2HNTC

Crystallographic structure of human gamma-thrombin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAMMA-THROMBIN
publication title Crystallographic structure of human gamma-thrombin.
pubmed rcsb
source organism Homo sapiens
molecule tags Serine protease
total genus 5
structure length 67
sequence length 67
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hntC00
3MU4A 2STAE 1VZQH 1SLUB 4JMYA 1GI2A 1P04A 3FP8E 1HXFH 1K22H 1BHXF 4KTCA 2RDLA 1BOQA 1SGCA 5ETXA 3NWUA 1P9UA 4X2WA 3D23A 2CMYA 3ZZDA 1O5BB 2KAIA 1KXEA 1A3BH 3I78A 4A1VA 1L1JA 2TGAA 3A7VA 1BMNH 4BAMB 1GJCB 3RUOA 1PQ8A 2ZA5A 1GI3A 1GJAB 1Z6EA 4DIIH 1GJBB 2AERH 1CA0B 1V2PT 1TGSZ 2QY0B 1AD8H 1C5VA 1SBWA 1OOKB 1UCYK 3FZZA 1DPOA 1W0ZU 3CS7A 3KNXA 1PPCE 2UUFB 4B75A 2R0KA 2G5VA 2ZDAH 3LPRA 5DO4H 3MMGA 1BHXB 3M5MA 3GDVA 4FU9A 2V3OH 1FAXA 3SJ9A 3FZDA 5I46H 1F5RA 1HJ9A 1AE8H 3TH2H 5DP7A 1ANEA 2QF3A 1BQYA 1BMAA 4NZQA 1OWKA 2FWWA 3K9XB 1NU9A 2PWXA 1P09A 4R0IA 1NRRH 3RXOA 1SGDE 2RG3A 5HM2A 1H1BA 1W0YH 5F6MA 4CRAA 1N6XA 1INCA 1F5LA 2PHBA 1ZTKA 1D3PB 1GVKB 1N8OB 3GY8A 1BUIA 4UE7H 1TNLA 2EEKA 4R8TB 3RMOH 3SV7A 1B7XB 2NWNA 1EX3A 3LGVA 2XCNA 2C8XB 2C90B 2P94A 1BJVA 3ODDA 3UOPA 3SV6A 1C2FA 3LIWA 3L6PA 1LVOA 1MH0A 1KXDA 1Z8IB 3RLYH 4OGYA 3Q76A 1GHVH 1WAYB 2Y6TA 4FUCA 2ZGBH 5EPNA 3ZZCA 5L2ZH 1DXWA 3VXEH 1KLJH 2H9TH 4WXVA 3I77A 1O3FA 1TLDA 4O97A 2HPQH 3LGIA 2J92A 1XUGA 1P2NA 3MWIU 1GBTA 1C5WB 1GJ9B 1OP2A 2A31A 2ESTE 2O8UA 2P3FH 2ANMH 3ZV9A 4B76A 3BIVH 2W3KA 3ESTA 1BTXA 1GBFA 1A5GH 1OXGA 1J9CH 1SHHB 2V35A 4MNVA 1CGHA 9LPRA 2VGCC 6CHAB 2AIQA 4GHTA 1LMWB 2P16A 1SOZA 1C5OH 1OWHA 4DW2U 2ZO3H 1IQFA 2G81E 4CRBA 5FCKA 3L3TA 1SFIA 8GCHG 1EUFA 1CT2E 1S0QA 1RTFB 4TWWA 1BJUA 4Z0KA 1QCPA 3HKIB 1WQVH 2JETC 4AYVB 5HMAA 1EB1H 1YLCA 1CSOE 1TNIA 4AGKA 1AIXH 3FP7E 1BIOA 3GOVB 1FPCH 3T25A 1TABE 1GI0A 3SNBA 4XDEA 2AGIX 2GVFA 1SPJA 1YP9A 5G4BA 3URDA 3RXEA 4I31A 4BAQB 5JBTA 2OTVA 3WY8A 1RIWC 1MCVA 3BN9A 3C1KA 1C1VH 3SU5A 2PKAA 4Y0YE 1Z8JB 4ABIA 1QNJA 2BXUH 2D26C 4IS5A 2R3YA 3F1SB 3SV9A 1GBEA 3RXPA 2J4IA 2PTNA 4ABGA 3SN8A 2HOBA 1DUEA 4Q7YA 1T7CA 1W2KH 2DUCA 5FX6A 1QJ6B 5F8ZA 5A2MH 1HAHH 3M3TA 4Q80A 1YPHE 1O3CA 3QUMP 1C2KA 3OTJE 3HPTB 1CA8B 4OS5A 2F9PA 5J4SA 2ALVA 4IC5A 3LC3A 5EGMA 4D9QA 1O2OA 1RIWB 2ZU1A 1NM6A 1RGQA 2VIPA 3ELAH 2FS9A 4WF8A 5L30H 1IQJA 1UVPA 2Y7ZA 3UWJH 3K2UA 1C2JA 1ZPZA 1HXEH 1BBRK 1HIAA 2WPLS 4K69A 3S9CA 1T4UH 3E91A 1O2KA 2G4TA 2BD9A 2C93B 2DE8A 1LHCH 1KYNA 4FUFA 1SI5H 1ABIH 2A1DB 4I33A 1C4Y2 4JZDH 3BTDE 1MUEB 4YTAA 2FOCA 1G3BA 1OYTH 3FFGA 3SU4A 1THPB 5JPMH 3MO3A 1C2MA 4MNYA 4INLA 1OSSA 3SUGA 2SGDE 3HGNA 3P95A 2VVVA 1XUJA 2BLWA 4Q7ZA 1MTUA 1C1OA 4HI3A 4NIVA 2XBYA 3CP7A 1GPZA 1YGCH 4ABFA 2ZDNA 5AHGH 1A46H 1UTNA 2VH0A 1UTLM 3SW2B 3A80A 2BLVA 2ZHWH 1Z8RA 1EOLA 2ZU2A 1P03A 1GWAA 3M3VA 2V3HH 2CF9H 1TMUH 2ZDLA 1IOEA 1TQ7B 2OP9A 1LVBA 1ZRKA 2XC5A 1DY8A 3TU7H 3PTBA 1DS2E 4A5TS 5SGAE 4GVUA 2Y5HA 1FY8E 3QDZB 1Y3UA 2WPHS 1IHTH 1CU1A 4BTUB 1GBBA 2JH6D 1BZXE 3LGTA 2VB0A 2GD4B 2ZFRH 4WMFA 1MCTA 2GTBA 1SGEE 1AY6H 2A2QH 1O2NA 4THNH 1D9IA 2ZC9H 1EP6A 3TJNA 4KELA 4Z6AH 1AFQC 1GJ8B 3RMNH 3LGUA 1GI8B 5K7RA 1EATA 1DT2A 1PPZA 4CRGA 3GY4A 4BTIB 2FX6A 1C1PA 5ESBA 1DSUA 2XC0A 3BTQE 3E1XB 1CHOG 3QX5H 2O8WA 2UUKB 4D9RA 5DP4A 2SGEE 1P10A 2PR3A 1O3DA 1EZUC 3SUEA 1ANBA 3Q3XA 1CGJE 4DY7B 2IPHA 2EI6A 2Z3DA 2BX4A 2FXRA 3GY6A 2VVCA 1AFQB 2QC2A 1UJ1A 3AAVA 1YF4A 1HLTH 3BEIB 6GCHF 2WYJA 1QIXB 2PV9B 1O39A 1L4ZA 3LONA 3AW1A 1QL7A 5F8TA 1TONA 5EQSA 1P2KA 2Z9LA 4TY7A 3TK6A 3VXFH 4GSOA 3GDUA 1EAUA 1F0SA 5LH8A 4UD9H 2OC0A 1NESE 3RC6A 3ITIA 3A82A 5T6GA 1BRBE 1UCYH 1MTNC 3BTEE 5JBBS 3UREA 2A4QA 4MG3A 3RXAA 3TGJE 1C2HA 4TPYA 4CBOA 1TBRH 1L2EA 3K6YA 1DWDH 1ELFA 3GYLB 4F4OC 4D76A 3T5FH 4GCHG 1UK2A 1Z6JH 1IQEA 1HPGA 1Y59T 2B0FA 1B0FA 4YLQH 1HAPH 2B9LA 1DWBH 1JIRA 1PYTD 1ANDA 1QL8A 3E16B 4UDWH 5JDUB 4ISLA 3A85A 4I8LA 1DITH 3TJVA 1AO5A 3RXFA 1EXFA 1RJXB 1IQMA 1P2QA 2FOBA 3M7QA 1WSSH 2HNTF 1EAWA 1TBQH 1BTHH 2GT8A 1A1RA 1ZSKA 4ABJA 2Z9KA 1PYTC 1BDAA 3VB4A 3ZVFA 1C5PA 3QO6A 3ZVAA 1TPOA 2W7SA 3ZZ7A 1WUNH 3PYHA 1ETSH 3ZZ8A 2WPIS 1ORFA 4CRFA 3LH1A 5F8XA 3KIDU 5L2YH 3DFLA 3F6UH 1T8LA 2BD7A 3LJOA 3PLBA 1GBHA 2BY8X 1O2MA 2FODA 4JZ1A 3SO3A 1GHBG 3ZVGA 4CHAB 2GZ9A 5FBIA 1W11U 4CRCA 3E6PH 1GHAG 2PUQH 3IG6B 1AKSA 4X6OA 4Y76A 4ZKSU 3D62A 1AQ7A 2P3TB 1Z8GA 4A1XA 1BTYA 1TOMH 2ANKH 4X1QU 3ZVEA 2OD3B 1T8NA 2EI8A 3A83A 2SNVA 4X6NA 4FU8A 2QYIA 3UR9A 3T62A 4KGAA 1G30B 3F9HA 3MH5A 1F0TA 3PV4A 2G55A 3BV9B 2F3CE 1W13U 1J15A 2H9EH 5E0GA 2A7JA 3MYWA 3KQDA 4Q7XA 1SGFA 5A8YA 3SV8A 4A6LA 1FAKH 1QR3E 4Y79A 1TMTH 2ODQA 2BY7X 4NG9H 1A0HB 1SGFG 4ABDA 1V2MT 1TNHA 2Q1JA 2ZFQH 1DVAH 1KXBA 1KLTA 5AFYH 1MZAA 2RCEA 8GCHF 1BT7A 1XKAC 1GI4A 1S6HA 3RDZA 3A8AA 2OCVB 4OS2A 4ZMAH 1YPLH 1NT1A 3GICB 3FANA 3RXGA 1EPTC 2QXJA 5E0HA 2FPZA 2AYWA 3E3TA 1C2DA 1QQUA 1RD3B 2UWLA 1O3HA 2CHAC 3MH7A 2A32A 1GMCG 2NU0E 3MNSA 3KCGH 2Q6FA 3M61U 1YKTA 1O2WA 2BTCE 2WINI 3S7HB 1V2TT 3ZZBA 5J4QA 1JBUH 1EJNA 3A84A 1OPHB 1UMAH 2G00A 3M35A 3CENA 1L0ZA 1LDTT 3MNCA 5HXFA 3LGYA 1F92A 2VVUA 3ZZ9A 