2HNTC

Crystallographic structure of human gamma-thrombin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
67
structure length
67
Chain Sequence
IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords GAMMA-THROMBIN
publication title Crystallographic structure of human gamma-thrombin.
pubmed rcsb
source organism Homo sapiens
total genus 5
structure length 67
sequence length 67
ec nomenclature ec 3.4.21.5: Thrombin.
pdb deposition date 1994-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2hntC00
1EATA 4J1YA 5GDSH 2BLQA 1A5HA 4BANB 1AO5A 1ZLRA 4SGBE 4JMYA 1LHDH 3AAUA 3RXUA 4NZQA 1F92A 2R3UA 1O2GH 3ELAH 3PLBA 3GY4A 1GL0E 1B7XB 1C1NA 2PW8H 1D3TB 2ZTZA 1GDUA 3OU0A 3TH4H 1DWCH 3SV2H 4AB8A 4FUJA 4RSPA 2VGCC 3MI4A 4YTAA 1HJAB 3GCOA 2UWPA 2PKSB 2SGAA 2V6NA 2BDBA 2O8TA 4ABJA 3ATWA 3ZZ5A 1ZR0A 4Z0KA 2Q1JA 4JCNA 2Z9GA 1T8OA 1HCGA 2ZU1A 4I8GA 3STIA 5CHAB 2FLBH 3C1KA 3O8RA 3K65B 4AFZA 2BD7A 2PWXA 1LDTT 1OP2A 3ESTA 2FOFA 3NXPA 1KXFA 1SGYE 2HPQH 4X6NA 4WXIA 2CF9H 1QNJA 3K9XB 1AZZA 2ZECA 2HPPH 2CGAA 1NFWA 1CGJE 2CXVA 5DGJA 3S0NA 3UR9A 2BVRH 4DGJA 2C8XB 3A8DA 3UY9A 1O2HA 1QY6A 2FX6A 1A3EH 1GG6B 1H8IH 3EA7A 2AGGX 2GMTB 2FI5E 1W7XH 1L0ZA 2A2QH 2RA0A 2VIDA 1TONA 2Z9JA 3KQEA 3TK9A 3STJA 4ABDA 3A82A 4MTBA 5JBAS 5LH8A 3DT0H 1KXEA 2AMDA 2W7UA 1GHXH 1WYKA 1O2MA 4AGKA 2ZGXH 1IQFA 1AQ7A 1KXBA 1F0TA 3Q3YA 2A7CA 2FOCA 3SU5A 1GMCG 1C5QA 2G5VA 3NZIA 4A7IB 3V0XA 1BTYA 2FS9A 4J2YB 4X1PU 2EA3A 3RUOA 4UFDH 1ZSKA 1LKBA 1PQ5A 1FN8A 1TQ0B 1MAXA 3RP2A 1DUAA 3A8AA 2AMPA 1KSNA 1IQHA 4MNWA 1AFQC 1QGFA 1AY6H 2FLRH 2Z7FE 3MYWA 1MH0A 2HLCA 3RU4T 3KIDU 5ESBA 4YT6H 3FANA 2EI7A 4X1SU 1YGCH 3U1IB 2FTMA 1GJ9B 2A2XH 2HWLB 1O2QA 3A88A 1SFQB 2VVCA 5GXPA 2A5KA 1SSXA 4OS1A 3A87A 1N6YA 1HLTH 4H6TA 2BQWB 4YOJA 3ZZ9A 4YZUA 4HGCA 4FU8A 6ESTA 1FJSA 1A5IA 1DE7H 4WF8A 3GY3A 2XNIA 3SV6A 3HPTB 3UQOA 3V7TA 1CT0E 3TPIZ 4Y6DA 1O31A 4GPGA 4Y8ZA 1GI5A 2OC8A 1SR5C 1UHBB 4FUCA 4D76A 2PV9B 4AOQA 1C5SA 4CBOA 3O8CA 1DT2A 4FVBA 1IQJA 1TGBA 1GI2A 1ABJH 3RXDA 1PFXC 2IOTA 4JYVH 3BTQE 1SC8U 3M5LA 3PMHB 3D49H 4CREA 2LPRA 5FBEA 3HKIB 4X0WU 1S84A 1DXPA 3RLYH 1TNGA 1SLXB 1Z1IA 4DIIH 2W3KA 1GI6A 1W12U 4WMEA 5A0BA 2C93B 1TMBH 5FHTA 1NRPH 5FCKA 3QX5H 1F5KU 3MWIU 1C2DA 3GCNA 1HJ8A 1EPTC 1O35A 1TX7A 3RMMH 1G3DA 4CHAC 3QZQA 1IQLA 1ZTLA 2QCYA 2HALA 2Y80A 1C5WB 1FPCH 1GJCB 1OYTH 1UCYE 1EB1H 1ANEA 2R3YA 3A7ZA 3QN7A 4ZKSU 1MCTA 3UOPA 2HVXA 3SHCH 4IGDA 2QF3A 1AVXA 3UNRA 2P93A 3ZVDA 1Y5AT 4YOIA 2XW9A 3A80A 1O3PB 2P8OC 3SZNA 2FXRA 3GY8A 2ZTYA 1Q3XA 4ABEA 4OGXA 3BEFB 1UTOA 1RJXB 3U9AH 4ABGA 1HNEE 3A7YA 1Y5UT 2PHBA 3RC6A 2ZGCA 2AIPA 1FQ3A 1QQUA 1G36A 1O3GA 1SB1H 4O3TA 1ZRBA 2ALPA 4Y10E 1X7AC 1HAYB 1AMHA 3UR6A 3M5MA 4FUGA 3CS7A 1ELBA 1W11U 1CO7E 3SUDA 2WYGA 1FLEE 1K1MA 3LH3A 3SNEA 1DY9A 1CT2E 4NZLA 3ZVAA 1V2PT 1VCWA 1BRUP 1EX3A 1E38B 2PTCE 3QO6A 1EKBB 3TH3H 1ELVA 1GDQA 1SGNE 2R2MB 1GI8B 1BMMH 1TGTA 3MHWU 1GBJA 2A0QB 1KLTA 4F49A 5EQSA 2OXSA 3E3TA 5TCAA 4THNH 4XSKU 1WU1A 2GT7A 1O2ZA 1TNHA 4VGCC 4ASHA 5IDKA 1BJVA 1EPTA 1AU8A 1OWJA 1TA2A 4BAHB 1GHBG 1N6XA 2QIQA 3TJUA 3NPSA 3LC5A 2OTVA 1BDAA 5A8YA 1ZYOA 2AEIH 4WVPE 1GGDC 1P06A 1EUFA 3A89A 1QRXA 4O9VA 1IQMA 1L4DA 2J2UA 2JKHA 2JETC 4E06H 1C2KA 1GL1A 2K1QA 3P8FA 3T2NA 4K2YA 2BY9X 1AKSA 2ZDNA 1RD3B 1P0SH 4R8TB 1O2OA 7ESTE 1DOJA 1THRH 2NWNA 1O5FH 2A7JA 1AB9B 1YKTA 3F68H 3AW1A 1HFDA 4FUDA 1GBIA 3LOXA 5GWZA 3JZ2B 1KXCA 1BTXA 1GBDA 4Y7AA 2BDYA 2BXUH 2GCHG 2QXGA 2YNBA 1XVOA 2VIQA 1ZJKA 1C5UA 1JMOH 2ZDLA 3RC5A 5LPEA 1ARCA 4KELA 1CHOG 3GYMA 4B1TA 2UUJB 3MO3A 4DY7B 2GV6A 1P9UA 1O3BA 3GCHC 1GHYH 2V35A 1TPOA 1OP8A 5A0AE 1NC6A 2Z94A 1CGHA 3MH7A 5FPYA 5E0GA 2G00A 3SV9A 1K21H 3G01A 4BAKB 1NPMA 1HIAA 2ANKH 4UEHH 1UO6A 3PB1E 3RXOA 4NWKA 3M7QA 3LGWA 1HAZB 1D3DB 3DFJA 2XTTB 2FDAA 1ANDA 4CRBA 2RDLA 1GMDG 4E7NA 5FCRA 3RU4D 1YPKH 5B6OA 2P3UB 2QGRA 3MU4A 3BV9B 3GDSA 3SNCA 4MG3A 1WTHD 5A8ZA 1RIWB 4E05H 2F9PA 1O5BB 2A32A 3SU2A 6CHAC 2FYQA 3OSYA 1BQYA 2O8WA 4ZHMU 1GJ6A 1SHYA 2G5NA 1T8LA 1P2QA 4BAMB 1Y3WA 1O3LA 1LTOA 4GVUA 5EW1H 4I8JA 4JZIA 5LGOA 2XBYA 1O0DH 3ZVCA 1WSSH 5EQQA 3QZRA 3LH1A 3ZV9A 1MKXH 1CA0B 1LHFH 4ISOA 3RXAA 1S85A 3HKJB 3MU8A 3ATLA 3TGIE 4FXGH 1D6WA 1N1LA 5EXLA 2IJOB 2J9NA 5E2OA 3RMNH 3LONA 4ZXXH 1FY4A 2ALVA 4BTTB 3MH6A 5IYTA 3WY8A 2FI3E 5BRRE 3F6UH 4GCHF 1TRYA 1GDNA 1FDPA 2ESTE 2ODQA 2UUYA 3QTVH 1BTHH 3H7OA 4KTCA 2XYAA 4FU9A 5C1UA 2ZHEH 1NT1A 3BTDE 4ISNA 1ETTH 4KP0A 1O2IA 2PGBB 1SGFA 3QGJA 3P17H 4NSVA 1GJ4H 5E8EH 3MO9A 1C1UH 1C2JA 1S6FA 1BCUH 1C9TA 3SGQE 1MTNB 1TB6H 1UJ1A 1KTTB 2F9BH 2P3TB 2C90B 1ZTKA 1CSOE 1OS8A 4U30A 2KAIB 2Z3DA 1NM6A 1GBCA 1AUJA 1C1RA 1C5TA 4IN1A 1ZMLA 7GCHF 3OY5U 1GJBB 4NFEA 4OS7A 1BIOA 2AGIX 2VIVA 2OC0A 4O97A 2Q6DA 1VCQA 1E0FD 2WPLS 4IMZA 3SUFA 1KIGH 3AVZA 3TU7H 3KGPA 2TGAA 4O3UA 1EASA 2J4IA 2GX4A 1VITH 1C1MA 3EGKH 5TJXA 3LKWA 4AG2A 2ZDKA 2W26A 1J16A 3RM0H 4YESB 2ZGBH 1YLDA 2BLWA 2FM2A 1V2MT 3RXBA 2AFQB 5GIBA 1ZPBA 1CT4E 3F1SB 1QL8A 1UK4A 3URCA 1A0JA 2ZG0H 1OWEA 3CS0A 3BEUA 2CMYA 2W3IA 1ORFA 3DUXH 1TGCA 4DG4A 1BTZA 1HUTH 1C5MD 2F9OA 1GI3A 4A6LA 3PO1C 5DKMA 3LJOA 3VB5A 