3P70B 3RM0H 3K6YA 1O3GA 1ESTA 1SL3A 2GCHG 4CRGA 1BRBE 1AUJA 1ZLRA 4TWYA 3P95A 1G2MA 3ZZ6A 1K1NA 1NM6A 4ZKNU 2XNIA 4O3TA 3RXCA 4DIHH 3LC5A 1VJ9U 2GZ7A 3BTTE 1XUJA 2A0QB 2HNTE 1UK3A 3NZIA 1MQ5A 2UUJB 2CHAB 1L1GA 1IQHA 5FX5A 1Y3XA 2HPPH 4FXGH 4NCYA 1O3NA 1J16A 1CT4E 1J8AA 3GYLB 1VITG 1DE7H 3CENA 3PTNA 3A7TA 2O8WA 1SQTA 1GMCG 2ZC9H 4QT8C 2XWBI 1GHBF 5JPMH 4THNH 1N8OB 1O2HA 2PUXB 1T8MA 1OX1A 1J9CH 3TPIZ 1MD8A 2FS8A 1RS0A 2ZPRA 1V2UT 4K1EA 5T6FA 2C8XB 1ABIH 1NN6A 2P93A 1Z8JB 3RXIA 1UHBB 4BAQB 1JRSA 2VINA 1UHBA 5DP4A 3ZZCA 1NFYA 4CR5A 2A4RA 5JB8S 1P9UA 3JZ2B 4AGJA 3KQDA 3MU4A 3TIUA 2H9HA 4OS4A 3PROA 5C1YA 2M5TA 5GCHG 1QL7A 3HATH 3RXJA 1VCPA 3D62A 3KNXA 3RUOA 3FP6E 1D6RA 2I6QA 1O3KA 3P17H 4MTBA 3TU7H 2BVXH 3RXOA 5DK1A 3OU0A 1O5EH 2Z7FE 3SUDA 3SNEA 1SGTA 4XDEA 1S83A 4Y11E 4YO9A 3GCHB 3ZVCA 4GPGA 1ZJKA 1L4ZA 5EOKA 1BMMH 1GVZA 1ANDA 3S0NA 5E0GA 3ZVAA 4O9VA 3SV8A 2EI8A 2SGFE 1HAHH 1O30A 2ZDVH 4NA7A 3Q3YA 2FX4A 4KTSA 2FOGA 2SNVA 1MD7A 1EZXC 2A7HA 3GDSA 1SGIB 1YPGH 4NG9H 1BITA 3RM2H 2QXIA 1ORFA 4NZLA 1YPKH 1O3EA 3S69A 1AE8H 1PYTC 1W2KH 2PHBA 4IMZA 4KTUA 4XBBA 2ZTYA 2GD4B 2A4OA 1RXPA 3M36A 2PFEA 1D3PB 1QA7A 3G01A 1W7GH 1TBQH 1GHVH 4NA8A 3SU4A 2A2QH 2FESH 1MTVA 1YPJH 3LPRA 5JYIA 8KME2 3GCTG 3OSYA 4IC6A 4F49A 3LJOA 2B0FA 1S6FA 1CHOG 3RMOH 1DSUA 4GCHG 1OXGA 1E34B 1AMHA 2VVUA 1ESAA 3CS7A 2AIQA 1SI5H 2ZF0H 1MTWA 1V2KT 1SGFA 1ACBE 1F92A 3KQBA 5GXPA 1NRSH 3NUMA 1GBAA 5JDUB 3BEUA 2GT8A 3GOVB 2YNBA 1ZR0A 3EA7A 3S9AA 1UMAH 1ZRBA 1BRUP 1HNEE 1K9OE 1HBTH 1GMCF 1P2KA 1SGYE 4WH6A 2TRMA 2P95A 1KDQB 2J94A 2P3UB 1V2VT 3LGTA 3QDZB 3QGNB 1IQLA 1KLIH 1OSSA 1LKAA 3RU4T 4A1XA 3UNRA 1O2RA 3URCA 2FDAA 1JIMA 4X1RU 3VB7A 3A7ZA 1QA0A 1Y3VA 4JK5A 4ZUHA 1BQYA 3LGYA 5AFZH 1KY9A 3V7TA 2GCHF 1UK4A 1HAPH 4LZ4B 2V35A 2ZGJA 4ISHH 1C2KA 3GY4A 3RXHA 3TITA 1SC8U 1C2JA 4X2VA 4GAWA 1F5RA 1W12U 4MDSA 4X2WA 1KIGH 1SG8B 9ESTA 4LXBH 1SFQB 1ZPZA 3ZZ3A 2A7JA 3NK8A 1C2HA 1HAIH 1S81A 1LQEA 4DIIH 2TGPZ 1HXEH 4ABHA 1K1OA 1UVUH 4NWKA 3W94A 1UTNA 3H7TA 1GDUA 3SOSA 1UK2A 4WXVA 1ZHPA 5E0HA 3QTVH 1FUJA 3SBKA 1GMDG 2K1QA 2GMTB 3K65B 4IGDA 5GJ4B 3SU5A 1RTLA 1GJ6A 4OS7A 1O5BB 2RDLA 2ZHQH 1QB6A 5EXMA 4CR9A 4BAOB 4AN7A 1E0FD 1EX3A 2J34A 1P02A 1XUGA 5K7RA 1O3OA 2ZGXH 1P2OA 1DT2A 1C5ZB 4J1YA 4JYVH 3BG8A 1C5WB 1EPTC 1O35A 1H9LB 1AGJA 1PPGE 1QB1A 1ETSH 5FPYA 3U8RH 1P05A 1MZAA 1LPGB 1ABJH 1RIWB 1FY3A 3E8LA 1K1PA 2OQ5A 2OTVA 2BY8X 2PGBB 1WSSH 1C2MA 1FN8A 1FMGA 1GCDA 3TVJB 5L30H 2BXUH 2FWWA 8GCHG 1XX9A 1Z1IA 4R0IA 3A82A 1LHFH 1DVAH 2PLXA 2UUFB 2ZCLP 5EXLA 1OWEA 1PPBH 2ZHDA 1THPB 5A8ZA 4MNXA 2QXGA 1JXPA 3BF6H 1TFXA 1NO9H 1Y5AT 3U69H 4U30A 3UOPA 2D1JA 2G5NA 4A5TS 4YOGA 1CT0E 1O2YA 4OS2A 2UUKB 3O8CA 1B0FA 1E36B 3K2UA 3UREA 5DG6A 2RG3A 2QN5T 1C1RA 2DUCA 4I8HA 4A1VA 2Z9IA 3UUZA 1P9SA 5FAHA 1SPJA 1YGCH 1SGFG 1DSTA 1WTGH 4ZH8A 4Q7YA 4ESTE 3QZQA 1AN1E 2HNTF 1GBMA 5EXNA 4JYUH 5DP3A 1JRTA 4I8JA 3UFAA 3E0NB 2ZCHP 1W0YH 3SUEA 1G37A 4FUFA 3RXDA 1SQOA 2GDDA 5HMAA 5EG4A 3SO3A 2FODA 1GDQA 1QRXA 3A86A 1MKWK 1S82A 1PPZA 1YBWA 2HRVA 5BPEA 2ZDMA 4I8LA 3SORA 3SNAA 3M7UA 1DPOA 3H7OA 3KEEA 1EATA 4BOHA 1YF4A 2DE9A 4Y8ZA 1VITF 3VPKA 3K9XB 3RXKA 4A6LA 3EQ0H 4CRDA 1P2MA 1A5GH 1THRH 2AEIH 1L0ZA 1V2JT 2Y82A 2Y5HA 2Q6FA 3V3MA 3P8NA 1WQVH 4IS5A 2OBOA 1HJAB 1P57B 1CQQA 2HPQH 2ZU4A 1OYTH 1GI8B 1DY9A 1NU9A 1TMBH 7KMEH 1O2XA 1TX8A 1C5MD 4OS1A 3IWMA 2C4FH 3M5NA 3OY5U 4INHA 1TONA 3MOCA 1FY4A 1S5SA 4AOQA 2CV3A 2VU8E 3SU0A 2ZFRH 4I31A 1Z1JA 3E1XB 3OYPA 2XC4A 1GI5A 1HJAC 1KXAA 4TPYA 3MU8A 2OC1A 1ELVA 4XFQA 3MH4A 4I33A 2VIDA 1QIXB 2F9BH 4YOJA 5J4SA 1C1MA 3NWUA 3RDZA 1Y59T 3PB1E 1QJ7B 4NFEA 1ANBA 1G32B 3GYMA 7GCHF 2VWNA 2HVXA 5TCAA 3MU5A 1Z6EA 4JZ1A 1O2GH 2W3KA 1DY8A 3ZZDA 