1SLWB 1EJMA 4X6MA 1HAOH 1GL0E 5LPRA 2QA9E 1LTOA 5HM9A 1O3PB 2PSXA 4O03A 1V6DA 4FUIA 1BBRH 1XUHA 2CHAB 1NS3A 1VGCC 1TB6H 4BXWA 1YPEH 1EZSC 1QURH 1V2RT 3QTVH 4B2AA 1O35A 4WH8A 3NUMA 3I29A 3FAOA 1CVWH 1ELDE 4CR5A 3VB3A 1LVMA 1SGYE 2BY9X 1MQ5A 4KTUA 3VFEA 1TA6A 4BAKB 2BXTH 1RFNA 3MU5A 1NN6A 2ULLA 1VITH 2VNTA 3UQOA 1C1SA 1GBAA 5E2OA 3PMBB 1VGCB 1ELAA 4X8TH 2G52A 4X2VA 3KQCA 1QB6A 4AFSA 1MU8B 1FMGA 4IGDA 4ZHMU 3RXQA 4NWLA 3R0FA 4YLUA 1O38A 4BANB 5IDKA 1ETTH 4DG4A 1RRKA 2H9HA 1Y3YA 4K2YA 3AW0A 1SFQB 1NFUA 1O2ZA 1EASA 3PLKA 2F9NA 1KDQA 1U6QA 3RXBA 3LU9B 5EPYA 5CHAC 1ZPBA 1AUTC 3TITA 1O3OA 1A0JA 3BIUH 1Q31A 2J34A 5DP6A 1Y3WA 2BQWB 2VIQA 1DXPA 3HKJB 3UY9A 1ZPCA 2GKVE 5PTPA 2BB4A 3A7YA 1BRUP 1DSTA 1H8IH 1P2MA 1V2ST 2JH0D 1HAZB 1PQAA 1HV7A 4ISNA 1GHWH 4K60A 2XWBI 2PW8H 1B0EA 2HVXA 2J38A 1XUIA 4NA7A 5DJ7A 5FBEA 3KL6A 4ZXYH 4Q2KA 3QZQA 5CHAB 1D6RA 4JZIA 1DFPA 1O2IA 1ELEE 1P2JA 2XXLA 4K1SA 5GCHG 1CHOF 2ZFFH 1J17T 1UVSH 1O3MA 2BOKA 2W5EA 4I7YH 1GL1A 2FTMA 2TGDA 3M7TA 3S0NA 3O8CA 3GCOA 1QY6A 4OS1A 1GI6A 1N8OC 1DX5M 4AGJA 3A8DA 2BX3A 3KQBA 2THFB 1WBGB 1E35B 1SSXA 1PFXC 2ZZUH 4X1PU 3T26A 2HPPH 3A7WA 5EODA 3BTHE 1MKXH 3GY3A 3LOXA 1XMNB 2VWNA 1QJ7B 2H5DA 4DT7B 3A88A 2A5KA 2PTCE 1V2JT 3SU3A 1QRWA 1WYKA 5FAHA 2BY6X 4CR9A 5DGJA 1LPGB 3PMAB 5A09A 1SL3A 3RM2H 3IITA 3F9FA 3K6ZA 3VB6A 4AFQA 4DGJA 3PO1C 4AB9A 3UFAA 4AB8A 2YOLA 2Z7FE 1GGDB 4U30A 1ARCA 4E05H 3RU4T 5EU8A 2SGFE 1UK4A 3ZZ3A 1ZMLA 1A5HA 3Q00A 1K1PA 2ALPA 4GCHF 2HLCA 1QFKH 3BG8A 3T29A 4FUGA 1QBNA 6CHAC 1H8DH 2OINA 4OS4A 4FUJA 4B1TA 2AMPA 2CV3A 1O5GH 3EGKH 1OYQA 1GJ4H 1V2LT 2Z3EA 3PO1B 1DE7H 5GXPA 1O2JA 3RXSA 4MVNA 1P02A 4I8GA 2XC4A 2VWOA 1XUFA 1GJ6A 3VGCC 2BDIA 1MTSA 2J2UA 1T32A 1UHBB 2ASUB 3FVFB 4DURA 4AFZA 1FY4A 3S69A 1RXPA 3GYMA 4MLFB 2WPKS 1ID5H 1PQ5A 2ZQ2A 3NCLA 1VCWA 2GMTB 1TGCA 2BDGA 4BXSA 2C8WB 1Z7KA 1TAWA 4UONA 2JH5D 2FS8A 1GHBF 4FVBA 4AZ2B 3VGCB 4ESTE 1VJAU 2F9VA 7LPRA 1GHAF 1AVGH 1AFEH 1O2YA 2Q6GA 1EPTA 3F9GA 4NA8A 4X2YA 3SZNA 1CHGA 2A4GA 1HFDA 3LJJA 1GBMA 1OWJA 1YPGH 4B74A 1C5NH 1WTHD 2GDDA 1TALA 1C4U2 1C5QA 4WMEA 4MPVA 1QBOA 3B8JA 3H7OA 3S9AA 2FLRH 1HYLA 2A5IA 3PWBA 5DPAA 1CBWC 4DJZB 2ZECA 1NY22 3KGPA 3N7OA 4AOQA 8KME2 3SHAH 2AH4X 1GBKA 3VEQB 3RXKA 1DDJA 1UTKA 1A4WH 3TNSA 2BDBA 2ZU4A 1GMHG 2SGAA 3DFJA 4MNWA 1SGPE 2R2WU 1HAVB 2ZG0H 3PM3A 1V2UT 2GCHG 3A8CA 3DHKH 3NK8A 4KTSA 4DVAU 1O5CB 3M5NA 2F9UA 3BTWE 1AU8A 1EB2A 1CBWB 1QRZA 2HNTE 1ZOMA 1O3LA 3TH4H 1H9IE 1T8MA 3BEFB 2BZ6H 3BTTE 4U01A 2BD8A 3E0NB 3RU4E 1C5RA 1G3CA 1C1UH 2FOGA 4NSYA 5FCRA 1GDNA 3A89A 1C5MD 4HTCH 1LO6A 1ZJDA 1GMCF 2ZF0H 1IAUA 4IMZA 3SJIA 4BNRA 5FPSA 4ABAA 2A7CA 3M5LA 1ETRH 1C1QA 1TFXA 2BD2A 4MPUA 5EQRA 1QA0A 1GHZA 2Z94A 3BG4B 2G5NA 2QXHA 5T6DA 1OP0A 1BTZA 4IBLH 4Y0ZE 1Y3VA 4PROA 1UTJA 5A0CA 4A1TA 1C5XB 1ACBE 1EZXC 2ZGXH 3TJOA 3UTUH 1NFXA 2UWPA 3HK3B 1Y3XA 5H4IB 2YNBA 2BD5A 4X1SU 1LQDB 3U98H 2UUYA 1KY9A 2OXSA 4X8UH 5BPEA 1VJ9U 1GHXH 1FIWA 2DE9A 1SB1H 3TGKE 1ELGA 1TPAE 2ZCHP 3S9BA 1GBLA 1F2SE 4AG1A 3SV2H 3OU0A 4BTTB 1OKXA 1NO9H 1TA2A 1GDQA 2BQ7B 1WCZA 3PWCA 4ABHA 3KHVA 1FXYA 1DUAA 1FY5A 1P11E 5AVDA 2Z3CA 1HRTH 3DD2H 3ZVCA 3RC5A 1MBQA 2AMQA 1AHTH 1GJDB 3URCA 3UPEA 1J8AA 1F5KU 3P70B 2AGEX 2C8YB 1L1NA 1K9OE 3SU0A 2G51A 1LQEA 1FQ3A 2TPIZ 5FXLA 3H5CB 4MDSA 2GCTC 3TH3H 1ZGIA 4TPIZ 1D3QB 2BLOA 3E8LA 1AVXA 4CRDA 1WTGH 5JB8S 4X6PA 1KTTB 2QIQA 4RSPA 4BAHB 1WQSA 2F9OA 1IQLA 5A0AE 1MAXA 1DANH 3MNXA 3P8NA 1GI5A 5TJXA 3TK5A 1PPGE 4IMQA 1A61H 2F9BH 1S82A 3ZZ6A 1K1NA 1XVMA 4XBCA 2ZIQH 4IN1A 1MKXK 1TWXB 1C9PA 4E7RG 1HAIH 1EAIA 2GCTB 3KN2A 3SU6A 1BITA 1BRAA 4I8KA 4X8VH 1OWEA 1S84A 2OQ5A 1G2LA 1D3DB 2BHGA 3F68H 4A7IB 1ARBA 2BDAA 3GCHC 5GCHF 3VPKA 1ZTJA 5EOKA 1HNEE 1C5LH 1ELBA 4J2YB 3DT0H 1Z1JA 5A8ZA 5K0HA 1YCPM 1O2LA 2BYAX 5DP9A 1TGBA 1ZR0A 1LKAA 3QN7A 2C3SA 1K21H 4CHAC 4MTBA 4O9VA 2XBVA 1XM1A 2Q6DA 1TX6A 2TBSA 7KMEH 1F0UA 1YPHC 2I6SA 1O2RA 2TGPZ 3GCHB 3MTYA 1LKBA 3P8FA 3RXHA 1O5DH 1O5AB 2BY5X 2QAAA 1IQHA 2HNTC 2FMJA 3MH6A 1CO7E 4LXBH 4ABBA 3TJUA 3UWIA 1NC6A 2R3UA 1SVPA 3QTOH 5C1YA 4AX9H 1IQNA 1DM4B 3S7KB 1D4PB 4X1NU 1AE5A 2FOEA 4O3TA 1PPBH 5FHTA 4B2CA 1QGFA 1X7AC 2ZFSA 1O3GA 5GPIB 1GBJA 4GPGA 1P2IA 2QV1A 3O8RA 5DP5A 3A7TA 1V3XA 2Z6BD 4SGAE 1GBIA 1BCUH 1KIGH 4J1YA 2FM2A 1FY1A 3U1IB 1MMJN 2BM2A 2VIDA 2GP9B 3BSQA 2WV5A 1MTVA 3GCNA 1ZHMA 2ANWA 1FZZA 1E34B 1O36A 3TPIZ 1HAVA 1NFYA 1C5UA 2W26A 3W94A 2TGTA 3QGNB 2ZHQH 4K8BA 3RP2A 1ZMNA 3RMLH 3Q3YA 5DG6A 4GUXA 4X8SH 4ISHH 1BMLA 1C1NA 3EA9A 4JYUH 1TQ0B 3OYPA 2OC1A 3Q3KA 2ZHFH 5JBCS 3STJA 2GDEH 3SUFA 1ZGVA 1YPMH 2ODYB 1IQKA 1D6WA 1ZHRA 4H4FA 3MO9A 1KLIH 4Y8YA 2QXGA 1NRSH 3MOCA 1C1MA 2FDAA 3OY6U 4TWYA 2FP7B 3A7XA 4XBDA 5C1XA 4K5ZA 3PMHB 1HUTH 1K1LA 4K3JA 2O9QA 1WV7H 1K1JA 4GLYA 3LDXH 4FUHA 1AI8H 1QJ1B 1QA7A 2XTTB 1ESBA 4H6TA 1LVYA 3PTNA 1K28D 1NTPA 1XKBC 3EQ0H 4SGBE 3RXIA 3TNTA 1W8BH 1Z71A 1MTWA 3U69H 1W12U 1O2QA 2ZEBA 3A7ZA 3UIRA 1IQIA 2BD4A 1O2GH 3KEEA 2Z9GA 1YPKH 3OX7U 4NWKA 2AEIH 2UUJB 3BF6H 5JYIA 1JXPA 1O2XA 4D7GA 4TYDA 2BDCA 1SMFE 1XXDA 4FXGH 2P8OC 5T6FA 1LCYA 4BAOB 5E2PA 4Y8XA 3DUXH 1XVOA 