1V2LT 4A5TS 2F83A 4YLUA 3SJOA 2IPHA 6GCHG 4BTIB 1QCPA 4B2CA 4BOHA 3TNSA 3E8LA 2FP7B 1OP0A 3MFJA 1G3BA 1UK2A 2CN0H 3SQEE 1S0QA 3PLPA 1SGEE 3ATIA 1IQGA 4RKJB 4CRGA 3BIVH 1O2KA 3DD2H 3U8RH 1O2RA 4LOYH 3KHVA 4HFPB 1QTFA 3LT3A 4XOJA 5F6MA 1XUFA 1YP9A 1LHEH 3SGBE 1TGNA 4WH6A 3T28A 1G2MA 5FAHA 4I31A 4XDEA 1SQTA 1GCTC 3HGPA 4Y79A 2BMGB 2PUXB 2BY7X 1DUEA 4B73A 3DA9B 1HAXB 1ZGIA 4ZAEA 2GCTC 4AN7A 4LXBH 1GHWH 1TALA 1FIZA 2G55A 1IOEA 3SOSA 3CENA 8GCHG 2XCFA 1PQ8A 1Y3UA 1H9LB 1G32B 1ETSH 1A7SA 3PV4A 1ZGVA 1HPGA 3RXTA 2WUBA 1KXDA 1MKWK 4B76A 4K8YA 2A4QA 5EU8A 1O2YA 5C5NA 3RXCA 1BITA 2ZI2H 4AFUA 3SU3A 1QURH 2QN5T 3IG6B 1GMCF 3M3TA 2BB4A 4D8NA 2PKSC 4U01A 1LMWB 1FY3A 1QBVH 5E0HA 1NFYA 5AFZH 4XBBA 3SW2B 1E36B 2ZHFH 1NFUA 4IW4E 1A0HB 1FN6A 2A45B 3EQ0H 1SLWB 1T31A 2SGPE 4GHQA 2ZTXA 3NK8A 2FOBA 1P12E 2BDHA 1F7ZA 4Y8XA 4ZKRU 4F4OC 1FV9A 2Y81A 1TAWA 2BHGA 1KDQA 1UVOA 2FX4A 3P8OA 4NWLA 3SI3H 1ARBA 3T5FH 3ODDA 2GZ9A 2VGCB 1C2MA 2GZ8A 1BMAA 4FVDA 1HV7A 1TIOA 2M5TA 3Q77A 1XUGA 3PLKA 3MH5A 1BTUA 2FTLE 1GG6C 2VWMA 4Q7XA 2BD5A 1O33A 1RXPA 1T8NA 2ZNKH 5EODA 5G4BA 3LDXH 4IMQA 1AVGH 1H4WA 1ELAA 1P04A 2NU4E 2ANMH 1PPCE 2R9PA 1GI9B 1ESTA 2BX3A 4WMFA 2VB0A 2FOHA 2P59A 3V13A 2C8ZB 1TMUH 4NSYA 1YBWA 2P94A 3MNSA 1MZDA 1YF4A 2BD3A 2NU3E 4CRFA 3FVFB 2W7SA 5L6NH 1NRRH 1EB2A 4A1VA 2ZO3H 1HXEH 1WQVH 1DVAH 2ZEBA 1BBRK 4ZROA 1B5GH 3MNXA 1EAUA 2AYWA 4OS6A 1H9IE 1QHRB 1IQIA 3BTTE 3BTHE 2DE9A 1UK3A 2TPIZ 3UOUA 3SV7A 3VXEH 3RC4A 3UQVA 3R3GB 3O8DA 1NN6A 2BYAX 1O2UA 1IQEA 4AZ2B 1GJ7B 1S6HA 5DG6A 3RXKA 2ZU4A 1DDJA 1D9IA 1WTGH 2PLXA 3ATMA 2QXHA 3BTME 3QDZB 2BDIA 1BMNH 1UTNA 4YO9A 1T4VH 2BVXH 2WYJA 1EXFA 2D2DA 2ZHDA 4UFEH 2BXTH 2I6SA 4ABHA 1LKAA 3PMAB 1O2VA 3URDA 3GOVB 4MNXA 1SHHB 2FIRH 4Y0YE 3BG8A 1UTPA 1QB9A 3NUMA 1DWBH 1P57B 3DHKH 5JBBS 4Y0ZE 1FNIA 1AHTH 4TWWA 4AB9A 3UNQA 1ELFA 3A83A 2ZGHA 4NA7A 2CF8H 1C5XB 2ZU5A 3FP6E 5HM9A 1GHZA 1RRKA 1DLKB 3VB6A 3H7TA 1K22H 1CGIE 3KCGH 2QXJA 3ZZCA 4DCDA 1ACBE 1VZQH 1ZZZA 1OPHB 4CH2B 4D7GA 4LK4A 3ZYDA 1HAIH 3LU9B 1C5ZB 3SGAE 3GY2A 4BAOB 1SFIA 3BG4C 1LQDB 2JH6D 3F9GA 4TPIZ 2ZCHP 1K9OE 4X1QU 1HAOH 3TIUA 4BAQB 2D26C 1VGCC 1GHBF 1SGDE 1EAXA 1UVPA 2RG3A 1NESE 2AIQA 1CBWB 3I78A 2I6QA 4TYDA 1FUJA 3ZZ6A 4Q80A 1C1QA 2P3FH 3UFAA 1J9CH 1ZMJA 1EPTB 2FOAA 1IQNA 4CHAB 3SJIA 1F5RA 3Q3KA 2ODYB 2OLGA 2BQ7B 2Q6GA 1E37B 1V2JT 5FX6A 1XXDA 1JOUB 3A85A 4XE4A 3MMGA 1ELDE 1RTLA 2RA3A 4MDSA 1PYTC 3RXEA 2ZIQH 3ZYEA 1TA6A 2TGTA 1C5VA 1UVTH 1C2HA 2P8OB 4KTUA 3SO3A 1GPZA 1HRTH 1K1IA 2ZFPH 1PPFE 1SL3A 3T62A 1TE0A 4JZ1A 1Y3YA 3GDUA 1DX5M 2SFAA 1AKSB 4TWYA 3M3SA 3LGIA 3M7UA 3SNDA 1YPGH 1XX9A 2A1DB 4NGAH 1Z7KA 2GCHF 2GT8A 3VXFH 3VGCB 4AFQA 1CHOF 2J34A 3FZZA 2Z3EA 4D9QA 3TGJE 1QL9A 1EOJA 1GI4A 4MLFB 1MAYA 1CA8B 1A61H 3BEIB 4MPWA 4TY6A 2Y5GA 3CP7A 1P10A 4X8SH 4INLA 1F2SE 5T6DA 2SGFE 1MBMA 1V6DA 3ZVFA 1QR3E 5DK1A 1Y3VA 3UPEA 2SNVA 2FODA 3KEEA 3SJKA 2PFEA 2NU0E 3U8OH 3S9BA 3ZV8A 5C5OA 1A1RA 1ZHMA 2THFB 3M5NA 1UTLM 1HGTH 1MD8A 1VITG 3FP7E 3SN8A 1QL7A 1HIAB 2VVUA 1NY22 2ZFTA 1TRNA 3MH4A 1S0RA 1GMDF 1AGJA 1BBRE 3SUEA 1KY9A 2B8OH 1C5LH 1HB0B 5JBCS 3TH2H 1O3KA 1P8VC 1YCPH 2H9EH 1GMHG 1Q31A 2J94A 3AAVA 1H9HE 1TPAE 4I8HA 1ABIH 1AE8H 2ZCKP 1O5GH 1AB9C 3BSQA 3IITA 4ABFA 4JYUH 4DT7B 4HZHA 3F9FA 3V3MA 3GCTG 2CHAB 1OYQA 1GGDB 4ZH8A 1Z6EA 3VB7A 5DP3A 4IC6A 2PR3A 2RCEA 3IWMA 4IS5A 3S7KB 5GCHG 4X6MA 2JETB 4NA9H 5C2ZA 1YPEH 4GAWA 2SNWA 3KL6A 1GCDA 2AERH 2OCVB 4CBNA 5ABWA 1P2JA 1GI0A 1XKBC 2R0KA 1S81A 2OC1A 1FAXA 5AHGH 3RU4E 1P2IA 2WINI 1EZQA 1HXFH 2ZHWH 1INCA 2XWBI 5DP5A 4HTCH 1FPHH 2EI6A 2Y5HA 3TK5A 1YPHC 4CRAA 1KYNA 3D65E 2ZFSA 5JYIA 3PTNA 1SGIB 2R2WU 2ASUB 1BTPA 3TJNA 1RFNA 1RS0A 1JXPA 5F8XA 5GJ4B 3OY6U 2BLOA 2F9NA 4MVNA 2AMQA 3GCHB 4KTSA 7KMEH 2PTNA 1SGCA 1YPLH 1Z8JB 1SOTA 2BTCE 3T27A 1L2EA 1TFXA 1OWIA 1UMAH 1P01A 1UTJA 2BD9A 2G4UA 4B2BA 2A4GA 2FOEA 2ILNA 2OBOA 1N8OB 3ZZ3A 2FWWA 4WMDA 2EEKA 5J4QA 4Q2KA 4I33A 3A7TA 5JB9S 2ZP0H 4D7FA 3SNAA 1FONA 4WWYA 2P16A 5F8ZA 1BUIA 1GI1A 1TNLA 1MUEB 2VINA 1P2OA 3ATKA 3L6PA 3S69A 2HNTC 5DP8A 1NRQH 1YC0A 3HK3B 1EAIA 4NIXA 4B74A 4CH8B 1O5AB 3NWUA 1QFKH 4ZXYH 3BIUH 1SLUB 3LPRA 2QF0A 2SGDE 5T3HA 2OQ5A 3LIWA 1WCZA 2ZC9H 4X8VH 6CHAB 1AN1E 1GVLA 1UCYH 1P09A 2H5CA 1PYTD 1OWHA 4AYYB 2OP9A 1YPJH 1DITH 3E1XB 1MMJN 3M37A 3LGYA 4DJZB 4AFSA 2XC4A 1FAKH 3RMLH 3EDXB 1IHTH 2VNTA 4X1NU 3RM2H 1TABE 5EQRA 1W2KH 1W13U 3NKKA 6GCHF 1SBWA 1OX1A 5F8TA 3ZVBA 4DIHH 3VB3A 1O3EA 1O2JA 2IN2A 3L33A 2G4TA 3SU1A 1CU1A 2Z9IA 5CMXH 2SGQE 2YOLA 1AZ8A 1DSTA 1NU7B 2OINA 2ZFRH 2FPZA 5L2YH 3M35A 4LZ1H 4JK6A 4CR9A 5DP7A 1WUNH 4JZFH 1UVSH 1L4ZA 3SNBA 2Y82A 1AWFH 3VEQB 1EJMA 1SLVB 2XWAA 4Y7BA 1S5SA 2VJ1A 2BX4A 3A84A 3Q00A 1WBGB 1KXAA 1GJAB 1AUTC 2OQUA 1SPJA 2G52A 3U1JB 2ANWA 1QA0A 1RGQA 2Z3CA 5FBIA 4YM9A 2SGEE 1THPB 3KQBA 3HK6B 3B8JA 4CRDA 4Q7YA 1YCPK 1TQ7B 3I77A 8GCHF 2VH0A 3A7XA 1TWXB 3ZZBA 1C1TA 2AS9A 2F9UA 2Y7XA 3SI4H 5C20A 1P05A 4SGAE 1DSUA 1V2OT 2HNTF 1IHSH 1V2ST 2FI4E 3VFEA 3BTKE 1T8MA 4NCYA 3RXQA 1SG8B 1C5NH 5HGGA 1O3FA 1TX8A 3S7HB 4MPXA 4NG9H 5JDUB 7LPRA 3B9FH 2ZQ2A 1ELEE 9ESTA 4NIWA 2ZU2A 1C1SA 