2WYJA 1GBHA 1MKXK 3GY6A 4TWWA 4PROA 2BD3A 1PQ5A 2C3SA 3UR9A 2BLVA 1SLWB 7ESTE 5C3NA 1BHXF 1GL1A 4SGBE 1MMJN 1W14U 1YPHE 1XVOA 4B71A 5F03A 1SGQE 2BX3A 2BDIA 1TE0A 3VB6A 2Q6GA 2TGAA 1SOZA 1TGSZ 3Q76A 1EJNA 1HAOH 5JBBS 3SV2H 1MTNB 2ZU2A 5AVDA 2WPMS 3RXEA 4H6TA 1UCYE 3BIUH 2BDYA 1GJ8B 1CSOE 3A83A 4WWYA 4AFSA 2G81E 3LJJA 5EQQA 3O8RA 1TALA 3QZRA 1EB1H 5AFYH 1BMAA 1UTJA 2FMJA 1KYNA 2A2XH 4KP0A 3U9AH 1YLCA 2C90B 3UR6A 2J95A 3OY6U 3UWIA 1QGFA 3UY9A 1GJ9B 1O2OA 3FP8E 1BTHH 2QIQA 1FJSA 2EI6A 2VJ1A 1ZJDA 4GHTA 4X2XA 3B8JA 3MNCA 4B2BA 4YLUA 2NU4E 1BJVA 2XBWA 1G3CA 1C1WH 2BY7X 5ETXA 4X6NA 4U01A 1AFQC 4X6MA 3RXQA 5FXLA 1ZPCA 1DXWA 2XBXA 1P03A 2B7DH 1SVPA 2P59A 3GY2A 1EKBB 4CREA 1RRKA 2A4QA 4Y7AA 1NROH 2P3FH 1ELBA 1LHDH 5FCKA 1MCVA 4K1TA 1RFNA 1OYQA 2PSYA 1UVSH 3GY7A 2BHGA 2SFAA 2HLCA 1AFQB 1ELGA 5LPEA 1XVMA 3RXBA 3W95A 1O3MA 2XXLA 1P09A 4BAKB 1GHWH 1IHTH 1W10U 1YCPM 3A87A 2AGGX 2QYIA 4M7GA 1KXDA 1BUIA 4X1QU 1GHXH 1ZTJA 2V3HH 1EPTB 3BTGE 1XKAC 1O5FH 4KKDA 1XUKA 3D23A 4FUEA 1L1JA 1O5GH 3MU0A 3AAUA 2CMYA 4ISNA 1AB9B 2AERH 3A7YA 1B5GH 1AFEH 2W26A 4BNRA 5LH8A 1PPHE 2GP9B 3M5OA 2CF8H 2I6SA 3EAJA 3TH3H 1V6DA 1D9IA 2NWNA 2V0BA 5A09A 4BANB 4OS6A 1QJ6B 3RLWH
chains in the Genus database with same CATH superfamily
2ZFTA 1TA6A 3C1KA 1SLXB 1XM1A 2OQUA 4B1TA 2Y5FA 3E0PB 4B73A 3KIDU 4FUDA 2R2MB 4X6OA 1GBDA 1TPAE 4IBLH 2W6JD 3DT0H 2ASUB 3R0FA 1G9IE 4RN6A 3VXEH 2ZEBA 5EIYA 1GI4A 1GVLA 3MYWA 1GBBA 2BD5A 2WV9A 2KCYA 1SBWA 3ENSB 1D3QB 3L6PA 4JZIA 1AU8A 2WPJS 3EYDA 3LU9B 3AW0A 3UIRA 3SUGA 5LPFA 1EZUC 3BTME 1GJDB 4K8YA 3FVFB 3PM3A 1GMHG 4F48B 1OWKA 4JCNA 1IQJA 3RLYH 3U28C 1C5XB 1F5KU 1OS8A 3HK3B 4DVAU 1GJCB 2AS9A 6ESTA 3VFEA 4ABBA 3ZVBA 3RC4A 1BMLA 3MWIU 3OFND 1O2VA 3RXFA 4K3JA 1QZ8A 2F91A 1TX7A 3GY8A 3LGWA 3MH5A 3KN2A 5EQRA 5G4BA 5EGMA 3QGJA 1F0TA 4JZEH 4Y6DA 3A88A 2GMTC 4ISOA 3VB4A 2BD9A 1PPCE 3ITIA 1SLVB 4ABAA 1A5HA 2VGCB 1C1SA 3HGPA 3B23B 4FUBA 1OWIA 5ESBA 2Z6BD 1TX6A 1CGIE 6CHAC 1BB0B 1HAXB 1MABB 1YPLH 1AWFH 1GBIA 2FOMB 2VIPA 2J98B 1D6WA 3GCHC 2RA3A 2JETC 4IMQA 4OM9A 1BZXE 3U98H 1IQKA 1TIOA 4B2CA 1FNIA 3D49H 1G36A 2JH5D 3LC3A 1D3DB 3ODFA 2KAIB 2BX4A 2RCEA 2BDHA 1TOMH 2YMSC 1E1QD 5KECA 2NU0E 1O32A 2GZ8A 1WOFA 1LVOA 3UNQA 4OS5A 3A7WA 1V2WT 1QY6A 1S85A 1HXFH 1FN6A 1C5SA 8LPRA 1QFKH 3S7KB 1TGBA 2Z94A 1GI9B 1DDJA 1AHTH 3E6PH 2ZWLH 3DCLA 1PYTD 1G3EA 1LPKB 3TNSA 2G5VA 1TNLA 1WCZA 2V6NA 5HYOA 4YTAA 1VITH 3DSOA 4K5ZA 1P04A 3P8GA 4I8KA 4B76A 3M35A 1UTPA 4ASHA 3ZIAD 1GHAF 2F9PA 5EQSA 1THSH 1C5NH 2ZQ2A 2A1DB 2RFKC 2H6MA 1GHBG 2QAAA 3A80A 2ZGBH 3GDVA 2WPKS 2XTTB 4UFDH 1LKBA 4IC5A 2J38A 1EASA 1SFIA 1GWAA 2TIOA 2ZQ1A 1LO6A 1Y5BT 3AASA 1JBUH 1IQFA 2AIPA 1EOLA 3EE0B 1GVKB 3VB5A 4NSYA 7LPRA 5EODA 3DSGA 1C1QA 2EQNA 4WMFA 2QXHA 1W7XH 1OP8A 4DOQA 3Q00A 4K2YA 1UVPA 1GGDC 1IOEA 2VWMA 3UNSA 3AVZA 3M37A 2P94A 1DWDH 1KXBA 1INCA 2QF3A 3RXTA 1O3IA 3U8OH 1A4WH 1CBWC 1ZSJA 3PMAB 2WPHS 1WYKA 2OBQA 1VGCC 2PTNA 3TK5A 1K1LA 1WUNH 1UO6A 1HUTH 3ZVEA 1QRZA 2BVSH 4K8BA 3PMBB 1FPHH 5F6MA 3PMJA 2QXJA 2A7CA 2F3CE 1CGJE 2Y7XA 2Z9GA 1XMNB 1BCUH 1AI8H 1XXDA 1XUHA 1C4V2 4JZDH 4SGAE 2WPLS 3A8CA 3RC6A 4YOIA 4GSOA 1GJBB 2AMQA 5HGGA 1YM0A 2P3TB 3SQEE 1Y8TA 4NA9H 1O2WA 2PKSB 1TNKA 1NBMD 2D26C 1EAUA 3A89A 3MHWU 5DP9A 1S6HA 5T6DA 2BD8A 4WVPE 2G4UA 2BY6X 1P12E 1T32A 2F9OA 3BV9B 1QR3E 2ZTZA 1KTSB 3BTEE 2Z3DA 3RXUA 5CDFE 1J17T 3SYJA 3LH1A 1DS2E 1TPSA 3P8FA 1BRAA 1CA0C 1MKWH 1MCTA 2AMDA 4GLYA 3SJ9A 1Q31A 1AY6H 4MNYA 1KXCA 4BAHB 2H5CA 5GWZA 4WY3A 2BMGB 2H5DA 2Y5GA 2ESTE 2WV5A 4AB9A 2CXVA 3M3SA 1Q3XA 1ANEA 1HAVA 4MVNA 1FY5A 1L1NA 1YYY1 4E05H 3TK6A 4YLQH 3I77A 2GVFA 3UQVA 1O5DH 1IQNA 1GBCA 1GBJA 3PO1C 3KF2A 1TABE 3F9EA 1OPHB 1NRNH 2XBVA 