2QF0A 1GI1A 1GMHF 1E36B 2ZQ1A 1S6FA 4Y11E 3BEUA 1O3IA 2GCHF 3NZIA 4ZAEA 1NROH 3BTFE 4MPWA 1NRNH 1ELTA 1UVUH 1EJAA 1TPPA 1LPKB 1ZRBA 3O8DA 1Q3XA 2FZZA 2V6NA 4B71A 1EQ9A 1GBCA 2P8OB 4NIWA 1BRCE 2PGQB 1TX8A 2UWOA 4I32A 5C5OA 3PMJA 1K2I1 2PKAB 5DP8A 3HGPA 4DIHH 2HWLB 1DOJA 5GJ4B 4ZHAA 2OBQA 5CE1A 1ZYOA 3SNDA 5C2ZA 3JZ2B 1Y5UT 1L1GA 2BZAA 1AB9C 1J16A 3EA8A 2FIRH 4Y6DA 2ZWLH 1TE0A 1F0RA 1ZHPA 1CGIE 2H6MA 2Y5FA 1UCYE 1QL9A 3LC5A 4BOHA 2XNIA 2WUCA 2JKHA 1UTOA 1UVOA 4YO9A 2M5TA 4GAWA 1B5GH 4UFGH 1GVZA 1O3EA 4Y71A 1AMHA 5EXMA 5EXLA 3SNAA 1HIAB 1ZJKA 3UR6A 3TGIE 1H9HE 4MNXA 3GCTG 2QCYA 1AB9B 4XE4A 5ESTE 1TRNA 5GIBA 2G8TA 7GCHG 2R2MB 5TCAA 1ABJH 1THRH 4YOIA 1O3NA 2VIVA 1EP5A 1AGJA 5CMXH 5F03A 4LZ1H 2OLGA 1CE5A 3T27A 4QT8C 1TRMA 5A8XA 1P12E 1AN1E 3EA7A 4ISOA 3ATMA 3SI3H 3RXLA 2BDYA 2NU2E 3EE0B 3A8BA 1G32B 4HGCA 4GHQA 2BDHA 1KXCA 5EW2H 1K1MA 4JZFH 3P6ZB 3VB7A 3C27B 1VCPA 4NGAH 3RXRA 1C1WH 2A45B 2XCFA 1FN6A 1VITG 2XRCA 4LK4A 3V12A 3OY5U 4NIXA 4INHA 1O2TA 4XOJA 3P17H 1GGDC 2VJ1A 2EI7A 2SNWA 3T28A 1C5ZB 1G3DA 3JZ1B 4ZHLU 2FOMB 1K1OA 1UK3A 1O5FH 1FUJA 1P8VC 2IN2A 1C5SA 3CS0A 2ZP0H 2GX4A 1FDPA 4CH8B 4NFFA 1MU6B 1OWDA 4ABEA 3M36A 1V2NT 3NPSA 2TRMA 1OWIA 3ATWA 4JYTA 2NU4E 3D49H 3QZRA 3U1JB 4AYYB 4IW4E 4WJG2 1GVLA 1C2IA 1ELCA 2FX4A 1EAXA 5EW1H 3RMMH 2FYQA 2AMDA 3A86A 4DCDA 1W10U 1L4DA 4OGXA 1EOJA 5EG4A 3MU1A 3RXVA 1A5IA 1E38B 5JB9S 1D3TB 1QTFA 4B73A 1WU1A 4XBBA 1KSNA 4OS6A 1SG8B 3UUZA 2TIOA 3ATKA 3EDXB 1DLEA 1PQ7A 2GMTC 1JWTA 1BB0B 1WOFA 4RKJB 2OC8A 1NRPH 1QRXA 1SQAA 5C3NA 3RXMA 1IQGA 1SQTA 1Z1IA 1Y5BT 4ASHA 6ESTA 2A4OA 2CJIA 4JYVH 5DKMA 1M9UA 2ILNA 3M37A 2Z9JA 4Y8ZA 4YT7H 1C2GA 1PPFE 1Y8TA 3MI4A 1YBWA 2J94A 1O31A 1C2EA 1O3AA 1S5SA 2OUAA 1QHRB 4AORA 4ZUHA 2GV7A 2IOTA 3AVZA 2CXVA 1MZDA 4F49A 2RA3A 3T2NA 4YT6H 4WY3A 1ANCA 1RTLA 1THSH 1AWFH 1LPZB 1FJSA 2SGPE 4JK6A 2VH6A 2F91A 4YESB 1O0DH 3B23B 1O2HA 3Q77A 1G2MA 3LGWA 1GHYH 1C2LA 1BTPA 1YYY1 1P01A 2GGVB 2R9PA 3BTGE 1YCPH 4CREA 3SBKA 3GY2A 1SGNE 2PLXA 1V2VT 1BBRE 1SR5C 2ODPA 3NXPA 1NFWA 1TOCB 2Y5GA 2BD3A 2R0LA 1IHSH 1HAGE 1Q2WA 3RXJA 1W7XH 1AWHB 1O2UA 3E0PB 1V2QT 2VWMA 2ZKSA 1EKBB 2PUXB 5HYOA 2VGCB 1P3CA 1AVWA 1GG6C 2WV4A 1W3CA 5LPEA 1MKWK 1P05A 2YNAA 5ABWA 1DICA 5DK1A 2ZPRA 1O5EH 4OS7A 5E8EH 1V2KT 1N1LA 3MU0A 3SNCA 1SC8U 1O3JA 2GT7A 2A0QB 1GMDG 1HB0B 3UNSA 1O30A 1HCGA 2VWLA 3BTME 1JIMA 4K1TA 1AKSB 2JETB 2O8LA 4JCNA 3BG4C 2HRVA 1C5YB 4JK5A 1QB9A 3ENSB 2XBXA 5C1UA 1FV9A 1PJPA 1GG6B 4XFQA 2OC7A 1F7ZA 5HGGA 1EZQA 3KF2A 1A3EH 4UFDH 3D65E 2BVRH 2VIOA 3RM0H 3M3SA 1H4WA 1N6YA 2NU1E 1T31A 3TVJB 1O2SA 1ZSLA 4ZH8A 1TRYA 1C1RA 1GCTC 2F83A 3HATH 1TYNA 2SGQE 3E90B 2ZPQA 4JZEH 1TGTA 1ELVA 3KQEA 5FPTA 2RA0A 1T8OA 1YC0A 2G4UA 4HZHA 1JRSA 4MQAA 1O2VA 1A2CH 1MD8A 1VR1H 4KKDA 3U8RH 4MPXA 2FLBH 4E7NA 5LGOA 2B8OH 4VGCC 1G3EA 3U8TH 1FN8A 4YZUA 1RS0A 4ZKOU 2ZFTA 1LHDH 1KTSB 5T3HA 5TCCA 1QBVH 1W14U 3QGJA 1CT4E 1GCTB 1GI9B 5I25A 2J9NA 1O32A 3FP6E 3RXDA 1G36A 3SU1A 2WYGA 2XW9A 5FX5A 1GBDA 1O3BA 1DWCH 2WUBA 1HAYB 1ZMJA 1QQ4A 2FTLE 3GY7A 1C9TA 1SGRE 1SLXB 1UVTH 2W7UA 4VGCB 4RKOB 2FEQH 2C8ZB 4UFEH 1C4V2 3ZYEA 1TIOA 1HGTH 1YLDA 5IYTA 3SU2A 2ZHEH 2P3UB 1E0FD 4WH6A 3ZVBA 1DY9A 1RTKA 3IWMA 4YOJA 1XXFA 1FY3A 1GI7B 4M7GA 4UEHH 3SGBE 2P93A 3M7UA 4CH2B 1P0SH 3ZVDA 2GZ8A 2I6QA 2SFAA 5C5NA 2V0BA 3SUDA 4FU7A 1HJAC 3PB1E 2OQUA 3OSYA 1GCDA 2ZCLP 3GISB 1OS8A 1ESTA 1KXAA 3TLOA 2QGRA 4H6SB 1P9SA 3GCTF 3PROA 4NCYA 3EYDA 1UTQA 8ESTE 1SLVB 1OP8A 7GCHF 2XWAA 1AZ8A 2ZDKA 1DLKB 2FI5E 1HBTH 1J14A 1O33A 1S81A 3LH3A 1O37A 1E37B 1CT0E 3SI4H 5AFZH 1PPEE 1BA8B 1AZZA 3L33A 2AS9A 9ESTA 2GV6A 1P3EA 3P8GA 2ZDMA 1HJAB 2EC9H 3MNBA 1FPHH 1LHEH 1UHBA 2O8TA 2ZI2H 1SOTA 1G37A 1YPJH 3GDSA 4K1EA 3SQEE 4WMDA 4IC6A 2HGTH 1KDQB 3GY5A 1VITF 4I8HA 3UNRA 1TX7A 5GDSH 4NIYA 3UNQA 2Y7XA 2ZCKP 1AUJA 4U32A 2VIWA 4FUEA 1ZTLA 1XX9A 2ANYA 2H5CA 1GDUA 2FI4E 2A4RA 1V2WT 4O3UA 2P95A 2KAIB 2W3IA 2CGAA 3M5OA 4D8NA 2PGBB 2VINA 4RN6A 1ZLRA 3RU4D 1FIZA 1MTNB 1ESAA 4ZKRU 1MQ6A 1TGNA 4AG2A 3G01A 1SGTA 4E06H 1LHFH 3QWCH 4INKA 3NKKA 3UQVA 3ATLA 2XBWA 3HK6B 3BTKE 2BVSH 3MFJA 1SGQE 3QLPH 2Y81A 1P57B 4WVPE 4KP0A 2BMGB 4A92A 2ZPSA 4ZKNU 1JRTA 1P2OA 2AIPA 2FOFA 2H2ZA 3SORA 3R3GB 3SJ8A 1FI8A 2NU3E 4LZ4B 3MO6A 1Y5AT 1JOUB 4XSKU 1GJ5H 2OBOA 2D2DA 2ZTYA 3P92A 3V13A 3A87A 1TNGA 2CF8H 2PFEA 3U9AH 1YCPK 1H9LB 4NFEA 4UFFH 3VB5A 1S83A 1FNIA 3H7TA 3MHWU 4Y7BA 2CN0H 2ZTZA 4ZROA 3LT3A 7ESTE 1S0RA 1ZSJA 2BQ6B 4Y7AA 5A0BA 1SQOA 3SGQE 3PLPA 4WWYA 1JMOH 2AGGX 3K65B 1NRQH 1BTWA 2ZGHA 1FONA 2FO9A 1GJ7B 2FESH 4CBNA 1YM0A 1MD7A 3SJKA 3ZZ4A 1TMBH 2EA3A 3W95A 2ZGJA 1W7GH 1C1TA 3A81A 1UTMA 1KXFA 4FUBA 1PPHE 2Y80A 1A0LA 5B6OA 3V7TA 2BLQA 5C20A 1T4VH 1DWEH 2ZU3A 2O8MA 4FVDA 3F9EA 1C5TA 4U2WA 3DA9B 3QK1A 1OX1A 1TNJA 1A7SA 3SNEA 1MAYA 2ZNKH 4AN7A 2P59A 4NZLA 3ZYDA 8LPRA 5BRRE 5FPYA 3MH4A 2BOHB 1HJ8A 2PSYA 1CQQA 3O8BA 4K8YA 1MKWH 2H1UA 2LPRA 3MU8A 3STIA 1K1IA 2ZHDA 6LPRA 5JBAS 4NSVA 3ZV8A 2GZ7A 3TK9A 5GWZA 3ZZAA 2HALA 2Z9IA 5C67A 5EXNA 2FOAA 4WXIA 3RXTA 2PKSC 5LPFA 1TPSA 3RXUA 3RC4A 1SHYA 2FYRA 4HFPB 4B2BA 2FI3E 4AFUA 1GMDF 1ZZZA 3SQHE 2B7DH 2AFQB 2ZDVH 3TIUA 2WPMS 4D7FA 4X2XA 1BTUA 1EPTB 2ZU5A 3B9FH 3LKWA 2VU8E 3RLWH 2J95A 2ZFPH 1NPMA 3ZZ5A 4IN2A 2WPJS 5DP3A 2LNCA 3ATIA 2STBE 1TNKA 2A5AA 1UTPA 2PKSB 1UO6A 1V2OT 2D8WA 1NZQH 5AF9H 2A2XH 3UOUA 2B5TB 1O34A 4Y10E 3SOSA 3AASA 4H42U 3SHCH 1TBZH 2QXIA 1HDTH 4FUDA 1O2PA 4X1RU 3SJOA 1LHGH 4YM9A 5E0JA 4YOGA 1HAXB 4LOYH 5L6NH 2K1QA 4ZXXH 3RXCA 1XUKA 1O3KA 3EAJA 2ZGCA 3ODFA 1G9IE 4ISIH 4TY6A 2ZTXA 3U8OH 1S85A 2A7HA 1VCQA 2Y82A 2FOHA 3AAUA 1NU7B 1P06A 4DOQA 3P8OA 5EQQA 3V3MA 2IJOB 1MBMA 2XYAA 2D1JA 4I8JA 2BVXH 3V0XA 1SGIB 1FLEE 4NA9H 4X0WU 3SGAE 1CA0C 2QN5T 1QB1A 6GCHG 2C4FH 1BMMH