4AORA 3Q76A 2UUKB 2BY6X 3HGNA 1Z8RA 2V3OH 1EJAA 1Z6JH 4ISHH 4FUFA 1GVKB 3K6ZA 5T6FA 1AIXH 1O39A 1FY5A 4GUXA 1S83A 3TJOA 3NCLA 1O2NA 3KF2A 4QT8C 3MU5A 1XXFA 1GJ5H 1Z71A 3PO1B 2GGVB 2ZDVH 3BTGE 1A5GH 2PKAA 1MTVA 2LNCA 4Y8YA 8LPRA 1LVMA 2ZDMA 4JZDH 2FEQH 4ZKOU 3VPKA 1K1NA 2Z9LA 4UONA 1K1PA 1C1OA 1WOFA 2VWNA 2DE8A 1KLJH 2BOHB 1GHAG 3P6ZB 1J15A 5DPAA 1GI7B 4X8TH 4RN6A 3U8TH 2HNTE 4MQAA 4M7GA 3N7OA 1MQ5A 1FI8A 1DWDH 4ZKNU 2HRVA 3MNBA 1G37A 1KDQB 1HDTH 3E90B 5H4IB 2XXLA 3TVJB 3M61U 1W8BH 4Z6AH 2QAAA 1F0RA 2BZAA 2D8WA 1WQSA 1O3JA 2H1UA 2Y7ZA 3LGVA 3TNTA 1GCTB 1LVBA 3SJ9A 4H42U 4H6SB 2Y5FA 1OKXA 1EP6A 4R0IA 3LGTA 1TOCB 2CV3A 4JZEH 4X6OA 1GHVH 2GCTB 2A4RA 3FP8E 4K8BA 3SORA 2A31A 1V2RT 2BQ6B 2DUCA 2C8WB 1UTMA 3F9EA 1C2EA 1FZZA 1MKXK 1YYY1 4I7YH 2QY0B 3C27B 1P11E 5LPRA 3LC3A 4ABAA 3GDVA 1O2PA 4ZUHA 1HJAC 3RXHA 1FY8E 4MNVA 5EGMA 5FPSA 1O3AA 2TRMA 5ETXA 4BXSA 1UCYK 4INHA 2OBQA 1A0LA 2ZWLH 2A7HA 1W0ZU 2VWLA 5CHAC 2UWOA 2GP9B 2B9LA 3K6YA 2OD3B 1XUIA 3PMBB 5L30H 1AE5A 4PROA 1O32A 1BRBE 3TJVA 1ESAA 1G2LA 1M9UA 4NIVA 3HATH 5EG4A 1GVZA 2VIOA 3T25A 1BA8B 2XBWA 2QC2A 2UUFB 1FIWA 1C4V2 1GJDB 1HAVA 4X2WA 1W10U 2WUCA 3RXMA 4KKDA 1O5DH 3V12A 2XBXA 2ZDAH 1JIRA 2ZHQH 2ZPSA 3UNSA 1LO6A 1TLDA 1SGQE 2D1JA 2GMTC 1J14A 4UFFH 2A4OA 5HXFA 4I8KA 3S9CA 5CE1A 3FAOA 1AI8H 2BD8A 1FXYA 1PQ7A 5C1YA 3MNCA 1J17T 1D6RA 1TNKA 3FFGA 1NS3A 4A1TA 1K1LA 2ZQ1A 1O3CA 3F9HA 1ELTA 2ZF0H 1JBUH 1WV7H 2TIOA 3PYHA 1O36A 1DM4B 1YLCA 3A8BA 2BD4A 1EQ9A 1SGPE 1UVUH 1TNJA 4X8UH 3ENSB 5BPEA 4DOQA 2ZU3A 2VH6A 4UE7H 1CE5A 4Y71A 3SU0A 3W95A 4IN2A 3ZZ4A 1AD8H 3TK6A 1GBEA 4WY3A 3QK1A 1K2I1 4DURA 3KQCA 5L2ZH 1BT7A 1TRMA 3OX7U 1MD7A 1O2TA 2ZKSA 1Y3XA 3RXSA 1O3MA 2FO9A 1C2FA 1O3HA 1B0EA 3M5OA 1IAUA 1DS2E 3GISB 3U69H 1MU6B 2W5EA 2GDEH 1ELGA 3L3TA 1TPPA 3E6PH 1H8DH 1C5PA 3W94A 3SU4A 3BF6H 4O03A 1AFQB 1O2WA 4NA8A 2A5IA 2BOKA 4IBLH 4U2WA 1F0SA 4LZ4B 2XBVA 4WXVA 1QJ1B 2QYIA 3LGUA 4FUIA 2A5AA 3M36A 3QLPH 5FX5A 4ABBA 3P8NA 3PWCA 1D4PB 1V3XA 1ZPCA 4ZHLU 1P2NA 2GDDA 1QBOA 1QQ4A 2OUAA 3PMJA 4Q7ZA 4X2XA 3BTEE 3M3VA 2GZ7A 2BD2A 4XBDA 8KME2 2STAE 1JRSA 1OOKB 5JBTA 5PTPA 1PPHE 1G9IE 1O2SA 1O2LA 3RXIA 1PPGE 1BHXB 1HJ9A 2VU8E 1F5LA 2H9TH 3KN2A 3QTOH 2ZFQH 3A86A 1O3IA 5EOKA 4YT7H 1P03A 4KGAA 3SV8A 3P70B 4HI3A 3UUZA 3TLOA 2TBSA 1G30B 1KTSB 4K5ZA 2GV7A 1V2WT 5A2MH 1V2TT 1OSSA 4YLQH 4NIYA 1Y8TA 2ULLA 3SQHE 1EZSC 1TNIA 4ABIA 3A81A 1C1PA 1D3QB 1ZMNA 1SOZA 4DW2U 3DFLA 4BNRA 1GBBA 3UREA 9LPRA 2AGEX 1CBWC 2ZA5A 3P92A 3ZVGA 3GYLB 3ZZ7A 1F0UA 3QWCH 4RKOB 2GTBA 3RXVA 1AVWA 5LPFA 1V2VT 1WAYB 2G8TA 2ZGJA 4MPVA 4BTUB 1IQKA 3MOCA 1VITF 1LPZB 2ZPRA 1SGRE 2VIWA 1ZTJA 1BOQA 1EAWA 1CVWH 1QRWA 3BG4B 1C1WH 3KQDA 1E35B 1TYNA 1UTKA 1ZSLA 5JB8S 5DJ7A 1G3CA 2BM2A 5I25A 5HM2A 1UHBA 1VGCB 1GMHF 2JH5D 2QXIA 1P2MA 1RTKA 3ZVEA 3RDZA 1Z8IB 3GY5A 5SGAE 1HAPH 2VVVA 3GCTF 1ZHPA 1LPKB 1P2KA 1BHXF 1OWDA 3M7TA 1HYLA 5C3NA 3ZZ8A 3SUGA 5GCHF 3TGKE 4AG1A 1QB6A 3VGCC 5E0JA 1TBRH 2O8LA 1VJ9U 3SHAH 3QGNB 1A3BH 1W0YH 1LQEA 4K60A 3E0PB 1DXWA 4ISIH 4X2VA 2H6MA 1XUJA 1SQAA 3UWJH 3EAJA 5C1XA 3MTYA 1OXGA 2H9HA 1K28D 1O34A 1MBQA 2AH4X 1BB0B 1A46H 1JWTA 3H5CB 1ZPZA 1E34B 3EE0B 1MCVA 1O3OA 2C4FH 5EPNA 1EP5A 1XVMA 4OS2A 5DP4A 5FPTA 4ZHAA 1EZXC 3RLWH 1VR1H 2F9VA 4TY7A 2WV4A 1BMLA 1LVOA 1QIXB 2GKVE 4X1RU 1D3PB 3A7VA 2PSXA 3EA8A 3U98H 3LJJA 5AVDA 5GPIB 4VGCB 2BLVA 4UD9H 1AWHB 1JRTA 3UIRA 1MTUA 4K1SA 4Y11E 1VJAU 2QA9E 3BTFE 1QBNA 3E16B 3PTBA 4INKA 4K3JA 2CHAC 1GWAA 5A8XA 3RXRA 2TGPZ 1C5OH 4FUHA 4DVAU 5AF9H 1NTPA 2PGQB 2C8YB 2J38A 4UFGH 2UWLA 4IC5A 1GBMA 1RTFB 2TGDA 2BVSH 1SMFE 2GD4B 1C5RA 3AASA 3RXGA 5DO4H 5AFYH 1NO9H 1YM0A 2V3HH 3MO6A 1QRZA 1TMTH 1ELCA 4OGYA 4ISLA 1A4WH 1FMGA 2STBE 1H1BA 1HAGE 3K2UA 1PPBH 1HAHH 1Z1JA 5EXNA 3RMOH 2VIPA 1HBTH 1MU8B 3SBKA 3E0NB 1PQAA 2G51A 3JZ1B 1K1JA 5I46H 2F91A 1MZAA 3GY6A 2WV5A 3RXFA 1TBQH 2BY8X 1O37A 4Y76A 2EC9H 1DFPA 1ID5H 3ITIA 2Z6BD 1Y59T 2B5TB 3A8CA 3EA9A 1FY1A 1SI5H 1ANBA 5K0HA 1PJPA 4CR5A 1L1GA 4NFFA 1ETRH 2BY5X 1CHGA 2XCNA 1PPZA 1TPSA 1N8OC 1XMNB 1LVYA 2YNAA 1T32A 1DY8A 3OTJE 2EI8A 4I8LA 4UDWH 4AX9H 3OYPA 4FU7A 1RIWC 3GY7A 6LPRA 8ESTE 3P8GA 2JH0D 5C67A 5A0CA 3KNXA 4XFQA 1C4Y2 1MTWA 2HGTH 5FXLA 1W7GH 2WPHS 1XKAC 1NRNH 1G3EA 1NU9A 2O8UA 3ZZAA 3PROA 2ZFFH 2Y6TA 5DP9A 1C2IA 1GBTA 1CA0C 2WPMS 3D23A 4BXWA 1DWEH 2FS8A 1GBHA 1GBAA 1DICA 4I32A 3T29A 1T4UH 4WH8A 3RXLA 1U6QA 1K1OA 3GICB 3P95A 5J4SA 1A2CH 1C9PA 1MKWH 4FUBA 2O8MA 1B0FA 1JIMA 3S9AA 5A09A 1EOLA 1NROH 2PSYA 2NU2E 4A1XA 1L1JA 1O38A 1MTSA 3SJ8A 2P95A 1TGSZ 1MQ6A 2PUQH 4FUEA 4GLYA 1O5EH 2FZZA 1NRSH 5K7RA 3FZDA 1MTNC 1O3NA 4JK5A 1KLIH 2FOMB 1BTWA 2XC5A 4OS5A 4D9RA 4H4FA 1YPMH 2R0LA 3EYDA 1GJ8B 1P9SA 2Q6FA 1J8AA 1LHGH 2FYRA 4U32A 1VCPA 1THSH 1QJ7B 5E2PA 1TOMH 2ODPA 2XRCA 5EW2H 1W3CA 1C1VH 1YCPM 1L1NA 1BRAA 4A92A 1ZHRA 2H2ZA 1P3CA 4ZMAH 1UTQA 4YOGA 3SU6A 3QUMP 1ZSJA 1O2XA 1LPGB 1S82A 2J92A 2B0FA 1P02A 1GBKA 3RXPA 3VB4A 1GHAF 4K1EA 2GVFA 1OWKA 1XUHA 3BTWE 1QA7A 3Q3XA 1SGTA 3ODFA 2PKAB 4CRCA 4OS4A 1GBLA 2FMJA 4TPYA 3MU1A 1AFEH 5HMAA 4WJG2 2BZ6H 2WPJS 1O30A 2BDCA 2FESH 1EJNA 1XUKA 3T26A 1LCYA 3O8BA 4K1TA 1BZXE 4JYTA 2CJIA 2F3CE 1YPHE 4AYVB 1DPOA 2G81E 1V2KT 1DANH 1ZOMA 5EXMA 1ZJDA 2WPIS 4B75A 1V2UT 1SVPA 3BN9A 1C2GA 5EPYA 4GCHG 2FOGA 4B2AA 3E91A 2VWOA 2BDAA 3PWBA 5HYOA 2XC0A 4MPUA 1BBRH 3RXJA 2H5DA 1SQOA 1QJ6B 1NFXA 3UTUH 3B23B 2KAIA 1TBZH 1Q2WA 2ZPQA 1V2NT 4XBCA 2ZCLP 2C3SA 2O9QA 5T6GA 1SGFG 3UWIA 1T7CA 5TCCA 1Y5BT 1C5YB 1O3DA 5JPMH 3TITA 2OC7A 5F03A 1PPEE 3I29A 1ESBA 2ANYA 4GSOA 4E7RG 1DLEA 1W14U 7GCHG 2NU1E 1Z8GA 3D62A 4K69A 1LHCH 4X6PA 1TX6A 1HAVB 1CQQA 1XM1A 4MNYA 1C4U2 1P3EA 4ESTE 1V2QT 1BRCE 1QB1A 4B71A 5ESTE 2V0BA 5DP6A 1BJUA 1ZRKA 2B7DH 2WPKS 2J95A 3ZZDA 3AW0A 3A7WA 3R0FA 1O5CB 1GBFA 2HOBA 2QV1A 2Z9KA 1NZQH 2BDGA 2ZZUH 4AGJA 3PM3A 1ANCA 4GHTA 1C2LA 4X2YA 3MU0A 1EZUC