3L33A 4IW4E 3U1JB 3RXRA 1AVGH 2A5AA 2LNCA 3ZZ5A 2ZHWH 3GY5A 2XCNA 4INKA 4NZQA 1D4PB 1CT2E 1TBRH 3MQKC 2PKAA 4O03A 1NS3A 1F2SE 3RXLA 1CE5A 1A3EH 1CO7E 2JKHA 1O2QA 1C1NA 3RXAA 1O3HA 3WY8A 2CF9H 5EW1H 2W6ID 3TGJE 3F68H 4MQAA 1HAZB 2FZZA 2OC7A 3DD2H 5C20A 1TGNA 1O38A 4H6SB 4NSVA 1SGRE 1YCPK 2J9NA 1QURH 1O0DH 4NIYA 1ZGIA 3LGUA 4U2WA 5EJZA 5PTPA 1O3AA 2BLQA 5KGOA 2WYGA 4CRAA 3DFJA 3LGIA 1PFXC 4I8GA 2ALVA 3PV2A 4K69A 4WMDA 3EDXB 1C1VH 1IHSH 2HGTH 3LKWA 3QUMP 1WXRA 2ZU5A 1ZTLA 1RJXB 3F2FA 3M7TA 3D65E 1QNJA 1C2FA 1MTNC 1CA8B 1ZPBA 2HALA 3S9BA 1WDIA 5DO4H 1O2SA 2R3YA 3OTJE 2ZFFH 4DW2U 3QWCH 3T26A 4K60A 4YZUA 3SW2B 1EP5A 3I78A 3ZZ7A 3ZYDA 2G51A 2BTCE 2GX4A 1C5LH 1P01A 3DHKH 1IAUA 1O5CB 5FL7D 5A8YA 1P10A 4UFFH 1UCYH 2Z9KA 4NIXA 4Y8YA 2PP6A 2F43B 4NWLA 2BDBA 3F6UH 1DOJA 3UOUA 1O2UA 3ATMA 1ETRH 2WHXA 3H09A 4Y7BA 4F4OC 1C2DA 2EI7A 1GGDB 2V3MA 4AG2A 3QX5H 1O2ZA 4DT4A 2VNTA 5K0HA 5C17A 2SGDE 1V2ST 2HLDD 1NT1A 1AB9C 2R9PA 3QK1A 5JBTA 1QRWA 3SHAH 1H8IH 1YPHC 3OEED 5AHGH 5F8TA 1BBRH 8GCHF 3PTBA 4LOYH 3EA9A 1TYNA 5HXFA 2W7SA 1BT7A 1GHAG 1AIXH 3TJOA 3SU6A 3M5LA 3T25A 2Y7ZA 1P8VC 2FI4E 1J14A 3RMNH 1MZDA 1SHYA 4WMEA 2OP9A 1C5QA 2A31A 4AGKA 5HM9A 1Y3UA 1AZZA 2VIOA 2WSSD 3RMLH 1GI0A 1DANH 3BTKE 1BJUA 1O3DA 2FM2A 4TY7A 2GCTC 5DPAA 4YESB 4ZHLU 3SNCA 1WTHD 3LT3A 4XD7D 1ELTA 1F0RA 3V0XA 3TJNA 2VWLA 1W13U 5HIYA 1F5LA 4U32A 2A5IA 2JDID 2XW9A 2ILNA 1WQSA 1HCGA 2A45B 1P2IA 2GZ9A 3RU4E 1PQ8A 1BBRE 4D7FA 1TA2A 3QLPH 5FX6A 1O2IA 2TGDA 1KMHB 1DUAA 1P2JA 1E38B 4CRFA 3MNSA 1K22H 2CN0H 2ZDLA 4AORA 2PSXA 2ZPSA 3E90B 1UTMA 1S84A 4DCDA 3HK6B 1MUEB 4FETA 1K28D 3PLPA 1NRPH 4AC9A 4AB8A 3PO1B 3SJ8A 1GI2A 1ZMLA 1BTXA 3E91A 3F9HA 1O34A 1O3FA 2WINI 1TNGA 2AH4X 4XBDA 3CP7A 3SQHE 5C2ZA 3MNXA 1FAKH 1QQ4A 3M5MA 5EJLA 2ZNKH 1LVBA 2Z3EA 1Y3YA 1NFWA 2LELA 2NU1E 1ELAA 4RI0A 4K1SA 4AFUA 2BM2A 2FPZA 1HIAA 2G00A 2NU2E 2J97A 1YKTA 1NU7B 2B5TB 2FOBA 4CRCA 1LPZB 3SV9A 2FTMA 3KHVA 2OXSA 2ZDKA 5E2OA 1C2IA 4ACAA 3A7XA 2BDAA 5F8XA 3BIVH 3SI3H 1UVOA 2RA0A 1K2I1 3T28A 1H4WA 3ATKA 4Y79A 3TNTA 2SGAA 2FP7B 1ZSLA 1C2LA 1O2NA 2ANWA 1G2LA 2ZG0H 4X8TH 3L3TA 2FYQA 2VH6A 3SJIA 4OGYA 3UWJH 4D7GA 2B9LA 1V2RT 3STJA 1GMDF 3A8DA 1O39A 4D76A 1EPTA 1TQ7B 3V12A 4YT7H 1DITH 1GPZA 3E3TA 4O3UA 2BZAA 3SGAE 3RXSA 3PYHA 2ZU3A 1EZSC 2LPRA 2G4TA 2QA9E 2WUBA 2IJOB 3T62A 3LOXA 1P06A 2D8WA 1C5PA 1ZSKA 2KCAA 2J4IA 2KAIA 1DXPA 2OK5A 2IJD1 5L2YH 4NIVA 1BDAA 2WV4A 1VCWA 4CBNA 1NC6A 1ZGVA 1IQGA 1GCTB 1HJ8A 5ABWA 5IDKA 2PKSC 3PMHB 1FONA 1QBVH 5DJ7A 2Y6TA 1TGCA 2Q1JA 3IG6B 4B75A 2O8UA 3T2NA 1AE5A 2WPIS 5JB9S 1LQDB 4UD9H 4DURA 4ABEA 1T7CA 5GPIB 2O8LA 2BLWA 4HTCH 4DG4A 1AQ7A 3SJOA 1O33A 4BTIB 3P8OA 1OHHD 4BAMB 2G55A 2PV9B 2G8TA 3A81A 4ZKRU 3SGBE 4X8VH 3ZZ8A 1VR1H 2AYWA 2EEKA 1MAYA 4GHQA 4FUGA 4HZHA 4P00A 1TPPA 1V2MT 1HB0B 4X1PU 3KGPA 2OC8A 1MKXH 3FP7E 1SQRA 1T4VH 3PV4A 5T1VA 1C1PA 5GDSH 1Y3WA 2BOHB 2JH0D 2ZGHA 1QTFA 3FZZA 2ZDAH 2ODPA 3TH2H 1O2JA 2FOHA 4H42U 4VGCB 3AAVA 1UTQA 1AD8H 1BTYA 1GHZA 2JJ1D 2J5UA 1GMHF 2A32A 2BZ6H 2FEQH 5BRRE 4H4FA 1SQAA 1V2QT 2NU3E 3MFJA 2Y81A 1UTOA 2W3IA 2ZKSA 1W0ZU 1IQEA 2B8OH 2IPHA 1K1MA 2CHAC 3LGVA 2XOKD 2VWOA 4ZKSU 1C4Y2 1HAGE 1BRCE 1OOKB 1FIWA 1KLJH 3F9GA 2ZGCA 1L2EA 2IOTA 5DP5A 4X2YA 1SOTA 3WWBA 2CK3D 4ABIA 1O36A 3N7OA 1DLKB 5B6OA 1KSNA 4XBCA 2Z9JA 4ZXXH 3HPTB 1G3DA 4KGAA 1FPCH 5EU8A 1HIAB 3HGNA 2AHME 4NIWA 1A46H 1BHXB 1RTFB 1TRYA 5CHAC 4ABFA 1CVWH 2PKAB 2XWAA 3CS0A 4MPVA 5A8XA 1AVWA 1KXFA 2ZO3H 3BTDE 1TB6H 3EA8A 3NRLA 4FVDA 5FHTA 1H8DH 3SNBA 2ANYA 2VVCA 2ZTXA 5TCCA 1HGTH 1EJAA 3JZ1B 4KELA 2P8OB 1A1RA 2ZP0H 3BEFB 1S0RA 1C5OH 3F0OA 1C5RA 1X7AC 2C8ZB 4ISIH 1GI3A 3FN8A 2ZECA 2ZHFH 3QO6A 1FY1A 1SKYE 2F9NA 1AO5A 5GCHF 1TNHA 1HAVB 