chains in the Genus database with same CATH superfamily
3MU4A 2STAE 1VZQH 1SLUB 4JMYA 1GI2A 1P04A 3FP8E 1HXFH 1K22H 1BHXF 4KTCA 2RDLA 1BOQA 1SGCA 5ETXA 3NWUA 1P9UA 4X2WA 3KQ5A 1COWD 3D23A 2CMYA 3ZZDA 1O5BB 2KAIA 1KXEA 1A3BH 3I78A 4A1VA 1L1JA 2TGAA 3A7VA 1BMNH 3GS9A 2WV9A 4BAMB 1GJCB 3RUOA 1PQ8A 2ZA5A 1GI3A 1GJAB 1Z6EA 4DIIH 1GJBB 2AERH 1CA0B 1V2PT 1TGSZ 2QY0B 1AD8H 1C5VA 1SBWA 4P02A 1OOKB 1UCYK 3FZZA 1DPOA 3UB0A 1W0ZU 3CS7A 3KNXA 3MQKC 1PPCE 2UUFB 4B75A 2KCOA 2R0KA 2G5VA 2KCAA 2ZDAH 3LPRA 5DO4H 3MMGA 1BHXB 3M5MA 3GDVA 4FU9A 2V3OH 1FAXA 3SJ9A 3FZDA 5I46H 1F5RA 1HJ9A 1AE8H 3TH2H 5DP7A 1ANEA 4DT4A 2QF3A 1BQYA 1BMAA 4NZQA 1OWKA 2FWWA 3K9XB 1NU9A 2PWXA 1P09A 4R0IA 1NRRH 3RXOA 1SGDE 2RG3A 5HM2A 1H1BA 1W0YH 5F6MA 4CRAA 1N6XA 1INCA 1F5LA 2PHBA 1ZTKA 1D3PB 1GVKB 1N8OB 3GY8A 1BUIA 4UE7H 3OEHD 1TNLA 2EEKA 4R8TB 3RMOH 3SV7A 1B7XB 2NWNA 1EX3A 3LGVA 2XCNA 2C8XB 2C90B 2P94A 1BJVA 3ODDA 3UOPA 3SV6A 1C2FA 3LIWA 3L6PA 1LVOA 1MH0A 1KXDA 1Z8IB 3RLYH 4OGYA 3Q76A 1GHVH 1WAYB 2Y6TA 4FUCA 2ZGBH 5EPNA 3ZZCA 5L2ZH 1DXWA 2V7QD 3VXEH 1KLJH 2H9TH 4WXVA 3I77A 1O3FA 1TLDA 4O97A 2HPQH 3LGIA 2J92A 1XUGA 1P2NA 3MWIU 1GBTA 1C5WB 1GJ9B 1OP2A 2A31A 2ESTE 2O8UA 2P3FH 2ANMH 3ZV9A 2WPDD 4B76A 3BIVH 2W3KA 3ESTA 1BTXA 1GBFA 1A5GH 1OXGA 1J9CH 1SHHB 2V35A 4MNVA 1CGHA 9LPRA 2VGCC 6CHAB 2AIQA 4GHTA 1LMWB 2P16A 1SOZA 1C5OH 1OWHA 4DW2U 2ZO3H 1IQFA 2G81E 4CRBA 5FCKA 2QF4A 3L3TA 1SFIA 8GCHG 2W6JD 1EUFA 1CT2E 1S0QA 1RTFB 4TWWA 1BJUA 4Z0KA 1QCPA 3HKIB 1WQVH 2JETC 4AYVB 5HMAA 1EB1H 1YLCA 1CSOE 1TNIA 4AGKA 1AIXH 3CNRA 3FP7E 1BIOA 3GOVB 1FPCH 3T25A 1TABE 1GI0A 3SNBA 4XDEA 2AGIX 2GVFA 1SPJA 1YP9A 5G4BA 3URDA 3RXEA 4I31A 4B6FA 4BAQB 5JBTA 2OTVA 3WY8A 1RIWC 1MCVA 3BN9A 3C1KA 1C1VH 3SU5A 3PV5A 2PKAA 4Y0YE 1Z8JB 4ABIA 1QNJA 2BXUH 2D26C 4IS5A 2R3YA 3F1SB 3SV9A 1GBEA 3RXPA 2F43B 2J4IA 2PTNA 4ABGA 3SN8A 2HOBA 1DUEA 4Q7YA 1T7CA 1S6LA 1W2KH 2DUCA 5FX6A 1QJ6B 5F8ZA 5A2MH 1HAHH 3M3TA 4Q80A 3SYJA 1YPHE 1O3CA 3QUMP 1C2KA 3OTJE 3HPTB 1CA8B 4OS5A 2F9PA 5J4SA 2ALVA 4IC5A 3LC3A 5EGMA 4D9QA 1O2OA 1RIWB 2ZU1A 1NM6A 1RGQA 5C94A 2VIPA 3ELAH 2FS9A 4WF8A 5L30H 1IQJA 1UVPA 2Y7ZA 3UWJH 3K2UA 1C2JA 2CK3D 1ZPZA 1HXEH 1BBRK 1HIAA 2WPLS 4K69A 3S9CA 1T4UH 3E91A 1O2KA 2G4TA 2BD9A 2C93B 2DE8A 1LHCH 1KYNA 4FUFA 1SI5H 1ABIH 2A1DB 3FOAA 4I33A 1C4Y2 4JZDH 3BTDE 1MUEB 4YTAA 2FOCA 1W0KD 1G3BA 1OYTH 2L74A 3FFGA 3SU4A 1THPB 5JPMH 3MO3A 1C2MA 4MNYA 4INLA 1OSSA 3SUGA 2SGDE 3HGNA 3P95A 2VVVA 1XUJA 2BLWA 4Q7ZA 4FETA 1MTUA 1C1OA 4HI3A 4NIVA 2XBYA 3CP7A 1GPZA 1YGCH 4ABFA 2ZDNA 1QZ8A 5AHGH 1A46H 1UTNA 2VH0A 1UTLM 3SW2B 3A80A 2BLVA 2ZHWH 1Z8RA 1EOLA 2ZU2A 1P03A 1WDIA 2YMSB 1GWAA 3M3VA 2V3HH 2CF9H 1TMUH 2ZDLA 3WW7A 1IOEA 1TQ7B 2OP9A 1LVBA 1ZRKA 2XC5A 1DY8A 3TU7H 3PTBA 1DS2E 4A5TS 5SGAE 4GVUA 2Y5HA 1FY8E 3QDZB 1Y3UA 2WPHS 1IHTH 1CU1A 3W1EA 4BTUB 1GBBA 2JH6D 1BZXE 3LGTA 2VB0A 2GD4B 2ZFRH 4WMFA 1MCTA 2GTBA 1SGEE 1AY6H 2A2QH 1O2NA 4THNH 1D9IA 2ZC9H 1EP6A 3TJNA 4KELA 4Z6AH 1AFQC 1GJ8B 3RMNH 3LGUA 1GI8B 5K7RA 1EATA 1DT2A 1PPZA 4CRGA 3GY4A 4BTIB 2FX6A 1C1PA 5ESBA 1DSUA 2XC0A 3BTQE 3E1XB 1CHOG 3QX5H 2O8WA 2UUKB 4D9RA 5DP4A 2SGEE 1P10A 2PR3A 3F0PA 1O3DA 1EZUC 3SUEA 1ANBA 3Q3XA 1CGJE 4DY7B 2IPHA 2EI6A 2Z3DA 2BX4A 2FXRA 3GY6A 2VVCA 1AFQB 2QC2A 1UJ1A 3AAVA 1YF4A 1HLTH 3BEIB 6GCHF 2WYJA 1QIXB 2PV9B 1O39A 1L4ZA 3LONA 3AW1A 1QL7A 5F8TA 1TONA 5EQSA 1P2KA 2Z9LA 4TY7A 3TK6A 3VXFH 4OM9A 4GSOA 3GDUA 1EAUA 1F0SA 5LH8A 4UD9H 2OC0A 1NESE 3RC6A 3ITIA 3A82A 5T6GA 1BRBE 1UCYH 1MTNC 3BTEE 5JBBS 3UREA 2A4QA 4MG3A 3RXAA 3TGJE 1C2HA 4TPYA 4CBOA 1TBRH 1L2EA 3K6YA 1DWDH 1ELFA 3GYLB 4F4OC 4D76A 3T5FH 4GCHG 2XNDD 1UK2A 1Z6JH 1IQEA 1NBMD 1HPGA 1Y59T 2B0FA 1B0FA 4XRNA 4YLQH 1HAPH 2B9LA 1DWBH 1JIRA 1PYTD 1ANDA 1QL8A 3E16B 4Q4LA 4UDWH 5JDUB 4ISLA 3A85A 4Q63A 4I8LA 1DITH 3TJVA 1AO5A 3RXFA 1EXFA 1RJXB 1IQMA 1P2QA 2FOBA 2W6ID 3M7QA 1WSSH 2HNTF 3F3BA 1EAWA 1TBQH 1BTHH 2GT8A 1A1RA 1ZSKA 4ABJA 2Z9KA 1PYTC 1BDAA 3VB4A 3ZVFA 1C5PA 2LP6A 3QO6A 3ZVAA 1TPOA 2W7SA 3ZZ7A 1WUNH 3PYHA 1ETSH 3ZZ8A 2WPIS 1ORFA 4CRFA 3LH1A 5F8XA 3KIDU 4TT3D 5L2YH 3DFLA 3F6UH 1T8LA 2BD7A 3LJOA 3PLBA 1GBHA 2BY8X 1O2MA 2FODA 4JZ1A 3SO3A 1GHBG 3ZVGA 4CHAB 2GZ9A 4HG6A 5FBIA 1W11U 4CRCA 3E6PH 1GHAG 2PUQH 4ASUD 3IG6B 1AKSA 4X6OA 4Y76A 2EY4C 4ZKSU 3D62A 1AQ7A 2P3TB 1Z8GA 4A1XA 1BTYA 1TOMH 2ANKH 4X1QU 3ZVEA 1KMHB 2OD3B 1H8ED 1T8NA 2EI8A 3A83A 2SNVA 4X6NA 4FU8A 2QYIA 3UR9A 3T62A 4KGAA 1G30B 3F9HA 3MH5A 1F0TA 