chains in the Genus database with same CATH superfamily
1EATA 4J1YA 5GDSH 2BLQA 2HVYB 1A5HA 4BANB 1AO5A 1ZLRA 4SGBE 4JMYA 1LHDH 3AAUA 3RXUA 4NZQA 1F92A 2R3UA 1O2GH 3ELAH 3PLBA 3GY4A 1GL0E 1B7XB 1C1NA 2PW8H 1D3TB 2ZTZA 1GDUA 3OU0A 3TH4H 1DWCH 3SV2H 4AB8A 4FUJA 4RSPA 2JJ1D 2VGCC 3MI4A 4YTAA 1HJAB 3GCOA 2UWPA 2PKSB 2SGAA 2V6NA 2BDBA 2O8TA 4ABJA 3ATWA 3ZZ5A 1ZR0A 4Z0KA 2KCPA 2Q1JA 4JCNA 2Z9GA 1T8OA 1HCGA 2ZU1A 4I8GA 3STIA 2V3MA 5CHAB 2FLBH 3C1KA 3O8RA 3K65B 4AFZA 2BD7A 2PWXA 1LDTT 1OP2A 3ESTA 2FOFA 3NXPA 1KXFA 1SGYE 2HPQH 4X6NA 4WXIA 2CF9H 1QNJA 3K9XB 1AZZA 2ZECA 2HPPH 2CGAA 1NFWA 1CGJE 2CXVA 5DGJA 3S0NA 3UR9A 2BVRH 4DGJA 2C8XB 3A8DA 4FOUC 3UY9A 1O2HA 1QY6A 2FX6A 1A3EH 1GG6B 1H8IH 3EA7A 2AGGX 2GMTB 2FI5E 1W7XH 1L0ZA 4B6FA 2A2QH 2RA0A 2VIDA 1TONA 2Z9JA 2WPDD 3KQEA 3TK9A 3STJA 4ABDA 3A82A 4MTBA 5JBAS 3OEHD 5LH8A 3DT0H 1KXEA 1BMFD 2AMDA 2W7UA 1GHXH 1WYKA 2QE7D 1O2MA 4AGKA 2ZGXH 1IQFA 1AQ7A 1KXBA 1F0TA 3Q3YA 2A7CA 2FOCA 3SU5A 3SYJA 1GMCG 1C5QA 2G5VA 3NZIA 4A7IB 1WXRA 3V0XA 1BTYA 2FS9A 4J2YB 4X1PU 2EA3A 3RUOA 4UFDH 1ZSKA 1LKBA 1PQ5A 1FN8A 1TQ0B 1MAXA 3RP2A 1DUAA 3A8AA 2AMPA 2J98A 1KSNA 5EJLA 1IQHA 4MNWA 1AFQC 3NRLA 1QGFA 1AY6H 2FLRH 2Z7FE 3MYWA 1MH0A 2HLCA 3RU4T 3KIDU 5ESBA 4YT6H 3FANA 3VG8A 2EI7A 4X1SU 1YGCH 3U1IB 2FTMA 1GJ9B 2A2XH 2HWLB 2HLDD 1O2QA 3A88A 1SFQB 2VVCA 5GXPA 2A5KA 1SSXA 4OS1A 3A87A 1N6YA 1HLTH 4H6TA 2BQWB 4YOJA 3ZZ9A 1NBMD 4YZUA 4HGCA 4FU8A 6ESTA 1FJSA 1A5IA 1DE7H 4WF8A 3GY3A 4F55A 2XNIA 3AK5A 3SV6A 3HPTB 3UQOA 3V7TA 1CT0E 3TPIZ 4Y6DA 3OTPA 1O31A 2KCYA 4GPGA 4Y8ZA 1GI5A 2OC8A 1SR5C 1UHBB 5DSFA 4FUCA 2KX4A 4RI0A 2PV9B 4D76A 4AOQA 1C5SA 5EJZA 4CBOA 3O8CA 1DT2A 4FVBA 1IQJA 1TGBA 1GI2A 1ABJH 2IPQX 3RXDA 1PFXC 2IOTA 4JYVH 3BTQE 1SC8U 3M5LA 3PMHB 4I86A 3D49H 4CREA 2LPRA 5FBEA 3HKIB 4X0WU 1S84A 1K0HA 1DXPA 3RLYH 1TNGA 1SLXB 1Z1IA 4DIIH 2W3KA 1GI6A 1W12U 4WMEA 5A0BA 2C93B 1TMBH 5FHTA 1NRPH 5FCKA 4DT4A 3QX5H 5GNDA 1F5KU 3MWIU 1C2DA 3GCNA 1HJ8A 1EPTC 1O35A 1TX7A 3RMMH 1G3DA 4CHAC 3QZQA 1IQLA 1ZTLA 2RDEA 3F0OA 2QCYA 2HALA 2Y80A 1C5WB 1FPCH 1GJCB 1OYTH 1UCYE 1EB1H 1ANEA 2R3YA 3A7ZA 3QN7A 4ZKSU 1MCTA 3UOPA 1KMHB 2HVXA 3SHCH 4IGDA 2QF3A 1AVXA 3UNRA 2P93A 3ZVDA 1Y5AT 4YOIA 2XW9A 3A80A 1O3PB 2P8OC 4YXWD 3SZNA 2FXRA 3GY8A 2ZTYA 1Q3XA 4ABEA 4OGXA 3BEFB 1UTOA 1RJXB 3U9AH 4ABGA 1HNEE 3A7YA 1Y5UT 2PHBA 3DCLA 3RC6A 2YMSB 2ZGCA 2AIPA 1FQ3A 1QQUA 1G36A 1O3GA 1SB1H 4O3TA 1ZRBA 2ALPA 4Y10E 1X7AC 3OE7D 1HAYB 1AMHA 3UR6A 3M5MA 4FUGA 3CS7A 1ELBA 1W11U 1CO7E 3SUDA 2WYGA 1FLEE 1K1MA 3LH3A 3SNEA 1DY9A 1CT2E 4NZLA 3ZVAA 1V2PT 1VCWA 1BRUP 1EX3A 1E38B 2PTCE 3QO6A 1EKBB 3TH3H 1ELVA 1GDQA 1SGNE 2R2MB 1GI8B 1BMMH 1TGTA 3MHWU 1GBJA 2A0QB 1KLTA 4F49A 5EQSA 2EY4C 2OXSA 5EIYA 3E3TA 5TCAA 4THNH 2VBCA 4XSKU 2K8IA 1WU1A 2GT7A 1O2ZA 1TNHA 4VGCC 4ASHA 5IDKA 1BJVA 1EPTA 1AU8A 3F2HA 1OWJA 1TA2A 4BAHB 3N99A 1GHBG 1N6XA 2QIQA 3TJUA 3NPSA 3LC5A 3OEED 2OTVA 1BDAA 5A8YA 1ZYOA 2AEIH 4WVPE 1GGDC 1P06A 1EUFA 3A89A 3F0PA 1QRXA 5HIZA 4O9VA 1IQMA 1L4DA 2J2UA 2JKHA 2JETC 4E06H 3DSGA 4ACAA 1C2KA 1GL1A 2K1QA 3P8FA 3T2NA 4K2YA 2BY9X 1AKSA 2ZDNA 1RD3B 1P0SH 4R8TB 3UB0A 1O2OA 7ESTE 1DOJA 1THRH 2NWNA 1O5FH 2A7JA 1AB9B 1YKTA 2F43B 3F68H 3AW1A 4RT0A 1HFDA 4FUDA 1GBIA 3LOXA 5GWZA 3JZ2B 4TT3D 1KXCA 1BTXA 3PRBA 1GBDA 4Y7AA 2BDYA 2BXUH 2GCHG 2QXGA 2YNBA 1XVOA 2VIQA 1ZJKA 1C5UA 1JMOH 3WW7A 2ZDLA 3RC5A 5LPEA 1ARCA 4KELA 1CHOG 2KM0A 3GYMA 4B1TA 2UUJB 3MO3A 4DY7B 2GV6A 1MABB 1P9UA 1O3BA 3GCHC 1GHYH 2V35A 1TPOA 1OP8A 5A0AE 1NC6A 2Z94A 3PV2A 1CGHA 3MH7A 5FPYA 5E0GA 2G00A 3SV9A 1K21H 3G01A 4BAKB 1NPMA 1HIAA 2ANKH 4UEHH 1UO6A 3PB1E 3RXOA 4NWKA 3M7QA 3LGWA 1HAZB 1E79D 1D3DB 3DFJA 2XTTB 2FDAA 1ANDA 4CRBA 2RDLA 1GMDG 4E7NA 5FCRA 3RU4D 1YPKH 5B6OA 2P3UB 2QGRA 3MU4A 3BV9B 4Z1MD 3GDSA 3SNCA 4MG3A 1WTHD 5A8ZA 1RIWB 4E05H 2F9PA 1O5BB 2A32A 3SU2A 6CHAC 2FYQA 3OSYA 1BQYA 2O8WA 4ZHMU 1GJ6A 1SHYA 2G5NA 1T8LA 1P2QA 4BAMB 1Y3WA 1O3LA 1LTOA 4GVUA 5EW1H 4I8JA 4JZIA 5LGOA 4P02A 2XBYA 1O0DH 3ZVCA 1WSSH 5EQQA 3QZRA 3LH1A 3ZV9A 1MKXH 1CA0B 1LHFH 4ISOA 3RXAA 1S85A 3HKJB 3MU8A 3ATLA 3TGIE 4FXGH 1D6WA 1N1LA 5EXLA 2IJOB 2J9NA 5E2OA 4Q4LA 3RMNH 3LONA 4ZXXH 1FY4A 2ALVA 4BTTB 3MH6A 5IYTA 3WY8A 2FI3E 5BRRE 3F6UH 4GCHF 1TRYA 1GDNA 1FDPA 2ESTE 2ODQA 2UUYA 3QTVH 1BTHH 5C0UA 3H7OA 4KTCA 2XYAA 4FU9A 5C1UA 2ZHEH 1NT1A 1OHHD 3BTDE 4ISNA 5FL7D 1ETTH 4KP0A 1O2IA 