3TLOA 4ZCNA 3ATLA 2STBE 4MNWA 2O8MA 1P11E 1KXEA 4ABJA 3B9FH 1ZHRA 2P16A 1GHYH 4FVBA 4FU9A 1AVXA 1HLTH 2P8OC 3FAOA 2BY9X 5ESTE 3LH3A 1T4UH 2VGCC 2STAE 2G52A 4Y76A 4CHAC 5CMXH 2H2ZA 3TGKE 4INLA 1QJ1B 1K0HA 2OCVB 2GV7A 2FLRH 2FI5E 2CJIA 1V2OT 1YPEH 2XCFA 3OEHD 1GJ7B 1SB1H 1PQAA 3U1IB 4GUXA 5DP7A 1DLEA 1GG6B 2OLGA 3E16B 1V3XA 3GISB 3MNBA 4ZMAH 4TYDA 4MNVA 2KX4A 5IYTA 3ELAH 2R0KA 1W0KD 3M3VA 5E2PA 4F55A 1Z8GA 2WUCA 2PTCE 4ZHAA 4HI3A 3ZYEA 5C5NA 1UCYK 4AZ2B 5EPNA 2JIZD 2A4GA 1BBRK 1QB9A 3GCOA 3ZZ4A 4B6FA 5L2ZH 2GCTB 4IN2A 2VH0A 9LPRA 1AZ8A 1C2EA 1DM4B 2W5EA 1AUTC 5EW2H 5IK2D 3UPEA 1NBME 3MI4A 1BA8B 3AW1A 3SU1A 3URDA 1P2QA 4ZKOU 4RSPA 4I32A 3DUXH 3MO3A 4BTTB 2VB0A 2QC2A 1OWDA 4UEHH 1VJAU 1E35B 4ZAEA 2PR3A 1CHGA 2OC0A 1FAXA 5AF9H 1P0SH 1MAXA 1B7XB 1GJAB 2R3UA 2ZCKP 1G30B 2FO9A 3TJUA 1K21H 4X1SU 5EPYA 1TBZH 1HAYB 2H9TH 1ANCA 1S6LA 2BYAX 1T8NA 2YNAA 4DJZB 2HWLB 3Q3KA 3MTYA 1GG6C 1W8BH 2R0LA 1CU1A 2TGTA 2J92A 3BTQE 3IITA 2FS9A 3PRDA 1BTWA 1TRMA 1V2PT 4UONA 1FZZA 1RGQA 4NGAH 1IQIA 3PV5A 2FOEA 1F7ZA 2AMPA 1Z7KA 3PWCA 1WAYB 1ZOMA 2KZ4A 2W7UA 2DE8A 1C5YB 1XXFA 3RXMA 1Z6JH 1MTUA 1FXYA 3GDUA 2QGRA 3PRBA 4MPWA 4WF8A 1LHGH 1ELCA 2FXRA 2GTBA 2ZIQH 4RT1A 4A92A 4DGJA 1NPMA 1L4DA 2TPIZ 4XSKU 1MBMA 4WJG2 2XNDD 4UE7H 4FU8A 3LIWA 4FUCA 1O2KA 5C5OA 1QBOA 5A2MH 4X8UH 3P92A 1NZQH 4FUIA 5A0AE 1V2NT 3SUFA 2Q6DA 2UWLA 1EB2A 1E1RD 1MU8B 2PWXA 4AX9H 4BTUB 1MH0A 1QBNA 1QCPA 2K8IA 2ZFPH 1GBTA 3RXGA 5SGAE 2PW8H 1NFUA 2BD4A 1F0SA 1W0JD 2XYAA 1E79D 4JMYA 3DA9B 4D9RA 1SGCA 1FQ3A 3KYFA 3O8BA 3BSQA 3STIA 1O3CA 1RTKA 5DGJA 2SGPE 1O31A 2CGAA 3KL6A 3GY3A 2SGEE 6GCHG 1PPFE 2D2DA 5LPRA 2ODQA 4Y8XA 5EJ1A 1XKBC 4ABDA 2V3OH 1BTUA 1YY3A 3A84A 1ESBA 2BDCA 3GICB 1A5IA 3KYGA 2FIRH 1H9HE 2YMSB 5CHAB 4Q7ZA 1HRTH 1AKSB 1O2LA 4FUHA 4GVUA 4HFPB 1AKSA 4YM9A 1EUFA 5A0BA 1H1BA 3FO8D 4CH8B 1JMOH 4X8SH 4AG1A 3VB3A 1SR5C 4P02A 2EY4C 3S9CA 4GCHF 2F9UA 1CHOF 3MO6A 1F0UA 3TJVA 1N6YA 3C27B 4ISLA 4E06H 3MMGA 1DUEA 1MQ6A 1Y5UT 4O97A 1A0LA 2AFQB 2IPQX 1ID5H 3SHCH 1EFRD 1ARCA 5GIBA 2FYRA 2EA3A 3M61U 1ZZZA 2GJGA 2IN2A 3R3GB 3UTUH 1SSXA 3MU1A 2FI3E 5FBEA 1AWHB 1EJMA 2C8YB 3FANA 3NKKA 4Y71A 1U6QA 3BEIB 1PJPA 4OGXA 3PLBA 1O3LA 3SU2A 2ZDNA 4ASUD 2Z9LA 1J15A 1G3BA 1YPMH 2O8TA 4J2YB 3SJKA 1TMUH 3SV7A 3ATIA 3BTHE 2FTLE 1FY8E 2WPDD 3HKJB 1P2NA 3FZDA 1RIWC 3LONA 1QQUA 1DX5M 1BTPA 1CA0B 1WBGB 1NY22 1HJ9A 3UB0A 3T5FH 1CBWB 5L6NH 2VIQA 3RC5A 1O37A 1S0QA 1ZTKA 1OP2A 2FX6A 1O3PB 3SNDA 1P3EA 5C94A 1C9TA 1EAWA 1LVMA 3OX7U 1C4U2 2ZI2H 4YT6H 1GDNA 2Z3CA 1QL9A 1W3CA 4MLFB 2BQWB 4D9QA 2GT7A 5FCRA 1QHRB 1UJ1A 2XBYA 1YCPH 3P6ZB 3RU4D 1T31A 1C9PA 4HGCA 3ZV9A 1EQ9A 1EZQA 3GS9A 1ELDE 5JBAS 1D3TB 4I7YH 2KFWA 5HIZA 2BVRH 1NRQH 3BG4C 1GBEA 1EAIA 4MPXA 1C1TA 4XE4A 1N8OC 1K1IA 3TGIE 1UVTH 1YP9A 1C1UH 2BDGA 1FIZA 4CHAB 1SMFE 4AYVB 2ZA5A 2GKVE 4Y0ZE 4DT7B 1SGEE 1NFXA 3RP2A 1JWTA 3A85A 3EGKH 4WH8A 1O2TA 1PPEE 3RXPA 2QV1A 2SGQE 3SN8A 3TK9A 1DWCH 1UTLM 3SZNA 1OWJA 1VZQH 2ZFSA 3VEQB 1SHHB 3Q77A 4CRBA 1O2MA 2ZHEH 2FLBH 3GCTF 2C93B 1TPOA 1NTPA 2F9VA 1MU6B 1MTSA 4I86A 1VCQA 3ZZ9A 3VGCC 1T8LA 1N6XA 1SGDE 3I29A 2VVVA 1M9UA 4KTCA 2BD7A 1VGCB 4NFFA 1LTOA 3F1SB 2ZFQH 2BXTH 1E37B 1XUIA 4CBOA 5DP6A 4TY6A 4BXSA 1OWHA 3ZV8A 1FX0B 3QTOH 1BOQA 1HPGA 3WW7A 1JIRA 1ARBA 3ODDA 1PQ7A 5A0CA 3PWBA 3DFLA 1RD3B 3SI4H 4Q80A 2JH6D 1TNJA 1B0EA 4Y0YE 3SV6A 3ZZAA 5I46H 4Z0KA 3O8DA 1ELEE 4JK6A 5H4IB 3F2GA 1LVYA 3ZVGA 3ZZBA 1KTTB 3ZVFA 4Z6AH 3F9FA 1HV7A 2FOCA 2VIWA 2QY0B 4TSFD 5E0JA 5C1XA 1GI6A 1MBQA 1W11U 7GCHG 4AFQA 2BOKA 5J4QA 1A7SA 1Z71A 2OD3B 1ELFA 3MO9A 2BY5X 2PGQB 2ZU1A 3AK5A 1TQ0B 4AYYB 5I25A 3NCLA 1TLDA 2R2WU 4VGCC 2XRCA 1JOUB 2QCYA 1P3CA 4YXWD 2BQ6B 5T3HA 4A7IB 1K1JA 1ZRKA 