3PV4A 2G55A 3BV9B 2F3CE 1W13U 2KX4A 1J15A 2H9EH 5E0GA 2A7JA 3MYWA 3KQDA 4Q7XA 1SGFA 5A8YA 3SV8A 4A6LA 1FAKH 1QR3E 4Y79A 1SQRA 1TMTH 2ODQA 2BY7X 4NG9H 1A0HB 1SGFG 4ABDA 1V2MT 1TNHA 2Q1JA 2ZFQH 2PP6A 1DVAH 1KXBA 1KLTA 5AFYH 1MZAA 2RCEA 8GCHF 1BT7A 1XKAC 1GI4A 1S6HA 3RDZA 3A8AA 2OCVB 4OS2A 4ZMAH 1YPLH 1NT1A 3GICB 3FANA 3RXGA 1EPTC 2QXJA 5E0HA 2FPZA 2AYWA 3E3TA 1C2DA 1QQUA 1RD3B 2UWLA 1O3HA 2CHAC 3MH7A 1UW7A 2A32A 1GMCG 2NU0E 3MNSA 3KCGH 2Q6FA 3M61U 1YKTA 1O2WA 2BTCE 2WINI 4YXWD 3S7HB 1V2TT 3ZZBA 5J4QA 1JBUH 1EJNA 3A84A 3DSOA 1OPHB 1UMAH 2G00A 3M35A 3CENA 1L0ZA 1LDTT 3MNCA 5HXFA 3LGYA 1F92A 2VVUA 3ZZ9A 1SLWB 1EJMA 4X6MA 1HAOH 1MABB 1GL0E 5LPRA 2QA9E 1LTOA 5HM9A 1O3PB 3U28C 2PSXA 4O03A 1V6DA 4FUIA 1BBRH 1XUHA 2CHAB 1NS3A 1VGCC 1TB6H 4BXWA 1YPEH 1EZSC 1QURH 1V2RT 3QTVH 4B2AA 2KZ4A 1O35A 4WH8A 3UAIC 3NUMA 3I29A 3FAOA 1CVWH 1ELDE 4CR5A 3VB3A 1LVMA 1SGYE 2BY9X 1MQ5A 4KTUA 3PRBA 3VFEA 1TA6A 4BAKB 2BXTH 1RFNA 3MU5A 1NN6A 2ULLA 1VITH 2VNTA 3UQOA 1C1SA 1GBAA 5E2OA 3PMBB 1VGCB 1ELAA 4X8TH 2G52A 2M2AA 4ACBA 4X2VA 3KQCA 2AHME 1QB6A 4AFSA 1MU8B 1FMGA 4IGDA 4ZHMU 3RXQA 4NWLA 3R0FA 4YLUA 5KECA 1O38A 4BANB 5IDKA 1ETTH 4DG4A 1RRKA 2H9HA 1Y3YA 4K2YA 3AW0A 1SFQB 1NFUA 1O2ZA 1EASA 2XOKD 2F9NA 1KDQA 1U6QA 3PLKA 3RXBA 3LU9B 5EPYA 5CHAC 1ZPBA 3PRDA 1AUTC 3TITA 1O3OA 1A0JA 3BIUH 1Q31A 2J34A 5DP6A 1Y3WA 2BQWB 2VIQA 1DXPA 3HKJB 3UY9A 1ZPCA 2GKVE 5PTPA 2BB4A 3A7YA 2JIZD 1BRUP 1DSTA 1H8IH 1P2MA 1V2ST 2JH0D 1HAZB 1PQAA 1HV7A 4ISNA 1GHWH 4K60A 2XWBI 2PW8H 1B0EA 2HVXA 2J38A 1XUIA 4NA7A 5DJ7A 5FBEA 3KL6A 4ZXYH 4Q2KA 3QZQA 2F4LA 5CHAB 1D6RA 4JZIA 1DFPA 1O2IA 5C0TA 1ELEE 1P2JA 2XXLA 4K1SA 5GCHG 1CHOF 2ZFFH 1J17T 1UVSH 1O3MA 2BOKA 2W5EA 3FKSD 4I7YH 1GL1A 2FTMA 2TGDA 3M7TA 3S0NA 3O8CA 3GCOA 1QY6A 4OS1A 1GI6A 1N8OC 1DX5M 4AGJA 3A8DA 2BX3A 2QF5A 3KQBA 2THFB 1WBGB 5KEDA 1E35B 1SSXA 1PFXC 2ZZUH 4X1PU 3T26A 2HPPH 3A7WA 5EODA 3BTHE 1MKXH 3GY3A 3LOXA 1XMNB 2VWNA 1QJ7B 2H5DA 4DT7B 3A88A 2A5KA 2PTCE 1V2JT 3SU3A 1QRWA 1WYKA 5FAHA 2BY6X 4CR9A 5DGJA 1LPGB 3PMAB 5A09A 1SL3A 3RM2H 3IITA 4AC9A 3F9FA 3K6ZA 3VB6A 4AFQA 4DGJA 3PO1C 4AB9A 3FN8A 3UFAA 4AB8A 2YOLA 2Z7FE 4RI0A 1GGDB 4U30A 1ARCA 4E05H 3RU4T 5EU8A 2SGFE 1UK4A 3ZZ3A 2J98A 1ZMLA 1A5HA 3Q00A 1K1PA 2ALPA 4GCHF 2HLCA 1QFKH 3BG8A 3T29A 4FUGA 1QBNA 6CHAC 1H8DH 2OINA 4OS4A 4FUJA 4B1TA 2AMPA 2CV3A 1O5GH 3EGKH 1OYQA 1GJ4H 1V2LT 2Z3EA 3PO1B 1DE7H 5GXPA 1O2JA 3RXSA 1OHHD 4MVNA 1P02A 4I8GA 2XC4A 2VWOA 1XUFA 1GJ6A 3VGCC 2BDIA 1MTSA 2J2UA 1T32A 1UHBB 2ASUB 3FVFB 4DURA 4AFZA 1FY4A 3S69A 1RXPA 2OK5A 3GYMA 4MLFB 2WPKS 1ID5H 1PQ5A 2ZQ2A 3NCLA 1VCWA 2GMTB 1TGCA 3PV2A 2BDGA 4BXSA 2C8WB 1Z7KA 1TAWA 4UONA 2JH5D 2FS8A 1GHBF 4FVBA 4AZ2B 3VGCB 4ESTE 1VJAU 2F9VA 7LPRA 1GHAF 1AVGH 1AFEH 1O2YA 2Q6GA 1EPTA 3F9GA 4NA8A 4X2YA 3SZNA 1CHGA 2A4GA 1HFDA 3LJJA 1GBMA 1OWJA 1YPGH 4B74A 1C5NH 1WTHD 2GDDA 1TALA 1C4U2 1C5QA 4WMEA 4MPVA 1QBOA 3B8JA 3H7OA 3S9AA 1K0HA 2FLRH 3KYGA 1HYLA 2A5IA 3PWBA 1W0JD 5DPAA 1CBWC 4DJZB 2ZECA 1NY22 3KGPA 3N7OA 4AOQA 8KME2 3SHAH 2AH4X 1GBKA 1H8HD 3VEQB 3RXKA 1DDJA 1UTKA 4FOUC 1A4WH 3TNSA 2BDBA 2ZU4A 1GMHG 2SGAA 3DFJA 4MNWA 5T1VA 1SGPE 2R2WU 1HAVB 2ZG0H 5C0UA 3PM3A 1V2UT 2GCHG 3A8CA 3DHKH 3NK8A 4KTSA 4DVAU 1O5CB 3M5NA 2F9UA 3BTWE 1AU8A 1EB2A 5CHBA 1CBWB 1QRZA 2HNTE 1ZOMA 1O3LA 3TH4H 5DN6D 1H9IE 1T8MA 3BEFB 2BZ6H 3BTTE 4U01A 2BD8A 3E0NB 3RU4E 2YMSC 1C5RA 1G3CA 2KCPA 1C1UH 2FOGA 4NSYA 5FCRA 1GDNA 3A89A 1C5MD 4HTCH 1LO6A 1ZJDA 1GMCF 2ZF0H 1IAUA 2RFKC 4IMZA 3SJIA 4BNRA 5FPSA 4ABAA 2A7CA 3M5LA 1ETRH 1C1QA 1TFXA 2BD2A 4MPUA 5EQRA 1QA0A 1GHZA 2Z94A 3BG4B 2G5NA 2QXHA 5T6DA 1OP0A 1BTZA 4IBLH 4Y0ZE 1Y3VA 4PROA 1UTJA 5A0CA 4A1TA 1C5XB 1ACBE 1EZXC 2ZGXH 3TJOA 3UTUH 1NFXA 2UWPA 3HK3B 1Y3XA 5H4IB 2YNBA 5IK2D 2BD5A 4X1SU 1LQDB 3U98H 2KR7A 3AK5A 2UUYA 1KY9A 2OXSA 4X8UH 5BPEA 1VJ9U 5EJLA 1GHXH 1FIWA 2DE9A 1SB1H 3EE7A 3TGKE 1ELGA 1TPAE 2ZCHP 3S9BA 1GBLA 1F2SE 4AG1A 1VKYA 3SV2H 3OU0A 4BTTB 1OKXA 1NO9H 1TA2A 1GDQA 2BQ7B 1WCZA 3PWCA 4ABHA 3KHVA 1FXYA 1DUAA 1FY5A 1P11E 5AVDA 2Z3CA 2IPQX 1HRTH 3DD2H 3ZVCA 3RC5A 1MBQA 2AMQA 3NRLA 1AHTH 1YWUA 1GJDB 3URCA 3UPEA 1J8AA 1F5KU 5KGOA 3ZIAD 3P70B 2AGEX 2C8YB 1L1NA 1K9OE 4Z1MD 3SU0A 2G51A 1LQEA 1FQ3A 2TPIZ 5FXLA 3H5CB 4MDSA 2GCTC 3TH3H 1ZGIA 4TPIZ 1D3QB 2BLOA 3E8LA 1AVXA 4CRDA 1WTGH 5JB8S 4X6PA 1KTTB 2QIQA 4RSPA 4BAHB 1WQSA 5DSFA 2F9OA 1IQLA 5A0AE 1MAXA 1DANH 3MNXA 3P8NA 1GI5A 5TJXA 3TK5A 1PPGE 3OEED 1A61H 2F9BH 4IMQA 5HKKD 1S82A 3ZZ6A 1K1NA 1XVMA 4XBCA 2ZIQH 4IN1A 1MKXK 1TWXB 1C9PA 4E7RG 1HAIH 1EAIA 2GCTB 3KN2A 3SU6A 1BITA 1BRAA 4I8KA 4X8VH 1OWEA 1S84A 2OQ5A 1G2LA 4RT0A 1D3DB 2BHGA 3F68H 4A7IB 1ARBA 2BDAA 3GCHC 5GCHF 3VPKA 1ZTJA 5EOKA 1HNEE 1C5LH 1ELBA 4J2YB 3DT0H 1Z1JA 5A8ZA 5K0HA 1YCPM 1O2LA 2BYAX 5DP9A 1TGBA 1ZR0A 1LKAA 3QN7A 2C3SA 1K21H 4ACAA 4CHAC 4MTBA 4O9VA 2XBVA 1XM1A 2Q6DA 1TX6A 2TBSA 7KMEH 1F0UA 1YPHC 2I6SA 1O2RA 2TGPZ 3GCHB 3MTYA 1LKBA 3P8FA 3RXHA 1O5DH 1EFRD 3DCLA 1O5AB 2BY5X 2QAAA 1IQHA 2HNTC 2FMJA 3MH6A 1CO7E 4LXBH 4ABBA 3TJUA 3UWIA 1NC6A 2R3UA 1SVPA 3QTOH 5C1YA 4AX9H 1IQNA 1DM4B 3S7KB 1D4PB 