2PGBB 1SGFA 3QGJA 3P17H 4NSVA 1GJ4H 5E8EH 3MO9A 1C1UH 1C2JA 1S6FA 1BCUH 1C9TA 3SGQE 1MTNB 1TB6H 1UJ1A 1KTTB 2F9BH 2P3TB 2C90B 1ZTKA 1CSOE 1OS8A 4U30A 1UW7A 2KAIB 2Z3DA 1NM6A 1GBCA 1AUJA 1C1RA 1C5TA 4IN1A 1ZMLA 7GCHF 3OY5U 1GJBB 4NFEA 4OS7A 1BIOA 2AGIX 2VIVA 2OC0A 4O97A 2Q6DA 1VCQA 1E0FD 2WPLS 4IMZA 3SUFA 1KIGH 3AVZA 3TU7H 3KGPA 2TGAA 3DSPA 4O3UA 1EASA 2J4IA 2GX4A 1VITH 1C1MA 3EGKH 5TJXA 3LKWA 4AG2A 2ZDKA 2W26A 1J16A 3RM0H 4YESB 2ZGBH 1YLDA 2BLWA 2FM2A 1V2MT 3RXBA 2AFQB 5GIBA 1ZPBA 1CT4E 3F1SB 1QL8A 5IK2D 1UK4A 3OFND 3URCA 1A0JA 2ZG0H 1OWEA 2JJ2D 3CS0A 3BEUA 2CMYA 2W3IA 1ORFA 3DUXH 1TGCA 4DG4A 1BTZA 1HUTH 1C5MD 2F9OA 1GI3A 4A6LA 5KECA 3PO1C 5DKMA 3LJOA 3VB5A 1V2LT 4A5TS 2F83A 4YLUA 3SJOA 2IPHA 6GCHG 4BTIB 1QCPA 4B2CA 4BOHA 3TNSA 3E8LA 2FP7B 3DSOA 1OP0A 3MFJA 1G3BA 1UK2A 2CN0H 3SQEE 1S0QA 3PLPA 1SGEE 3ATIA 1IQGA 4RKJB 4CRGA 3BIVH 1O2KA 3DD2H 3U8RH 1O2RA 4LOYH 5C94A 3KHVA 4HFPB 1QTFA 3LT3A 4XOJA 5F6MA 1XUFA 1YP9A 1LHEH 3SGBE 1TGNA 4WH6A 3T28A 1G2MA 5FAHA 4I31A 4XDEA 1SQTA 1GCTC 3HGPA 4Y79A 2BMGB 2PUXB 2BY7X 4P00A 1DUEA 4B73A 3DA9B 1HAXB 1ZGIA 4ZAEA 2WHXA 2GCTC 4AN7A 4LXBH 1GHWH 1TALA 1FIZA 2G55A 1IOEA 4B6EA 3SOSA 3CENA 8GCHG 2XCFA 1PQ8A 1Y3UA 1H9LB 1G32B 1ETSH 3PRDA 1A7SA 3PV4A 1SQRA 1ZGVA 1HPGA 3RXTA 2WUBA 1KXDA 1MKWK 4B76A 4K8YA 2A4QA 5EU8A 1O2YA 5C5NA 3RXCA 1BITA 2ZI2H 4AFUA 3SU3A 1QURH 2QN5T 3IG6B 1GMCF 3M3TA 2BB4A 4D8NA 2PKSC 4U01A 1LMWB 1FY3A 1QBVH 5E0HA 1NFYA 5AFZH 4XBBA 3SW2B 1E36B 2ZHFH 1NFUA 4IW4E 1A0HB 1FN6A 4AC9A 2LELA 2A45B 3EQ0H 1SLWB 1T31A 2SGPE 4GHQA 2ZTXA 3NK8A 2FOBA 1P12E 2BDHA 1F7ZA 4Y8XA 4ZKRU 4F4OC 1FV9A 4FETA 2Y81A 1TAWA 2BHGA 1KDQA 1UVOA 2FX4A 3P8OA 4NWLA 3SI3H 1ARBA 3T5FH 3ODDA 2J98B 2GZ9A 2VGCB 2KCAA 1C2MA 2GZ8A 1BMAA 4FVDA 1HV7A 1TIOA 2M5TA 3Q77A 1XUGA 3PLKA 3MH5A 1BTUA 3N7EA 2FTLE 1GG6C 2VWMA 4Q7XA 2BD5A 1O33A 1RXPA 1T8NA 2ZNKH 5EODA 5G4BA 3LDXH 5HIYA 4IMQA 1AVGH 1H4WA 1ELAA 1P04A 2NU4E 3F3BA 2ANMH 1PPCE 2R9PA 1GI9B 1ESTA 2BX3A 4WMFA 2VB0A 2FOHA 2P59A 3V13A 2C8ZB 1TMUH 4NSYA 1YBWA 2P94A 3MNSA 1MZDA 1YF4A 2BD3A 2NU3E 2WSSD 4CRFA 3FVFB 1NBME 2W7SA 5L6NH 1NRRH 1EB2A 4A1VA 2ZO3H 1HXEH 1WQVH 1DVAH 2ZEBA 1BBRK 4ZROA 1B5GH 3MNXA 4RT1A 1EAUA 2AYWA 4OS6A 1H9IE 1QHRB 1IQIA 3BTTE 3UAIC 5KEDA 3BTHE 2DE9A 4Q63A 1UK3A 2TPIZ 3UOUA 3SV7A 3VXEH 2QF5A 3RC4A 3UQVA 5C0TA 3R3GB 2L6OA 3O8DA 1NN6A 2BYAX 1O2UA 1IQEA 4AZ2B 1GJ7B 1S6HA 5DG6A 3RXKA 2ZU4A 1DDJA 1D9IA 1WTGH 2PLXA 3ATMA 2QXHA 3BTME 3QDZB 2BDIA 1BMNH 1UTNA 4YO9A 1T4VH 2BVXH 2LP6A 2WYJA 1EXFA 2D2DA 2ZHDA 4UFEH 2BXTH 2I6SA 4ABHA 1LKAA 3PMAB 1O2VA 3URDA 3GOVB 4MNXA 1SHHB 2FIRH 4Y0YE 3BG8A 1UTPA 1QB9A 3NUMA 1DWBH 1P57B 3DHKH 5JBBS 4Y0ZE 1FNIA 1AHTH 4TWWA 4AB9A 3UNQA 1ELFA 3A83A 2ZGHA 4NA7A 2CF8H 1C5XB 2ZU5A 3FP6E 5HM9A 1E1QD 1GHZA 1RRKA 1DLKB 3VB6A 3H7TA 1K22H 1CGIE 3KCGH 2QXJA 3ZZCA 4DCDA 1ACBE 1VZQH 1ZZZA 1OPHB 4CH2B 4D7GA 4LK4A 3ZYDA 1HAIH 3LU9B 1C5ZB 3SGAE 3GY2A 4BAOB 1SFIA 3BG4C 1LQDB 2JH6D 3F9GA 4TPIZ 2ZCHP 1K9OE 4X1QU 1HAOH 3TIUA 4BAQB 2D26C 1VGCC 1GHBF 1SGDE 1EAXA 1UVPA 2RG3A 1NESE 2AIQA 1CBWB 3I78A 2I6QA 4TYDA 1FUJA 3ZZ6A 4Q80A 1C1QA 2P3FH 3UFAA 1J9CH 1ZMJA 1EPTB 2FOAA 1IQNA 4CHAB 3SJIA 1F5RA 3Q3KA 2JIZD 2ODYB 2OLGA 2BQ7B 2Q6GA 1E37B 1V2JT 5FX6A 1XXDA 1JOUB 3A85A 4XE4A 3MMGA 1ELDE 1RTLA 2RA3A 4MDSA 1PYTC 3RXEA 2ZIQH 3ZYEA 1TA6A 2TGTA 1C5VA 1UVTH 1C2HA 2P8OB 4KTUA 3SO3A 1GPZA 1HRTH 1K1IA 1QZ8A 2ZFPH 1PPFE 1SL3A 3T62A 1TE0A 4JZ1A 1Y3YA 3GDUA 1DX5M 1E1RD 2SFAA 1AKSB 4TWYA 3M3SA 3LGIA 3M7UA 3SNDA 1YPGH 1XX9A 2A1DB 4NGAH 1Z7KA 2GCHF 2GT8A 3VXFH 3VGCB 4ZCNA 4AFQA 1CHOF 2J34A 3FZZA 2Z3EA 4D9QA 3TGJE 1QL9A 1EOJA 1GI4A 1YWUA 1MAYA 4MLFB 1CA8B 2JDID 1A61H 2KFWA 3BEIB 2PP6A 4MPWA 4TY6A 2Y5GA 3CP7A 1P10A 4X8SH 4INLA 1F2SE 3EE7A 2SGFE 5T6DA 1MBMA 1V6DA 3ZVFA 1QR3E 5DK1A 1Y3VA 3UPEA 2SNVA 2FODA 3KEEA 3SJKA 2PFEA 2NU0E 3U8OH 3S9BA 3ZV8A 5C5OA 1A1RA 1ZHMA 2THFB 3M5NA 1UTLM 1HGTH 1MD8A 1VITG 3FP7E 3SN8A 1QL7A 1HIAB 2VVUA 1NY22 2ZFTA 1TRNA 3MH4A 1S0RA 1GMDF 1AGJA 1BBRE 3SUEA 1KY9A 2B8OH 1C5LH 2WZQA 1HB0B 5JBCS 3TH2H 3FKSD 1O3KA 1P8VC 1YCPH 2H9EH 1GMHG 1Q31A 2J94A 3AAVA 1H9HE 1TPAE 4I8HA 1ABIH 1AE8H 2ZCKP 1O5GH 1AB9C 3BSQA 3IITA 4ABFA 4JYUH 4DT7B 4HZHA 3F9FA 3V3MA 3GCTG 2CHAB 1OYQA 1GGDB 4ZH8A 1Z6EA 3VB7A 5DP3A 4IC6A 2PR3A 2RCEA 3F2GA 3IWMA 4IS5A 3S7KB 5GCHG 3CNRA 4X6MA 2JETB 4NA9H 5C2ZA 1YPEH 4GAWA 2SNWA 3KL6A 1GCDA 2AERH 2OCVB 4CBNA 5ABWA 1P2JA 1GI0A 3KYGA 1XKBC 2R0KA 1S81A 2OC1A 1FAXA 2GJGA 5AHGH 3RU4E 1P2IA 2WINI 1EZQA 1HXFH 2ZHWH 1INCA 2XWBI 5DP5A 4HTCH 1FPHH 2EI6A 2Y5HA 3PV5A 3TK5A 1YPHC 4CRAA 1KYNA 3D65E 2ZFSA 5JYIA 3PTNA 1H8ED 1SGIB 2R2WU 2ASUB 1BTPA 3TJNA 2OK5A 1RFNA 1RS0A 1JXPA 5F8XA 5GJ4B 3OY6U 2BLOA 2F9NA 4MVNA 2AMQA 3GCHB 4KTSA 7KMEH 2PTNA 1SGCA 1YPLH 1Z8JB 1SOTA 2BTCE 3T27A 1L2EA 1TFXA 1OWIA 1UMAH 1P01A 1UTJA 2BD9A 2G4UA 4B2BA 2A4GA 2FOEA 2ILNA 2OBOA 1N8OB 3ZZ3A 2FWWA 4WMDA 2EEKA 5J4QA 4Q2KA 2M2AA 4I33A 3A7TA 5JB9S 2ZP0H 4D7FA 3SNAA 1FONA 4WWYA 2P16A 5F8ZA 1BUIA 1GI1A 1TNLA 1MUEB 2VINA 1P2OA 3ATKA 1H8HD 3L6PA 3S69A 2HNTC 5DP8A 1NRQH 1YC0A 3HK3B 1EAIA 4NIXA 4B74A 4CH8B 1O5AB 3NWUA 