5FPSA 3FKSD 5DKMA 5TJXA 3LDXH 4JZFH 2BLOA 3BTWE 4ZHMU 1YC0A 1A2CH 1FDPA 4TT3D 2THFB 2UWOA 3BN9A 3NXPA 1Q2WA 3QN7A 4A1TA 1GL0E 4CH2B 4E7NA 3NPSA 3ATWA 1YLDA 2KR7A 1UTKA 1O3JA 6GCHF 1TNIA 1N1LA 2VBCA 2VIVA 3S7HB 4FU7A 4UDWH 1FI8A 1A61H 1Z8IB 2HNTC 2EC9H 1LCYA 1OP0A 2BQ7B 3N7DA 3KCGH 5FBIA 5F8ZA 1TOCB 5C0UA 1EAXA 1GI1A 4LK4A 3BG4B 1A0JA 2QF0A 1ZMNA 3SZEA 1C5UA 2ANKH 2XC0A 2C8WB 5JBCS 4MG3A 1NRRH 3VG8A 1HYLA 4Q63A 4ABGA 2GGVB 1GCTC 1TAWA 1FLEE 1Z8RA 2JJ2D 3FFGA 1YLNA 3HKIB 1TGTA 4M9FA 5LGOA 1FV9A 1EOJA 1ZMJA 4DY7B 2AGIX 3T29A 1H8HD 1A3BH 5FPTA 1TWXB 4UFGH 1C2GA 2SNWA 2QF5A 1SGPE 3V13A 1GBLA 3KQCA 1BIOA 1BTZA 2K0QA 2AGEX 3Q3XA 4Q2KA 3A8AA 1TRNA 1DICA 1O5AB 1GBKA 3SGQE 2ULLA 3M7QA 8ESTE 1KLTA 1NESE 5C1UA 1GJ5H 3H5CB 5E8EH 2F83A 1C5VA 1SLUB 1IQMA 2Y80A 4BXWA 2OUAA 2BD2A 2UWPA 1LMWB 3A8BA 5DP8A 1V2TT 1GI7B 1WU1A 2UUYA 1C5TA 4RKOB 2FOAA 3KQEA 3TH4H 2BB4A 3UAIC 4Y10E 1H9IE 2GDEH 3M3TA 3MH7A 1ZHMA 2O9QA 4TPIZ 5T6GA 4D8NA 1EXFA 3ESTA 1BMNH 1OKXA 2JETB 1ETTH 4IN1A 4R8TB 3VXFH 4ZROA 1HFDA 4RKJB 4WXIA 1HDTH 3SU3A 5HKKD 1QL8A 2YOLA 3VGCB 1T8OA 2ZPQA 2FOFA 4AFZA 2ALPA 2H9EH 2QE7D 4E7RG 1LDTT 1TMTH 4JYTA 1KDQA 2GV6A 4XOJA 1DWBH 1LHCH 4X6PA 3BTFE 2XC5A 3OAAD 1GBFA 2F4LA 1C1OA 3K6ZA 1A0HB 4XRNA 4Z1MD 2H1UA 1GJ4H 2J2UA 1WV7H 4X0WU 3PLKA 3UQOA 1XUFA 2ANMH 1DWEH 1ZYOA 4Q7XA 2OINA 5CE1A 2TBSA 3MH6A 2HOBA 3RMMH 2ODYB 3T27A 1O2PA 1LHEH 4X1NU 3A7VA 1DFPA 1V2LT 6LPRA 4ZXYH 6CHAB 1O3BA 3ZVDA 1CGHA 3U8TH 4FUJA 1EP6A 3GCNA 2PUQH 4UFEH 2A5KA 3RXVA 4LZ1H 1SGNE 3F3BA 4B74A 4MPUA 5C67A 4B2AA 5HM2A 2ZZUH 3P70B 3RM0H 3K6YA 1O3GA 1ESTA 1SL3A 2GCHG 4CRGA 1BRBE 1AUJA 1ZLRA 4TWYA 3P95A 1G2MA 3ZZ6A 1K1NA 1NM6A 4ZKNU 2XNIA 4O3TA 3RXCA 4DIHH 3LC5A 2M2AA 1VJ9U 2GZ7A 3BTTE 1XUJA 2A0QB 2HNTE 1UK3A 3NZIA 1MQ5A 5B6LA 2UUJB 2CHAB 2V7QD 1L1GA 1IQHA 5FX5A 1Y3XA 2HPPH 4FXGH 4NCYA 1O3NA 1J16A 1CT4E 1J8AA 3GYLB 1VITG 1DE7H 3CENA 3PTNA 3A7TA 3OE7D 2O8WA 1SQTA 1GMCG 2ZC9H 4QT8C 3FOAA 2XWBI 1GHBF 5JPMH 4THNH 2YMSD 1N8OB 1O2HA 2PUXB 5C0TA 1T8MA 1OX1A 1J9CH 3TPIZ 1MD8A 2FS8A 1RS0A 2ZPRA 1V2UT 4K1EA 5T6FA 2C8XB 1ABIH 1NN6A 2P93A 1Z8JB 3RXIA 1UHBB 4BAQB 1JRSA 2VINA 1UHBA 5DP4A 3ZZCA 1NFYA 4CR5A 2A4RA 5JB8S 1P9UA 3JZ2B 4AGJA 3KQDA 3MU4A 2L6OA 3TIUA 3N99A 2H9HA 4OS4A 3PROA 5C1YA 2M5TA 5GCHG 1QL7A 3HATH 3RXJA 1VCPA 3D62A 3KNXA 3RUOA 3FP6E 1D6RA 1BMFD 2I6QA 1O3KA 3P17H 4MTBA 2KM0A 3TU7H 2BVXH 3RXOA 5DK1A 3OU0A 1O5EH 2Z7FE 3SUDA 3SNEA 1SGTA 4XDEA 1S83A 4Y11E 4YO9A 3GCHB 3ZVCA 4GPGA 1ZJKA 3CNRA 1L4ZA 5EOKA 1BMMH 1GVZA 1ANDA 3S0NA 1YWUA 5E0GA 3ZVAA 4O9VA 3F0PA 3SV8A 2EI8A 2SGFE 1HAHH 1O30A 2ZDVH 4NA7A 3Q3YA 2FX4A 4KTSA 2FOGA 2SNVA 1MD7A 1EZXC 2A7HA 3GDSA 1SGIB 1YPGH 4NG9H 1BITA 3RM2H 2QXIA 1ORFA 4NZLA 1YPKH 1O3EA 5DSFA 3S69A 1AE8H 1PYTC 1W2KH 2PHBA 4IMZA 4KTUA 4XBBA 2ZTYA 2GD4B 2A4OA 1RXPA 3M36A 2PFEA 1D3PB 1QA7A 3G01A 1W7GH 1TBQH 1GHVH 4NA8A 3SU4A 2A2QH 2FESH 1MTVA 1YPJH 3LPRA 5JYIA 8KME2 3GCTG 3OSYA 4IC6A 4F49A 3LJOA 2B0FA 1S6FA 1CHOG 3RMOH 1DSUA 4GCHG 1OXGA 1E34B 1AMHA 2VVUA 1ESAA 3CS7A 1VKYA 2AIQA 1SI5H 2ZF0H 1MTWA 1V2KT 1SGFA 1ACBE 1F92A 3KQBA 5GXPA 1NRSH 3NUMA 1GBAA 5JDUB 2L74A 3BEUA 2GT8A 3GOVB 2YNBA 1ZR0A 3EA7A 3S9AA 1UMAH 1ZRBA 1BRUP 1HNEE 1K9OE 1HBTH 1GMCF 1P2KA 1SGYE 4WH6A 2TRMA 2P95A 1KDQB 2J94A 2P3UB 1V2VT 3LGTA 3QDZB 3QGNB 1IQLA 1KLIH 1OSSA 1LKAA 3RU4T 4A1XA 3UNRA 2LP6A 1O2RA 4Q4LA 3URCA 2FDAA 1JIMA 4X1RU 3VB7A 3A7ZA 1QA0A 1Y3VA 4JK5A 5CHBA 4ZUHA 1BQYA 3LGYA 5AFZH 3W1EA 1KY9A 3V7TA 2GCHF 1UK4A 1HAPH 4LZ4B 2V35A 2ZGJA 4ISHH 1C2KA 3GY4A 3RXHA 3TITA 1SC8U 1C2JA 4X2VA 4GAWA 1F5RA 1W12U 4MDSA 4B6EA 4X2WA 5KEDA 1KIGH 1SG8B 9ESTA 4LXBH 1SFQB 1ZPZA 3ZZ3A 2A7JA 3NK8A 1C2HA 1HAIH 1S81A 1LQEA 4DIIH 2TGPZ 1HXEH 4ABHA 