4X1NU 1AE5A 2FOEA 4O3TA 1PPBH 5FHTA 4B2CA 1QGFA 2WSSD 1X7AC 2ZFSA 3VG8A 1O3GA 2J97A 5GPIB 1GBJA 4GPGA 1P2IA 2QV1A 3O8RA 5DP5A 3A7TA 1V3XA 2Z6BD 4SGAE 1GBIA 1BCUH 1KIGH 4J1YA 2FM2A 1FY1A 3U1IB 1MMJN 2BM2A 2VIDA 2GP9B 3BSQA 2WV5A 1MTVA 3GCNA 5CDFE 1ZHMA 2ANWA 1FZZA 1E34B 1O36A 3TPIZ 1HAVA 1NFYA 1C5UA 2W26A 3W94A 2TGTA 3QGNB 2ZHQH 4K8BA 5C17A 3RP2A 1ZMNA 3RMLH 3Q3YA 5DG6A 4GUXA 4X8SH 1BMFD 4ISHH 1BMLA 1C1NA 3EA9A 4JYUH 1TQ0B 3OYPA 2OC1A 3Q3KA 2ZHFH 5JBCS 1WXRA 3STJA 2GDEH 3SUFA 1ZGVA 1YPMH 2ODYB 1IQKA 1D6WA 1ZHRA 4H4FA 3MO9A 1KLIH 4Y8YA 3SZEA 2QXGA 1NRSH 3MOCA 1C1MA 2FDAA 3OY6U 4TWYA 2FP7B 3A7XA 4XBDA 2KCYA 2KFWA 5C1XA 4K5ZA 5HIYA 3PMHB 1HUTH 1K1LA 4K3JA 2O9QA 1WV7H 1K1JA 4GLYA 3LDXH 4FUHA 1AI8H 1QJ1B 1QA7A 2XTTB 3N7DA 1ESBA 4H6TA 1LVYA 3PTNA 1K28D 1NTPA 1XKBC 3EQ0H 4SGBE 3RXIA 3TNTA 1W8BH 1Z71A 1MTWA 3U69H 1W12U 1O2QA 2ZEBA 3A7ZA 3UIRA 1IQIA 2BD4A 1O2GH 3KEEA 2Z9GA 1YPKH 3OX7U 4NWKA 2AEIH 2UUJB 3BF6H 5JYIA 1JXPA 1O2XA 4D7GA 4TYDA 2BDCA 1SMFE 1XXDA 4FXGH 2P8OC 5T6FA 1LCYA 4BAOB 5B6LA 5E2PA 4Y8XA 3DUXH 1XVOA 2QF0A 1GI1A 1GMHF 1E36B 2HVYB 2ZQ1A 1S6FA 4Y11E 3BEUA 1O3IA 2GCHF 3NZIA 4ZAEA 1NROH 3BTFE 4MPWA 1NRNH 1ELTA 1UVUH 1EJAA 1TPPA 1LPKB 1ZRBA 3O8DA 1Q3XA 2FZZA 2V6NA 4B71A 1EQ9A 1GBCA 2P8OB 4NIWA 1BRCE 2PGQB 1TX8A 2UWOA 4I32A 5C5OA 3OAAD 3PMJA 1K2I1 2PKAB 5DP8A 3HGPA 4DIHH 2HWLB 1DOJA 5GJ4B 4ZHAA 2OBQA 5CE1A 1ZYOA 3SNDA 5C2ZA 3JZ2B 1Y5UT 1L1GA 2BZAA 1AB9C 1J16A 3EA8A 2FIRH 4Y6DA 2ZWLH 1TE0A 2IJD1 1F0RA 1ZHPA 1CGIE 2H6MA 2Y5FA 1UCYE 1QL9A 4RT1A 3LC5A 4BOHA 2XNIA 2WUCA 2JKHA 1UTOA 1UVOA 4YO9A 2M5TA 4GAWA 1B5GH 4UFGH 1GVZA 1O3EA 4Y71A 1AMHA 5EXMA 5EXLA 3SNAA 3KYFA 1HIAB 1ZJKA 3UR6A 3TGIE 1H9HE 4MNXA 3GCTG 2QCYA 1AB9B 4XE4A 5ESTE 1TRNA 5GIBA 2G8TA 7GCHG 2R2MB 5TCAA 1ABJH 1THRH 4YOIA 1O3NA 2VIVA 1EP5A 1AGJA 3H09A 5CMXH 5F03A 4LZ1H 2OLGA 1CE5A 3T27A 4QT8C 5EIYA 1TRMA 5A8XA 1P12E 1AN1E 3EA7A 4ISOA 3ATMA 3SI3H 3RXLA 2BDYA 2NU2E 3EE0B 3A8BA 1G32B 3WWFA 4HGCA 4GHQA 2BDHA 1KXCA 5EW2H 1K1MA 4JZFH 3P6ZB 3VB7A 1E1RD 3C27B 1VCPA 4NGAH 3RXRA 2VBCA 1C1WH 2A45B 2XCFA 1FN6A 1VITG 2XRCA 2LELA 4LK4A 3V12A 3OY5U 4NIXA 4INHA 5EJZA 1O2TA 4XOJA 3P17H 1GGDC 2VJ1A 2EI7A 2SNWA 3T28A 1C5ZB 1G3DA 3JZ1B 4ZHLU 2FOMB 1K1OA 1UK3A 1O5FH 1FUJA 1P8VC 2IN2A 1C5SA 3CS0A 2ZP0H 2GX4A 1FDPA 4CH8B 4NFFA 1MU6B 1OWDA 4ABEA 3M36A 1V2NT 3NPSA 2TRMA 1OWIA 3ATWA 4JYTA 2NU4E 3D49H 2WZQA 3QZRA 3U1JB 4AYYB 3OTPA 4IW4E 2J5UA 4WJG2 1GVLA 4F55A 1C2IA 1ELCA 2FX4A 1EAXA 5EW1H 3RMMH 2FYQA 2AMDA 3A86A 4DCDA 1W10U 1L4DA 3N99A 4OGXA 1EOJA 5EG4A 3MU1A 3RXVA 1A5IA 1E38B 5JB9S 1D3TB 1QTFA 4B73A 1WU1A 4XBBA 1KSNA 4OS6A 1SG8B 2GJGA 2TIOA 3ATKA 3EDXB 3UUZA 1DLEA 1PQ7A 2GMTC 1JWTA 1BB0B 1WOFA 4RKJB 2OC8A 1NRPH 1QRXA 1SQAA 5C3NA 3RXMA 1IQGA 1SQTA 1Z1IA 1Y5BT 4ASHA 1E79D 6ESTA 2A4OA 2CJIA 4JYVH 5DKMA 1M9UA 2ILNA 3M37A 2Z9JA 4Y8ZA 4YT7H 1C2GA 1PPFE 1Y8TA 3MI4A 1YBWA 2J94A 1O31A 1C2EA 1O3AA 1S5SA 2OUAA 1QHRB 4AORA 4ZUHA 2GV7A 2IOTA 3AVZA 2CXVA 1MZDA 4F49A 2RA3A 3T2NA 4YT6H 4WY3A 1ANCA 1RTLA 1THSH 1AWFH 1LPZB 1FJSA 2SGPE 4JK6A 2VH6A 2F91A 4YESB 1O0DH 3B23B 1O2HA 3Q77A 1G2MA 3LGWA 1GHYH 1C2LA 1BTPA 1YYY1 1P01A 2GGVB 2R9PA 3BTGE 1YCPH 4CREA 3SBKA 3GY2A 3FO8D 1SGNE 2PLXA 1V2VT 1BBRE 1SR5C 2ODPA 3NXPA 1NFWA 1TOCB 2Y5GA 2BD3A 2R0LA 1IHSH 1HAGE 1Q2WA 3RXJA 1W7XH 1AWHB 1O2UA 3E0PB 1V2QT 2VWMA 2ZKSA 1EKBB 2PUXB 5HYOA 2VGCB 1P3CA 1AVWA 1GG6C 2WV4A 1W3CA 5LPEA 1MKWK 1P05A 2YNAA 5ABWA 1DICA 5DK1A 2ZPRA 1O5EH 4OS7A 5E8EH 1V2KT 1N1LA 3MU0A 3SNCA 1SC8U 1O3JA 2GT7A 2A0QB 1GMDG 1HB0B 3UNSA 2YMSD 1O30A 1HCGA 2VWLA 3BTME 1JIMA 4K1TA 1AKSB 2JETB 2O8LA 4JCNA 3BG4C 2HRVA 1C5YB 4JK5A 1NBME 1QB9A 3ENSB 2XBXA 5C1UA 1FV9A 1PJPA 1GG6B 4XFQA 2OC7A 1F7ZA 5HGGA 1EZQA 3KF2A 1A3EH 3DSGA 4UFDH 3D65E 2BVRH 2VIOA 3RM0H 3M3SA 1H4WA 1N6YA 2NU1E 1T31A 3TVJB 1O2SA 1ZSLA 4ZH8A 1TRYA 1C1RA 1GCTC 2F83A 3HATH 1TYNA 2SGQE 3E90B 2ZPQA 4JZEH 1TGTA 2QE7D 1ELVA 3KQEA 5FPTA 2RA0A 1T8OA 1YC0A 2G4UA 4HZHA 1JRSA 4MQAA 1O2VA 1A2CH 1MD8A 1VR1H 4KKDA 3U8RH 4MPXA 2FLBH 4E7NA 5LGOA 4XD7D 2B8OH 4VGCC 1G3EA 3U8TH 1FN8A 4YZUA 1RS0A 4ZKOU 2ZFTA 1LHDH 1KTSB 5T3HA 5TCCA 1QBVH 1W14U 3QGJA 1CT4E 1GCTB 1GI9B 5I25A 2J9NA 1O32A 3FP6E 3RXDA 1G36A 3SU1A 2WYGA 2XW9A 5FX5A 1GBDA 1O3BA 1DWCH 2WUBA 1HAYB 1ZMJA 3OE7D 1QQ4A 2FTLE 3GY7A 1C9TA 1SGRE 1SLXB 1UVTH 2W7UA 4VGCB 4RKOB 2FEQH 2C8ZB 4UFEH 1C4V2 3ZYEA 1TIOA 1HGTH 1YLDA 5IYTA 3SU2A 2ZHEH 2P3UB 1E0FD 4WH6A 3ZVBA 1DY9A 1RTKA 3IWMA 4YOJA 1XXFA 1FY3A 1GI7B 4M7GA 4UEHH 3SGBE 2P93A 3M7UA 4CH2B 1P0SH 3ZVDA 2GZ8A 2I6QA 2SFAA 5C5NA 2V0BA 3SUDA 4FU7A 1HJAC 3PB1E 1YY3A 2OQUA 3OSYA 1GCDA 2ZCLP 3GISB 1OS8A 1ESTA 1KXAA 3TLOA 2QGRA 3F2FA 4H6SB 1P9SA 3GCTF 3PROA 4NCYA 2JJ1D 3EYDA 1UTQA 8ESTE 1SLVB 1OP8A 7GCHF 2XWAA 1AZ8A 2ZDKA 2HLDD 3OFND 1DLKB 2FI5E 1HBTH 1J14A 1O33A 1S81A 3LH3A 1O37A 1E37B 2L6OA 1CT0E 3SI4H 5AFZH 1PPEE 1BA8B 1AZZA 3L33A 2AS9A 9ESTA 2GV6A 5EJ1A 1P3EA 3P8GA 2ZDMA 1HJAB 1FX0B 1SKYE 2EC9H 3MNBA 1FPHH 1LHEH 1UHBA 2O8TA 2ZI2H 1SOTA 1G37A 1YPJH 3GDSA 4K1EA 3SQEE 4WMDA 4IC6A 2HGTH 1KDQB 3GY5A 1VITF 4I8HA 3UNRA 1TX7A 5GDSH 