1QFKH 4ZXYH 3BIUH 1SLUB 3LPRA 2QF0A 2SGDE 5T3HA 2OQ5A 3LIWA 4F48B 1WCZA 2ZC9H 4X8VH 6CHAB 3MQKC 1AN1E 1GVLA 1UCYH 1P09A 2H5CA 1PYTD 1OWHA 4AYYB 2OP9A 1YPJH 1DITH 3E1XB 1MMJN 3M37A 3LGYA 4DJZB 4AFSA 2XC4A 1FAKH 3RMLH 3EDXB 1IHTH 2VNTA 4X1NU 3RM2H 1TABE 5EQRA 1W2KH 1W13U 3NKKA 6GCHF 1SBWA 1OX1A 5F8TA 3ZVBA 4DIHH 3VB3A 1O3EA 1O2JA 2IN2A 3L33A 2G4TA 3SU1A 1CU1A 2Z9IA 5CMXH 2SGQE 2YOLA 1AZ8A 1DSTA 1NU7B 2OINA 2ZFRH 2FPZA 5L2YH 3M35A 4LZ1H 4JK6A 2KR7A 5DP7A 4CR9A 1WUNH 4JZFH 1UVSH 1L4ZA 3SNBA 3WWFA 2Y82A 1AWFH 2V7QD 3VEQB 1EJMA 1SLVB 2XWAA 4Y7BA 1S5SA 2VJ1A 2BX4A 3A84A 3Q00A 1WBGB 1KXAA 1GJAB 1AUTC 2OQUA 1SPJA 2G52A 3U1JB 2ANWA 1QA0A 1RGQA 2Z3CA 5FBIA 4YM9A 2SGEE 1THPB 3KQBA 3HK6B 3B8JA 4CRDA 4Q7YA 1YCPK 1TQ7B 3I77A 8GCHF 2VH0A 3A7XA 1TWXB 3ZZBA 1C1TA 2AS9A 2F9UA 2Y7XA 3SI4H 5C20A 1P05A 4SGAE 1DSUA 1V2OT 2HNTF 1IHSH 1V2ST 2FI4E 3VFEA 3BTKE 1T8MA 4NCYA 3N7DA 3RXQA 1SG8B 1C5NH 5HGGA 1O3FA 1TX8A 3S7HB 4MPXA 4NG9H 5JDUB 7LPRA 3B9FH 2ZQ2A 1ELEE 9ESTA 3SZEA 4NIWA 4ASUD 2ZU2A 1C1SA 4AORA 3Q76A 2UUKB 2BY6X 2K0QA 3HGNA 1Z8RA 2V3OH 1EJAA 1Z6JH 4ISHH 4FUFA 1GVKB 3K6ZA 5T6FA 1AIXH 1O39A 1FY5A 4GUXA 3KQ5A 1S83A 3TJOA 3NCLA 1O2NA 3KF2A 4QT8C 3MU5A 1XXFA 1GJ5H 1Z71A 3PO1B 2GGVB 2ZDVH 3BTGE 1A5GH 2PKAA 1MTVA 2LNCA 4Y8YA 8LPRA 1LVMA 2ZDMA 4JZDH 2FEQH 4ZKOU 3VPKA 1K1NA 2Z9LA 4UONA 1K1PA 1C1OA 1WOFA 2VWNA 2DE8A 1KLJH 2BOHB 1GHAG 3P6ZB 1J15A 5DPAA 1GI7B 4X8TH 1SKYE 4RN6A 3U8TH 2HNTE 4MQAA 4M7GA 3N7OA 1MQ5A 1FI8A 1DWDH 4ZKNU 2HRVA 3MNBA 1G37A 1KDQB 1HDTH 3E90B 5H4IB 3WWBA 2XXLA 3TVJB 3M61U 1W8BH 4Z6AH 2QAAA 1F0RA 2BZAA 2D8WA 1COWD 1WQSA 1O3JA 2H1UA 2Y7ZA 3LGVA 3TNTA 1GCTB 1LVBA 3SJ9A 4H42U 4H6SB 2Y5FA 1OKXA 1EP6A 4R0IA 3LGTA 1TOCB 2CV3A 4JZEH 4X6OA 1GHVH 2GCTB 2A4RA 3FP8E 4K8BA 3SORA 2A31A 1V2RT 2BQ6B 2DUCA 2C8WB 1UTMA 3F9EA 1C2EA 1FZZA 1MKXK 1YYY1 4I7YH 2QY0B 3C27B 1P11E 5LPRA 3LC3A 4ABAA 3GDVA 1EFRD 1O2PA 4ZUHA 1HJAC 3RXHA 1FY8E 4MNVA 5EGMA 5FPSA 1O3AA 2TRMA 5ETXA 4BXSA 1UCYK 4INHA 2OBQA 1A0LA 2WV9A 2ZWLH 2A7HA 4XRNA 1W0ZU 2VWLA 2J97A 5CHAC 2UWOA 2GP9B 2B9LA 3K6YA 3FOAA 2OD3B 1XUIA 3PMBB 5L30H 1AE5A 4PROA 2XNDD 1O32A 1BRBE 3TJVA 1ESAA 1G2LA 5B6LA 1M9UA 4NIVA 3HATH 5EG4A 1GVZA 2VIOA 3T25A 1BA8B 2XBWA 2QC2A 2UUFB 1FIWA 1C4V2 1GJDB 4ACBA 1HAVA 4X2WA 1W10U 2WUCA 3RXMA 4KKDA 1O5DH 3V12A 2XBXA 2ZDAH 1JIRA 2ZHQH 2ZPSA 3UNSA 1LO6A 1TLDA 1SGQE 2D1JA 3H09A 2GMTC 1J14A 4UFFH 2A4OA 5HXFA 4I8KA 3S9CA 5CE1A 3FAOA 1AI8H 2BD8A 1FXYA 1PQ7A 5C1YA 3MNCA 1J17T 1D6RA 1TNKA 3FFGA 1NS3A 4A1TA 1K1LA 2ZQ1A 1O3CA 3F9HA 1ELTA 2ZF0H 1JBUH 1WV7H 2TIOA 3PYHA 1O36A 1DM4B 5EJ1A 2XOKD 1YLCA 3A8BA 2BD4A 1EQ9A 1YLNA 1SGPE 1UVUH 1TNJA 4X8UH 3ENSB 5BPEA 4DOQA 2ZU3A 2VH6A 4UE7H 1CE5A 4HG6A 4Y71A 3SU0A 3W95A 4IN2A 3ZZ4A 1AD8H 3TK6A 1GBEA 4WY3A 3QK1A 5C17A 1K2I1 4DURA 3KQCA 5L2ZH 1BT7A 1TRMA 3OX7U 1MD7A 1O2TA 2ZKSA 1Y3XA 3RXSA 1O3MA 2FO9A 1C2FA 1O3HA 1B0EA 3M5OA 1IAUA 1DS2E 5F53A 3GISB 3U69H 1MU6B 2W5EA 5CHBA 2GDEH 1ELGA 3L3TA 1TPPA 3E6PH 1W0KD 1H8DH 1C5PA 3W94A 3SU4A 3BF6H 4O03A 1AFQB 1O2WA 4NA8A 2A5IA 2BOKA 4IBLH 4U2WA 1F0SA 4LZ4B 2XBVA 4WXVA 2CK3D 1QJ1B 2QYIA 3LGUA 4FUIA 2A5AA 3M36A 3QLPH 2KZ4A 5FX5A 3P8NA 4ABBA 3PWCA 1D4PB 1V3XA 3ZIAD 1ZPCA 4ZHLU 1P2NA 2GDDA 1QBOA 1QQ4A 2OUAA 3PMJA 4Q7ZA 4X2XA 3BTEE 3M3VA 2GZ7A 2BD2A 4XBDA 8KME2 2STAE 1JRSA 1OOKB 5JBTA 5PTPA 1PPHE 1G9IE 1O2SA 1O2LA 3RXIA 1PPGE 1BHXB 1HJ9A 2VU8E 1F5LA 2H9TH 3KN2A 3QTOH 2ZFQH 3A86A 1O3IA 5EOKA 4YT7H 1P03A 4KGAA 3SV8A 3P70B 4HI3A 3UUZA 3TLOA 2TBSA 1G30B 1KTSB 4K5ZA 2GV7A 1V2WT 5A2MH 1V2TT 1OSSA 4YLQH 4NIYA 1Y8TA 2ULLA 3SQHE 1EZSC 1TNIA 4ABIA 3A81A 1C1PA 1D3QB 1ZMNA 1SOZA 4DW2U 3DFLA 4BNRA 1GBBA 3UREA 9LPRA 2AGEX 1CBWC 2ZA5A 3P92A 3ZVGA 3GYLB 3ZZ7A 1F0UA 3QWCH 4RKOB 2GTBA 3RXVA 1AVWA 5LPFA 1V2VT 1WAYB 2G8TA 2ZGJA 4MPVA 4BTUB 1IQKA 3MOCA 1VITF 1LPZB 2ZPRA 1SGRE 2VIWA 2YMSC 1ZTJA 2QF4A 1S6LA 1BOQA 1EAWA 1CVWH 1QRWA 3BG4B 1C1WH 3KQDA 1E35B 1TYNA 1UTKA 1ZSLA 5JB8S 3W1EA 5DJ7A 1G3CA 2BM2A 5I25A 5HM2A 1UHBA 1VGCB 1GMHF 2JH5D 2QXIA 1P2MA 1RTKA 3ZVEA 3RDZA 1Z8IB 3GY5A 5SGAE 1HAPH 2VVVA 3GCTF 1ZHPA 1LPKB 1P2KA 1BHXF 1OWDA 3M7TA 1HYLA 5C3NA 3ZZ8A 3SUGA 5GCHF 3TGKE 4AG1A 1QB6A 3VGCC 5E0JA 1TBRH 2O8LA 1VJ9U 3SHAH 3QGNB 1A3BH 1W0YH 1LQEA 4TSFD 4K60A 3E0PB 1DXWA 4ISIH 4X2VA 2H6MA 1XUJA 1SQAA 3UWJH 3EAJA 5C1XA 3MTYA 1OXGA 2H9HA 1K28D 1O34A 1MBQA 2AH4X 1BB0B 1A46H 1JWTA 3H5CB 1ZPZA 1E34B 3EE0B 1MCVA 1O3OA 2C4FH 5EPNA 1EP5A 1XVMA 4OS2A 5DP4A 5FPTA 4ZHAA 2L74A 1EZXC 3RLWH 1VR1H 2F9VA 4TY7A 2WV4A 1BMLA 1LVOA 1QIXB 2GKVE 4X1RU 1D3PB 3A7VA 2PSXA 3EA8A 3U98H 3LJJA 5AVDA 5GPIB 4VGCB 2BLVA 4UD9H 1AWHB 1JRTA 3UIRA 1MTUA 4K1SA 4Y11E 1VJAU 2QA9E 3BTFE 3F2FA 1QBNA 3E16B 4XD7D 3PTBA 4INKA 4K3JA 2CHAC 1GWAA 5A8XA 3RXRA 2TGPZ 1C5OH 4FUHA 4DVAU 5AF9H 1NTPA 2PGQB 2C8YB 2J38A 4UFGH 2UWLA 4IC5A 1GBMA 1RTFB 2TGDA 2BVSH 1SMFE 2GD4B 1C5RA 3AASA 3RXGA 5DO4H 5AFYH 1WDIA 1NO9H 1YM0A 2V3HH 3MO6A 1QRZA 1TMTH 1ELCA 4OGYA 4ISLA 1A4WH 1FMGA 2STBE 1H1BA 1HAGE 3K2UA 1PPBH 1HAHH 1Z1JA 1YY3A 5EXNA 3RMOH 2VIPA 1W0JD 1HBTH 1MU8B 3SBKA 3E0NB 1PQAA 2G51A 3JZ1B 1K1JA 5I46H 2F91A 1MZAA 