1K1OA 1UVUH 4NWKA 3W94A 1UTNA 3H7TA 1GDUA 3SOSA 1UK2A 4WXVA 1ZHPA 5E0HA 3QTVH 3DSPA 1FUJA 3SBKA 1GMDG 2K1QA 2GMTB 3K65B 4IGDA 5GJ4B 4FOUC 3SU5A 1RTLA 1GJ6A 4OS7A 1O5BB 2RDLA 2ZHQH 1QB6A 5EXMA 4CR9A 4BAOB 4AN7A 1E0FD 1EX3A 2J34A 1P02A 1XUGA 5K7RA 1O3OA 2ZGXH 1P2OA 1DT2A 1C5ZB 4J1YA 4JYVH 3BG8A 1C5WB 1EPTC 1O35A 1H9LB 1AGJA 1PPGE 1QB1A 1ETSH 5FPYA 3U8RH 1P05A 1MZAA 1LPGB 1ABJH 1RIWB 1FY3A 3E8LA 1K1PA 2OQ5A 2OTVA 2BY8X 2PGBB 1WSSH 1C2MA 1FN8A 1FMGA 3N7EA 1GCDA 5DN6D 3TVJB 5L30H 2BXUH 2FWWA 8GCHG 1XX9A 1Z1IA 4R0IA 3A82A 1LHFH 1DVAH 2PLXA 2UUFB 2ZCLP 5EXLA 1OWEA 1PPBH 2ZHDA 1THPB 5A8ZA 4MNXA 2QXGA 1JXPA 3BF6H 1TFXA 2WZQA 1NO9H 1Y5AT 3U69H 4U30A 3UOPA 2D1JA 2KCOA 2G5NA 4A5TS 4YOGA 1CT0E 1O2YA 4OS2A 2UUKB 3O8CA 2KCPA 1B0FA 1E36B 3K2UA 3UREA 5DG6A 2RG3A 2QN5T 1C1RA 2DUCA 4I8HA 4A1VA 2Z9IA 3UUZA 1P9SA 5FAHA 1SPJA 1YGCH 1SGFG 1DSTA 1WTGH 4ZH8A 4Q7YA 4ESTE 3QZQA 1AN1E 2HNTF 1GBMA 5EXNA 4JYUH 5DP3A 1JRTA 4I8JA 3UFAA 3E0NB 2ZCHP 1W0YH 3SUEA 1G37A 4FUFA 3RXDA 1SQOA 2GDDA 5HMAA 5EG4A 3SO3A 2FODA 1GDQA 1QRXA 3A86A 1MKWK 1S82A 1PPZA 1YBWA 2HRVA 5BPEA 2ZDMA 4I8LA 3SORA 3SNAA 3M7UA 1DPOA 3H7OA 3KEEA 1EATA 4BOHA 1YF4A 2DE9A 4Y8ZA 1VITF 3VPKA 3K9XB 3RXKA 4A6LA 3EQ0H 4CRDA 1P2MA 1A5GH 1THRH 2AEIH 1L0ZA 1V2JT 2Y82A 2Y5HA 2Q6FA 3V3MA 3P8NA 1WQVH 4IS5A 2QF4A 2OBOA 1HJAB 1P57B 1CQQA 2HPQH 2ZU4A 1OYTH 1GI8B 1DY9A 1NU9A 1TMBH 7KMEH 1O2XA 1TX8A 1C5MD 4OS1A 3IWMA 2C4FH 3M5NA 3OY5U 4INHA 1TONA 3MOCA 1FY4A 1S5SA 4AOQA 2CV3A 2VU8E 3SU0A 2ZFRH 4I31A 1Z1JA 3E1XB 3OYPA 2XC4A 1GI5A 1HJAC 1KXAA 4TPYA 3MU8A 2OC1A 1ELVA 4XFQA 3MH4A 4I33A 2VIDA 1QIXB 2F9BH 4YOJA 5J4SA 1C1MA 3NWUA 3F2HA 3RDZA 1Y59T 3PB1E 1QJ7B 4NFEA 4HG6A 1ANBA 1G32B 3GYMA 7GCHF 2VWNA 2HVXA 5TCAA 3MU5A 1Z6EA 4JZ1A 1O2GH 2W3KA 1DY8A 3ZZDA 2WYJA 1GBHA 3EE7A 1MKXK 3GY6A 4TWWA 5F53A 4PROA 2BD3A 1PQ5A 2C3SA 3UR9A 2BLVA 1SLWB 7ESTE 2HVYB 5C3NA 1BHXF 1GL1A 4SGBE 1MMJN 1W14U 1YPHE 1XVOA 4B71A 5F03A 1SGQE 2BX3A 2BDIA 1TE0A 3VB6A 2Q6GA 2TGAA 1SOZA 1TGSZ 3Q76A 1EJNA 1HAOH 5JBBS 3SV2H 1MTNB 2ZU2A 5AVDA 2WPMS 3RXEA 4H6TA 3OTPA 1UCYE 3BIUH 2BDYA 1GJ8B 1CSOE 3A83A 4WWYA 4AFSA 2G81E 3LJJA 5EQQA 3O8RA 1TALA 3QZRA 1EB1H 5AFYH 1BMAA 1UTJA 2RDEA 2FMJA 1KYNA 2A2XH 4KP0A 3U9AH 1YLCA 2C90B 3UR6A 2J95A 3OY6U 3UWIA 1QGFA 3UY9A 1GJ9B 1O2OA 3FP8E 1COWD 1BTHH 4RT0A 2QIQA 1FJSA 2EI6A 2VJ1A 2J98A 1ZJDA 4GHTA 4X2XA 3B8JA 3MNCA 4B2BA 4YLUA 2NU4E 1BJVA 2XBWA 1G3CA 1C1WH 2BY7X 5ETXA 4X6NA 4U01A 1AFQC 4X6MA 3RXQA 5FXLA 1ZPCA 1DXWA 2XBXA 1P03A 2B7DH 1SVPA 2P59A 3GY2A 1EKBB 4CREA 1RRKA 2A4QA 4Y7AA 1NROH 2P3FH 1ELBA 1LHDH 5FCKA 1MCVA 4K1TA 1RFNA 1OYQA 2PSYA 1UVSH 3GY7A 5GNDA 2BHGA 2SFAA 1H8ED 2HLCA 1AFQB 1ELGA 5LPEA 1XVMA 3RXBA 3W95A 1O3MA 2XXLA 1P09A 4BAKB 1GHWH 1IHTH 1W10U 1YCPM 3A87A 2AGGX 2QYIA 4M7GA 1KXDA 1BUIA 4X1QU 4ACBA 1GHXH 1ZTJA 2V3HH 1EPTB 3BTGE 1XKAC 1O5FH 4KKDA 1XUKA 3WWFA 3D23A 1UW7A 4FUEA 1L1JA 1O5GH 3MU0A 3AAUA 2CMYA 4ISNA 1AB9B 3KQ5A 2AERH 3A7YA 1B5GH 1AFEH 2W26A 4BNRA 5LH8A 1PPHE 2GP9B 3M5OA 2CF8H 2I6SA 3EAJA 3TH3H 1V6DA 1D9IA 2NWNA 2V0BA 5A09A 4BANB 4OS6A 1QJ6B 3RLWH
chains in the Genus database with same CATH topology
2ZFTA 1TA6A 3C1KA 1SLXB 1XM1A 2OQUA 4B1TA 2Y5FA 3E0PB 4B73A 3KIDU 4FUDA 2R2MB 4X6OA 1GBDA 1TPAE 4IBLH 3DT0H 2ASUB 3R0FA 1G9IE 4RN6A 3VXEH 2ZEBA 1GI4A 1GVLA 3MYWA 1GBBA 2BD5A 1SBWA 3ENSB 1D3QB 3L6PA 4JZIA 1AU8A 2WPJS 3EYDA 3LU9B 3AW0A 3UIRA 3SUGA 5LPFA 1EZUC 3BTME 1GJDB 4K8YA 3FVFB 3PM3A 1GMHG 1OWKA 4JCNA 1IQJA 3RLYH 1C5XB 1F5KU 1OS8A 3HK3B 4DVAU 1GJCB 2AS9A 6ESTA 3VFEA 4ABBA 3ZVBA 3RC4A 1BMLA 3MWIU 1O2VA 3RXFA 4K3JA 3LGWA 2F91A 1TX7A 3GY8A 3MH5A 5G4BA 3KN2A 5EQRA 5EGMA 3QGJA 1F0TA 4JZEH 4Y6DA 3A88A 2GMTC 4ISOA 3VB4A 2BD9A 1PPCE 