3F2HA 2WHXA 4NIYA 3UNQA 2Y7XA 2ZCKP 1AUJA 4U32A 2VIWA 4FUEA 1ZTLA 1XX9A 2ANYA 2H5CA 1GDUA 2FI4E 2A4RA 1V2WT 4O3UA 2P95A 2KAIB 2W3IA 2CGAA 3M5OA 4D8NA 2PGBB 2VINA 4RN6A 1ZLRA 3RU4D 1FIZA 2K8IA 1MTNB 1ESAA 4ZKRU 1MQ6A 1TGNA 4AG2A 2JJ2D 3G01A 1SGTA 4E06H 1LHFH 3QWCH 4INKA 3NKKA 3UQVA 3ATLA 2XBWA 3HK6B 3BTKE 2BVSH 3MFJA 1SGQE 3QLPH 2Y81A 1P57B 4WVPE 4KP0A 2BMGB 4A92A 2ZPSA 4ZKNU 1JRTA 1P2OA 2AIPA 2FOFA 2H2ZA 3SORA 3R3GB 3SJ8A 1FI8A 2NU3E 4LZ4B 3MO6A 1Y5AT 1JOUB 4XSKU 1GJ5H 2OBOA 2D2DA 2ZTYA 3P92A 3V13A 3A87A 1TNGA 2CF8H 2PFEA 3U9AH 1YCPK 1H9LB 4NFEA 1YLNA 4UFFH 3VB5A 1S83A 1FNIA 3F0OA 3H7TA 3MHWU 2CN0H 2ZTZA 4Y7BA 3LT3A 4ZROA 1S0RA 1ZSJA 2BQ6B 4Y7AA 7ESTE 5A0BA 1SQOA 2V3MA 3SGQE 3PLPA 4P00A 4WWYA 1JMOH 2AGGX 5GNDA 3K65B 1NRQH 1BTWA 2ZGHA 1FONA 2FO9A 1GJ7B 2FESH 4CBNA 1YM0A 3WWBA 1MD7A 2EQNA 3SJKA 3ZZ4A 1TMBH 2EA3A 3W95A 2ZGJA 1W7GH 2J98B 1C1TA 3A81A 1UTMA 1KXFA 4FUBA 1PPHE 2Y80A 1A0LA 5B6OA 3V7TA 2BLQA 5C20A 1T4VH 1DWEH 2ZU3A 2O8MA 4FVDA 3F9EA 1C5TA 4U2WA 3DA9B 3QK1A 1OX1A 1TNJA 1A7SA 3SNEA 1MAYA 2KM0A 2ZNKH 4AN7A 2P59A 4NZLA 3ZYDA 8LPRA 5BRRE 5FPYA 3MH4A 2BOHB 1HJ8A 2PSYA 1CQQA 3O8BA 4K8YA 1MKWH 2H1UA 2LPRA 3MU8A 3STIA 1K1IA 2ZHDA 6LPRA 5JBAS 4NSVA 3ZV8A 2GZ7A 3TK9A 5GWZA 3ZZAA 4M9FA 2HALA 2Z9IA 5C67A 5EXNA 2FOAA 1E1QD 4WXIA 5FL7D 3RXTA 2PKSC 5LPFA 1TPSA 3RXUA 3RC4A 1SHYA 2FYRA 4HFPB 4B2BA 2FI3E 4AFUA 1GMDF 1ZZZA 3SQHE 2B7DH 2AFQB 2ZDVH 2K0QA 3DSPA 3TIUA 4F48B 2WPMS 2JDID 4D7FA 4X2XA 1BTUA 1EPTB 2ZU5A 3B9FH 3LKWA 2VU8E 5F53A 3RLWH 2J95A 4I86A 2ZFPH 1NPMA 3ZZ5A 3F2GA 4IN2A 2WPJS 5DP3A 2LNCA 3ATIA 2STBE 1TNKA 3N7EA 5HIZA 2A5AA 1UTPA 2RDEA 2PKSB 1UO6A 1V2OT 2D8WA 1NZQH 5AF9H 2A2XH 3UOUA 2B5TB 1O34A 4Y10E 3SOSA 3AASA 4H42U 3SHCH 1TBZH 2QXIA 1HDTH 4FUDA 1O2PA 4X1RU 3SJOA 1LHGH 4YM9A 5E0JA 4ZCNA 4B6EA 4YOGA 1HAXB 4LOYH 5L6NH 2K1QA 4ZXXH 3RXCA 1XUKA 1O3KA 3EAJA 2ZGCA 3ODFA 1G9IE 4ISIH 4TY6A 2ZTXA 3U8OH 1S85A 2A7HA 1VCQA 2Y82A 2FOHA 3AAUA 1NU7B 1P06A 4DOQA 3P8OA 5EQQA 3V3MA 2IJOB 1MBMA 2XYAA 4TSFD 2D1JA 4I8JA 2BVXH 3V0XA 1SGIB 1FLEE 4NA9H 4X0WU 3SGAE 1CA0C 2QN5T 1QB1A 6GCHG 2C4FH 1BMMH
chains in the Genus database with same CATH topology
3MU4A 2STAE 1VZQH 1SLUB 4JMYA 1GI2A 1P04A 3FP8E 1HXFH 1K22H 1BHXF 4KTCA 2RDLA 1BOQA 1SGCA 5ETXA 3NWUA 1P9UA 4X2WA 3D23A 2CMYA 3ZZDA 1O5BB 2KAIA 1KXEA 1A3BH 3I78A 4A1VA 1L1JA 2TGAA 3A7VA 1BMNH 4BAMB 1GJCB 3RUOA 1PQ8A 2ZA5A 1GI3A 1GJAB 1Z6EA 4DIIH 1GJBB 2AERH 1CA0B 1V2PT 1TGSZ 2QY0B 1AD8H 1C5VA 1SBWA 1OOKB 1UCYK 3FZZA 1DPOA 1W0ZU 3CS7A 3KNXA 1PPCE 2UUFB 4B75A 2R0KA 2G5VA 2ZDAH 3LPRA 5DO4H 3MMGA 1BHXB 3M5MA 3GDVA 4FU9A 2V3OH 1FAXA 3SJ9A 3FZDA 5I46H 1F5RA 1HJ9A 1AE8H 3TH2H 5DP7A 1ANEA 2QF3A 1BQYA 1BMAA 4NZQA 1OWKA 2FWWA 3K9XB 1NU9A 2PWXA 1P09A 4R0IA 1NRRH 3RXOA 1SGDE 2RG3A 5HM2A 1H1BA 1W0YH 5F6MA 4CRAA 1N6XA 1INCA 1F5LA 2PHBA 1ZTKA 1D3PB 1GVKB 1N8OB 3GY8A 1BUIA 4UE7H 1TNLA 2EEKA 4R8TB 3RMOH 3SV7A 1B7XB 2NWNA 1EX3A 3LGVA 2XCNA 2C8XB 2C90B 2P94A 1BJVA 3ODDA 3UOPA 3SV6A 1C2FA 3LIWA 3L6PA 1LVOA 1MH0A 1KXDA 1Z8IB 3RLYH 4OGYA 3Q76A 1GHVH 1WAYB 2Y6TA 4FUCA 2ZGBH 5EPNA 3ZZCA 5L2ZH 1DXWA 3VXEH 1KLJH 2H9TH 4WXVA 3I77A 1O3FA 1TLDA 4O97A 2HPQH 3LGIA 2J92A 1XUGA 1P2NA 3MWIU 1GBTA 1C5WB 1GJ9B 1OP2A 2A31A 2ESTE 2O8UA 2P3FH 2ANMH 3ZV9A 4B76A 3BIVH 2W3KA 3ESTA 1BTXA 1GBFA 1A5GH 1OXGA 1J9CH 1SHHB 2V35A 4MNVA 1CGHA 9LPRA 2VGCC 6CHAB 2AIQA 4GHTA 1LMWB 2P16A 1SOZA 1C5OH 1OWHA 4DW2U 2ZO3H 1IQFA 2G81E 4CRBA 5FCKA 3L3TA 1SFIA 8GCHG 1EUFA 1CT2E 1S0QA 1RTFB 4TWWA 1BJUA 4Z0KA 1QCPA 3HKIB 1WQVH 2JETC 4AYVB 5HMAA 1EB1H 1YLCA 1CSOE 1TNIA 4AGKA 1AIXH 3FP7E 1BIOA 3GOVB 1FPCH 3T25A 1TABE 1GI0A 3SNBA 4XDEA 2AGIX 2GVFA 1SPJA 1YP9A 5G4BA 3URDA 3RXEA 4I31A 4BAQB 5JBTA 2OTVA 3WY8A 1RIWC 1MCVA 3BN9A 3C1KA 1C1VH 3SU5A 2PKAA 4Y0YE 1Z8JB 4ABIA 1QNJA 2BXUH 2D26C 4IS5A 2R3YA 3F1SB 3SV9A 1GBEA 3RXPA 2J4IA 2PTNA 4ABGA 3SN8A 2HOBA 1DUEA 4Q7YA 1T7CA 1W2KH 2DUCA 5FX6A 1QJ6B 5F8ZA 5A2MH 1HAHH 3M3TA 4Q80A 1YPHE 1O3CA 3QUMP 1C2KA 3OTJE 3HPTB 1CA8B 4OS5A 2F9PA 5J4SA 2ALVA 4IC5A 3LC3A 5EGMA 4D9QA 1O2OA 1RIWB 2ZU1A 1NM6A 1RGQA 2VIPA 3ELAH 2FS9A 4WF8A 5L30H 1IQJA 1UVPA 2Y7ZA 3UWJH 3K2UA 1C2JA 1ZPZA 1HXEH 1BBRK 1HIAA 2WPLS 4K69A 3S9CA 1T4UH 3E91A 1O2KA 2G4TA 2BD9A 2C93B 2DE8A 1LHCH 1KYNA 4FUFA 1SI5H 1ABIH 2A1DB 4I33A 1C4Y2 4JZDH 3BTDE 1MUEB 4YTAA 2FOCA 1G3BA 1OYTH 3FFGA 3SU4A 1THPB 5JPMH 3MO3A 1C2MA 4MNYA 4INLA 1OSSA 3SUGA 2SGDE 3HGNA 3P95A 2VVVA 1XUJA 2BLWA 4Q7ZA 1MTUA 1C1OA 4HI3A 4NIVA 2XBYA 3CP7A 1GPZA 1YGCH 4ABFA 2ZDNA 5AHGH 1A46H 1UTNA 2VH0A 1UTLM 3SW2B 3A80A 2BLVA 2ZHWH 1Z8RA 1EOLA 2ZU2A 1P03A 1GWAA 3M3VA 2V3HH 2CF9H 1TMUH 2ZDLA 1IOEA 1TQ7B 2OP9A 1LVBA 1ZRKA 2XC5A 1DY8A 3TU7H 3PTBA 1DS2E 4A5TS 5SGAE 4GVUA 2Y5HA 1FY8E 3QDZB 1Y3UA 2WPHS 1IHTH 1CU1A 4BTUB 1GBBA 2JH6D 1BZXE 3LGTA 2VB0A 2GD4B 2ZFRH 4WMFA 1MCTA 2GTBA 1SGEE 1AY6H 2A2QH 1O2NA 4THNH 1D9IA 2ZC9H 1EP6A 3TJNA 4KELA 4Z6AH 1AFQC 1GJ8B 3RMNH 3LGUA 1GI8B 5K7RA 1EATA 1DT2A 1PPZA 4CRGA 3GY4A 4BTIB 2FX6A 1C1PA 5ESBA 1DSUA 2XC0A 3BTQE 3E1XB 1CHOG 3QX5H 2O8WA 2UUKB 4D9RA 5DP4A 2SGEE 1P10A 2PR3A 1O3DA 