3GY6A 2WV5A 3RXFA 1TBQH 2BY8X 1O37A 4Y76A 2EC9H 3FO8D 1DFPA 5HKKD 1ID5H 3ITIA 2Z6BD 1Y59T 2B5TB 3A8CA 3EA9A 1FY1A 1SI5H 1ANBA 5K0HA 1PJPA 4CR5A 1L1GA 4NFFA 1ETRH 5CDFE 2BY5X 1CHGA 2XCNA 1PPZA 1TPSA 1N8OC 1XMNB 1LVYA 2YNAA 1T32A 1DY8A 3OTJE 2EI8A 4I8LA 4UDWH 4AX9H 3OYPA 4FU7A 1RIWC 3GY7A 5KGOA 6LPRA 8ESTE 2W6JD 3P8GA 2JH0D 5C67A 5A0CA 3KNXA 4XFQA 1C4Y2 1MTWA 2HGTH 5FXLA 1W7GH 2WPHS 1XKAC 1NRNH 1G3EA 1NU9A 2O8UA 3ZZAA 3PROA 2ZFFH 2Y6TA 5DP9A 1C2IA 1GBTA 4OM9A 1CA0C 2WPMS 3D23A 4BXWA 1DWEH 2FS8A 1GBHA 1GBAA 1DICA 4I32A 3T29A 1T4UH 4WH8A 3RXLA 2YMSD 1U6QA 5T1VA 1K1OA 3GICB 3OAAD 3P95A 5J4SA 1A2CH 1C9PA 1MKWH 4FUBA 2O8MA 1B0FA 1JIMA 3S9AA 5A09A 1EOLA 1NROH 2PSYA 2NU2E 4A1XA 1L1JA 1O38A 3U28C 1MTSA 3SJ8A 2P95A 1TGSZ 1MQ6A 2PUQH 4FUEA 4GLYA 1O5EH 2FZZA 1NRSH 5K7RA 3FZDA 1MTNC 2KCOA 1O3NA 1FX0B 4JK5A 1KLIH 2FOMB 1BTWA 2XC5A 4OS5A 4D9RA 4H4FA 1YPMH 2R0LA 3EYDA 1GJ8B 1P9SA 2Q6FA 1J8AA 1LHGH 2FYRA 4U32A 1VCPA 1THSH 1QJ7B 5E2PA 1TOMH 2ODPA 2XRCA 5EW2H 2J5UA 1W3CA 1C1VH 4M9FA 1YCPM 1L1NA 1BRAA 4A92A 1ZHRA 2H2ZA 1P3CA 4ZMAH 1UTQA 4YOGA 3SU6A 3QUMP 1ZSJA 1O2XA 1LPGB 1S82A 2J92A 2B0FA 1P02A 1GBKA 3RXPA 3VB4A 1GHAF 4K1EA 2GVFA 1OWKA 1XUHA 3BTWE 1QA7A 3Q3XA 1SGTA 3ODFA 2PKAB 4CRCA 4OS4A 1GBLA 2FMJA 4TPYA 3MU1A 1AFEH 5HMAA 4WJG2 2BZ6H 2WPJS 1O30A 2BDCA 3FN8A 2FESH 1EJNA 1XUKA 3T26A 1LCYA 3O8BA 4K1TA 1BZXE 4JYTA 2F4LA 2CJIA 2F3CE 1YPHE 4AYVB 2AHME 1DPOA 1VKYA 2G81E 1V2KT 1DANH 1ZOMA 5EXMA 1ZJDA 3GS9A 2WPIS 4B75A 1V2UT 1SVPA 3BN9A 1C2GA 5EPYA 4GCHG 2FOGA 4B2AA 3E91A 2VWOA 2BDAA 3PWBA 5HYOA 2XC0A 4MPUA 1BBRH 3RXJA 2H5DA 1SQOA 1QJ6B 1NFXA 3UTUH 3B23B 2KAIA 1TBZH 1Q2WA 2ZPQA 2RFKC 3KYFA 1V2NT 4XBCA 2ZCLP 2C3SA 2O9QA 5T6GA 1SGFG 3UWIA 1T7CA 5TCCA 1Y5BT 1C5YB 1O3DA 5JPMH 3TITA 2OC7A 5F03A 1PPEE 3I29A 2EQNA 1ESBA 2ANYA 4GSOA 4E7RG 1DLEA 1W14U 7GCHG 2NU1E 1Z8GA 3D62A 4K69A 2W6ID 1LHCH 4X6PA 1TX6A 1HAVB 1CQQA 1XM1A 4MNYA 1C4U2 1P3EA 4ESTE 1V2QT 1BRCE 1QB1A 4B71A 5ESTE 2V0BA 5DP6A 1BJUA 1ZRKA 2B7DH 2WPKS 2J95A 3ZZDA 3AW0A 3A7WA 3R0FA 1O5CB 1GBFA 2HOBA 2QV1A 5DN6D 2Z9KA 1NZQH 2BDGA 2IJD1 2ZZUH 4AGJA 3PM3A 1ANCA 4GHTA 1C2LA 4X2YA 3MU0A 1EZUC
chains in the Genus database with same CATH topology
1EATA 4J1YA 5GDSH 2BLQA 1A5HA 4BANB 1AO5A 1ZLRA 4SGBE 4JMYA 1LHDH 3AAUA 3RXUA 4NZQA 1F92A 2R3UA 1O2GH 3ELAH 3PLBA 3GY4A 1GL0E 1B7XB 1C1NA 2PW8H 1D3TB 2ZTZA 1GDUA 3OU0A 3TH4H 1DWCH 3SV2H 4AB8A 4FUJA 4RSPA 2VGCC 3MI4A 4YTAA 1HJAB 3GCOA 2UWPA 2PKSB 2SGAA 2V6NA 2BDBA 2O8TA 4ABJA 3ATWA 3ZZ5A 1ZR0A 4Z0KA 2Q1JA 4JCNA 2Z9GA 1T8OA 1HCGA 2ZU1A 4I8GA 3STIA 5CHAB 2FLBH 3C1KA 3O8RA 3K65B 4AFZA 2BD7A 2PWXA 1LDTT 1OP2A 3ESTA 2FOFA 3NXPA 1KXFA 1SGYE 2HPQH 4X6NA 4WXIA 2CF9H 1QNJA 3K9XB 1AZZA 2ZECA 2HPPH 2CGAA 1NFWA 1CGJE 2CXVA 5DGJA 3S0NA 3UR9A 2BVRH 4DGJA 2C8XB 3A8DA 3UY9A 1O2HA 1QY6A 2FX6A 1A3EH 1GG6B 1H8IH 3EA7A 2AGGX 2GMTB 2FI5E 1W7XH 1L0ZA 2A2QH 2RA0A 2VIDA 1TONA 2Z9JA 3KQEA 3TK9A 3STJA 4ABDA 3A82A 4MTBA 5JBAS 5LH8A 3DT0H 1KXEA 2AMDA 2W7UA 1GHXH 1WYKA 1O2MA 4AGKA 2ZGXH 1IQFA 1AQ7A 1KXBA 1F0TA 3Q3YA 2A7CA 2FOCA 3SU5A 1GMCG 1C5QA 2G5VA 3NZIA 4A7IB 3V0XA 1BTYA 2FS9A 4J2YB 4X1PU 2EA3A 3RUOA 4UFDH 1ZSKA 1LKBA 1PQ5A 1FN8A 1TQ0B 1MAXA 3RP2A 1DUAA 3A8AA 2AMPA 1KSNA 1IQHA 4MNWA 1AFQC 1QGFA 1AY6H 2FLRH 2Z7FE 3MYWA 1MH0A 2HLCA 3RU4T 3KIDU 5ESBA 4YT6H 3FANA 2EI7A 4X1SU 1YGCH 3U1IB 2FTMA 1GJ9B 2A2XH 2HWLB 1O2QA 3A88A 1SFQB 2VVCA 5GXPA 2A5KA 1SSXA 4OS1A 3A87A 1N6YA 1HLTH 4H6TA 2BQWB 4YOJA 3ZZ9A 4YZUA 4HGCA 4FU8A 6ESTA 1FJSA 1A5IA 1DE7H 4WF8A 3GY3A 2XNIA 3SV6A 3HPTB 3UQOA 3V7TA 1CT0E 3TPIZ 4Y6DA 1O31A 4GPGA 4Y8ZA 1GI5A 2OC8A 1SR5C 1UHBB 4FUCA 4D76A 2PV9B 4AOQA 1C5SA 4CBOA 3O8CA 1DT2A 4FVBA 1IQJA 1TGBA 1GI2A 1ABJH 3RXDA 1PFXC 2IOTA 4JYVH 3BTQE 1SC8U 3M5LA 3PMHB 3D49H 4CREA 2LPRA 5FBEA 3HKIB 4X0WU 1S84A 1DXPA 3RLYH 1TNGA 1SLXB 1Z1IA 4DIIH 2W3KA 1GI6A 1W12U 4WMEA 5A0BA 2C93B 1TMBH 5FHTA 1NRPH 5FCKA 3QX5H 1F5KU 3MWIU 1C2DA 3GCNA 1HJ8A 1EPTC 1O35A 1TX7A 3RMMH 1G3DA 4CHAC 3QZQA 1IQLA 1ZTLA 2QCYA 2HALA 2Y80A 1C5WB 1FPCH 1GJCB 1OYTH 1UCYE 1EB1H 1ANEA 2R3YA 3A7ZA 3QN7A 4ZKSU 1MCTA 3UOPA 2HVXA 3SHCH 4IGDA 2QF3A 1AVXA 3UNRA 2P93A 3ZVDA 1Y5AT 4YOIA 2XW9A 3A80A 1O3PB 2P8OC 3SZNA 2FXRA 3GY8A 2ZTYA 1Q3XA 4ABEA 4OGXA 3BEFB 1UTOA 1RJXB 3U9AH 4ABGA 1HNEE 3A7YA 1Y5UT 2PHBA 3RC6A 2ZGCA 2AIPA 1FQ3A 1QQUA 1G36A 1O3GA 1SB1H 4O3TA 1ZRBA 2ALPA 4Y10E 1X7AC 1HAYB 1AMHA 3UR6A 3M5MA 4FUGA 3CS7A 1ELBA 1W11U 1CO7E 3SUDA 2WYGA 1FLEE 1K1MA 3LH3A 3SNEA 1DY9A 1CT2E 4NZLA 3ZVAA 1V2PT 1VCWA 1BRUP 1EX3A 1E38B 2PTCE 3QO6A 1EKBB 3TH3H 1ELVA 1GDQA 1SGNE 2R2MB 1GI8B 1BMMH 1TGTA 3MHWU 1GBJA 2A0QB 1KLTA 4F49A 5EQSA 2OXSA 3E3TA 5TCAA 4THNH 4XSKU 1WU1A 2GT7A 1O2ZA 1TNHA 4VGCC 4ASHA 5IDKA 1BJVA 1EPTA 1AU8A 1OWJA 1TA2A 4BAHB 1GHBG 1N6XA 2QIQA 3TJUA 3NPSA 3LC5A 2OTVA 1BDAA 5A8YA 1ZYOA 2AEIH 4WVPE 1GGDC 1P06A 1EUFA 3A89A 1QRXA 4O9VA 1IQMA 1L4DA 2J2UA 2JKHA 2JETC 4E06H 1C2KA 1GL1A 2K1QA 3P8FA 3T2NA 4K2YA 2BY9X 1AKSA 2ZDNA 1RD3B 1P0SH 4R8TB 1O2OA 7ESTE 1DOJA 1THRH 2NWNA 1O5FH 2A7JA 1AB9B 1YKTA 3F68H 3AW1A 1HFDA 4FUDA 1GBIA 3LOXA 5GWZA 3JZ2B 1KXCA 1BTXA 1GBDA 