3ITIA 1SLVB 4ABAA 1A5HA 2VGCB 1C1SA 3HGPA 3B23B 4FUBA 1OWIA 5ESBA 2Z6BD 1TX6A 1CGIE 6CHAC 1BB0B 1HAXB 1YPLH 1AWFH 1GBIA 2FOMB 2VIPA 1D6WA 3GCHC 2RA3A 2JETC 4IMQA 1BZXE 3U98H 1IQKA 1TIOA 4B2CA 1FNIA 3D49H 1G36A 2JH5D 3LC3A 1D3DB 3ODFA 2KAIB 2BX4A 2RCEA 2BDHA 1TOMH 2NU0E 1O32A 2GZ8A 1WOFA 1LVOA 3UNQA 4OS5A 3A7WA 1V2WT 1QY6A 1S85A 1HXFH 1FN6A 1C5SA 8LPRA 1QFKH 3S7KB 1TGBA 2Z94A 1GI9B 1DDJA 1AHTH 3E6PH 2ZWLH 1PYTD 1G3EA 1LPKB 3TNSA 2G5VA 1TNLA 1WCZA 2V6NA 5HYOA 4YTAA 1VITH 4K5ZA 1P04A 3P8GA 4I8KA 4B76A 3M35A 1UTPA 4ASHA 1GHAF 2F9PA 5EQSA 1THSH 1C5NH 2ZQ2A 2A1DB 2H6MA 1GHBG 2QAAA 3A80A 2ZGBH 3GDVA 2WPKS 2XTTB 4UFDH 1LKBA 4IC5A 2J38A 1EASA 1SFIA 1GWAA 2TIOA 2ZQ1A 1LO6A 1Y5BT 3AASA 1JBUH 1IQFA 2AIPA 1EOLA 3EE0B 1GVKB 3VB5A 4NSYA 7LPRA 5EODA 1C1QA 4WMFA 2QXHA 1W7XH 1OP8A 4DOQA 3Q00A 4K2YA 1UVPA 1GGDC 1IOEA 2VWMA 3UNSA 3AVZA 3M37A 2P94A 1DWDH 1KXBA 1INCA 2QF3A 3RXTA 1O3IA 3U8OH 1A4WH 1CBWC 1ZSJA 3PMAB 2WPHS 1WYKA 2OBQA 1VGCC 2PTNA 3TK5A 1K1LA 1WUNH 1UO6A 1HUTH 3ZVEA 1QRZA 2BVSH 4K8BA 3PMBB 1FPHH 5F6MA 3PMJA 2QXJA 2A7CA 2F3CE 1CGJE 2Y7XA 2Z9GA 1XMNB 1BCUH 1AI8H 1XXDA 1XUHA 1C4V2 4JZDH 4SGAE 2WPLS 3A8CA 3RC6A 4YOIA 4GSOA 1GJBB 2AMQA 5HGGA 1YM0A 2P3TB 3SQEE 1Y8TA 4NA9H 1O2WA 2PKSB 1TNKA 5DP9A 2D26C 1EAUA 3A89A 3MHWU 1S6HA 5T6DA 2BD8A 4WVPE 2G4UA 2BY6X 1P12E 1T32A 2F9OA 3BV9B 1QR3E 2ZTZA 1KTSB 3BTEE 2Z3DA 3RXUA 1J17T 3LH1A 1DS2E 1TPSA 3P8FA 1BRAA 1CA0C 1MKWH 1MCTA 2AMDA 4GLYA 3SJ9A 1Q31A 1AY6H 4MNYA 1KXCA 4BAHB 2H5CA 5GWZA 4WY3A 2BMGB 2H5DA 2Y5GA 2ESTE 2WV5A 4AB9A 2CXVA 3M3SA 1Q3XA 1ANEA 1HAVA 4MVNA 1FY5A 1L1NA 1YYY1 4E05H 3TK6A 4YLQH 3I77A 2GVFA 3UQVA 1O5DH 1IQNA 1GBCA 1GBJA 3PO1C 3KF2A 1TABE 3F9EA 1OPHB 1NRNH 2XBVA 3L33A 4IW4E 3U1JB 3RXRA 1AVGH 2A5AA 2LNCA 3ZZ5A 2ZHWH 3GY5A 2XCNA 4INKA 4NZQA 1D4PB 1CT2E 1TBRH 2PKAA 4O03A 1NS3A 1F2SE 3RXLA 1CE5A 1A3EH 1CO7E 2JKHA 1O2QA 1C1NA 3RXAA 1O3HA 3WY8A 2CF9H 5EW1H 3TGJE 3F68H 4MQAA 1HAZB 2FZZA 2OC7A 3DD2H 5C20A 1TGNA 1O38A 4H6SB 4NSVA 1SGRE 1YCPK 2J9NA 1QURH 1O0DH 4NIYA 1ZGIA 3LGUA 4U2WA 5PTPA 1O3AA 2BLQA 2WYGA 4CRAA 3DFJA 3LGIA 1PFXC 4I8GA 2ALVA 4K69A 4WMDA 3EDXB 1C1VH 1IHSH 2HGTH 3LKWA 3QUMP 2ZU5A 1ZTLA 1RJXB 3M7TA 3D65E 1QNJA 1C2FA 1MTNC 1CA8B 1ZPBA 2HALA 3S9BA 5DO4H 1O2SA 2R3YA 3OTJE 2ZFFH 4DW2U 3QWCH 3T26A 4K60A 4YZUA 3SW2B 1EP5A 3I78A 3ZZ7A 3ZYDA 2G51A 2BTCE 2GX4A 1C5LH 1P01A 3DHKH 1IAUA 1O5CB 5A8YA 1P10A 4UFFH 1UCYH 2Z9KA 4NIXA 4Y8YA 4NWLA 2BDBA 3F6UH 1DOJA 3UOUA 1O2UA 3ATMA 1ETRH 4F4OC 4Y7BA 1C2DA 2EI7A 1GGDB 4AG2A 3QX5H 1O2ZA 2VNTA 5K0HA 2SGDE 1V2ST 1NT1A 1AB9C 2R9PA 3QK1A 5JBTA 1QRWA 3SHAH 1H8IH 1YPHC 5AHGH 5F8TA 1BBRH 8GCHF 3PTBA 4LOYH 3EA9A 1TYNA 5HXFA 2W7SA 1BT7A 1GHAG 1AIXH 3TJOA 3SU6A 3M5LA 3T25A 2Y7ZA 1P8VC 2FI4E 1J14A 3RMNH 1MZDA 1SHYA 4WMEA 2OP9A 1C5QA 2A31A 4AGKA 5HM9A 1Y3UA 1AZZA 2VIOA 3RMLH 1GI0A 1DANH 3BTKE 1BJUA 1O3DA 2FM2A 4TY7A 2GCTC 5DPAA 4YESB 4ZHLU 3SNCA 1WTHD 3LT3A 1ELTA 1F0RA 3V0XA 3TJNA 2VWLA 1W13U 1F5LA 4U32A 2A5IA 2XW9A 2ILNA 1WQSA 1HCGA 2A45B 1P2IA 2GZ9A 3RU4E 1PQ8A 1BBRE 4D7FA 1TA2A 3QLPH 5FX6A 1O2IA 2TGDA 1DUAA 1P2JA 1E38B 4CRFA 3MNSA 1K22H 2CN0H 2ZDLA 4AORA 2PSXA 2ZPSA 3E90B 1UTMA 1S84A 4DCDA 3HK6B 1MUEB 1K28D 3PLPA 1NRPH 4AB8A 3PO1B 3SJ8A 1GI2A 1ZMLA 1BTXA 3E91A 3F9HA 1O34A 1O3FA 2WINI 1TNGA 2AH4X 4XBDA 3CP7A 3SQHE 5C2ZA 3MNXA 1FAKH 1QQ4A 3M5MA 2ZNKH 1LVBA 2Z3EA 1Y3YA 1NFWA 2NU1E 1ELAA 4K1SA 4AFUA 2BM2A 2FPZA 1HIAA 2G00A 2NU2E 1YKTA 1NU7B 2B5TB 2FOBA 4CRCA 1LPZB 3SV9A 2FTMA 3KHVA 2OXSA 2ZDKA 5E2OA 1C2IA 3A7XA 2BDAA 5F8XA 3BIVH 3SI3H 1UVOA 2RA0A 1K2I1 3T28A 1H4WA 3ATKA 4Y79A 3TNTA 2SGAA 2FP7B 1ZSLA 1C2LA 1O2NA 2ANWA 1G2LA 2ZG0H 4X8TH 3L3TA 2FYQA 2VH6A 3SJIA 4OGYA 3UWJH 4D7GA 2B9LA 