1EZUC 3SUEA 1ANBA 3Q3XA 1CGJE 4DY7B 2IPHA 2EI6A 2Z3DA 2BX4A 2FXRA 3GY6A 2VVCA 1AFQB 2QC2A 1UJ1A 3AAVA 1YF4A 1HLTH 3BEIB 6GCHF 2WYJA 1QIXB 2PV9B 1O39A 1L4ZA 3LONA 3AW1A 1QL7A 5F8TA 1TONA 5EQSA 1P2KA 2Z9LA 4TY7A 3TK6A 3VXFH 4GSOA 3GDUA 1EAUA 1F0SA 5LH8A 4UD9H 2OC0A 1NESE 3RC6A 3ITIA 3A82A 5T6GA 1BRBE 1UCYH 1MTNC 3BTEE 5JBBS 3UREA 2A4QA 4MG3A 3RXAA 3TGJE 1C2HA 4TPYA 4CBOA 1TBRH 1L2EA 3K6YA 1DWDH 1ELFA 3GYLB 4F4OC 4D76A 3T5FH 4GCHG 1UK2A 1Z6JH 1IQEA 1HPGA 1Y59T 2B0FA 1B0FA 4YLQH 1HAPH 2B9LA 1DWBH 1JIRA 1PYTD 1ANDA 1QL8A 3E16B 4UDWH 5JDUB 4ISLA 3A85A 4I8LA 1DITH 3TJVA 1AO5A 3RXFA 1EXFA 1RJXB 1IQMA 1P2QA 2FOBA 3M7QA 1WSSH 2HNTF 1EAWA 1TBQH 1BTHH 2GT8A 1A1RA 1ZSKA 4ABJA 2Z9KA 1PYTC 1BDAA 3VB4A 3ZVFA 1C5PA 3QO6A 3ZVAA 1TPOA 2W7SA 3ZZ7A 1WUNH 3PYHA 1ETSH 3ZZ8A 2WPIS 1ORFA 4CRFA 3LH1A 5F8XA 3KIDU 5L2YH 3DFLA 3F6UH 1T8LA 2BD7A 3LJOA 3PLBA 1GBHA 2BY8X 1O2MA 2FODA 4JZ1A 3SO3A 1GHBG 3ZVGA 4CHAB 2GZ9A 5FBIA 1W11U 4CRCA 3E6PH 1GHAG 2PUQH 3IG6B 1AKSA 4X6OA 4Y76A 4ZKSU 3D62A 1AQ7A 2P3TB 1Z8GA 4A1XA 1BTYA 1TOMH 2ANKH 4X1QU 3ZVEA 2OD3B 1T8NA 2EI8A 3A83A 2SNVA 4X6NA 4FU8A 2QYIA 3UR9A 3T62A 4KGAA 1G30B 3F9HA 3MH5A 1F0TA 3PV4A 2G55A 3BV9B 2F3CE 1W13U 1J15A 2H9EH 5E0GA 2A7JA 3MYWA 3KQDA 4Q7XA 1SGFA 5A8YA 3SV8A 4A6LA 1FAKH 1QR3E 4Y79A 1TMTH 2ODQA 2BY7X 4NG9H 1A0HB 1SGFG 4ABDA 1V2MT 1TNHA 2Q1JA 2ZFQH 1DVAH 1KXBA 1KLTA 5AFYH 1MZAA 2RCEA 8GCHF 1BT7A 1XKAC 1GI4A 1S6HA 3RDZA 3A8AA 2OCVB 4OS2A 4ZMAH 1YPLH 1NT1A 3GICB 3FANA 3RXGA 1EPTC 2QXJA 5E0HA 2FPZA 2AYWA 3E3TA 1C2DA 1QQUA 1RD3B 2UWLA 1O3HA 2CHAC 3MH7A 2A32A 1GMCG 2NU0E 3MNSA 3KCGH 2Q6FA 3M61U 1YKTA 1O2WA 2BTCE 2WINI 3S7HB 1V2TT 3ZZBA 5J4QA 1JBUH 1EJNA 3A84A 1OPHB 1UMAH 2G00A 3M35A 3CENA 1L0ZA 1LDTT 3MNCA 5HXFA 3LGYA 1F92A 2VVUA 3ZZ9A 1SLWB 1EJMA 4X6MA 1HAOH 1GL0E 5LPRA 2QA9E 1LTOA 5HM9A 1O3PB 2PSXA 4O03A 1V6DA 4FUIA 1BBRH 1XUHA 2CHAB 1NS3A 1VGCC 1TB6H 4BXWA 1YPEH 1EZSC 1QURH 1V2RT 3QTVH 4B2AA 1O35A 4WH8A 3NUMA 3I29A 3FAOA 1CVWH 1ELDE 4CR5A 3VB3A 1LVMA 1SGYE 2BY9X 1MQ5A 4KTUA 3VFEA 1TA6A 4BAKB 2BXTH 1RFNA 3MU5A 1NN6A 2ULLA 1VITH 2VNTA 3UQOA 1C1SA 1GBAA 5E2OA 3PMBB 1VGCB 1ELAA 4X8TH 2G52A 4X2VA 3KQCA 1QB6A 4AFSA 1MU8B 1FMGA 4IGDA 4ZHMU 3RXQA 4NWLA 3R0FA 4YLUA 1O38A 4BANB 5IDKA 1ETTH 4DG4A 1RRKA 2H9HA 1Y3YA 4K2YA 3AW0A 1SFQB 1NFUA 1O2ZA 1EASA 3PLKA 2F9NA 1KDQA 1U6QA 3RXBA 3LU9B 5EPYA 5CHAC 1ZPBA 1AUTC 3TITA 1O3OA 1A0JA 3BIUH 1Q31A 2J34A 5DP6A 1Y3WA 2BQWB 2VIQA 1DXPA 3HKJB 3UY9A 1ZPCA 2GKVE 5PTPA 2BB4A 3A7YA 1BRUP 1DSTA 1H8IH 1P2MA 1V2ST 2JH0D 1HAZB 1PQAA 1HV7A 4ISNA 1GHWH 4K60A 2XWBI 2PW8H 1B0EA 2HVXA 2J38A 1XUIA 4NA7A 5DJ7A 5FBEA 3KL6A 4ZXYH 4Q2KA 3QZQA 5CHAB 1D6RA 4JZIA 1DFPA 1O2IA 1ELEE 1P2JA 2XXLA 4K1SA 5GCHG 1CHOF 2ZFFH 1J17T 1UVSH 1O3MA 2BOKA 2W5EA 4I7YH 1GL1A 2FTMA 2TGDA 3M7TA 3S0NA 3O8CA 3GCOA 1QY6A 4OS1A 1GI6A 1N8OC 1DX5M 4AGJA 3A8DA 2BX3A 3KQBA 2THFB 1WBGB 1E35B 1SSXA 1PFXC 2ZZUH 4X1PU 3T26A 2HPPH 3A7WA 5EODA 3BTHE 1MKXH 3GY3A 3LOXA 1XMNB 2VWNA 1QJ7B 2H5DA 4DT7B 3A88A 2A5KA 2PTCE 1V2JT 3SU3A 1QRWA 1WYKA 5FAHA 2BY6X 4CR9A 5DGJA 1LPGB 3PMAB 5A09A 1SL3A 3RM2H 3IITA 3F9FA 3K6ZA 3VB6A 4AFQA 4DGJA 3PO1C 4AB9A 3UFAA 4AB8A 2YOLA 2Z7FE 1GGDB 4U30A 1ARCA 4E05H 3RU4T 5EU8A 2SGFE 1UK4A 3ZZ3A 1ZMLA 1A5HA 3Q00A 1K1PA 2ALPA 4GCHF 2HLCA 1QFKH 3BG8A 3T29A 4FUGA 1QBNA 6CHAC 1H8DH 2OINA 4OS4A 4FUJA 4B1TA 2AMPA 2CV3A 1O5GH 3EGKH 1OYQA 1GJ4H 1V2LT 2Z3EA 3PO1B 1DE7H 5GXPA 1O2JA 3RXSA 4MVNA 1P02A 4I8GA 2XC4A 2VWOA 1XUFA 1GJ6A 3VGCC 2BDIA 1MTSA 2J2UA 1T32A 1UHBB 2ASUB 3FVFB 4DURA 4AFZA 1FY4A 3S69A 1RXPA 3GYMA 4MLFB 2WPKS 1ID5H 1PQ5A 2ZQ2A 3NCLA 1VCWA 2GMTB 1TGCA 2BDGA 4BXSA 2C8WB 1Z7KA 1TAWA 4UONA 2JH5D 2FS8A 1GHBF 4FVBA 4AZ2B 3VGCB 4ESTE 1VJAU 2F9VA 7LPRA 1GHAF 1AVGH 1AFEH 1O2YA 2Q6GA 1EPTA 3F9GA 4NA8A 4X2YA 3SZNA 1CHGA 2A4GA 1HFDA 3LJJA 1GBMA 1OWJA 1YPGH 4B74A 1C5NH 1WTHD 2GDDA 1TALA 1C4U2 1C5QA 4WMEA 4MPVA 1QBOA 3B8JA 3H7OA 3S9AA 2FLRH 1HYLA 2A5IA 3PWBA 5DPAA 1CBWC 4DJZB 2ZECA 1NY22 3KGPA 3N7OA 4AOQA 8KME2 3SHAH 2AH4X 1GBKA 3VEQB 3RXKA 1DDJA 1UTKA 1A4WH 3TNSA 2BDBA 2ZU4A 1GMHG 2SGAA 3DFJA 4MNWA 1SGPE 2R2WU 1HAVB 2ZG0H 3PM3A 1V2UT 2GCHG 3A8CA 3DHKH 3NK8A 4KTSA 4DVAU 1O5CB 3M5NA 2F9UA 3BTWE 1AU8A 1EB2A 1CBWB 1QRZA 2HNTE 1ZOMA 1O3LA 3TH4H 1H9IE 1T8MA 3BEFB 2BZ6H 3BTTE 4U01A 2BD8A 3E0NB 3RU4E 1C5RA 1G3CA 1C1UH 2FOGA 4NSYA 5FCRA 1GDNA 3A89A 1C5MD 4HTCH 1LO6A 1ZJDA 1GMCF 2ZF0H 1IAUA 4IMZA 3SJIA 4BNRA 5FPSA 4ABAA 2A7CA 3M5LA 1ETRH 1C1QA 1TFXA 2BD2A 4MPUA 5EQRA 1QA0A 1GHZA 2Z94A 3BG4B 2G5NA 2QXHA 5T6DA 1OP0A 1BTZA 4IBLH 4Y0ZE 1Y3VA 4PROA 1UTJA 5A0CA 4A1TA 1C5XB 1ACBE 1EZXC 2ZGXH 3TJOA 3UTUH 1NFXA 2UWPA 3HK3B 1Y3XA 5H4IB 2YNBA 2BD5A 4X1SU 1LQDB 3U98H 2UUYA 1KY9A 2OXSA 4X8UH 5BPEA 1VJ9U 1GHXH 1FIWA 2DE9A 1SB1H 3TGKE 1ELGA 1TPAE 2ZCHP 3S9BA 1GBLA 1F2SE 4AG1A 3SV2H 3OU0A 4BTTB 1OKXA 1NO9H 1TA2A 1GDQA 2BQ7B 1WCZA 3PWCA 4ABHA 3KHVA 1FXYA 1DUAA 1FY5A 1P11E 5AVDA 2Z3CA 1HRTH 3DD2H 3ZVCA 3RC5A 1MBQA 2AMQA 1AHTH 1GJDB 3URCA 3UPEA 1J8AA 1F5KU 3P70B 2AGEX 2C8YB 1L1NA 1K9OE 3SU0A 2G51A 1LQEA 1FQ3A 2TPIZ 5FXLA 3H5CB 4MDSA 2GCTC 3TH3H