4Y7AA 2BDYA 2BXUH 2GCHG 2QXGA 2YNBA 1XVOA 2VIQA 1ZJKA 1C5UA 1JMOH 2ZDLA 3RC5A 5LPEA 1ARCA 4KELA 1CHOG 3GYMA 4B1TA 2UUJB 3MO3A 4DY7B 2GV6A 1P9UA 1O3BA 3GCHC 1GHYH 2V35A 1TPOA 1OP8A 5A0AE 1NC6A 2Z94A 1CGHA 3MH7A 5FPYA 5E0GA 2G00A 3SV9A 1K21H 3G01A 4BAKB 1NPMA 1HIAA 2ANKH 4UEHH 1UO6A 3PB1E 3RXOA 4NWKA 3M7QA 3LGWA 1HAZB 1D3DB 3DFJA 2XTTB 2FDAA 1ANDA 4CRBA 2RDLA 1GMDG 4E7NA 5FCRA 3RU4D 1YPKH 5B6OA 2P3UB 2QGRA 3MU4A 3BV9B 3GDSA 3SNCA 4MG3A 1WTHD 5A8ZA 1RIWB 4E05H 2F9PA 1O5BB 2A32A 3SU2A 6CHAC 2FYQA 3OSYA 1BQYA 2O8WA 4ZHMU 1GJ6A 1SHYA 2G5NA 1T8LA 1P2QA 4BAMB 1Y3WA 1O3LA 1LTOA 4GVUA 5EW1H 4I8JA 4JZIA 5LGOA 2XBYA 1O0DH 3ZVCA 1WSSH 5EQQA 3QZRA 3LH1A 3ZV9A 1MKXH 1CA0B 1LHFH 4ISOA 3RXAA 1S85A 3HKJB 3MU8A 3ATLA 3TGIE 4FXGH 1D6WA 1N1LA 5EXLA 2IJOB 2J9NA 5E2OA 3RMNH 3LONA 4ZXXH 1FY4A 2ALVA 4BTTB 3MH6A 5IYTA 3WY8A 2FI3E 5BRRE 3F6UH 4GCHF 1TRYA 1GDNA 1FDPA 2ESTE 2ODQA 2UUYA 3QTVH 1BTHH 3H7OA 4KTCA 2XYAA 4FU9A 5C1UA 2ZHEH 1NT1A 3BTDE 4ISNA 1ETTH 4KP0A 1O2IA 2PGBB 1SGFA 3QGJA 3P17H 4NSVA 1GJ4H 5E8EH 3MO9A 1C1UH 1C2JA 1S6FA 1BCUH 1C9TA 3SGQE 1MTNB 1TB6H 1UJ1A 1KTTB 2F9BH 2P3TB 2C90B 1ZTKA 1CSOE 1OS8A 4U30A 2KAIB 2Z3DA 1NM6A 1GBCA 1AUJA 1C1RA 1C5TA 4IN1A 1ZMLA 7GCHF 3OY5U 1GJBB 4NFEA 4OS7A 1BIOA 2AGIX 2VIVA 2OC0A 4O97A 2Q6DA 1VCQA 1E0FD 2WPLS 4IMZA 3SUFA 1KIGH 3AVZA 3TU7H 3KGPA 2TGAA 4O3UA 1EASA 2J4IA 2GX4A 1VITH 1C1MA 3EGKH 5TJXA 3LKWA 4AG2A 2ZDKA 2W26A 1J16A 3RM0H 4YESB 2ZGBH 1YLDA 2BLWA 2FM2A 1V2MT 3RXBA 2AFQB 5GIBA 1ZPBA 1CT4E 3F1SB 1QL8A 1UK4A 3URCA 1A0JA 2ZG0H 1OWEA 3CS0A 3BEUA 2CMYA 2W3IA 1ORFA 3DUXH 1TGCA 4DG4A 1BTZA 1HUTH 1C5MD 2F9OA 1GI3A 4A6LA 3PO1C 5DKMA 3LJOA 3VB5A 1V2LT 4A5TS 2F83A 4YLUA 3SJOA 2IPHA 6GCHG 4BTIB 1QCPA 4B2CA 4BOHA 3TNSA 3E8LA 2FP7B 1OP0A 3MFJA 1G3BA 1UK2A 2CN0H 3SQEE 1S0QA 3PLPA 1SGEE 3ATIA 1IQGA 4RKJB 4CRGA 3BIVH 1O2KA 3DD2H 3U8RH 1O2RA 4LOYH 3KHVA 4HFPB 1QTFA 3LT3A 4XOJA 5F6MA 1XUFA 1YP9A 1LHEH 3SGBE 1TGNA 4WH6A 3T28A 1G2MA 5FAHA 4I31A 4XDEA 1SQTA 1GCTC 3HGPA 4Y79A 2BMGB 2PUXB 2BY7X 1DUEA 4B73A 3DA9B 1HAXB 1ZGIA 4ZAEA 2GCTC 4AN7A 4LXBH 1GHWH 1TALA 1FIZA 2G55A 1IOEA 3SOSA 3CENA 8GCHG 2XCFA 1PQ8A 1Y3UA 1H9LB 1G32B 1ETSH 1A7SA 3PV4A 1ZGVA 1HPGA 3RXTA 2WUBA 1KXDA 1MKWK 4B76A 4K8YA 2A4QA 5EU8A 1O2YA 5C5NA 3RXCA 1BITA 2ZI2H 4AFUA 3SU3A 1QURH 2QN5T 3IG6B 1GMCF 3M3TA 2BB4A 4D8NA 2PKSC 4U01A 1LMWB 1FY3A 1QBVH 5E0HA 1NFYA 5AFZH 4XBBA 3SW2B 1E36B 2ZHFH 1NFUA 4IW4E 1A0HB 1FN6A 2A45B 3EQ0H 1SLWB 1T31A 2SGPE 4GHQA 2ZTXA 3NK8A 2FOBA 1P12E 2BDHA 1F7ZA 4Y8XA 4ZKRU 4F4OC 1FV9A 2Y81A 1TAWA 2BHGA 1KDQA 1UVOA 2FX4A 3P8OA 4NWLA 3SI3H 1ARBA 3T5FH 3ODDA 2GZ9A 2VGCB 1C2MA 2GZ8A 1BMAA 4FVDA 1HV7A 1TIOA 2M5TA 3Q77A 1XUGA 3PLKA 3MH5A 1BTUA 2FTLE 1GG6C 2VWMA 4Q7XA 2BD5A 1O33A 1RXPA 1T8NA 2ZNKH 5EODA 5G4BA 3LDXH 4IMQA 1AVGH 1H4WA 1ELAA 1P04A 2NU4E 2ANMH 1PPCE 2R9PA 1GI9B 1ESTA 2BX3A 4WMFA 2VB0A 2FOHA 2P59A 3V13A 2C8ZB 1TMUH 4NSYA 1YBWA 2P94A 3MNSA 1MZDA 1YF4A 2BD3A 2NU3E 4CRFA 3FVFB 2W7SA 5L6NH 1NRRH 1EB2A 4A1VA 2ZO3H 1HXEH 1WQVH 1DVAH 2ZEBA 1BBRK 4ZROA 1B5GH 3MNXA 1EAUA 2AYWA 4OS6A 1H9IE 1QHRB 1IQIA 3BTTE 3BTHE 2DE9A 1UK3A 2TPIZ 3UOUA 3SV7A 3VXEH 3RC4A 3UQVA 3R3GB 3O8DA 1NN6A 2BYAX 1O2UA 1IQEA 4AZ2B 1GJ7B 1S6HA 5DG6A 3RXKA 2ZU4A 1DDJA 1D9IA 1WTGH 2PLXA 3ATMA 2QXHA 3BTME 3QDZB 2BDIA 1BMNH 1UTNA 4YO9A 1T4VH 2BVXH 2WYJA 1EXFA 2D2DA 2ZHDA 4UFEH 2BXTH 2I6SA 4ABHA 1LKAA 3PMAB 1O2VA 3URDA 3GOVB 4MNXA 1SHHB 2FIRH 4Y0YE 3BG8A 1UTPA 1QB9A 3NUMA 1DWBH 1P57B 3DHKH 5JBBS 4Y0ZE 1FNIA 1AHTH 4TWWA 4AB9A 3UNQA 1ELFA 3A83A 2ZGHA 4NA7A 2CF8H 1C5XB 2ZU5A 3FP6E 5HM9A 1GHZA 1RRKA 1DLKB 3VB6A 3H7TA 1K22H 1CGIE 3KCGH 2QXJA 3ZZCA 4DCDA 1ACBE 1VZQH 1ZZZA 1OPHB 4CH2B 4D7GA 4LK4A 3ZYDA 1HAIH 3LU9B 1C5ZB 3SGAE 3GY2A 4BAOB 1SFIA 3BG4C 1LQDB 2JH6D 3F9GA 4TPIZ 2ZCHP 1K9OE 4X1QU 1HAOH 3TIUA 4BAQB 2D26C 1VGCC 1GHBF 1SGDE 1EAXA 1UVPA 2RG3A 1NESE 2AIQA 1CBWB 3I78A 2I6QA 4TYDA 1FUJA 3ZZ6A 4Q80A 1C1QA 2P3FH 3UFAA 1J9CH 1ZMJA 1EPTB 2FOAA 1IQNA 4CHAB 3SJIA 1F5RA 3Q3KA 2ODYB 2OLGA 2BQ7B 2Q6GA 1E37B 1V2JT 5FX6A 1XXDA 1JOUB 3A85A 4XE4A 3MMGA 1ELDE 1RTLA 2RA3A 4MDSA 1PYTC 3RXEA 2ZIQH 3ZYEA 1TA6A 2TGTA 1C5VA 1UVTH 1C2HA 2P8OB 4KTUA 3SO3A 1GPZA 1HRTH 1K1IA 2ZFPH 1PPFE 1SL3A 3T62A 1TE0A 4JZ1A 1Y3YA 3GDUA 1DX5M 2SFAA 1AKSB 4TWYA 3M3SA 3LGIA 3M7UA 3SNDA 1YPGH 1XX9A 2A1DB 4NGAH 1Z7KA 2GCHF 2GT8A 3VXFH 3VGCB 4AFQA 1CHOF 2J34A 3FZZA 2Z3EA 4D9QA 3TGJE 1QL9A 1EOJA 1GI4A 4MLFB 1MAYA 1CA8B 1A61H 3BEIB 4MPWA 4TY6A 2Y5GA 3CP7A 1P10A 4X8SH 4INLA 1F2SE 5T6DA 2SGFE 1MBMA 1V6DA 3ZVFA 1QR3E 5DK1A 1Y3VA 3UPEA 2SNVA 2FODA 3KEEA 3SJKA 2PFEA 2NU0E 3U8OH 3S9BA 3ZV8A 5C5OA 1A1RA 1ZHMA 2THFB 3M5NA 1UTLM 1HGTH 1MD8A 1VITG 3FP7E 3SN8A 1QL7A 1HIAB 2VVUA 1NY22 2ZFTA 1TRNA 3MH4A 1S0RA 1GMDF 1AGJA 1BBRE 3SUEA 1KY9A 2B8OH 1C5LH 1HB0B 5JBCS 3TH2H 1O3KA 1P8VC 1YCPH 2H9EH 1GMHG 1Q31A 2J94A 3AAVA 1H9HE 1TPAE 4I8HA 1ABIH 1AE8H 2ZCKP 1O5GH 1AB9C 3BSQA 3IITA 4ABFA 4JYUH 4DT7B 4HZHA 3F9FA 3V3MA 3GCTG 2CHAB 1OYQA 1GGDB 4ZH8A 1Z6EA 3VB7A 5DP3A 4IC6A 2PR3A 2RCEA 3IWMA 4IS5A 3S7KB 5GCHG 4X6MA 2JETB 4NA9H 5C2ZA 1YPEH 4GAWA 2SNWA 3KL6A 1GCDA