1V2RT 3STJA 1GMDF 3A8DA 1O39A 4D76A 1EPTA 1TQ7B 3V12A 4YT7H 1DITH 1GPZA 3E3TA 4O3UA 2BZAA 3SGAE 3RXSA 3PYHA 2ZU3A 1EZSC 2LPRA 2G4TA 2QA9E 2WUBA 2IJOB 3T62A 3LOXA 1P06A 2D8WA 1C5PA 1ZSKA 2J4IA 2KAIA 1DXPA 5L2YH 4NIVA 1BDAA 2WV4A 1VCWA 4CBNA 1NC6A 1ZGVA 1IQGA 1GCTB 1HJ8A 5ABWA 5IDKA 2PKSC 3PMHB 1FONA 1QBVH 5DJ7A 2Y6TA 1TGCA 2Q1JA 3IG6B 4B75A 2O8UA 3T2NA 1AE5A 2WPIS 5JB9S 1LQDB 4UD9H 4DURA 4ABEA 1T7CA 5GPIB 2O8LA 2BLWA 4HTCH 4DG4A 1AQ7A 3SJOA 1O33A 4BTIB 3P8OA 4BAMB 2G55A 2PV9B 2G8TA 3A81A 4ZKRU 3SGBE 4X8VH 3ZZ8A 1VR1H 2AYWA 2EEKA 1MAYA 4GHQA 4FUGA 4HZHA 1TPPA 1V2MT 1HB0B 4X1PU 3KGPA 2OC8A 1MKXH 3FP7E 1T4VH 3PV4A 1C1PA 5GDSH 1Y3WA 2BOHB 2JH0D 2ZGHA 1QTFA 3FZZA 2ZDAH 2ODPA 3TH2H 1O2JA 2FOHA 4H42U 4VGCB 3AAVA 1UTQA 1AD8H 1BTYA 1GHZA 1GMHF 2A32A 2BZ6H 2FEQH 5BRRE 4H4FA 1SQAA 1V2QT 2NU3E 3MFJA 2Y81A 1UTOA 2W3IA 2ZKSA 1W0ZU 1IQEA 2B8OH 2IPHA 1K1MA 2CHAC 3LGVA 2VWOA 4ZKSU 1C4Y2 1HAGE 1BRCE 1OOKB 1FIWA 1KLJH 3F9GA 2ZGCA 1L2EA 2IOTA 5DP5A 4X2YA 1SOTA 4ABIA 1O36A 3N7OA 1DLKB 5B6OA 1KSNA 4XBCA 2Z9JA 4ZXXH 3HPTB 1G3DA 4KGAA 1FPCH 5EU8A 1HIAB 3HGNA 4NIWA 1A46H 1BHXB 1RTFB 1TRYA 5CHAC 4ABFA 1CVWH 2PKAB 2XWAA 3CS0A 4MPVA 5A8XA 1AVWA 1KXFA 2ZO3H 3BTDE 1TB6H 3EA8A 4FVDA 5FHTA 1H8DH 3SNBA 2ANYA 2VVCA 2ZTXA 5TCCA 1HGTH 1EJAA 3JZ1B 4KELA 2P8OB 1A1RA 2ZP0H 3BEFB 1S0RA 1C5OH 1C5RA 1X7AC 2C8ZB 4ISIH 1GI3A 2ZECA 2ZHFH 3QO6A 1FY1A 2F9NA 1AO5A 5GCHF 1TNHA 1HAVB 3TLOA 3ATLA 2STBE 4MNWA 2O8MA 1P11E 1KXEA 4ABJA 3B9FH 1ZHRA 2P16A 1GHYH 4FVBA 4FU9A 1AVXA 1HLTH 2P8OC 3FAOA 2BY9X 5ESTE 3LH3A 1T4UH 2VGCC 2STAE 2G52A 4Y76A 4CHAC 5CMXH 2H2ZA 3TGKE 4INLA 1QJ1B 2OCVB 2GV7A 2FLRH 2FI5E 2CJIA 1V2OT 1YPEH 2XCFA 1GJ7B 1SB1H 1PQAA 3U1IB 4GUXA 5DP7A 1DLEA 1GG6B 2OLGA 3E16B 1V3XA 3GISB 3MNBA 4ZMAH 4TYDA 4MNVA 5IYTA 3ELAH 2R0KA 3M3VA 5E2PA 1Z8GA 2WUCA 2PTCE 4ZHAA 4HI3A 3ZYEA 5C5NA 1UCYK 4AZ2B 5EPNA 2A4GA 1BBRK 1QB9A 3GCOA 3ZZ4A 5L2ZH 2GCTB 4IN2A 2VH0A 9LPRA 1AZ8A 1C2EA 1DM4B 2W5EA 1AUTC 5EW2H 3UPEA 3MI4A 1BA8B 3AW1A 3SU1A 3URDA 1P2QA 4ZKOU 4RSPA 4I32A 3DUXH 3MO3A 4BTTB 2VB0A 2QC2A 1OWDA 4UEHH 1VJAU 1E35B 4ZAEA 2PR3A 1CHGA 2OC0A 1FAXA 5AF9H 1P0SH 1MAXA 1B7XB 1GJAB 2R3UA 2ZCKP 1G30B 2FO9A 3TJUA 1K21H 4X1SU 5EPYA 1TBZH 1HAYB 2H9TH 1ANCA 2BYAX 1T8NA 2YNAA 4DJZB 2HWLB 3Q3KA 3MTYA 1GG6C 1W8BH 2R0LA 1CU1A 2TGTA 2J92A 3BTQE 3IITA 2FS9A 1BTWA 1TRMA 1V2PT 4UONA 1FZZA 1RGQA 4NGAH 1IQIA 2FOEA 1F7ZA 2AMPA 1Z7KA 3PWCA 1WAYB 1ZOMA 2W7UA 2DE8A 1C5YB 1XXFA 3RXMA 1Z6JH 1MTUA 1FXYA 3GDUA 2QGRA 4MPWA 4WF8A 1LHGH 1ELCA 2FXRA 2GTBA 2ZIQH 4A92A 4DGJA 1NPMA 1L4DA 2TPIZ 4XSKU 1MBMA 4WJG2 4UE7H 4FU8A 3LIWA 4FUCA 1O2KA 5C5OA 1QBOA 5A2MH 4X8UH 3P92A 1NZQH 4FUIA 5A0AE 1V2NT 3SUFA 2Q6DA 2UWLA 1EB2A 4AX9H 1MU8B 2PWXA 4BTUB 1MH0A 1QBNA 1QCPA 2ZFPH 1GBTA 3RXGA 5SGAE 2PW8H 1NFUA 2BD4A 1F0SA 2XYAA 4JMYA 3DA9B 4D9RA 1SGCA 1FQ3A 3O8BA 3BSQA 3STIA 1O3CA 1RTKA 5DGJA 2SGPE 1O31A 2CGAA 3KL6A 3GY3A 2SGEE 6GCHG 1PPFE 2D2DA 5LPRA 2ODQA 4Y8XA 1XKBC 4ABDA 2V3OH 1BTUA 3GICB 3A84A 1ESBA 2BDCA 1A5IA 2FIRH 1H9HE 5CHAB 4Q7ZA 1HRTH 1AKSB 1O2LA 4FUHA 4GVUA 4HFPB 1AKSA 4YM9A 1EUFA 5A0BA 1H1BA 4CH8B 1JMOH 4X8SH 4AG1A 3VB3A 1SR5C 3S9CA 4GCHF 2F9UA 1CHOF 3MO6A 1F0UA 3TJVA 1N6YA 3C27B 4ISLA 4E06H 3MMGA 1DUEA 1MQ6A 1Y5UT 4O97A 1A0LA 2AFQB 1ID5H 3SHCH 5GIBA 1ARCA 2FYRA 2EA3A 3M61U 1ZZZA 2IN2A 3R3GB 3UTUH 1SSXA 3MU1A 2FI3E 5FBEA 1AWHB 1EJMA 2C8YB 3FANA 3NKKA 4Y71A 1U6QA 3BEIB 1PJPA 4OGXA 3PLBA 1O3LA 3SU2A 2ZDNA 2Z9LA 1J15A 1G3BA 1YPMH 2O8TA 4J2YB 3SJKA 1TMUH 3SV7A 3ATIA 3BTHE 2FTLE 1FY8E 3HKJB 1P2NA 3FZDA 1RIWC 3LONA 1QQUA 1DX5M 1BTPA 1CA0B 1WBGB 1NY22 1HJ9A 3T5FH 1CBWB 5L6NH 2VIQA 3RC5A 1O37A 1S0QA 1ZTKA 1OP2A 2FX6A 1O3PB 3SNDA 1P3EA 1C9TA 1EAWA 1LVMA 3OX7U